3KZ7A

C-terminal domain of murine fkbp25 rapamycin complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
b'EGPPKYTKSILKKGDKTNFPKKGDVVHCWYTGTLPDGTVFDTNIQTSSKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNTKLIFEVELVDID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 3
publication title Diversified targets of FKBP25 and its complex with rapamycin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Isomerase/inhibitor
total genus 25
structure length 119
sequence length 119
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kz7A00
1W26A 4DRMA 1QZ2A 3NTPA 1FKIA 3JYMA 1PBKA 1FKFA 2ZQTA 4W9QA 3WH0A 4DZ2A 5J6EA 1D7HA 2LPVA 3H9RB 1J4IA 1FKBA 4GIVA 4J4NA 3VAWA 3KACA 3MDYB 5B8IC 3FAPA 1YATA 3JXVA 4J4OA 2DG4A 4IPXA 4LAXA 4QIBA 1F8AB 3KAIA 2KI3A 4TYOA 3O5PA 2PBCA 3TCZA 3IHZA 1FKKA 2UZ5A 3IKGA 4QT3A 2L2SA 2Q5AA 4G50A 2PPNA 5DIVA 3PA7A 4FN2A 1FAPA 4DRPA 4JFMA 1NSGA 2F21A 3LUOA 4LAYA 2RSEA 4TW8A 4TNSA 3TC5A 5HUAA 2PV3A 5HW7A 2MLYA 2KGJA 1FKGA 2M2AA 4ITZA 4JFJA 3UI6A 4DROA 4MGVA 1D7JA 3O5LA 3O5DA 4NNRA 3NRKA 4TX0A 2F4EA 2KR7A 4JFKA 4DIPA 4W9PA 2FAPA 3O5JA 4DRHA 3CGMA 3OOBA 3O5EA 5DIUA 1FJDA 4U84A 4ODPA 1Y0OA 4DH0A 1TCOC 2ZR6A 1PINA 3IKDA 2XP6A 1FD9A 1F40A 4U86A 2MNTA 4N19A 1FKLA 3RFWA 1ZCNA 1C9HA 4ODRA 1Q1CA 1D7IA 1KT1A 3CGNA 3UI4A 1JNTA 2VN1A 1BL4A 4MSPA 1N1AA 3KABA 2LGOA 2K8IA 1FKDA 3KAFA 3O5IA 4LAWA 5GPGA 2ZQUA 5HWBA 4JYSA 1P5QA 4LAVA 4DRNA 2XP5A 1HXVA 4TW7A 2RUDA 4IQ2A 3O5MA 5HW8A 5DITA 2DG9A 3GPKA 2LKNA 3I6CA 2MLZA 4ODMA 2MPHA 4DRIA 3EY6A 4DRKA 5HKGA 1L1PA 4TW6A 1J4RA 2PV2A 2RUQA 2XP8A 2IF4A 3O5FA 3B7XA 2XP4A 5HW6A 2JZVA 4IQCA 2OFNA 4ODOA 2KE0A 4QT2A 4JFLA 3PRDA 1T11A 2MLXA 3KAHA 5HWCA 2XP7A 3KZ7A 4ODNA 1ZK6A 3O5QA 1Q6UA 1Q6IA 2M1IA 4FAPA 4W9OA 2DG3A 1FKJA 2AWGA 2VCDA 2XP9A 2RQSA 4DZ3A 2KFWA 4G2PA 4O2TA 1B6CA 3ODKA 3O5RA 4ODQA 2XP3A 5HT1A 5HTGA 4ODKA 2N87A 1EYMA 3UI5A 2PPPA 3JYJA 2MF9A 3RGCA 1FKSA 2ZR5A 2XPBA 1NMWA 2M08A 2PV1A 2LJ4A 3TDBA 1KT0A 2F2DA 1JNSA 1FKHA 1YW5A 3KADA 1R9HA 2ZR4A 2ZQVA 2PPOA 3NI6A 4ODLA 2KO7A 4DRQA 5I98A 1J4HA 3O5KA 1ROUA 3UQAA 1ROTA 1Q6HA 2RURA 3KCEA 4GGQA 4R0XA 2RUCA 4DT4A 5BXJA 3UQBA 1D6OA 3O5OA 4BF8A 1FKTA 1NMVA 2D9FA 1A7XA 4JFIA 1FKRA 3KAGA 2ZQSA 1QPFA 3O5GA 1QPLA 3PRBA 1U79A 4C02B 1JVWA 2Y78A 3UQIA 5D75A 1BKFA 2FKEA 2ITKA 1M5YA 2XPAA 4U85A 3UF8A 4DRJA 1J6YA 1EQ3A 3IK8A
chains in the Genus database with same CATH superfamily
1W26A 1EHNA 1LL4A 3B9AA 4NSBA 1NWSA 3WH0A 4W9QA 4DZ2A 3G6LA 3H9RB 4GIVA 5I98A 4Z2GA 4J4OA 3WL1A 1OGBA 2FDMA 1NWUA 1F8AB 3IHZA 3PRAA 2UZ5A 1E6NA 1ZU8A 4QT3A 2Q5AA 4ZPVR 1W1PA 4FN2A 1W9VA 1FAPA 4WKAA 4Z2HA 1ZBWA 5HUAA 2PV3A 1GUVA 4JFJA 2DT0A 4DROA 1NH6A 2G8ZA 5DIUA 4IT4A 2ZR6A 1PINA 2B31A 3IKDA 1TFVA 1F40A 1NWRA 3ALFA 1ZBVA 1HKMA 1GOIA 1HJVA 4DWSC 4MSPA 1N1AA 3ARQA 4LAWA 2ZQUA 5DF0A 3O5MA 3OA5A 5DITA 1XHGA 4ODMA 4DWSB 4ML4A 4TW6A 2OFNA 4JFLA 1T11A 3KAHA 3AQUA 3GU0A 1EDQA 1Q6IA 2VCDA 2YBTA 1FKJA 1WNOA 2XP9A 1H0GA 1ZL1A 1E6PA 4HARA 1EYMA 3RGCA 2A3EA 4MNKA 2PV1A 3TDBA 3KADA 1R9HA 2ZQVA 4ODLA 1LL7A 1J4HA 3ALGA 4MNJA 4Q22A 3KCEA 4R0XA 2RUCA 2PN0A 3UQBA 1A7XA 1U79A 1BKFA 4U85A 2XPAA 3NTPA 3JYMA 1W9UA 4WK9A 4S3JA 1FKFA 5B8IC 1J4IA 4J4NA 1ZBCA 3MDYB 3CHDA 4IPXA 3KAIA 1LG2A 2KI3A 4AY1A 2WLZA 5DO2A 1FKKA 3IKGA 4KR0B 1H0IA 3PA7A 4QZVB 4DRPA 1IX5A 1XRVA 5HW7A 3O5DA 3RM8A 2B5UB 2F4EA 2KR7A 4DIPA 3ARZA 3FY1A 3CGMA 4Z2IA 3O5EA 2DSWA 4W5UA 4DH0A 1TCOC 1OGGA 4U86A 3WD2A 4N19A 1X6NA 1FKLA 1GRJA 1HKIA 1LL6A 2WM0A 3RFWA 3WIJA 4ODRA 1Q1CA 1D7IA 2OLHA 2VN1A 1BL4A 3KABA 5GPGA 1E6ZA 1X6LA 4DRNA 1HXVA 1UR8A 4Z2KA 3PR9A 3GPKA 2LKNA 4NZCA 1O6IA 3AS3A 1D2KA 1E6RA 2RUQA 3B7XA 5HW6A 4KQZA 3WD0A 3PRDA 5HWCA 2XP7A 2O92A 4ODNA 4Z2JA 1Q6UA 1HJWA 3CHCA 4WJXA 3RMEA 1JNEA 1K9TA 2KFWA 4O2TA 2DT2A 4ODQA 4PTMA 3UI5A 3ARPA 2PPPA 1FKSA 2LJ4A 2A3BA 1GPFA 2ZR4A 2ESCA 4DRQA 3O5KA 4UDMA 1Q6HA 2RURA 3O5OA 1FKTA 1NMVA 4JFIA 1SR0A 2ZQSA 3O5GA 4Z2LA 1LJYA 1JVWA 5JH8A 3UQIA 2ITKA 2O9OA 4R5EA 3RM9A 4DRMA 4P8UA 1FKIA 3AS1A 1JNDA 5J6EA 1D7HA 2LPVA 3VAWA 1FKBA 3GTYX 2AOSA 3KACA 3JXVA 4LAXA 4TYOA 3CHEA 3TCZA 4P8WA 4G50A 1E9LA 4JFMA 1NSGA 2F21A 2RSEA 3WQWA 1OWQA 3ARUA 3TC5A 2DSVA 1JCHB 2KGJA 2M2AA 4ITZA 4MGVA 1D7JA 3NRKA 4TX0A 4W9PA 1FFQA 2FAPA 5HBFA 4DRHA 2P4VA 1RD6A 4ODPA 1Y0OA 3BMBA 3EIPA 1UR9A 1FD9A 2XP6A 4MTVA 4ZS6A 1E44A 4L72B 2F23A 3CZ8A 2WK2A 1C9HA 1CTNA 1KT1A 4ZPWR 1ZBKA 4DWSA 1JNTA 5DEZA 2A3CA 1FKDA 3O5IA 4JYSA 4MNLA 4TW7A 2RUDA 4IQ2A 2YBUA 4S3KA 3ARXA 2MLZA 4DRIA 2MPHA 3EY6A 1J4RA 2PV2A 3QOKA 2XP8A 2JZVA 2KE0A 4QT2A 3KZ7A 3O5QA 4FAPA 4W9OA 4MPKA 2DG3A 2AWGA 2RQSA 1HKJA 5HT1A 5HTGA 4ODKA 2N87A 1WB0A 3G6MA 2XPBA 2M08A 2DSZA 1ZB5A 1KT0A 2F2DA 3NI6A 4IT6A 3WQVA 3UQAA 4DT4A 4WKHA 5BXJA 1D6OA 1FKRA 2D9FA 3KAGA 1FFRA 4LGXA 1QPFA 1QPLA 3PRBA 4MAVA 5D75A 2FKEA 3UF8A 1M5YA 1J6YA 1EQ3A 1W1VA 1QZ2A 5GQBA 1PBKA 3CH9A 2ZQTA 3WKZA 1W9PA 3ARWA 1YATA 3FAPA 2DG4A 1LG1A 4QIBA 3O5PA 1ITXA 2PBCA 3AROA 2L2SA 1W1YA 4URIA 2PPNA 5DIVA 4HBOA 4TW8A 4LAYA 3LUOA 2A3AA 2ETNA 4TNSA 3FXYA 2MLYA 3B9EA 1FKGA 2DPEA 3UI6A 3W4RA 1WAWA 3O5LA 4NNRA 2QF8A 4JFKA 3O5JA 3OOBA 1FJDA 3B9DA 4U84A 3ARSA 2IUZA 3AS0A 1EIBA 2MNTA 4DWSD 1NWTA 1VF8A 4L3NA 1HJXA 1ZCNA 3ARVA 3CGNA 3UI4A 3CHFA 3ARYA 2LGOA 2K8IA 3KAFA 5HWBA 4LAVA 1P5QA 2DSUA 2XP5A 1LQ0A 2DT1A 5HW8A 2DG9A 3I6CA 3AS2A 5HKGA 1L1PA 4DRKA 4WIWA 1HKKA 2IF4A 4Q7NA 3O5FA 3WL0A 2XP4A 4IQCA 4P8VA 4ODOA 3B8SA 4XAKA 4WKFA 2MLXA 3ARTA 4ZPTR 1ZK6A 1E15A 4HBEA 2M1IA 4P8XA 3RM4A 4DZ3A 4G2PA 1B6CA 3ODKA 3O5RA 1SYTA 2XP3A 3JYJA 2MF9A 3WD4A 2ZR5A 1NMWA 5GPRA 1JNSA 1FKHA 1YW5A 3WD3A 2PPOA 2KO7A 2WLYA 2G41A 1W1TA 1ROUA 1ROTA 3WD1A 4GGQA 2EULA 1KFWA 4BF8A 4MNMA 2PI6A 4C02B 3ARRA 2DT3A 2Y78A 3BXWA 4DRJA 3IK8A
chains in the Genus database with same CATH topology
1W26A 1EHNA 1LL4A 3B9AA 4NSBA 1NWSA 3WH0A 4W9QA 4DZ2A 3G6LA 3H9RB 4GIVA 5I98A 4Z2GA 4J4OA 3WL1A 1OGBA 2FDMA 1NWUA 1F8AB 3IHZA 3PRAA 2UZ5A 1E6NA 1ZU8A 4QT3A 2Q5AA 4ZPVR 1W1PA 4FN2A 1W9VA 1FAPA 4WKAA 4Z2HA 1ZBWA 5HUAA 2PV3A 1GUVA 4JFJA 2DT0A 4DROA 1NH6A 2G8ZA 5DIUA 4IT4A 2ZR6A 1PINA 2B31A 3IKDA 1TFVA 1F40A 1NWRA 3ALFA 1ZBVA 1HKMA 1GOIA 1HJVA 4DWSC 4MSPA 1N1AA 3ARQA 4LAWA 2ZQUA 5DF0A 3O5MA 3OA5A 5DITA 1XHGA 4ODMA 4DWSB 4ML4A 4TW6A 2OFNA 4JFLA 1T11A 3KAHA 3AQUA 1EDQA 1Q6IA 2VCDA 2YBTA 1FKJA 1WNOA 2XP9A 1H0GA 1ZL1A 1E6PA 4HARA 1EYMA 3RGCA 2A3EA 4MNKA 2PV1A 3TDBA 3KADA 1R9HA 2ZQVA 4ODLA 1LL7A 1J4HA 3ALGA 4MNJA 4Q22A 3KCEA 4R0XA 2RUCA 3UQBA 1A7XA 1U79A 1BKFA 4U85A 2XPAA 3NTPA 3JYMA 1W9UA 4WK9A 4S3JA 1FKFA 5B8IC 1J4IA 4J4NA 1ZBCA 3MDYB 3CHDA 4IPXA 3KAIA 1LG2A 2KI3A 4AY1A 2WLZA 5DO2A 1FKKA 3IKGA 4KR0B 1H0IA 3PA7A 4QZVB 4DRPA 1IX5A 1XRVA 5HW7A 3O5DA 3RM8A 2F4EA 2KR7A 4DIPA 3ARZA 3FY1A 3CGMA 4Z2IA 3O5EA 2DSWA 4W5UA 4DH0A 1TCOC 1OGGA 4U86A 3WD2A 4N19A 1X6NA 1FKLA 1HKIA 1LL6A 2WM0A 3RFWA 3WIJA 4ODRA 1Q1CA 1D7IA 2OLHA 2VN1A 1BL4A 3KABA 5GPGA 1E6ZA 1X6LA 4DRNA 1HXVA 1UR8A 4Z2KA 3PR9A 3GPKA 2LKNA 4NZCA 1O6IA 3AS3A 1D2KA 1E6RA 2RUQA 3B7XA 5HW6A 4KQZA 3WD0A 3PRDA 5HWCA 2XP7A 2O92A 4ODNA 4Z2JA 1Q6UA 1HJWA 3CHCA 4WJXA 3RMEA 1JNEA 1K9TA 2KFWA 4O2TA 2DT2A 4ODQA 4PTMA 3UI5A 3ARPA 2PPPA 1FKSA 2LJ4A 2A3BA 1GPFA 2ZR4A 2ESCA 4DRQA 3O5KA 1Q6HA 2RURA 3O5OA 1FKTA 1NMVA 4JFIA 1SR0A 2ZQSA 3O5GA 4Z2LA 1LJYA 1JVWA 5JH8A 3UQIA 2ITKA 2O9OA 4R5EA 3RM9A 4DRMA 4P8UA 1FKIA 3AS1A 1JNDA 5J6EA 1D7HA 2LPVA 3VAWA 1FKBA 2AOSA 3KACA 3JXVA 4LAXA 4TYOA 3CHEA 3TCZA 4P8WA 4G50A 1E9LA 4JFMA 1NSGA 2F21A 2RSEA 3WQWA 1OWQA 3ARUA 3TC5A 2DSVA 2KGJA 2M2AA 4ITZA 4MGVA 1D7JA 3NRKA 4TX0A 4W9PA 1FFQA 2FAPA 5HBFA 4DRHA 1RD6A 4ODPA 1Y0OA 1UR9A 1FD9A 2XP6A 4MTVA 4ZS6A 4L72B 3CZ8A 2WK2A 1C9HA 1CTNA 1KT1A 4ZPWR 1ZBKA 4DWSA 1JNTA 5DEZA 2A3CA 1FKDA 3O5IA 4JYSA 4MNLA 4TW7A 2RUDA 4IQ2A 2YBUA 4S3KA 3ARXA 2MLZA 4DRIA 2MPHA 3EY6A 1J4RA 2PV2A 3QOKA 2XP8A 2JZVA 2KE0A 4QT2A 3KZ7A 3O5QA 4FAPA 4W9OA 4MPKA 2DG3A 2AWGA 2RQSA 1HKJA 5HT1A 5HTGA 4ODKA 2N87A 1WB0A 3G6MA 2XPBA 2M08A 2DSZA 1ZB5A 1KT0A 2F2DA 3NI6A 4IT6A 3WQVA 3UQAA 4DT4A 4WKHA 5BXJA 1D6OA 1FKRA 2D9FA 3KAGA 1FFRA 4LGXA 1QPFA 1QPLA 3PRBA 4MAVA 5D75A 2FKEA 3UF8A 1M5YA 1J6YA 1EQ3A 1W1VA 1QZ2A 5GQBA 1PBKA 3CH9A 2ZQTA 3WKZA 1W9PA 3ARWA 1YATA 3FAPA 2DG4A 1LG1A 4QIBA 3O5PA 1ITXA 2PBCA 3AROA 2L2SA 1W1YA 4URIA 2PPNA 5DIVA 4HBOA 4TW8A 4LAYA 3LUOA 2A3AA 4TNSA 3FXYA 2MLYA 3B9EA 1FKGA 2DPEA 3UI6A 3W4RA 1WAWA 3O5LA 4NNRA 2QF8A 4JFKA 3O5JA 3OOBA 1FJDA 3B9DA 4U84A 3ARSA 2IUZA 3AS0A 1EIBA 2MNTA 4DWSD 1NWTA 1VF8A 4L3NA 1HJXA 1ZCNA 3ARVA 3CGNA 3UI4A 3CHFA 3ARYA 2LGOA 2K8IA 3KAFA 5HWBA 4LAVA 1P5QA 2DSUA 2XP5A 1LQ0A 2DT1A 5HW8A 2DG9A 3I6CA 3AS2A 5HKGA 1L1PA 4DRKA 4WIWA 1HKKA 2IF4A 4Q7NA 3O5FA 3WL0A 2XP4A 4IQCA 4P8VA 4ODOA 3B8SA 4XAKA 4WKFA 2MLXA 3ARTA 4ZPTR 1ZK6A 1E15A 4HBEA 2M1IA 4P8XA 3RM4A 4DZ3A 4G2PA 1B6CA 3ODKA 3O5RA 1SYTA 2XP3A 3JYJA 2MF9A 3WD4A 2ZR5A 1NMWA 5GPRA 1JNSA 1FKHA 1YW5A 3WD3A 2PPOA 2KO7A 2WLYA 2G41A 1W1TA 1ROUA 1ROTA 3WD1A 4GGQA 1KFWA 4BF8A 4MNMA 2PI6A 4C02B 3ARRA 2DT3A 2Y78A 3BXWA 4DRJA 3IK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W26 A;  4DRM A;  1QZ2 A;  3NTP A;  1FKI A;  3JYM A;  1PBK A;  1FKF A;  2ZQT A;  4W9Q A;  3WH0 A;  4DZ2 A;  5J6E A;  1D7H A;  2LPV A;  3H9R B;  1J4I A;  1FKB A;  4GIV A;  4J4N A;  3VAW A;  3KAC A;  3MDY B;  5B8I C;  3FAP A;  1YAT A;  3JXV A;  4J4O A;  2DG4 A;  4IPX A;  4LAX A;  4QIB A;  1F8A B;  3KAI A;  2KI3 A;  4TYO A;  3O5P A;  2PBC A;  3TCZ A;  3IHZ A;  1FKK A;  2UZ5 A;  3IKG A;  4QT3 A;  2L2S A;  2Q5A A;  4G50 A;  2PPN A;  5DIV A;  3PA7 A;  4FN2 A;  1FAP A;  4DRP A;  4JFM A;  1NSG A;  2F21 A;  3LUO A;  4LAY A;  2RSE A;  4TW8 A;  4TNS A;  3TC5 A;  5HUA A;  2PV3 A;  5HW7 A;  2MLY A;  2KGJ A;  1FKG A;  2M2A A;  4ITZ A;  4JFJ A;  3UI6 A;  4DRO A;  4MGV A;  1D7J A;  3O5L A;  3O5D A;  4NNR A;  3NRK A;  4TX0 A;  2F4E A;  2KR7 A;  4JFK A;  4DIP A;  4W9P A;  2FAP A;  3O5J A;  4DRH A;  3CGM A;  3OOB A;  3O5E A;  5DIU A;  1FJD A;  4U84 A;  4ODP A;  1Y0O A;  4DH0 A;  1TCO C;  2ZR6 A;  1PIN A;  3IKD A;  2XP6 A;  1FD9 A;  1F40 A;  4U86 A;  2MNT A;  4N19 A;  1FKL A;  3RFW A;  1ZCN A;  1C9H A;  4ODR A;  1Q1C A;  1D7I A;  1KT1 A;  3CGN A;  3UI4 A;  1JNT A;  2VN1 A;  1BL4 A;  4MSP A;  1N1A A;  3KAB A;  2LGO A;  2K8I A;  1FKD A;  3KAF A;  3O5I A;  4LAW A;  5GPG A;  2ZQU A;  5HWB A;  4JYS A;  1P5Q A;  4LAV A;  4DRN A;  2XP5 A;  1HXV A;  4TW7 A;  2RUD A;  4IQ2 A;  3O5M A;  5HW8 A;  5DIT A;  2DG9 A;  3GPK A;  2LKN A;  3I6C A;  2MLZ A;  4ODM A;  2MPH A;  4DRI A;  3EY6 A;  4DRK A;  5HKG A;  1L1P A;  4TW6 A;  1J4R A;  2PV2 A;  2RUQ A;  2XP8 A;  2IF4 A;  3O5F A;  3B7X A;  2XP4 A;  5HW6 A;  2JZV A;  4IQC A;  2OFN A;  4ODO A;  2KE0 A;  4QT2 A;  4JFL A;  3PRD A;  1T11 A;  2MLX A;  3KAH A;  5HWC A;  2XP7 A;  3KZ7 A;  4ODN A;  1ZK6 A;  3O5Q A;  1Q6U A;  1Q6I A;  2M1I A;  4FAP A;  4W9O A;  2DG3 A;  1FKJ A;  2AWG A;  2VCD A;  2XP9 A;  2RQS A;  4DZ3 A;  2KFW A;  4G2P A;  4O2T A;  1B6C A;  3ODK A;  3O5R A;  4ODQ A;  2XP3 A;  5HT1 A;  5HTG A;  4ODK A;  2N87 A;  1EYM A;  3UI5 A;  2PPP A;  3JYJ A;  2MF9 A;  3RGC A;  1FKS A;  2ZR5 A;  2XPB A;  1NMW A;  2M08 A;  2PV1 A;  2LJ4 A;  3TDB A;  1KT0 A;  2F2D A;  1JNS A;  1FKH A;  1YW5 A;  3KAD A;  1R9H A;  2ZR4 A;  2ZQV A;  2PPO A;  3NI6 A;  4ODL A;  2KO7 A;  4DRQ A;  5I98 A;  1J4H A;  3O5K A;  1ROU A;  3UQA A;  1ROT A;  1Q6H A;  2RUR A;  3KCE A;  4GGQ A;  4R0X A;  2RUC A;  4DT4 A;  5BXJ A;  3UQB A;  1D6O A;  3O5O A;  4BF8 A;  1FKT A;  1NMV A;  2D9F A;  1A7X A;  4JFI A;  1FKR A;  3KAG A;  2ZQS A;  1QPF A;  3O5G A;  1QPL A;  3PRB A;  1U79 A;  4C02 B;  1JVW A;  2Y78 A;  3UQI A;  5D75 A;  1BKF A;  2FKE A;  2ITK A;  1M5Y A;  2XPA A;  4U85 A;  3UF8 A;  4DRJ A;  1J6Y A;  1EQ3 A;  3IK8 A; 
#chains in the Genus database with same CATH topology
 1W26 A;  1EHN A;  1LL4 A;  3B9A A;  4NSB A;  1NWS A;  3WH0 A;  4W9Q A;  4DZ2 A;  3G6L A;  3H9R B;  4GIV A;  5I98 A;  4Z2G A;  4J4O A;  3WL1 A;  1OGB A;  2FDM A;  1NWU A;  1F8A B;  3IHZ A;  3PRA A;  2UZ5 A;  1E6N A;  1ZU8 A;  4QT3 A;  2Q5A A;  4ZPV R;  1W1P A;  4FN2 A;  1W9V A;  1FAP A;  4WKA A;  4Z2H A;  1ZBW A;  5HUA A;  2PV3 A;  1GUV A;  4JFJ A;  2DT0 A;  4DRO A;  1NH6 A;  2G8Z A;  5DIU A;  4IT4 A;  2ZR6 A;  1PIN A;  2B31 A;  3IKD A;  1TFV A;  1F40 A;  1NWR A;  3ALF A;  1ZBV A;  1HKM A;  1GOI A;  1HJV A;  4DWS C;  4MSP A;  1N1A A;  3ARQ A;  4LAW A;  2ZQU A;  5DF0 A;  3O5M A;  3OA5 A;  5DIT A;  1XHG A;  4ODM A;  4DWS B;  4ML4 A;  4TW6 A;  2OFN A;  4JFL A;  1T11 A;  3KAH A;  3AQU A;  3GU0 A;  1EDQ A;  1Q6I A;  2VCD A;  2YBT A;  1FKJ A;  1WNO A;  2XP9 A;  1H0G A;  1ZL1 A;  1E6P A;  4HAR A;  1EYM A;  3RGC A;  2A3E A;  4MNK A;  2PV1 A;  3TDB A;  3KAD A;  1R9H A;  2ZQV A;  4ODL A;  1LL7 A;  1J4H A;  3ALG A;  4MNJ A;  4Q22 A;  3KCE A;  4R0X A;  2RUC A;  2PN0 A;  3UQB A;  1A7X A;  1U79 A;  1BKF A;  4U85 A;  2XPA A;  3NTP A;  3JYM A;  1W9U A;  4WK9 A;  4S3J A;  1FKF A;  5B8I C;  1J4I A;  4J4N A;  1ZBC A;  3MDY B;  3CHD A;  4IPX A;  3KAI A;  1LG2 A;  2KI3 A;  4AY1 A;  2WLZ A;  5DO2 A;  1FKK A;  3IKG A;  4KR0 B;  1H0I A;  3PA7 A;  4QZV B;  4DRP A;  1IX5 A;  1XRV A;  5HW7 A;  3O5D A;  3RM8 A;  2B5U B;  2F4E A;  2KR7 A;  4DIP A;  3ARZ A;  3FY1 A;  3CGM A;  4Z2I A;  3O5E A;  2DSW A;  4W5U A;  4DH0 A;  1TCO C;  1OGG A;  4U86 A;  3WD2 A;  4N19 A;  1X6N A;  1FKL A;  1GRJ A;  1HKI A;  1LL6 A;  2WM0 A;  3RFW A;  3WIJ A;  4ODR A;  1Q1C A;  1D7I A;  2OLH A;  2VN1 A;  1BL4 A;  3KAB A;  5GPG A;  1E6Z A;  1X6L A;  4DRN A;  1HXV A;  1UR8 A;  4Z2K A;  3PR9 A;  3GPK A;  2LKN A;  4NZC A;  1O6I A;  3AS3 A;  1D2K A;  1E6R A;  2RUQ A;  3B7X A;  5HW6 A;  4KQZ A;  3WD0 A;  3PRD A;  5HWC A;  2XP7 A;  2O92 A;  4ODN A;  4Z2J A;  1Q6U A;  1HJW A;  3CHC A;  4WJX A;  3RME A;  1JNE A;  1K9T A;  2KFW A;  4O2T A;  2DT2 A;  4ODQ A;  4PTM A;  3UI5 A;  3ARP A;  2PPP A;  1FKS A;  2LJ4 A;  2A3B A;  1GPF A;  2ZR4 A;  2ESC A;  4DRQ A;  3O5K A;  4UDM A;  1Q6H A;  2RUR A;  3O5O A;  1FKT A;  1NMV A;  4JFI A;  1SR0 A;  2ZQS A;  3O5G A;  4Z2L A;  1LJY A;  1JVW A;  5JH8 A;  3UQI A;  2ITK A;  2O9O A;  4R5E A;  3RM9 A;  4DRM A;  4P8U A;  1FKI A;  3AS1 A;  1JND A;  5J6E A;  1D7H A;  2LPV A;  3VAW A;  1FKB A;  3GTY X;  2AOS A;  3KAC A;  3JXV A;  4LAX A;  4TYO A;  3CHE A;  3TCZ A;  4P8W A;  4G50 A;  1E9L A;  4JFM A;  1NSG A;  2F21 A;  2RSE A;  3WQW A;  1OWQ A;  3ARU A;  3TC5 A;  2DSV A;  1JCH B;  2KGJ A;  2M2A A;  4ITZ A;  4MGV A;  1D7J A;  3NRK A;  4TX0 A;  4W9P A;  1FFQ A;  2FAP A;  5HBF A;  4DRH A;  2P4V A;  1RD6 A;  4ODP A;  1Y0O A;  3BMB A;  3EIP A;  1UR9 A;  1FD9 A;  2XP6 A;  4MTV A;  4ZS6 A;  1E44 A;  4L72 B;  2F23 A;  3CZ8 A;  2WK2 A;  1C9H A;  1CTN A;  1KT1 A;  4ZPW R;  1ZBK A;  4DWS A;  1JNT A;  5DEZ A;  2A3C A;  1FKD A;  3O5I A;  4JYS A;  4MNL A;  4TW7 A;  2RUD A;  4IQ2 A;  2YBU A;  4S3K A;  3ARX A;  2MLZ A;  4DRI A;  2MPH A;  3EY6 A;  1J4R A;  2PV2 A;  3QOK A;  2XP8 A;  2JZV A;  2KE0 A;  4QT2 A;  3KZ7 A;  3O5Q A;  4FAP A;  4W9O A;  4MPK A;  2DG3 A;  2AWG A;  2RQS A;  1HKJ A;  5HT1 A;  5HTG A;  4ODK A;  2N87 A;  1WB0 A;  3G6M A;  2XPB A;  2M08 A;  2DSZ A;  1ZB5 A;  1KT0 A;  2F2D A;  3NI6 A;  4IT6 A;  3WQV A;  3UQA A;  4DT4 A;  4WKH A;  5BXJ A;  1D6O A;  1FKR A;  2D9F A;  3KAG A;  1FFR A;  4LGX A;  1QPF A;  1QPL A;  3PRB A;  4MAV A;  5D75 A;  2FKE A;  3UF8 A;  1M5Y A;  1J6Y A;  1EQ3 A;  1W1V A;  1QZ2 A;  5GQB A;  1PBK A;  3CH9 A;  2ZQT A;  3WKZ A;  1W9P A;  3ARW A;  1YAT A;  3FAP A;  2DG4 A;  1LG1 A;  4QIB A;  3O5P A;  1ITX A;  2PBC A;  3ARO A;  2L2S A;  1W1Y A;  4URI A;  2PPN A;  5DIV A;  4HBO A;  4TW8 A;  4LAY A;  3LUO A;  2A3A A;  2ETN A;  4TNS A;  3FXY A;  2MLY A;  3B9E A;  1FKG A;  2DPE A;  3UI6 A;  3W4R A;  1WAW A;  3O5L A;  4NNR A;  2QF8 A;  4JFK A;  3O5J A;  3OOB A;  1FJD A;  3B9D A;  4U84 A;  3ARS A;  2IUZ A;  3AS0 A;  1EIB A;  2MNT A;  4DWS D;  1NWT A;  1VF8 A;  4L3N A;  1HJX A;  1ZCN A;  3ARV A;  3CGN A;  3UI4 A;  3CHF A;  3ARY A;  2LGO A;  2K8I A;  3KAF A;  5HWB A;  4LAV A;  1P5Q A;  2DSU A;  2XP5 A;  1LQ0 A;  2DT1 A;  5HW8 A;  2DG9 A;  3I6C A;  3AS2 A;  5HKG A;  1L1P A;  4DRK A;  4WIW A;  1HKK A;  2IF4 A;  4Q7N A;  3O5F A;  3WL0 A;  2XP4 A;  4IQC A;  4P8V A;  4ODO A;  3B8S A;  4XAK A;  4WKF A;  2MLX A;  3ART A;  4ZPT R;  1ZK6 A;  1E15 A;  4HBE A;  2M1I A;  4P8X A;  3RM4 A;  4DZ3 A;  4G2P A;  1B6C A;  3ODK A;  3O5R A;  1SYT A;  2XP3 A;  3JYJ A;  2MF9 A;  3WD4 A;  2ZR5 A;  1NMW A;  5GPR A;  1JNS A;  1FKH A;  1YW5 A;  3WD3 A;  2PPO A;  2KO7 A;  2WLY A;  2G41 A;  1W1T A;  1ROU A;  1ROT A;  3WD1 A;  4GGQ A;  2EUL A;  1KFW A;  4BF8 A;  4MNM A;  2PI6 A;  4C02 B;  3ARR A;  2DT3 A;  2Y78 A;  3BXW A;  4DRJ A;  3IK8 A; 
#chains in the Genus database with same CATH homology
 1W26 A;  1EHN A;  1LL4 A;  3B9A A;  4NSB A;  1NWS A;  3WH0 A;  4W9Q A;  4DZ2 A;  3G6L A;  3H9R B;  4GIV A;  5I98 A;  4Z2G A;  4J4O A;  3WL1 A;  1OGB A;  2FDM A;  1NWU A;  1F8A B;  3IHZ A;  3PRA A;  2UZ5 A;  1E6N A;  1ZU8 A;  4QT3 A;  2Q5A A;  4ZPV R;  1W1P A;  4FN2 A;  1W9V A;  1FAP A;  4WKA A;  4Z2H A;  1ZBW A;  5HUA A;  2PV3 A;  1GUV A;  4JFJ A;  2DT0 A;  4DRO A;  1NH6 A;  2G8Z A;  5DIU A;  4IT4 A;  2ZR6 A;  1PIN A;  2B31 A;  3IKD A;  1TFV A;  1F40 A;  1NWR A;  3ALF A;  1ZBV A;  1HKM A;  1GOI A;  1HJV A;  4DWS C;  4MSP A;  1N1A A;  3ARQ A;  4LAW A;  2ZQU A;  5DF0 A;  3O5M A;  3OA5 A;  5DIT A;  1XHG A;  4ODM A;  4DWS B;  4ML4 A;  4TW6 A;  2OFN A;  4JFL A;  1T11 A;  3KAH A;  3AQU A;  1EDQ A;  1Q6I A;  2VCD A;  2YBT A;  1FKJ A;  1WNO A;  2XP9 A;  1H0G A;  1ZL1 A;  1E6P A;  4HAR A;  1EYM A;  3RGC A;  2A3E A;  4MNK A;  2PV1 A;  3TDB A;  3KAD A;  1R9H A;  2ZQV A;  4ODL A;  1LL7 A;  1J4H A;  3ALG A;  4MNJ A;  4Q22 A;  3KCE A;  4R0X A;  2RUC A;  3UQB A;  1A7X A;  1U79 A;  1BKF A;  4U85 A;  2XPA A;  3NTP A;  3JYM A;  1W9U A;  4WK9 A;  4S3J A;  1FKF A;  5B8I C;  1J4I A;  4J4N A;  1ZBC A;  3MDY B;  3CHD A;  4IPX A;  3KAI A;  1LG2 A;  2KI3 A;  4AY1 A;  2WLZ A;  5DO2 A;  1FKK A;  3IKG A;  4KR0 B;  1H0I A;  3PA7 A;  4QZV B;  4DRP A;  1IX5 A;  1XRV A;  5HW7 A;  3O5D A;  3RM8 A;  2F4E A;  2KR7 A;  4DIP A;  3ARZ A;  3FY1 A;  3CGM A;  4Z2I A;  3O5E A;  2DSW A;  4W5U A;  4DH0 A;  1TCO C;  1OGG A;  4U86 A;  3WD2 A;  4N19 A;  1X6N A;  1FKL A;  1HKI A;  1LL6 A;  2WM0 A;  3RFW A;  3WIJ A;  4ODR A;  1Q1C A;  1D7I A;  2OLH A;  2VN1 A;  1BL4 A;  3KAB A;  5GPG A;  1E6Z A;  1X6L A;  4DRN A;  1HXV A;  1UR8 A;  4Z2K A;  3PR9 A;  3GPK A;  2LKN A;  4NZC A;  1O6I A;  3AS3 A;  1D2K A;  1E6R A;  2RUQ A;  3B7X A;  5HW6 A;  4KQZ A;  3WD0 A;  3PRD A;  5HWC A;  2XP7 A;  2O92 A;  4ODN A;  4Z2J A;  1Q6U A;  1HJW A;  3CHC A;  4WJX A;  3RME A;  1JNE A;  1K9T A;  2KFW A;  4O2T A;  2DT2 A;  4ODQ A;  4PTM A;  3UI5 A;  3ARP A;  2PPP A;  1FKS A;  2LJ4 A;  2A3B A;  1GPF A;  2ZR4 A;  2ESC A;  4DRQ A;  3O5K A;  1Q6H A;  2RUR A;  3O5O A;  1FKT A;  1NMV A;  4JFI A;  1SR0 A;  2ZQS A;  3O5G A;  4Z2L A;  1LJY A;  1JVW A;  5JH8 A;  3UQI A;  2ITK A;  2O9O A;  4R5E A;  3RM9 A;  4DRM A;  4P8U A;  1FKI A;  3AS1 A;  1JND A;  5J6E A;  1D7H A;  2LPV A;  3VAW A;  1FKB A;  2AOS A;  3KAC A;  3JXV A;  4LAX A;  4TYO A;  3CHE A;  3TCZ A;  4P8W A;  4G50 A;  1E9L A;  4JFM A;  1NSG A;  2F21 A;  2RSE A;  3WQW A;  1OWQ A;  3ARU A;  3TC5 A;  2DSV A;  2KGJ A;  2M2A A;  4ITZ A;  4MGV A;  1D7J A;  3NRK A;  4TX0 A;  4W9P A;  1FFQ A;  2FAP A;  5HBF A;  4DRH A;  1RD6 A;  4ODP A;  1Y0O A;  1UR9 A;  1FD9 A;  2XP6 A;  4MTV A;  4ZS6 A;  4L72 B;  3CZ8 A;  2WK2 A;  1C9H A;  1CTN A;  1KT1 A;  4ZPW R;  1ZBK A;  4DWS A;  1JNT A;  5DEZ A;  2A3C A;  1FKD A;  3O5I A;  4JYS A;  4MNL A;  4TW7 A;  2RUD A;  4IQ2 A;  2YBU A;  4S3K A;  3ARX A;  2MLZ A;  4DRI A;  2MPH A;  3EY6 A;  1J4R A;  2PV2 A;  3QOK A;  2XP8 A;  2JZV A;  2KE0 A;  4QT2 A;  3KZ7 A;  3O5Q A;  4FAP A;  4W9O A;  4MPK A;  2DG3 A;  2AWG A;  2RQS A;  1HKJ A;  5HT1 A;  5HTG A;  4ODK A;  2N87 A;  1WB0 A;  3G6M A;  2XPB A;  2M08 A;  2DSZ A;  1ZB5 A;  1KT0 A;  2F2D A;  3NI6 A;  4IT6 A;  3WQV A;  3UQA A;  4DT4 A;  4WKH A;  5BXJ A;  1D6O A;  1FKR A;  2D9F A;  3KAG A;  1FFR A;  4LGX A;  1QPF A;  1QPL A;  3PRB A;  4MAV A;  5D75 A;  2FKE A;  3UF8 A;  1M5Y A;  1J6Y A;  1EQ3 A;  1W1V A;  1QZ2 A;  5GQB A;  1PBK A;  3CH9 A;  2ZQT A;  3WKZ A;  1W9P A;  3ARW A;  1YAT A;  3FAP A;  2DG4 A;  1LG1 A;  4QIB A;  3O5P A;  1ITX A;  2PBC A;  3ARO A;  2L2S A;  1W1Y A;  4URI A;  2PPN A;  5DIV A;  4HBO A;  4TW8 A;  4LAY A;  3LUO A;  2A3A A;  4TNS A;  3FXY A;  2MLY A;  3B9E A;  1FKG A;  2DPE A;  3UI6 A;  3W4R A;  1WAW A;  3O5L A;  4NNR A;  2QF8 A;  4JFK A;  3O5J A;  3OOB A;  1FJD A;  3B9D A;  4U84 A;  3ARS A;  2IUZ A;  3AS0 A;  1EIB A;  2MNT A;  4DWS D;  1NWT A;  1VF8 A;  4L3N A;  1HJX A;  1ZCN A;  3ARV A;  3CGN A;  3UI4 A;  3CHF A;  3ARY A;  2LGO A;  2K8I A;  3KAF A;  5HWB A;  4LAV A;  1P5Q A;  2DSU A;  2XP5 A;  1LQ0 A;  2DT1 A;  5HW8 A;  2DG9 A;  3I6C A;  3AS2 A;  5HKG A;  1L1P A;  4DRK A;  4WIW A;  1HKK A;  2IF4 A;  4Q7N A;  3O5F A;  3WL0 A;  2XP4 A;  4IQC A;  4P8V A;  4ODO A;  3B8S A;  4XAK A;  4WKF A;  2MLX A;  3ART A;  4ZPT R;  1ZK6 A;  1E15 A;  4HBE A;  2M1I A;  4P8X A;  3RM4 A;  4DZ3 A;  4G2P A;  1B6C A;  3ODK A;  3O5R A;  1SYT A;  2XP3 A;  3JYJ A;  2MF9 A;  3WD4 A;  2ZR5 A;  1NMW A;  5GPR A;  1JNS A;  1FKH A;  1YW5 A;  3WD3 A;  2PPO A;  2KO7 A;  2WLY A;  2G41 A;  1W1T A;  1ROU A;  1ROT A;  3WD1 A;  4GGQ A;  1KFW A;  4BF8 A;  4MNM A;  2PI6 A;  4C02 B;  3ARR A;  2DT3 A;  2Y78 A;  3BXW A;  4DRJ A;  3IK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...