1WB0A

Specificity and affinity of natural product cyclopentapeptide inhibitor argifin against human chitinase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
364
structure length
364
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITOTRIOSIDASE 1
publication title Specificity and Affinity of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human and Bacterial Chitinases
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 128
structure length 364
sequence length 364
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2004-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF01607 CBM_14 Chitin binding Peritrophin-A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1wb0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1wb0A01
3VKKA 3VD5A 4XV0A 4Y7EA 1H41A 1KR0A 3AJ7A 3VIJA 1HF6A 1WKYA 4CD7A 3NSXA 3DHUA 1GQLA 3AIUA 1C7SA 3ZMRA 1Q4NX 2WWCA 3BGAA 3VMPA 4MJ4A 4ZEPA 1B3XA 1JAEA 2G8ZA 2X1IA 3CZKA 1R7AA 3NUKA 5A8QA 2JEQA 4MDPA 4CUCA 3SUUA 2XSBA 3PZGA 4MAZA 2TAAA 2A3CA 3FHAA 2WVUA 3OGVA 4UFHA 3VIOA 2J79A 4F9JA 1W2PA 3WSUA 2PWFA 2OWXA 2WMJA 1E0WA 1GOKA 1N82A 5JUVA 1W32A 2ESCA 3T0BA 1GHSA 1VJZA 1UR4A 4W7UA 1NP0A 4AD0A 3AIBA 3MU7A 3WEZA 1QOXA 1OGGA 2ZXBA 5I6SA 1NOUA 4GZJA 4W5ZA 1J0YA 2O9RA 3L4ZA 4GI8A 2BY0A 3TP4A 3BSGA 2CHNA 1KWKA 2UY2A 3QOMA 1HXJA 5BROA 3ZSSA 1GPFA 2W67A 5IHSA 1HKJA 3BCFA 2PWHA 3UG4A 1C8XA 3HU7A 3VMNA 4CD6A 1WB0A 2Y24A 4TTGA 4PTMA 5A6AA 1OB0A 1W9PA 2CBIA 1QI2A 3WELA 4OIFA 7CGTA 5FL1A 3SCNA 2D2OA 4NRRA 4CVWA 2DDXA 5HPCA 4CGTA 4W88A 3FW6A 2XFFA 3W4RA 4B15A 2VL4A 5LA1A 5BYWA 3PZVA 1DWIM 1CXEA 3MV01 4L4PA 4PMVA 4PSRA 2BVYA 3U57A 1X6LA 2XWEA 2WBKA 1E6RA 1DWFM 1DHKA 3LPFA 1WPCA 2VNCA 4Z2LA 1OINA 4W93A 4WK9A 2J7GA 5CSUA 3MO4A 1QPKA 1E0VA 1CLXA 3L4XA 3WUFA 2VX4A 2GUYA 3VGDA 3SUTA 3QHNA 2CNCA 3BMVA 4A3YA 1CGYA 2WCGA 4PMUA 3ZSTA 5BWFA 3N15A 1H2JA 2Z1KA 4FLQA 3ZO9A 3A4WA 4ACYA 3WBEA 1SYTA 3L2MA 2B31A 3WH6A 4HOWA 9CGTA 3IJ8A 3AIQA 4OBRA 5IFTA 4CN1A 1OM0A 4TX6A 2FDMA 1KGWA 1VRXA 1GORA 1JFHA 4CVUA 2YA2A 3APGA 2OLHA 2BFGA 4UOJA 2JF6A 1MXDA 1PJ9A 5E70A 5M3WA 2VRKA 5LYRA 4HPGA 3WF3A 1UD6A 1W3KA 1YQ2A 1AQHA 1QNQA 2XGIA 1BYCA 2EJ1A 4DWSA 4MPKA 4B3KA 1BF2A 2VRQA 4U2YA 2WHKA 4B9YA 3VDBA 3VIHA 2WC4A 3WMCA 4AYSA 4IPLA 3DHPA 1W3JA 1JL8A 2WMKA 1B3ZA 2EO7A 4ACZA 3VGGA 2VCAA 4S3KA 2EPOA 3WF1A 1F4AA 4W8LA 3W53A 1Q6EA 1HVQA 3QR3A 1H11A 5GNZA 3SCTA 1TA3B 4MJ2A 2ZXQA 4M81A 4AIEA 1V3JA 4FLRA 3E1F1 3RM8A 2WVVB 2GJPA 2YL6A 4PCTA 1FOBA 4HA4A 2Y2WA 2WK2A 4DWSB 4DM1A 1TMQA 3KL0A 2DPEA 3N17A 3VNYA 4AEFA 1XSJA 4PBGA 5A95A 5ABGA 4W5UA 2O92A 4YPJA 4J3SA 1SR0A 1ECEA 3I3BA 5ABFA 5E09A 3GH4A 4YHEA 1VBUA 3VIGA 1GOIA 1ESWA 1UKQA 2V3DA 3EYPA 3WKZA 4BQ5A 1W9DM 4KWUA 2WM0A 2GDVA 5AY7A 3PZNA 2EXOA 2WC3A 4D72A 4M24A 1JD7A 1M7XA 5D9NA 1X6NA 3BAJA 1CPUA 4H41A 5M03A 1ZBKA 2GK1A 3VIFA 2MANA 4TUFA 2J7HA 2XVKA 1ODZA 1V3LA 4JFTA 3FAXA 5A8NA 3TTOA 2YL5A 2QMJA 2BY2A 5A94A 2WXDM 2C8NA 2VVNA 3FHQA 1R7OA 3LPGA 4JFWA 4H8UA 1KQYA 1VFUA 2Y8VA 4AD2A 3BLPX 1SMDA 1XSIA 2JIEA 3D3AA 1LL6A 3VMOA 3SUSA 3ZT6A 4HMDA 2YA0A 4AMCA 1MWOA 2VZSA 3WN6A 1CXFA 2XHYA 2ZXAA 4D6EA 3VD9A 4Z2JA 3OG2A 1R86A 2OSXA 1TZ7A 4AZGA 1QW8A 4AZCB 2VZUA 2JFEX 3CTTA 3AXXA 3O6AA 1UWQA 1V6YA 4BF7A 3N9KA 4NSBA 2HVMA 1NH6A 3AZRA 2D20A 3K8KA 4UQBA 2WC7A 1K6AA 3CLWA 2G3NA 1E4MM 4CD8A 5M5DA 1I1WA 3RIKA 2X0HA 4ZXOA 4ATDA 1TFVA 1CDGA 2BHYA 4OUEA 1XV8A 2XFRA 3WQ5A 2XM2A 1XHGA 2XVPA 3MMUA 2NW0A 1CXLA 3GZAA 2D3LA 2YDRA 4GZEA 4W84A 3MUIA 1R85A 5FKYA 1VEMA 4D6CA 3THCA 4EANA 4D6JA 2F61A 1C92A 4KH2A 3WUEA 1E6XM 2QF8A 1XD1A 2CYGA 2DH3A 3GNPA 2BXZA 5I23A 3GBEA 1BVNP 3L4UA 3AS1A 5DT5A 2PI6A 1US3A 2FHCA 4UFMA 1BAGA 4C7GA 1J0ZA 4QFUA 1GOOA 4P8UA 3WL0A 3CUHA 4PMDA 1PIFA 1CIUA 2JF7A 3VNZA 3VU2A 4ZXLA 3AXIA 2YDQA 3UETA 1JZ7A 3ARUA 1UD2A 1U30A 2QLYA 1OIFA 2JIWA 1KXHA 2J47A 5D4YA 2D24A 1JI1A 1NOWA 1UQZA 5JBEA 1E9LA 3M46A 3VINA 1HJSA 1JI2A 4HU8A 1M01A 3WNNA 2VUYA 3UR8A 3T2OA 3ARZA 1FH9A 2UY5A 1E4NA 4MB1A 3VUPA 4PSPA 1PAMA 1UA3A 4WJXA 4IPNB 2RGMA 3MMWA 4BQ3A 1QVBA 3AQUA 2W63A 5JBDA 2A3HA 4CKQA 3WQVA 2DT3A 2WLYA 3PTQA 2ZX6A 3K4DA 3VIPA 5CGMA 4MB5A 1UKTA 3M07A 1E43A 2QMKA 1KQZA 1LG1A 8A3HA 4HZ7A 1DP0A 3VDCA 2DSVA 2G4FA 1V3KA 1E0XA 1XYFA 2GJXA 2OSWA 1G5AA 2YLLA 2GVYA 3SCPA 1G0CA 1JXJA 1TVPA 3AFBA 4PRWA 1H0IA 5CPTA 4CD5A 2WMFA 3RO8A 2QPSA 3NDZA 4UQEA 4P7OA 2OSYA 2FGLA 2WWDA 2VZVA 4DM2A 3GNOA 6A3HA 1PZ2A 1L0PA 4H04A 3PHAA 4UCFA 4MAVA 1B3WA 3ARXA 1W3LA 4M56A 3VGHA 3UR7A 3RPMA 1CBGA 3VD3A 4S3JA 2VQUA 2XIIA 3POHA 4LQ1A 1E56A 4OOZA 3SIMA 2WMIA 3ZT5A 1ISWA 1AVAA 1QI5A 3GNRA 4QLLA 1FHDA 1JYVA 1D7FA 4YN5A 1WDRA 2XUCA 2X0YA 2XVLA 2J7CA 3VGBA 4U5KA 4PEEA 2NT1A 3CZLA 1VEPA 1UOKA 4AISA 2UY3A 1GOMA 1ZB5A 2BS9A 4YHGA 3GTNA 4AD5A 3WBAA 1MYRA 1E40A 1G01A 2VX6A 4XB3A 5HBFA 3PZIA 3CHDA 3WNPA 4B16A 1E3XA 5AC5A 3AICA 4CCDA 1J9YA 4MDOA 5IDIA 1E6SM 4IM4A 5EFDA 2ZX5A 4P8VA 1G9HA 2WHMA 5BRQA 3VX1A 2PBOA 3ZR6A 2FHFA 3I3DA 1JZ8A 3AROA 4PN2A 2VI0A 3KL5A 3SEPA 4UQAA 3GH7A 2JE8A 2CBVA 2D23A 2X05A 2CESA 4LPCA 4D6GA 3S2CA 1ZJBA 1LWJA 2CIPA 1J0IA 3CIVA 4GZIA 1CNVA 5CPSA 1IT0A 2V5CA 1RD6A 1PX8A 4MNJA 1CGUA 2ZUVA 2D3NA 3BAIA 4QDMA 2OYMA 1K9EA 4X0VA 3WDRA 3EDDA 2ZUWA 4KGLA 1BSIA 3T0DA 1ZBVA 3BAWA 2DGAA 2DSUA 2G3JA 5GPRA 1XCWA 3GXFA 3GXIA 4FF5A 5A2CA 1JZ5A 1XCXA 3SCOA 4JKMA 2X8RA 4W8AA 1MQRA 1QBAA 3MS8A 1JNEA 1ZBCA 2J75A 1EDTA 3N04A 1BPLB 4JZ5A 4UOZA 3WQ6A 3K1DA 4U31A 3OGSA 1D2KA 2V3FA 2VR5A 1V0LA 3ARWA 1Y7VA 4OJYA 5C71A 2WMGA 4RL3A 1QHZA 4QLJA 3A4XA 1FA2A 2XJ7A 3L2LA 2PWDA 3PN8A 4GIAA 1XC6A 3BAXA 3AMLA 1HT6A 3MV11 5BRPA 2WPGA 3WENA 2E3ZA 1I75A 2PC8A 1E3ZA 5DF0A 4GPNA 1C90A 3EMZA 4P7LA 1UKSA 2YBTA 2D0FA 1V0MA 2XIBA 1K9DA 4UQDA 3WQ4A 1BQCA 4HOZA 4MNLA 1CGWA 4UQ9A 4FLSA 2ZOXA 1F4HA 1GQIA 3ARQA 5GQBA 1KWGA 4AW7A 1UUQA 1C8YA 3FXYA 4L4OA 4H8HA 3QHMA 2J77A 2CITA 3U5UA 3WDPP 1KCLA 1V03A 1E6ZA 5D9PA 3BAYA 3N18A 3L4WA 1NARA 4D6IA 2XWDA 1AQMA 2VCBA 4DWSD 1MXGA 3RM4A 5CLTA 2XG9A 2E8YA 1JXKA 1EO7A 2CERA 1XYZA 1HKIA 2D0HA 5I77A 1EOMA 3HMCA 1FP9A 2QV4A 2E0PA 4F9DA 5DMYA 4UZUA 1HL9A 3AYRA 4BA0A 4JKLA 4MB3A 4LX4A 3T09A 4J3TA 3TTQA 1WZAA 1VFFA 3K8LA 1HKKA 1WP6A 1E6QM 5E0FA 1J01A 3HJEA 4CCCA 3FAWA 3WD2A 4Z2KA 3EDEA 3RM9A 4U2ZA 1H4PA 4N42A 3IJ7A 3BH4A 5EFFA 3OGRA 4N0RA 2J7FA 3WFLA 1IV8A 2BVTA 1EDGA 1EHAA 1BYDA 3W0KA 5CXPA 3VD4A 7A3HA 3AIWA 2E9BA 4EK7A 1E4IA 1X1NA 1UR9A 2AMGA 2OYKA 1VJSA 1VEOA 2G3IA 4AC1X 1H09A 3N12A 3NCOA 1DWGM 3KL3A 2W61A 3SCSA 3U7BA 3WD0A 4RE4A 2V3GA 5CLWA 1KXQA 2BXYA 2Y5EA 2ZWZA 2WMHA 3LPPA 1GQKA 4JFSA 2GFTA 2FGZA 1KGXA 2D0GA 1J18A 1MQPA 3OLEA 2EQDA 1BGAA 1MFUA 1QHOA 3HN3A 3DC0A 2EPKX 1TG7A 1KXTA 3TOPA 1VB9A 4DWSC 1UD4A 3BCDA 4XZWA 5I2UA 3OIHA 3WQ8A 4P8WA 4XX6A 1LQ0A 1UR2A 3WEMA 1MW0A 1C3FA 1JZ6A 4ACZB 3ZR5A 5CJ5A 3AZTA 4PMZA 3CZ8A 2XM1A 3A4AA 5I24A 2ZX7A 1JG9A 4ZE5A 1Q6GA 3F5LA 3W27A 5JBFA 3TTYA 1O7AA 3AIVA 4MNKA 4AZ5A 3MUAA 4PTXA 1UWTA 3ALFA 4JCMA 1Q6FA 4MB4A 2Y4SA 4BQ2A 3GBDA 3K8MA 4TXEA 1R8LA 3TTSA 5A8OA 3ARYA 3JUGA 3O9NA 1PX4A 4CD4A 3MKKA 3MSGA 3SCRA 4UTFA 1HN1A 3W29A 3CZEA 3GH5A 3OBAA 2FH8A 2X2YA 2IXUA 4ZENA 2ZWYA 3WH8A 5CGTA 5CQ1A 4NRSA 4UQCA 1QBBA 3W25A 1GONA 2ZIDA 4PYSA 5ABFB 3AYSA 2AAAA 2VQTA 1CXHA 5JH8A 2G3MA 1WO2A 1V3HA 3POCA 5E0CA 5ABEA 4M29A 1GUVA 1W9VA 4LGXA 3IK2A 1EQPA 1BFNA 3DECA 1W9UA 1Q6DA 4EKJA 1RP9A 4UZSA 5EMYA 3KWXA 1V0NA 3CMGA 4J27A 4R5EA 3PZ9A 2GK1B 4PMOA 1GJWA 4PUDA 3ZJ6A 1KB3A 4PMNA 3ZOAA 3OZOA 3CHEA 4UNIA 5DFAA 1GOWA 5A69A 5A6BD 2EPNA 4H8VA 4JKKA 3F5JA 1EA9C 1WDSA 4BS0A 4AZIA 2DIEA 5FD0A 3OZPA 2GJRA 1H5VA 1E72M 2ZX8A 3EMQA 4HP5A 1PPIA 2PWEA 4HA3A 3OB8A 2DT2A 3M7SA 3ZJ8A 1Q6CA 3NSMA 4HOXA 7TAAA 4TX8A 5FCZA 1ZU8A 2WANA 4J3WA 3F4VA 1HJVA 1FHLA 4LYRA 1UG6A 5A6MA 2E40A 1BTCA 1JIBA 4M8UA 3ZT7A 1JYWA 1V6VA 3WEOA 1ISYA 2QPUA 5I3DA 1UD8A 4JAWA 4A3HA 1DWJM 5D8ZA 4Z2GA 4M82A 5A3HA 1OBAA 4J28A 3CPUA 1U2YA 1HP4A 1DWAM 4KRTA 3WF2A 3WMSA 5IXEA 1GJUA 1E6NA 4WKAA 3CO4A 4WKFA 4GI6A 4PMQA 3AMKA 5A8PA 2WZIA 5F7UA 5M17A 5C70A 2VR4A 3AXHA 1Z32X 2J4GA 1GQJA 3ARVA 1TR1A 4AXNA 1OSEA 4UFIA 4JCLA 2VTFA 3NSNA 5FL0A 4ZE4A 5A6JA 5HDRA 3F5KA 4CN4A 4HZ6A 3II1A 1CXIA 4GQQA 2DSKA 5AC4A 4QCFA 4WLCA 1PZ3A 1UWIA 3WF4A 3NDYA 4CN6A 1BHGA 1R87A 2A3EA 3VD7A 3MSDA 2VZTA 3SUVA 1HNYA 4HU0A 4J7RA 5BCAA 4QAWA 2DT0A 3IANA 3UERA 1EO5A 2CBJA 5A6SA 1GCYA 3PZMA 1ISZA 3VDAA 3W6LA 4DUXA 4KMQA 3B9DA 2VO5A 1H49A 2WVSA 2C7FA 1V6UA 5CG0A 1ISXA 1JDAA 4V2XA 5HNNA 1HVXA 1HP5A 4MNMA 3THDA 1UH4A 2OWCA 2G41A 4BZYA 3AI0A 1O6IA 1W3HA 2CPUA 4QCEA 1WNOA 1PX3A 3CUFA 2NSXA 3A6OA 1BVZA 1QW9A 5E6ZA 3VVGA 1NWSA 1OT1A 4TTUA 5D8WA 2GJXB 3FN9A 1UD3A 4EE9A 5IFPA 4V27A 2YBUA 3WNLA 3NIYA 3WFZA 1B1YA 4OZOA 1B31A 1CGXA 3U5YA 2PBGA 3W37A 2O9TA 3ALGA 2ZXDA 3PBGA 2VMFA 2WYSA 4GINA 1ZBWA 1MW2A 5I5RA 4KGJA 3DYPA 5KZ6A 3K46A 1B2YA 5I78A 3OA5A 1UWUA 1LLOA 2UY4A 2WMIB 3GXMA 3T0AA 4AZBA 1OCQA 4OOUA 1J0HA 4W86A 3T2PA 4UOQA 2WZEA 1GNXA 4AIUA 1DWHM 1J0JA 2YA1A 4MADA 5TD4A 4ZFMA 2ZX9A 1AMYA 3FNDA 4U5IA 1E15A 3ZJ7A 3W82A 2CETA 3TONA 4HTYA 1VIWA 1V02A 1G94A 1BG9A 2IXVA 3SURA 1UZ4A 4CU6A 1UH2A 3D5HA 2NT0A 1J11A 1UWRA 4H2CA 5ABHA 2ZICA 4NI3A 3CUGA 4PCSA 4TOQA 2CCRA 2WKLA 2E8ZA 1JYNA 3RJYA 1WDQA 3KZSA 5E6YA 1WAWA 4DUWA 1W2VA 4WSKA 1B0IA 2F2HA 2GDUA 2W5FA 4OKDA 3WF0A 1LF1A 4H7VA 2XPKA 4LYPA 2DSWA 2CHOA 4BQ4A 3NJ3A 1KFWA 3SUWA 2VX7A 2XGBA 1JZ4A 2W4XA 1B3VA 3MUZ1 1M03A 2OYLA 1UKOA 3PZOA 1E73M 3W24A 4PUEA 1VENA 1E1FA 4D1IA 6CGTA 1ISVA 2A3BA 3OLDA 3B8SA 1KBBA 3VILA 3U7VA 2ZUTA 4D6HA 4MTVA 1KXVA 1A47A 1UR0A 5GNXA 2JALA 2WKGA 4X9YA 3VTRA 3VIMA 2XVNA 3AZSA 3AS3A 2BVDA 1JAKA 2WAGA 3CZJA 3IJ9A 1CZ1A 1UA7A 1TCMA 3NYDA 2YL9A 5E9AA 4JHOA 4LXFA 3CMJA 4D1JA 1HIZA 1CWYA 1UYQA 1LG2A 4X0NA 5C8BB 4OBSA 3BSHA 3VM5A 1E6PA 3WL1A 4GI9A 3VPLA 3BLKA 3QOKA 3WNMA 8CGTA 2XFYA 3WUBA 5A6LA 3B9EA 2VZOA 3WMBA 2BY3A 2Y8KA 2J8GA 4J3UA 2C0HA 1S46A 3ZM8A 4M80A 5DEZA 3ARTA 3RCNA 5KEZA 2EPMX 2YL8A 1W91A 3ECQA 1VFOA 1HJQA 3PTKA 1OD8A 4J3XA 2QHAA 3W38A 3L4VA 5CSYA 4CU8A 4HPHA 1NWTA 1UHVA 3PZUA 2YKKA 1FH7A 3WQWA 3AMGA 5I79A 2O9OA 5HPOA 1US2A 1E4LA 4E8CA 3K4AA 1BYBA 2IUZA 4HZ8A 4GO8A 3W81A 3PTMA 3CHFA 2WB5A 4IUGA 1C7TA 4W85A 2J7BA 1LL7A 1U33A 1QHPA 2V38A 1H3GA 1WZLA 4PMRA 2DT1A 2V5DA 3AHVA 1HJUA 1UZ1A 4WKHA 2UWFA 3IAQA 2X09A 3VIKA 4F66A 4E2OA 1E71M 1UR8A 1AQ0A 1B3YA 3WD1A 4D71A 4JL2A 3SCVA 1MVYA 1WZMA 1EDQA 3EDKA 4W7WA 3ZJKA 2WW5A 4AZ6A 4F79A 2BHZA 2J7EA 2CXGA 1TA3A 1ZL1A 1EIBA 2WNWA 4B3LA 4CCEA 4A4AA 1CXKA 4CU7A 2WVVA 4V28A 3DYMA 4W8BA 1CGVA 4FMVA 1B9ZA 4B9ZA 1W9XA 3UG3A 4PTWA 2GSJA 3N1AA 1QI4A 1LJYA 3CUJA 3TA9A 3EDFA 3IAPA 4NF7A 1OGBA 3T2QA 3ARSA 3G6LA 3WD4A 4AD1A 5AYIA 3AS2A 4AZ7A 1DTUA 1K9TA 3VDHA 1VBRA 1SMAA 4UFJA 1BYAA 3EDJA 1NP2A 4RE3A 3WH9A 1JF5A 1FFRA 3AHZA 3VO0A 2E9LA 2J8FA 1EHNA 1KR1A 1V3MA 1MFVA 1CECA 3PZTA 3I3EA 5GNYA 3WDJA 1NOFA 2WHJA 4EAMA 4XZBA 5EBAA 4URIA 1GOQA 2CKRA 3ARRA 1B90A 2RGLA 5JIPA 1WDPA 5CZKA 4AEEA 2FHBA 4J3VA 2VCCA 2BV9A 2FH6A 1J12A 5CPQA 3WNOA 5A6KA 4ML4A 3O2LA 1UQYA 1XSKA 3RMEA 1C8QA 1CENA 4P7NA 1EOKA 3A3HA 4GO9A 2VVSA 1XD0A 1K9FA 2W92A 1UWSA 2XTKA 1XH2A 4D6DA 4F8XA 3QHOA 4P8XA 1QNOA 1GZJA 1V08A 2DEPA 2WSPA 5BXRA 1KBKA 3ZIZA 1CLVA 4JL1A 1TE1A 5D9MA 1HL8A 1BGGA 1ITCA 4K68A 2ZUMA 1IZJA 1E1EA 1ODUA 4Q7NA 1XGZA 2DQXA 1RH9A 1NWRA 4AZCA 2Q8XA 4R27A 4WF7A 4PMYA 1WCGA 1NQ6A 4HMEA 1M53A 4GQRA 4PTVA 1FH8A 1W1YA 1YHTA 1V3IA 5EB8A 3VGEA 2W91A 3WDQA 4W87A 4UFKA 3BC9A 4TVCA 1WE5A 2WLZA 3W6MA 1FP8A 3DYOA 3W26A 1V6WA 1W9BM 2CBUA 2W62A 2BY1A 3WUGA 2J62A 1ITXA 4WIWA 4AD4A 5DT7A 3UCQA 2J25A 2J78A 1XH1A 1C91A 2VRJA 5BXPA 4U3CA 1MW3A 5A1AA 1QI0A 2EBNA 1LWHA 1GHRA 1JDCA 1EXPA 4ATWA 3VM7A 3AMDA 1GVYA 2VC9A 3CGTA 6TAAA 4W7VA 5LA0A 1CEOA 1LL4A 3CBWA 4JIEA 1VF8A 1QI3A 1PIGA 1VAHA 2DH2A 4W89A 4ATLA 1JYXA 1UR1A 3WH5A 4HMCA 1XRVA 3SCWA 3AMCA 2Z1SA 3CH9A 2PB1A 3G6MA 2VT0A 2JEPA 3M6DA 3W28A 2YLAA 4NZCA 3GYCA 1E5JA 3LMYA 4IISA 5A2AA 1OD0A 2F8QA 5D9OA 1L8NA 3KEHA 4UFLA 5FIPA 5I0DA 1E5NA 3S6TA 3MANA 4E4PA 2CEQA 1E55A 1TVNA 1JFXA 2ZUNA 3AIEA 1QNPA 1JDDA 1WZKA 3AHYA 1QNSA 3RDKA 1KGUA 4LYQA 1EGZA 3WIJA 1EQCA 1UD5A 1D3CA 3AHTA 4P7QA 2VJXA 3T08A 3ZQ9A 2VURA 3AIRA 2VOTA 1HJXA 1HX0A 3AHXA 3FY1A 2D22A 2ZUUA 3UESA 3AS0A 2XVGA 5FOOA 5A6BA 1W1VA 1GVIA 2VX5A 5BXSA 4DUVA 3AISA 3VX0A 1E70M 2WBGA 3LPOA 1PBGA 1ZJAA 1TUXA 1JD9A 1BG4A 2PWGA 5DO8A 2O9PA 4Q22A 1RP8A 2ZE0A 5A8MA 3VIIA 4AD3A 1J10A 2YDSA 2WVTA 2YJQA 3BXWA 4FLOA 4PMXA 4BCEA 4GXPA 3MUY1 1IZKA 3A47A 2OWWA 4JHZA 4AY1A 2EPLX 2E4TA 2J7DA 3WY1A 2XSAA 2WCSA 5HOSA 1C93A 1KCKA 2PF0A 4RE2A 1J0KA 1OGSA 3KE0A 3RILA 1P6WA 1M04A 4AWEA 5A2BA 5HXMA 1OIMA 1EH9A 3OLGA 3CHCA 3BAKA 3WDHA 1XH0A 1JZ2A 5IHRA 3SCUA 3RJXA 1HJWA 4AIOA 2A3AA 3L4TA 4JFVA 4XUYA 3B9AA 4Z2IA 5JIWA 3VGFA 1CGTA 1PEZA 4E8DA 5AYBA 2D1ZA 3WNKA 3WDIA 1QNRA 2BNJA 1VFMA 4Z2HA 1A3HA 4U3AA 5ECUA 2WZHA 3ARPA 4QP0A 1JZ3A 2E9MA 1H0GA 3UG5A 2EEXA 2AOSA 4M1RA 1OT2A 2XYLA 5LA2A 3CUIA 1CTNA 4WSJA 3CZGA 4FK9A 4UR9A 4GKLA 3VOCA 3L4YA 4C7FA 4P7RA 1SFSA 1I1XA 2V3EA 2WCAA 1OWQA 1DEDA 1JNDA 1CYGA 4U33A 2YOCA 3SCQA 3N11A 3GDBA 1MQQA 1GW1A 2WHLA 3BMWA 2WSKA 3PZQA 5BXTA 1JF6A 1B30A 1G1YA 2DSZA 4JFUA 3WH7A 2CKSA 1W1TA 4KRUA 3WD3A 3EBVA 1MW1A 1HKMA 2DIJA 3GM8A 1NWUA 1ZS2A 2W66A 4TVDA 1JGIA 1NM9A 3J7HA 1H1NA 2YIHA 3QGVA 4TVUA 4HA1A 4AZHA 4C7DA 1FFQA 1V0KA 2BHUA 1UH3A 2ZUSA 1W1PA 3UEQA 3EMCA 2HISA 3MMDA 1V6XA 1RPKA 1UKPA 3OLIA 1V02E 1BLIA 3AOFA 3GXDA 2J74A 3N13A 4QLKA 4D6FA
chains in the Genus database with same CATH superfamily
1L1PA 3VD5A 1FD9A 5EYWA 2ZE3A 3UCDA 2OMAA 1TVLA 1P7TB 3A3WA 3DHUA 1GQLA 1EJTC 2Z0IA 1Q4NX 3BGAA 4IP7A 2C1HA 2ZQSA 3VUSA 3W7JA 4RDYA 4Y90A 3KCJA 4Q8VA 4DJDA 1R7AA 1Y5VA 5J6EA 6REQA 4QJ4B 1DJHA 1A4LA 5HW6A 2XSBA 3PZGA 3GDTA 1FKJA 2PWFA 2OO6A 1F3EA 5D2TA 3VKCA 5DO2A 1E0WA 1N82A 2E1WA 1W32A 3F03K 3T0BA 3SGZA 3ONCA 3UZWA 1SZEA 1EX5A 3NQ7A 3AIBA 1PE1A 2ZXBA 5I6SA 3B8WA 4KS0A 5HKGA 4W5ZA 2Z6IA 3SADA 3L4ZA 2Z2BA 1KWKA 2UY2A 3R11A 4IPXA 4ZQCA 1HKJA 1A5KC 1EP3A 5D75A 1MXSA 1PZ0A 4CD6A 1WB0A 2VCDA 3TVAA 3M5ZA 4F4RA 4LVDA 2CBIA 4JTGA 3C2EA 2IMRA 3WELA 4ICCX 4OIFA 1W54A 3W1PA 4LUSB 1PS9A 4ZPTR 1YMYA 3H23A 3OQ8A 5HPCA 4FSAA 3W4RA 2VL4A 2NV2A 1DXEA 4R33A 2C16A 3GNXA 4K1WA 1DWIM 4HBOA 2XPAA 4QISA 4PMVA 2C15A 3VI2A 1NEYA 4G7EB 2BVYA 1X6LA 2XWEA 3GG0A 3V7PA 4GD0A 3GD6A 1KFEA 3LPFA 2YW3A 2QR6A 5CSRA 4F0KA 3N6JA 2GOUA 4W93A 4WK9A 3W7CA 2J7GA 3MO4A 3INPA 3LXCA 5IBXA 2HBXA 3SUTA 3R0UA 3CAKA 1EJUC 2WCGA 3E0FA 4EWND 2O55A 3ZSTA 1NDVA 3N15A 1LWIA 3WQFA 1SYTA 3L2MA 2B31A 1I9CB 2PDIA 1OX4B 1XC4A 5LNWA 1VRXA 3QVQA 2BFGA 2PBCA 4NZ4A 4X2PA 4DPQA 4UOJA 1LCOA 4IPPA 2ADAA 1MXDA 1MUCA 3ITTA 2VRKA 4RUBA 3WF3A 3M0HA 3OTRA 4NL1A 3IK4A 2XGIA 1KO0A 1LLZA 2EJ1A 4DWSA 4B3KA 4C90A 1TV8A 2ALRA 4H4IA 1BF2A 2INZA 2F2DA 3N6QA 3V5CA 3WLPA 2YCEA 3VDBA 2WC4A 4B4FA 4IPLA 3AUOA 1P1MA 2ETNA 2J66A 3VZXA 2EO7A 2QKFA 2AL2B 2Z00A 1F4AA 3V75A 4W8LA 1KBIA 3VNKA 3E2RA 4ZO6A 1HVQA 1XYAA 5H1WA 3QR3A 4OGZA 1H11A 2ZXQA 3H70A 4M81A 4AVNA 1LZOA 2WKJA 2VEFA 3KBVA 2QGYA 3T8QA 3RGCA 2F6UA 2HRWA 2GJPA 3BQ5A 4YTSA 1W5QA 2H8XA 4WRHA 4MUZA 4DM1A 3KL0A 1OEPA 2OQHA 2PZ0A 2H9AA 4PBGA 2JGQA 3S5NA 1KFCA 4W5UA 3GC4A 3LV5A 1EFZA 4J3SA 2NV1A 4S39A 4CNSA 1SR0A 1PDYA 5ABFA 1PYMA 4YHEA 1DIKA 4GC3A 4BK9A 1FJDA 1BL4A 4BQ5A 2L2SA 1Q85A 3H6OA 4XVDA 3RUBL 3GU9A 1U22A 2PRMA 3UR2A 2C19A 4IP5A 1QT1A 3PZNA 3NPUA 4O54A 2WC3A 4D72A 3IPWA 4M24A 4FI4A 3W7EA 4Y9PA 5D9NA 3BAJA 3MVTA 2IQDA 1V7YA 1CPUA 3H2OA 5REQA 5M03A 3GDMA 3L21A 3VIFA 2Z1BA 3QZAA 1H7NA 2WO5A 3DBPA 2J7HA 1V3LA 4JFTA 1R9ZA 3FAXA 1FKLA 4KCUA 3MDUA 2QMJA 3K4WA 2WXDM 3UJFA 2GLKA 3LPGA 3OHIA 1I2QA 2Y8VA 1P4CA 1X1OA 1W1ZA 3D3AA 2ZVIA 2O4QA 2XH4A 1TZ7A 4PZVA 2CLHA 1W8SA 3AXXA 4B5SA 2HVMA 1QPQA 2V8ZA 3K8KA 4UQBA 1H7OA 2G3NA 3TZFA 1I1WA 5D04C 3WLIA 3R89A 4ZOAA 1AH0A 2R1PA 4OUEA 4HSHA 1XV8A 2NXGA 1QO5A 2XFRA 3URNA 5FJRA 4Q3MA 1SFJA 2PC4A 3QSRA 1EJWC 1Q6RA 3GZAA 2V5KA 1PTDA 3A23A 3WYZA 2X7WA 5I3HA 2BXVA 3GVRA 3H2NA 4W84A 1R85A 2VGFA 3N2TA 5FKYA 3THCA 5KETA 4CCZA 2ZA1A 2V81A 1C92A 2QF8A 1XLEA 2CYGA 1XDLA 1H50A 3AS1A 2I7GA 2OZ8A 1BAGA 4C7GA 4KEVA 4QFUA 2XPBA 1PWLA 4PMDA 3KRZA 1JR1A 2JF7A 4IGNA 4TW7A 3VU2A 5I03A 5DCBA 4WVXA 3OODA 3UETA 3WQGA 1UD2A 4HYVA 4WDTA 1ROTA 3WK3A 2Z1VA 1OIFA 2JIWA 4JY9A 1OC6A 1TMHA 5D4YA 4DHGA 1C9DA 3M46A 4KWSA 3QGAC 4Y96A 1HJSA 2VC6A 2NSOA 3DN5A 3VINA 4HU8A 4TO8A 1MRQA 3U8GA 2Q3RA 4QIUA 2HXUA 4IG2B 1K3UA 3AUJA 3NWRA 1KA9F 2B4GA 4PSPA 3QFWA 5CC3A 2GVGA 4BQ3A 3HQOA 2W63A 5JBDA 4X63A 3WQVA 4CKQA 2WLYA 3PTQA 2M1IA 3K4DA 3VIPA 5CGMA 3HIJA 3M07A 2HVNA 1PKLA 3TOYA 5AB3A 2QMKA 5TNVA 1TREA 5HT1A 4HZ7A 5G5IA 5C55A 1S2AA 1M68A 4NZJA 3HG4A 2OSWA 2ASHA 2GVYA 4IFRA 5T91A 3MVIA 3KLKA 5G4EA 1H0IA 1XRFA 4N2YA 2CWNA 3R2GA 2QPSA 3CL7A 4XBSA 4TX0A 2FGLA 2OSYA 1JEZA 4IQDA 5G2WA 2PPNA 1S2WA 3O16A 4DRKA 4H04A 4GNJA 3W1UA 1VFTA 1B3WA 4XIAA 1EYWA 1CBGA 3UT0A 4LQ1A 2NLIA 2NZLA 4OOZA 3SIMA 4UTHA 3EPOA 3B40A 3ZT5A 4UTJA 1FDJA 1QI5A 4O19A 1FHDA 1D7FA 2R1LA 3UZZA 2GJNA 2XUCA 2XVLA 1U1JA 3G0SA 3TN5A 1F76A 3GK0A 4JS3A 5LXXA 1K8ZA 3MBDA 3HO8A 4RV3A 2DZVA 1UMLA 1GOMA 1RJQA 4KCWA 4PUMA 3A9BA 4GZ7A 4YHGA 4ZQOA 2F23A 3Q67A 2TSYA 1MYRA 1AZ2A 1E40A 2J24A 4XB3A 1V93A 1BQGA 1GKPA 4B16A 5HW7A 1YXYA 5BNKA 2GDQA 1N8WA 1QU4A 2JK2A 3VZYA 3OIXA 1G9HA 5K3VA 5AFDA 4W9OA 2GUUA 3TR9A 1ZY9A 3R1ZA 1DPMA 1YEYA 3OJGA 1A5BA 5I3GA 3GH7A 1QK2A 5ENLA 1OJXA 1Q66A 3ITYA 2X05A 3UVAA 4B2DD 1LWJA 2QAFA 2EF9A 4MZYA 1J0IA 5LIUX 5K9DA 2HXTA 5CPSA 2V5CA 2VM8A 3O5LA 4FNSA 1JRCA 3BAIA 1XLMA 4I9JA 4S2BA 2VC7A 4PTNA 1IGWA 3OP2A 3SN1A 3EWDA 1QTWA 3BAWA 2RDTA 2DGAA 3C4UA 4GYKA 2VEKA 2LKNA 5GPRA 4LAVA 3GXFA 4FF5A 1JZ5A 3U48A 4TW6A 1LBFA 1W6TA 4FO4A 1JNEA 1ZBCA 2J75A 3G1FA 4MOZA 4ZVJA 2OGJA 1JPIA 1XI3A 2ABBA 3MPGA 4I5RA 3WQ6A 1D2KA 4GUIA 4JTQA 3ARWA 4OJYA 5DBUA 4MUPA 4XZIA 1GYMA 1AH4A 3KVKA 3B3DA 3RX2A 1FA2A 2FB2A 2PWDA 1Q2SA 3O5QA 1XC6A 2NWSA 5BRPA 1S5MA 3QTGA 4J5NA 2UZ5A 1R9HA 1JPMA 2X16A 1MO0A 4TV5A 3EMZA 3VCCA 4PRRA 2DZBA 3V16A 3HA1A 3PWAA 1Y5XA 3SFKA 1K9DA 1R3WA 3W2MA 1L6WA 3IKGA 1Y8BA 5KINA 4AW7A 3E0WA 3URQA 3O5RA 4L4OA 4O1CA 2J77A 2QCDB 3U5UA 1KCLA 2RDWA 3MZNA 4HN4A 4NASA 1FKSA 1V77A 5FJUA 1TYGA 5I7GA 2VD9A 3C5QA 2E5BA 3GTFA 1MXGA 3RM4A 4FS9A 4RDWA 1JXKA 3C61A 1EO7A 2AKMA 5I77A 2P3EA 2F21A 3ABRA 2E67A 4DWDA 5AYYA 1SGJA 1RA5A 3UPWA 3WJWA 5DMYA 4DX3A 4MPQA 2IKGA 4DUOA 4JKLA 5HQMA 1ME7A 2A0NA 2QCHA 4QS5A 2NVCA 1E6QM 1TPVA 5E0FA 3ERPA 3M0KA 3TA6A 3HJEA 2F38A 3UY8A 3PB2A 5G1MA 4Z2KA 4Z0JA 3COTA 3NQCA 4N42A 1KFBA 3LSBA 5EFFA 3WFLA 3DEQA 2BVTA 4KKXA 1EHAA 3MDYB 1BYDA 2Y85A 5CXPA 7A3HA 4EK7A 4BWLA 1E4IA 1QPNA 3RLGA 2MLXA 2OYKA 1VJSA 1VEOA 2G3IA 1TX0A 4AC1X 4PCFA 2HCVA 3TLQA 3N12A 4GYFA 4FR6A 3SCSA 3U7BA 1SO6A 1E51A 3RPTA 3W1TA 1LOLA 1HL2A 2YCLB 3HG2A 2WMHA 1J2WA 1YTDA 3LPPA 4RDZA 3W6YA 3WZ0E 2GFTA 2D0GA 1MQPA 4H9MA 4LRTA 5EMUA 3HN3A 3DC0A 3LN3A 3TOPA 4GRSA 3TEVA 2OJPA 3BCDA 4XZWA 4IX2A 4XX6A 1C3FA 4ACZB 1D6OA 1TTQA 3AZTA 3CYVA 3LU2A 4H9ZA 4DZAA 3TYDA 3JRKA 3KRBA 5JBFA 2WSRA 3KDNA 3U2ZA 3TTYA 1TWDA 4NYUA 4MNKA 4AZ5A 1HO4A 1WBHA 3STGA 3N2OA 1GYNA 3M4HA 3T07A 5JMUA 3FGCA 3K8MA 4X60A 4OHQA 1ZP4A 1JCXA 3WBYA 1MEIA 1WYIA 3MSGA 4UTFA 3W29A 3CZEA 3OBAA 4FZIA 4F40A 4MHBA 4GY0A 5CGTA 4NRSA 4UQCA 2PDLA 3P84A 5HMSA 2V5JA 1TCOC 3PULA 4ZS6A 1GEQA 4IH3A 4YTQA 1A3XA 1D7KA 1CXHA 3UJEA 1XGEA 5JH8A 3BJTA 1WO2A 5ABEA 5E0CA 1MUMA 1UCWA 2QNEA 4M29A 1GUVA 3PBVA 3XINA 5DCEA 1JPHA 1YPFA 2PCQA 3BG9A 1A5NC 3USBA 4HBKA 3CMGA 2X42A 3NQAA 4Y9OA 3AXMA 4C65A 1IYXA 3MKCA 3FA5A 4PUDA 4A2SA 3EWBX 1ICPA 3ZJ6A 3K2GA 4D8ZA 2PWVA 3C0LA 3FLUA 2XP5A 1Q2RA 4LBSA 1ZGDA 4LF2A 5D02A 1FWAC 4H8VA 4JKKA 4LB3A 4DPPA 3IK8A 3REQB 3ZR4A 1WDSA 1YLVA 2EJAA 4AZIA 5KZMA 4H9VA 2Z6JA 3BMBA 4H6QA 3TCSA 1XKJA 4H9UA 4KFNA 1ALDA 3GNDA 1SSDA 2V82A 4F0HA 3VCRA 2VGBA 4JFLA 3VC5A 2FPVA 1FKKA 2OEJA 3S9IA 4DI8A 4QS6A 1PPIA 2B0MA 4HK7A 3FA4A 1YNPA 1Q6CA 3NSMA 5FCZA 1HJVA 1UG6A 2QGHA 2XH0A 3T6CA 4UNKA 4M6QA 1JIBA 4M8UA 4JFKA 5D03A 1S39A 3WEOA 2QPUA 4RZBA 4IFKA 3LQLA 3CL8A 4WJEA 1CB7B 1DORA 2ZR6A 2QJMA 2XISA 4KR0B 4C6LA 3EB2A 1DWAM 5IXEA 1AK5A 3ITXA 2OQYA 2PAJA 5AOUA 2A6LA 4WKFA 4DRHA 4GI6A 3AMKA 5A8PA 2OX1A 4NT0A 4LJ3A 5M17A 4HARA 1Z32X 2J4GA 1ADDA 4DO4A 5A6JA 5HDRA 4CN4A 1LOSA 3KDOA 3II1A 1UWIA 4QITA 4N9DA 2O0TA 1CW2A 2X1SA 4HNUA 2ZR5A 4IMGA 3SUVA 4ODQA 4IXXA 1HNYA 3IANA 3UERA 4IXHA 1G6CA 2CBJA 4BY3A 1D8WA 3M0JA 5HQEA 3DUGA 4WSHA 4DUXA 1OADA 2R14A 1AW1A 2C7FA 3QY7A 3LCIA 5CG0A 2PDBA 5I06A 1AD1A 4PA8A 4NJKA 2PDWA 2OO0A 3DU0A 2R8WA 4NAFB 3EWYA 3A6OA 3C8NA 1M9HA 3LRLA 1Q6LA 1TKKA 1OT1A 2WNQA 5D8WA 5FJJA 4PMJA 1WXJA 1XYMA 4EE9A 3PFMA 4FNQA 3WFZA 5AHMA 2DV0A 1P7TA 4FA3A 3A21A 4QTGA 1B57A 2DUZA 2R24A 3WBXA 4O8RA 3PBGA 1RZMA 4GINA 3S1VA 3BGGA 4PB5A 3LLFA 3DIPA 3S2JA 3E2SA 2DZPA 1B2YA 3EOSA 5GJPA 1TV5A 2ANUA 2VDHA 3W7RA 1OFEA 3DESA 1ZALA 4ZTXA 3WJSA 4MYAA 1DXFA 3WLSA 3E02A 3T0AA 1OCQA 4M7TA 2WZEA 2Q8LA 1POKA 1AJ0A 4FXJA 4CEXC 4AHOA 4PR4A 2ZX9A 1AMYA 3ZJ7A 1ZHAA 1VIWA 1V02A 1K70A 1MSSA 2VOMA 2IXVA 3SURA 4CU6A 3D5HA 1J11A 1UWRA 4CNPA 4H2CA 4ZODA 3CV1A 3CUGA 4O10A 1ELSA 3WQCA 2WKLA 1K8CA 4MYXA 3ABXA 3TJXA 2OFNA 5BU6A 2GDUA 1PVNA 3JVAA 2XPKA 5HJYA 3UI4A 3NJ3A 2HJPA 2VX7A 1JZ4A 4PE8A 1L6SA 1B3VA 1KW1A 4LUSA 4R34A 1M03A 1UP3A 4X2RA 2OYLA 2WJFA 3W24A 1R3YA 1FWEC 1FWCC 1EYMA 4E5TA 2WZTA 1ISVA 3NEHA 2KR7A 3OLDA 1HO1A 1KBBA 3U7VA 2ZUTA 4MTVA 3T4CA 4AC7C 4E6MA 1P0KA 4WEVX 3M64A 2Q6ZA 4LS0A 1XIMA 3S83A 1B5TA 4HPNA 2XVNA 4WGHA 3AZSA 3AS3A 2BVDA 2VELA 4AVFA 3CV2A 1CZ1A 3GR8A 4QJ3B 4ZQRA 1Y0OA 4ECLA 4JHOA 3GU2A 1EX1A 3RCMA 4DXXA 1UYQA 3HOJA 4H1ZA 1LG2A 3IJDA 4FF7A 4RW3A 3WNMA 3CIXA 3DAQA 1UZHA 1R3VA 4ODNA 4C6DA 4HBEA 3B9EA 4JOMA 5F4SA 1A80A 1W3TA 2J8GA 1XFCA 1NF0A 2C0HA 3MO7A 5DEZA 1S5VA 3RCNA 3EGJA 2EPMX 1OX4A 1PO9A 1HJQA 1O1HA 2PDQA 3W38A 4CU8A 1GTHA 2DG3A 5IOBA 4GIEA 3AMGA 2CLOA 3TWBA 4XAFA 4O57A 2YFNA 3H7UA 4DB7A 1OCJA 1TSIA 3F4DA 3GYEA 4HNNA 3OVPA 2IUZA 3W81A 2VHLA 3PTMA 2VGIA 2WB5A 3OBKA 4KEUA 1C7TA 4DT4A 4LANA 2J7BA 1U33A 1MMFA 2V38A 3N19B 1WZLA 2NX3A 4PMRA 1TB3A 3U2CA 3CT2A 3QY6A 3F4NA 3TIMA 2QYGA 4WKHA 2UWFA 1YXCA 2AL2A 4IPIA 3SN0A 2J9YA 4F66A 1E71M 1UR8A 1P5QA 4O0ZA 3GHRA 3SCVA 3P62A 2Y88A 3CV6A 1TRIA 3GTXA 2BHZA 1XLCA 2WNWA 3MWAA 3NQDA 2QF7A 3V0UA 4IIGA 4KWWA 2PTXA 1T41A 1DJWA 1F9CA 1BTMA 2H3BA 3DYMA 4W8BA 4XZHA 1FKXA 4LY4A 4AUBA 1Q45A 2QCGA 3ABSA 4KFOA 1W9XA 4D9PA 3OU8A 2E5CA 1QI4A 5E1QA 3TLLA 3DDMA 4LVAA 3EDFA 4MM1A 1O66A 3IAPA 1OGBA 1XIHA 3WD4A 1S2CA 5AYIA 4LS1A 3VDHA 1DE6A 1QASA 4JYSA 4LOCA 3C56A 3EDJA 2WSYA 3W76A 1KM5A 1JF5A 3O06A 2J8FA 4PRTA 3K1GA 4WX2A 1EL3A 1SO4A 1MFVA 1CECA 3PZTA 2UZ9A 3KADA 2KZHA 2WHJA 4EOUA 3GHUA 1QXLA 2XIQA 4C6CA 3DERA 3ARRA 1B90A 4FXFA 2QVNA 4YL2A 1J12A 3FCPA 3N4FA 1D7JA 4Z1CA 3WNOA 1B4KA 4P7NA 1EOKA 2CLEA 3BLFA 5F2MA 3PBMA 1DTNA 3TW7A 4US5A 2W92A 1UWSA 1XH2A 1M3UA 3QHOA 1Z7AA 4Q4SA 1V08A 4XK2A 1DQUA 3NL6A 5I3JA 3GW3A 4K68A 1M41A 1E1EA 1XGZA 4C1NB 4LF1A 1MI3A 2X2GA 4PMYA 3RR4A 3RO6A 4KIRA 3CQHA 2HE8A 4HMEA 1M53A 4GQRA 4GH3A 4O12A 4DYKA 3TCZA 3VGEA 3BTNA 4IMFA 5I98A 3WDQA 4FIQA 2BZNA 4W87A 4Z1AA 2WPBA 3BC9A 2WLZA 1PZ1A 1NTHA 4N9EA 1VP5A 4ALDA 5TAOA 1W9BM 4OBTA 2W62A 2WZMA 1JCHB 3WUGA 1ITXA 4WIWA 5DT7A 1XH1A 5D2XA 4B5VA 4O53A 4LV4A 1A49A 4GGHA 2XIOA 6ENLA 5BXPA 1NQKA 4N02A 1MW3A 3TNOA 1QI0A 3H2MA 1FKIA 3O1NA 1J93A 1TJPA 4Z17A 3MUCA 2VC9A 5LA0A 4W7VA 3HFYA 4NNAA 1QI3A 1VAHA 3FJNA 4G2PA 4W89A 5F4XA 3SCWA 5I3IA 3AMCA 3GIYA 3ABQA 3QMTA 3G6MA 3OG3A 2VT0A 4NX0A 3RFAA 2JEPA 4UXDA 4ICNA 1UOZA 3N2XA 3GYCA 3N34A 1PB0A 4IISA 5A2AA 1L8NA 4UFLA 5D05A 4AWSA 2MNRA 1S5NA 3MANA 5TIMA 2QDEA 1RAKA 3RHGA 4M5PA 3LM3A 4IT4A 3AIEA 1EWDA 3A4JA 1XLGA 1L2UA 4LAKA 2DORA 4MGGA 3IIOA 4BI5A 3I6CA 1EQCA 4Y8FA 3GY1A 1X7FA 2NV9A 3HPSA 3AHTA 4RKAA 1P0NA 3EPMA 1DIDA 4ODRA 3FFSA 2TYSA 3ZWTA 3T08A 3AYVA 2VURA 3AIRA 4U4MA 1HX0A 3AHXA 3W7IA 2NVAA 5DITA 3UESA 2HVOA 5CZSA 5FOOA 5A6BA 2Y5JA 4DUVA 2P10A 1YNQA 3ZZ1A 2ZFAA 1TUXA 1TPUA 3OQEA 1ZTVA 2PWGA 3GS6A 4M7SA 3FYYA 4UC5A 4XO7A 4HGXA 3V5FA 2ZE0A 3O5JA 3MDWA 3VIIA 2YJQA 3ZS4A 3EOUA 1TUFA 3BLDA 4GXPA 1H60A 3MUY1 5H6HA 5HULA 4A8LA 1V79A 3IGHX 4AEOA 2XSAA 1F73A 4GNVA 1ZFJA 2X7VA 5C9WA 3RILA 3RMJA 3NRKA 5HXMA 3UXDA 3OLGA 5DY3A 1KV5A 3WDHA 1XH0A 4JTIA 3V0TA 4GHRA 3PJWA 3LOTA 4ZB5A 3SCUA 4BF5A 2GOKA 4XO6A 4EF9A 4IIFA 3LY0A 1ADOA 3EA3A 1JQXA 2BNJA 1VFMA 2IF4A 5ECUA 2WZHA 4H7ZA 3WQOA 1JZ3A 3KOXA 2DZWA 2DZUA 3CPRA 1OT2A 1GVOA 5DXYA 3QBUA 4L65A 4GABA 4WSJA 2QCCA 2A6NA 3CZGA 4FEZA 8TIMA 2CZEA 4WY0B 3W2LA 3UVIA 4UUIA 2WCAA 1EJVC 3NZ1A 5F2IA 2YOCA 1QPRA 3ITVA 1MQQA 4X22A 2WSKA 4LVFA 3DBNA 1JF6A 1W5MA 1G1YA 3WH7A 2CKSA 1W1TA 3LTYA 3N3TA 2DVXA 4KCTA 4O1AA 2DIJA 3TC6A 1PCWA 3PWGA 1QOPA 3AO0A 2GWNA 2W66A 4LB4A 3QGVA 1EKOA 4UDMA 4E8GA 4QE5A 3NL2A 3VA8A 1UH3A 4EXBA 1RPKA 3SBFA 4Q4OA 4NX5A 3S9ZA 2GWGA 3TJLA 3T7VA 1XUZA 1X8FA 3IVTA 1OVDA 1T7LA 4Y7EA 3U3HA 4A3QA 2ZTKA 1WKYA 4XIMA 4H6EA 3NSXA 4P61A 3AIUA 2HE5A 4W9TA 1SJBA 1TTIA 4MJ4A 2OKTA 3UZ5A 1SVDA 5DMMA 1TPH1 4ZEPA 1JAEA 3CZKA 3PK7A 4R0XA 3I7QA 1A0CA 5A8QA 2VC5A 2JEQA 4CUCA 1FXQA 3SUUA 3EWCA 4CQ9A 4EP8C 4KT2A 3WLLA 2QV5A 4AWTA 1C9HA 4MAZA 3VIOA 4F9JA 1FQ0A 1RCQA 3WSUA 2J8TA 3MWCA 1DQXA 3PJXA 2IS7A 2PDHA 4OT7A 3MHUA 1OF8A 1GHSA 1UR4A 4W7UA 2PTYA 2LGOA 2OFJA 4AD0A 4YYFA 3P2VA 3TN6A 2AGKA 3JR2A 1L2QA 2BY0A 1O12A 3TP4A 1W1A1 3BSGA 2IPWA 4QIBA 3GFXA 1HXJA 3AAMA 2PWHA 1C8XA 2YXOA 2QCDA 4TTGA 1K1DA 4G7FA 5C6MA 5AHFA 1G67A 1PHWA 4YLWA 7XIMA 3QV9A 5D38A 3F2DA 3NPVA 3KOYA 1KM0A 3LLDA 4RNHA 3FW6A 3BE7A 4BEUA 4ERIA 5HUOA 2V68A 4V1YA 5DLCA 3G18A 4JQ3A 3U57A 5CPMA 3G1HA 3UD6A 1OX6A 4FOUA 4KWOA 2WBKA 1E6RA 3QPYA 4XD3A 3GLCA 2C14A 4Z1DA 1DHKA 1AD4A 2PPGA 4Z2LA 5D2VA 4Q8QA 1OINA 5FSEC 1Z9AA 4LAMA 4F0RA 1TCDA 1QPKA 5J5DA 3L4XA 1CLXA 5G2HA 1Q6HA 2D2HA 2I57A 3VGDA 1UJQA 3QHNA 4A3YA 1FCBA 1Z48A 4YVPA 1JCNA 5BWFA 2Y7DA 1H2JA 4FLQA 3A4WA 4ACYA 3R58A 1FTXA 5EBUA 1LOQA 4HOWA 1OM0A 2BASA 4TX6A 5DIUA 1S5WA 3VOIA 4CVUA 4EAYA 3OVGA 2YCLA 4GH1A 2V2DA 1JULA 2JF6A 2PLJA 4EPKA 3MQTA 4WQ6A 1YQ2A 3STPA 4HU4A 4MPKA 1TPFA 1HTIA 2EG7A 3C2VA 1AW2A 1R2RA 1R30A 2ISDA 2VRQA 4B9YA 4DY1A 4AYSA 2FZDA 3H9RB 1GGOA 1JL8A 4ACZA 1OFBA 1MZRA 4S3KA 4DRIA 2QULA 2V9DA 1OFRA 1MNSA 3DHFA 2EPOA 1TWZA 1BWLA 4DLFA 4PL2A 1ZK6A 1EUAA 4B91A 1VLIA 3EX3A 4HYWA 1YRRA 2REQB 3EX2A 1PKYA 3WJXA 3TC5A 4MJ2A 5CG7A 3S2MA 1SW7A 1QR7A 4QSHA 1QPFA 1GVRA 2WQPA 3VKBA 1FCQA 4FLRA 3E1F1 3BGJA 3WLHA 3RM8A 1REQB 2KGJA 4PCTA 1FOBA 2Y2WA 2E6DA 2J27A 3E9AA 4DWSB 3Q4DA 1TMQA 8XIAA 4IWWA 3GTYX 3UG8A 3GFZA 3VNYA 4PB4A 2QUNA 5ABGA 2O92A 4N6EA 4YPJA 2ZR4A 5E09A 3GH4A 1VBUA 1JNSA 3VIGA 4J3ZA 1UKQA 4YCPA 4L1GA 3GKAA 3H7RA 3MCOA 1J5TA 2WM0A 1F05A 5AY7A 1JJKA 5DCDA 3T44A 1WOBA 1RK6A 1TZ9A 1JD7A 1M7XA 1X6NA 3STCA 4C6PA 4TYOA 1GVFA 1J6YA 2XVKA 4WY0F 4PH6A 4UR8A 2YL5A 5HMDA 2GGGA 3FHQA 2H9AB 3G1SA 4HKPA 4IICA 4PULA 3REQA 3UGVA 3GVQA 4JFWA 4HT3A 4KWVA 4DZHA 3R25A 3W73A 1LL6A 3SUSA 3ZT6A 1VCGA 2RUQA 2Q09A 4AMCA 2YA0A 4OV9A 1MWOA 2VZSA 2XHYA 4D6EA 2OEMA 3VD9A 3UXKA 4Z2JA 4XBKA 3NM3A 1R86A 3FKRA 1QW8A 3V4BA 4GBDA 2CLPA 3O6AA 4JTLA 5HR7A 3N9KA 4NSBA 4NXKA 2H8ZA 2TPSA 1T8QA 2JKPA 3CLWA 1XDMA 5HWJA 2X0HA 4ZXOA 4JFIA 1ICSA 3M16A 1FKTA 1CDGA 3L9CA 1UMYA 4FB7A 4HK5A 3UU0A 3KP1A 1P0EA 2XVPA 3BARA 3MMUA 3QFEA 1B4EA 1ITUA 4MY1A 1XIDA 3W2KA 2C6QA 4GZEA 2KE0A 3TE9A 1E44A 2ZTJA 1F8AB 4EANA 4KH2A 3WUEA 4NJIA 1E6XM 1XD1A 3HV8A 5I23A 1BVNP 2QUUA 2PI6A 1DE5A 4UFMA 2YXGA 4P8UA 3WL0A 1UPMB 2Z26A 4U28A 3DX5A 2ABAA 2PDFA 3CQKA 3VNZA 1J4RA 2GQ3A 3AXIA 5D33A 1SJCA 1Z44A 3A22A 3EZ4A 2CC0A 1EZWA 1L8PA 1KXHA 2R1MA 1KLYA 3BMXA 3P8IA 3LHUA 2D24A 4DF0A 1VFHA 1JI1A 1NOWA 4S3CA 3MKVA 4A35A 3I6TA 3LM7A 4ZA0A 3W02A 4F2BA 1E9LA 2Q5AA 5XIMA 1VR6A 3W01A 3KX6A 4JD4A 4GISA 3UR8A 3WNNA 4M19A 3R8HA 2ODOA 1M5WA 1TPEA 3HJZA 4LNYA 2H90A 5C5YA 4IT1A 2DJXA 4ES4A 4AFYA 4I5XA 3MMWA 4ZB2A 2RH9A 4ZO9A 4NAFA 1H51A 2Y78A 5CGQA 2ZX6A 3EAUA 1VIZA 4A2RA 3HM7A 3FEMA 1MRAA 4DBSA 4DYEA 2DSVA 2G4FA 1LDCA 1PWMA 1XYFA 2DVUA 3CU2A 1RJRA 4PB3A 3MT1A 3FJLA 3A12A 2EG8A 1XIIA 1TVPA 5CPTA 2NXHA 1B3OA 2WMFA 3UQNA 4L56A 3SECA 2V2HA 2DIKA 3G1AA 4P7OA 3DH7A 4JYEA 4DM2A 1R2SA 6A3HA 2GGHA 3TXVA 1PZ2A 1X1ZA 4FPSA 2W27A 2IPGA 2FTYA 1LBMA 1EF2A 3C6CA 3IVUA 3H12A 3GTIA 8RUCA 3RPMA 3VD3A 1WUEA 2VQUA 3LCGA 3POHA 2JQXA 4GIYA 4C6FA 2Z25A 4ZOCA 2PDPA 3MYPA 3GNRA 2MLYA 3H53A 2E77A 4YN5A 1WDRA 3O5PA 2X40A 4RX0A 4U5KA 4OV4A 3UWYA 3K13A 1UOKA 4JN7A 4FXSA 1AW5A 1ZB5A 2BS9A 4ZOEA 4IX0A 3GTNA 1AODA 1I0DA 4OUIA 3WBAA 1RQHA 1QWKA 3TSDA 2HWGA 3L7RA 2VX6A 5HBFA 4CNUA 2J88A 5CH9A 3CHDA 1FWTA 4DRSA 1GZGA 4HNCA 4KETA 4AG0A 3VNLA 4MDOA 3HV9A 2GJLA 5IDIA 1E6SM 3WK2A 2DW7A 4RZ6A 1W1B1 2ZX5A 4LY8A 3FJ4A 1H1YA 3R5EA 5T8GA 2FHFA 4MLJA 4XAGA 3I3DA 1XM3A 5FA5A 3PG9A 3KL5A 3E0VA 1UWAA 3CAWA 3CXOA 3SEPA 4UQAA 3NFUA 2RUSA 3F1QA 1TPC1 1C8VA 1Y65A 4D6GA 1KRAC 5HNTA 2NWRA 3CIVA 1IT0A 4J35A 6ALDA 4MNJA 4NAEB 3N3MA 2RHGA 1CGUA 1XICA 2ZUVA 1BKSA 2QJGA 3P60A 4JTUA 4QDMA 1U5HA 3G1YA 2JBMA 3LMZA 2MF9A 4Z08A 1K9EA 3PUDA 3WDRA 3EDDA 1VPXA 4DRNA 4XAYA 5RUBA 1ZBVA 3A5FA 2XGZA 4UTLA 3VNMA 2DSUA 3H2CA 3KBJA 4GI4A 2G3JA 1JUKA 4BI6A 3DFQA 2R9RA 3NDOA 4K38A 3KBSA 1XCXA 4JKMA 2X8RA 4W8AA 4UTTC 2DVTA 1MQRA 4O50A 2RAGA 3V35A 3LZ3A 3H4GA 4S3AA 1XLFA 3QTPA 1A4MA 3RITA 1VCVA 4U31A 2FTWA 4IGSA 2QJJA 1TQXA 2XP4A 1DYSA 1FHUA 4RL3A 1QHZA 4QLJA 2X1RA 1LYXA 1NFGA 3PN8A 4YTTA 3P82A 4FNUA 4L3NA 3AMLA 1E0TA 3HZ3A 3AC0A 2WPGA 3GR4A 3SQSA 4GPNA 2CFFA 1C90A 3TQKA 3VNIA 4FNRA 2D0FA 3AU6A 5I02A 1Q7ZA 4UQDA 3WQ4A 4O18A 1BQCA 3QY8A 4HOZA 4AX7A 4FLSA 2FB3A 1MNZA 1F4HA 1GQIA 1Q4WA 3ARQA 5GQBA 4ZSUA 4WXYA 4E3VA 3VKDA 4K39A 2G37A 1GK8A 2I5QA 4K8EA 3CQ0A 3GB6A 5D9PA 4LTSA 4I3GA 2V67A 6PTDA 1AQMA 1VPYA 2HK0A 2WJDA 3NPWA 2NX9A 5CAKA 4Q4QA 2CERA 3EB3A 1HKIA 2D0HA 3SSZA 3W2NA 1EOMA 3PRDA 2ZKMX 3DGBA 2QV4A 4HPJA 3MCNA 2E0PA 4DF1A 5LXEA 5ABTA 3VAVA 2BVWA 4MB3A 4BF9A 1WZAA 3K8LA 2QCEA 3KVMA 4L6DA 1J01A 2FDSA 5HNRA 4QJ1A 3QRHA 4C6IA 3E5PA 1RVKA 3EDEA 3I4KA 4U2ZA 3PPGA 3IJ7A 4DRPA 3OGRA 4N0RA 2GUBA 2A5HA 1EDGA 5FF0A 3W0KA 5I07A 1NJJA 1LT7A 1X1NA 3P8JA 3Q37A 3W71A 1RALA 1IWAA 3T40A 5TF0A 1ZSXA 1MEHA 2V3GA 5HJLA 4S23A 3VOHA 4QJ5B 2ZWZA 2MUCA 1K6WA 2E09A 1KGXA 2FGZA 1J18A 2OU4A 3RLVA 1TG7A 1KXTA 3A9IA 3W84A 4IGMA 3KW3A 4POCA 2PLKA 2ZBTA 3I10A 3W70A 1UR2A 4EF8A 3PJTA 1JZ6A 4YXGA 2O7QA 1XLKA 3ZR5A 5CJ5A 1KM2A 3CZ8A 4PMZA 4XZLX 5LIYX 4HNOA 3KM8A 1JG9A 3O6CA 4ZE5A 2ITKA 1RUSA 1QK0A 4IT6A 3UWEA 3FA3A 5HWNA 4GVGA 2VFIA 2IKHA 1O7AA 2ACQA 4DIPA 4Q4MA 3MJYA 1SO3A 1H5YA 1TIMA 2QJIA 1T6MA 4PTXA 4I7VA 2QCFA 3GIPA 4GUJA 3GBDA 4TXEA 2E5DA 3OBEA 5U7SA 3KBNA 3TUUA 3TTSA 3O9NA 1PX4A 1V51A 3MKKA 2NUWA 4DJFD 3SCRA 3PA7A 1NSJA 3P93A 3LZ5A 2X2YA 3WQEA 4ZENA 4WDUA 2C18A 2RUDA 3WH8A 5CQ1A 3NZGA 1E9ZB 5F2GA 1GONA 3LENA 4WJ8A 1F5ZA 3GUWA 3AYSA 3JU2A 3OYZA 4Q8UA 2AAAA 3L5AA 5H2ZA 2G3MA 2Z2AA 4FOJA 1V3HA 1IGSA 4V15A 1EZ2A 4IL2A 3ZFHA 1EYEA 1W9VA 3IK2A 1R3QA 1BFNA 3M7WA 3CPGA 5B7YA 3DECA 6XIMA 1Q6DA 3SI9A 4ODKA 4UZSA 3KWXA 5AHLA 3QKZA 1XCFA 2GK1B 4XSMA 4PUUA 2R82A 3P67A 5FACA 2B7PA 3ZOAA 1ONEA 4OQVA 3OZOA 4FXRA 3R8RA 1GKQA 1GOWA 5A69A 1K8YA 4Q4RA 5CZ0A 2Q8ZA 1D3HA 4TV6A 1IEVA 4BS0A 5CJNA 2DIEA 4O52A 4DXVA 3DENA 3RN6A 3OZPA 3FSTA 1DJIA 2GJRA 3S5OA 4UTIA 4QZVB 4JEQA 5G1YA 5EY5A 4Z0SA 1XXXA 4GKTA 3ZJ8A 5CBBA 4E2BA 3S8HA 1ZU8A 2WANA 5LIKX 2JGYA 4LYRA 3W2UA 5C2XA 1XKYA 2X0SA 1BTCA 2Z1XA 4PBEA 2V5BA 1JYWA 3EXSA 5I3DA 4A3HA 4JAWA 4Z2GA 1NDWA 1A5LC 4GIRA 5A3HA 4J28A 1HP4A 3QC3A 1GJUA 4BI7A 3CC1A 3P3BA 4A22A 2WZIA 4MWAC 2UBPC 3CEUA 5F7UA 3UWZA 3E3HA 1G4TA 4O8AA 4TMCA 3PR9A 2VR4A 3H54A 3AXHA 1TO3A 3VDGA 2HZGA 3ARVA 3RGTA 3B0VC 4UFIA 2BDQA 1IXPA 3AU2A 3EKLA 3O5GA 5CKSA 2GGJA 4HZ6A 1CXIA 4GQQA 5AC4A 1KCXA 4WLCA 3NDYA 3KAFA 3F7JA 2VZTA 1U5JA 4WY0A 3IVSA 1RXOB 5CZJA 3N29A 4QAWA 1FKWA 1T99A 1KBJA 4RZ4A 3PZMA 3F4WA 3MCMA 1ISZA 3TJIA 3FJ6A 3VDAA 3W6LA 3GXPA 2XP6A 1YATA 1H49A 4DRJA 2DFAA 4A21A 1ZNNA 4K37A 5A6TC 1CB2A 1UH4A 2OWCA 4QGCA 4BZYA 3TW6A 1PHQA 3BW3A 3SB0A 3C3UA 2NSXA 2RSEA 1OF6A 1RA0A 2C3ZA 2XP9A 4XG1A 1FHVA 4G56A 3M43A 3VVGA 5PTDA 1I8JA 4TTUA 1PV8A 2VGGA 2A1YA 4QQ3A 1VD6A 3GR7A 3S47A 3FN9A 4G5DA 1BD0A 1NF7A 3GO2A 3P80A 3SW6A 3TZNA 5G2IA 1B31A 1CGXA 4DJDD 3W7LA 4C5YA 4HA0A 1XIGA 1YE4A 2BBFA 1YX1A 2BG5A 1BKFA 3M44A 5HJXA 2WYSA 1QW7A 4LU0A 2O7SA 1WKFA 3TNBA 3EWWA 4WZHA 5I78A 1KRCC 3OA5A 3O63A 1FWWA 1LLOA 5AC6A 4WDXA 3W1NA 4AZBA 1NFPA 4RLIA 1RD5A 4OOUA 2P88A 1PTGA 1J0HA 3KZPA 3T2PA 4UOQA 1WDWA 5HINA 7ENLA 2AMXA 1P1XA 1DWHM 5TD4A 3FNDA 4N6FA 2I16A 4O17A 2PV1A 3TONA 4J2PA 3GC2A 4C1KA 5D2YA 1UC4A 1BG9A 4QX4A 1UH2A 3O5FA 2FPTA 5C7HA 2NQLA 2HBVA 4C6OA 4PCSA 2CCRA 1ZZMA 4I8DA 2YFOA 5E6YA 1WAWA 1V5XA 4JICA 5C9RA 3CWHA 3GG1A 1B0IA 2F2HA 3LLXA 4JY8A 1SSGA 4LYPA 4QR6A 3MP3A 2ZADA 3HFTA 4OWGA 1KFWA 3EWUA 3PZOA 2OR2A 4M1BA 4PUEA 1E1FA 4W9PA 1O94A 3VILA 4UCGA 1KXVA 2ACSA 4Y6GA 1ZPTA 3QH2A 1UR0A 5GNXA 4X9YA 1HXVA 3UZYA 3VIMA 3DOPA 2KAUC 1UA7A 1TCMA 4N19A 3UWVA 3SQLA 3IWPA 2YL9A 2ZCGA 4CQCA 1Q1CA 4LXFA 3BW2A 1HIZA 1CWYA 2OB3A 4WXZA 4OBSA 4XTIA 5C0QA 1UC5A 4RR4A 3VM5A 3W7HA 3MTWA 5T9CE 3O3RA 3VPLA 3UW6A 3QOKA 3WBWA 4AH7A 4A3UA 3W7GA 4G50A 8CGTA 3L12A 3WUBA 1DIEA 2VZOA 3WMBA 5I09A 4ERGA 1KLZA 1S46A 1DJYA 1W91A 4FIRA 4JTAA 3TV8A 1JVNA 2QHAA 4LUIA 4J3XA 3ATZA 4K8HA 3L4VA 4YWIA 5H8UA 2FQIA 1H63A 1R2TA 3O5MA 1R3RA 1XRSA 2EKGA 5HPOA 2O9OA 4DAFA 2Z27A 3LXBA 4E8CA 1GW9A 3K4AA 1XYLA 3UGRA 1DIOA 1TV2A 1FRBA 3ISIX 3CHFA 4IUGA 4W85A 2Y5SA 1W37A 2YDAA 2J13A 4WD0A 2AQWA 2YZ5A 4CQAA 2V5DA 3AHVA 4Q6JA 3IAQA 3EXRA 1U1UA 1ZJIA 1XPGA 5C9UA 5LGXA 4GUHA 2PUZA 3DFOA 3ZJKA 3ANUA 2PV3A 1OYAA 3MMTA 2REQA 3TYEA 2WV8A 1IR2A 4XQ6A 1CXKA 4A4AA 5LNUA 2DUAA 1GVQA 3LHZA 4CU7A 5DXXA 1REQA 5JVLA 4QHRA 4FMVA 4LUYA 2PMQA 1B9ZA 4MSPA 4B9ZA 1TWWA 3IV8A 5DX7A 1LJYA 3H24A 3G24A 3PY2A 4NF7A 1KT0A 3OZYA 4B4HA 3KCOA 3T2QA 3ARSA 3N25A 3R12A 3AS2A 1DTUA 4IL0A 2UV8G 2VR2A 2DG4A 4HIBA 4RXFA 1AFSA 2QJHA 2VFGA 2Q02A 3T8LA 2E9LA 4W9QA 2GPTA 3I3EA 1EP2A 3WDJA 1NOFA 4EAMA 4XZBA 3APYA 4LNCA 4AQLA 3LBMA 4URIA 1O5QA 1KD0A 2RGLA 1Q5MA 3PTDA 4GJ1A 4HNTA 3YPIA 4G6CA 4AEEA 3O5OA 4Y2WA 4GNKB 2VCCA 4MFEA 2BV9A 1YW1A 1Q7QA 3GXNA 5A6KA 4ML4A 3MP4A 1EGMA 3O2LA 1UQYA 1O5KA 1R3SA 1C8QA 4PC8A 5HK4A 3H4WA 3FYPA 3IIVA 2VVSA 1K9FA 3ZWSA 3VFCA 5HMEA 2FZMA 4FAMA 5LZLA 3DGRA 3LI0A 4JIRA 1OCNA 5EMLA 2FVLA 2DU2A 3TYBA 4Q4KA 3EKGA 3ZIZA 1PL9A 3LNPA 4JX4A 3H2FA 2VXNA 1OFDA 2DQXA 1RH9A 4W4QA 3ITGA 1WCGA 4DQWA 4IF2A 1W1YA 3GSMA 1KM4A 4YVXA 1OQFA 5HNUA 4UFKA 4R9XA 1WE5A 2IQTA 3BL3A 1FWHC 1FP8A 1GVEA 1T8XA 3DYOA 3W26A 3R13A 3EXTA 2Y6ZA 2CBUA 3VYLA 2RURA 2J62A 4NQ1A 3UCQA 3SRKA 2J78A 2PDKA 1C91A 2ZZ1A 1GJPA 4L5ZA 5FF4A 2JKAA 4PEKA 3LK6A 1WDDA 4ICMA 1JDCA 4ZCWA 2G4JA 5FF2A 1QRQA 2DZAA 3LBCA 3LTPA 3CGTA 4ORMA 1LL4A 4MJMA 3CBWA 1VF8A 1US0A 3MBFA 2PLCA 3GUGA 1Q65A 4ATLA 1JYXA 1UR1A 3WH5A 1R46A 3CH9A 1TJ0A 4H00A 3QV8A 2Z28A 3H2EA 3W28A 5AYXA 4LCSA 4NZCA 3R6IA 4KF1A 4LYKA 1TTPA 3LMYA 4Q8WA 3BOXA 1C29A 1TIWA 4ZQPA 2RKXA 4KEZA 2CZFA 3IV3A 2E6YA 3HGRA 2BLEA 5C9ZA 2NUYA 4E4PA 1TR9A 2CEQA 4DIAA 4IQJA 5FJOA 4R7JA 2OEKA 4NZ3A 3OEXA 1QNSA 4JTFA 4UTKA 3IIXA 5DN1A 9RUBA 3KFTA 3FY1A 2ZUUA 1EPVA 1HZYA 1GVIA 2ACRA 5AC7A 4ITZA 3UJRA 3LPOA 1PBGA 1M6JA 1ZJAA 3H21A 1BG4A 5BZAA 4AF0B 1OG6A 4XAZA 3W1LA 2XU2A 4Q22A 4ZPVR 1RP8A 1T96A 5A8MA 2QUMA 2Y0FA 4AD3A 3IEBA 2YDSA 2WVTA 4IPJA 3TX9A 5CC6A 1IZKA 3MHGA 3A47A 3LGEA 4ODMA 2EPLX 2E4TA 5HOSA 2GVLA 1HKWA 1J0KA 5CC5A 4E38A 2GQAA 3GWQA 1H61A 2A4AA 1UROA 3TQVA 5IHRA 4GK8A 1POJA 1H62A 3L4TA 3NNTA 3B9AA 1O5XA 1CGTA 3AALA 3BCJA 3WNKA 4Z2HA 1A3HA 3GXTA 4U3AA 1BXNA 3ARPA 1XWYA 3GDKA 4QP0A 2EEXA 2AOSA 4M1RA 1NAL1 1Q6QA 5J5RA 2QS8A 5LA2A 1S5TA 4DBUA 3G5EA 4ADSA 3L4YA 3Q2DA 5H8PA 1KFLA 1EQ3A 3SY5A 3LS9A 1DEDA 1S3HA 3SCQA 4TNSA 3SN4A 4ZTYA 4BR1A 2WHLA 5BW6A 5BXTA 3UF9A 3UWWA 5HUAA 2DSZA 2GL5A 3VC6A 3GM8A 1AL7A 1NWUA 4GG9A 4QE1A 1ZCNA 2FPYA 1H1NA 3J7HA 2QVHA 4TVUA 1VJIA 4C7DA 1QNVA 3QGKC 1V0KA 4NAEA 2BHUA 1F8MA 3HURA 1W1PA 3MMDA 3BV4A 4L9YA 3DHDA 1P48A 1UKPA 2YYUA 3AOFA 3GXDA 2I5IA 4OU1A 4LUTB 5DMNA 4QLKA 2OT0A 4AU0A 3LG3A 1YIXA 3VKKA 3A64A 4XV0A 4LWWA 1OC5A 5KZDA 1H41A 1Q8JA 4MY8A 1HF6A 3C3NA 4LCRA 4MG4A 4ZQMA 3ONBA 2EHHA 5AECA 3TQPA 3ZMRA 1RBLA 4UTTA 4MKSA 2WWCA 3VMPA 1TPB1 3O07A 2W3ZA 2X1IA 2G3FA 5K2ZA 3NUKA 3SQMA 4MDPA 5CBJA 2BOGX 3N4AA 5FF7A 1A3WA 4XD6A 4YNGA 2TAAA 2A3CA 3BOFA 2WVUA 3FHAA 4JTHA 5B7ZA 4UFHA 4JTKA 2C0AA 3U2OA 3JXVA 1XPYA 2CLMA 1W17A 4YS1A 2WMJA 1FWFC 4BHYA 2E6FA 5BXJA 1XIEA 1ZJHA 1VJZA 4O4VA 3WLMA 1KNWA 1X98A 1NP0A 2CZDA 3D47A 1F74A 3I65A 3N4EA 1OGGA 2PDXA 2FZNA 2QDHA 4HZMA 1J0YA 2O9RA 2PRHA 1E0UA 4GI8A 4MLRA 1SZFA 1U83A 2CHNA 3EY6A 5A5WA 1VHCA 5LKYA 4N7QA 5BROA 3ZSSA 1FCUA 5IHSA 3BCFA 3P5YA 2Y24A 3HGOA 4XISA 5A6AA 1OB0A 1H7WA 1HGWA 4PUWA 3H2AA 3O5IA 1MDRA 1BEUA 1QI2A 7CGTA 2VYOA 3SCNA 4NRRA 3ZVHB 4IMEA 4NJHA 5FEXA 3LCFA 4MFDA 4TQTA 4CVWA 2DDXA 4NNCA 4W88A 2VWTA 4B15A 1RCOB 2DZSA 2ZA3A 3UJ2A 2FJUB 3P5ZA 3PZVA 4G1NA 1CXEA 4L4PA 4PSRA 2RJHA 3LYEA 3C86A 1DV7A 1DWFM 3LHYA 2P0OA 5FEPA 3S42A 1LP6A 1P0DA 3AWNA 2NLYA 4G1KA 5HUPA 3WUFA 2VX4A 2GUYA 2PDNA 2A21A 1XLIA 3BSMA 3TFCA 2QCNA 5HW8A 2Z7KA 3BMVA 3CAVA 3LGGA 4S38A 5J04A 2HROA 4DBEA 4RZ5A 2Z1KA 1G7VA 2R91A 3ZO9A 2GQ8A 4C6KA 3WH6A 3L5LA 3BW4A 1W5OA 9CGTA 3IJ8A 3AIQA 3WH0A 3UQAA 3SRFA 1NMVA 2Y8UA 1KGWA 4DO7A 4YTUA 2ZRXA 4TMBA 1TZZA 3APGA 3WQDA 1VFLA 3WLJA 3QMSA 1SW3A 1GG0A 3DKLA 4UTWC 4JYDA 2JKEA 1UD6A 1W3KA 4C6MA 3PP7A 1YBQB 1BYCA 4X61A 3I6RA 2F84A 3W3OA 5DQPA 1EBGA 1RK5A 1S1RA 3EX6A 4U2YA 2WHKA 4XVEA 3VIHA 1AUSL 3L65A 3DHPA 3UF8A 3LGDA 2XP3A 3QW4B 1B3ZA 4B5XA 2PODA 3APTA 2VCAA 3WF1A 3QZEA 4K2SA 3WX7A 1E1CB 2HNHA 1XBVA 5GNZA 2XINA 1TA3B 4A05A 1IT7A 4M6PA 3Q94A 3W75A 4E4UA 4D8AA 3C0JA 5I00A 3S1XA 1TV7A 2OKOA 2GVEA 3DFTA 1UJPA 2PURA 2WK2A 3RLHA 5JH1A 2PDCA 3E0LA 5KMYA 1EPXA 4GVIA 4AEFA 2NQ5A 2OCZA 5A95A 3E2VA 5HQLA 4Y9MA 3WFAA 1QPOA 2P3ZA 1ECEA 1ECQA 3TC7A 2OX4A 1RY8A 4M6VA 3IKDA 2JZVA 2PSNA 2V3DA 3EYPA 3WKZA 3KTXA 1W9DM 1SO5A 3B06A 3W23A 1WKEA 1KTBA 4FOKA 1VZWA 1SFTA 2VN1A 5CZTA 3CL6A 2DP3A 4YTRA 3QJAA 3MZ2A 2GK1A 4GVFA 3TK7A 2FKEA 1A7XA 1A0EA 4TIMA 4TUFA 1P43A 3IRDA 1ODZA 5EMJA 4AB4A 1FKBA 3TTOA 2POTA 4IMCA 2EULA 3E0IA 3WK0A 3NO5A 3SY1A 2C8NA 2VVNA 1RV8A 1RJPA 3KACA 2JIEA 3TQ0A 1I6NA 1X8CA 2GSHA 3KHDA 3PPCA 5FJIA 1TWIA 2ZXAA 5EPDA 2PN0A 2FZ8A 1XIFA 3OG2A 2OSXA 4L9XA 1ONRA 4AZGA 4AZCB 3CV7A 4LW7A 5TQLA 1UWQA 1V6YA 2BOEX 4BF7A 2A7RA 1A5UA 2Y70A 3ATYA 2WC7A 3SY8A 2QQ6A 1E4MM 5M5DA 3P74A 1Z42A 3SIZA 1FWDC 3D3FA 4A6GA 3W7NA 1WKDA 3O5KA 3EEGA 1SZNA 3UI6A 2H6RA 2D3LA 2YDRA 5C54A 1EF3A 3MUIA 3PR2A 1VEMA 4Z1BA 2F61A 3T55A 1KTCA 1A5OC 3BLOA 4MWAA 4O1EA 3OO2A 2E68A 3EOLA 4ZSTA 2DH3A 3T9PA 1I60A 3GHTA 3GNPA 3DC8A 2P50A 4U86A 2FHCA 1J0ZA 5G4HC 1PIFA 1JDFA 4ONVA 5DY2A 4ZXLA 4GXMA 4Z1YA 2YDQA 3QV6A 3W1QA 2QCLA 5T26A 2J47A 3UNDA 4MIMA 5E9XA 4I9MA 4FNPA 1GT8A 3LCHA 3VXGA 3HQNA 1VC4A 3FV9A 1JI2A 3TFXA 3U6WA 2VUYA 3T2OA 1FH9A 1EJSC 2UY5A 1E4NA 3VUPA 1X6UA 4A8NA 1UA3A 3U4FA 4R53A 4IPNB 2RGMA 3WLNA 3AQUA 5CPNA 2DT3A 2ZQUA 3E6EA 4MB5A 1IZCA 1UKTA 3PG8A 5K4ZA 4GWEA 1JDEA 3LERA 5K9CA 5L6UA 3NZRA 1KQZA 8A3HA 1DP0A 3VDCA 1V3KA 1R38A 1E0XA 3A24A 4XZ9A 1G5AA 4MVAA 3IJLA 3SCPA 1G0CA 3AFBA 4PRWA 4CD5A 1TJRA 5F2LA 4LCQA 2V2CA 4XAKA 1DOSA 2PS2A 2VDIA 1KM1A 2WWDA 3LCLA 3TWAA 3GNOA 3L0NA 2YR1A 3BQ6A 1L0PA 5CSSA 2D2GA 3WK1A 1PUDA 3LEPA 4MAVA 5LNVA 3ARXA 3PUGA 8XIMA 1W3LA 4M56A 3UR7A 3I6EA 4JTTA 4S3JA 1QUMA 2F6KA 3BICA 4OFCA 1E56A 3DFYA 1O60A 3I7SA 3QEZA 3CQJA 4JNMA 2P0IA 3N73A 1K8XA 2PDJA 3E2QA 1J96A 4JX6A 3CGNA 1JYVA 1VQTA 4P5UA 4H9XA 2X0YA 2J7CA 1A5MC 3VGBA 4LT9A 1LBLA 4PEEA 1M7PA 2I1OA 1JPKA 3CZLA 2FTPA 1KFKA 1GOXA 4AISA 2UY3A 4UTMA 3G3MA 3DG3A 3LHWA 3BOLA 3FVDA 4AD5A 5F1VA 3HPZA 4GCAA 5XIAA 3ANVA 3LCWA 3UXIA 3FDGA 3PZIA 3WNPA 4QEHA 3GVVA 4QT3A 3E49A 5AC5A 1D3GA 3AICA 3RXZA 1XP3A 2P8CA 2YBVA 4IM4A 3H7VA 4P8VA 3M41A 3KVLA 3O5EA 3VAWA 1G4PA 2WHMA 1IEQA 1QZ2A 1UUOA 1XL9A 1RVGA 3AROA 4PN2A 2VI0A 3GDRA 2PCEA 2W79A 1Y5WA 2JE8A 1F3WA 3F4CA 4L7ZA 2PGFA 2D23A 2PEVA 5KZEA 2QEZA 2YSWA 4EPBC 1N8IA 1FWIC 1ZJBA 3RLUA 2OXNA 2CIPA 1YKWA 4V1XA 4L4LA 1H7XA 3SRDA 3T81A 3NQMA 1W1IE 1S2UA 5AHIA 4CQ8A 3NXLA 4X3ZA 4KGLA 1O68A 1BSIA 3QMRA 3T0DA 3TW9A 2WQDA 3P61A 4I9AA 1XCWA 3GXIA 3UZJA 3D46A 4GQBA 5A2CA 3D6NA 3EA1A 2OZ3A 4TW8A 3GNNA 1R9YA 4RNIA 1EDTA 3N04A 5BWAA 1BPLB 4JZ5A 2AQVA 4UOZA 3O8AA 3KUMA 3G3DA 3TYUA 3OGSA 1DHPA 1DQWA 2V3FA 2VR5A 1V0LA 1Y7VA 2WMGA 4Q6XA 4EXAA 3W7QA 1VCFA 1IWPA 3B0XA 4G8TA 3L2LA 1THFD 4IJCA 3B8VA 4GIAA 5EL1A 4IOTA 1ICQA 3BAXA 1U1HA 1HT6A 2A85A 3MV11 4UB9A 3BG3A 3M5YA 2PC8A 1E3ZA 2Y89A 3CS2A 5DF0A 4NU7A 1HKVA 4P7LA 3FVMA 2RDXA 2YBTA 3VOGA 1Q6UA 1XRTA 4L9ZA 1WX0A 2J6XA 3TSMA 4HHPA 1XINA 3B8TA 4K8GA 2PU1A 4S3FA 4MNLA 3R43A 2ZOXA 3ID7A 4INFA 4NG3A 1KWGA 1C8YA 4H8HA 3OYXA 4A8IA 3QHMA 3A3XA 3WDPP 1E6ZA 5EKYA 3SDOA 4HHLA 3BAYA 4JFJA 4D6IA 2XWDA 2GGIA 3I68A 2YZRA 1K7XA 2NQJA 5CLTA 2XG9A 2E8YA 3NQ2A 1GTEA 3OPSA 1FKGA 4B5UA 1PSCA 1XYZA 2EAWA 1PKMA 3NQEA 3HMCA 4GQ0A 3OOBA 3E12A 3DFHA 2PD9A 2X1UA 2A79A 3EKZA 4GUGA 1M65A 3AYRA 3TAOA 4J4KA 3T09A 2ATSA 3TTQA 2HEJA 3P14A 3DG7A 1XLAA 3WLKX 1HKKA 3NL5A 4PODA 1CLKA 3CASA