1WB0A

Specificity and affinity of natural product cyclopentapeptide inhibitor argifin against human chitinase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
364
structure length
364
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CHITOTRIOSIDASE 1
publication title Specificity and Affinity of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human and Bacterial Chitinases
pubmed doi rcsb
total genus 128
structure length 364
sequence length 364
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2004-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF01607 CBM_14 Chitin binding Peritrophin-A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1wb0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1wb0A01
2ZWYA 4WKHA 1J0KA 3VIKA 3VDCA 4CUCA 4XZBA 4HPHA 4EANA 4MB5A 1JF5A 3QHOA 4FK9A 1JZ2A 2YOCA 1CXKA 1HJXA 3LPPA 4GI8A 4U33A 1ZU8A 4WSKA 3KL3A 1JI2A 4HOZA 2DSVA 1CBGA 4TUFA 4YN5A 4D6CA 1AQMA 4E8CA 5BROA 3AS2A 4Z2GA 5A6BD 4W7WA 2ZUTA 1CGYA 2QPUA 1XRVA 1E4IA 1A47A 1UH3A 5A8PA 1EGZA 4OBSA 4U5IA 1JYXA 2XVKA 3MMUA 4P8UA 2IXUA 5CSUA 2WSPA 5FIPA 4CU7A 3WNMA 1UD8A 1US2A 3HMCA 3OG2A 3AIWA 5DFAA 3GNPA 1XGZA 3U5YA 1V0LA 1QNSA 4M82A 3W4RA 1DEDA 2BY0A 3W24A 4PCTA 3RM9A 1C7SA 1ZL1A 2D2OA 2QV4A 2J47A 1QHZA 1TA3B 1V0KA 2CBUA 2WZEA 2YDRA 3OLGA 1W9DM 3EBVA 4YHEA 3MSDA 4JCMA 1VFUA 3AHVA 3LPGA 5CGTA 3SUUA 3WD1A 1JZ6A 3ZT7A 1O6IA 1ODZA 3ZR5A 1BHGA 1LWJA 1UR0A 3N04A 4ZXLA 5GNZA 4F9DA 3AOFA 3CGTA 4A3YA 3OBAA 4D6GA 1BG9A 2V38A 4Y7EA 1BYCA 1NOFA 2J7HA 1MW0A 1GHSA 2ZE0A 1MQPA 2ZXAA 1GCYA 1SYTA 3WNNA 1JZ8A 3L4ZA 6CGTA 1E0VA 4KRUA 2VT0A 4JFWA 4HMCA 4ML4A 4UNIA 1WO2A 1GONA 3CUJA 4A4AA 2D0GA 2VX7A 1MVYA 2OWXA 3M46A 1GZJA 4DWSC 1BYAA 1US3A 1JZ5A 3AYSA 3THCA 1CDGA 4NRSA 1IZJA 1DWGM 1QI5A 2EPOA 1UUQA 4J3SA 3BAWA 4PTWA 2D23A 2PWHA 3AROA 2IXVA 4PMDA 2J7GA 2OSYA 2Z1SA 3SCTA 1A3HA 3OGRA 3L4UA 5BXRA 1HF6A 2JF6A 2E40A 3VDAA 3EDFA 2HISA 2PF0A 2W91A 1CWYA 3B9DA 1J9YA 1CEOA 3I3DA 4GIAA 5D9PA 3MUZ1 3JUGA 1OSEA 5ABFA 1C3FA 3CTTA 4R5EA 4TXEA 3DHPA 1J11A 4S3JA 3K8LA 4D6FA 3WN6A 4UOQA 4B9YA 3MSGA 4H41A 2WMIB 2DSKA 4HZ7A 3GTNA 4MJ4A 3G6MA 4URIA 1XH2A 4J3TA 4DWSD 3ZO9A 1UZ1A 1I75A 3NDZA 1VFFA 4Z2JA 2A3BA 1VF8A 3WH6A 1QNRA 4ACZA 1KWGA 1WKYA 2CHNA 5A6JA 3LMYA 2VQTA 2ZWZA 1OWQA 2WW5A 3VGBA 4MNMA 1UOKA 2D24A 7CGTA 2DEPA 3AS0A 1E15A 1QW9A 4B3KA 3AFBA 1K6AA 2WNWA 2EEXA 1OINA 4BCEA 3GNRA 1HKIA 3T08A 2ZUMA 1HIZA 3BAIA 4PMXA 5A8NA 1FFRA 4CD8A 4NRRA 4D6EA 3T2PA 2XVPA 3L4WA 3OB8A 2PWGA 3BLKA 4F79A 2J7FA 3W27A 3NDYA 1J12A 4QCFA 3THDA 2J25A 3CUHA 2VOTA 1JYWA 2YA0A 4MADA 1HP5A 1MXDA 3AXHA 5D9MA 2JE8A 3A4AA 4JFSA 1V3JA 2BVYA 2CEQA 4UQBA 4R27A 2BY1A 1VEMA 4M81A 5A6SA 1DWFM 1DWHM 2V5DA 3CZGA 5DT7A 1NOUA 4PYSA 1U33A 4U2YA 2QLYA 4GQQA 2J7EA 1HJVA 4JHOA 1PZ3A 3AXXA 1TMQA 3WF0A 3VKKA 1HJSA 3OLEA 1UYQA 1ITXA 2YBUA 1BLIA 1TR1A 4H7VA 3S6TA 4KRTA 3MMDA 3OLDA 4PBGA 4PMVA 4U3CA 3ARWA 4D6DA 1DHKA 2VC9A 4Q7NA 1XHGA 1QVBA 4A3HA 3VMNA 3KEHA 3VGHA 1UA3A 3CZJA 1KGUA 1WDRA 1BGAA 4AWEA 1CGVA 2ZX7A 2GJRA 3AI0A 1UD5A 2AAAA 4XX6A 1JAKA 4AC1X 1F4AA 5CJ5A 1H11A 3VIFA 3CPUA 2V5CA 1GOOA 4M1RA 5EBAA 5AC4A 1HN1A 5JIWA 2WM0A 5E9AA 4NSBA 1OM0A 3SUSA 4KGJA 5BRQA 3SCOA 4AD5A 4CCEA 4P7OA 3GXDA 2YDQA 1UH4A 1EDQA 5DMYA 2JEQA 2D22A 1CLVA 3RJYA 3EDDA 2CIPA 2D0FA 4D72A 4MAVA 1BVZA 3VIJA 5AYBA 2VCCA 3EMQA 1W1YA 3ZT5A 4QAWA 2BXYA 5E0CA 2VR5A 3EYPA 4W8BA 4P7QA 3AYRA 1E70M 5BCAA 5I6SA 1EOMA 3KWXA 5A8OA 2G41A 3VMPA 1C90A 1IZKA 4MJ2A 1B3WA 3DYPA 1XD0A 2O92A 3UEQA 2OSWA 2EPKX 3WIJA 3U7BA 3WUFA 3WDJA 4HTYA 2YA1A 3WF1A 1TFVA 2OWWA 3VGEA 1UR1A 3EDKA 2OSXA 4UOJA 4W88A 3FHQA 3ARXA 2VNCA 4IM4A 2W92A 1Q6EA 3CHCA 3ARZA 3AZSA 2DQXA 4JL2A 2VZTA 1U30A 1OCQA 1GQLA 3F4VA 2GUYA 2XGBA 3AMKA 4AIUA 1UKQA 3WQWA 1W9BM 4HMDA 4AD4A 3T0DA 1UWQA 5A6LA 1OIMA 1KXVA 3BAJA 3WNKA 2YLLA 2X05A 2FDMA 4DWSB 1UD4A 3ZOAA 1XC6A 4U5KA 1QI3A 2XUCA 1EOKA 3AIEA 2RGMA 1RD6A 2WCGA 4OBRA 5CG0A 1PZ2A 4HPGA 1E71M 4LQ1A 2BS9A 5AYIA 5BXSA 4ATDA 1V03A 1H0IA 2XVGA 3QOKA 3ZJ8A 3AS1A 1KR0A 5FD0A 4UR9A 4FMVA 4M29A 1QNQA 3W0KA 1JI1A 4EAMA 4IISA 4NF7A 1FH7A 3GXFA 3AISA 5C71A 5E09A 3AMGA 1OT2A 1X1NA 3E1F1 2GSJA 4ZXOA 4GI9A 3UESA 1MQRA 3WBAA 1B31A 4JZ5A 1G9HA 1UR9A 3SURA 1MW1A 4H04A 4ATWA 1JFXA 1UD2A 1NWUA 3VX0A 1GNXA 3CZ8A 1JXJA 4BS0A 2J78A 1TG7A 1W2VA 4CGTA 3K8MA 4CU6A 1R7OA 5HPOA 2CYGA 3AMLA 3PBGA 4AZ6A 7TAAA 3RIKA 1UD3A 3ZJ7A 2VZOA 2VL4A 1GHRA 3F5JA 1E6NA 1VJSA 1E0WA 3VD9A 3MUY1 3PN8A 4W7UA 4EKJA 1WPCA 3RM4A 2E9LA 1OIFA 2Q8XA 5E70A 3A6OA 5BWFA 1NWSA 1ESWA 2GJXB 1HKJA 2E8YA 1BSIA 1XYZA 3WEMA 3FXYA 4IUGA 2ZUUA 5IHSA 1E6QM 4DM2A 2X0HA 1GOKA 4Z2IA 4UFJA 1HKKA 1R85A 3OZOA 1WDSA 3D5HA 3SEPA 2ZUSA 3DYOA 2WVVA 3EMCA 3W38A 1E3ZA 4CVUA 1RP9A 4ZEPA 4MDOA 3M07A 2CITA 4CD5A 1TCMA 4WKAA 5KZ6A 1EO7A 2WC3A 4OUEA 4HA1A 4JKKA 4W5UA 2W67A 3IAQA 1CGXA 1X6NA 4LYQA 3WNOA 3N12A 1LQ0A 3GBEA 5E6YA 2VRQA 2VQUA 1CGTA 3VO0A 1ZBKA 3DYMA 3ARVA 3APGA 1BPLB 2DPEA 1R86A 3KL0A 3ZQ9A 1UA7A 4JHZA 1UWTA 2UWFA 3AMCA 4ATLA 1HL8A 3ARSA 3CHFA 3QGVA 1GOQA 2CERA 2WZIA 3CZKA 3TONA 4U2ZA 1O7AA 1LG1A 3PZTA 4UOZA 2YIHA 4PTXA 5KEZA 5JIPA 1WAWA 4CD4A 3SCPA 3CMGA 5AC5A 1WE5A 1NP0A 2VZSA 5A2AA 5CXPA 4MNKA 1BAGA 2PBGA 1MXGA 3AZTA 3BXWA 4PN2A 1CIUA 1E55A 2BVTA 2WMHA 3WBEA 2VO5A 3DHUA 3K4DA 2PBOA 3AHZA 2YL8A 5M3WA 4OJYA 2DIJA 5JBDA 4N0RA 4BQ4A 5I24A 1C8YA 2VMFA 4RE3A 3ECQA 4QDMA 1G94A 3VIGA 3BAYA 1ISWA 3PZ9A 3N1AA 3KE0A 1XYFA 2WVSA 3WENA 1VEPA 2OYMA 3W6MA 1TUXA 1CXIA 1K9DA 3TA9A 1MW2A 1E6RA 5DEZA 5LA1A 1W32A 5I5RA 5GQBA 4CCDA 3M7SA 3WMBA 2NW0A 4PUDA 4D1IA 2DT0A 4HU8A 4W87A 2DH3A 5CZKA 2XFRA 1CXEA 4WJXA 1UKSA 4HP5A 3WMCA 1WZLA 1KXHA 3VPLA 2XFYA 3J7HA 2ZUNA 4D6JA 4HU0A 3GDBA 1BQCA 1ZJAA 1IV8A 2JIEA 2WXDM 1TZ7A 3L4YA 4AIEA 5IHRA 1W9XA 2GDVA 1NP2A 1DTUA 1OGSA 3VDHA 3QHNA 2EXOA 1B3XA 1H49A 2BY2A 5TD4A 2WWCA 5CPTA 3DC0A 1EIBA 3SCNA 2BHUA 1I1XA 2NT0A 1QNPA 1CZ1A 2ZX6A 1MFUA 2XSAA 3CIVA 4DUXA 1LJYA 1FP9A 1NWRA 3B9AA 2CCRA 4S3KA 4W5ZA 4HMEA 5JBFA 1E6ZA 2EO7A 3WY1A 4P7NA 2CETA 3TOPA 3CO4A 3OIHA 4ACZB 1E4NA 3HN3A 3RJXA 4MB1A 1BF2A 5LA2A 3WF2A 5HOSA 1OBAA 2YKKA 3CLWA 3WF3A 1GOIA 1LF1A 2XSBA 5JUVA 2WBGA 2UY3A 4Z2HA 1V6WA 2Y5EA 2WCSA 1ISVA 5EFDA 3WKZA 1W2PA 4PMQA 1SMAA 5D9OA 3RMEA 3CMJA 5LYRA 2DIEA 4AW7A 4AZHA 1B9ZA 4GPNA 4B15A 3MUIA 1E73M 4UFLA 5M17A 4JIEA 2XYLA 4JCLA 2CBIA 3ZJKA 2YA2A 4N42A 5CPSA 4W85A 3RPMA 3VU2A 4OZOA 4CKQA 1C8QA 2WLZA 3GNOA 1JZ4A 3PZNA 3L2MA 2DH2A 3L2LA 1WCGA 2BV9A 2JFEX 1KFWA 2E3ZA 2VRKA 2X1IA 4V2XA 3FY1A 2VVSA 4RL3A 2DSUA 3W6LA 4BZYA 1E4MM 2MANA 3VOCA 1AQHA 3OGVA 4KWUA 2ZXDA 4RE2A 4UFMA 1B3ZA 2DGAA 1GQIA 2CBJA 3AJ7A 1RPKA 3PZGA 3BMWA 5CQ1A 5EFFA 1MWOA 3I3EA 3ARUA 1QPKA 1ECEA 1C93A 1RH9A 1UR2A 5FKYA 1Q6DA 1HVXA 2Y8KA 1J10A 3WEZA 1QI2A 1K9TA 3MKKA 1EA9C 4WKFA 3W53A 2Z1KA 3K46A 2XM1A 3EMZA 3NYDA 1GW1A 1LWHA 3G6LA 1JAEA 2W5FA 9CGTA 1B2YA 3SUTA 2XIBA 2OYKA 1G0CA 5A2BA 3MU7A 2UY2A 1BTCA 1FH9A 4M24A 1VBRA 4H2CA 1MYRA 3OGSA 3CHDA 3SUWA 1JFHA 4AMCA 1ZJBA 1EHNA 1VIWA 7A3HA 1HJQA 2XM2A 1PEZA 2XVNA 3N15A 2BFGA 3WQ5A 2CPUA 4CCCA 2YBTA 4CN4A 4AZIA 1V3KA 4P8WA 4PSRA 4D6IA 2BY3A 4B9ZA 4WF7A 1JF6A 1VJZA 1K9EA 1JD9A 3WDIA 3F5KA 4E8DA 5A95A 2J62A 3VGFA 4QLLA 1XCWA 2VTFA 3ALGA 5AY7A 1UHVA 1R7AA 1G5AA 1OB0A 2PWDA 3AHTA 4QLKA 1SR0A 1SFSA 3MMWA 4F66A 3VIIA 1EDGA 3WQ6A 4IPNB 3RO8A 1UWUA 1F4HA 2V3EA 3VX1A 2WC4A 1CENA 3LPOA 3WFZA 1X6LA 1WNOA 1E3XA 4AEEA 4YPJA 3ARTA 4AD1A 4JKLA 3LPFA 2JEPA 2WCAA 1KCLA 1KXTA 3N9KA 3WNLA 4AZCA 1ITCA 1PX3A 1V0NA 2GK1B 4AYSA 1WP6A 3VDBA 3VM7A 4ZENA 2XWDA 5IFTA 3WUGA 2OYLA 3GH4A 1V3LA 3UCQA 4ACYA 1S46A 3PHAA 1PPIA 3MS8A 3PTMA 1PIFA 1ISYA 6A3HA 2GDUA 1UWIA 1JG9A 1EH9A 4BQ5A 2QF8A 4UTFA 2ESCA 4J7RA 2J8GA 2XHYA 1GUVA 4MB3A 1LLOA 2ZICA 3SCWA 3CUIA 5BYWA 3A4WA 1UKOA 1PX8A 1BG4A 1QOXA 1EQPA 3N18A 3ARYA 2CNCA 5HPCA 3QOMA 5A6MA 1KCKA 1CECA 1SMDA 3VMOA 1UH2A 1D3CA 3IANA 3GXMA 4EE9A 2WSKA 4X9YA 5FCZA 2O9PA 4BQ3A 3CZLA 8A3HA 2J7DA 2Y24A 2WWDA 4D6HA 3AIRA 3BH4A 1MW3A 3GXIA 1XCXA 3VD5A 3WL0A 3WDHA 2XWEA 3VM5A 3D3AA 4LGXA 2VZUA 3WDQA 3FHAA 4ZE5A 1KBBA 1M04A 2OLHA 1KBKA 5M03A 3MUAA 3MANA 5IXEA 2ZIDA 3BSHA 4HA3A 3W29A 2YL9A 1AMYA 4GXPA 3QHMA 1ZBCA 4YHGA 3NSXA 4FLRA 2YJQA 1JDCA 1XSIA 2EPNA 1GVYA 1VEOA 2ZXBA 4Z2LA 5GNYA 2V3GA 4X0NA 1D2KA 5CLWA 1PIGA 5I79A 4UZUA 1EO5A 1C7TA 3WSUA 4Z2KA 1R87A 2BVDA 4XZWA 4CD6A 2FHFA 4D71A 1W3HA 3FW6A 4AD3A 1AQ0A 1XSJA 3AICA 2WMJA 1J01A 2UY4A 4FLQA 1UZ4A 1KGXA 1CGWA 3O2LA 2NT1A 2VJXA 5DF0A 1OGGA 3ZT6A 2Y4SA 1G1YA 5D9NA 1JD7A 1UWSA 1CLXA 1HL9A 1V3IA 4P7RA 3VNYA 2CKRA 2AOSA 4TOQA 1E6XM 4GINA 4HZ8A 1KWKA 1PAMA 3TTOA 4GI6A 5CPQA 5ECUA 3GM8A 3UG3A 2CESA 2E9BA 3ZSSA 3WF4A 3CUGA 3B8SA 2O9OA 3HJEA 3L4XA 4P7LA 2YL5A 3WD2A 1VFOA 2CBVA 3GZAA 4TX6A 1FFQA 1WB0A 1LL4A 2A3AA 1KXQA 3WH7A 3WH9A 4UFKA 5CLTA 4JFTA 1W91A 1HX0A 2ZX8A 5ABHA 3VVGA 5A3HA 2J79A 2ZOXA 2X0YA 5JBEA 1FHDA 1KQYA 2GFTA 2WHMA 3PZIA 4UQEA 1H5VA 1GORA 5FL0A 3ALFA 3MO4A 1NOWA 4Q22A 2WVTA 2J75A 4W7VA 3WMSA 4GZEA 3WUEA 1E6SM 2ZUWA 2NSXA 3NIYA 1HKMA 1E40A 2QMJA 4LPCA 3VD7A 3AMDA 1XH1A 2VI0A 3T09A 4ZE4A 4NZCA 4MAZA 5C70A 2QPSA 4F9JA 5GNXA 5HDRA 6TAAA 1Q6CA 3OLIA 1HP4A 2WMFA 1H0GA 1NM9A 1XH0A 3OZPA 2XFFA 4MB4A 1TE1A 1JNDA 4DUWA 4IPLA 3BAKA 1WZAA 4M8UA 1QI4A 2GJXA 1W9VA 1CXFA 4M56A 1OGBA 2ZUVA 2WC7A 1K9FA 1GJUA 4UFHA 4PMNA 2E0PA 3ZMRA 3POCA 4QCEA 3NSNA 1QBBA 2Y8VA 3WQ8A 1E43A 2D3LA 4HOXA 3IJ9A 3WEOA 2PI6A 2TAAA 1V3HA 3VTRA 3NCOA 4UZSA 1NWTA 3VUPA 1BFNA 4QFUA 1GVIA 2WVUA 3UG4A 2WB5A 2EPMX 1HNYA 3PZUA 3AIUA 1V08A 2QHAA 2ZX9A 5ABEA 4UCFA 2JF7A 2C7FA 3EDEA 1MQQA 5A1AA 3WUBA 1H4PA 5I3DA 2CXGA 3RCNA 3A47A 2WLYA 1JXKA 2G3MA 4J3VA 5EB8A 1UKPA 1Y7VA 1E9LA 2J7BA 5BXTA 1V6XA 4PMOA 2G3JA 4GZIA 2YLAA 1DP0A 1L0PA 3GH7A 1UD6A 2FHBA 2A3HA 4MTVA 4PUEA 4C7FA 2EPLX 3BGAA 4J28A 4K68A 3RILA 5ABFB 2VVNA 4PMRA 3AS3A 2YL6A 3IK2A 1M03A 4EK7A 1JNEA 4BA0A 4PMUA 3W25A 3K4AA 1VBUA 3VD3A 1V6VA 1TA3A 2HVMA 3PZQA 4TTGA 5DT5A 3SCUA 5HNNA 1B3VA 2WKLA 4OOUA 3UERA 3U7VA 5CSYA 3VIHA 3NUKA 1QNOA 3ARQA 1HJUA 5D4YA 1JZ3A 2A3CA 4V27A 3BLPX 3BCDA 3N11A 5FOOA 1XSKA 1WZMA 4LXFA 1M01A 4DUVA 4AXNA 1TVPA 4GKLA 5LA0A 5DO8A 3WD3A 4AZBA 3FAWA 3WL1A 1H3GA 1CXHA 3BMVA 3TTQA 1FH8A 2XG9A 2WPGA 4E2OA 1V6YA 4OIFA 2E4TA 5M5DA 4XV0A 3W82A 2PWEA 2WMGA 4CD7A 4AD0A 1HT6A 4AZ5A 3A4XA 1LG2A 2EQDA 4MNJA 1V3MA 1GJWA 1I1WA 2XPKA 2XJ7A 1VENA 3SUVA 4AEFA 1H09A 4M80A 2VUYA 3WQVA 1C92A 3L4TA 4HOWA 1Z32X 2YDSA 3CHEA 1AVAA 2WHKA 2X09A 3O6AA 1D7FA 3W81A 1W9UA 4AIOA 3WDRA 1CYGA 3WDPP 2D20A 4W89A 2VX5A 1KGWA 5A2CA 5IDIA 4KGLA 1N82A 3F5LA 3AHXA 1QI0A 3WFLA 2VX4A 1H41A 1OT1A 4W84A 3WELA 3POHA 3ARRA 2VCAA 1ISZA 4FLSA 1CNVA 2DT3A 5I0DA 4MPKA 1WDPA 3UETA 1KR1A 4B3LA 2D3NA 4QP0A 4V28A 2J4GA 3WD0A 2VCBA 5A6AA 1OD0A 4PMYA 4B16A 1JDAA 2G3IA 2ZXQA 5EMYA 3K8KA 1LL6A 4GQRA 1UQYA 5HBFA 4GO9A 3B9EA 1VB9A 3QR3A 1OD8A 1KQZA 2WMIA 1CTNA 2D1ZA 2FGZA 1QW8A 4H8UA 2EBNA 1H1NA 4PTVA 3I3BA 4UQ9A 4BF7A 3CUFA 4TX8A 1BYBA 2DDXA 3VIMA 2BHZA 4U3AA 4TVCA 5C8BB 3W26A 1W1PA 3DECA 1Q6FA 1XD1A 2W61A 3AXIA 4W8LA 2PB1A 4AY1A 2V3DA 1DWJM 2VURA 3IAPA 3TP4A 1GQJA 1CPUA 5FL1A 1B0IA 8CGTA 4AZCB 4CVWA 3M6DA 1E4LA 1HXJA 1J0YA 2X8RA 1V02E 5E0FA 4WLCA 4L4PA 3BC9A 2W63A 4LYPA 1EQCA 3NJ3A 1QHOA 2BHYA 3PTKA 4KH2A 1B1YA 2E8ZA 3T0AA 1Q6GA 1J0IA 1QBAA 3SIMA 5BXPA 3KZSA 2G8ZA 1J0ZA 4GO8A 3T0BA 5I78A 2J77A 2C8NA 1Q4NX 1ZBVA 4PRWA 3O9NA 1WDQA 2GVYA 3FN9A 2DSWA 1W3KA 4W86A 5GPRA 1V0MA 2QMKA 2RGLA 4PEEA 4J27A 1E5JA 2G3NA 2J8FA 2WAGA 3ZJ6A 1J0JA 3RDKA 3AIVA 5A6BA 1UR4A 4D1JA 4L4OA 4J3XA 1BGGA 1CXLA 4DM1A 1W3LA 2WBKA 4JL1A 4WIWA 1PJ9A 1UKTA 1G01A 4GZJA 5I2UA 2EJ1A 4AISA 2C0HA 3KL5A 3K1DA 3GYCA 3HU7A 5I23A 3ARPA 4CN6A 4BQ2A 1RP8A 1E6PA 1PBGA 2XIIA 4CN1A 3S2CA 3RM8A 3T2OA 3II1A 3W37A 1W1TA 1UQZA 3WH8A 3ZM8A 3VIPA 1V6UA 3MV11 1DWAM 1CGUA 4UQDA 2F2HA 1JYVA 4JAWA 4LYRA 3VILA 2Y2WA 4JKMA 1ISXA 1FA2A 2OWCA 4ZFMA 1E5NA 3PZMA 1ZB5A 2PWFA 4H8HA 3UG5A 1UWRA 2PC8A 3ZSTA 2B31A 2O9RA 1NH6A 2DT2A 4J3UA 5A6KA 1MFVA 2J7CA 2XGIA 1C8XA 4W8AA 3TTSA 1VAHA 4HZ6A 1P6WA 4F8XA 3VD4A 1B30A 4QLJA 3GH5A 1E72M 4JFUA 1NARA 4JFVA 5F7UA 1JL8A 2FHCA 4NI3A 1FP8A 5IFPA 3PZVA 4UQCA 3VNZA 4XB3A 4UFIA 3SCSA 5D8WA 2WHLA 2GK1A 2JIWA 3VINA 1JDDA 1BVNP 4MNLA 3WD4A 5A8MA 1J18A 1ODUA 1WZKA 2A3EA 5JH8A 3N17A 4H8VA 4OKDA 2BNJA 4AZ7A 3WNPA 1HVQA 1VRXA 3BAXA 4J3WA 1DWIM 2XTKA 3FNDA 5E6ZA 2X2YA 4P8XA 2VRJA 3VGGA 3PTQA 4X0VA 1M7XA 4KMQA 4RE4A 1C91A 2WYSA 2ZX5A 2FH6A 3SCQA 2DT1A 1KB3A 3BCFA 5A69A 2E9MA 3CZEA 2WKGA 3VGDA 4C7GA 1ZBWA 4HA4A 5HXMA 3SCRA 2J74A 4WK9A 3BSGA 2F61A 1JZ7A 4TVUA 1VFMA 1GOWA 1JYNA 4FLOA 3TTYA 3PZOA 1LL7A 3OA5A 1L8NA 1QHPA 1M53A 2BXZA 5CGMA 2GJPA 3U57A 3AHYA 1E1EA 4PCSA 4TTUA 3WQ4A 5D8ZA 1R8LA 1BYDA 1GQKA 3IJ8A 1HJWA 2WVVB 4PTMA 2WHJA 4AD2A 4LX4A 3IJ7A 1B3YA 2CHOA 1ZS2A 1J0HA 3U5UA 1EDTA 1U2YA 1IT0A 2V3FA 2W66A 3SCVA 1PX4A 2FH8A 4DWSA 1W9PA 3N13A 3UR7A 2CKSA 2AMGA 3ZR6A 2UY5A 3NSMA 3AQUA 2W62A 4C7DA 1XV8A 4E4PA 3GBDA 3CH9A 3L4VA 3WH5A 5A8QA 1UR8A 4W93A 4FF5A 1GOMA 4AZGA 2DSZA 2WMKA 2D0HA 3CBWA 5BRPA 4XUYA 4U31A 2VR4A 4TVDA 2XVLA 2FGLA 3UR8A 3VIOA 1YHTA 2WZHA 4MDPA 3ZIZA 4PSPA 1UG6A 3AZRA 4OOZA 1JIBA 4WSJA 2VX6A 1E0XA 1NQ6A 1W1VA 3A3HA 4CU8A 2JALA 3W28A 1YQ2A 1JGIA 1V02A 4P8VA 1E56A 1E1FA 2G4FA 2WANA 4PMZA 2IUZA 2VZVA 1FOBA 4UQAA 1H2JA 2O9TA 3AIQA 5A94A 3AIBA 3FAXA 5I77A 1B90A 1TVNA 3T2QA 1FHLA 3MV01 5ABGA 1EHAA 1W3JA 2F8QA 3EDJA 1EXPA 2W4XA 1GPFA 2WK2A
chains in the Genus database with same CATH superfamily
2ZWYA 2HVOA 3W7LA 1J0KA 1VCFA 4G7FA 1L6SA 4XZBA 4GBUA 4JX5A 3S6DA 3GX9A 3NXLA 5FESA 4FK9A 3WCZA 1CXKA 1TMLA 2CLHA 4CEXC 4IT6A 3U3HA 1ZU8A 3N3TA 3KL3A 1AFSA 4NX5A 2ABBA 1JI2A 3FSUA 4HOZA 1S39A 1OFEA 3S1VA 3B97A 5BROA 3G0XA 4OGZA 1EX5A 4PR4A 4V15A 3B04A 3MDWA 1YDYA 3URQA 1EGZA 3R58A 1GVFA 3WQCA 4WD0A 3K30A 3G1SA 4CU7A 1FKLA 3AJXA 4LB3A 1UD8A 3EOOA 3M0XA 3NM1A 3V18A 4GY1A 1XGZA 1XRTA 2P88A 4M82A 4AFYA 3L2IA 3QXBA 4IP5A 4E2BA 4DRJA 1UBSA 1ZL1A 1TPFA 2QR6A 3KOZA 3W84A 2J47A 4CQCA 1KM4A 3UU0A 1LCOA 4GUGA 1O4UA 3BJTA 4NY2A 3FS2A 4O1AA 1MUCA 3ZVHA 3OLGA 4AHQA 2WJFA 3P5ZA 4YHEA 4KW2A 4DNMA 1XBYA 4YTRA 3LPGA 3LU2A 1FQ0A 5AHMA 4O4VA 2CU0A 2QVHA 3UWYA 3N04A 2FZ8A 3AOFA 3CGTA 4A3YA 3OBAA 4XBKA 4D6GA 3CT7A 4QHRA 1BG9A 3NPXA 4GIEA 3M5VA 3TQVA 1WKEA 2FYMA 2ZE0A 2ZXAA 1SYTA 2FPYA 2CC0A 1KFEA 4PUJA 3CUZA 1A80A 3L4ZA 3UWVA 6CGTA 2F23A 4KRUA 3UFYA 2VT0A 2RUDA 4IJCA 3H2AA 1GONA 1XLIA 3BLLA 2FLIA 3OA3A 4A4AA 2VX7A 1NSJA 2OWXA 4DWSC 3NZ1A 4ZQCA 3UXAA 1US3A 3TR2A 4JDYA 2X7WA 3BW3A 2ZTKA 1PWMA 1IZJA 3DFYA 4LAVA 3EWCA 3N29A 2Q3OA 3NQ2A 3UVIA 1AH3A 4J3SA 4PTWA 4LFYA 4AIBA 3I4EA 2PWHA 4QG6A 4PMDA 1T41A 2Z1SA 3SCTA 5BXRA 1HF6A 5AC8A 3S2MA 4RZ5A 2JF6A 3QBUA 2ZR6A 3UY7A 3WLLA 3XINA 2PF0A 1RLDA 3B9DA 3PUDA 1OFAA 3PNZA 1S2VA 3JUGA 4J4KA 1IWBA 1C3FA 4GISA 4R5EA 2IQDA 4S3JA 4UOQA 4B9YA 3TN5A 2I56A 4HZ7A 3GTNA 3PAOA 4MJ4A 4RCXA 1Y5VA 1A50A 4URIA 4DWSD 4PB4A 4YTUA 1UZ1A 3M0ZA 3P8IA 2XFWA 1KO0A 1WKYA 2CHNA 3PBMA 2VQTA 2ZWZA 1OWQA 3PBWA 7CGTA 1DJHA 2Y7DA 3AS0A 1S2AA 1E15A 1QW9A 4B3KA 1V51A 4DRQA 4LC8A 1B57A 2ZQSA 3ZS4A 4NZ5A 2Z6JA 3KVMA 2ZUMA 1HIZA 4C6DA 2OELA 1FFRA 1FWGC 3OODA 3T7VA 3PY2A 3L4WA 3OB8A 3BLKA 4F79A 2P4VA 3MP5A 3NDYA 3KS5A 3RFAA 5LIWX 4JQ4A 2J25A 3R94A 3THDA 3V5CA 3KZPA 3OVQA 4J9JA 3H23A 2JE8A 3T4WA 1NQKA 5EMJA 4BWLA 1GW9A 1UBPC 4UQBA 3IGXA 1ZAIA 4M81A 5JVLA 5J6EA 1RSCA 1G4SA 3CZGA 4MFDA 3LBCA 4PYSA 4YCPA 4GQQA 3EX4A 1RBAA 4GQ0A 3C8FA 1HJVA 2GWNA 1K8ZA 5DRCA 3ABZA 1A5NC 3IGHX 4US6A 3R2GA 4NX0A 2YYTA 2C16A 2Q01A 3NG3A 3EXSA 5C9XA 3CWOX 1UYQA 3BTNA 1ITXA 2YBUA 2HV5A 1N8FA 5B7ZA 4O12A 1BLIA 2VEIA 3S6TA 4KRTA 3KWSA 1KFCA 3TYZA 3MMDA 2NXHA 2ZDRA 2NWSA 3F4DA 4GGBA 4RK8A 4D6DA 1WKFA 4Q7NA 2VC9A 5TIMA 4HJFA 3KEHA 4TV6A 1I2OA 1W3IA 3VGHA 4QBXA 4GY0A 4ZGYA 3EZ4A 1BGAA 3OBKA 3I7QA 5HTGA 4AC1X 1F4AA 1H11A 5DXXA 3UCCA 3B9NA 3V7PA 1GOOA 4H9VA 5AC4A 5JU6A 1FXPA 4QDWA 1OM0A 3O8AA 3RRAA 1T6MA 3OOBA 4LBSA 1QRQA 2PURA 4GYFA 3KVKA 4IWWA 4Y9OA 2NVCA 1CLVA 3HG3A 3RJYA 3AALA 3VC6A 1Y5XA 2D0FA 3E96A 2E68A 4EXQA 5AYBA 4ZZ9A 2TODA 2ZTJA 5E0CA 1DKWA 1E70M 4ZOCA 1SZNA 1Z42A 3N2TA 3BG5A 1UP0A 1IGWA 4ZR8A 1EZWA 2BLEA 1IZKA 3DYPA 5H2ZA 3WIJA 4L72B 3P6LA 4HTYA 4K1WA 2OWWA 3VGEA 1UR1A 2NX1A 4A21A 3EEZA 4UOJA 5F1UA 3PF3A 3ARXA 4V33A 1QJWA 4IM4A 2E5DA 3W7RA 1FAPA 1MXSA 2DQXA 3QY8A 4K6AA 1IEQA 2GLKA 5LNRA 1G7VA 4OUIA 1U30A 2PD9A 1GQLA 1J96A 3QZAA 3W75A 3ZFHA 1W9BM 4WXZA 1FDJA 3T0DA 1A53A 3FFSA 1EBHA 1F61A 2YDAA 1KXVA 1G7UA 1W1B1 4Y8EA 3SBFA 3URAA 1HL2A 2FDMA 3FA3A 3ZOAA 1XC6A 4JTIA 3IRSA 3SAZA 3AIEA 4NXKA 2RGMA 2EAWA 2WCGA 2BX7A 3DGBA 4R7JA 3TCEA 3ZYZA 3G1VA 5CG0A 3N9RA 3NZQA 3SW6A 4LQ1A 5CAKA 5FEZA 1X1OA 1V03A 3DZ1A 4XG1A 3HV9A 3PPCA 3CV2A 1L6FA 3UD6A 3HQPA 4L3NA 5C71A 3AISA 3E1F1 4JEQA 2FAPA 2CLLA 2Y7GA 4GI9A 3NM3A 3NPWA 1MQRA 2QCDB 3LGEA 2I7GA 1QOPA 5DY2A 1B31A 4JZ5A 4AWUA 1MW1A 1TPUA 3TLQA 3VX0A 4HNTA 3CZ8A 3VFCA 1JXJA 1B5TA 2OTDA 3KXQA 4AX6A 3PBGA 4ZFCA 2A7RA 3R8RA 3RR1A 3RIKA 1IHIA 2VZOA 2H9AA 2VL4A 2WZMA 4NNRA 3VD9A 1GJPA 4DEFA 3F1QA 1XRSA 1M9HA 1LQAA 1IF2A 3RM4A 3EPMA 2E9LA 4DXVA 1XGEA 4V1YA 5BWFA 1NWSA 2CZVA 4X63A 1HKJA 4G9PA 1BSIA 1K7FA 3GS6A 2Y1HA 2ZUUA 1Q6RA 1E6QM 1R3YA 4IQJA 1ZUAX 3TYUA 2PDLA 5BZAA 1WDSA 1QPOA 3SEPA 3W7KA 4O18A 4TMBA 2ZUSA 3WJZA 1E3ZA 2J9YA 2VHLA 2FMNA 1YNQA 2REQA 1Z41A 4ZEPA 3GTXA 3M07A 3QRHA 2Z7GA 3CK5A 3GR4A 1RALA 1V5XA 1G67A 4GYPC 5KZ6A 4GOAA 1XF0A 1R9HA 1LYXA 3PPGA 1Q2SA 1FD9A 2QJNA 3UJEA 3IAQA 1YNYA 1CGXA 2R1MA 1C29A 1DJNA 3GBEA 3N12A 3UJ2A 3H53A 2F6KA 1EIXA 4MWAE 3VCNA 3S2NA 3VO0A 3S47A 3DYMA 3APGA 2G50A 4N4PA 3ODKA 3RYSA 8RUCA 5HMFA 4MLJA 2VENA 1W3TA 3ARSA 3GIPA 3GVWA 2CLEA 2YIHA 4FXSA 4PTXA 2VD8A 3CMGA 3NEHA 5AC5A 2VZSA 3VCRA 5CXPA 2PBGA 3PS7A 3BXWA 4PN2A 2YCLB 2F6UA 2WMHA 1N2VA 1J5SA 4O54A 2YL8A 3H8AA 4G7EA 2ALDA 4N0RA 1KBLA 1ZNNA 3LHTA 4RE3A 4NJHA 2Z2AA 1W5NA 1ISWA 3PZ9A 3N1AA 3KE0A 3CXOA 1K3UA 3WENA 1VEPA 4GACA 1M7PA 2I9UA 3P81A 3CPRA 4H19A 1CXIA 1K9DA 1MW2A 3VCCA 1E6RA 5LA1A 3DFSA 1W32A 5I5RA 3GLCA 7ENLA 2QW5A 3WMBA 4UB9A 2E25A 3QTPA 2QGHA 3ITTA 1W5QA 3LXAA 3LN3A 3QQ0A 3WJXA 5CZKA 4ZQOA 3RITA 2F2DA 4Q6JA 4WJXA 3UI4A 1N8WA 5AHIA 1KM6A 1XBVA 1GVSA 4R9OA 4C6MA 5IHRA 1TZ7A 4AIEA 1W9XA 3BUVA 3UXIA 1NP2A 4JPGA 1DTUA 3VDHA 5DRIA 1TR9A 2EXOA 2BG5A 1PKMA 4HN4A 4PCFA 1AJ2A 2RQSA 2BY2A 4QT2A 3DC0A 1WDDA 1VGAA 1EIBA 3R8HA 3LGGA 4C1NA 1I1XA 5TF0A 2NT0A 4ZQNA 1DJGA 1ZP4A 3MYOA 4Z1CA 3CIVA 2EHHA 4Q4QA 3DCPA 1FP9A 1NWRA 3ES8A 3B9AA 2NV2A 2WNNA 4W5ZA 3TYEA 3G1XA 4TQTA 4G50A 2HNHA 4K3ZA 3UG8A 1S5MA 2P8BA 4HCHA 5HK4A 2V30A 1BF2A 1VFLA 3ITLA 1E1CA 3E9AA 1OBAA 5RUBA 4X9SA 3WF3A 5JUVA 1YRRA 1KLYA 4Z2HA 2WCSA 3WKZA 5D9OA 4PMQA 3B8WA 3OVRA 3RMEA 4E2VA 4ODPA 4AW7A 3F2DA 4Q8OA 3GWQA 4K8EA 1TQXA 5EMUA 4LAXA 4XZMX 1E73M 4JIEA 1KM1A 2XYLA 1EJVC 2FVLA 3ZJKA 4W85A 3RX4A 3VU2A 1KFKA 7REQA 4CKQA 1C8QA 2WLZA 3GNOA 1UOZA 2C71A 3L2MA 1SSDA 1YPXA 4ODKA 3R13A 3QZ6A 2VRKA 2GQ9A 1JDFA 2VVSA 5C5YA 3TKFA 4KWUA 2ZXDA 3W2LA 5G1YA 5HR6A 4RE2A 1B3ZA 4C6IA 4IP7A 1BRLB 4KCVA 3WBXA 2LGOA 3PZGA 1CT5A 1FXQA 2VGIA 5EFFA 3I3EA 3TQPA 2DG3A 3ARUA 5AN7A 1RH9A 5ECVA 1PYMA 1Q6DA 3WEZA 2PDBA 5E1QA 2NQZA 3KOYA 2P1FA 2Z1KA 3CT2A 4W9QA 1QPRA 4GK8A 3NYDA 4NNBA 2ZC1A 2PDWA 1F3XA 5D2WA 1LWHA 3G6LA 3USZA 2XIBA 1Q7ZA 2UY2A 2PU0A 2HPIA 5T91A 1TWSA 1VBRA 3VC5A 1Q6IA 4WJ8A 4XAFA 3B7XA 5HNRA 1C9DA 4MWAA 1EHNA 3TAOA 1UB3A 2I5GA 1VIWA 5I7GA 1HJQA 2HJPA 1PEZA 3G3DA 1U1JA 3GDRA 1A5LC 2BFGA 5DITA 2CPUA 1FWFC 2P50A 4YLWA 4HPNA 3O0FA 3N14A 4P8WA 4ZODA 2QZRA 4O57A 1S5NA 5CBBA 1JF6A 1HW6A 1B4EA 1K9EA 1JD9A 4DI9A 3F5KA 4AB4A 4E8DA 5A95A 2DUZA 4OQVA 1ENUA 3VGFA 4RNFA 3ALGA 2PS2A 2W79A 3IIVA 1R7AA 5MHBA 1G5AA 2PWDA 1SPQA 3AHTA 2Y88A 2QEZA 4IPNB 3RO8A 4DLFA 1ITQA 1UWUA 3VX1A 5G2IA 1J4EA 2ZR4A 3IJDA 1CENA 3OJGA 4KS0A 5FACA 4MYAA 1E3XA 4S3DA 1RPXA 3QPYA 4S23A 3V1PA 4ILSA 2WCAA 2FZ9A 3N9KA 3H2CA 4LU0A 1PX3A 2P0IA 3OVGA 3KAFA 2Y5JA 3LM3A 5G4WA 3IK8A 3VDBA 1PCWA 5K7JA 2CLMA 4DELA 3WUGA 5IFTA 3OEXA 2XIQA 3LNPA 4S3BA 3TSBA 1EJUC 4ACYA 1S46A 2FVMA 5HWMA 5J8LA 4GFSA 2HSAA 3FX4A 3I65A 2G95A 1UP2A 3P8JA 2V5JA 1IEXA 3CB3A 2CZ5A 4LC6A 3LHZA 1DQWA 1O60A 1KFJA 3W87A 4JQAA 4J4NA 1Z48A 2J8GA 3RPTA 3T9PA 4F40A 5XIAA 2C0AA 4UTTC 3WK2A 3SCWA 4UTJA 1UKOA 1F8IA 1EQPA 2G0WA 3ARYA 3GUWA 1TV7A 3IVUA 1QK2A 1CECA 3FDKA 2ZQTA 1OY0A 5CPOA 3IANA 3NOEA 4EE9A 2WSKA 2TMDA 1MZRA 3GFXA 3WJYA 2Y24A 1RJQA 4D6HA 5D38A 3NQCA 3URBA 3WDHA 4O0QA 3D3AA 3T1GA 3FHAA 5IBXC 1ADOA 1PSCA 3HZ3A 4IMAA 1PHQA 4PUMA 4RE0A 3RLGA 3BSHA 1J6OA 3B0VC 2YL9A 1RCXB 3GXTA 4AF0A 4GXPA 2DJLA 3NSXA 4J35A 1XSIA 1TV5A 1GVYA 3LDVA 3SZ8A 3E12A 4UNLA 5CLWA 2ZQVA 4QEHA 1PIGA 1TWIA 5AB3A 1EGMA 1XLFA 3OO2A 1C7TA 3RU8X 4Z2KA 4XZWA 1OF6A 3LTPA 3SJ3A 1W3HA 3WK1A 1M7OA 3R6IA 4XQ6A 1HGWA 1U5VA 1XSJA 2OOFA 3CB8A 4GZ7A 4O10A 5BU9A 4JFKA 4QG9A 1XL9A 2Z1BA 2KI3A 2VJXA 1W54A 3RLVA 3ZT6A 4F0KA 1QUMA 2G3FA 5CBIA 1Q1CA 4P7RA 3FYOA 1GOXA 3SADA 4HCLA 2CKRA 4TOQA 4DJEC 3VOFA 1TCDA 1ZZMA 4GI6A 3EGJA 2PGRA 3UG3A 1VBGA 1U1HA 3MP3A 4LS0A 4WX2A 3BMXA 2WNZA 1NVMA 3WF4A 3CUGA 3B8SA 3HJEA 4DHGA 1Q6LA 2DZSA 2YL5A 5FF2A 3CV1A 5D05A 4ZBCA 2I1OA 1PZ1A 3QV9A 2P3ZA 3E0VA 5CC7A 1A5AA 2OQHA 3FVMA 2FGBA 5FL0A 1IT8A 4FNQA 4MVAA 3TSMA 5TAOA 4YVVA 4L4LA 4W7VA 3SGZA 2W6RA 2R8WA 4G7EB 2NSXA 1BTMA 3TNBA 1E40A 4J40A 3S8HA 3AMDA 1GK8A 4IIEA 4WDXA 3EIPA 5GNXA 3L0KA 1A4MA 1NDWA 5AHEA 4J2MA 2DZVA 2WMFA 2F84A 4NZFA 2PDFA 1WXJA 4U85A 4KFNA 4FX7A 4L6DA 4JYEA 5AKQA 1TE1A 4G1NA 1WUEA 3FXGA 4M8UA 1QI4A 3M7WA 4US5D 3C52A 4KWSA 1CXFA 4M56A 4IMEA 1OGBA 4LWWA 4KKXA 4JTLA 3E5BA 1K9FA 3L5LA 3QMRA 5EU9A 3HG2A 3QC0A 2Z2UA 3ZMRA 3GD6A 1K7EA 3UPBA 2YSWA 1YW5A 4UTKA 3QMTA 3S1UA 4QCEA 4BEUA 5HA7A 1Q63A 2Y8VA 3UQBA 1LLWA 1FTXA 3WEOA 1CX9A 5AHNA 1I2RA 3VZXA 3CYVA 4LY4A 4GGQA 3CPGA 1BFNA 1L1PA 4C1NB 1GVIA 1E0TA 2WVUA 3QV7A 3W7OA 1SQ7A 2WB5A 1KT1A 2EPMX 4N9DA 2H3BA 1CW2A 3WFAA 3V0SA 1F3EA 2CZDA 3P60A 4FXJA 4UCFA 3EDEA 3MJMA 5A1AA 1QAPA 2BB0A 2OEJA 3O5DA 1JPHA 4GIRA 1JPDX 3RCNA 4HPJA 5SWUA 1IXQA 2WLYA 4FX6M 3DOPA 1JQVA 2J7BA 4QEEA 1IIHA 1WX0A 1V6XA 3LYEA 2G3JA 5CJMA 1FJDA 4DJFA 3ELFA 1DP0A 3NGJA 1L0PA 4RX0A 4KEZA 3I68A 1T0OA 5CSSA 4C7FA 1KW1A 3ME3A 2DZPA 4GXMA 4JTFA 4CQ8A 5G2WA 2YL6A 7REQB 5K9CA 4O1DA 4GYJA 3PTDA 4EK7A 2IW0A 4HQVA 3K4AA 3W25A 4O0ZA 3VD3A 2HVMA 3PZQA 1F6KA 1B3VA 4NILA 4OOUA 3FA4A 2QJIA 3FLUA 1B4KA 5D4YA 1KD0A 2Y62A 2AMXA 3N11A 4L5ZA 5FOOA 1XSKA 5G1MA 2FTWA 3BZJA 3O5JA 3HIJA 3TXZA 1GKPA 5DO8A 4B3ZA 3WL1A 4UTTA 1H3GA 3EY6A 3TTQA 1KBJA 1D8CA 1V6YA 5A5WA 3G1YA 2E4TA 2E77A 1GJWA 1A0EA 1I1WA 2XJ7A 5I06A 3SUVA 4ODNA 1H09A 2VUYA 3WQVA 1XLMA 3SECA 2EG6A 2YDSA 5HKGA 3W7DA 3W81A 2OVLA 4W9PA 3LRLA 1CYGA 1VFTA 1RQBA 2PV2A 2MNRA 3I6CA 3K13A 1J4RA 3TH6A 2GDQA 3EX3A 3BLEA 4ROQA 5IBXA 1H41A 4W84A 1V7YA 2PE4A 3PBUA 3IV8A 3POHA 5DANA 2PDCA 4NJIA 4FLSA 1CNVA 3P5YA 1VC4A 1DIEA 3W22A 1JEZA 1OFQA 5IRPA 1Q7MA 4QP0A 1YKWA 4NT0A 3TOYA 2OLSA 1OD0A 4B16A 2NLIA 3TW7A 3K8KA 2D2HA 4GQRA 5D09A 4UTWA 4Q4SA 2NWRA 1WV2A 1VB9A 3ZLFA 3BPWA 3TC7A 2WMIA 4MY9A 1UUOA 1ONRA 3I3BA 4FAPA 2UBPC 2DY3A 4DROA 4TX8A 3LTYA 5I98A 2PDMA 3SJNA 1YDNA 3HM7A 4J4OA 4MY1A 3UT0A 1W1PA 3DECA 1XD1A 2PCQA 3AXKA 3AXIA 4W8LA 2V3DA 3BMBA 4DBUA 3HV8A 3HG5A 4IQCA 3TP4A 2A7NA 3TJXA 2AQVA 4ICCX 1GYMA 2YXXA 1O1HA 1J0YA 2X8RA 1V02E 4ZQRA 4L4PA 4HN8A 2PRMA 3BC9A 5CSRA 3I6EA 4LYPA 4IL0A 3NJ3A 3C56A 3PTKA 2BHYA 2WJZA 2E8ZA 1QBAA 4BY3A 4XWUA 3ANVA 1TPH1 3TDFA 1A5OC 5I78A 2C8NA 1ZBVA 5I3GA 2C91A 4M5PA 4MUZA 3UJSA 4W86A 2OR2A 4NJGA 4H9ZA 4PEEA 2MLYA 3A23A 1HFBA 1PVNA 1V8EA 3AIVA 4HYRA 4D1JA 4L4OA 4DM1A 5G4EA 1X98A 4GNKB 2OGYA 4WIWA 3LX9A 4FHAA 5DBUA 4EOUA 3KL5A 3K1DA 3Q4DA 3HU7A 3KAIA 3UQIA 5MKGB 3M44A 2MNTA 3H12A 4S3FA 4ZCWA 3QSRA 2XIIA 4CN1A 3C2VA 3S2CA 4E2DA 3UGRA 5J5RA 3ZXWA 1F40A 3WH8A 3ITYA 1V6UA 3MV11 1CGUA 5D2XA 2F2HA 4F4RA 4Q7IA 4LYRA 2Y2WA 2ONEA 3FGCA 4KIEA 4ZFMA 3PZMA 4BKNA 3AYVA 4RW3A 4QISA 3ZSTA 4FA3A 2XP5A 2B31A 2O9RA 2VFDA 2DT2A 3JRKA 3H70A 8TIMA 1FCQA 2DORA 4REQA 1Q45A 1MFVA 2AKZA 2GJNA 2E1WA 1P6WA 4KCWA 4OV9A 1E72M 4IPIA 3P80A 3VE7A 2HBXA 4UQCA 5D8WA 2WHLA 2GK1A 1JPIA 1QCWA 1BVNP 4N6EA 4MNLA 2P8CA 3IIZA 1ODUA 2OT0A 2A3EA 4Q32A 1XI3A 1ML1A 1XDMA 2Z28A 4OKDA 3LUOA 3QV6A 1VYRA 3VNKA 2AKMA 1TYGA 3BAXA 2WSYA 4NHVA 4P8XA 3CAVA 3STGA 4KMQA 5C7VA 1P43A 1NFPA 2ZX5A 4H83A 3B9OA 4HJWA 3BCFA 1XW8A 1ZBWA 3UNDA 2PLJA 3QC3A 5JH1A 2ZYFA 1J79A 2ZVRA 1JZ7A 4FLOA 1AG1O 1QHPA 3IGSA 1WBHA 3DFQA 2DVUA 3U57A 3AHYA 1ZK6A 4XAZA 4LCSA 3WQ4A 1R8LA 3IJ8A 1HJWA 2WVVB 3C6CA 5HWBA 1F6PA 2FJUB 2OOGA 3BLFA 3KHJA 4AD2A 4J3ZA 1EC8A 4JY8A 1EJSC 1POJA 2W66A 2GGIA 2VEGA 1SW7A 2Y78A 3FDGA 3UR7A 3PWAA 2AMGA 3TJIA 5I00A 4JR5A 3V5OA 4E4PA 3GBDA 3P7YA 3FSTA 3WH5A 4F2UA 5LIXX 1IT7A 4KFPA 2V67A 4FF5A 1GOMA 4AZGA 4F0LA 2DUAA 1AL7A 1WBJA 3CBWA 5BRPA 5I07A 4TVDA 4RNJA 2VEMA 4MGVA 1YHTA 2WZHA 4DF1A 4FXRA 2A7PA 5CC6A 2VFEA 3AZRA 4MWAD 3A13A 3JW7A 1TJ0A 2DVTA 5FJIA 5I09A 3A3HA 3PC0A 2JALA 1V02A 1E56A 1XYCA 3KCJA 4PMZA 2IUZA 3VOGA 1FOBA 2QIWA 4GKTA 1H2JA 1OFRA 2O9TA 3W1TA 4I90A 3AIQA 2Y85A 3LXBA 2L5HA 1TVNA 3COTA 1FHLA 2RKXA 3GO2A 1A5CA 2F8QA 4FPSA 5K2ZA 4M6UA 4JHMA 4TR9A 2V0TA 4AUBA 4WKHA 2R94A 3R5EA 3VIKA 4HPHA 5BNKA 4EANA 4O17A 1JF5A 4Y96A 3G3MA 1YTEA 3MTWA 1A3XA 4TU1A 1TJ2A 2BGNE 3VNJA 3R89A 3SQMA 2DSVA 2NQHA 4F0RA 4YN5A 3LA4A 1AQMA 2P3EA 3S6OA 1GYNA 5A6BD 3BOLA 1W1ZA 2DZXA 1G4PA 4JFLA 3UY8A 3SQLA 1A47A 1UH3A 5XIMA 1JYXA 3MMUA 2IKGA 4MZ1A 1MDRA 1SFTA 1OFOA 5KSWA 3AIWA 4NG3A 1V6TA 1XM3A 3IVSA 1V0LA 3W4RA 5A8GA 1C7SA 4N6FA 4O11A 3DC8A 3FJLA 1VBHA 3BE7A 2FFCA 1QHZA 3O5QA 5HANA 1V0KA 1W8SA 2XISA 3KAGA 2YDRA 3ANUA 3V1HA 4ONVA 1ZY9A 1JZ6A 3ZT7A 4LALA 2QCHA 2TSYA 3ZR5A 1Q6QA 3EWWA 5GJMA 1UR0A 1MUWA 2OXNA 3YPIA 5GNZA 2AGTA 3NQAA 2GOUA 2V38A 3MA8A 2J7HA 3QTGA 3CIWA 1SM9A 3NQEA 1DJZA 1DPMA 4DVOA 3MYPA 3PR9A 4KCTA 2IPJA 4HHMA 4L4MA 1I2QA 5DCBA 1XDLA 3L12A 4GRSA 1OF8A 4J5NA 4E38A 1OFBA 1Y0EA 4UNIA 4DBSA 1WO2A 2R82A 3EX2A 1SZRA 2D0GA 3M46A 4I6VA 4RLIA 1F74A 3THCA 4WVXA 1IR2A 3VNMA 2NQ5A 1M6JA 3I6TA 4EVZA 4ZSUA 3BAWA 3W7JA 4DQWA 4CQBA 2VEKA 1Q85A 1NFGA 3W86A 3R12A 3GNXA 2XP9A 3KDOA 3W2KA 1N55A 3DXIA 1A3HA 2XGZA 5K3VA 2E40A 3EDFA 3GXPA 3SN0A 3UXDA 3W2MA 2HISA 3QYQA 2W91A 5BOEA 1J9YA 3I3DA 2Z7KA 4DO6A 1OSEA 5ABFA 2VR2A 3CTTA 4TXEA 3ITGA 1J11A 4O1CA 2NV9A 3WN6A 4HNCA 3MSGA 2WMIB 2DSKA 4GC4A 1XIHA 1XISA 3OBEA 1XH2A 1TMHA 3QGAC 1I75A 2R1PA 2OMAA 3EKZA 1Q3NA 5D37A 1MDLA 4JN7A 4ACZA 1FWTA 3LMYA 1EJXC 2WW5A 4K36A 4I3GA 3GU2A 2R91A 2DEPA 1R47A 2QUNA 4MM1A 2WNWA 1JNSA 5AHFA 4XZIA 3GNRA 5EYWA 1HKIA 3SM0A 2ZRZA 3CIXA 3BAIA 1TRIA 4PMXA 5A8NA 4CNPA 5HUAA 3QH2A 3S5NA 3O5RA 4UTHA 1J12A 2GOKA 4IQDA 4S1FA 2B7PA 2VOTA 1JYWA 5FF4A 2D2GA 2XH7A 4MADA 1HP5A 1MXDA 1TELA 3AXHA 3GPKA 2CZFA 4H2HA 2CEQA 4HBOA 3MWAA 3S1XA 2Y7EA 2BY1A 1ZQ5A 1DWFM 1JCJA 3NNTA 5DT7A 4IXXA 4CNOA 2QLYA 2J7EA 4O4WA 3W7QA 3BLIA 1LOLA 3R25A 1PZ3A 3AXXA 1TMQA 2J13A 3WF0A 3WG6A 3NTPA 1A49A 4KRZA 4CEUC 3KTSA 1TR1A 3PUOA 1CB2A 3VKDA 4PBGA 1MRQA 1POKA 3TMQA 3C0LA 3IVTA 3ITVA 1DTNA 1UIOA 2QCCA 1QVBA 3GAKA 3PULA 4GQBA 3B8UA 1QXLA 1UA3A 3CZJA 4GIVA 1KGUA 1WDRA 3AI0A 1UD5A 1IR1A 4XX6A 3WQEA 4RPQA 5CJ5A 4A29A 2H8XA 4M1RA 2FPTA 5EBAA 4YIWA 5JIWA 1I2PA 3C2EA 4KGJA 4OU1A 1EKOA 3H6OA 3NVDA 3IACA 4TV5A 3UPMA 2AWGA 1D6OA 1UH4A 1EDQA 5DMYA 3W1XA 2RJGA 3QKEA 3HQ1A 1R2RA 3EDDA 3NL6A 4Q4KA 3LTSA 5CZSA 3FKRA 1SSGA 4D72A 3M5XA 1W1YA 4QAWA 1Q8AA 3ATZA 3O6CA 3FAPA 4P7QA 2IPFA 4FR6A 3VAWA 5BCAA 3WLMA 1O66A 1SGJA 1C90A 4MJ2A 2ZRXA 2XIMA 3UNTA 4S3CA 3LS9A 2EPKX 3U7BA 4KIRA 1REQA 2YA1A 2GGHA 1BXNA 3HB9A 1ZALA 3FHQA 1ME9A 2VNCA 1MEIA 1Q6EA 2GUBA 2W92A 3CHCA 4PUNA 1QWKA 4AVNA 3GFYA 3TX9A 1RCOB 3NXFA 4JL2A 1VKFA 3HGSA 1F8AB 1OCQA 1R9XA 3F4VA 4AIUA 2XGBA 3AMKA 4XD5A 3WQWA 4HMDA 1H7XA 1UWQA 1OIMA 3BAJA 3G1RA 3GG1A 2XN1A 2ODOA 3WNKA 2YLLA 1DQUA 2X05A 1XUZA 1TCOC 3EA2A 2ZQ0A 1KRMA 2PPOA 1EOKA 4NZJA 1EZ2A 2XZ9A 4UNKA 3NZGA 4IG2B 3MCOA 4HPGA 2BS9A 2Q3RA 3CNYA 4ATDA 3ABXA 9RUBA 4LAOA 1XS2A 3NVTA 3GC5A 4LRTA 1QNQA 3MSRA 4XVEA 1JI1A 3LSBA 2MF9A 1MEHA 2PGFA 3ICJA 3M64A 3CQKA 1FH7A 2HBVA 3N2BA 5FEPA 3O5GA 4XSLA 3AMGA 5E09A 1X1NA 2Z24A 1YPIA 4FR1A 1K77A 2GSJA 2NXIA 2PTWA 3L67A 4NU7A 3TQ0A 2QDHA 4C6NA 4BF8A 3SURA 3EB4A 1KTBA 4QNWA 4YMZA 3W1AA 3GC4A 4G5DA 4ZPWR 1FKWA 2QJJA 4MUPA 4WY0F 2J78A 1W2VA 4CGTA 2X7VA 4L65A 3K8MA 2BBFA 1YW1A 2F9RA 3M5ZA 5DLCA 1RUSA 3NGFA 5LSMA 1J8VA 4A2SA 4MSSA 1UD3A 1VPQA 2YGYA 3F5JA 5DMNA 1VJSA 3W7MA 5CC3A 1FKSA 2OODA 4KWVA 4W7UA 3NURA 2Q8XA 5E70A 3V0UA 3A6OA 4AQLA 1ESWA 1SZFA 4IJBA 1XYZA 4OE7A 3FXYA 4IUGA 5CKSA 4DM2A 3N3MA 3RPDA 2OU4A 3D5HA 2A3LA 1UZHA 3DYOA 5TNVA 1TRDA 3W38A 4HB7A 3T0CA 1RP9A 1RVKA 4MDOA 4Z08A 5AHLA 1TCMA 4WKAA 3NQ7A 1Q4WA 3V36A 1EO7A 4O1EA 3S5OA 2A6LA 4W5UA 2W67A 3A9IA 3TCZA 4O8RA 4DYEA 3WNOA 4FEZA 2POTA 2VRQA 3MZ2A 2VQUA 1ZBKA 1P7TA 3LEPA 4XZHA 5H8PA 1KTCA 1R86A 3KL0A 1A5BA 1UA7A 2ETNA 3AMCA 1RJRA 3T40A 4LS2A 1GOQA 2CERA 4GY7A 3TONA 3CV7A 4Z0SA 1O7AA 3LV6A 3MT1A 4GHRA 4UOZA 3MO7A 4JIHA 3PNUA 5K9XA 3SCPA 3KRUA 1WE5A 5H8MA 3C86A 1CIUA 4BJHA 2BVTA 2EGZA 2FB2A 2PBOA 4OT7A 4OJYA 2DIJA 5I24A 2VMFA 4IPXA 1EGVA 1XYFA 2WVSA 3BV7A 3MCMA 3H2MA 1XIGA 2PP1A 3ATYA 4D8AA 4HT3A 1YEYA 3PG9A 1TSIA 4JTRA 2R24A 1LBFA 3WLJA 4XZ9A 4ZA0A 5DEZA 3SY8A 2YBVA 5GQBA 1AZ1A 2NW0A 4PUDA 4DPQA 2DT0A 4HU8A 3F2BA 1K4GA 1EEXA 2RUQA 3NPVA 2OEKA 3WMCA 3W7HA 4D6JA 1ZJAA 3L4YA 3QFEA 2GDVA 2VGFA 1ICSA 7PTDA 3BL3A 2DU2A 1OGSA 3N4EA 3QHNA 2QUVA 4DWDA 1QPFA 2V69A 1H49A 5EPDA 5FSEC 5TD4A 4DN1A 1B54A 3SCNA 3WMLA 1MFUA 4LT9A 4DUXA 3FYPA 3VUSA 3KOXA 2MLZA 1NDYA 3H22A 4UMAA 2YPIA 2CCRA 4S3KA 2ISVA 5JBFA 2CETA 1NF0A 4AX7A 5G5IA 4DZ2A 2IS7A 3OIHA 4ACZB 3URNA 3DG3A 2GVJA 3HN3A 3W9ZA 3MI2A 2XP4A 5D32A 5D2VA 1FWDC 4JTTA 3VA8A 4HNLA 4YNGA 1LF1A 2A0NA 1ISVA 2LLEA 5EFDA 3AU2A 4C6CA 2IF4A 4IIFA 4FAMA 2OJPA 1SW3A 2DIEA 4AZHA 1B9ZA 1LP6A 3HF3A 2IKIA 5D2YA 4IF2A 4B15A 4Z42C 1FWWA 5CPSA 3RPMA 1TTJA 2OZ3A 2DH2A 3L2LA 3MBFA 2BV9A 4GABA 2JFEX 4NP7A 4E8GA 4ODQA 1X8CA 3EPNA 2FQIA 1RCQA 3FY1A 5CPNA 1DJXA 1L6WA 4O14A 2IQTA 1E4MM 3KBNA 3PWGA 3P0XA 1A3WA 3W88A 4LV4A 1UP3A 2CBJA 1RPKA 4DY1A 4P61A 5CQ1A 1UR2A 5F4SA 2Y8KA 1J10A 4ZO9A 1QI2A 3B3DA 4EPBC 2V5BA 2V2CA 4E4UA 1IEVA 4WKFA 1IWPA 1D7JA 4HK5A 1D3GA 4YU1A 1GW1A 9CGTA 2OYKA 3O05A 4WCJA 3P84A 2EJAA 1BTCA 1FH9A 2GYIA 5HULA 1K03A 4LUIA 3OYXA 3OGSA 3O7UA 2LPVA 3SUWA 1JUEA 1JFHA 1KA9F 2JK2A 1K02A 1A0CA 4F48A 1ZJBA 2PDQA 3JS3A 3LENA 4IGHA 3SQSA 2IQ0A 1W0MA 4YTQA 5HUPA 3GW3A 3ANYA 2YBTA 4AZIA 2FB3A 4H9MA 2Z1VA 3B0UX 4B4FA 2BY3A 4KFOA 4E3VA 3U9IA 2HNEA 1VJZA 3WDIA 2Y6ZA 4C6LA 1XCWA 3UF8A 1EJTC 2HS6A 4C6OA 1FKKA 2V3EA 1X1ZA 4UTIA 4XZNX 3WFZA 3V3WA 1TV4A 3M47A 4X60A 3H4GA 3VKAA 1X6LA 4DZ5A 1REQB 1XKJA 1XICA 4YPJA 4WEVX 2MLXA 3ARTA 1T5AA 4POCA 4BHYA 3LPFA 3OG3A 3GVVA 4DZHA 1KXTA 4AZCA 4JYSA 3W2JA 1H60A 1XG4A 4IFOA 1V0NA 4D8LA 5LNVA 1VR6A 4NIRA 4AYSA 1WP6A 3KVJA 1Z8AA 4TNSA 2E5CA 4EP8C 4S2BA 4GA8A 3UCQA 3D47A 4AG0A 1PPIA 1XGDA 3MS8A 1ISYA 6A3HA 1OFPA 5KETA 2OFJA 4ERGA 2PODA 2VFHA 3GTIA 4BQ5A 3DI0A 4OTKA 4N7QA 1PKLA 4JIIX 2ESCA 5E9XA 4J7RA 2XHYA 4EF9A 2ZQUA 4MB3A 1LLOA 2C1HA 2DUXA 4KWOA 5BYWA 3A4WA 1QOXA 6XIAA 1GKRA 1PWLA 4DJDC 4R85A 5A6MA 4V1XA 1KCKA 3S5YA 4JQ3A 3AO0A 1UH2A 4ODMA 4QGCA 1AJZA 2VDHA 3GXMA 4WZHA 3CU2A 3I4KA 1C9HA 1UPMB 1QMLA 3WO8A 4BQ3A 3SB0A 1QO5A 5LXXA 4TW8A 1RQEA 3BH4A 1XCXA 3P14A 5HWCA 3EOSA 1QASA 3WDQA 1KBBA 5HJYA 1H7WA 1US0A 1KBKA 5M03A 2WPBA 4H7ZA 5FJPA 4HSOA 1BSLA 3CH0A 3MANA 4EF8A 4ES4A 4MF4A 3BW4A 3W29A 1AMYA 2DP3A 2FPVA 4A2RA 3U2EA 3BLDA 4AYGA 2WV8A 3E2QA 1FWAC 1VEOA 3W83A 5I79A 4I8DA 4CCZA 5CEWA 3IIOA 1J6PA 1R87A 4CD6A 1XLHA 1KCZA 4KPLA 1WYIA 3H2FA 3LCLA 1AQ0A 1EL3A 4I9MA 2WMJA 3CAWA 1UZ4A 2PPPA 1FDYA 3O2LA 5BRBA 3DH7A 5D33A 2VELA 5DF0A 2FZMA 4AVOA 4QJ4B 1VHNA 5D9NA 4IQ2A 3CEPA 4MKVA 3QFWA 1NDVA 1UIPA 2CHRA 1B9BA 1CLXA 1HL9A 5EA9A 5C9WA 4M6QA 3F03K 1I60A 1EPXA 2AOSA 1P6BA 5CZTA 4GINA 4HZ8A 1KWKA 1IE7C 3TTOA 5ECUA 4KQZA 3GM8A 3BOXA 3DFTA 3ZSSA 1J4IA 3L4XA 2O9OA 3UWWA 3NAVA 4UMCA 4PB3A 3GZAA 3CS2A 4TX6A 1FFQA 4RNHA 3DHFA 1LL4A 2A3AA 4DYKA 3VNIA 3MBDA 1MEWA 1E9YB 4PC8A 1KXQA 3MC5A 1LRNA 2PSNA 4UFKA 5CLTA 3TXVA 3EB2A 1W91A 2KR7A 2ZX8A 2PU1A 5A3HA 2QCDA 1ZLPA 2ZOXA 4RZ6A 5JBEA 1FHDA 1KQYA 2WQPA 3NQFA 1EB3A 2WHMA 3GUGA 3WZ0E 3HTWA 3LB0A 3CQJA 1H5VA 2A1YA 1GORA 3MO4A 4Q22A 1GPWA 3MUXA 4NKCA 3VOHA 5HW6A 3LOTA 3WMSA 5H1WA 5JMUA 3W71A 3S83A 2NX3A 4QIUA 2NQJA 2QMJA 1NMVA 1TPC1 3VD7A 1PDZA 2VI0A 4MAZA 4XKYB 4KERA 5D03A 1Q6CA 3OLIA 1EWDA 1XLBA 3PP7A 1EC7A 1H0GA 4GLEA 1JNDA 3P93A 2BZNA 4DUWA 3MJYA 4IPLA 3EX6A 3STEA 3DU0A 3QPZA 5B80A 1GJUA 4FOJA 3EWUA 4L6OA 2RUCA 4S39A 1QBBA 1YE4A 3M0YA 7TIMA 4C60A 3QW3A 1IWAA 4LAKA 1XRFA 2TAAA 3CQIA 1S2WA 1QNVA 1V3HA 3W7IA 3CQHA 3NCOA 4UZSA 1NWTA 4XO6A 4K8GA 1YMYA 4JXCA 2QJMA 4K7VA 4QJ5B 3LZ3A 4QFUA 3REQB 1H7PA 2GSEA 1AA1B 4DRNA 1E9ZB 2ZX9A 2YFOA 5ABEA 1H61A 2I5IA 1MQQA 1J2WA 4QQ3A 2Z6IA 1DHPA 1TJRA 1K8XA 5EBUA 4O28A 2CXGA 3IV3A 1VFSA 4MJZA 3ABQA 5EB8A 1UKPA 1Y7VA 3VABA 3MPGA 4H9XA 4TIMA 1M3UA 1F2JA 3JU2A 2VCDA 3V75A 3PM6A 3L0NA 4AXKA 1OABA 4PUEA 3R0UA 2XP7A 1FDZA 3BGAA 2YCLA 4XTIA 5C2GA 5T26A 1UCWA 4AU0A 2W3ZA 4H8NA 3E6EA 3ES7A 4G1KA 2HTMA 2PDJA 3QN3A 1JNEA 3EWZA 2LKNA 1AH4A 2EPHA 3L5AA 4G6CA 4PMUA 1VBUA 2GUUA 4NAEA 1UWAA 1TA3A 2BXVA 4XD3A 4TTGA 2PDHA 5HNNA 6TIMA 1ITUA 5LNUA 2WKLA 5DIVA 3SFKA 3U7VA 2QXWA 1HUVA 1MNZA 3STCA 1HJUA 3FCPA 2CLPA 5EMLA 1P4CA 2A3CA 1OC7A 3SSJA 3BCDA 3Q58A 1HZYA 2CLIA 5DELA 3EXRA 1EC9A 3VZZA 3FAWA 5DCEA 4ITZA 3LLDA 2OX4A 4LW7A 3VOJA 1QK0A 4A8NA 1GZGA 3W7NA 4CD7A 3PJUA 4DXXA 4MHBA 5HWNA 1LG2A 4MNJA 2AGKA 2XPKA 1W3NA 4AEFA 4M80A 3L4TA 4HOWA 2GGGA 2X09A 3O6AA 4W9TA 2PLMA 2TRSA 3ERPA 3WDRA 1MO0A 3D6NA 3WDPP 3O6DA 4H9TA 3TYDA 3NO1A 1RHCA 3AHXA 3WFLA 5REQB 3OVPA 3CL8A 3W72A 2ON3A 3DG7A 2ISDA 2DT3A 4S2CA 3UZZA 2QUUA 2FMOA 5EMKA 4B3LA 4B4HA 1S5WA 2VCBA 1TWDA 5A6AA 2EG7A 5CG7A 4Q8UA 4YJ5A 5EMYA 3IWPA 3TDBA 5I3KA 5HBFA 4LOCA 1OD8A 3U2ZA 2D1ZA 1V79A 1QW8A 4H8UA 2PP0A 3GSMA 4B2DA 2EBNA 1H1NA 4TW6A 2PD5A 4UQ9A 4H4IA 8XIMA 3KCLA 4AMAA 2PTXA 4YTSA 2QDDA 1I9CB 3TE9A 2TYSA 5C8BB 1LRQA 1Q6FA 4PUWA 3G24A 4MGGA 3KBJA 1S2TA 4AY1A 1DWJM 2VURA 3ABSA 2OX1A 2XN2A 1OX4A 4N9EA 5FL1A 5H91A 4QR6A 4AZCB 1HXJA 3OHIA 4WGHA 4I7UA 3H7RA 1JQXA 1QHOA 2PDUA 3H24A 3MHGA 1BRLA 5HT1A 1Q6GA 4N19A 1EUNA 5BXPA 3PPHA 2FIQA 4XZLX 2J77A 1ZHAA 1R3RA 6XIMA 4PRWA 1WDQA 4Q7BA 1ZP3A 1UMYA 1TPWA 1EWEA 2OLAA 4A3UA 2RGLA 3NTYA 5FJJA 1E5JA 2FKPA 2G3NA 4GC3A 3ZJ6A 4FO4A 1L6GA 3RDKA 3LCGA 1BGGA 2DG9A 4JY9A 4NNCA 3LNMA 3UYCA 2EF9A 2JQXA 4GZJA 5I2UA 2EJ1A 5FAGA 3VOIA 1NTHA 1ZFJA 2C0HA 4HNNA 3Q94A 5IOBA 1GEHA 4MIMA 2E6FA 2B0MA 1QZ2A 2VWTA 3PRAA 1RP8A 1E6PA 5M1TA 4MZYA 2X1TA 3OHMB 1W37A 3ITOA 1K70A 1XIFA 4ZOAA 3ZM8A 3LLFA 1DWAM 3BGJA 3IS4A 3RGTA 3EWXA 1ISXA 1E5NA 4H8HA 3MI3A 1UWRA 2PC8A 3M0IA 4NJJA 4NYUA 5A6KA 2XGIA 1QT1A 4HZ6A 3ZR4A 3GQYA 4F8XA 3ORWA 1VFHA 4JIPA 3ZWTA 3PUEA 4JFUA 4JFVA 3O5IA 1JL8A 2FHCA 1UMLA 5IFPA 2INFA 2B7OA 5F2IA 1DIKA 4UFIA 3A3WA 2FJKA 3KRZA 2YYUA 4H01A 3PSWA 1PE1A 2LJ4A 3WD4A 3RN6A 1CLKA 3O16A 4H8VA 4EIVA 2HK1A 1HVQA 1VRXA 4GXWA 4J3WA 3TA6A 2PRLA 2INEA 5E6ZA 2VRJA 3WLTA 4C91A 2OB3A 4U10A 1M7XA 4X0VA 2WYSA 3VYLA 2FH6A 1EEPA 2DT1A 3SRKA 1R5YA 5A69A 2E9MA 1HG3A 1GEQA 1KKOA 3VGDA 2ISFA 3ZLGA 4HA4A 1UC4A 2QNEA 4JQ1A 5C55A 4LANA 1L9WA 5LIUX 4JX6A 1YPFA 4DO5A 3PJXA 3E2VA 4YYFA 3ISIX 3A9BA 4PTMA 3AAMA 4OBTA 2K8IA 3IJ7A 2CHOA 2QCEA 2E67A 1J0HA 3U5UA 1IT0A 5B7YA 5AC6A 4DWSA 3TROA 1W9PA 3N13A 4ZQMA 2CKSA 5FJUA 1Q7QA 1B3OA 4MOZA 3MDUA 4M3PA 3L9CA 1BWLA 2ZA2A 3L4VA 1UR8A 3W1MA 2BMBA 4AWTA 3DAQA 2DSZA 4DNHA 4XBSA 4XUYA 3CJPA 2XIOA 3KP1A 2XPBA 3RXZA 3T07A 2F2KA 5EY5A 4IHCA 1FRBA 3C3NA 4PSPA 2X0SA 3O5FA 4R7OA 3WLKX 1A5SA 4N02A 4X2PA 1E9IA 5HMEA 1E0XA 3C5QA 3IHZA 5KINA 4NNAA 1SZEA 4IP4A 4Q6XA 1JRCA 2WANA 3UCDA 5JH2A 4ENLA 2PP3A 1D8WA 4OWGA 4Z0JA 3MCNA 2P10A 3AIBA 1QR7A 2A4AA 1PIIA 3T2QA 4M19A 1IZCA 5ABGA 4LH8A 3VKCA 1OHLA 2WK2A 4LCQA 1THFD 4FN2A 3WQDA 1O5QA 1LBLA 4MB5A 4I5UA 3QHOA 2IPWA 1JZ2A 4A05A 1PXGA 2X41A 1HJXA 3LPPA 4U33A 1QPLA 2J6XA 4IXHA 3PR2A 3P3BA 1CBGA 4TUFA 2KAUC 1PHWA 3RLHA 1U79A 3AS2A 4Z2GA 5HJLA 1UZDA 2ZUTA 4PL1A 1CGYA 3U6WA 2PWVA 4QDPA 2QPUA 1E4IA 3TR9A 2NQLA 5A8PA 4OBSA 3AWOA 1YDOA 2XVKA 4B90A 5D02A 4RNIA 4BK9A 2WSPA 4XAPA 3WNMA 1US2A 2RSEA 3OG2A 5HNUA 5DFAA 4ZO6A 3U5YA 2W0UA 4C90A 4XUGA 1DEDA 2BY0A 3W24A 3TSDA 4QE5A 1Q6HA 4LBRA 5KITA 1FCUA 4NAEB 1F6YA 1TA3B 1XLJA 2CBUA 5I3HA 2I57A 2WZEA 2Y5SA 4Q8PA 2BP1A 1R30A 4PUUA 1W9DM 3LY0A 3GVGA 3C0JA 3MSDA 4R0XA 1TJPA 4JCMA 4ZB5A 1VFUA 1XLLA 3AHVA 4IMGA 3U4AA 3O5EA 3GHRA 1F7BA 5CGTA 3WD1A 1ODZA 5DQPA 3KVLA 2VC6A 1FCBA 4F9DA 2H3DA 3VAVA 1MW0A 1GHSA 3C3UA 1LLZA 1JCXA 1YNPA 2N87A 4U4MA 1GCYA 2YR1A 1FUYA 4X3ZA 1W1IE 2Y70A 2ZC8A 3LZ5A 1JZ8A 2QCMA 3GRIA 3QQ1A 2B7QA 4ML4A 4NJKA 3GNDA 4F0HA 1LBMA 1VD6A 4M0XA 4ZO8A 1OYCA 1MVYA 1H1YA 1GZJA 4ODOA 3WLHA 4IT4A 1C8VA 1M7JA 4NRSA 3D0CA 5G1TA 1QI5A 4HNOA 3W23A 4JN8A 2WSQA 4NZ4A 1Z9AA 5FI8A 2KX9A 3AROA 1J6YA 3QKZA 1BEUA 3W7CA 4C1LA 2IXVA 2J7GA 3KDNA 1W31A 3NQDA 1S1PA 2I16A 4LVFA 4DRPA 2CFFA 3MKVA 2F6XA 2Z4GA 2Y63A 4Q8QA 1CEOA 1EFZA 1PKYA 4GIAA 5D9PA 3MUZ1 2UZ5A 3DHPA 3K8LA 3TN6A 3NRKA 2VXNA 4H41A 3PVFA 4WQ6A 3ZO9A 4DUOA 1F73A 3NDZA 1VFFA 4Z2JA 4GJIA 1VF8A 1VIZA 5KZEA 1FWNA 3LQLA 2Q8ZA 2OGJA 1R9YA 9XIMA 3U2CA 2ABAA 1BQGA 1OX4B 3M5YA 4HU4A 3AFBA 3GKFA 1FCVA 1OINA 3MUCA 5I3JA 2V81A 4BCEA 4MSPA 1DV7A 2GVLA 4GNJA 3M0MA 5J04A 3G1DA 2IKJA 2C79A 4O1BA 1ZPTA 4FNTA 3RR4A 1CB7B 1DYSA 2VC7A 3T42A 4CD8A 1OVDA 1OZQA 4D6EA 4R9XA 3T2PA 2PWGA 3BJFA 1PUDA 2J7FA 5BMXA 4ZSTA 1VZWA 2B7NA 4QCFA 3TV8A 3CUHA 2HWGA 2DZWA 3E0LA 2FZBA 3A4AA 1V3JA 3W70A 1OJXA 2AL2A 4WDWA 2R1LA 1VEMA 5HQLA 5A6SA 3BO9A 3PJTA 2V5DA 1W5OA 1NOUA 4PBFA 3A12A 1KM2A 2ZRWA 3UW6A 3GC2A 3DENA 3LCWA 1KCXA 2Q6ZA 3SY1A 3BVJA 1FWCC 1R3QA 1XQKA 2Q8LA 4KWWA 2M08A 3B40A 1A5UA 2V5LA 1HJSA 1DJIA 4OHQA 1XLEA 5LXEA 3O5OA 3TVAA 1AH0A 3OLDA 3L21A 4DPPA 4U3CA 3ARWA 1DHKA 3VMNA 4DRSA 1RJPA 1PYFA 5CAHA 2A2IA 3R11A 3H7UA 1AZ2A 3KTCA 5HMDA 1Z7AA 4AWEA 5K4XA 1SO6A 4JTAA 1JAKA 1V4YA 4PH6A 1KM3A 3CPUA 2QUTA 2WM0A 1K1DA 5E9AA 4NSBA 2X1SA 2C18A 5CPLA 4B5NA 4EPKA 3PSVA 4P7OA 2YDQA 3OOQA 1KTNA 1FWJC 4O50A 3KS6A 2X16A 1BWVA 4F0MA 4GYPA 1XXXA 2GPTA 3UQNA 1BVZA 3VIJA 4D2JA 8XIAA 3EMQA 4I5XA 1TIMA 4JICA 3ZT5A 2XH4A 3TYCA 3BANA 4IX2A 4GMEA 4MYXA 2Z26A 5I6SA 4ZPVR 5FEXA 1NU5A 1EOMA 5E0KA 1JVWA 1OX5A 2G41A 2YB1A 5A8OA 3VMPA 3BCJA 3B06A 2ZZ1A 1XD0A 3UEQA 2OSWA 2QKFA 3WDJA 1WUFA 3WF1A 1TFVA 2PDKA 4UC5A 2YCJA 3UBPC 3H55A 4RJEA 3STFA 3CL7A 1W5PA 2A85A 4M7SA 2ZFAA 4WUIA 3MVIA 3ARZA 3AZSA 4LB4A 2A79A 4FI4A 4E5TA 2UV8G 1DE6A 3WQPA 5MKGA 3DESA 4JYFA 1U1UA 4AD4A 4B5VA 4QS6A 1PTGA 4LUSA 2XINA 3RNDA 6ALDA 3ZLHA 3MMTA 3B4UA 4KR0B 3UI6A 3TN4A 4RDZA 4QM1A 4DWSB 1UD4A 4I8YA 3L5MA 2XUCA 3MZNA 2YZRA 1I8JA 1RD6A 1OYAA 4A8LA 1D7IA 4OBRA 1FX6A 1PZ2A 1DOSA 4PFHA 1LT8A 5BXSA 1PDYA 3O1NA 3N2CA 1R38A 3R79A 1H0IA 4GVGA 2ZE3A 3AS1A 3ZJ8A 4UR9A 4FMVA 4ZOEA 2GQ3A 2GWGA 4NF7A 3GXFA 4Q4PA 1OT2A 4BWLC 4BI7A 1WA3A 3UESA 1Q5MA 1G9HA 4FX8A 3WLOA 1UR9A 2DVXA 1U83A 3A64A 4BF9A 1FKXA 4H04A 4ATWA 1UD2A 4DBWA 4IFKA 4GH1A 5F2MA 3UZXA 4LVBA 4BS0A 1TG7A 1JCNA 4Y90A 5HPOA 3QSTA 4CQAA 3AMLA 7TAAA 5CZ0A 1L2UA 4FF7A 4LVAA 4H9YA 1K8CA 3ZJ7A 3BICA 2XH2A 1GHRA 3G77A 3LXCA 1TWWA 1MUMA 1E0WA 1TPVA 3MUY1 3V0TA 3PN8A 3V16A 1PZ0A 1WPCA 4QNEA 4LS1A 1Y65A 3N4AA 3JVAA 4WHBA 5DMLA 2GJXB 2PDGA 2E8YA 3LBMA 3W02A 4N9BA 3EA1A 1D9EA 4DF2A 3WEMA 4EPEC 3VFLA 4IIBA 1R85A 4RKAA 2R1NA 3W01A 1Y8BA 2PWUA 1X7FA 5KZDA 2H90A 2WVVA 3EMCA 2HEJA 2PPNA 4TX0A 3B0XA 1S3HA 6ENLA 4CD5A 1SFLA 1A7XA 4KEUA 2OFNA 2D2JA 1G4TA 4EPDC 3IPWA 1XR2A 1YXCA 4Q3MA 3JR2A 1TPDA 4OUEA 4HA1A 4IICA 2Y7FA 1YIXA 4O16A 4LYQA 4IH3A 4PFMA 1LQ0A 3TZFA 2XPAA 3SN1A 3BK0A 2KFWA 4Y9AA 1T11A 4DBDA 1BPLB 5JXQA 1MSSA 1E51A 3FA5A 3ZQ9A 4I9TA 1KM5A 2YX0A 1HL8A 1SVDA 1SZGA 1VCGA 2WZIA 3NPUA 5KZMA 5BOFA 1LG1A 3PZTA 4E0CA 4CD4A 2DW7A 1LUCB 1NP0A 4AY7A 5A2AA 4MNKA 1BAGA 5HJXA 2O4QA 2VFFA 1NY1A 3A5FA 1E55A 1RK5A 2Z27A 2Y61A 3DHUA 3M0JA 4HD5A 5D04C 1DJYA 3DERA 2NLYA 4Q8TA 5CBJA 5M3WA 3UWEA 1XIIA 5JBDA 2QCGA 4BQ4A 3FYYA 4HCDA 1C8YA 2DJXA 3IIPA 3VIGA 3AYTA 3IARA 1TV3A 3W6MA 1RK6A 2UZ9A 3DHDA 4JTJA 2RAGA 1EA0A 3E3HA 4INFA 1EPVA 4UBPC 4MKSA 4D1IA 2PPGA 1FBAA 1ICQA 2PDXA 4UXDA 4X2RA 4IMFA 1NAL1 2DH3A 4UTLA 4WY0A 2X1UA 2XFRA 1UKSA 2PDPA 1QO2A 2VUNA 1WZLA 3FEQA 1KXHA 3VPLA 1J2BA 1T96A 5TBOA 4H6RA 4BF5A 2QT3A 1BQCA 3GDBA 2WXDM 1IV8A 2JIEA 4HYVA 4QQUA 4L1XA 4JN6A 2BOFX 2HMCA 1BF6A 3UWUA 2GSHA 1JUBA 4TYOA 1RR2A 4JTGA 4ZQPA 5CPTA 4YS1A 2ACSA 1TTQA 4IUOA 2GZXA 2XSAA 2BDQA 1LJYA 2JKPA 2E6AA 3GB6A 1E6ZA 2EO7A 3WY1A 4P7NA 3S1GA 3TOPA 2ATMA 3CO4A 1JCTA 2C1IA 3RJXA 1XYMA 2Z2BA 3W7GA 1AMKA 2MPHA 3WF2A 3LHYA 2YKKA 3CLWA 4DF0A 1X6UA 2WBGA 2UY3A 2Y5EA 2P53A 5BW6A 1ZJIA 1SMAA 4W4QA 5F2GA 3MHFA 1HQTA 2J27A 3FK4A 1KRAC 1LT7A 3EWYA 4GPNA 4IX0A 1KV5A 3K5XA 4IT1A 2NUYA 3CTLA 5HINA 3W00A 3LRMA 4NUWA 1Q13A 3GVQA 2VYOA 4QSFA 4UFLA 5M17A 3PA7A 1K4HA 4JCLA 2CBIA 3CL6A 1DBTA 4N42A 4RXFA 4ZB0A 3DN5A 4OZOA 4I5RA 1JZ4A 3PZNA 4LUTB 2RDXA 3NQVA 1KFWA 2AL2B 5CH9A 3TMLA 2GGEA 2X1IA 1LRTA 4YXGA 4V2XA 4WDT