3KZ7A

C-terminal domain of murine fkbp25 rapamycin complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
EGPPKYTKSILKKGDKTNFPKKGDVVHCWYTGTLPDGTVFDTNIQTSSKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNTKLIFEVELVDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversified targets of FKBP25 and its complex with rapamycin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Isomerase/inhibitor
molecule keywords FK506-binding protein 3
total genus 25
structure length 119
sequence length 119
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kz7A00
2VN1A 1J4HA 2XP5A 2XP7A 5DIVA 4J4NA 5GPGA 4DRNA 2PV3A 4O2TA 3NI6A 4ODNA 1FKIA 3TC5A 1ZCNA 1D7HA 4DIPA 1Q6HA 4FN2A 4DRPA 4IQ2A 2PPPA 1HXVA 1F8AB 4JYSA 2Q5AA 3UI5A 4DZ2A 2XP3A 4QIBA 1D7JA 3OOBA 2MLYA 1Q6IA 4ODLA 1QPLA 5BXJA 3JYMA 5HTGA 2MLZA 3RGCA 2RUQA 3PRBA 4FAPA 4DRHA 3EY6A 4ODKA 3LUOA 5HWBA 2F4EA 5D75A 2KFWA 2FKEA 2IF4A 3O5FA 2N87A 3JXVA 1C9HA 4DT4A 1Q6UA 2XP4A 1Q1CA 4TNSA 1L1PA 3O5DA 4DRQA 2AWGA 4IQCA 2F21A 4ODRA 4R0XA 4TW6A 4BF8A 1NMVA 1FKTA 2ZQUA 3O5PA 2MPHA 1BL4A 1NSGA 2RUCA 1D7IA 3KABA 4N19A 2L2SA 3GPKA 5HW8A 1A7XA 2ITKA 2XP8A 1J4IA 4MSPA 1KT1A 4U86A 2D9FA 2LGOA 2ZR6A 2ZQVA 2XPBA 4DH0A 3UQAA 3KZ7A 5HW7A 2XPAA 3JYJA 4QT3A 3IKDA 4ITZA 3CGMA 3KADA 4ODOA 1U79A 2K8IA 1ROUA 4DRKA 1FKJA 3FAPA 4JFMA 3UI6A 1B6CA 3MDYB 1YATA 1BKFA 1JNTA 2ZQTA 3KAHA 3KAFA 4ODMA 5HWCA 4LAWA 2DG9A 3UF8A 1YW5A 2M1IA 3KACA 3H9RB 4JFJA 4LAXA 3O5RA 2PV1A 4DRJA 2ZR4A 1FKLA 4G2PA 3PRDA 3VAWA 4W9PA 5HUAA 1J6YA 1FKRA 2ZR5A 1FKFA 1KT0A 2RURA 3O5QA 2PPNA 4DRMA 4DRIA 2JZVA 2LPVA 4DZ3A 3TCZA 5DITA 1TCOC 3CGNA 4JFLA 4W9QA 5HT1A 1FD9A 2MF9A 4MGVA 4J4OA 1FKDA 3NTPA 2MNTA 1T11A 2M2AA 3O5IA 4NNRA 4ODPA 1FKSA 3UQIA 1FKHA 3KCEA 1NMWA 2DG4A 2KI3A 3O5GA 2LJ4A 5B8IC 2DG3A 5HKGA 4DROA 5I98A 4U84A 4TX0A 2UZ5A 2KR7A 1FKGA 1JVWA 1W26A 3B7XA 3O5MA 3PA7A 1D6OA 4C02B 1FKKA 2RQSA 2ZQSA 3TDBA 2Y78A 1M5YA 1N1AA 1EYMA 1R9HA 1P5QA 3O5EA 1ROTA 5HW6A 4U85A 2M08A 5DIUA 2KE0A 2PV2A 5J6EA 4GIVA 1EQ3A 2RSEA 4G50A 1QZ2A 3KAIA 4W9OA 2MLXA 3KAGA 1PBKA 3O5KA 3O5JA 2PBCA 3IKGA 3RFWA 2KO7A 3UQBA 3UI4A 1FAPA 1FKBA 1Y0OA 2PPOA 2KGJA 3IK8A 4TW8A 4TYOA 2OFNA 4LAVA 1PINA 1JNSA 4IPXA 2RUDA 4GGQA 3O5OA 4JFIA 4ODQA 1F40A 2XP9A 3ODKA 1J4RA 1FJDA 4QT2A 4LAYA 3I6CA 2F2DA 4TW7A 3O5LA 3WH0A 2VCDA 1QPFA 3IHZA 3NRKA 2LKNA 4JFKA 2XP6A 1ZK6A 2FAPA
chains in the Genus database with same CATH superfamily
2B31A 1ZBWA 5DIVA 4J4NA 1H0GA 1LL7A 3NI6A 1NWTA 2WM0A 1SR0A 3TC5A 4URIA 4DRPA 4IQ2A 2P4VA 2YBTA 4QZVB 4QIBA 3GU0A 1LG2A 1GUVA 2MLZA 3RGCA 4FAPA 4DRHA 1VF8A 2KFWA 1C9HA 4DT4A 1Q1CA 3ARRA 1L1PA 1W9VA 4Z2IA 1UR9A 2ZQUA 3O5PA 4ML4A 1BL4A 1D7IA 5HW8A 2XP8A 1KT1A 1ITXA 2ZR6A 2ZQVA 2XPBA 5HW7A 3IKDA 5HBFA 4ODOA 4Z2HA 3UI6A 2A3AA 1BKFA 4ODMA 5HWCA 4JFJA 4LAXA 2F23A 3GTYX 1EIBA 4G2PA 3VAWA 3PRDA 3WL1A 4W9PA 1LJYA 1FKFA 1KT0A 4HARA 2PPNA 2ESCA 1JNDA 5HT1A 4MNMA 5GPRA 2MNTA 1T11A 2M2AA 1FKSA 2DSZA 3O5GA 2LJ4A 1X6LA 3CH9A 5I98A 2ETNA 2UZ5A 1W26A 1JVWA 3ARSA 3B7XA 4WKHA 1FKKA 3TDBA 1R9HA 3AROA 2M08A 5DIUA 4Z2GA 1EQ3A 2DT0A 3G6MA 3KAIA 2MLXA 3O5KA 1SYTA 2PBCA 1E9LA 3ARUA 3IKGA 4PTMA 1OGBA 1FKBA 4DWSC 3IK8A 2WK2A 1PINA 3O5OA 2XP9A 3ODKA 5DEZA 2A3EA 3WD3A 5JH8A 1FJDA 3FXYA 3QOKA 3NRKA 1LL6A 1QPFA 2VCDA 1K9TA 2XP6A 3ARYA 1H0IA 2AOSA 2VN1A 2XP5A 2IUZA 4NSBA 4Q7NA 1HJVA 1D7HA 2A3CA 3CHEA 1Q6HA 4DIPA 2EULA 2PPPA 1HXVA 1F8AB 2XP3A 3EIPA 3OOBA 5BXJA 5HTGA 4DWSA 1HJXA 2F4EA 5D75A 2IF4A 2N87A 4MNKA 5DO2A 1X6NA 1O6IA 4WK9A 3O5DA 2AWGA 4R0XA 4TW6A 4HBEA 2MPHA 2RUCA 1ZB5A 4N19A 4IT6A 4P8XA 4ZPTR 2XPAA 4QT3A 3CGMA 3RM4A 1ROUA 4DRKA 4JFMA 1GOIA 3MDYB 1YATA 1JNTA 3KAHA 3KAFA 2DG9A 1YW5A 1HKKA 3ALFA 2O92A 2ZR4A 1EDQA 2DSUA 2QF8A 4DRMA 3O5QA 4DRIA 1HKIA 3CGNA 4J4OA 1CTNA 3NTPA 3WQWA 3CHFA 1FKHA 3KCEA 1NMWA 2KI3A 2DG3A 4DROA 4U84A 1FKGA 1E6RA 1W1PA 1WAWA 4C02B 2ZQSA 1N1AA 1EYMA 3B9DA 3O5EA 3WIJA 4GIVA 3FY1A 3G6LA 3UI4A 4P8VA 4IPXA 2RUDA 4GGQA 4ODQA 1ZBCA 3O5LA 4DWSB 1XHGA 2LKNA 4L3NA 1ZK6A 3AS2A 4L72B 4WKFA 3B8SA 4DRNA 5GPGA 2PV3A 4ODNA 1FKIA 3B9EA 1JCHB 4NZCA 1ZCNA 4FN2A 3ALGA 3WD0A 1D7JA 1Q6IA 1QPLA 2FDMA 3PRBA 3RM9A 1IX5A 3ARQA 3O5FA 4R5EA 1Q6UA 5HUAA 4ODRA 1LL4A 4BF8A 5DF0A 5GQBA 1W1TA 4KR0B 1WB0A 1W9UA 1RD6A 2L2SA 3GPKA 1A7XA 4MSPA 1E15A 3BXWA 4U86A 2YBUA 3WD2A 1GRJA 4DH0A 3UQAA 2DT2A 4MPKA 1JNEA 4ITZA 3KADA 1U79A 2K8IA 1ZL1A 3FAPA 1HKJA 3WKZA 3ARVA 4MTVA 3O5RA 2PV1A 4Z2KA 4WIWA 3CZ8A 2ZR5A 2RURA 4MAVA 2JZVA 2LPVA 3CHCA 3TCZA 1ZBVA 5DITA 4Z2JA 4JFLA 4W9QA 1UR8A 3AS3A 1FD9A 2MF9A 2B5UB 4ZPWR 3O5IA 4NNRA 4ODPA 4S3KA 4ZPVR 5HKGA 2DG4A 5B8IC 3CHDA 2G8ZA 4W5UA 2WLYA 1KFWA 4TX0A 2KR7A 4MNLA 2PI6A 1E44A 1M5YA 5HW6A 1ROTA 5J6EA 2WLZA 2RSEA 2G41A 3KAGA 1PBKA 3O5JA 4S3JA 3PRAA 2PN0A 3OA5A 2PPOA 3ARXA 2OFNA 1GPFA 1JNSA 4JFIA 1F40A 3B9AA 1ZBKA 4QT2A 4LAYA 1E6PA 3I6CA 3WD1A 2F2DA 4AY1A 3WH0A 4LGXA 4DWSD 4XAKA 4JFKA 1NWRA 2FAPA 3AS0A 3ARTA 3RMEA 2XP7A 1J4HA 1LQ0A 3AS1A 3PR9A 1XRVA 4JYSA 2DT3A 2Q5AA 3UI5A 3WL0A 4DZ2A 1W1VA 1HKMA 2MLYA 4ODLA 3JYMA 4WKAA 4IT4A 2RUQA 1EHNA 3EY6A 4ODKA 3LUOA 3WD4A 5HWBA 1LG1A 4HBOA 2FKEA 3JXVA 2XP4A 1OGGA 1NWSA 4TNSA 4DRQA 1WNOA 4IQCA 2F21A 1NMVA 1FKTA 1NSGA 3KABA 3WQVA 1FFQA 2ITKA 1J4IA 1OWQA 2D9FA 2LGOA 3KZ7A 1HJWA 3JYJA 4MNJA 1FKJA 1B6CA 2ZQTA 3W4RA 4LAWA 3UF8A 2OLHA 2M1IA 3KACA 3H9RB 3ARWA 4DRJA 1FKLA 1J6YA 1FKRA 4DZ3A 4ZS6A 1E6ZA 1D2KA 1TCOC 4UDMA 1TFVA 2DSVA 2DSWA 4MGVA 1FKDA 1NWUA 4Q22A 3UQIA 1W9PA 2O9OA 2A3BA 2DPEA 3ARPA 3PA7A 3O5MA 4Z2LA 1D6OA 1E6NA 2RQSA 2Y78A 1P5QA 4U85A 2KE0A 2PV2A 4G50A 3RM8A 1QZ2A 4W9OA 3RFWA 2DT1A 2KO7A 3UQBA 1FAPA 1Y0OA 2KGJA 4KQZA 4TW8A 4P8WA 4TYOA 4WJXA 4LAVA 3BMBA 3AQUA 1J4RA 1ZU8A 1W1YA 4P8UA 3ARZA 1NH6A 3IHZA 1FFRA 4O2TA 4TW7A
chains in the Genus database with same CATH topology
2B31A 1ZBWA 5DIVA 4J4NA 1H0GA 1LL7A 3NI6A 1NWTA 2WM0A 1SR0A 3TC5A 4URIA 4DRPA 4IQ2A 2YBTA 4QZVB 4QIBA 1LG2A 1GUVA 2MLZA 3RGCA 4FAPA 4DRHA 1VF8A 2KFWA 1C9HA 4DT4A 1Q1CA 3ARRA 1L1PA 1W9VA 4Z2IA 1UR9A 2ZQUA 3O5PA 4ML4A 1BL4A 1D7IA 5HW8A 2XP8A 1KT1A 1ITXA 2ZR6A 2ZQVA 2XPBA 5HW7A 3IKDA 5HBFA 4ODOA 4Z2HA 3UI6A 2A3AA 1BKFA 4ODMA 5HWCA 4JFJA 4LAXA 1EIBA 4G2PA 3VAWA 3PRDA 3WL1A 4W9PA 1LJYA 1FKFA 1KT0A 4HARA 2PPNA 2ESCA 1JNDA 5HT1A 4MNMA 5GPRA 2MNTA 1T11A 2M2AA 1FKSA 2DSZA 3O5GA 2LJ4A 1X6LA 3CH9A 5I98A 2UZ5A 1W26A 1JVWA 3ARSA 3B7XA 4WKHA 1FKKA 3TDBA 1R9HA 3AROA 2M08A 5DIUA 4Z2GA 1EQ3A 2DT0A 3G6MA 3KAIA 2MLXA 3O5KA 1SYTA 2PBCA 1E9LA 3ARUA 3IKGA 4PTMA 1OGBA 1FKBA 4DWSC 3IK8A 2WK2A 1PINA 3O5OA 2XP9A 3ODKA 5DEZA 2A3EA 3WD3A 5JH8A 1FJDA 3FXYA 3QOKA 3NRKA 1LL6A 1QPFA 2VCDA 1K9TA 2XP6A 3ARYA 1H0IA 2AOSA 2VN1A 2XP5A 2IUZA 4NSBA 4Q7NA 1HJVA 1D7HA 2A3CA 3CHEA 1Q6HA 4DIPA 2PPPA 1HXVA 1F8AB 2XP3A 3OOBA 5BXJA 5HTGA 4DWSA 1HJXA 2F4EA 5D75A 2IF4A 2N87A 4MNKA 5DO2A 1X6NA 1O6IA 4WK9A 3O5DA 2AWGA 4R0XA 4TW6A 4HBEA 2MPHA 2RUCA 1ZB5A 4N19A 4IT6A 4P8XA 4ZPTR 2XPAA 4QT3A 3CGMA 3RM4A 1ROUA 4DRKA 4JFMA 1GOIA 3MDYB 1YATA 1JNTA 3KAHA 3KAFA 2DG9A 1YW5A 1HKKA 3ALFA 2O92A 2ZR4A 1EDQA 2DSUA 2QF8A 4DRMA 3O5QA 4DRIA 1HKIA 3CGNA 4J4OA 1CTNA 3NTPA 3WQWA 3CHFA 1FKHA 3KCEA 1NMWA 2KI3A 2DG3A 4DROA 4U84A 1FKGA 1E6RA 1W1PA 1WAWA 4C02B 2ZQSA 1N1AA 1EYMA 3B9DA 3O5EA 3WIJA 4GIVA 3FY1A 3G6LA 3UI4A 4P8VA 4IPXA 2RUDA 4GGQA 4ODQA 1ZBCA 3O5LA 4DWSB 1XHGA 2LKNA 4L3NA 1ZK6A 3AS2A 4L72B 4WKFA 3B8SA 4DRNA 5GPGA 2PV3A 4ODNA 1FKIA 3B9EA 4NZCA 1ZCNA 4FN2A 3ALGA 3WD0A 1D7JA 1Q6IA 1QPLA 2FDMA 3PRBA 3RM9A 1IX5A 3ARQA 3O5FA 4R5EA 1Q6UA 5HUAA 4ODRA 1LL4A 4BF8A 5DF0A 5GQBA 1W1TA 4KR0B 1WB0A 1W9UA 1RD6A 2L2SA 3GPKA 1A7XA 4MSPA 1E15A 3BXWA 4U86A 2YBUA 3WD2A 3UQAA 4DH0A 2DT2A 4MPKA 1JNEA 4ITZA 3KADA 1U79A 2K8IA 1ZL1A 3FAPA 1HKJA 3WKZA 3ARVA 4MTVA 3O5RA 2PV1A 4Z2KA 4WIWA 3CZ8A 2ZR5A 2RURA 4MAVA 2JZVA 2LPVA 3CHCA 3TCZA 1ZBVA 5DITA 4Z2JA 4JFLA 4W9QA 1UR8A 3AS3A 1FD9A 2MF9A 4ZPWR 3O5IA 4NNRA 4ODPA 4S3KA 4ZPVR 5HKGA 2DG4A 5B8IC 3CHDA 2G8ZA 4W5UA 2WLYA 1KFWA 4TX0A 2KR7A 4MNLA 2PI6A 1M5YA 5HW6A 1ROTA 5J6EA 2WLZA 2RSEA 2G41A 3KAGA 1PBKA 3O5JA 4S3JA 3PRAA 3OA5A 2PPOA 3ARXA 2OFNA 1GPFA 1JNSA 4JFIA 1F40A 3B9AA 1ZBKA 4QT2A 4LAYA 1E6PA 3I6CA 3WD1A 2F2DA 4AY1A 3WH0A 4LGXA 4DWSD 4XAKA 4JFKA 1NWRA 2FAPA 3AS0A 3ARTA 3RMEA 2XP7A 1J4HA 1LQ0A 3AS1A 3PR9A 1XRVA 4JYSA 2DT3A 2Q5AA 3UI5A 3WL0A 4DZ2A 1W1VA 1HKMA 2MLYA 4ODLA 3JYMA 4WKAA 4IT4A 2RUQA 1EHNA 3EY6A 4ODKA 3LUOA 3WD4A 5HWBA 1LG1A 4HBOA 2FKEA 3JXVA 2XP4A 1OGGA 1NWSA 4TNSA 4DRQA 1WNOA 4IQCA 2F21A 1NMVA 1FKTA 1NSGA 3KABA 3WQVA 1FFQA 2ITKA 1J4IA 1OWQA 2D9FA 2LGOA 3KZ7A 1HJWA 3JYJA 4MNJA 1FKJA 1B6CA 2ZQTA 3W4RA 4LAWA 3UF8A 2OLHA 2M1IA 3KACA 3H9RB 3ARWA 4DRJA 1FKLA 1J6YA 1FKRA 4DZ3A 4ZS6A 1E6ZA 1D2KA 1TCOC 1TFVA 2DSVA 2DSWA 4MGVA 1FKDA 1NWUA 4Q22A 3UQIA 1W9PA 2O9OA 2A3BA 2DPEA 3ARPA 3PA7A 3O5MA 4Z2LA 1D6OA 1E6NA 2RQSA 2Y78A 1P5QA 4U85A 2KE0A 2PV2A 4G50A 3RM8A 1QZ2A 4W9OA 3RFWA 2DT1A 2KO7A 3UQBA 1FAPA 1Y0OA 2KGJA 4KQZA 4TW8A 4P8WA 4TYOA 4WJXA 4LAVA 3AQUA 1J4RA 1ZU8A 1W1YA 4P8UA 3ARZA 1NH6A 3IHZA 1FFRA 4O2TA 4TW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VN1 A;  1J4H A;  2XP5 A;  2XP7 A;  5DIV A;  4J4N A;  5GPG A;  4DRN A;  2PV3 A;  4O2T A;  3NI6 A;  4ODN A;  1FKI A;  3TC5 A;  1ZCN A;  1D7H A;  4DIP A;  1Q6H A;  4FN2 A;  4DRP A;  4IQ2 A;  2PPP A;  1HXV A;  1F8A B;  4JYS A;  2Q5A A;  3UI5 A;  4DZ2 A;  2XP3 A;  4QIB A;  1D7J A;  3OOB A;  2MLY A;  1Q6I A;  4ODL A;  1QPL A;  5BXJ A;  3JYM A;  5HTG A;  2MLZ A;  3RGC A;  2RUQ A;  3PRB A;  4FAP A;  4DRH A;  3EY6 A;  4ODK A;  3LUO A;  5HWB A;  2F4E A;  5D75 A;  2KFW A;  2FKE A;  2IF4 A;  3O5F A;  2N87 A;  3JXV A;  1C9H A;  4DT4 A;  1Q6U A;  2XP4 A;  1Q1C A;  4TNS A;  1L1P A;  3O5D A;  4DRQ A;  2AWG A;  4IQC A;  2F21 A;  4ODR A;  4R0X A;  4TW6 A;  4BF8 A;  1NMV A;  1FKT A;  2ZQU A;  3O5P A;  2MPH A;  1BL4 A;  1NSG A;  2RUC A;  1D7I A;  3KAB A;  4N19 A;  2L2S A;  3GPK A;  5HW8 A;  1A7X A;  2ITK A;  2XP8 A;  1J4I A;  4MSP A;  1KT1 A;  4U86 A;  2D9F A;  2LGO A;  2ZR6 A;  2ZQV A;  2XPB A;  4DH0 A;  3UQA A;  3KZ7 A;  5HW7 A;  2XPA A;  3JYJ A;  4QT3 A;  3IKD A;  4ITZ A;  3CGM A;  3KAD A;  4ODO A;  1U79 A;  2K8I A;  1ROU A;  4DRK A;  1FKJ A;  3FAP A;  4JFM A;  3UI6 A;  1B6C A;  3MDY B;  1YAT A;  1BKF A;  1JNT A;  2ZQT A;  3KAH A;  3KAF A;  4ODM A;  5HWC A;  4LAW A;  2DG9 A;  3UF8 A;  1YW5 A;  2M1I A;  3KAC A;  3H9R B;  4JFJ A;  4LAX A;  3O5R A;  2PV1 A;  4DRJ A;  2ZR4 A;  1FKL A;  4G2P A;  3PRD A;  3VAW A;  4W9P A;  5HUA A;  1J6Y A;  1FKR A;  2ZR5 A;  1FKF A;  1KT0 A;  2RUR A;  3O5Q A;  2PPN A;  4DRM A;  4DRI A;  2JZV A;  2LPV A;  4DZ3 A;  3TCZ A;  5DIT A;  1TCO C;  3CGN A;  4JFL A;  4W9Q A;  5HT1 A;  1FD9 A;  2MF9 A;  4MGV A;  4J4O A;  1FKD A;  3NTP A;  2MNT A;  1T11 A;  2M2A A;  3O5I A;  4NNR A;  4ODP A;  1FKS A;  3UQI A;  1FKH A;  3KCE A;  1NMW A;  2DG4 A;  2KI3 A;  3O5G A;  2LJ4 A;  5B8I C;  2DG3 A;  5HKG A;  4DRO A;  5I98 A;  4U84 A;  4TX0 A;  2UZ5 A;  2KR7 A;  1FKG A;  1JVW A;  1W26 A;  3B7X A;  3O5M A;  3PA7 A;  1D6O A;  4C02 B;  1FKK A;  2RQS A;  2ZQS A;  3TDB A;  2Y78 A;  1M5Y A;  1N1A A;  1EYM A;  1R9H A;  1P5Q A;  3O5E A;  1ROT A;  5HW6 A;  4U85 A;  2M08 A;  5DIU A;  2KE0 A;  2PV2 A;  5J6E A;  4GIV A;  1EQ3 A;  2RSE A;  4G50 A;  1QZ2 A;  3KAI A;  4W9O A;  2MLX A;  3KAG A;  1PBK A;  3O5K A;  3O5J A;  2PBC A;  3IKG A;  3RFW A;  2KO7 A;  3UQB A;  3UI4 A;  1FAP A;  1FKB A;  1Y0O A;  2PPO A;  2KGJ A;  3IK8 A;  4TW8 A;  4TYO A;  2OFN A;  4LAV A;  1PIN A;  1JNS A;  4IPX A;  2RUD A;  4GGQ A;  3O5O A;  4JFI A;  4ODQ A;  1F40 A;  2XP9 A;  3ODK A;  1J4R A;  1FJD A;  4QT2 A;  4LAY A;  3I6C A;  2F2D A;  4TW7 A;  3O5L A;  3WH0 A;  2VCD A;  1QPF A;  3IHZ A;  3NRK A;  2LKN A;  4JFK A;  2XP6 A;  1ZK6 A;  2FAP A; 
#chains in the Genus database with same CATH topology
 2B31 A;  1ZBW A;  5DIV A;  4J4N A;  1H0G A;  1LL7 A;  3NI6 A;  1NWT A;  2WM0 A;  1SR0 A;  3TC5 A;  4URI A;  4DRP A;  4IQ2 A;  2P4V A;  2YBT A;  4QZV B;  4QIB A;  3GU0 A;  1LG2 A;  1GUV A;  2MLZ A;  3RGC A;  4FAP A;  4DRH A;  1VF8 A;  2KFW A;  1C9H A;  4DT4 A;  1Q1C A;  3ARR A;  1L1P A;  1W9V A;  4Z2I A;  1UR9 A;  2ZQU A;  3O5P A;  4ML4 A;  1BL4 A;  1D7I A;  5HW8 A;  2XP8 A;  1KT1 A;  1ITX A;  2ZR6 A;  2ZQV A;  2XPB A;  5HW7 A;  3IKD A;  5HBF A;  4ODO A;  4Z2H A;  3UI6 A;  2A3A A;  1BKF A;  4ODM A;  5HWC A;  4JFJ A;  4LAX A;  2F23 A;  3GTY X;  1EIB A;  4G2P A;  3VAW A;  3PRD A;  3WL1 A;  4W9P A;  1LJY A;  1FKF A;  1KT0 A;  4HAR A;  2PPN A;  2ESC A;  1JND A;  5HT1 A;  4MNM A;  5GPR A;  2MNT A;  1T11 A;  2M2A A;  1FKS A;  2DSZ A;  3O5G A;  2LJ4 A;  1X6L A;  3CH9 A;  5I98 A;  2ETN A;  2UZ5 A;  1W26 A;  1JVW A;  3ARS A;  3B7X A;  4WKH A;  1FKK A;  3TDB A;  1R9H A;  3ARO A;  2M08 A;  5DIU A;  4Z2G A;  1EQ3 A;  2DT0 A;  3G6M A;  3KAI A;  2MLX A;  3O5K A;  1SYT A;  2PBC A;  1E9L A;  3ARU A;  3IKG A;  4PTM A;  1OGB A;  1FKB A;  4DWS C;  3IK8 A;  2WK2 A;  1PIN A;  3O5O A;  2XP9 A;  3ODK A;  5DEZ A;  2A3E A;  3WD3 A;  5JH8 A;  1FJD A;  3FXY A;  3QOK A;  3NRK A;  1LL6 A;  1QPF A;  2VCD A;  1K9T A;  2XP6 A;  3ARY A;  1H0I A;  2AOS A;  2VN1 A;  2XP5 A;  2IUZ A;  4NSB A;  4Q7N A;  1HJV A;  1D7H A;  2A3C A;  3CHE A;  1Q6H A;  4DIP A;  2EUL A;  2PPP A;  1HXV A;  1F8A B;  2XP3 A;  3EIP A;  3OOB A;  5BXJ A;  5HTG A;  4DWS A;  1HJX A;  2F4E A;  5D75 A;  2IF4 A;  2N87 A;  4MNK A;  5DO2 A;  1X6N A;  1O6I A;  4WK9 A;  3O5D A;  2AWG A;  4R0X A;  4TW6 A;  4HBE A;  2MPH A;  2RUC A;  1ZB5 A;  4N19 A;  4IT6 A;  4P8X A;  4ZPT R;  2XPA A;  4QT3 A;  3CGM A;  3RM4 A;  1ROU A;  4DRK A;  4JFM A;  1GOI A;  3MDY B;  1YAT A;  1JNT A;  3KAH A;  3KAF A;  2DG9 A;  1YW5 A;  1HKK A;  3ALF A;  2O92 A;  2ZR4 A;  1EDQ A;  2DSU A;  2QF8 A;  4DRM A;  3O5Q A;  4DRI A;  1HKI A;  3CGN A;  4J4O A;  1CTN A;  3NTP A;  3WQW A;  3CHF A;  1FKH A;  3KCE A;  1NMW A;  2KI3 A;  2DG3 A;  4DRO A;  4U84 A;  1FKG A;  1E6R A;  1W1P A;  1WAW A;  4C02 B;  2ZQS A;  1N1A A;  1EYM A;  3B9D A;  3O5E A;  3WIJ A;  4GIV A;  3FY1 A;  3G6L A;  3UI4 A;  4P8V A;  4IPX A;  2RUD A;  4GGQ A;  4ODQ A;  1ZBC A;  3O5L A;  4DWS B;  1XHG A;  2LKN A;  4L3N A;  1ZK6 A;  3AS2 A;  4L72 B;  4WKF A;  3B8S A;  4DRN A;  5GPG A;  2PV3 A;  4ODN A;  1FKI A;  3B9E A;  1JCH B;  4NZC A;  1ZCN A;  4FN2 A;  3ALG A;  3WD0 A;  1D7J A;  1Q6I A;  1QPL A;  2FDM A;  3PRB A;  3RM9 A;  1IX5 A;  3ARQ A;  3O5F A;  4R5E A;  1Q6U A;  5HUA A;  4ODR A;  1LL4 A;  4BF8 A;  5DF0 A;  5GQB A;  1W1T A;  4KR0 B;  1WB0 A;  1W9U A;  1RD6 A;  2L2S A;  3GPK A;  1A7X A;  4MSP A;  1E15 A;  3BXW A;  4U86 A;  2YBU A;  3WD2 A;  1GRJ A;  4DH0 A;  3UQA A;  2DT2 A;  4MPK A;  1JNE A;  4ITZ A;  3KAD A;  1U79 A;  2K8I A;  1ZL1 A;  3FAP A;  1HKJ A;  3WKZ A;  3ARV A;  4MTV A;  3O5R A;  2PV1 A;  4Z2K A;  4WIW A;  3CZ8 A;  2ZR5 A;  2RUR A;  4MAV A;  2JZV A;  2LPV A;  3CHC A;  3TCZ A;  1ZBV A;  5DIT A;  4Z2J A;  4JFL A;  4W9Q A;  1UR8 A;  3AS3 A;  1FD9 A;  2MF9 A;  2B5U B;  4ZPW R;  3O5I A;  4NNR A;  4ODP A;  4S3K A;  4ZPV R;  5HKG A;  2DG4 A;  5B8I C;  3CHD A;  2G8Z A;  4W5U A;  2WLY A;  1KFW A;  4TX0 A;  2KR7 A;  4MNL A;  2PI6 A;  1E44 A;  1M5Y A;  5HW6 A;  1ROT A;  5J6E A;  2WLZ A;  2RSE A;  2G41 A;  3KAG A;  1PBK A;  3O5J A;  4S3J A;  3PRA A;  2PN0 A;  3OA5 A;  2PPO A;  3ARX A;  2OFN A;  1GPF A;  1JNS A;  4JFI A;  1F40 A;  3B9A A;  1ZBK A;  4QT2 A;  4LAY A;  1E6P A;  3I6C A;  3WD1 A;  2F2D A;  4AY1 A;  3WH0 A;  4LGX A;  4DWS D;  4XAK A;  4JFK A;  1NWR A;  2FAP A;  3AS0 A;  3ART A;  3RME A;  2XP7 A;  1J4H A;  1LQ0 A;  3AS1 A;  3PR9 A;  1XRV A;  4JYS A;  2DT3 A;  2Q5A A;  3UI5 A;  3WL0 A;  4DZ2 A;  1W1V A;  1HKM A;  2MLY A;  4ODL A;  3JYM A;  4WKA A;  4IT4 A;  2RUQ A;  1EHN A;  3EY6 A;  4ODK A;  3LUO A;  3WD4 A;  5HWB A;  1LG1 A;  4HBO A;  2FKE A;  3JXV A;  2XP4 A;  1OGG A;  1NWS A;  4TNS A;  4DRQ A;  1WNO A;  4IQC A;  2F21 A;  1NMV A;  1FKT A;  1NSG A;  3KAB A;  3WQV A;  1FFQ A;  2ITK A;  1J4I A;  1OWQ A;  2D9F A;  2LGO A;  3KZ7 A;  1HJW A;  3JYJ A;  4MNJ A;  1FKJ A;  1B6C A;  2ZQT A;  3W4R A;  4LAW A;  3UF8 A;  2OLH A;  2M1I A;  3KAC A;  3H9R B;  3ARW A;  4DRJ A;  1FKL A;  1J6Y A;  1FKR A;  4DZ3 A;  4ZS6 A;  1E6Z A;  1D2K A;  1TCO C;  4UDM A;  1TFV A;  2DSV A;  2DSW A;  4MGV A;  1FKD A;  1NWU A;  4Q22 A;  3UQI A;  1W9P A;  2O9O A;  2A3B A;  2DPE A;  3ARP A;  3PA7 A;  3O5M A;  4Z2L A;  1D6O A;  1E6N A;  2RQS A;  2Y78 A;  1P5Q A;  4U85 A;  2KE0 A;  2PV2 A;  4G50 A;  3RM8 A;  1QZ2 A;  4W9O A;  3RFW A;  2DT1 A;  2KO7 A;  3UQB A;  1FAP A;  1Y0O A;  2KGJ A;  4KQZ A;  4TW8 A;  4P8W A;  4TYO A;  4WJX A;  4LAV A;  3BMB A;  3AQU A;  1J4R A;  1ZU8 A;  1W1Y A;  4P8U A;  3ARZ A;  1NH6 A;  3IHZ A;  1FFR A;  4O2T A;  4TW7 A; 
#chains in the Genus database with same CATH homology
 2B31 A;  1ZBW A;  5DIV A;  4J4N A;  1H0G A;  1LL7 A;  3NI6 A;  1NWT A;  2WM0 A;  1SR0 A;  3TC5 A;  4URI A;  4DRP A;  4IQ2 A;  2YBT A;  4QZV B;  4QIB A;  1LG2 A;  1GUV A;  2MLZ A;  3RGC A;  4FAP A;  4DRH A;  1VF8 A;  2KFW A;  1C9H A;  4DT4 A;  1Q1C A;  3ARR A;  1L1P A;  1W9V A;  4Z2I A;  1UR9 A;  2ZQU A;  3O5P A;  4ML4 A;  1BL4 A;  1D7I A;  5HW8 A;  2XP8 A;  1KT1 A;  1ITX A;  2ZR6 A;  2ZQV A;  2XPB A;  5HW7 A;  3IKD A;  5HBF A;  4ODO A;  4Z2H A;  3UI6 A;  2A3A A;  1BKF A;  4ODM A;  5HWC A;  4JFJ A;  4LAX A;  1EIB A;  4G2P A;  3VAW A;  3PRD A;  3WL1 A;  4W9P A;  1LJY A;  1FKF A;  1KT0 A;  4HAR A;  2PPN A;  2ESC A;  1JND A;  5HT1 A;  4MNM A;  5GPR A;  2MNT A;  1T11 A;  2M2A A;  1FKS A;  2DSZ A;  3O5G A;  2LJ4 A;  1X6L A;  3CH9 A;  5I98 A;  2UZ5 A;  1W26 A;  1JVW A;  3ARS A;  3B7X A;  4WKH A;  1FKK A;  3TDB A;  1R9H A;  3ARO A;  2M08 A;  5DIU A;  4Z2G A;  1EQ3 A;  2DT0 A;  3G6M A;  3KAI A;  2MLX A;  3O5K A;  1SYT A;  2PBC A;  1E9L A;  3ARU A;  3IKG A;  4PTM A;  1OGB A;  1FKB A;  4DWS C;  3IK8 A;  2WK2 A;  1PIN A;  3O5O A;  2XP9 A;  3ODK A;  5DEZ A;  2A3E A;  3WD3 A;  5JH8 A;  1FJD A;  3FXY A;  3QOK A;  3NRK A;  1LL6 A;  1QPF A;  2VCD A;  1K9T A;  2XP6 A;  3ARY A;  1H0I A;  2AOS A;  2VN1 A;  2XP5 A;  2IUZ A;  4NSB A;  4Q7N A;  1HJV A;  1D7H A;  2A3C A;  3CHE A;  1Q6H A;  4DIP A;  2PPP A;  1HXV A;  1F8A B;  2XP3 A;  3OOB A;  5BXJ A;  5HTG A;  4DWS A;  1HJX A;  2F4E A;  5D75 A;  2IF4 A;  2N87 A;  4MNK A;  5DO2 A;  1X6N A;  1O6I A;  4WK9 A;  3O5D A;  2AWG A;  4R0X A;  4TW6 A;  4HBE A;  2MPH A;  2RUC A;  1ZB5 A;  4N19 A;  4IT6 A;  4P8X A;  4ZPT R;  2XPA A;  4QT3 A;  3CGM A;  3RM4 A;  1ROU A;  4DRK A;  4JFM A;  1GOI A;  3MDY B;  1YAT A;  1JNT A;  3KAH A;  3KAF A;  2DG9 A;  1YW5 A;  1HKK A;  3ALF A;  2O92 A;  2ZR4 A;  1EDQ A;  2DSU A;  2QF8 A;  4DRM A;  3O5Q A;  4DRI A;  1HKI A;  3CGN A;  4J4O A;  1CTN A;  3NTP A;  3WQW A;  3CHF A;  1FKH A;  3KCE A;  1NMW A;  2KI3 A;  2DG3 A;  4DRO A;  4U84 A;  1FKG A;  1E6R A;  1W1P A;  1WAW A;  4C02 B;  2ZQS A;  1N1A A;  1EYM A;  3B9D A;  3O5E A;  3WIJ A;  4GIV A;  3FY1 A;  3G6L A;  3UI4 A;  4P8V A;  4IPX A;  2RUD A;  4GGQ A;  4ODQ A;  1ZBC A;  3O5L A;  4DWS B;  1XHG A;  2LKN A;  4L3N A;  1ZK6 A;  3AS2 A;  4L72 B;  4WKF A;  3B8S A;  4DRN A;  5GPG A;  2PV3 A;  4ODN A;  1FKI A;  3B9E A;  4NZC A;  1ZCN A;  4FN2 A;  3ALG A;  3WD0 A;  1D7J A;  1Q6I A;  1QPL A;  2FDM A;  3PRB A;  3RM9 A;  1IX5 A;  3ARQ A;  3O5F A;  4R5E A;  1Q6U A;  5HUA A;  4ODR A;  1LL4 A;  4BF8 A;  5DF0 A;  5GQB A;  1W1T A;  4KR0 B;  1WB0 A;  1W9U A;  1RD6 A;  2L2S A;  3GPK A;  1A7X A;  4MSP A;  1E15 A;  3BXW A;  4U86 A;  2YBU A;  3WD2 A;  3UQA A;  4DH0 A;  2DT2 A;  4MPK A;  1JNE A;  4ITZ A;  3KAD A;  1U79 A;  2K8I A;  1ZL1 A;  3FAP A;  1HKJ A;  3WKZ A;  3ARV A;  4MTV A;  3O5R A;  2PV1 A;  4Z2K A;  4WIW A;  3CZ8 A;  2ZR5 A;  2RUR A;  4MAV A;  2JZV A;  2LPV A;  3CHC A;  3TCZ A;  1ZBV A;  5DIT A;  4Z2J A;  4JFL A;  4W9Q A;  1UR8 A;  3AS3 A;  1FD9 A;  2MF9 A;  4ZPW R;  3O5I A;  4NNR A;  4ODP A;  4S3K A;  4ZPV R;  5HKG A;  2DG4 A;  5B8I C;  3CHD A;  2G8Z A;  4W5U A;  2WLY A;  1KFW A;  4TX0 A;  2KR7 A;  4MNL A;  2PI6 A;  1M5Y A;  5HW6 A;  1ROT A;  5J6E A;  2WLZ A;  2RSE A;  2G41 A;  3KAG A;  1PBK A;  3O5J A;  4S3J A;  3PRA A;  3OA5 A;  2PPO A;  3ARX A;  2OFN A;  1GPF A;  1JNS A;  4JFI A;  1F40 A;  3B9A A;  1ZBK A;  4QT2 A;  4LAY A;  1E6P A;  3I6C A;  3WD1 A;  2F2D A;  4AY1 A;  3WH0 A;  4LGX A;  4DWS D;  4XAK A;  4JFK A;  1NWR A;  2FAP A;  3AS0 A;  3ART A;  3RME A;  2XP7 A;  1J4H A;  1LQ0 A;  3AS1 A;  3PR9 A;  1XRV A;  4JYS A;  2DT3 A;  2Q5A A;  3UI5 A;  3WL0 A;  4DZ2 A;  1W1V A;  1HKM A;  2MLY A;  4ODL A;  3JYM A;  4WKA A;  4IT4 A;  2RUQ A;  1EHN A;  3EY6 A;  4ODK A;  3LUO A;  3WD4 A;  5HWB A;  1LG1 A;  4HBO A;  2FKE A;  3JXV A;  2XP4 A;  1OGG A;  1NWS A;  4TNS A;  4DRQ A;  1WNO A;  4IQC A;  2F21 A;  1NMV A;  1FKT A;  1NSG A;  3KAB A;  3WQV A;  1FFQ A;  2ITK A;  1J4I A;  1OWQ A;  2D9F A;  2LGO A;  3KZ7 A;  1HJW A;  3JYJ A;  4MNJ A;  1FKJ A;  1B6C A;  2ZQT A;  3W4R A;  4LAW A;  3UF8 A;  2OLH A;  2M1I A;  3KAC A;  3H9R B;  3ARW A;  4DRJ A;  1FKL A;  1J6Y A;  1FKR A;  4DZ3 A;  4ZS6 A;  1E6Z A;  1D2K A;  1TCO C;  1TFV A;  2DSV A;  2DSW A;  4MGV A;  1FKD A;  1NWU A;  4Q22 A;  3UQI A;  1W9P A;  2O9O A;  2A3B A;  2DPE A;  3ARP A;  3PA7 A;  3O5M A;  4Z2L A;  1D6O A;  1E6N A;  2RQS A;  2Y78 A;  1P5Q A;  4U85 A;  2KE0 A;  2PV2 A;  4G50 A;  3RM8 A;  1QZ2 A;  4W9O A;  3RFW A;  2DT1 A;  2KO7 A;  3UQB A;  1FAP A;  1Y0O A;  2KGJ A;  4KQZ A;  4TW8 A;  4P8W A;  4TYO A;  4WJX A;  4LAV A;  3AQU A;  1J4R A;  1ZU8 A;  1W1Y A;  4P8U A;  3ARZ A;  1NH6 A;  3IHZ A;  1FFR A;  4O2T A;  4TW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...