3KZ7A

C-terminal domain of murine fkbp25 rapamycin complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
b'EGPPKYTKSILKKGDKTNFPKKGDVVHCWYTGTLPDGTVFDTNIQTSSKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNTKLIFEVELVDID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 3
publication title Diversified targets of FKBP25 and its complex with rapamycin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Isomerase/inhibitor
total genus 25
structure length 119
sequence length 119
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kz7A00
3O5PA 2LKNA 4IPXA 2LGOA 1EYMA 4ITZA 4QIBA 4DRMA 1FKRA 4U84A 5HKGA 3KAHA 2F4EA 3B7XA 2XPBA 1NMVA 2ZR6A 1C9HA 2ZR5A 1L1PA 3O5QA 4G50A 2OFNA 2PPNA 4DRJA 3UI4A 3O5JA 4G2PA 4QT2A 3TDBA 1R9HA 2JZVA 2MLZA 2IF4A 3NTPA 2KE0A 4JFKA 4FN2A 4GIVA 1W26A 2DG9A 1YATA 4DZ3A 2ZQTA 3PRBA 4TNSA 1J6YA 1J4RA 1KT0A 3H9RB 3NRKA 3IHZA 3KAIA 4DRPA 1A7XA 3O5IA 2PPOA 4DRHA 3LUOA 4DH0A 4W9QA 1FKGA 2ZQUA 3GPKA 3UQAA 3UI6A 1FAPA 5HUAA 4GGQA 4ODMA 2FKEA 2RUCA 2UZ5A 1JVWA 4LAWA 3NI6A 2DG4A 4ODNA 2F21A 4DT4A 4LAVA 4N19A 4U85A 4DRNA 2KO7A 2M2AA 1NSGA 4JFMA 4ODQA 4U86A 2RURA 2Y78A 2KGJA 4MGVA 2MNTA 2XP6A 2MLYA 2F2DA 3O5KA 4IQCA 4W9OA 5DIVA 3O5DA 1ZK6A 3VAWA 4TW7A 3PRDA 2VN1A 1FKSA 3JXVA 4MSPA 5D75A 4J4NA 1KT1A 2XPAA 3O5OA 2XP5A 1ROTA 4DZ2A 2MF9A 2KI3A 1YW5A 1FKKA 4TYOA 3TCZA 3RFWA 1FKJA 2FAPA 2XP9A 1EQ3A 3O5RA 4O2TA 2XP3A 4NNRA 2M1IA 1FKTA 2M08A 2PV3A 3UQBA 4LAXA 3O5EA 4DIPA 3O5LA 1FKBA 2RQSA 3KCEA 5HT1A 2DG3A 3UI5A 1JNTA 1PINA 2PV2A 1TCOC 3FAPA 4JFLA 4DRQA 5HW8A 1ZCNA 3JYMA 2PBCA 1ROUA 1FKFA 1D7IA 2Q5AA 4JFIA 2AWGA 3O5FA 4J4OA 5HWCA 3IK8A 3UQIA 2XP4A 5HW6A 3MDYB 3ODKA 2L2SA 4LAYA 2RUQA 1PBKA 4ODKA 1FKDA 1P5QA 2PPPA 5J6EA 4JYSA 4TW6A 1FD9A 1Y0OA 1J4HA 3UF8A 5DIUA 4DROA 3O5MA 5DITA 2ZQSA 1FKIA 1QZ2A 2XP8A 4QT3A 1Q6IA 1N1AA 1QPFA 3I6CA 1T11A 4R0XA 2N87A 1BL4A 1NMWA 4ODPA 4FAPA 3CGMA 1HXVA 1J4IA 5BXJA 2LPVA 1D7JA 2MLXA 2LJ4A 4DRKA 1Q6UA 5GPGA 1M5YA 2KFWA 3WH0A 4ODRA 1FJDA 3KAGA 3JYJA 2D9FA 5HWBA 1FKLA 3KAFA 4W9PA 2MPHA 2RUDA 1F8AB 1FKHA 3IKGA 3IKDA 3PA7A 5I98A 4ODLA 3O5GA 1Q6HA 1JNSA 3OOBA 1B6CA 1D6OA 2K8IA 4ODOA 2ZR4A 3CGNA 1QPLA 3KABA 1U79A 4IQ2A 5HTGA 4BF8A 2KR7A 1BKFA 2RSEA 3KZ7A 4TW8A 4DRIA 5B8IC 2XP7A 3KACA 2PV1A 2ZQVA 4JFJA 4TX0A 5HW7A 2ITKA 4C02B 3RGCA 1Q1CA 3EY6A 3KADA 1F40A 1D7HA 2VCDA 3TC5A
chains in the Genus database with same CATH superfamily
1HJXA 4DRMA 4ITZA 1FKRA 4U84A 4MNMA 3KAHA 3PR9A 1NMVA 1W9VA 1L1PA 1TFVA 3WD4A 3QOKA 1E6NA 1EDQA 1R9HA 4DWSB 3NTPA 2KE0A 4FN2A 3W4RA 4DZ3A 3PRBA 3NRKA 4Z2KA 3O5IA 2PPOA 4L72B 4DH0A 3CHFA 4KR0B 1GPFA 2FKEA 3ARQA 3NI6A 1O6IA 1E15A 2KO7A 2M2AA 1IX5A 1X6NA 2RURA 2WLYA 4IT6A 2KGJA 2XP6A 4IQCA 4WKHA 3ARTA 4L3NA 1UR9A 3ARSA 4TW7A 1WNOA 4XAKA 4J4NA 1JNEA 3O5OA 1FFQA 4ZPTR 3RM8A 2MF9A 2KI3A 3WL1A 3RFWA 1EQ3A 1HJVA 2XP3A 3UQBA 3O5LA 1ZBKA 1JNTA 1PINA 4JFLA 1D2KA 4WK9A 4JFIA 2Q5AA 3B9EA 2AWGA 3O5FA 5DO2A 2DSUA 4LAYA 2RUQA 2PPPA 1W1VA 4Q22A 4URIA 2PI6A 4HARA 4ZS6A 1QPFA 1NWUA 1T11A 1BL4A 4ODPA 3FY1A 3BMBA 4MAVA 1J4IA 2MLXA 4DRKA 1Q6UA 5GPGA 1M5YA 3KAGA 5HWBA 2O92A 4W9PA 3ARUA 1F8AB 1JNSA 5JH8A 1B6CA 1D6OA 4ODOA 4NSBA 3CGNA 3WD2A 1U79A 1CTNA 1GRJA 5B8IC 3KACA 2PV1A 3B9AA 4TX0A 3ARXA 4C02B 3AS2A 3EY6A 2O9OA 3IK8A 3OA5A 3O5PA 4IPXA 1OGGA 1EYMA 2LGOA 4QIBA 3ARVA 2F4EA 4UDMA 1W9PA 1LL6A 2ZR5A 3AS1A 3O5QA 2OFNA 4P8UA 2MLZA 1ZL1A 4JFKA 3G6MA 2DG9A 1J4RA 1ZBWA 3H9RB 4DRPA 3ARWA 1A7XA 3CHCA 3WQVA 4AY1A 3GPKA 4P8WA 3CHEA 3UQAA 4DWSC 5HUAA 4GGQA 3ARZA 2RUCA 3AS0A 4ODNA 4LAVA 4N19A 3RM4A 1KFWA 4U85A 1NSGA 2MLYA 1ZK6A 3VAWA 3PRDA 1KT1A 1HKKA 4TYOA 3TCZA 2FAPA 1LG1A 1FKTA 1ZU8A 4WKAA 3RM9A 2WK2A 2RQSA 5HT1A 3UI5A 3WD0A 2PV2A 1TCOC 1WAWA 4ZPVR 1GUVA 1JNDA 2PBCA 1FKFA 1D7IA 1E6PA 2F23A 4J4OA 5HWCA 3UQIA 5HW6A 2L2SA 1RD6A 4ODKA 4TW6A 1W9UA 1HJWA 1Y0OA 3O5MA 1NWRA 5DITA 1FKIA 2A3EA 1QZ2A 2XP8A 4QT3A 4R0XA 1N1AA 1NMWA 1E6ZA 3WD1A 4P8XA 1HXVA 1H0IA 3WKZA 3AROA 1ITXA 3WH0A 4Z2LA 1LL4A 1EIBA 1JCHB 2MPHA 2RUDA 2OLHA 1FKHA 1W1PA 2EULA 3PA7A 4ODLA 3KABA 1WB0A 2RSEA 1BKFA 3KZ7A 3ARPA 2G41A 4DWSA 2ZQVA 4JFJA 5HW7A 4R5EA 4S3KA 3KADA 4DIPA 2LKNA 2P4VA 4MNJA 2ESCA 1X6LA 3B7XA 2XPBA 2DT3A 1E44A 3GU0A 4G50A 2WLZA 4G2PA 3TDBA 1SYTA 3CH9A 1W26A 4WIWA 4TNSA 1HKMA 1J6YA 1KT0A 3IHZA 3KAIA 2YBTA 1K9TA 3LUOA 3WD3A 1FKGA 4DWSD 3UI6A 1FAPA 3AQUA 1OWQA 1JVWA 4LAWA 2F21A 5GPRA 3CHDA 3CZ8A 4U86A 2Y78A 4W9OA 2B5UB 4IT4A 3O5KA 4WJXA 5DIVA 2VN1A 1NWSA 5D75A 1EHNA 2QF8A 2XP5A 1ROTA 1NWTA 2DSZA 4DZ2A 1ZBVA 1HKIA 1FKKA 1FKJA 2G8ZA 3O5RA 3ARRA 3ARYA 4NNRA 2M1IA 4W5UA 3G6LA 3KCEA 1HKJA 5HW8A 5DEZA 3JYMA 2DT1A 2DT0A 4Z2JA 2XP4A 3WIJA 2B31A 3MDYB 1XRVA 4MNLA 5J6EA 1FKDA 1UR8A 4JYSA 2AOSA 3UF8A 4DROA 1H0GA 2YBUA 2ZQSA 2WM0A 4HBEA 5BXJA 2LPVA 4S3JA 4ODRA 3JYJA 2D9FA 3KAFA 1E9LA 3WQWA 1LQ0A 3IKDA 1Q6HA 3ALFA 3OOBA 3B8SA 2K8IA 2ZR4A 1QPLA 5HTGA 4BF8A 2PN0A 2XP7A 2DSWA 1Q1CA 4KQZA 2A3BA 3JXVA 3TC5A 4FAPA 2FDMA 4QZVB 1VF8A 1NH6A 3EIPA 5HKGA 1W1YA 2ZR6A 4Z2IA 1C9HA 2PPNA 4DRJA 3UI4A 3O5JA 2DPEA 4QT2A 2JZVA 2IF4A 4GIVA 1YATA 4LGXA 2ZQTA 4DRHA 3B9DA 2A3AA 4W9QA 2ZQUA 4ODMA 2UZ5A 2DG4A 3WL0A 4DT4A 4MTVA 4DRNA 4JFMA 4WKFA 4ODQA 1SR0A 4MGVA 2MNTA 2F2DA 3O5DA 1FKSA 4MSPA 2ETNA 2XPAA 5HBFA 1LG2A 1YW5A 3FXYA 2XP9A 4O2TA 2M08A 2PV3A 4LAXA 3O5EA 1FKBA 2DG3A 5GQBA 1FFRA 3FAPA 4DRQA 1ZCNA 1ROUA 2IUZA 2A3CA 4Q7NA 1E6RA 3ODKA 1GOIA 1PBKA 1P5QA 1FD9A 1J4HA 3GTYX 5DIUA 1XHGA 3RMEA 4ZPWR 4PTMA 1Q6IA 3I6CA 2N87A 3CGMA 2DT2A 1LJYA 1D7JA 2LJ4A 1OGBA 3AS3A 2KFWA 1FJDA 1FKLA 5DF0A 2DSVA 4HBOA 4MPKA 3IKGA 5I98A 3O5GA 1ZBCA 4NZCA 4Z2GA 3PRAA 4IQ2A 2KR7A 1W1TA 4TW8A 4ML4A 4DRIA 4Z2HA 4P8VA 2ITKA 4MNKA 3BXWA 3RGCA 1ZB5A 1LL7A 1F40A 1D7HA 2VCDA 3ALGA
chains in the Genus database with same CATH topology
1HJXA 4DRMA 4ITZA 1FKRA 4U84A 4MNMA 3KAHA 3PR9A 1NMVA 1W9VA 1L1PA 1TFVA 3WD4A 3QOKA 1E6NA 1EDQA 1R9HA 4DWSB 3NTPA 2KE0A 4FN2A 3W4RA 4DZ3A 3PRBA 3NRKA 4Z2KA 3O5IA 2PPOA 4L72B 4DH0A 3CHFA 4KR0B 1GPFA 2FKEA 3ARQA 3NI6A 1O6IA 1E15A 2KO7A 2M2AA 1IX5A 1X6NA 2RURA 2WLYA 4IT6A 2KGJA 2XP6A 4IQCA 4WKHA 3ARTA 4L3NA 1UR9A 3ARSA 4TW7A 1WNOA 4XAKA 4J4NA 1JNEA 3O5OA 1FFQA 4ZPTR 3RM8A 2MF9A 2KI3A 3WL1A 3RFWA 1EQ3A 1HJVA 2XP3A 3UQBA 3O5LA 1ZBKA 1JNTA 1PINA 4JFLA 1D2KA 4WK9A 4JFIA 2Q5AA 3B9EA 2AWGA 3O5FA 5DO2A 2DSUA 4LAYA 2RUQA 2PPPA 1W1VA 4Q22A 4URIA 2PI6A 4HARA 4ZS6A 1QPFA 1NWUA 1T11A 1BL4A 4ODPA 3FY1A 4MAVA 1J4IA 2MLXA 4DRKA 1Q6UA 5GPGA 1M5YA 3KAGA 5HWBA 2O92A 4W9PA 3ARUA 1F8AB 1JNSA 5JH8A 1B6CA 1D6OA 4ODOA 4NSBA 3CGNA 3WD2A 1U79A 1CTNA 5B8IC 3KACA 2PV1A 3B9AA 4TX0A 3ARXA 4C02B 3AS2A 3EY6A 2O9OA 3IK8A 3OA5A 3O5PA 4IPXA 1OGGA 1EYMA 2LGOA 4QIBA 3ARVA 2F4EA 1W9PA 1LL6A 2ZR5A 3AS1A 3O5QA 2OFNA 4P8UA 2MLZA 1ZL1A 4JFKA 3G6MA 2DG9A 1J4RA 1ZBWA 3H9RB 4DRPA 3ARWA 1A7XA 3CHCA 3WQVA 4AY1A 3GPKA 4P8WA 3CHEA 3UQAA 4DWSC 5HUAA 4GGQA 3ARZA 2RUCA 3AS0A 4ODNA 4LAVA 4N19A 3RM4A 1KFWA 4U85A 1NSGA 2MLYA 1ZK6A 3VAWA 3PRDA 1KT1A 1HKKA 4TYOA 3TCZA 2FAPA 1LG1A 1FKTA 1ZU8A 4WKAA 3RM9A 2WK2A 2RQSA 5HT1A 3UI5A 3WD0A 2PV2A 1TCOC 1WAWA 4ZPVR 1GUVA 1JNDA 2PBCA 1FKFA 1D7IA 1E6PA 4J4OA 5HWCA 3UQIA 5HW6A 2L2SA 1RD6A 4ODKA 4TW6A 1W9UA 1HJWA 1Y0OA 3O5MA 1NWRA 5DITA 1FKIA 2A3EA 1QZ2A 2XP8A 4QT3A 4R0XA 1N1AA 1NMWA 1E6ZA 3WD1A 4P8XA 1HXVA 1H0IA 3WKZA 3AROA 1ITXA 3WH0A 4Z2LA 1LL4A 1EIBA 2MPHA 2RUDA 2OLHA 1FKHA 1W1PA 3PA7A 4ODLA 3KABA 1WB0A 2RSEA 1BKFA 3KZ7A 3ARPA 2G41A 4DWSA 2ZQVA 4JFJA 5HW7A 4R5EA 4S3KA 3KADA 4DIPA 2LKNA 4MNJA 2ESCA 1X6LA 3B7XA 2XPBA 2DT3A 4G50A 2WLZA 4G2PA 3TDBA 1SYTA 3CH9A 1W26A 4WIWA 4TNSA 1HKMA 1J6YA 1KT0A 3IHZA 3KAIA 2YBTA 1K9TA 3LUOA 3WD3A 1FKGA 4DWSD 3UI6A 1FAPA 3AQUA 1OWQA 1JVWA 4LAWA 2F21A 5GPRA 3CHDA 3CZ8A 4U86A 2Y78A 4W9OA 4IT4A 5DIVA 3O5KA 4WJXA 2VN1A 1NWSA 5D75A 1EHNA 2QF8A 2XP5A 1ROTA 1NWTA 2DSZA 4DZ2A 1ZBVA 1HKIA 1FKKA 1FKJA 2G8ZA 3O5RA 3ARRA 3ARYA 4NNRA 2M1IA 4W5UA 3G6LA 3KCEA 1HKJA 5HW8A 5DEZA 3JYMA 2DT1A 2DT0A 4Z2JA 2XP4A 3WIJA 2B31A 3MDYB 1XRVA 4MNLA 5J6EA 1FKDA 1UR8A 4JYSA 2AOSA 3UF8A 4DROA 1H0GA 2YBUA 2ZQSA 2WM0A 4HBEA 5BXJA 2LPVA 4S3JA 4ODRA 3JYJA 2D9FA 3KAFA 1E9LA 3WQWA 1LQ0A 3IKDA 1Q6HA 3ALFA 3OOBA 3B8SA 2K8IA 2ZR4A 1QPLA 5HTGA 4BF8A 2XP7A 2DSWA 1Q1CA 4KQZA 2A3BA 3JXVA 3TC5A 4FAPA 2FDMA 4QZVB 1VF8A 1NH6A 5HKGA 1W1YA 2ZR6A 4Z2IA 1C9HA 2PPNA 4DRJA 3UI4A 3O5JA 2DPEA 4QT2A 2JZVA 2IF4A 4GIVA 1YATA 4LGXA 2ZQTA 4DRHA 3B9DA 2A3AA 4W9QA 2ZQUA 4ODMA 2UZ5A 2DG4A 3WL0A 4DT4A 4MTVA 4DRNA 4JFMA 4WKFA 4ODQA 1SR0A 4MGVA 2MNTA 2F2DA 3O5DA 1FKSA 4MSPA 2XPAA 5HBFA 1LG2A 1YW5A 3FXYA 2XP9A 4O2TA 2M08A 2PV3A 4LAXA 3O5EA 1FKBA 2DG3A 5GQBA 1FFRA 3FAPA 4DRQA 1ZCNA 1ROUA 2IUZA 2A3CA 4Q7NA 1E6RA 3ODKA 1GOIA 1PBKA 1P5QA 1FD9A 1J4HA 5DIUA 1XHGA 3RMEA 4ZPWR 4PTMA 1Q6IA 3I6CA 2N87A 3CGMA 2DT2A 1LJYA 1D7JA 2LJ4A 1OGBA 3AS3A 2KFWA 1FJDA 1FKLA 5DF0A 2DSVA 4HBOA 4MPKA 3IKGA 5I98A 3O5GA 1ZBCA 4NZCA 4Z2GA 3PRAA 4IQ2A 2KR7A 1W1TA 4TW8A 4ML4A 4DRIA 4Z2HA 4P8VA 2ITKA 4MNKA 3BXWA 3RGCA 1ZB5A 1LL7A 1F40A 1D7HA 2VCDA 3ALGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5P A;  2LKN A;  4IPX A;  2LGO A;  1EYM A;  4ITZ A;  4QIB A;  4DRM A;  1FKR A;  4U84 A;  5HKG A;  3KAH A;  2F4E A;  3B7X A;  2XPB A;  1NMV A;  2ZR6 A;  1C9H A;  2ZR5 A;  1L1P A;  3O5Q A;  4G50 A;  2OFN A;  2PPN A;  4DRJ A;  3UI4 A;  3O5J A;  4G2P A;  4QT2 A;  3TDB A;  1R9H A;  2JZV A;  2MLZ A;  2IF4 A;  3NTP A;  2KE0 A;  4JFK A;  4FN2 A;  4GIV A;  1W26 A;  2DG9 A;  1YAT A;  4DZ3 A;  2ZQT A;  3PRB A;  4TNS A;  1J6Y A;  1J4R A;  1KT0 A;  3H9R B;  3NRK A;  3IHZ A;  3KAI A;  4DRP A;  1A7X A;  3O5I A;  2PPO A;  4DRH A;  3LUO A;  4DH0 A;  4W9Q A;  1FKG A;  2ZQU A;  3GPK A;  3UQA A;  3UI6 A;  1FAP A;  5HUA A;  4GGQ A;  4ODM A;  2FKE A;  2RUC A;  2UZ5 A;  1JVW A;  4LAW A;  3NI6 A;  2DG4 A;  4ODN A;  2F21 A;  4DT4 A;  4LAV A;  4N19 A;  4U85 A;  4DRN A;  2KO7 A;  2M2A A;  1NSG A;  4JFM A;  4ODQ A;  4U86 A;  2RUR A;  2Y78 A;  2KGJ A;  4MGV A;  2MNT A;  2XP6 A;  2MLY A;  2F2D A;  3O5K A;  4IQC A;  4W9O A;  5DIV A;  3O5D A;  1ZK6 A;  3VAW A;  4TW7 A;  3PRD A;  2VN1 A;  1FKS A;  3JXV A;  4MSP A;  5D75 A;  4J4N A;  1KT1 A;  2XPA A;  3O5O A;  2XP5 A;  1ROT A;  4DZ2 A;  2MF9 A;  2KI3 A;  1YW5 A;  1FKK A;  4TYO A;  3TCZ A;  3RFW A;  1FKJ A;  2FAP A;  2XP9 A;  1EQ3 A;  3O5R A;  4O2T A;  2XP3 A;  4NNR A;  2M1I A;  1FKT A;  2M08 A;  2PV3 A;  3UQB A;  4LAX A;  3O5E A;  4DIP A;  3O5L A;  1FKB A;  2RQS A;  3KCE A;  5HT1 A;  2DG3 A;  3UI5 A;  1JNT A;  1PIN A;  2PV2 A;  1TCO C;  3FAP A;  4JFL A;  4DRQ A;  5HW8 A;  1ZCN A;  3JYM A;  2PBC A;  1ROU A;  1FKF A;  1D7I A;  2Q5A A;  4JFI A;  2AWG A;  3O5F A;  4J4O A;  5HWC A;  3IK8 A;  3UQI A;  2XP4 A;  5HW6 A;  3MDY B;  3ODK A;  2L2S A;  4LAY A;  2RUQ A;  1PBK A;  4ODK A;  1FKD A;  1P5Q A;  2PPP A;  5J6E A;  4JYS A;  4TW6 A;  1FD9 A;  1Y0O A;  1J4H A;  3UF8 A;  5DIU A;  4DRO A;  3O5M A;  5DIT A;  2ZQS A;  1FKI A;  1QZ2 A;  2XP8 A;  4QT3 A;  1Q6I A;  1N1A A;  1QPF A;  3I6C A;  1T11 A;  4R0X A;  2N87 A;  1BL4 A;  1NMW A;  4ODP A;  4FAP A;  3CGM A;  1HXV A;  1J4I A;  5BXJ A;  2LPV A;  1D7J A;  2MLX A;  2LJ4 A;  4DRK A;  1Q6U A;  5GPG A;  1M5Y A;  2KFW A;  3WH0 A;  4ODR A;  1FJD A;  3KAG A;  3JYJ A;  2D9F A;  5HWB A;  1FKL A;  3KAF A;  4W9P A;  2MPH A;  2RUD A;  1F8A B;  1FKH A;  3IKG A;  3IKD A;  3PA7 A;  5I98 A;  4ODL A;  3O5G A;  1Q6H A;  1JNS A;  3OOB A;  1B6C A;  1D6O A;  2K8I A;  4ODO A;  2ZR4 A;  3CGN A;  1QPL A;  3KAB A;  1U79 A;  4IQ2 A;  5HTG A;  4BF8 A;  2KR7 A;  1BKF A;  2RSE A;  3KZ7 A;  4TW8 A;  4DRI A;  5B8I C;  2XP7 A;  3KAC A;  2PV1 A;  2ZQV A;  4JFJ A;  4TX0 A;  5HW7 A;  2ITK A;  4C02 B;  3RGC A;  1Q1C A;  3EY6 A;  3KAD A;  1F40 A;  1D7H A;  2VCD A;  3TC5 A; 
#chains in the Genus database with same CATH topology
 1HJX A;  4DRM A;  4ITZ A;  1FKR A;  4U84 A;  4MNM A;  3KAH A;  3PR9 A;  1NMV A;  1W9V A;  1L1P A;  1TFV A;  3WD4 A;  3QOK A;  1E6N A;  1EDQ A;  1R9H A;  4DWS B;  3NTP A;  2KE0 A;  4FN2 A;  3W4R A;  4DZ3 A;  3PRB A;  3NRK A;  4Z2K A;  3O5I A;  2PPO A;  4L72 B;  4DH0 A;  3CHF A;  4KR0 B;  1GPF A;  2FKE A;  3ARQ A;  3NI6 A;  1O6I A;  1E15 A;  2KO7 A;  2M2A A;  1IX5 A;  1X6N A;  2RUR A;  2WLY A;  4IT6 A;  2KGJ A;  2XP6 A;  4IQC A;  4WKH A;  3ART A;  4L3N A;  1UR9 A;  3ARS A;  4TW7 A;  1WNO A;  4XAK A;  4J4N A;  1JNE A;  3O5O A;  1FFQ A;  4ZPT R;  3RM8 A;  2MF9 A;  2KI3 A;  3WL1 A;  3RFW A;  1EQ3 A;  1HJV A;  2XP3 A;  3UQB A;  3O5L A;  1ZBK A;  1JNT A;  1PIN A;  4JFL A;  1D2K A;  4WK9 A;  4JFI A;  2Q5A A;  3B9E A;  2AWG A;  3O5F A;  5DO2 A;  2DSU A;  4LAY A;  2RUQ A;  2PPP A;  1W1V A;  4Q22 A;  4URI A;  2PI6 A;  4HAR A;  4ZS6 A;  1QPF A;  1NWU A;  1T11 A;  1BL4 A;  4ODP A;  3FY1 A;  3BMB A;  4MAV A;  1J4I A;  2MLX A;  4DRK A;  1Q6U A;  5GPG A;  1M5Y A;  3KAG A;  5HWB A;  2O92 A;  4W9P A;  3ARU A;  1F8A B;  1JNS A;  5JH8 A;  1B6C A;  1D6O A;  4ODO A;  4NSB A;  3CGN A;  3WD2 A;  1U79 A;  1CTN A;  1GRJ A;  5B8I C;  3KAC A;  2PV1 A;  3B9A A;  4TX0 A;  3ARX A;  4C02 B;  3AS2 A;  3EY6 A;  2O9O A;  3IK8 A;  3OA5 A;  3O5P A;  4IPX A;  1OGG A;  1EYM A;  2LGO A;  4QIB A;  3ARV A;  2F4E A;  4UDM A;  1W9P A;  1LL6 A;  2ZR5 A;  3AS1 A;  3O5Q A;  2OFN A;  4P8U A;  2MLZ A;  1ZL1 A;  4JFK A;  3G6M A;  2DG9 A;  1J4R A;  1ZBW A;  3H9R B;  4DRP A;  3ARW A;  1A7X A;  3CHC A;  3WQV A;  4AY1 A;  3GPK A;  4P8W A;  3CHE A;  3UQA A;  4DWS C;  5HUA A;  4GGQ A;  3ARZ A;  2RUC A;  3AS0 A;  4ODN A;  4LAV A;  4N19 A;  3RM4 A;  1KFW A;  4U85 A;  1NSG A;  2MLY A;  1ZK6 A;  3VAW A;  3PRD A;  1KT1 A;  1HKK A;  4TYO A;  3TCZ A;  2FAP A;  1LG1 A;  1FKT A;  1ZU8 A;  4WKA A;  3RM9 A;  2WK2 A;  2RQS A;  5HT1 A;  3UI5 A;  3WD0 A;  2PV2 A;  1TCO C;  1WAW A;  4ZPV R;  1GUV A;  1JND A;  2PBC A;  1FKF A;  1D7I A;  1E6P A;  2F23 A;  4J4O A;  5HWC A;  3UQI A;  5HW6 A;  2L2S A;  1RD6 A;  4ODK A;  4TW6 A;  1W9U A;  1HJW A;  1Y0O A;  3O5M A;  1NWR A;  5DIT A;  1FKI A;  2A3E A;  1QZ2 A;  2XP8 A;  4QT3 A;  4R0X A;  1N1A A;  1NMW A;  1E6Z A;  3WD1 A;  4P8X A;  1HXV A;  1H0I A;  3WKZ A;  3ARO A;  1ITX A;  3WH0 A;  4Z2L A;  1LL4 A;  1EIB A;  1JCH B;  2MPH A;  2RUD A;  2OLH A;  1FKH A;  1W1P A;  2EUL A;  3PA7 A;  4ODL A;  3KAB A;  1WB0 A;  2RSE A;  1BKF A;  3KZ7 A;  3ARP A;  2G41 A;  4DWS A;  2ZQV A;  4JFJ A;  5HW7 A;  4R5E A;  4S3K A;  3KAD A;  4DIP A;  2LKN A;  2P4V A;  4MNJ A;  2ESC A;  1X6L A;  3B7X A;  2XPB A;  2DT3 A;  1E44 A;  3GU0 A;  4G50 A;  2WLZ A;  4G2P A;  3TDB A;  1SYT A;  3CH9 A;  1W26 A;  4WIW A;  4TNS A;  1HKM A;  1J6Y A;  1KT0 A;  3IHZ A;  3KAI A;  2YBT A;  1K9T A;  3LUO A;  3WD3 A;  1FKG A;  4DWS D;  3UI6 A;  1FAP A;  3AQU A;  1OWQ A;  1JVW A;  4LAW A;  2F21 A;  5GPR A;  3CHD A;  3CZ8 A;  4U86 A;  2Y78 A;  4W9O A;  2B5U B;  4IT4 A;  3O5K A;  4WJX A;  5DIV A;  2VN1 A;  1NWS A;  5D75 A;  1EHN A;  2QF8 A;  2XP5 A;  1ROT A;  1NWT A;  2DSZ A;  4DZ2 A;  1ZBV A;  1HKI A;  1FKK A;  1FKJ A;  2G8Z A;  3O5R A;  3ARR A;  3ARY A;  4NNR A;  2M1I A;  4W5U A;  3G6L A;  3KCE A;  1HKJ A;  5HW8 A;  5DEZ A;  3JYM A;  2DT1 A;  2DT0 A;  4Z2J A;  2XP4 A;  3WIJ A;  2B31 A;  3MDY B;  1XRV A;  4MNL A;  5J6E A;  1FKD A;  1UR8 A;  4JYS A;  2AOS A;  3UF8 A;  4DRO A;  1H0G A;  2YBU A;  2ZQS A;  2WM0 A;  4HBE A;  5BXJ A;  2LPV A;  4S3J A;  4ODR A;  3JYJ A;  2D9F A;  3KAF A;  1E9L A;  3WQW A;  1LQ0 A;  3IKD A;  1Q6H A;  3ALF A;  3OOB A;  3B8S A;  2K8I A;  2ZR4 A;  1QPL A;  5HTG A;  4BF8 A;  2PN0 A;  2XP7 A;  2DSW A;  1Q1C A;  4KQZ A;  2A3B A;  3JXV A;  3TC5 A;  4FAP A;  2FDM A;  4QZV B;  1VF8 A;  1NH6 A;  3EIP A;  5HKG A;  1W1Y A;  2ZR6 A;  4Z2I A;  1C9H A;  2PPN A;  4DRJ A;  3UI4 A;  3O5J A;  2DPE A;  4QT2 A;  2JZV A;  2IF4 A;  4GIV A;  1YAT A;  4LGX A;  2ZQT A;  4DRH A;  3B9D A;  2A3A A;  4W9Q A;  2ZQU A;  4ODM A;  2UZ5 A;  2DG4 A;  3WL0 A;  4DT4 A;  4MTV A;  4DRN A;  4JFM A;  4WKF A;  4ODQ A;  1SR0 A;  4MGV A;  2MNT A;  2F2D A;  3O5D A;  1FKS A;  4MSP A;  2ETN A;  2XPA A;  5HBF A;  1LG2 A;  1YW5 A;  3FXY A;  2XP9 A;  4O2T A;  2M08 A;  2PV3 A;  4LAX A;  3O5E A;  1FKB A;  2DG3 A;  5GQB A;  1FFR A;  3FAP A;  4DRQ A;  1ZCN A;  1ROU A;  2IUZ A;  2A3C A;  4Q7N A;  1E6R A;  3ODK A;  1GOI A;  1PBK A;  1P5Q A;  1FD9 A;  1J4H A;  3GTY X;  5DIU A;  1XHG A;  3RME A;  4ZPW R;  4PTM A;  1Q6I A;  3I6C A;  2N87 A;  3CGM A;  2DT2 A;  1LJY A;  1D7J A;  2LJ4 A;  1OGB A;  3AS3 A;  2KFW A;  1FJD A;  1FKL A;  5DF0 A;  2DSV A;  4HBO A;  4MPK A;  3IKG A;  5I98 A;  3O5G A;  1ZBC A;  4NZC A;  4Z2G A;  3PRA A;  4IQ2 A;  2KR7 A;  1W1T A;  4TW8 A;  4ML4 A;  4DRI A;  4Z2H A;  4P8V A;  2ITK A;  4MNK A;  3BXW A;  3RGC A;  1ZB5 A;  1LL7 A;  1F40 A;  1D7H A;  2VCD A;  3ALG A; 
#chains in the Genus database with same CATH homology
 1HJX A;  4DRM A;  4ITZ A;  1FKR A;  4U84 A;  4MNM A;  3KAH A;  3PR9 A;  1NMV A;  1W9V A;  1L1P A;  1TFV A;  3WD4 A;  3QOK A;  1E6N A;  1EDQ A;  1R9H A;  4DWS B;  3NTP A;  2KE0 A;  4FN2 A;  3W4R A;  4DZ3 A;  3PRB A;  3NRK A;  4Z2K A;  3O5I A;  2PPO A;  4L72 B;  4DH0 A;  3CHF A;  4KR0 B;  1GPF A;  2FKE A;  3ARQ A;  3NI6 A;  1O6I A;  1E15 A;  2KO7 A;  2M2A A;  1IX5 A;  1X6N A;  2RUR A;  2WLY A;  4IT6 A;  2KGJ A;  2XP6 A;  4IQC A;  4WKH A;  3ART A;  4L3N A;  1UR9 A;  3ARS A;  4TW7 A;  1WNO A;  4XAK A;  4J4N A;  1JNE A;  3O5O A;  1FFQ A;  4ZPT R;  3RM8 A;  2MF9 A;  2KI3 A;  3WL1 A;  3RFW A;  1EQ3 A;  1HJV A;  2XP3 A;  3UQB A;  3O5L A;  1ZBK A;  1JNT A;  1PIN A;  4JFL A;  1D2K A;  4WK9 A;  4JFI A;  2Q5A A;  3B9E A;  2AWG A;  3O5F A;  5DO2 A;  2DSU A;  4LAY A;  2RUQ A;  2PPP A;  1W1V A;  4Q22 A;  4URI A;  2PI6 A;  4HAR A;  4ZS6 A;  1QPF A;  1NWU A;  1T11 A;  1BL4 A;  4ODP A;  3FY1 A;  4MAV A;  1J4I A;  2MLX A;  4DRK A;  1Q6U A;  5GPG A;  1M5Y A;  3KAG A;  5HWB A;  2O92 A;  4W9P A;  3ARU A;  1F8A B;  1JNS A;  5JH8 A;  1B6C A;  1D6O A;  4ODO A;  4NSB A;  3CGN A;  3WD2 A;  1U79 A;  1CTN A;  5B8I C;  3KAC A;  2PV1 A;  3B9A A;  4TX0 A;  3ARX A;  4C02 B;  3AS2 A;  3EY6 A;  2O9O A;  3IK8 A;  3OA5 A;  3O5P A;  4IPX A;  1OGG A;  1EYM A;  2LGO A;  4QIB A;  3ARV A;  2F4E A;  1W9P A;  1LL6 A;  2ZR5 A;  3AS1 A;  3O5Q A;  2OFN A;  4P8U A;  2MLZ A;  1ZL1 A;  4JFK A;  3G6M A;  2DG9 A;  1J4R A;  1ZBW A;  3H9R B;  4DRP A;  3ARW A;  1A7X A;  3CHC A;  3WQV A;  4AY1 A;  3GPK A;  4P8W A;  3CHE A;  3UQA A;  4DWS C;  5HUA A;  4GGQ A;  3ARZ A;  2RUC A;  3AS0 A;  4ODN A;  4LAV A;  4N19 A;  3RM4 A;  1KFW A;  4U85 A;  1NSG A;  2MLY A;  1ZK6 A;  3VAW A;  3PRD A;  1KT1 A;  1HKK A;  4TYO A;  3TCZ A;  2FAP A;  1LG1 A;  1FKT A;  1ZU8 A;  4WKA A;  3RM9 A;  2WK2 A;  2RQS A;  5HT1 A;  3UI5 A;  3WD0 A;  2PV2 A;  1TCO C;  1WAW A;  4ZPV R;  1GUV A;  1JND A;  2PBC A;  1FKF A;  1D7I A;  1E6P A;  4J4O A;  5HWC A;  3UQI A;  5HW6 A;  2L2S A;  1RD6 A;  4ODK A;  4TW6 A;  1W9U A;  1HJW A;  1Y0O A;  3O5M A;  1NWR A;  5DIT A;  1FKI A;  2A3E A;  1QZ2 A;  2XP8 A;  4QT3 A;  4R0X A;  1N1A A;  1NMW A;  1E6Z A;  3WD1 A;  4P8X A;  1HXV A;  1H0I A;  3WKZ A;  3ARO A;  1ITX A;  3WH0 A;  4Z2L A;  1LL4 A;  1EIB A;  2MPH A;  2RUD A;  2OLH A;  1FKH A;  1W1P A;  3PA7 A;  4ODL A;  3KAB A;  1WB0 A;  2RSE A;  1BKF A;  3KZ7 A;  3ARP A;  2G41 A;  4DWS A;  2ZQV A;  4JFJ A;  5HW7 A;  4R5E A;  4S3K A;  3KAD A;  4DIP A;  2LKN A;  4MNJ A;  2ESC A;  1X6L A;  3B7X A;  2XPB A;  2DT3 A;  4G50 A;  2WLZ A;  4G2P A;  3TDB A;  1SYT A;  3CH9 A;  1W26 A;  4WIW A;  4TNS A;  1HKM A;  1J6Y A;  1KT0 A;  3IHZ A;  3KAI A;  2YBT A;  1K9T A;  3LUO A;  3WD3 A;  1FKG A;  4DWS D;  3UI6 A;  1FAP A;  3AQU A;  1OWQ A;  1JVW A;  4LAW A;  2F21 A;  5GPR A;  3CHD A;  3CZ8 A;  4U86 A;  2Y78 A;  4W9O A;  4IT4 A;  5DIV A;  3O5K A;  4WJX A;  2VN1 A;  1NWS A;  5D75 A;  1EHN A;  2QF8 A;  2XP5 A;  1ROT A;  1NWT A;  2DSZ A;  4DZ2 A;  1ZBV A;  1HKI A;  1FKK A;  1FKJ A;  2G8Z A;  3O5R A;  3ARR A;  3ARY A;  4NNR A;  2M1I A;  4W5U A;  3G6L A;  3KCE A;  1HKJ A;  5HW8 A;  5DEZ A;  3JYM A;  2DT1 A;  2DT0 A;  4Z2J A;  2XP4 A;  3WIJ A;  2B31 A;  3MDY B;  1XRV A;  4MNL A;  5J6E A;  1FKD A;  1UR8 A;  4JYS A;  2AOS A;  3UF8 A;  4DRO A;  1H0G A;  2YBU A;  2ZQS A;  2WM0 A;  4HBE A;  5BXJ A;  2LPV A;  4S3J A;  4ODR A;  3JYJ A;  2D9F A;  3KAF A;  1E9L A;  3WQW A;  1LQ0 A;  3IKD A;  1Q6H A;  3ALF A;  3OOB A;  3B8S A;  2K8I A;  2ZR4 A;  1QPL A;  5HTG A;  4BF8 A;  2XP7 A;  2DSW A;  1Q1C A;  4KQZ A;  2A3B A;  3JXV A;  3TC5 A;  4FAP A;  2FDM A;  4QZV B;  1VF8 A;  1NH6 A;  5HKG A;  1W1Y A;  2ZR6 A;  4Z2I A;  1C9H A;  2PPN A;  4DRJ A;  3UI4 A;  3O5J A;  2DPE A;  4QT2 A;  2JZV A;  2IF4 A;  4GIV A;  1YAT A;  4LGX A;  2ZQT A;  4DRH A;  3B9D A;  2A3A A;  4W9Q A;  2ZQU A;  4ODM A;  2UZ5 A;  2DG4 A;  3WL0 A;  4DT4 A;  4MTV A;  4DRN A;  4JFM A;  4WKF A;  4ODQ A;  1SR0 A;  4MGV A;  2MNT A;  2F2D A;  3O5D A;  1FKS A;  4MSP A;  2XPA A;  5HBF A;  1LG2 A;  1YW5 A;  3FXY A;  2XP9 A;  4O2T A;  2M08 A;  2PV3 A;  4LAX A;  3O5E A;  1FKB A;  2DG3 A;  5GQB A;  1FFR A;  3FAP A;  4DRQ A;  1ZCN A;  1ROU A;  2IUZ A;  2A3C A;  4Q7N A;  1E6R A;  3ODK A;  1GOI A;  1PBK A;  1P5Q A;  1FD9 A;  1J4H A;  5DIU A;  1XHG A;  3RME A;  4ZPW R;  4PTM A;  1Q6I A;  3I6C A;  2N87 A;  3CGM A;  2DT2 A;  1LJY A;  1D7J A;  2LJ4 A;  1OGB A;  3AS3 A;  2KFW A;  1FJD A;  1FKL A;  5DF0 A;  2DSV A;  4HBO A;  4MPK A;  3IKG A;  5I98 A;  3O5G A;  1ZBC A;  4NZC A;  4Z2G A;  3PRA A;  4IQ2 A;  2KR7 A;  1W1T A;  4TW8 A;  4ML4 A;  4DRI A;  4Z2H A;  4P8V A;  2ITK A;  4MNK A;  3BXW A;  3RGC A;  1ZB5 A;  1LL7 A;  1F40 A;  1D7H A;  2VCD A;  3ALG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...