3KZ7A

C-terminal domain of murine fkbp25 rapamycin complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
EGPPKYTKSILKKGDKTNFPKKGDVVHCWYTGTLPDGTVFDTNIQTSSKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNTKLIFEVELVDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversified targets of FKBP25 and its complex with rapamycin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Isomerase/inhibitor
molecule keywords FK506-binding protein 3
total genus 25
structure length 119
sequence length 119
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kz7A00
1T11A 2KI3A 4JYSA 3O5QA 2ZQUA 1NSGA 4ODNA 2F4EA 2XP3A 2DG4A 4U86A 4IQ2A 4DROA 2VCDA 2RUQA 4DRQA 1FKTA 3UI4A 1FKSA 2UZ5A 3O5RA 1ZK6A 2F2DA 3NTPA 4TYOA 1FKDA 4MSPA 2DG9A 4U84A 3CGMA 1BL4A 1QPFA 2AWGA 1FKGA 1P5QA 2LJ4A 3KAIA 2MPHA 2PPPA 5I98A 1TCOC 2FAPA 2ITKA 2XP5A 4GIVA 1PBKA 3O5GA 4JFIA 2RUDA 1ROTA 2JZVA 1BKFA 2KE0A 2KGJA 4N19A 4NNRA 3TC5A 2PPNA 2RSEA 3EY6A 5HUAA 5HTGA 2M08A 1D7JA 4JFLA 4MGVA 2PV3A 3IKGA 2MF9A 3O5OA 3O5JA 4DRHA 4ODQA 1Y0OA 1NMVA 4LAWA 4DRNA 4QIBA 1D7IA 4DH0A 1FKLA 3PRDA 4DIPA 4TW7A 1FKBA 1Q1CA 3KAFA 2OFNA 2ZQSA 1J4IA 2MLZA 1FKIA 2ZR4A 4TW6A 4W9PA 4TNSA 3OOBA 3KADA 3KAGA 3FAPA 1NMWA 4ODMA 1KT0A 3UQIA 4ODKA 2XP7A 5DITA 4DRJA 2XP9A 2PPOA 3GPKA 2LKNA 5GPGA 1U79A 2D9FA 2M1IA 1FKKA 4JFJA 5HW8A 1JNSA 4TX0A 3NI6A 4LAYA 5HKGA 2ZQVA 1A7XA 2KR7A 5HT1A 1FKRA 3WH0A 5HWBA 2RUCA 5HW7A 2M2AA 2XP4A 2MLYA 4G50A 4J4OA 5D75A 3NRKA 3UF8A 4DRKA 2K8IA 2MLXA 4DRIA 1FAPA 1EYMA 4JFMA 1FJDA 1M5YA 2RQSA 2DG3A 3UI6A 4ODLA 4ODOA 1FD9A 3O5IA 1R9HA 4DZ2A 1KT1A 1J6YA 4BF8A 2N87A 5J6EA 1J4RA 4IPXA 1F8AB 3H9RB 2LGOA 3RGCA 1W26A 4O2TA 2ZQTA 3O5KA 3TDBA 4DZ3A 2ZR6A 3KACA 1JNTA 1Q6IA 2KO7A 3B7XA 3IK8A 3IKDA 1ROUA 3VAWA 1Q6HA 5B8IC 1HXVA 1EQ3A 3JYJA 1ZCNA 3O5EA 2PBCA 4DT4A 1FKHA 2L2SA 1Q6UA 4FN2A 1B6CA 4QT2A 4DRPA 5DIVA 2LPVA 4IQCA 4J4NA 3PRBA 4W9QA 2VN1A 1YATA 2XP8A 4FAPA 5BXJA 3O5LA 3UQBA 3KCEA 3LUOA 3TCZA 4C02B 4DRMA 2XPBA 4ODPA 3JYMA 4QT3A 3O5FA 3RFWA 3ODKA 2MNTA 2KFWA 1JVWA 3O5DA 4TW8A 1D6OA 2PV1A 2RURA 5DIUA 5HW6A 5HWCA 3UQAA 1F40A 4ODRA 3IHZA 4GGQA 4U85A 4R0XA 1QPLA 1FKJA 4G2PA 3CGNA 1J4HA 3O5PA 3UI5A 3JXVA 1N1AA 2ZR5A 1YW5A 4LAXA 3KZ7A 1C9HA 1FKFA 2Q5AA 2XP6A 1PINA 3MDYB 3O5MA 4LAVA 1D7HA 2IF4A 3I6CA 1QZ2A 3KABA 3PA7A 2F21A 4JFKA 4ITZA 4W9OA 1L1PA 2XPAA 2FKEA 3KAHA 2PV2A 2Y78A
chains in the Genus database with same CATH superfamily
1W1YA 2YBTA 1GUVA 2ZQUA 4ODNA 1E6ZA 3ALGA 4P8UA 1K9TA 1SR0A 2RUQA 4DRQA 1FKTA 2G8ZA 4NZCA 3O5RA 2F2DA 3NTPA 2DG9A 1P5QA 2LJ4A 3B9AA 2MPHA 3KAIA 1TCOC 3WQVA 1X6LA 5GQBA 4W5UA 2RUDA 2AOSA 2JZVA 1BKFA 1HJXA 4NNRA 4P8WA 2PV3A 2WLZA 4IT4A 4LAWA 4WKFA 4DH0A 4DIPA 1FKBA 3ALFA 2OFNA 1W9VA 2ZQSA 4TW6A 1XHGA 2EULA 3CH9A 4PTMA 1GRJA 3UQIA 5I98A 4ODKA 3WQWA 4DRJA 4XAKA 2XP9A 3GTYX 2LKNA 5GPGA 2D9FA 1JNSA 4TX0A 3NI6A 1FKRA 5HWBA 2XP4A 5D75A 4R5EA 4DRIA 1FJDA 1FFRA 3O5IA 1R9HA 1J6YA 1UR8A 1H0GA 1D2KA 2QF8A 1F8AB 3G6LA 3RGCA 3WD4A 1W26A 4KR0B 4Q7NA 4DZ3A 2ZR6A 3CZ8A 3VAWA 4L3NA 3IKDA 1EQ3A 1ZCNA 4DT4A 1NWSA 4ZPVR 4FN2A 5DIVA 3CHCA 2F23A 4J4NA 3PRBA 2VN1A 2XP8A 1ZBKA 1EIBA 4C02B 1ITXA 2RURA 3PR9A 4ODRA 4GGQA 1FKJA 4G2PA 2P4VA 3WD3A 1HKKA 3ARYA 2XP6A 4Z2IA 3PA7A 2PV2A 4JYSA 5GPRA 3O5QA 2DT0A 2OLHA 2XP3A 1NWTA 3G6MA 3ARUA 4IQ2A 4DROA 2VCDA 2DPEA 1FKSA 4MNMA 4TYOA 4KQZA 4MPKA 1FKDA 1FKGA 4S3JA 2ITKA 2ETNA 1PBKA 2O92A 3O5GA 4JFIA 2KE0A 4N19A 1HKMA 2PN0A 2RSEA 2A3BA 3RM9A 3OA5A 5HTGA 2O9OA 4NSBA 4DRHA 1LG2A 1NMVA 4DRNA 1D7IA 3PRDA 3KAFA 2MLZA 1LG1A 1FFQA 3OOBA 3KADA 3KAGA 1GOIA 1NMWA 5DITA 1OGGA 1W1TA 2M1IA 4JFJA 3ARVA 4LAYA 4HBEA 2M2AA 1OWQA 2K8IA 2MLXA 1LL4A 3ARPA 4JFMA 1M5YA 3AROA 1NH6A 3ARWA 1KT1A 4HBOA 3WL1A 4IPXA 2DSZA 3WD2A 3CHFA 1HJVA 3B9DA 3WL0A 3KACA 1Q6IA 3IK8A 3FXYA 5B8IC 1UR9A 3JYJA 1FKHA 1CTNA 4Q22A 1ZBVA 4IQCA 1E44A 4W9QA 4ZS6A 1YATA 4URIA 2XPBA 5JH8A 1X6NA 1WAWA 4QT3A 3RFWA 2MNTA 2KFWA 3O5DA 4TW8A 3WIJA 3BMBA 3W4RA 5HW6A 5HWCA 3UQAA 3RM4A 3IHZA 3CGNA 1J4HA 3O5PA 2WLYA 3JXVA 1N1AA 4LAXA 4LGXA 3KZ7A 1D7HA 1JNEA 1QZ2A 1L1PA 2FKEA 3KAHA 5DEZA 1T11A 2KI3A 2DT3A 4Z2LA 3AS3A 1KFWA 1NSGA 4Z2GA 2F4EA 5HBFA 2DG4A 2UZ5A 1ZK6A 2DSUA 4MSPA 4U84A 1E9LA 1QPFA 1WNOA 2DT1A 3AS0A 1ROTA 4Z2HA 4MNLA 2M08A 4JFLA 3IKGA 2MF9A 1WB0A 3O5JA 2A3EA 4QIBA 1RD6A 1E6RA 2ZR4A 4ZPWR 3B8SA 4TNSA 4Z2JA 2XP7A 3RM8A 3GPKA 1U79A 5HW8A 1ZBCA 2DSVA 1TFVA 2ZQVA 1A7XA 2KR7A 2RUCA 5HW7A 2MLYA 4G50A 3NRKA 3UF8A 4DRKA 1FAPA 1EYMA 4ML4A 3UI6A 4ODLA 1LL6A 1FD9A 4P8VA 4DZ2A 4BF8A 5J6EA 4L72B 1J4RA 3H9RB 3WD1A 4O2TA 2ZQTA 3TDBA 1JNTA 3B7XA 3RMEA 1HXVA 1ROUA 2A3AA 1Q6HA 4DWSC 4DWSD 4MAVA 2L2SA 4IT6A 4QT2A 1E15A 3FY1A 5BXJA 3O5LA 3LUOA 4DRMA 3GU0A 3BXWA 4ODPA 3JYMA 1NWRA 1JVWA 3AQUA 1O6IA 1D6OA 2PV1A 4Z2KA 1NWUA 2G41A 1H0IA 4U85A 3ARQA 1QPLA 4R0XA 3UI5A 2ZR5A 4MTVA 1FKFA 3MDYB 1PINA 2WK2A 1W9UA 1OGBA 4LAVA 3I6CA 3KABA 4JFKA 4ITZA 4W9OA 1LL7A 1HJWA 2XPAA 3ARZA 2Y78A 4W9PA 1E6PA 1ZB5A 3AS1A 1LQ0A 1ZL1A 4U86A 1JNDA 1ZBWA 3UI4A 2DT2A 4AY1A 3CGMA 1BL4A 2AWGA 2PPPA 2FAPA 2XP5A 1W9PA 4GIVA 1EHNA 2KGJA 3TC5A 2YBUA 1IX5A 2PPNA 3EY6A 5HUAA 1D7JA 4MGVA 3EIPA 3O5OA 1XRVA 4ODQA 1Y0OA 1FKLA 4TW7A 1Q1CA 1J4IA 1W1PA 1FKIA 4MNJA 4P8XA 3FAPA 2A3CA 4ODMA 2PI6A 1KT0A 1E6NA 2PPOA 1FKKA 4DWSA 5HKGA 5HT1A 3WH0A 4J4OA 1VF8A 4UDMA 2B31A 2IUZA 2RQSA 3ARTA 4HARA 2DG3A 4QZVB 2B5UB 4ODOA 4WJXA 1JCHB 2N87A 3ARRA 3ARXA 5DO2A 4WKAA 4ZPTR 1LJYA 5DF0A 2DSWA 4S3KA 2LGOA 4MNKA 1ZU8A 3O5KA 2FDMA 2KO7A 3ARSA 3CHEA 3WD0A 3O5EA 2PBCA 3WKZA 1Q6UA 1B6CA 4DRPA 2LPVA 4FAPA 3AS2A 3UQBA 3KCEA 3TCZA 1HKIA 1W1VA 3O5FA 3ODKA 5DIUA 4WK9A 3B9EA 1F40A 1SYTA 3PRAA 2WM0A 1YW5A 4WKHA 1C9HA 4DWSB 2Q5AA 1EDQA 3O5MA 3QOKA 1GPFA 2IF4A 2F21A 2ESCA 3CHDA 1HKJA 4WIWA
chains in the Genus database with same CATH topology
1W1YA 2YBTA 1GUVA 2ZQUA 4ODNA 1E6ZA 3ALGA 4P8UA 1K9TA 1SR0A 2RUQA 4DRQA 1FKTA 2G8ZA 4NZCA 3O5RA 2F2DA 3NTPA 2DG9A 1P5QA 2LJ4A 3B9AA 2MPHA 3KAIA 1TCOC 3WQVA 1X6LA 5GQBA 4W5UA 2RUDA 2AOSA 2JZVA 1BKFA 1HJXA 4NNRA 4P8WA 2PV3A 2WLZA 4IT4A 4LAWA 4WKFA 4DH0A 4DIPA 1FKBA 3ALFA 2OFNA 1W9VA 2ZQSA 4TW6A 1XHGA 3CH9A 4PTMA 3UQIA 5I98A 4ODKA 3WQWA 4DRJA 4XAKA 2XP9A 5GPGA 2LKNA 2D9FA 1JNSA 4TX0A 3NI6A 1FKRA 5HWBA 2XP4A 5D75A 4R5EA 4DRIA 1FJDA 1FFRA 3O5IA 1R9HA 1J6YA 1UR8A 1H0GA 1D2KA 2QF8A 1F8AB 3G6LA 3RGCA 3WD4A 1W26A 4KR0B 4Q7NA 4DZ3A 2ZR6A 3CZ8A 3VAWA 4L3NA 3IKDA 1EQ3A 1ZCNA 4DT4A 1NWSA 4ZPVR 4FN2A 5DIVA 3CHCA 4J4NA 3PRBA 2VN1A 2XP8A 1ZBKA 1EIBA 4C02B 1ITXA 2RURA 3PR9A 4ODRA 4GGQA 1FKJA 4G2PA 3WD3A 1HKKA 3ARYA 2XP6A 4Z2IA 3PA7A 2PV2A 4JYSA 5GPRA 3O5QA 2DT0A 2OLHA 2XP3A 1NWTA 3G6MA 3ARUA 4IQ2A 4DROA 2VCDA 2DPEA 1FKSA 4MNMA 4TYOA 4KQZA 4MPKA 1FKDA 1FKGA 4S3JA 2ITKA 1PBKA 2O92A 3O5GA 4JFIA 2KE0A 4N19A 1HKMA 2RSEA 2A3BA 3RM9A 3OA5A 5HTGA 2O9OA 4NSBA 4DRHA 1LG2A 1NMVA 4DRNA 1D7IA 3PRDA 3KAFA 2MLZA 1LG1A 1FFQA 3OOBA 3KADA 3KAGA 1GOIA 1NMWA 5DITA 1OGGA 1W1TA 2M1IA 4JFJA 3ARVA 4LAYA 4HBEA 2M2AA 1OWQA 2K8IA 2MLXA 1LL4A 3ARPA 4JFMA 1M5YA 3AROA 1NH6A 3ARWA 1KT1A 4HBOA 3WL1A 4IPXA 2DSZA 3WD2A 3CHFA 1HJVA 3B9DA 3WL0A 3KACA 1Q6IA 3IK8A 3FXYA 5B8IC 1UR9A 3JYJA 1FKHA 1CTNA 4Q22A 1ZBVA 4IQCA 4W9QA 4ZS6A 1YATA 4URIA 2XPBA 5JH8A 1X6NA 1WAWA 4QT3A 3RFWA 2MNTA 2KFWA 3O5DA 4TW8A 3WIJA 3W4RA 5HW6A 5HWCA 3UQAA 3RM4A 3IHZA 3CGNA 1J4HA 3O5PA 2WLYA 3JXVA 1N1AA 4LAXA 4LGXA 3KZ7A 1D7HA 1JNEA 1QZ2A 1L1PA 2FKEA 3KAHA 5DEZA 1T11A 2KI3A 2DT3A 4Z2LA 3AS3A 1KFWA 1NSGA 4Z2GA 2F4EA 5HBFA 2DG4A 2UZ5A 1ZK6A 2DSUA 4MSPA 4U84A 1E9LA 1QPFA 1WNOA 2DT1A 3AS0A 1ROTA 4Z2HA 4MNLA 2M08A 4JFLA 3IKGA 2MF9A 1WB0A 3O5JA 2A3EA 4QIBA 1RD6A 1E6RA 2ZR4A 4ZPWR 3B8SA 4TNSA 4Z2JA 2XP7A 3RM8A 3GPKA 1U79A 5HW8A 1ZBCA 2DSVA 1TFVA 2ZQVA 1A7XA 2KR7A 2RUCA 5HW7A 2MLYA 4G50A 3NRKA 3UF8A 4DRKA 1FAPA 1EYMA 4ML4A 3UI6A 4ODLA 1LL6A 1FD9A 4P8VA 4DZ2A 4BF8A 5J6EA 4L72B 1J4RA 3H9RB 3WD1A 4O2TA 2ZQTA 3TDBA 1JNTA 3B7XA 3RMEA 1HXVA 1ROUA 2A3AA 1Q6HA 4DWSC 4DWSD 4MAVA 2L2SA 4IT6A 4QT2A 1E15A 3FY1A 5BXJA 3O5LA 3LUOA 4DRMA 3BXWA 4ODPA 3JYMA 1NWRA 1JVWA 3AQUA 1O6IA 1D6OA 2PV1A 4Z2KA 1NWUA 2G41A 1H0IA 4U85A 3ARQA 1QPLA 4R0XA 3UI5A 2ZR5A 4MTVA 1FKFA 3MDYB 1PINA 2WK2A 1W9UA 1OGBA 4LAVA 3I6CA 3KABA 4JFKA 4ITZA 4W9OA 1LL7A 1HJWA 2XPAA 3ARZA 2Y78A 4W9PA 1E6PA 1ZB5A 3AS1A 1LQ0A 1ZL1A 4U86A 1JNDA 1ZBWA 3UI4A 2DT2A 4AY1A 3CGMA 1BL4A 2AWGA 2PPPA 2FAPA 2XP5A 1W9PA 4GIVA 1EHNA 2KGJA 3TC5A 2YBUA 1IX5A 2PPNA 3EY6A 5HUAA 1D7JA 4MGVA 3O5OA 1XRVA 4ODQA 1Y0OA 1FKLA 4TW7A 1Q1CA 1J4IA 1W1PA 1FKIA 4MNJA 4P8XA 3FAPA 2A3CA 4ODMA 2PI6A 1KT0A 1E6NA 2PPOA 1FKKA 4DWSA 5HKGA 5HT1A 3WH0A 4J4OA 1VF8A 2B31A 2IUZA 2RQSA 3ARTA 4HARA 2DG3A 4QZVB 4ODOA 4WJXA 2N87A 3ARRA 3ARXA 5DO2A 4WKAA 4ZPTR 1LJYA 5DF0A 2DSWA 4S3KA 2LGOA 4MNKA 1ZU8A 3O5KA 2FDMA 2KO7A 3ARSA 3CHEA 3WD0A 3O5EA 2PBCA 3WKZA 1Q6UA 1B6CA 4DRPA 2LPVA 4FAPA 3AS2A 3UQBA 3KCEA 3TCZA 1HKIA 1W1VA 3O5FA 3ODKA 5DIUA 4WK9A 3B9EA 1F40A 1SYTA 3PRAA 2WM0A 1YW5A 4WKHA 1C9HA 4DWSB 2Q5AA 1EDQA 3O5MA 3QOKA 1GPFA 2IF4A 2F21A 2ESCA 3CHDA 1HKJA 4WIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T11 A;  2KI3 A;  4JYS A;  3O5Q A;  2ZQU A;  1NSG A;  4ODN A;  2F4E A;  2XP3 A;  2DG4 A;  4U86 A;  4IQ2 A;  4DRO A;  2VCD A;  2RUQ A;  4DRQ A;  1FKT A;  3UI4 A;  1FKS A;  2UZ5 A;  3O5R A;  1ZK6 A;  2F2D A;  3NTP A;  4TYO A;  1FKD A;  4MSP A;  2DG9 A;  4U84 A;  3CGM A;  1BL4 A;  1QPF A;  2AWG A;  1FKG A;  1P5Q A;  2LJ4 A;  3KAI A;  2MPH A;  2PPP A;  5I98 A;  1TCO C;  2FAP A;  2ITK A;  2XP5 A;  4GIV A;  1PBK A;  3O5G A;  4JFI A;  2RUD A;  1ROT A;  2JZV A;  1BKF A;  2KE0 A;  2KGJ A;  4N19 A;  4NNR A;  3TC5 A;  2PPN A;  2RSE A;  3EY6 A;  5HUA A;  5HTG A;  2M08 A;  1D7J A;  4JFL A;  4MGV A;  2PV3 A;  3IKG A;  2MF9 A;  3O5O A;  3O5J A;  4DRH A;  4ODQ A;  1Y0O A;  1NMV A;  4LAW A;  4DRN A;  4QIB A;  1D7I A;  4DH0 A;  1FKL A;  3PRD A;  4DIP A;  4TW7 A;  1FKB A;  1Q1C A;  3KAF A;  2OFN A;  2ZQS A;  1J4I A;  2MLZ A;  1FKI A;  2ZR4 A;  4TW6 A;  4W9P A;  4TNS A;  3OOB A;  3KAD A;  3KAG A;  3FAP A;  1NMW A;  4ODM A;  1KT0 A;  3UQI A;  4ODK A;  2XP7 A;  5DIT A;  4DRJ A;  2XP9 A;  2PPO A;  3GPK A;  2LKN A;  5GPG A;  1U79 A;  2D9F A;  2M1I A;  1FKK A;  4JFJ A;  5HW8 A;  1JNS A;  4TX0 A;  3NI6 A;  4LAY A;  5HKG A;  2ZQV A;  1A7X A;  2KR7 A;  5HT1 A;  1FKR A;  3WH0 A;  5HWB A;  2RUC A;  5HW7 A;  2M2A A;  2XP4 A;  2MLY A;  4G50 A;  4J4O A;  5D75 A;  3NRK A;  3UF8 A;  4DRK A;  2K8I A;  2MLX A;  4DRI A;  1FAP A;  1EYM A;  4JFM A;  1FJD A;  1M5Y A;  2RQS A;  2DG3 A;  3UI6 A;  4ODL A;  4ODO A;  1FD9 A;  3O5I A;  1R9H A;  4DZ2 A;  1KT1 A;  1J6Y A;  4BF8 A;  2N87 A;  5J6E A;  1J4R A;  4IPX A;  1F8A B;  3H9R B;  2LGO A;  3RGC A;  1W26 A;  4O2T A;  2ZQT A;  3O5K A;  3TDB A;  4DZ3 A;  2ZR6 A;  3KAC A;  1JNT A;  1Q6I A;  2KO7 A;  3B7X A;  3IK8 A;  3IKD A;  1ROU A;  3VAW A;  1Q6H A;  5B8I C;  1HXV A;  1EQ3 A;  3JYJ A;  1ZCN A;  3O5E A;  2PBC A;  4DT4 A;  1FKH A;  2L2S A;  1Q6U A;  4FN2 A;  1B6C A;  4QT2 A;  4DRP A;  5DIV A;  2LPV A;  4IQC A;  4J4N A;  3PRB A;  4W9Q A;  2VN1 A;  1YAT A;  2XP8 A;  4FAP A;  5BXJ A;  3O5L A;  3UQB A;  3KCE A;  3LUO A;  3TCZ A;  4C02 B;  4DRM A;  2XPB A;  4ODP A;  3JYM A;  4QT3 A;  3O5F A;  3RFW A;  3ODK A;  2MNT A;  2KFW A;  1JVW A;  3O5D A;  4TW8 A;  1D6O A;  2PV1 A;  2RUR A;  5DIU A;  5HW6 A;  5HWC A;  3UQA A;  1F40 A;  4ODR A;  3IHZ A;  4GGQ A;  4U85 A;  4R0X A;  1QPL A;  1FKJ A;  4G2P A;  3CGN A;  1J4H A;  3O5P A;  3UI5 A;  3JXV A;  1N1A A;  2ZR5 A;  1YW5 A;  4LAX A;  3KZ7 A;  1C9H A;  1FKF A;  2Q5A A;  2XP6 A;  1PIN A;  3MDY B;  3O5M A;  4LAV A;  1D7H A;  2IF4 A;  3I6C A;  1QZ2 A;  3KAB A;  3PA7 A;  2F21 A;  4JFK A;  4ITZ A;  4W9O A;  1L1P A;  2XPA A;  2FKE A;  3KAH A;  2PV2 A;  2Y78 A; 
#chains in the Genus database with same CATH topology
 1W1Y A;  2YBT A;  1GUV A;  2ZQU A;  4ODN A;  1E6Z A;  3ALG A;  4P8U A;  1K9T A;  1SR0 A;  2RUQ A;  4DRQ A;  1FKT A;  2G8Z A;  4NZC A;  3O5R A;  2F2D A;  3NTP A;  2DG9 A;  1P5Q A;  2LJ4 A;  3B9A A;  2MPH A;  3KAI A;  1TCO C;  3WQV A;  1X6L A;  5GQB A;  4W5U A;  2RUD A;  2AOS A;  2JZV A;  1BKF A;  1HJX A;  4NNR A;  4P8W A;  2PV3 A;  2WLZ A;  4IT4 A;  4LAW A;  4WKF A;  4DH0 A;  4DIP A;  1FKB A;  3ALF A;  2OFN A;  1W9V A;  2ZQS A;  4TW6 A;  1XHG A;  2EUL A;  3CH9 A;  4PTM A;  1GRJ A;  3UQI A;  5I98 A;  4ODK A;  3WQW A;  4DRJ A;  4XAK A;  2XP9 A;  3GTY X;  2LKN A;  5GPG A;  2D9F A;  1JNS A;  4TX0 A;  3NI6 A;  1FKR A;  5HWB A;  2XP4 A;  5D75 A;  4R5E A;  4DRI A;  1FJD A;  1FFR A;  3O5I A;  1R9H A;  1J6Y A;  1UR8 A;  1H0G A;  1D2K A;  2QF8 A;  1F8A B;  3G6L A;  3RGC A;  3WD4 A;  1W26 A;  4KR0 B;  4Q7N A;  4DZ3 A;  2ZR6 A;  3CZ8 A;  3VAW A;  4L3N A;  3IKD A;  1EQ3 A;  1ZCN A;  4DT4 A;  1NWS A;  4ZPV R;  4FN2 A;  5DIV A;  3CHC A;  2F23 A;  4J4N A;  3PRB A;  2VN1 A;  2XP8 A;  1ZBK A;  1EIB A;  4C02 B;  1ITX A;  2RUR A;  3PR9 A;  4ODR A;  4GGQ A;  1FKJ A;  4G2P A;  2P4V A;  3WD3 A;  1HKK A;  3ARY A;  2XP6 A;  4Z2I A;  3PA7 A;  2PV2 A;  4JYS A;  5GPR A;  3O5Q A;  2DT0 A;  2OLH A;  2XP3 A;  1NWT A;  3G6M A;  3ARU A;  4IQ2 A;  4DRO A;  2VCD A;  2DPE A;  1FKS A;  4MNM A;  4TYO A;  4KQZ A;  4MPK A;  1FKD A;  1FKG A;  4S3J A;  2ITK A;  2ETN A;  1PBK A;  2O92 A;  3O5G A;  4JFI A;  2KE0 A;  4N19 A;  1HKM A;  2PN0 A;  2RSE A;  2A3B A;  3RM9 A;  3OA5 A;  5HTG A;  2O9O A;  4NSB A;  4DRH A;  1LG2 A;  1NMV A;  4DRN A;  1D7I A;  3PRD A;  3KAF A;  2MLZ A;  1LG1 A;  1FFQ A;  3OOB A;  3KAD A;  3KAG A;  1GOI A;  1NMW A;  5DIT A;  1OGG A;  1W1T A;  2M1I A;  4JFJ A;  3ARV A;  4LAY A;  4HBE A;  2M2A A;  1OWQ A;  2K8I A;  2MLX A;  1LL4 A;  3ARP A;  4JFM A;  1M5Y A;  3ARO A;  1NH6 A;  3ARW A;  1KT1 A;  4HBO A;  3WL1 A;  4IPX A;  2DSZ A;  3WD2 A;  3CHF A;  1HJV A;  3B9D A;  3WL0 A;  3KAC A;  1Q6I A;  3IK8 A;  3FXY A;  5B8I C;  1UR9 A;  3JYJ A;  1FKH A;  1CTN A;  4Q22 A;  1ZBV A;  4IQC A;  1E44 A;  4W9Q A;  4ZS6 A;  1YAT A;  4URI A;  2XPB A;  5JH8 A;  1X6N A;  1WAW A;  4QT3 A;  3RFW A;  2MNT A;  2KFW A;  3O5D A;  4TW8 A;  3WIJ A;  3BMB A;  3W4R A;  5HW6 A;  5HWC A;  3UQA A;  3RM4 A;  3IHZ A;  3CGN A;  1J4H A;  3O5P A;  2WLY A;  3JXV A;  1N1A A;  4LAX A;  4LGX A;  3KZ7 A;  1D7H A;  1JNE A;  1QZ2 A;  1L1P A;  2FKE A;  3KAH A;  5DEZ A;  1T11 A;  2KI3 A;  2DT3 A;  4Z2L A;  3AS3 A;  1KFW A;  1NSG A;  4Z2G A;  2F4E A;  5HBF A;  2DG4 A;  2UZ5 A;  1ZK6 A;  2DSU A;  4MSP A;  4U84 A;  1E9L A;  1QPF A;  1WNO A;  2DT1 A;  3AS0 A;  1ROT A;  4Z2H A;  4MNL A;  2M08 A;  4JFL A;  3IKG A;  2MF9 A;  1WB0 A;  3O5J A;  2A3E A;  4QIB A;  1RD6 A;  1E6R A;  2ZR4 A;  4ZPW R;  3B8S A;  4TNS A;  4Z2J A;  2XP7 A;  3RM8 A;  3GPK A;  1U79 A;  5HW8 A;  1ZBC A;  2DSV A;  1TFV A;  2ZQV A;  1A7X A;  2KR7 A;  2RUC A;  5HW7 A;  2MLY A;  4G50 A;  3NRK A;  3UF8 A;  4DRK A;  1FAP A;  1EYM A;  4ML4 A;  3UI6 A;  4ODL A;  1LL6 A;  1FD9 A;  4P8V A;  4DZ2 A;  4BF8 A;  5J6E A;  4L72 B;  1J4R A;  3H9R B;  3WD1 A;  4O2T A;  2ZQT A;  3TDB A;  1JNT A;  3B7X A;  3RME A;  1HXV A;  1ROU A;  2A3A A;  1Q6H A;  4DWS C;  4DWS D;  4MAV A;  2L2S A;  4IT6 A;  4QT2 A;  1E15 A;  3FY1 A;  5BXJ A;  3O5L A;  3LUO A;  4DRM A;  3GU0 A;  3BXW A;  4ODP A;  3JYM A;  1NWR A;  1JVW A;  3AQU A;  1O6I A;  1D6O A;  2PV1 A;  4Z2K A;  1NWU A;  2G41 A;  1H0I A;  4U85 A;  3ARQ A;  1QPL A;  4R0X A;  3UI5 A;  2ZR5 A;  4MTV A;  1FKF A;  3MDY B;  1PIN A;  2WK2 A;  1W9U A;  1OGB A;  4LAV A;  3I6C A;  3KAB A;  4JFK A;  4ITZ A;  4W9O A;  1LL7 A;  1HJW A;  2XPA A;  3ARZ A;  2Y78 A;  4W9P A;  1E6P A;  1ZB5 A;  3AS1 A;  1LQ0 A;  1ZL1 A;  4U86 A;  1JND A;  1ZBW A;  3UI4 A;  2DT2 A;  4AY1 A;  3CGM A;  1BL4 A;  2AWG A;  2PPP A;  2FAP A;  2XP5 A;  1W9P A;  4GIV A;  1EHN A;  2KGJ A;  3TC5 A;  2YBU A;  1IX5 A;  2PPN A;  3EY6 A;  5HUA A;  1D7J A;  4MGV A;  3EIP A;  3O5O A;  1XRV A;  4ODQ A;  1Y0O A;  1FKL A;  4TW7 A;  1Q1C A;  1J4I A;  1W1P A;  1FKI A;  4MNJ A;  4P8X A;  3FAP A;  2A3C A;  4ODM A;  2PI6 A;  1KT0 A;  1E6N A;  2PPO A;  1FKK A;  4DWS A;  5HKG A;  5HT1 A;  3WH0 A;  4J4O A;  1VF8 A;  4UDM A;  2B31 A;  2IUZ A;  2RQS A;  3ART A;  4HAR A;  2DG3 A;  4QZV B;  2B5U B;  4ODO A;  4WJX A;  1JCH B;  2N87 A;  3ARR A;  3ARX A;  5DO2 A;  4WKA A;  4ZPT R;  1LJY A;  5DF0 A;  2DSW A;  4S3K A;  2LGO A;  4MNK A;  1ZU8 A;  3O5K A;  2FDM A;  2KO7 A;  3ARS A;  3CHE A;  3WD0 A;  3O5E A;  2PBC A;  3WKZ A;  1Q6U A;  1B6C A;  4DRP A;  2LPV A;  4FAP A;  3AS2 A;  3UQB A;  3KCE A;  3TCZ A;  1HKI A;  1W1V A;  3O5F A;  3ODK A;  5DIU A;  4WK9 A;  3B9E A;  1F40 A;  1SYT A;  3PRA A;  2WM0 A;  1YW5 A;  4WKH A;  1C9H A;  4DWS B;  2Q5A A;  1EDQ A;  3O5M A;  3QOK A;  1GPF A;  2IF4 A;  2F21 A;  2ESC A;  3CHD A;  1HKJ A;  4WIW A; 
#chains in the Genus database with same CATH homology
 1W1Y A;  2YBT A;  1GUV A;  2ZQU A;  4ODN A;  1E6Z A;  3ALG A;  4P8U A;  1K9T A;  1SR0 A;  2RUQ A;  4DRQ A;  1FKT A;  2G8Z A;  4NZC A;  3O5R A;  2F2D A;  3NTP A;  2DG9 A;  1P5Q A;  2LJ4 A;  3B9A A;  2MPH A;  3KAI A;  1TCO C;  3WQV A;  1X6L A;  5GQB A;  4W5U A;  2RUD A;  2AOS A;  2JZV A;  1BKF A;  1HJX A;  4NNR A;  4P8W A;  2PV3 A;  2WLZ A;  4IT4 A;  4LAW A;  4WKF A;  4DH0 A;  4DIP A;  1FKB A;  3ALF A;  2OFN A;  1W9V A;  2ZQS A;  4TW6 A;  1XHG A;  3CH9 A;  4PTM A;  3UQI A;  5I98 A;  4ODK A;  3WQW A;  4DRJ A;  4XAK A;  2XP9 A;  5GPG A;  2LKN A;  2D9F A;  1JNS A;  4TX0 A;  3NI6 A;  1FKR A;  5HWB A;  2XP4 A;  5D75 A;  4R5E A;  4DRI A;  1FJD A;  1FFR A;  3O5I A;  1R9H A;  1J6Y A;  1UR8 A;  1H0G A;  1D2K A;  2QF8 A;  1F8A B;  3G6L A;  3RGC A;  3WD4 A;  1W26 A;  4KR0 B;  4Q7N A;  4DZ3 A;  2ZR6 A;  3CZ8 A;  3VAW A;  4L3N A;  3IKD A;  1EQ3 A;  1ZCN A;  4DT4 A;  1NWS A;  4ZPV R;  4FN2 A;  5DIV A;  3CHC A;  4J4N A;  3PRB A;  2VN1 A;  2XP8 A;  1ZBK A;  1EIB A;  4C02 B;  1ITX A;  2RUR A;  3PR9 A;  4ODR A;  4GGQ A;  1FKJ A;  4G2P A;  3WD3 A;  1HKK A;  3ARY A;  2XP6 A;  4Z2I A;  3PA7 A;  2PV2 A;  4JYS A;  5GPR A;  3O5Q A;  2DT0 A;  2OLH A;  2XP3 A;  1NWT A;  3G6M A;  3ARU A;  4IQ2 A;  4DRO A;  2VCD A;  2DPE A;  1FKS A;  4MNM A;  4TYO A;  4KQZ A;  4MPK A;  1FKD A;  1FKG A;  4S3J A;  2ITK A;  1PBK A;  2O92 A;  3O5G A;  4JFI A;  2KE0 A;  4N19 A;  1HKM A;  2RSE A;  2A3B A;  3RM9 A;  3OA5 A;  5HTG A;  2O9O A;  4NSB A;  4DRH A;  1LG2 A;  1NMV A;  4DRN A;  1D7I A;  3PRD A;  3KAF A;  2MLZ A;  1LG1 A;  1FFQ A;  3OOB A;  3KAD A;  3KAG A;  1GOI A;  1NMW A;  5DIT A;  1OGG A;  1W1T A;  2M1I A;  4JFJ A;  3ARV A;  4LAY A;  4HBE A;  2M2A A;  1OWQ A;  2K8I A;  2MLX A;  1LL4 A;  3ARP A;  4JFM A;  1M5Y A;  3ARO A;  1NH6 A;  3ARW A;  1KT1 A;  4HBO A;  3WL1 A;  4IPX A;  2DSZ A;  3WD2 A;  3CHF A;  1HJV A;  3B9D A;  3WL0 A;  3KAC A;  1Q6I A;  3IK8 A;  3FXY A;  5B8I C;  1UR9 A;  3JYJ A;  1FKH A;  1CTN A;  4Q22 A;  1ZBV A;  4IQC A;  4W9Q A;  4ZS6 A;  1YAT A;  4URI A;  2XPB A;  5JH8 A;  1X6N A;  1WAW A;  4QT3 A;  3RFW A;  2MNT A;  2KFW A;  3O5D A;  4TW8 A;  3WIJ A;  3W4R A;  5HW6 A;  5HWC A;  3UQA A;  3RM4 A;  3IHZ A;  3CGN A;  1J4H A;  3O5P A;  2WLY A;  3JXV A;  1N1A A;  4LAX A;  4LGX A;  3KZ7 A;  1D7H A;  1JNE A;  1QZ2 A;  1L1P A;  2FKE A;  3KAH A;  5DEZ A;  1T11 A;  2KI3 A;  2DT3 A;  4Z2L A;  3AS3 A;  1KFW A;  1NSG A;  4Z2G A;  2F4E A;  5HBF A;  2DG4 A;  2UZ5 A;  1ZK6 A;  2DSU A;  4MSP A;  4U84 A;  1E9L A;  1QPF A;  1WNO A;  2DT1 A;  3AS0 A;  1ROT A;  4Z2H A;  4MNL A;  2M08 A;  4JFL A;  3IKG A;  2MF9 A;  1WB0 A;  3O5J A;  2A3E A;  4QIB A;  1RD6 A;  1E6R A;  2ZR4 A;  4ZPW R;  3B8S A;  4TNS A;  4Z2J A;  2XP7 A;  3RM8 A;  3GPK A;  1U79 A;  5HW8 A;  1ZBC A;  2DSV A;  1TFV A;  2ZQV A;  1A7X A;  2KR7 A;  2RUC A;  5HW7 A;  2MLY A;  4G50 A;  3NRK A;  3UF8 A;  4DRK A;  1FAP A;  1EYM A;  4ML4 A;  3UI6 A;  4ODL A;  1LL6 A;  1FD9 A;  4P8V A;  4DZ2 A;  4BF8 A;  5J6E A;  4L72 B;  1J4R A;  3H9R B;  3WD1 A;  4O2T A;  2ZQT A;  3TDB A;  1JNT A;  3B7X A;  3RME A;  1HXV A;  1ROU A;  2A3A A;  1Q6H A;  4DWS C;  4DWS D;  4MAV A;  2L2S A;  4IT6 A;  4QT2 A;  1E15 A;  3FY1 A;  5BXJ A;  3O5L A;  3LUO A;  4DRM A;  3BXW A;  4ODP A;  3JYM A;  1NWR A;  1JVW A;  3AQU A;  1O6I A;  1D6O A;  2PV1 A;  4Z2K A;  1NWU A;  2G41 A;  1H0I A;  4U85 A;  3ARQ A;  1QPL A;  4R0X A;  3UI5 A;  2ZR5 A;  4MTV A;  1FKF A;  3MDY B;  1PIN A;  2WK2 A;  1W9U A;  1OGB A;  4LAV A;  3I6C A;  3KAB A;  4JFK A;  4ITZ A;  4W9O A;  1LL7 A;  1HJW A;  2XPA A;  3ARZ A;  2Y78 A;  4W9P A;  1E6P A;  1ZB5 A;  3AS1 A;  1LQ0 A;  1ZL1 A;  4U86 A;  1JND A;  1ZBW A;  3UI4 A;  2DT2 A;  4AY1 A;  3CGM A;  1BL4 A;  2AWG A;  2PPP A;  2FAP A;  2XP5 A;  1W9P A;  4GIV A;  1EHN A;  2KGJ A;  3TC5 A;  2YBU A;  1IX5 A;  2PPN A;  3EY6 A;  5HUA A;  1D7J A;  4MGV A;  3O5O A;  1XRV A;  4ODQ A;  1Y0O A;  1FKL A;  4TW7 A;  1Q1C A;  1J4I A;  1W1P A;  1FKI A;  4MNJ A;  4P8X A;  3FAP A;  2A3C A;  4ODM A;  2PI6 A;  1KT0 A;  1E6N A;  2PPO A;  1FKK A;  4DWS A;  5HKG A;  5HT1 A;  3WH0 A;  4J4O A;  1VF8 A;  2B31 A;  2IUZ A;  2RQS A;  3ART A;  4HAR A;  2DG3 A;  4QZV B;  4ODO A;  4WJX A;  2N87 A;  3ARR A;  3ARX A;  5DO2 A;  4WKA A;  4ZPT R;  1LJY A;  5DF0 A;  2DSW A;  4S3K A;  2LGO A;  4MNK A;  1ZU8 A;  3O5K A;  2FDM A;  2KO7 A;  3ARS A;  3CHE A;  3WD0 A;  3O5E A;  2PBC A;  3WKZ A;  1Q6U A;  1B6C A;  4DRP A;  2LPV A;  4FAP A;  3AS2 A;  3UQB A;  3KCE A;  3TCZ A;  1HKI A;  1W1V A;  3O5F A;  3ODK A;  5DIU A;  4WK9 A;  3B9E A;  1F40 A;  1SYT A;  3PRA A;  2WM0 A;  1YW5 A;  4WKH A;  1C9H A;  4DWS B;  2Q5A A;  1EDQ A;  3O5M A;  3QOK A;  1GPF A;  2IF4 A;  2F21 A;  2ESC A;  3CHD A;  1HKJ A;  4WIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...