3KZ7A

C-terminal domain of murine fkbp25 rapamycin complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
EGPPKYTKSILKKGDKTNFPKKGDVVHCWYTGTLPDGTVFDTNIQTSSKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNTKLIFEVELVDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 3
publication title Diversified targets of FKBP25 and its complex with rapamycin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Isomerase/inhibitor
total genus 25
structure length 119
sequence length 119
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kz7A00
2PPPA 2RSEA 5HWCA 2LKNA 1ROUA 3KADA 1ZCNA 4TW8A 1BKFA 4DRJA 4JFJA 1FKFA 3TDBA 3O5IA 4DRHA 3JYJA 1FKHA 4BF8A 3UQAA 1B6CA 2MLZA 2ZR4A 1NSGA 2PBCA 3FAPA 2RUCA 3KABA 1FKBA 4DH0A 4LAYA 4ODOA 4DZ3A 1J4HA 2RUDA 1FD9A 4IQCA 1NMVA 4GIVA 3UQIA 3WH0A 5HTGA 3KAFA 3O5MA 1C9HA 4TX0A 1KT1A 1YATA 5DIVA 5HKGA 2XP4A 3KAIA 2FKEA 4FN2A 1P5QA 4IQ2A 3O5LA 1D7JA 2DG3A 1FKJA 2ITKA 2M1IA 2RURA 1PINA 2KFWA 4W9OA 4ODNA 3TC5A 4DRNA 3PA7A 4TW6A 4DRQA 4G2PA 3GPKA 1PBKA 3IHZA 5HUAA 3PRBA 3ODKA 2UZ5A 4LAVA 4C02B 1D6OA 3KZ7A 4DT4A 4DRMA 3UI4A 3O5RA 2PPNA 2XP9A 4MGVA 4G50A 4U84A 2Q5AA 1Q6UA 1Q6IA 2PV1A 4ITZA 2KR7A 5HT1A 2RUQA 4U85A 2XPBA 3O5PA 2LGOA 1QPLA 1M5YA 2ZQSA 2KI3A 2ZR6A 1FKKA 3RGCA 2VCDA 3O5QA 2LJ4A 3MDYB 5B8IC 4R0XA 1JNSA 2OFNA 4JFKA 1Q6HA 2JZVA 1FKTA 1FKDA 3O5DA 3KAGA 4MSPA 1FKSA 3CGNA 2IF4A 3O5JA 2XP8A 1FJDA 2KO7A 5HWBA 1F40A 4DROA 4ODPA 1BL4A 5J6EA 2D9FA 1J4RA 2K8IA 2XP3A 2ZR5A 4ODLA 2KE0A 2PV3A 3IKGA 2M2AA 1W26A 3H9RB 2XP6A 4JFLA 3UQBA 1J6YA 2MLYA 2LPVA 1JVWA 1EYMA 3JXVA 2XP5A 1FAPA 1KT0A 2PV2A 2DG9A 1ROTA 3B7XA 3NI6A 4O2TA 1FKGA 2RQSA 3KCEA 5GPGA 5BXJA 2F21A 5DITA 2FAPA 3KACA 1A7XA 2PPOA 3O5EA 4J4NA 1R9HA 4DRIA 4QT3A 2N87A 4DIPA 2M08A 4GGQA 4LAXA 1QPFA 4JFMA 2VN1A 4FAPA 2MF9A 4IPXA 4TYOA 4DRPA 1Q1CA 2XPAA 3I6CA 3O5OA 2AWGA 4ODRA 4ODKA 3LUOA 3VAWA 2XP7A 4DZ2A 5D75A 1JNTA 2ZQUA 3KAHA 3O5GA 1Y0OA 4LAWA 1FKRA 2F2DA 1EQ3A 3RFWA 1HXVA 2Y78A 4U86A 2ZQTA 4TW7A 5DIUA 1FKIA 2DG4A 1ZK6A 4W9PA 4DRKA 4ODMA 4NNRA 5HW6A 3TCZA 2MLXA 1YW5A 2KGJA 4TNSA 3UI6A 3NTPA 5I98A 5HW7A 1QZ2A 1D7HA 2MPHA 3O5FA 3EY6A 4ODQA 1N1AA 5HW8A 4N19A 3UI5A 1T11A 3JYMA 4QT2A 1F8AB 3PRDA 2F4EA 2L2SA 4JYSA 1L1PA 4J4OA 3OOBA 3CGMA 3UF8A 1U79A 1D7IA 4W9QA 1FKLA 2MNTA 1NMWA 1J4IA 1TCOC 2ZQVA 4QIBA 3O5KA 3IK8A 3IKDA 3NRKA 4JFIA
chains in the Genus database with same CATH superfamily
2PPPA 2RSEA 1RD6A 1ZCNA 1BKFA 3OA5A 1E44A 1FKFA 3O5IA 1FKHA 2DSWA 2ZR4A 2PBCA 2RUCA 3ARRA 4LAYA 4ODOA 4DZ3A 1E6PA 3RM9A 3WQWA 1NMVA 1OGBA 1WNOA 5GPRA 5HKGA 2XP4A 4S3JA 1D7JA 4Q7NA 2RURA 1LQ0A 2WK2A 4HBEA 3TC5A 2DSVA 3PA7A 3GPKA 1PBKA 3B9AA 4LAVA 3O5RA 4U84A 4DWSA 2Q5AA 2PV1A 5HT1A 1ZL1A 4DWSD 4XAKA 1OWQA 3O5PA 2ZQSA 1W9UA 2KI3A 2ZR6A 4Z2KA 1TFVA 2YBTA 1JNSA 2OFNA 1Q6HA 2JZVA 1FKDA 1HKIA 4MSPA 2A3AA 2K8IA 2PV3A 2M2AA 1LG1A 4MNMA 3WQVA 1X6NA 3G6LA 3WKZA 3NI6A 2RQSA 3KCEA 2F21A 4NZCA 1R9HA 2N87A 2M08A 1JNEA 4TYOA 1Q1CA 4DZ2A 3AROA 3LUOA 3VAWA 1JNTA 2ZQUA 4HARA 1EQ3A 2ZQTA 1H0IA 2DSZA 4ODMA 1KFWA 3CH9A 4UDMA 3TCZA 3ARQA 3UI6A 1EDQA 1UR8A 4N19A 2B5UB 3WD2A 3G6MA 1F8AB 3ARXA 3PRDA 2QF8A 1D7IA 3CHEA 2P4VA 3PR9A 4W9QA 4QIBA 4KR0B 3O5KA 2LKNA 1W9PA 3JYJA 3PRAA 1NSGA 4DH0A 2PN0A 1J4HA 1FD9A 4WIWA 5HTGA 3AQUA 3KAFA 3O5MA 1C9HA 4DWSC 4Z2LA 3KAIA 4FN2A 3CHDA 1P5QA 1K9TA 1HJXA 1FKJA 2ITKA 2B31A 1XRVA 2IUZA 4ODNA 4NSBA 3CHCA 4TW6A 3IHZA 3ARWA 4Z2IA 3KZ7A 3WD4A 2PPNA 2XP9A 1IX5A 4G50A 1Q6IA 2A3CA 2KR7A 4WKAA 2ESCA 4U85A 1M5YA 4Z2JA 4URIA 2EULA 1FKKA 2VCDA 2LJ4A 1LG2A 2A3BA 3KAGA 1X6LA 3CGNA 3O5JA 1SR0A 1LL7A 5J6EA 1BL4A 2ZR5A 2XP3A 3RM4A 1ZBKA 2WLYA 1HKKA 3H9RB 1SYTA 2LPVA 1GOIA 1W1PA 1ZBVA 3AS1A 2PV2A 2DG9A 1ROTA 2WLZA 3ARYA 3WL1A 1W1VA 3AS2A 5DITA 3KACA 4ML4A 4PTMA 4AY1A 4GGQA 4LAXA 4LGXA 3FXYA 2VN1A 2DPEA 2MF9A 4IPXA 1Y0OA 4LAWA 1NWSA 4TW7A 4HBOA 4S3KA 1ZU8A 5HW6A 1XHGA 3WD0A 3BXWA 2KGJA 4TNSA 5I98A 4WK9A 2DT2A 1D7HA 1HKMA 5DEZA 4ODQA 5HW8A 1T11A 3JYMA 4JYSA 1L1PA 5HBFA 2YBUA 4L72B 2ETNA 3FY1A 1J4IA 3B9DA 2DT1A 1WB0A 4JFIA 1E9LA 5HWCA 1OGGA 1ROUA 4TW8A 2G8ZA 4DRJA 3TDBA 4MAVA 1GPFA 4BF8A 1B6CA 2MLZA 3FAPA 3KABA 1UR9A 2RUDA 3ALFA 3WH0A 4TX0A 5GQBA 5DIVA 3ARVA 4IQ2A 4WJXA 3O5LA 2DG3A 2M1IA 1ZB5A 1PINA 2KFWA 4W9OA 4ZPWR 5HUAA 3PRBA 3ODKA 2UZ5A 1D6OA 4MNJA 3UI4A 3B8SA 1ZBWA 4ITZA 4MNLA 3CZ8A 4MNKA 1QPLA 1NWTA 2PI6A 4MPKA 2A3EA 4ZS6A 3QOKA 3MDYB 1FKTA 1FKSA 1FJDA 3GU0A 2KO7A 5HWBA 1F40A 4QZVB 4MTVA 1J4RA 2OLHA 4ODLA 4L3NA 1HJVA 3ARZA 3IKGA 3W4RA 3WD1A 1H0GA 4JFLA 2XP6A 4DWSB 2MLYA 1JVWA 3JXVA 2XP5A 1ZBCA 3RMEA 4O2TA 5GPGA 1A7XA 2PPOA 4QT3A 2DSUA 1QPFA 4JFMA 4ODKA 2AWGA 3ALGA 4Q22A 4P8WA 1FKRA 4P8UA 4P8VA 1HXVA 2Y78A 5DIUA 4DRKA 1WAWA 3ARUA 3NTPA 1LL6A 1QZ2A 4Z2GA 2MPHA 3O5FA 1GUVA 1N1AA 2FDMA 4QT2A 1W9VA 3OOBA 3CGMA 1U79A 2WM0A 2MNTA 2ZQVA 1JCHB 4ZPVR 1FFRA 3IK8A 3NRKA 3ARPA 3KADA 4JFJA 4DRHA 2AOSA 3UQAA 1FKBA 3ARTA 5DF0A 4IQCA 4GIVA 3AS0A 3UQIA 1KT1A 1YATA 2FKEA 5DO2A 1D2KA 1E15A 4DRNA 4DRQA 4G2PA 1HJWA 1CTNA 4C02B 4Z2HA 4DT4A 4DRMA 1EIBA 2DT0A 4MGVA 1Q6UA 3WL0A 2RUQA 1LJYA 2XPBA 1W1TA 2LGOA 1O6IA 1E6ZA 1ITXA 3ARSA 3RGCA 3O5QA 5B8IC 4R0XA 3BMBA 4JFKA 2F23A 3O5DA 2IF4A 4W5UA 2XP8A 4WKFA 4IT6A 4ODPA 4DROA 2D9FA 4P8XA 2KE0A 1E6RA 4WKHA 4R5EA 3CHFA 1W26A 3UQBA 1J6YA 4KQZA 1EYMA 1FAPA 1KT0A 3B7XA 1W1YA 1FKGA 1JNDA 1NWUA 5BXJA 1E6NA 3EIPA 5JH8A 2FAPA 4IT4A 1LL4A 3O5EA 4J4NA 4DRIA 1NH6A 4DIPA 2O9OA 3AS3A 2DT3A 4FAPA 4DRPA 2XPAA 3I6CA 3O5OA 4ODRA 1HKJA 2XP7A 5D75A 3KAHA 3O5GA 3GTYX 1EHNA 2F2DA 3RFWA 4U86A 4ZPTR 2O92A 1NWRA 1FKIA 2DG4A 1ZK6A 1FFQA 4W9PA 4NNRA 3RM8A 2MLXA 1YW5A 3WIJA 5HW7A 3EY6A 3UI5A 2F4EA 1GRJA 2L2SA 3B9EA 4J4OA 3UF8A 1FKLA 3WD3A 1VF8A 1NMWA 1TCOC 3IKDA 2G41A
chains in the Genus database with same CATH topology
2PPPA 2RSEA 1RD6A 1ZCNA 1BKFA 3OA5A 1FKFA 3O5IA 1FKHA 2DSWA 2ZR4A 2PBCA 2RUCA 3ARRA 4LAYA 4ODOA 4DZ3A 1E6PA 3RM9A 3WQWA 1NMVA 1OGBA 1WNOA 5GPRA 5HKGA 2XP4A 4S3JA 1D7JA 4Q7NA 2RURA 1LQ0A 2WK2A 4HBEA 3TC5A 2DSVA 3PA7A 3GPKA 1PBKA 3B9AA 4LAVA 3O5RA 4U84A 4DWSA 2Q5AA 2PV1A 5HT1A 1ZL1A 4DWSD 4XAKA 1OWQA 3O5PA 2ZQSA 1W9UA 2KI3A 2ZR6A 4Z2KA 1TFVA 2YBTA 1JNSA 2OFNA 1Q6HA 2JZVA 1FKDA 1HKIA 4MSPA 2A3AA 2K8IA 2PV3A 2M2AA 1LG1A 4MNMA 3WQVA 1X6NA 3G6LA 3WKZA 3NI6A 2RQSA 3KCEA 2F21A 4NZCA 1R9HA 2N87A 2M08A 1JNEA 4TYOA 1Q1CA 4DZ2A 3AROA 3LUOA 3VAWA 1JNTA 2ZQUA 4HARA 1EQ3A 2ZQTA 1H0IA 2DSZA 4ODMA 1KFWA 3CH9A 3TCZA 3ARQA 3UI6A 1EDQA 1UR8A 4N19A 3WD2A 3G6MA 1F8AB 3ARXA 3PRDA 2QF8A 1D7IA 3CHEA 3PR9A 4W9QA 4QIBA 4KR0B 3O5KA 2LKNA 1W9PA 3JYJA 3PRAA 1NSGA 4DH0A 1J4HA 1FD9A 4WIWA 5HTGA 3AQUA 3KAFA 3O5MA 1C9HA 4DWSC 4Z2LA 3KAIA 4FN2A 3CHDA 1P5QA 1K9TA 1HJXA 1FKJA 2ITKA 2B31A 1XRVA 2IUZA 4ODNA 4NSBA 3CHCA 4TW6A 3IHZA 3ARWA 4Z2IA 3KZ7A 3WD4A 2PPNA 2XP9A 1IX5A 4G50A 1Q6IA 2A3CA 2KR7A 4WKAA 2ESCA 4U85A 1M5YA 4Z2JA 4URIA 1FKKA 2VCDA 2LJ4A 1LG2A 2A3BA 3KAGA 1X6LA 3CGNA 3O5JA 1SR0A 1LL7A 5J6EA 1BL4A 2ZR5A 2XP3A 3RM4A 1ZBKA 2WLYA 1HKKA 3H9RB 1SYTA 2LPVA 1GOIA 1W1PA 1ZBVA 3AS1A 2PV2A 2DG9A 1ROTA 2WLZA 3ARYA 3WL1A 1W1VA 3AS2A 5DITA 3KACA 4ML4A 4PTMA 4AY1A 4GGQA 4LAXA 4LGXA 3FXYA 2VN1A 2DPEA 2MF9A 4IPXA 1Y0OA 4LAWA 1NWSA 4TW7A 4HBOA 4S3KA 1ZU8A 5HW6A 1XHGA 3WD0A 3BXWA 2KGJA 4TNSA 5I98A 4WK9A 2DT2A 1D7HA 1HKMA 5DEZA 4ODQA 5HW8A 1T11A 3JYMA 4JYSA 1L1PA 5HBFA 2YBUA 4L72B 3FY1A 1J4IA 3B9DA 2DT1A 1WB0A 4JFIA 1E9LA 5HWCA 1OGGA 1ROUA 4TW8A 2G8ZA 4DRJA 3TDBA 4MAVA 1GPFA 4BF8A 1B6CA 2MLZA 3FAPA 3KABA 1UR9A 2RUDA 3ALFA 3WH0A 4TX0A 5GQBA 5DIVA 3ARVA 4IQ2A 4WJXA 3O5LA 2DG3A 2M1IA 1ZB5A 1PINA 2KFWA 4W9OA 4ZPWR 5HUAA 3PRBA 3ODKA 2UZ5A 1D6OA 4MNJA 3UI4A 3B8SA 1ZBWA 4ITZA 4MNLA 3CZ8A 4MNKA 1QPLA 1NWTA 2PI6A 4MPKA 2A3EA 4ZS6A 3QOKA 3MDYB 1FKTA 1FKSA 1FJDA 2KO7A 5HWBA 1F40A 4QZVB 4MTVA 1J4RA 2OLHA 4ODLA 4L3NA 1HJVA 3ARZA 3IKGA 3W4RA 3WD1A 1H0GA 4JFLA 2XP6A 4DWSB 2MLYA 1JVWA 3JXVA 2XP5A 1ZBCA 3RMEA 4O2TA 5GPGA 1A7XA 2PPOA 4QT3A 2DSUA 1QPFA 4JFMA 4ODKA 2AWGA 3ALGA 4Q22A 4P8WA 1FKRA 4P8UA 4P8VA 1HXVA 2Y78A 5DIUA 4DRKA 1WAWA 3ARUA 3NTPA 1LL6A 1QZ2A 4Z2GA 2MPHA 3O5FA 1GUVA 1N1AA 2FDMA 4QT2A 1W9VA 3OOBA 3CGMA 1U79A 2WM0A 2MNTA 2ZQVA 4ZPVR 1FFRA 3IK8A 3NRKA 3ARPA 3KADA 4JFJA 4DRHA 2AOSA 3UQAA 1FKBA 3ARTA 5DF0A 4IQCA 4GIVA 3AS0A 3UQIA 1KT1A 1YATA 2FKEA 5DO2A 1D2KA 1E15A 4DRNA 4DRQA 4G2PA 1HJWA 1CTNA 4C02B 4Z2HA 4DT4A 4DRMA 1EIBA 2DT0A 4MGVA 1Q6UA 3WL0A 2RUQA 1LJYA 2XPBA 1W1TA 2LGOA 1O6IA 1E6ZA 1ITXA 3ARSA 3RGCA 3O5QA 5B8IC 4R0XA 4JFKA 3O5DA 2IF4A 4W5UA 2XP8A 4WKFA 4IT6A 4ODPA 4DROA 2D9FA 4P8XA 2KE0A 1E6RA 4WKHA 4R5EA 3CHFA 1W26A 3UQBA 1J6YA 4KQZA 1EYMA 1FAPA 1KT0A 3B7XA 1W1YA 1FKGA 1JNDA 1NWUA 5BXJA 1E6NA 5JH8A 2FAPA 4IT4A 1LL4A 3O5EA 4J4NA 4DRIA 1NH6A 4DIPA 2O9OA 3AS3A 2DT3A 4FAPA 4DRPA 2XPAA 3I6CA 3O5OA 4ODRA 1HKJA 2XP7A 5D75A 3KAHA 3O5GA 1EHNA 2F2DA 3RFWA 4U86A 4ZPTR 2O92A 1NWRA 1FKIA 2DG4A 1ZK6A 1FFQA 4W9PA 4NNRA 3RM8A 2MLXA 1YW5A 3WIJA 5HW7A 3EY6A 3UI5A 2F4EA 2L2SA 3B9EA 4J4OA 3UF8A 1FKLA 3WD3A 1VF8A 1NMWA 1TCOC 3IKDA 2G41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPP A;  2RSE A;  5HWC A;  2LKN A;  1ROU A;  3KAD A;  1ZCN A;  4TW8 A;  1BKF A;  4DRJ A;  4JFJ A;  1FKF A;  3TDB A;  3O5I A;  4DRH A;  3JYJ A;  1FKH A;  4BF8 A;  3UQA A;  1B6C A;  2MLZ A;  2ZR4 A;  1NSG A;  2PBC A;  3FAP A;  2RUC A;  3KAB A;  1FKB A;  4DH0 A;  4LAY A;  4ODO A;  4DZ3 A;  1J4H A;  2RUD A;  1FD9 A;  4IQC A;  1NMV A;  4GIV A;  3UQI A;  3WH0 A;  5HTG A;  3KAF A;  3O5M A;  1C9H A;  4TX0 A;  1KT1 A;  1YAT A;  5DIV A;  5HKG A;  2XP4 A;  3KAI A;  2FKE A;  4FN2 A;  1P5Q A;  4IQ2 A;  3O5L A;  1D7J A;  2DG3 A;  1FKJ A;  2ITK A;  2M1I A;  2RUR A;  1PIN A;  2KFW A;  4W9O A;  4ODN A;  3TC5 A;  4DRN A;  3PA7 A;  4TW6 A;  4DRQ A;  4G2P A;  3GPK A;  1PBK A;  3IHZ A;  5HUA A;  3PRB A;  3ODK A;  2UZ5 A;  4LAV A;  4C02 B;  1D6O A;  3KZ7 A;  4DT4 A;  4DRM A;  3UI4 A;  3O5R A;  2PPN A;  2XP9 A;  4MGV A;  4G50 A;  4U84 A;  2Q5A A;  1Q6U A;  1Q6I A;  2PV1 A;  4ITZ A;  2KR7 A;  5HT1 A;  2RUQ A;  4U85 A;  2XPB A;  3O5P A;  2LGO A;  1QPL A;  1M5Y A;  2ZQS A;  2KI3 A;  2ZR6 A;  1FKK A;  3RGC A;  2VCD A;  3O5Q A;  2LJ4 A;  3MDY B;  5B8I C;  4R0X A;  1JNS A;  2OFN A;  4JFK A;  1Q6H A;  2JZV A;  1FKT A;  1FKD A;  3O5D A;  3KAG A;  4MSP A;  1FKS A;  3CGN A;  2IF4 A;  3O5J A;  2XP8 A;  1FJD A;  2KO7 A;  5HWB A;  1F40 A;  4DRO A;  4ODP A;  1BL4 A;  5J6E A;  2D9F A;  1J4R A;  2K8I A;  2XP3 A;  2ZR5 A;  4ODL A;  2KE0 A;  2PV3 A;  3IKG A;  2M2A A;  1W26 A;  3H9R B;  2XP6 A;  4JFL A;  3UQB A;  1J6Y A;  2MLY A;  2LPV A;  1JVW A;  1EYM A;  3JXV A;  2XP5 A;  1FAP A;  1KT0 A;  2PV2 A;  2DG9 A;  1ROT A;  3B7X A;  3NI6 A;  4O2T A;  1FKG A;  2RQS A;  3KCE A;  5GPG A;  5BXJ A;  2F21 A;  5DIT A;  2FAP A;  3KAC A;  1A7X A;  2PPO A;  3O5E A;  4J4N A;  1R9H A;  4DRI A;  4QT3 A;  2N87 A;  4DIP A;  2M08 A;  4GGQ A;  4LAX A;  1QPF A;  4JFM A;  2VN1 A;  4FAP A;  2MF9 A;  4IPX A;  4TYO A;  4DRP A;  1Q1C A;  2XPA A;  3I6C A;  3O5O A;  2AWG A;  4ODR A;  4ODK A;  3LUO A;  3VAW A;  2XP7 A;  4DZ2 A;  5D75 A;  1JNT A;  2ZQU A;  3KAH A;  3O5G A;  1Y0O A;  4LAW A;  1FKR A;  2F2D A;  1EQ3 A;  3RFW A;  1HXV A;  2Y78 A;  4U86 A;  2ZQT A;  4TW7 A;  5DIU A;  1FKI A;  2DG4 A;  1ZK6 A;  4W9P A;  4DRK A;  4ODM A;  4NNR A;  5HW6 A;  3TCZ A;  2MLX A;  1YW5 A;  2KGJ A;  4TNS A;  3UI6 A;  3NTP A;  5I98 A;  5HW7 A;  1QZ2 A;  1D7H A;  2MPH A;  3O5F A;  3EY6 A;  4ODQ A;  1N1A A;  5HW8 A;  4N19 A;  3UI5 A;  1T11 A;  3JYM A;  4QT2 A;  1F8A B;  3PRD A;  2F4E A;  2L2S A;  4JYS A;  1L1P A;  4J4O A;  3OOB A;  3CGM A;  3UF8 A;  1U79 A;  1D7I A;  4W9Q A;  1FKL A;  2MNT A;  1NMW A;  1J4I A;  1TCO C;  2ZQV A;  4QIB A;  3O5K A;  3IK8 A;  3IKD A;  3NRK A;  4JFI A; 
#chains in the Genus database with same CATH topology
 2PPP A;  2RSE A;  1RD6 A;  1ZCN A;  1BKF A;  3OA5 A;  1E44 A;  1FKF A;  3O5I A;  1FKH A;  2DSW A;  2ZR4 A;  2PBC A;  2RUC A;  3ARR A;  4LAY A;  4ODO A;  4DZ3 A;  1E6P A;  3RM9 A;  3WQW A;  1NMV A;  1OGB A;  1WNO A;  5GPR A;  5HKG A;  2XP4 A;  4S3J A;  1D7J A;  4Q7N A;  2RUR A;  1LQ0 A;  2WK2 A;  4HBE A;  3TC5 A;  2DSV A;  3PA7 A;  3GPK A;  1PBK A;  3B9A A;  4LAV A;  3O5R A;  4U84 A;  4DWS A;  2Q5A A;  2PV1 A;  5HT1 A;  1ZL1 A;  4DWS D;  4XAK A;  1OWQ A;  3O5P A;  2ZQS A;  1W9U A;  2KI3 A;  2ZR6 A;  4Z2K A;  1TFV A;  2YBT A;  1JNS A;  2OFN A;  1Q6H A;  2JZV A;  1FKD A;  1HKI A;  4MSP A;  2A3A A;  2K8I A;  2PV3 A;  2M2A A;  1LG1 A;  4MNM A;  3WQV A;  1X6N A;  3G6L A;  3WKZ A;  3NI6 A;  2RQS A;  3KCE A;  2F21 A;  4NZC A;  1R9H A;  2N87 A;  2M08 A;  1JNE A;  4TYO A;  1Q1C A;  4DZ2 A;  3ARO A;  3LUO A;  3VAW A;  1JNT A;  2ZQU A;  4HAR A;  1EQ3 A;  2ZQT A;  1H0I A;  2DSZ A;  4ODM A;  1KFW A;  3CH9 A;  4UDM A;  3TCZ A;  3ARQ A;  3UI6 A;  1EDQ A;  1UR8 A;  4N19 A;  2B5U B;  3WD2 A;  3G6M A;  1F8A B;  3ARX A;  3PRD A;  2QF8 A;  1D7I A;  3CHE A;  2P4V A;  3PR9 A;  4W9Q A;  4QIB A;  4KR0 B;  3O5K A;  2LKN A;  1W9P A;  3JYJ A;  3PRA A;  1NSG A;  4DH0 A;  2PN0 A;  1J4H A;  1FD9 A;  4WIW A;  5HTG A;  3AQU A;  3KAF A;  3O5M A;  1C9H A;  4DWS C;  4Z2L A;  3KAI A;  4FN2 A;  3CHD A;  1P5Q A;  1K9T A;  1HJX A;  1FKJ A;  2ITK A;  2B31 A;  1XRV A;  2IUZ A;  4ODN A;  4NSB A;  3CHC A;  4TW6 A;  3IHZ A;  3ARW A;  4Z2I A;  3KZ7 A;  3WD4 A;  2PPN A;  2XP9 A;  1IX5 A;  4G50 A;  1Q6I A;  2A3C A;  2KR7 A;  4WKA A;  2ESC A;  4U85 A;  1M5Y A;  4Z2J A;  4URI A;  2EUL A;  1FKK A;  2VCD A;  2LJ4 A;  1LG2 A;  2A3B A;  3KAG A;  1X6L A;  3CGN A;  3O5J A;  1SR0 A;  1LL7 A;  5J6E A;  1BL4 A;  2ZR5 A;  2XP3 A;  3RM4 A;  1ZBK A;  2WLY A;  1HKK A;  3H9R B;  1SYT A;  2LPV A;  1GOI A;  1W1P A;  1ZBV A;  3AS1 A;  2PV2 A;  2DG9 A;  1ROT A;  2WLZ A;  3ARY A;  3WL1 A;  1W1V A;  3AS2 A;  5DIT A;  3KAC A;  4ML4 A;  4PTM A;  4AY1 A;  4GGQ A;  4LAX A;  4LGX A;  3FXY A;  2VN1 A;  2DPE A;  2MF9 A;  4IPX A;  1Y0O A;  4LAW A;  1NWS A;  4TW7 A;  4HBO A;  4S3K A;  1ZU8 A;  5HW6 A;  1XHG A;  3WD0 A;  3BXW A;  2KGJ A;  4TNS A;  5I98 A;  4WK9 A;  2DT2 A;  1D7H A;  1HKM A;  5DEZ A;  4ODQ A;  5HW8 A;  1T11 A;  3JYM A;  4JYS A;  1L1P A;  5HBF A;  2YBU A;  4L72 B;  2ETN A;  3FY1 A;  1J4I A;  3B9D A;  2DT1 A;  1WB0 A;  4JFI A;  1E9L A;  5HWC A;  1OGG A;  1ROU A;  4TW8 A;  2G8Z A;  4DRJ A;  3TDB A;  4MAV A;  1GPF A;  4BF8 A;  1B6C A;  2MLZ A;  3FAP A;  3KAB A;  1UR9 A;  2RUD A;  3ALF A;  3WH0 A;  4TX0 A;  5GQB A;  5DIV A;  3ARV A;  4IQ2 A;  4WJX A;  3O5L A;  2DG3 A;  2M1I A;  1ZB5 A;  1PIN A;  2KFW A;  4W9O A;  4ZPW R;  5HUA A;  3PRB A;  3ODK A;  2UZ5 A;  1D6O A;  4MNJ A;  3UI4 A;  3B8S A;  1ZBW A;  4ITZ A;  4MNL A;  3CZ8 A;  4MNK A;  1QPL A;  1NWT A;  2PI6 A;  4MPK A;  2A3E A;  4ZS6 A;  3QOK A;  3MDY B;  1FKT A;  1FKS A;  1FJD A;  3GU0 A;  2KO7 A;  5HWB A;  1F40 A;  4QZV B;  4MTV A;  1J4R A;  2OLH A;  4ODL A;  4L3N A;  1HJV A;  3ARZ A;  3IKG A;  3W4R A;  3WD1 A;  1H0G A;  4JFL A;  2XP6 A;  4DWS B;  2MLY A;  1JVW A;  3JXV A;  2XP5 A;  1ZBC A;  3RME A;  4O2T A;  5GPG A;  1A7X A;  2PPO A;  4QT3 A;  2DSU A;  1QPF A;  4JFM A;  4ODK A;  2AWG A;  3ALG A;  4Q22 A;  4P8W A;  1FKR A;  4P8U A;  4P8V A;  1HXV A;  2Y78 A;  5DIU A;  4DRK A;  1WAW A;  3ARU A;  3NTP A;  1LL6 A;  1QZ2 A;  4Z2G A;  2MPH A;  3O5F A;  1GUV A;  1N1A A;  2FDM A;  4QT2 A;  1W9V A;  3OOB A;  3CGM A;  1U79 A;  2WM0 A;  2MNT A;  2ZQV A;  1JCH B;  4ZPV R;  1FFR A;  3IK8 A;  3NRK A;  3ARP A;  3KAD A;  4JFJ A;  4DRH A;  2AOS A;  3UQA A;  1FKB A;  3ART A;  5DF0 A;  4IQC A;  4GIV A;  3AS0 A;  3UQI A;  1KT1 A;  1YAT A;  2FKE A;  5DO2 A;  1D2K A;  1E15 A;  4DRN A;  4DRQ A;  4G2P A;  1HJW A;  1CTN A;  4C02 B;  4Z2H A;  4DT4 A;  4DRM A;  1EIB A;  2DT0 A;  4MGV A;  1Q6U A;  3WL0 A;  2RUQ A;  1LJY A;  2XPB A;  1W1T A;  2LGO A;  1O6I A;  1E6Z A;  1ITX A;  3ARS A;  3RGC A;  3O5Q A;  5B8I C;  4R0X A;  3BMB A;  4JFK A;  2F23 A;  3O5D A;  2IF4 A;  4W5U A;  2XP8 A;  4WKF A;  4IT6 A;  4ODP A;  4DRO A;  2D9F A;  4P8X A;  2KE0 A;  1E6R A;  4WKH A;  4R5E A;  3CHF A;  1W26 A;  3UQB A;  1J6Y A;  4KQZ A;  1EYM A;  1FAP A;  1KT0 A;  3B7X A;  1W1Y A;  1FKG A;  1JND A;  1NWU A;  5BXJ A;  1E6N A;  3EIP A;  5JH8 A;  2FAP A;  4IT4 A;  1LL4 A;  3O5E A;  4J4N A;  4DRI A;  1NH6 A;  4DIP A;  2O9O A;  3AS3 A;  2DT3 A;  4FAP A;  4DRP A;  2XPA A;  3I6C A;  3O5O A;  4ODR A;  1HKJ A;  2XP7 A;  5D75 A;  3KAH A;  3O5G A;  3GTY X;  1EHN A;  2F2D A;  3RFW A;  4U86 A;  4ZPT R;  2O92 A;  1NWR A;  1FKI A;  2DG4 A;  1ZK6 A;  1FFQ A;  4W9P A;  4NNR A;  3RM8 A;  2MLX A;  1YW5 A;  3WIJ A;  5HW7 A;  3EY6 A;  3UI5 A;  2F4E A;  1GRJ A;  2L2S A;  3B9E A;  4J4O A;  3UF8 A;  1FKL A;  3WD3 A;  1VF8 A;  1NMW A;  1TCO C;  3IKD A;  2G41 A; 
#chains in the Genus database with same CATH homology
 2PPP A;  2RSE A;  1RD6 A;  1ZCN A;  1BKF A;  3OA5 A;  1FKF A;  3O5I A;  1FKH A;  2DSW A;  2ZR4 A;  2PBC A;  2RUC A;  3ARR A;  4LAY A;  4ODO A;  4DZ3 A;  1E6P A;  3RM9 A;  3WQW A;  1NMV A;  1OGB A;  1WNO A;  5GPR A;  5HKG A;  2XP4 A;  4S3J A;  1D7J A;  4Q7N A;  2RUR A;  1LQ0 A;  2WK2 A;  4HBE A;  3TC5 A;  2DSV A;  3PA7 A;  3GPK A;  1PBK A;  3B9A A;  4LAV A;  3O5R A;  4U84 A;  4DWS A;  2Q5A A;  2PV1 A;  5HT1 A;  1ZL1 A;  4DWS D;  4XAK A;  1OWQ A;  3O5P A;  2ZQS A;  1W9U A;  2KI3 A;  2ZR6 A;  4Z2K A;  1TFV A;  2YBT A;  1JNS A;  2OFN A;  1Q6H A;  2JZV A;  1FKD A;  1HKI A;  4MSP A;  2A3A A;  2K8I A;  2PV3 A;  2M2A A;  1LG1 A;  4MNM A;  3WQV A;  1X6N A;  3G6L A;  3WKZ A;  3NI6 A;  2RQS A;  3KCE A;  2F21 A;  4NZC A;  1R9H A;  2N87 A;  2M08 A;  1JNE A;  4TYO A;  1Q1C A;  4DZ2 A;  3ARO A;  3LUO A;  3VAW A;  1JNT A;  2ZQU A;  4HAR A;  1EQ3 A;  2ZQT A;  1H0I A;  2DSZ A;  4ODM A;  1KFW A;  3CH9 A;  3TCZ A;  3ARQ A;  3UI6 A;  1EDQ A;  1UR8 A;  4N19 A;  3WD2 A;  3G6M A;  1F8A B;  3ARX A;  3PRD A;  2QF8 A;  1D7I A;  3CHE A;  3PR9 A;  4W9Q A;  4QIB A;  4KR0 B;  3O5K A;  2LKN A;  1W9P A;  3JYJ A;  3PRA A;  1NSG A;  4DH0 A;  1J4H A;  1FD9 A;  4WIW A;  5HTG A;  3AQU A;  3KAF A;  3O5M A;  1C9H A;  4DWS C;  4Z2L A;  3KAI A;  4FN2 A;  3CHD A;  1P5Q A;  1K9T A;  1HJX A;  1FKJ A;  2ITK A;  2B31 A;  1XRV A;  2IUZ A;  4ODN A;  4NSB A;  3CHC A;  4TW6 A;  3IHZ A;  3ARW A;  4Z2I A;  3KZ7 A;  3WD4 A;  2PPN A;  2XP9 A;  1IX5 A;  4G50 A;  1Q6I A;  2A3C A;  2KR7 A;  4WKA A;  2ESC A;  4U85 A;  1M5Y A;  4Z2J A;  4URI A;  1FKK A;  2VCD A;  2LJ4 A;  1LG2 A;  2A3B A;  3KAG A;  1X6L A;  3CGN A;  3O5J A;  1SR0 A;  1LL7 A;  5J6E A;  1BL4 A;  2ZR5 A;  2XP3 A;  3RM4 A;  1ZBK A;  2WLY A;  1HKK A;  3H9R B;  1SYT A;  2LPV A;  1GOI A;  1W1P A;  1ZBV A;  3AS1 A;  2PV2 A;  2DG9 A;  1ROT A;  2WLZ A;  3ARY A;  3WL1 A;  1W1V A;  3AS2 A;  5DIT A;  3KAC A;  4ML4 A;  4PTM A;  4AY1 A;  4GGQ A;  4LAX A;  4LGX A;  3FXY A;  2VN1 A;  2DPE A;  2MF9 A;  4IPX A;  1Y0O A;  4LAW A;  1NWS A;  4TW7 A;  4HBO A;  4S3K A;  1ZU8 A;  5HW6 A;  1XHG A;  3WD0 A;  3BXW A;  2KGJ A;  4TNS A;  5I98 A;  4WK9 A;  2DT2 A;  1D7H A;  1HKM A;  5DEZ A;  4ODQ A;  5HW8 A;  1T11 A;  3JYM A;  4JYS A;  1L1P A;  5HBF A;  2YBU A;  4L72 B;  3FY1 A;  1J4I A;  3B9D A;  2DT1 A;  1WB0 A;  4JFI A;  1E9L A;  5HWC A;  1OGG A;  1ROU A;  4TW8 A;  2G8Z A;  4DRJ A;  3TDB A;  4MAV A;  1GPF A;  4BF8 A;  1B6C A;  2MLZ A;  3FAP A;  3KAB A;  1UR9 A;  2RUD A;  3ALF A;  3WH0 A;  4TX0 A;  5GQB A;  5DIV A;  3ARV A;  4IQ2 A;  4WJX A;  3O5L A;  2DG3 A;  2M1I A;  1ZB5 A;  1PIN A;  2KFW A;  4W9O A;  4ZPW R;  5HUA A;  3PRB A;  3ODK A;  2UZ5 A;  1D6O A;  4MNJ A;  3UI4 A;  3B8S A;  1ZBW A;  4ITZ A;  4MNL A;  3CZ8 A;  4MNK A;  1QPL A;  1NWT A;  2PI6 A;  4MPK A;  2A3E A;  4ZS6 A;  3QOK A;  3MDY B;  1FKT A;  1FKS A;  1FJD A;  2KO7 A;  5HWB A;  1F40 A;  4QZV B;  4MTV A;  1J4R A;  2OLH A;  4ODL A;  4L3N A;  1HJV A;  3ARZ A;  3IKG A;  3W4R A;  3WD1 A;  1H0G A;  4JFL A;  2XP6 A;  4DWS B;  2MLY A;  1JVW A;  3JXV A;  2XP5 A;  1ZBC A;  3RME A;  4O2T A;  5GPG A;  1A7X A;  2PPO A;  4QT3 A;  2DSU A;  1QPF A;  4JFM A;  4ODK A;  2AWG A;  3ALG A;  4Q22 A;  4P8W A;  1FKR A;  4P8U A;  4P8V A;  1HXV A;  2Y78 A;  5DIU A;  4DRK A;  1WAW A;  3ARU A;  3NTP A;  1LL6 A;  1QZ2 A;  4Z2G A;  2MPH A;  3O5F A;  1GUV A;  1N1A A;  2FDM A;  4QT2 A;  1W9V A;  3OOB A;  3CGM A;  1U79 A;  2WM0 A;  2MNT A;  2ZQV A;  4ZPV R;  1FFR A;  3IK8 A;  3NRK A;  3ARP A;  3KAD A;  4JFJ A;  4DRH A;  2AOS A;  3UQA A;  1FKB A;  3ART A;  5DF0 A;  4IQC A;  4GIV A;  3AS0 A;  3UQI A;  1KT1 A;  1YAT A;  2FKE A;  5DO2 A;  1D2K A;  1E15 A;  4DRN A;  4DRQ A;  4G2P A;  1HJW A;  1CTN A;  4C02 B;  4Z2H A;  4DT4 A;  4DRM A;  1EIB A;  2DT0 A;  4MGV A;  1Q6U A;  3WL0 A;  2RUQ A;  1LJY A;  2XPB A;  1W1T A;  2LGO A;  1O6I A;  1E6Z A;  1ITX A;  3ARS A;  3RGC A;  3O5Q A;  5B8I C;  4R0X A;  4JFK A;  3O5D A;  2IF4 A;  4W5U A;  2XP8 A;  4WKF A;  4IT6 A;  4ODP A;  4DRO A;  2D9F A;  4P8X A;  2KE0 A;  1E6R A;  4WKH A;  4R5E A;  3CHF A;  1W26 A;  3UQB A;  1J6Y A;  4KQZ A;  1EYM A;  1FAP A;  1KT0 A;  3B7X A;  1W1Y A;  1FKG A;  1JND A;  1NWU A;  5BXJ A;  1E6N A;  5JH8 A;  2FAP A;  4IT4 A;  1LL4 A;  3O5E A;  4J4N A;  4DRI A;  1NH6 A;  4DIP A;  2O9O A;  3AS3 A;  2DT3 A;  4FAP A;  4DRP A;  2XPA A;  3I6C A;  3O5O A;  4ODR A;  1HKJ A;  2XP7 A;  5D75 A;  3KAH A;  3O5G A;  1EHN A;  2F2D A;  3RFW A;  4U86 A;  4ZPT R;  2O92 A;  1NWR A;  1FKI A;  2DG4 A;  1ZK6 A;  1FFQ A;  4W9P A;  4NNR A;  3RM8 A;  2MLX A;  1YW5 A;  3WIJ A;  5HW7 A;  3EY6 A;  3UI5 A;  2F4E A;  2L2S A;  3B9E A;  4J4O A;  3UF8 A;  1FKL A;  3WD3 A;  1VF8 A;  1NMW A;  1TCO C;  3IKD A;  2G41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...