1WB0A

Specificity and affinity of natural product cyclopentapeptide inhibitor argifin against human chitinase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
364
structure length
364
Chain Sequence
b'AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITOTRIOSIDASE 1
publication title Specificity and Affinity of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human and Bacterial Chitinases
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 128
structure length 364
sequence length 364
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2004-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF01607 CBM_14 Chitin binding Peritrophin-A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1wb0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1wb0A01
2XM2A 1XGZA 1BLIA 1CTNA 2WVVB 3BGAA 3SCPA 1XCWA 4M8UA 1XH1A 2D24A 4PYSA 2W66A 3TTOA 1A3HA 4GO9A 3WSUA 2X1IA 2WZEA 2EPMX 4UCFA 2WVUA 3SIMA 3SUSA 3VOCA 3CHEA 5D9MA 4ZENA 2CPUA 3WEZA 2E8ZA 2PC8A 3K4DA 2QPUA 3IJ8A 1JL8A 4JKKA 4OUEA 3NSMA 1BHGA 3CTTA 4UZUA 1HKKA 5C8BB 1GNXA 1HP4A 4D71A 1DWJM 3ARSA 4GZJA 4UFLA 3CUJA 2GJXB 2V38A 4JAWA 4YHEA 3AMKA 2XFYA 4Q22A 4TOQA 3GNRA 3GNOA 4PEEA 3B9AA 3VMNA 3AIUA 4UR9A 3ARPA 3AHYA 4FMVA 4P7LA 2CKSA 3A4XA 3PZVA 3WUFA 4CCEA 2JEQA 4KRTA 2J7BA 4A4AA 2J79A 2WVTA 4UNIA 3ARXA 2WSPA 4EK7A 1UR2A 1CGYA 4XUYA 1VEOA 3PZGA 2CERA 3T0DA 8CGTA 3VX1A 2J8GA 1F4AA 3W25A 1R8LA 4J28A 4E8CA 2VZTA 1BYAA 4GIAA 1EQPA 1CXEA 4H2CA 4FLSA 1KGXA 4JCLA 3CLWA 1OB0A 3G6MA 3LPFA 3BLPX 1UOKA 3ARRA 5JBEA 4BQ4A 2QHAA 4TTUA 1KB3A 3UG5A 1X6NA 5HDRA 1E6SM 2JEPA 4TVUA 4JKLA 1M03A 1OGGA 3IJ7A 5I23A 3GNPA 1W3LA 3PZTA 3WQ5A 2UY3A 2EEXA 4GZIA 4WLCA 5I2UA 2ZXDA 2O9OA 3W81A 1GQKA 1WDRA 1GOWA 2DH2A 3T2PA 1JZ4A 2WANA 3T0AA 4JFSA 1JYWA 2XYLA 3ARTA 2G4FA 2GK1B 3ZSSA 3AJ7A 3AXHA 4PMOA 1UD8A 1H5VA 5A3HA 2EPNA 1HP5A 5D8ZA 3EDKA 2WZIA 1CXHA 1VFFA 1UQZA 1Q6DA 1JDDA 1UKTA 1U30A 1QBAA 5DF0A 3RMEA 2G3MA 2YLLA 3WD2A 1ODUA 1UH3A 3VDAA 1JNEA 3KL5A 1E9LA 4UOZA 3A47A 3WH7A 3U5UA 5D9NA 2Y4SA 5JH8A 1SFSA 3BAYA 1EH9A 2J7DA 1NWUA 4DWSB 1V0KA 3HN3A 1JI1A 1FFRA 1LJYA 2WK2A 1G0CA 3ZMRA 1GVYA 1W91A 1PIGA 3CMGA 3CZKA 3D3AA 4GI8A 5IDIA 4PMQA 2CNCA 2EQDA 1LG2A 1QI2A 2XUCA 4P7QA 4BQ3A 2FGZA 2WMKA 3AMCA 3GTNA 4V2XA 1MYRA 1XCXA 1PJ9A 2CIPA 3WIJA 5IHRA 3EYPA 2FHFA 3M7SA 4OZOA 2QMJA 5FKYA 3RJYA 1BGGA 3GH7A 2JE8A 1JAKA 2J7FA 3MMDA 3VO0A 3HMCA 1E72M 3VIOA 1W2VA 3GM8A 3WMCA 1ESWA 1UKSA 2YL8A 2XM1A 1VB9A 4JFWA 2QV4A 1ZBVA 2BHYA 4MNKA 4H7VA 4GI6A 2D0HA 1BQCA 3DHPA 4HZ7A 4N42A 3VNYA 2J25A 4LYRA 2OSWA 2WHLA 3VD5A 1ODZA 1UD2A 4QLLA 4AD1A 1GOQA 2DSUA 3L4VA 1E43A 2CKRA 3FY1A 2YA2A 5M5DA 4U5KA 1CGVA 1V6UA 5DT5A 1K9EA 4P8XA 5ABFA 3SUWA 4AISA 2WKGA 2ZXAA 2ZUUA 2WVSA 1JZ2A 2XJ7A 3FXYA 4PUDA 1AMYA 2V3DA 4JL2A 1KXQA 2BVDA 1UR9A 3EDJA 2VVNA 2XFRA 2BHUA 5LA2A 4B3LA 2O9TA 2JFEX 3POHA 1ZU8A 4P7RA 4CCDA 1QI3A 3KZSA 2JALA 3IANA 4W7WA 3L2MA 3WFLA 2ZIDA 3AIQA 3GBEA 4JHZA 4QCEA 4HOXA 4ZXOA 3OLIA 1LL4A 1VFMA 1JNDA 1E0WA 3ECQA 3W27A 3VINA 3IAQA 1VIWA 1ZS2A 3AIVA 2ZUVA 5CPQA 2VCAA 1L8NA 4FF5A 2VZOA 1V6XA 4IPNB 4PSRA 2EJ1A 1C92A 3WELA 4MADA 3U7VA 3AS3A 4PMRA 1QBBA 1QHZA 4W5ZA 4R27A 4CUCA 1B31A 4V28A 4KWUA 3CBWA 3VD7A 1NWTA 1VFUA 3F5KA 4HA1A 3ZJ7A 3EDEA 1CXLA 3AIBA 4P7NA 1V02E 1NOFA 3AHVA 4X0NA 4GXPA 4JKMA 2DH3A 2CITA 1WAWA 3CUIA 4AYSA 1ZL1A 4PTVA 4W8AA 1ZB5A 4UFMA 5GNXA 1EDGA 3L4WA 2ZUMA 4TVCA 1V3LA 1D7FA 4LYPA 1DWIM 5A2BA 4WJXA 1TMQA 2ZUSA 3UG4A 3CIVA 4BQ5A 2XGBA 1JGIA 5A6AA 1WNOA 1QNOA 1NOWA 2GSJA 5GQBA 2RGLA 1WB0A 4PBGA 1EDQA 1JG9A 2ZXQA 2V3GA 2RGMA 1I1XA 3DC0A 5LA1A 3VIGA 2PWGA 2ZX9A 3OG2A 5DMYA 3UERA 1UR4A 1NP2A 3WQ8A 1ZBKA 3N11A 2YKKA 3WH5A 5A8MA 3AHXA 3VIFA 2WMHA 2DPEA 4PSPA 2WCGA 1E56A 3ZR5A 1UUQA 1TA3B 1KXVA 2CCRA 1HKMA 3MMUA 1VJZA 1B3XA 1E6ZA 4K68A 3M46A 2J7EA 2BY1A 1AQ0A 5ABEA 2GJRA 1XHGA 5HXMA 2YA1A 3BLKA 1JD7A 5CQ1A 3WDQA 3WD4A 1EO7A 4AD0A 4HPGA 1H49A 3ZT7A 4PMVA 1U33A 3SCTA 4PMYA 1UWSA 3WF1A 4B9YA 2YL6A 4X0VA 4FLRA 1F4HA 4UOQA 4PRWA 5AC4A 2ZOXA 3VTRA 4CVWA 4DM2A 1FOBA 4UTFA 1A47A 4MNLA 4Z2KA 3PBGA 3ZT6A 5E09A 5A8NA 1G1YA 1EHAA 4OOZA 1EO5A 2CBIA 3RM8A 2ESCA 1JXJA 1HT6A 1UH2A 1WZKA 2WW5A 1GUVA 4U2ZA 7CGTA 1GQJA 4HPHA 1V02A 1JXKA 1BYDA 1S46A 1BAGA 2W62A 2PI6A 1HKIA 3WH8A 3N18A 3PTMA 3WMBA 1H09A 2UY4A 1UWQA 4AIEA 4F9JA 4CD6A 1H0GA 3LPGA 3HJEA 5GNYA 4HP5A 2CXGA 3AZRA 3RDKA 2YJQA 4NF7A 2IXUA 3RPMA 4KGJA 1E6NA 2E3ZA 3ZJ6A 3W38A 3WNKA 3F5LA 3OLEA 5EFFA 2CBUA 4MB5A 2NSXA 5A6MA 3GDBA 2WHKA 1BPLB 1J0YA 4W8BA 1W32A 1OSEA 4W7UA 4YHGA 1US2A 4M81A 5JBFA 1MW1A 2Y2WA 3WNOA 2ZE0A 3AXIA 4CD4A 2VR4A 2OWWA 2VRJA 3VMPA 1E4NA 5A8OA 1VENA 4DM1A 1UWIA 1HJQA 3ZT5A 4GKLA 3MUZ1 2F61A 3BSHA 2PWEA 1GOKA 5JIPA 1LL6A 2WPGA 3ZQ9A 1WCGA 2Z1KA 3OLGA 4L4OA 1NOUA 2NT0A 1CLVA 2FHBA 1DEDA 4AW7A 2YL9A 6CGTA 1JZ3A 3D5HA 3EBVA 4C7FA 4AEEA 4UQDA 3WMSA 4QLKA 3I3BA 4UQCA 1IV8A 1W2PA 4CU8A 1CLXA 2ZUNA 1CGTA 1R7OA 1V3IA 2VI0A 3TONA 1JZ7A 1QNPA 4P8WA 1H41A 2WCSA 4D6HA 3NYDA 3VIKA 2Y8KA 3RILA 3VD9A 2XIBA 5C71A 1KCLA 1I1WA 5A6SA 2VR5A 2D23A 1DWGM 3S6TA 3W29A 2JF6A 3U5YA 5M17A 2UY5A 4WKAA 3WQVA 2CETA 4FLOA 3N12A 4U33A 4D1IA 3WNPA 1VBUA 4ACYA 1FHLA 1UKOA 3WD0A 3VGEA 3KEHA 1E73M 1C8XA 1B1YA 1J0HA 4M56A 4J7RA 2OWXA 4AZBA 1EOKA 4QDMA 3ALFA 3AHTA 1B90A 1DHKA 4BA0A 3WDPP 1BYBA 3THDA 1H1NA 1V6YA 3BAIA 2PF0A 2W67A 1W9XA 1JF5A 1W3HA 2DGAA 2E0PA 2BVYA 3VIMA 2Q8XA 4CU7A 2VURA 2W4XA 2ZXBA 1I75A 5F7UA 2YL5A 1V3JA 1NM9A 3B9DA 4YN5A 1UR0A 1CZ1A 3GXFA 3EDDA 1EIBA 1WDPA 2XIIA 2ZWYA 2VQUA 1UH4A 1GORA 3POCA 1YHTA 2E40A 4AZGA 2WKLA 4DWSC 1H0IA 4MNJA 2PBGA 3GYCA 3MUAA 2DT1A 4CVUA 3BAWA 4TX6A 4D6GA 1C90A 1LF1A 2VZVA 2D0FA 1CXFA 2CEQA 3T2QA 5BXSA 3AS1A 3PZMA 4ZXLA 2BXZA 3M07A 3ARWA 4HMDA 3AZTA 3II1A 5D9OA 1EA9C 1UHVA 4ATLA 3MANA 3CPUA 1E4LA 1JZ6A 2VX4A 2XFFA 2G3IA 2VUYA 3W0KA 4KMQA 3N13A 5IFPA 4OKDA 5IXEA 1NP0A 3NCOA 1PX8A 3VMOA 1ISVA 1B3YA 5BYWA 4M1RA 3WQ6A 2V3FA 4AC1X 4NRRA 1G5AA 4A3YA 5CSUA 1QVBA 3MKKA 2DSZA 4EANA 4F9DA 3VGHA 1CDGA 2YOCA 1J18A 3WNLA 1V6VA 2HVMA 4J3VA 1OD8A 1M04A 3AICA 3WF0A 3OGVA 4PMXA 5CLTA 3CHDA 1DTUA 4AD3A 4AY1A 1TVNA 4UQ9A 3WDJA 3VGDA 5EFDA 1U2YA 3N9KA 2DQXA 4ACZA 3HU7A 9CGTA 4MPKA 2A3HA 1ISXA 3OGSA 4AEFA 3OLDA 1C8YA 2X0YA 5ABFB 1ITXA 1SYTA 5HNNA 4PN2A 4C7GA 5HPCA 1GPFA 1E70M 3VU2A 2D3LA 1EQCA 3OZOA 1B3ZA 1M53A 2WYSA 3EMZA 2ZX6A 2EXOA 1OIMA 5LA0A 3ARZA 1J01A 2EPOA 2J7GA 3U7BA 2D2OA 2J47A 1CECA 1GOOA 2YBUA 3K8LA 2OYLA 3T09A 2XTKA 1HKJA 1PEZA 2V5CA 4QCFA 1UZ1A 3K4AA 2WC3A 4N0RA 1Q6EA 2BV9A 5A6JA 1CEOA 4WIWA 1UWTA 4TX8A 4PCTA 3BXWA 2W5FA 4B16A 1FA2A 1UG6A 5A1AA 4W88A 2PWHA 2WHMA 1E5JA 2ZX7A 5CGMA 4GPNA 3AIWA 1WDQA 3AYSA 1KGWA 5CGTA 1G9HA 2WBGA 3VD4A 3A3HA 4W5UA 2NW0A 2QPSA 2OYKA 3SUVA 4MB3A 2DIEA 3QHOA 1D2KA 1KFWA 3PN8A 2CBJA 1US3A 1E6RA 3WQ4A 3DECA 2JIWA 1HVQA 2WWDA 1BVZA 1Q4NX 1XH2A 3NIYA 1LLOA 4DUWA 1G94A 1TR1A 1R7AA 2VX6A 1BG9A 3L4ZA 3BAXA 1EXPA 3DYOA 4DWSD 4HOZA 3MV11 2FGLA 4MJ4A 1TZ7A 4HMEA 1E1EA 1M7XA 2VO5A 2A3CA 3B9EA 5I5RA 2PWFA 1E0VA 3GXIA 3BAKA 3AZSA 1XRVA 4AZCA 2X8RA 3CGTA 1QNRA 1BGAA 1HX0A 3F4VA 2VL4A 2VZSA 1OGBA 4XV0A 3VGBA 4J3XA 2XWEA 3OIHA 3EMQA 4UOJA 2HISA 1J9YA 4PMUA 5JBDA 3AIEA 7A3HA 1V0LA 1DWFM 1TG7A 3BCDA 3WL0A 3TA9A 3VD3A 2ZUTA 3PHAA 3IJ9A 2QLYA 1KXHA 4W89A 1E6XM 2DSVA 5FD0A 1HJUA 4U5IA 5A6LA 1FHDA 1JDAA 1FP8A 1GQLA 1GJUA 3KE0A 2VQTA 1JYXA 5E0CA 4NZCA 3GH4A 1K9DA 5IHSA 1V0NA 2VC9A 4M80A 1Y7VA 3WDRA 3VIIA 3I3EA 3UR7A 1IZKA 1J12A 3AOFA 3CMJA 1KGUA 4NI3A 3SUUA 1XSIA 4PMDA 2VOTA 2FDMA 3QOKA 2VRKA 4OJYA 3WDIA 4QLJA 3O2LA 2WC7A 2YDSA 4L4PA 1HJSA 1PX3A 1W9BM 3APGA 2WBKA 4MJ2A 4PMZA 3NSXA 1JZ5A 5HPOA 5CPTA 2CESA 3N04A 3W26A 1QI5A 4UZSA 3MU7A 1W9DM 1OM0A 2VNCA 3KL3A 3KWXA 2WWCA 4WF7A 1IT0A 1LWJA 1OGSA 1V6WA 1UD4A 2E9BA 3CUFA 4U3CA 2WMIA 3O9NA 3GXMA 5DFAA 3TTSA 4HZ8A 1PX4A 3SCNA 1CENA 3N17A 4Z2HA 2VZUA 2VVSA 3AQUA 2AAAA 2WM0A 3FN9A 1CPUA 1RPKA 3FHAA 4Y7EA 3MUY1 4BQ2A 2EO7A 3VKKA 5EBAA 3OBAA 3CZGA 3WF3A 4W8LA 5ECUA 3IK2A 1LQ0A 5I3DA 2VRQA 1V3KA 1GQIA 3K8MA 3M6DA 1V3HA 4GINA 3B8SA 2WHJA 4X9YA 4Z2LA 2D1ZA 3TTYA 4RL3A 2ZICA 1UD3A 4E4PA 2BHZA 2A3BA 2PBOA 4B3KA 1RD6A 1LWHA 4W86A 4Z2GA 1O7AA 1UKQA 1PZ2A 1UA3A 3BC9A 1HF6A 4HMCA 2Y24A 3WEOA 4MAZA 5A94A 2C8NA 1JYNA 4M24A 5AC5A 1AVAA 2OYMA 3A6OA 5I0DA 3LPOA 3DYPA 1TE1A 2E8YA 2Y5EA 3CO4A 3DYMA 4D72A 1EOMA 1VRXA 2DT0A 3NDYA 4M29A 1KBKA 3WF2A 4A3HA 3CZLA 4DUVA 4U2YA 2X0HA 2YDQA 3TP4A 1E6QM 2DSWA 1E15A 5HOSA 1HJXA 2D3NA 3OZPA 3ARYA 1QI4A 1BF2A 2XWDA 3K1DA 1KWKA 3VIPA 1NQ6A 4URIA 4F66A 1HJWA 3PTKA 1HL8A 3VUPA 2BY0A 2BNJA 3E1F1 5A8PA 1TFVA 1SMDA 3CH9A 2GVYA 5D9PA 2GUYA 1OBAA 4WK9A 2GFTA 2EPLX 2WMGA 1XYFA 4OIFA 3PZIA 4D1JA 5M3WA 3WD1A 2J75A 3OB8A 4GQRA 5BCAA 4BS0A 4HOWA 5JUVA 3NDZA 1O6IA 4HA4A 4PTXA 1MQPA 3WUBA 1OT1A 2CHOA 1EGZA 3F5JA 2VTFA 5TD4A 1J11A 3W6LA 3MSGA 1UQYA 2XGIA 3OGRA 2VCCA 3MSDA 1R85A 1E5NA 1B9ZA 3RIKA 4H8VA 4BZYA 3L4YA 6TAAA 1MXGA 2YIHA 2Y8VA 1OINA 3NUKA 1FFQA 3N15A 3O6AA 5FL1A 3GBDA 5C70A 3AHZA 1NARA 2TAAA 5ABGA 1CXIA 4H8UA 3LPPA 2BXYA 1N82A 3SCVA 3FNDA 2J7CA 1KBBA 2JF7A 5A2CA 4CCCA 4EAMA 4PTMA 1TCMA 5DO8A 3KL0A 3SCOA 1W1TA 5FOOA 3UESA 3W82A 3W4RA 1DWAM 1J0IA 1W3JA 3K46A 4D6IA 1K9TA 1ZBCA 3VNZA 4D6EA 2F8QA 1V03A 4R5EA 4S3JA 3BSGA 5LYRA 3PZ9A 2G8ZA 1KQYA 5A6BD 2DIJA 3W37A 1E55A 3JUGA 4H41A 4AZIA 3WENA 1MW0A 3WUEA 4MDOA 4HU0A 1W9UA 3UETA 2W63A 4LPCA 1X1NA 4PTWA 3U57A 3BCFA 3WD3A 1JAEA 3K8KA 3VIJA 3AMLA 5E6YA 4LXFA 5ABHA 5I78A 5DEZA 4JHOA 3CZJA 5E70A 5GNZA 4ML4A 1KQZA 1QNQA 1JF6A 2AOSA 2C0HA 2WC4A 1W9VA 2PWDA 1XC6A 4MAVA 3GH5A 3SEPA 2E4TA 1CWYA 2X2YA 3RJXA 3RO8A 1ZBWA 3MV01 4AZ6A 5FIPA 4UFJA 3UR8A 4JFTA 1EHNA 2XSAA 2WLZA 4DUXA 3WNNA 1HJVA 2Z1SA 1C8QA 3SCWA 4AD4A 4TXEA 3T0BA 4CN4A 2W91A 4GO8A 3T2OA 1H2JA 2UY2A 1GHRA 4LQ1A 1Q6FA 4P8VA 4ATWA 4ACZB 2WZHA 5I79A 4CGTA 1JI2A 1QW9A 3AISA 1UZ4A 1XD0A 2D20A 1ITCA 5A6KA 4U31A 4J27A 2WVVA 4C7DA 3W28A 3SCQA 1W3KA 4W87A 1RH9A 4MB4A 5A95A 4BF7A 1K6AA 2IUZA 4UFKA 4AIOA 2VCBA 3ARVA 1JD9A 1QW8A 4AMCA 4GZEA 3BMVA 4WKHA 1GJWA 4H04A 3RCNA 1WP6A 4FLQA 1CYGA 1WO2A 4J3UA 2ZX5A 1NWSA 3SURA 3FW6A 1WZAA 2E9MA 5I24A 3MS8A 2GJXA 3AFBA 1VF8A 1E71M 3THCA 3A4AA 5BRQA 1WZLA 1FP9A 1DWHM 4HZ6A 1TUXA 2FH6A 3I3DA 4LX4A 3AROA 1JYVA 4NRSA 2BVTA 2EBNA 1VFOA 3ZJKA 2XVGA 4W85A 2WMFA 2XPKA 1LL7A 4GI9A 3SCSA 2D0GA 5CG0A 1E4IA 2OWCA 4W93A 3PZQA 2YDRA 3WBEA 4MDPA 5BRPA 3WH9A 3VM7A 5E9AA 1C7TA 4H8HA 7TAAA 2WSKA 2WCAA 1MQQA 1RP9A 4J3TA 2XVLA 1XSJA 3QGVA 1QNSA 3RM4A 4KH2A 1P6WA 4PMNA 2G41A 1QI0A 2XVPA 3QOMA 2WAGA 1AQHA 1EDTA 3ZOAA 1QPKA 4AZCB 1E6PA 4RE3A 2YLAA 1MWOA 3AI0A 4IISA 2IXVA 2C7FA 3UEQA 1MXDA 1GCYA 4AWEA 3VDHA 1W9PA 3ALGA 1GOMA 4AXNA 3SCRA 2GK1A 1CGXA 4KRUA 2JIEA 1UR8A 1B3VA 4AZ5A 4PCSA 3MUIA 3L4TA 1E3ZA 3FAWA 2XG9A 3QHMA 4NSBA 3ZJ8A 2UWFA 4FK9A 1V0MA 4Z2JA 1CGUA 1ISWA 1C91A 1PZ3A 3UCQA 3LMYA 2VJXA 4OOUA 1OT2A 4IPLA 2VT0A 4PUEA 4JIEA 3VDBA 2VMFA 4Q7NA 2X09A 3TTQA 1GONA 1OIFA 2D22A 3SUTA 5AY7A 3WY1A 2WLYA 1OCQA 4RE4A 4W7VA 4DWSA 3AMGA 1XYZA 3DHUA 1C7SA 2B31A 4M82A 4WKFA 2BY3A 5BWFA 4WSJA 3WL1A 3IAPA 4P8UA 2VX5A 3A4WA 1QHPA 2G3NA 4JCMA 4BCEA 5CZKA 5CXPA 4AD2A 1AQMA 4ZFMA 3CHFA 1H3GA 1ISYA 2J8FA 2BS9A 2WMJA 1E0XA 1Z32X 1XSKA 1WDSA 1V08A 3L4XA 2WMIB 4E8DA 4UFHA 2AMGA 1HL9A 2WNWA 3WDHA 3AMDA 1JIBA 5FCZA 2QMKA 1HIZA 5A8QA 2J4GA 2OLHA 1BFNA 3AIRA 4HU8A 8A3HA 4ZE4A 1SMAA 1BG4A 4AD5A 1ZJBA 1J10A 3MO4A 1G01A 5CLWA 5CPSA 1CIUA 4F8XA 1KXTA 3VPLA 1BYCA 3CZ8A 1B0IA 2YA0A 3VM5A 2J62A 3G6LA 1KCKA 1WPCA 4AZHA 3EMCA 3ARUA 2O92A 1UD5A 2CYGA 1JDCA 1PAMA 3WQWA 3AS0A 1CGWA 3N1AA 2X05A 4E2OA 4TTGA 1B30A 1K9FA 1CXKA 1UWRA 1CBGA 2ZWZA 1D3CA 1ZJAA 1KR0A 2GDVA 3WF4A 2V3EA 1RP8A 5KEZA 3AYRA 1FH8A 3L2LA 2O9PA 2W61A 3BMWA 4UQBA 5BXRA 2ZUWA 4D6DA 1VJSA 1OWQA 4TUFA 4Z2IA 5AYIA 5D4YA 1GVIA 1BTCA 4OBRA 1M01A 1C93A 1FH7A 5JIWA 1ECEA 1JFXA 2WB5A 4XB3A 4HA3A 1GHSA 1YQ2A 2A3EA 4LGXA 1QHOA 1HXJA 1R87A 3EDFA 1W1YA 3MMWA 4KGLA 3S2CA 1J0KA 1E3XA 3BH4A 4XZBA 1PPIA 4UQAA 3NJ3A 3FAXA 5BROA 1GOIA 2V5DA 2CHNA 1XV8A 3WBAA 1E4MM 3WFZA 1J0ZA 1B2YA 2XSBA 2DT3A 4JFUA 5AYBA 4V27A 3VDCA 4EKJA 3T08A 1VBRA 2FHCA 5A2AA 1KWGA 3BAJA 3GXDA 4J3SA 2QF8A 1LG1A 3CUGA 2YBTA 2XVNA 2BY2A 3QHNA 1MFVA 5GPRA 3WNMA 1UD6A 1ISZA 2BFGA 4RE2A 1CNVA 4D6FA 4JZ5A 1MW3A 2GDUA 1X6LA 3ZSTA 4J3WA 4QP0A 4CN6A 4MNMA 3W6MA 3ARQA 1VEMA 3ZIZA 1DP0A 4GQQA 4AZ7A 1GW1A 2DSKA 4UFIA 4EE9A 3W53A 1XD1A 1Q6CA 2WXDM 1UR1A 4F79A 4XZWA 1R86A 1J0JA 3FHQA 3CZEA 2GJPA 2XVKA 1B3WA 1JFHA 4UQEA 1UA7A 4WSKA 3VGFA 5BXPA 5BXTA 2E9LA 5HBFA 1FH9A 4HTYA 3ZR6A 1NWRA 2ZX8A 2NT1A 2CBVA 3WH6A 1OD0A 2A3AA 3PTQA 6A3HA 4IUGA 4CD7A 1SR0A 5E6ZA 1TVPA 1WE5A 3CHCA 3QR3A 1GZJA 5EB8A 1W1PA 1QOXA 1NH6A 3VGGA 3PZOA 1HVXA 3SCUA 3J7HA 2XHYA 1VEPA 3GZAA 1HNYA 4QFUA 3VILA 5KZ6A 4JFVA 2W92A 2DEPA 1PIFA 2G3JA 4YPJA 4TVDA 2J77A 4D6CA 4XX6A 5CSYA 3L4UA 2MANA 3PZNA 1TA3A 1WZMA 5FL0A 1BVNP 4MB1A 1XH0A 3WN6A 5D8WA 3WEMA 3WKZA 2EPKX 1IZJA 4CD5A 4LYQA 4OBSA 2J7HA 3VVGA 1H11A 1C3FA 2J74A 1WKYA 4P7OA 5E0FA 1PBGA 2J78A 1MW2A 1H4PA 5IFTA 1E1FA 4ZE5A 4CKQA 3RM9A 4D6JA 2F2HA 4CN1A 3TOPA 1V3MA 3VIHA 4W84A 1UWUA 5CJ5A 3AXXA 4AIUA 1MFUA 2OSXA 3NSNA 1KR1A 4CU6A 5EMYA 3ZM8A 1W1VA 4ATDA 1MVYA 3ZO9A 2VX7A 5I77A 3AS2A 1JZ8A 3OA5A 4JL1A 5I6SA 3W24A 1BSIA 1E40A 4U3AA 1UKPA 4QAWA 5A69A 3WUGA 1MQRA 5DT7A 4CD8A 1VAHA 2OSYA 2DT2A 4B9ZA 1HN1A 3PZUA 4IM4A 4S3KA 1UYQA 3CUHA 5M03A 4B15A 2PB1A 5A6BA 3UG3A 4MTVA 2DDXA 2O9RA 3VX0A 2FH8A 1Q6GA 4ZEPA 1L0PA
chains in the Genus database with same CATH superfamily
2PPGA 3PUDA 1R46A 1XCWA 2ACQA 1XH1A 3T4CA 3FSTA 1AL7A 3NXFA 3M4HA 3H24A 2X1IA 3ZS4A 3S9IA 2WVUA 3SIMA 4IGMA 2XINA 5D9MA 3U6WA 4ZENA 2CPUA 1ZP4A 4KWVA 3CC1A 1T8XA 3IJ8A 4OUEA 3VUSA 1SJDA 3NAVA 4M51A 3U4AA 3CTTA 3GXNA 3DI0A 1I2PA 1RCOB 3NQMA 2BB0A 3HQNA 2FKPA 1GNXA 1HP4A 4WDUA 3C8FA 4GH1A 3QSRA 4GFIA 1YRRA 2ISVA 2GJXB 3FVMA 3BJSA 3BQ6A 3E02A 4QTGA 3AMKA 2ZZ7A 3GNRA 1PSCA 4JD4A 3AIUA 3ARPA 1RK5A 4FMVA 3V35A 3GFXA 4KRTA 4C6JA 3OA3A 2J79A 2F9RA 1UR2A 2WZTA 4KQNA 2BSLA 3PZGA 1N2VA 1GVEA 3QV7A 3T0DA 4CQCA 3IK4A 2FPVA 5HQEA 4E8CA 1BYAA 2FFIA 1CXEA 4KRZA 1GTHA 4O17A 3VNLA 1KGXA 4UMCA 2DZBA 1XW8A 1OB0A 1S2WA 2R1KA 3P5YA 2DZUA 2EG7A 3BLPX 5DIUA 1C8VA 2WO5A 1KRAC 1E6SM 4AH7A 1QPOA 3UT0A 4F0LA 2DU2A 4IIGA 1W3LA 2Z7KA 2UY3A 4UNKA 4EF9A 1EX1A 4GZIA 3S83A 4DLMA 2ZXDA 2O9OA 1SW7A 2QCGA 2FZBA 4YXGA 4O57A 4UTLA 5CSSA 5I07A 1JZ4A 3OVQA 4JFSA 1HW6A 3AXHA 3EOEA 4IGNA 3PM6A 2FZNA 4WGHA 2F23A 1UD8A 2EPNA 5D8ZA 1UUMA 2WZIA 1CXHA 3R0DA 4R88A 1EXBA 1HGYA 1UKTA 2DZAA 4DWDA 3EWWA 4P61A 4PGLA 5DF0A 2YCLB 6REQA 3WD2A 2A6NA 1QK0A 4PB4A 3VDAA 3CMFA 2Y8UA 1E9LA 1QPNA 3NPXA 3QFEA 3U5UA 1UB3A 3UQNA 5JH8A 1EH9A 3A22A 3TWAA 1AK5A 3KDNA 3HN3A 1FFRA 3TYCA 3LERA 1GVYA 3CZKA 3F4DA 4LNCA 4BR1A 2F38A 4DHGA 3STPA 4BQ3A 4ERIA 2WMKA 1MYRA 2QQ6A 3QC0A 4FF7A 5IHRA 4RZ4A 2FHFA 3DX5A 4IXXA 2PE4A 4Z0JA 4YTRA 4IT1A 1S3TC 4LAKA 1QOQA 3KAGA 2IPFA 3VKDA 3MI3A 2J7FA 3HMCA 1W2VA 1KBIA 4O0KA 1CW2A 2OO6A 4K37A 4Q33A 1OK6A 2MNRA 4H8NA 2BHYA 4MNKA 3GU0A 5I3HA 3UR5A 3VNYA 1SFJA 2J25A 1VS1A 2TRSA 2OSWA 3VD5A 1ODZA 1Q13A 4FX8A 5AHMA 3W2UA 4AD1A 4DX3A 1V79A 2DSUA 3TZNA 4NNRA 3KVJA 1TPH1 3EA1A 3E0IA 4JOMA 4U5KA 1CGVA 1V6UA 4YVVA 4DZ2A 4MM1A 2GQ8A 4XVEA 1X38A 3MMTA 1OFOA 4AISA 5F2IA 3CB8A 4JTCA 1EL3A 3IJIA 3LQLA 1JZ2A 3FXYA 1AMYA 2V3DA 4ROQA 1KXQA 3BUVA 1T0OA 3R4IA 2JGQA 4FNQA 4HNNA 1ZJHA 5HWNA 2O9TA 1ROTA 1QI3A 3AXMA 5L9FA 1YTEA 2E6DA 4Q8OA 1XLDA 2C16A 2QCDB 3GBEA 4FB7A 1P5BA 4PA8A 1H61A 1SZRA 3W73A 5D05A 3GUGA 1JNDA 3MJMA 5EBUA 3ECQA 4U10A 1XIEA 1VIWA 3SR7A 3CU2A 1XIFA 4GY1A 4ZA0A 1W54A 4PSRA 1F3WA 9RUBA 4PBEA 5T9BG 4MADA 2G97A 3KBNA 3W23A 1VFHA 5GJPA 4W5ZA 1DXIA 3AUOA 1B31A 2I14A 2RDWA 1ROUA 4KWUA 4Z08A 1IEWA 3VD7A 1LLZA 4HA1A 4P7NA 1V02E 4X0NA 3U9IA 4GXPA 2FZ9A 1SZEA 4PTVA 5LNVA 2HEJA 3W1PA 4W8AA 2NV9A 4AG0A 1RJQA 5GNXA 3KADA 1A5BA 1EDGA 4O1AA 3OQEA 2BOGX 1TE6A 1OADA 1NDWA 3KCEA 4QT2A 5CBIA 4BQ5A 1JGIA 4GIYA 1RJRA 1O60A 1IXPA 5GQBA 3MYOA 1JUEA 1Q65A 4PBGA 3ANVA 2ZXQA 1EEXA 2GQ3A 5LA1A 1Z7AA 3DG6A 1KD0A 3H22A 2EULA 3M9YA 3UERA 3O5GA 4UC5A 1Q7MA 4AFYA 1ZBKA 3FYOA 2YKKA 3WH5A 4CNTA 3LD5A 2WMHA 2DPEA 3GNDA 1E56A 3ZR5A 1UUQA 2V69A 1F07A 4GXWA 2CCRA 3TJIA 2GWNA 3M46A 3R94A 3IVUA 3PSWA 5FF4A 3TWBA 2J7EA 2OJPA 5ABEA 3QC3A 5F1VA 2V8ZA 3AYVA 4F40A 4YL2A 3G0UA 3MC5A 4PMJA 1ZAIA 3GW0A 2BP1A 1AG1O 3TQ0A 1WOAA 1QR7A 2QGHA 3SCTA 1DL3A 3VK5A 3I7RA 3ZLFA 3LX9A 1J8VA 5I02A 3PBGA 3L23A 3LTPA 5E09A 5A8NA 2Z6JA 1D8CA 1PCWA 2KO7A 5C9XA 3U2CA 5DO2A 3QN3A 1UH2A 2PP3A 3UJSA 3VZYA 1BYDA 3C2OA 2NX1A 1EJXC 1S46A 2W62A 1GG1A 2P8BA 3N18A 3TC3A 1TPB1 1NU5A 4LWWA 3WMLA 1F76A 3C56A 3LPGA 1EIXA 2C18A 2CXGA 3K1GA 1GEHA 4NF7A 2IXUA 3W7KA 2NQ9A 2OQLA 3W38A 3OLEA 1PWLA 1CLKA 3NQFA 3NEHA 2RJGA 2WHKA 3R8GA 1A5SA 1J0YA 2ZZ6A 3C0QA 3PBYA 1US2A 5MHBA 1F73A 4ZFCA 3WNOA 3AXIA 3VCRA 3LCGA 2YYTA 3H6OA 1E4NA 5A8OA 4B4HA 3QZ6A 3MUZ1 1M3UA 3BSHA 4Q32A 2PWEA 5E5CA 3KOWA 1D7IA 5JIPA 1GYNA 1FWJC 3ZQ9A 3W83A 1VKFA 1WCGA 2Z1KA 1Z44A 3EA3A 1NOUA 3GK0A 1CLVA 1DEDA 5GJMA 4AW7A 3LI1A 1JZ3A 4C7FA 3WMSA 4DUOA 1AD4A 3OZMA 1IV8A 4RDWA 4RX0A 1CGTA 4E4UA 3E3HA 4Y90A 3PWAA 3O16A 3TONA 1JZ7A 3V0TA 4H9YA 1QNPA 4H9ZA 4FR1A 2E6YA 2ZRWA 1EFZA 3VIKA 1I9CB 3RILA 3VD9A 2PU0A 4MWAA 2Z25A 3L12A 1KCLA 3I6RA 3QTPA 3S6TA 2PDUA 2UY5A 3PWGA 5I03A 1DBTA 4FLOA 3N12A 2R8WA 3WNPA 3GSMA 1VBUA 1UKOA 3BG5A 1TPWA 4ZS6A 4GJ1A 2ZZ1A 1XUZA 1FVPA 1FWFC 3LCIA 1XCFA 3ALFA 5HJYA 4QQUA 1YXDA 1BYBA 1EC7A 2PDIA 2GGJA 1J4RA 2PRHA 3H9RB 5J6EA 1W9XA 4TMBA 1HGWA 3KDOA 5C2XA 1OYBA 2IQ0A 3V1PA 2ZXBA 1YTDA 3BOLA 1I75A 4G50A 1UR0A 3GXFA 1WDPA 3VDGA 2ZWYA 2VQUA 1GORA 4Z1DA 1YHTA 1AW5A 1YX1A 4AZGA 3B06A 4NNCA 3VC6A 4G2DA 3QLLA 3N34A 1DJWA 3GYCA 3MUAA 2DT1A 4CVUA 1C90A 1P6CA 5HUOA 2VZVA 2D0FA 1CXFA 4I90A 3H2AA 4NHVA 5HMDA 3T2QA 1FWDC 2PRMA 3L68A 2BXZA 1WUFA 3M07A 4DAIA 4JFJA 3II1A 4Z17A 2IQDA 4MLRA 3CPUA 4UTHA 3ORWA 4RPQA 2PDHA 3O3RA 3GTXA 4R85A 1E44A 4ROPA 5CSRA 3W0KA 5IFPA 4OKDA 2M08A 3C0SA 3D46A 3NCOA 1PX8A 1ZUAX 4G1NA 3VMOA 1ISVA 1B3YA 4DIPA 2HROA 2A21A 4M1RA 3WQ6A 4NJIA 2R1LA 3AO0A 4E4FA 4A3YA 2C91A 1QVBA 3MKKA 3O5MA 1F05A 5HMFA 2YOCA 3WNLA 1J18A 4XISA 5K2ZA 4OFCA 1SSGA 2Z1VA 4J3VA 3L5AA 5CPMA 3MCNA 3MTWA 5TBOA 2FTWA 4MYXA 1DORA 4Q8MA 3QQ1A 4HNUA 2HVOA 3VGDA 1U2YA 3DZ1A 1HO4A 3P8IA 4O50A 2A3HA 1ISXA 1TWWA 2RSEA 2Y7FA 2ACSA 2X0YA 3DDMA 4O15A 1SYTA 3W2LA 4AUBA 4DRNA 4Z0SA 5HPCA 8RUCA 3QZAA 3LSCA 3VU2A 3SECA 1KFEA 4YJ5A 2Z26A 1RQEA 5J5RA 1Q6HA 3M41A 2EXOA 4DYJA 2F84A 4AB4A 1IWAA 2CU0A 4XO7A 2VEPA 3U7BA 2D2OA 1DYSA 1OCNA 3B04A 4NJHA 1EYWA 1V51A 1JCLA 1KBLA 3SB0A 1GQNA 3T09A 1UJQA 3G8EA 1PZ1A 4ERAA 3EXTA 3K4AA 3UR2A 1P6BA 3BLDA 2WC3A 4HNOA 1CEOA 5T9CE 1XIGA 2NZLA 1DIEA 4US6A 4TX8A 3RR1A 1IZCA 2VC7A 4A8LA 1XDMA 2W5FA 4IFRA 1FA2A 1UG6A 4HCDA 3P62A 4XD6A 2H9AB 4HCHA 3EX1A 5AKQA 4IH3A 5DRIA 3VD4A 1K8YA 3A3HA 1FKLA 4W5UA 2OEMA 3B0YA 2OYKA 4MJZA 1LP6A 2CLFA 3IGXA 1UZHA 3PN8A 1US3A 2IKHA 3GVRA 3RF9A 3DECA 3D6NA 3MT1A 1REQB 3TJ4A 1BVZA 2L2SA 2D9FA 2ISWA 1TTJA 1G94A 1TR1A 1R7AA 4JXCA 3G1AA 2C1HA 5CZ0A 4DWSD 2PPOA 4HMEA 2QUNA 4LOCA 8XIAA 1A5UA 2Z1XA 2DUXA 2J9XA 1JCXA 4J9JA 3H2FA 3BAKA 2GGIA 3AZSA 3TN4A 3OHMB 3N25A 1ECQA 1OGBA 4MIMA 2H8ZA 3TNBA 3UQBA 1TV8A 4ODRA 2QCNA 3H26A 4FOKA 5AFDA 5JBDA 4OV9A 1NEYA 2V68A 1TG7A 2WQPA 3WL0A 3BCDA 3VD3A 2KI3A 1A5MC 3GKFA 4W89A 3GR7A 1N8WA 2Z2UA 2DSVA 3GAKA 1OHLA 2TMDA 5A6LA 1FP8A 4XWUA 2PDQA 4V1YA 1GQLA 1EB3A 1XQKA 1B4KA 3BJFA 3H2NA 3L0KA 1K9DA 4CNNA 1AMKA 1JPDX 4IMCA 3KABA 4DJEC 3W88A 3BCJA 3SGZA 1OK4A 4MPQA 2X42A 2QCEA 3S5YA 4PMDA 1N55A 1T40A 2FDMA 3NQVA 3U8GA 3G2GA 4OJYA 4DPPA 5HK4A 1DQUA 4KWOA 4R3UA 4B5SA 4M6VA 1HJSA 2C79A 1W9BM 1GKRA 3AUJA 3I65A 1I2OA 3BARA 3N4EA 4AY8A 4UZSA 5BOEA 2PURA 3MU7A 1RY8A 1ZP3A 4WDWA 2W0UA 1W5QA 1XS2A 2WWCA 4L7ZA 4WF7A 1LWJA 4JFMA 1V6WA 1DIOA 1XLJA 2J6XA 3CUFA 4U3CA 2WMIA 5CC6A 1WBJA 3TMQA 1P0NA 3WLJA 5FJPA 3WJXA 2QUVA 3CQIA 3IACA 3PK7A 3V18A 5JQ9A 2B7QA 1GK8A 4CQ9A 2UZ9A 5MF5A 3QXBA 4Y7EA 3FHAA 4O0ZA 4BQ2A 4KWSA 3VKKA 1M9HA 1K1DA 3EOOA 5FJTA 2DZSA 2OU4A 1AH4A 3NFUA 1LQ0A 2VRQA 1GQIA 2PDMA 3K8MA 2Y70A 4D8LA 2AWGA 4GIRA 3M0ZA 2WJDA 2BHZA 2PBOA 3I10A 1TWSA 1RD6A 1O7AA 4WGXA 1HF6A 1Z9AA 4F0RA 2Y7EA 3WEOA 4MAZA 5A94A 2C8NA 1JYNA 4HSOA 1YLVA 5I0DA 3LPOA 2AKMA 3NPUA 3DYPA 4AHQA 2Y5EA 1YBQB 3DENA 1EOMA 1VRXA 2CHRA 4KR0B 3NDYA 3NXLA 3WF2A 2XP6A 4RDYA 3BVJA 5HOSA 2D3NA 1QI4A 2OPJA 1NQ6A 4URIA 3O5EA 3STFA 4F66A 3LTYA 1HL8A 4PUMA 2B7OA 5C2GA 4KESA 4LVAA 5A8PA 1EJTC 3GWQA 3NOEA 5FAGA 2GUYA 2BOEX 1RALA 2WMGA 1XYFA 1R30A 4D1JA 1GVFA 4HJWA 2V5BA 1OC6A 4F0MA 2X0SA 5BCAA 1FKHA 4BS0A 2FZMA 3GHUA 4PTXA 3UZZA 1OT1A 2CHOA 1EGZA 3F5JA 1J11A 1UQYA 4L4LA 3OGRA 3IRDA 1IXQA 4MVAA 1B9ZA 2NXGA 1VH7A 1SZNA 4BZYA 2EHHA 4QISA 4XK2A 2RJHA 1OINA 2E09A 1LCOA 3NUKA 5FL1A 1W3TA 4FEZA 1RPXA 3FK4A 4RUBA 3NO3A 2WNQA 1KBBA 1Q85A 2REQB 1SPQA 4PTMA 3F2BA 1R2TA 3MBFA 3SCOA 1FBAA 3UESA 4E8GA 4QDPA 1DWAM 1J0IA 1DJXA 3GC4A 1GVOA 1W3JA 3THQA 3QM3A 4JDYA 4R5EA 1KQYA 1O1ZA 2PBCA 4IT6A 1Z48A 1PTAA 4H41A 3DESA 4HU0A 4S3AA 4JPGA 2AGKA 3B3DA 3G0SA 1B3OA 3S3GA 2X40A 4LPCA 3CV7A 1QW7A 3U57A 4N9EA 5FF3A 4RCXA 3K8KA 3GDKA 2POZA 3VIJA 1GW9A 3PR9A 2WV8A 4PUKA 3WX7A 4E3VA 4LXFA 3NZQA 4DB7A 2PGWA 3QZEA 4JHOA 3CZJA 2XH0A 1KQZA 1QNQA 2XH4A 2AOSA 2HK0A 3NQ7A 4L1XA 1DTNA 4HK5A 2OQHA 5H91A 1KTNA 1HKWA 2X2YA 2J88A 3FJ4A 3MV01 2VR2A 4RKAA 1FKFA 4AZ6A 5FIPA 4UFJA 4JFTA 2QAPA 3A9BA 2WLZA 4C65A 4U85A 5C9RA 2YZ5A 1HJVA 1C8QA 4Z1CA 3M0VA 2CLKA 4UUIA 1IQ8A 2BOFX 3PVFA 4DJDC 2W91A 5LXEA 1BXBA 3I6EA 1DJZA 2FGBA 1DJQA 2ODOA 1Q6FA 4JS3A 3NWRA 4LAOA 3ZLHA 3W1MA 4P8VA 4ATWA 4EWND 3WJSA 4ACZB 3CL6A 2XP8A 3KACA 2OZTA 2F2DA 1QW9A 4ADUA 3TYEA 5MKGA 1IXOA 4IP4A 3OO2A 1XD0A 2D20A 1LUCB 4Q4PA 3TCSA 3UGRA 4BF7A 2VXNA 5CPLA 2QUMA 1UR3M 2H90A 1KTBA 3ARVA 3KBVA 4QG6A 2AQWA 2Q01A 4DRSA 4GZEA 3A9IA 4FIQA 3N3MA 4O1BA 3RCNA 1WP6A 4G1KA 4GY0A 1IGWA 1SUXA 4PCPA 4QX4A 3R58A 3G0XA 2Z4GA 4MGGA 2E9MA 1VF8A 4JTLA 6XIMA 3THCA 4PE8A 3A4AA 1TTQA 3KOXA 5BRQA 2ZYFA 3Q2DA 3N9SA 4HZ6A 3E2SA 3M7WA 4NRSA 2BVTA 5H8UA 1CX9A 1EQ3A 4XAPA 2IKGA 2YXOA 1QOPA 4GI9A 4M1BA 3OODA 5A8GA 4DYEA 4GI4A 4W93A 3NQGA 3T4WA 3E38A 2YDRA 4LF2A 1R9YA 4B90A 3VAWA 3KLLA 3GTFA 3WH9A 3CO8A 2VEKA 7TAAA 2YCEA 1MQQA 5EYWA 4J3TA 2XVLA 2YCJA 3CV6A 1XSJA 1KRBC 1VHCA 2H8XA 3W7QA 1QNSA 4OBTA 1QI0A 2XVPA 3QOMA 2WAGA 4KBXA 1FDZA 4AZCB 3B0PA 2YLAA 4GJIA 3DAQA 1MWOA 4IISA 4JY9A 3OQ8A 2C7FA 1EP2A 2V9DA 3UEQA 4AWEA 4AXNA 4EPBC 1S5WA 1XIIA 2CZEA 1OJXA 2JIEA 2JK2A 2WSQA 1P1XA 4E6MA 4I9AA 4PCSA 2VP8A 1RA0A 3UYCA 2F7FA 4NSBA 4JIIX 1XYCA 2I5IA 3M0XA 3SO7A 3LI0A 3DFOA 1QWGA 4H19A 3EWUA 1DJIA 1EJUC 4J5NA 5FF0A 3LMYA 3Q58A 3WLOA 7XIMA 5JH1A 3VKBA 1UZDA 3WLQA 5XINA 4V15A 3O5QA 4B92A 4JIEA 3W1NA 2VMFA 1LRTA 1UPMB 3KVLA 5DMLA 3W2NA 1OIFA 1DJGA 5AY7A 4RE4A 4G56A 1CI1A 3R89A 4HPXA 4O8AA 2XP7A 4BHYA 5BWFA 3KX6A 3MWAA 3S2JA 3IAPA 3WQPA 2R82A 4FN2A 2INZA 5CZKA 2OLSA 1AQMA 2PDJA 3RRAA 2Q02A 2ATSA 2IQTA 5EA9A 3LK6A 1WDSA 4MKVA 3M0JA 3L4XA 3ANUA 3CXOA 3WDHA 3AMDA 5HWJA 2QMKA 1HIZA 3TJXA 5A8QA 1OF6A 1VLWA 1Y0OA 2J4GA 3B9OA 3UYIA 3AIRA 3OBEA 3VE9A 3S5ZA 1UUOA 4GVHA 4KPLA 1CIUA 4HD5A 2NVAA 3CZ8A 2YA0A 1IE7C 2R24A 1UPPA 3VOHA 1QASA 1KCKA 1WPCA 4XSLA 4X60A 1AUSL 3EMCA 2O92A 1UD5A 4QS6A 4KEZA 3L66A 1NDZA 2P88A 3SGGA 1XG3A 2X05A 3H4WA 3ABQA 5LSMA 1K9FA 3CLMA 3HQOA 3NO1A 2P3EA 1XYAA 4Y8FA 2F21A 1T96A 1FKXA 1ZJAA 5KEZA 3LZ5A 1HQTA 1FH8A 1EEPA 2P1FA 4GH3A 4IG2B 1A0EA 5BXRA 2BMBA 1VJSA 4TUFA 3LCXA 5AYIA 5D4YA 5CG7A 5XIMA 3OHIA 2PTDA 1OQFA 1C93A 1YNYA 3EZ4A 1SM9A 4XUGA 4MOZA 4N6EA 5LIKX 2BXVA 4LY4A 4XB3A 3WJWA 2YXXA 3R5EA 3N6QA 1GHSA 2VWSA 1QHOA 1HXJA 4JTEA 4KGLA 1J0KA 4L61A 2E5DA 3ZVIA 2OFJA 3P60A 4AEOA 3A3XA 2P0OA 1GWJA 1TX2A 1E4MM 1K7XA 4GQGA 3WFZA 1J0ZA 4C91A 1B2YA 2DT3A 3WJYA 1PO9A 3IIXA 2LPVA 1VQTA 3N19B 4WQ6A 1KWGA 3FAPA 4ZQRA 3PAOA 1SSDA 1LG1A 1Q6OA 2NV2A 2K8IA 2YBTA 4XIMA 1CB2A 1J5SA 1ISZA 3RX4A 2C15A 4D6FA 1MW3A 1ICPA 4CN6A 5HQLA 3UZ5A 1VEMA 3MUCA 4WY0B 3LLXA 3FDKA 4GQQA 4UFIA 2P3ZA 2PU1A 3W53A 2AL2A 2FB3A 4DYKA 1FRBA 4A2SA 2IW0A 3IIPA 4Y2WA 4S3BA 2J66A 2V6AA 3CZEA 3M6YA 2B0MA 3IKDA 1JNSA 2XVKA 1JFHA 2J9YA 2Y5SA 4UQEA 1UA7A 1I2NA 2VKZG 4XD5A 1D7JA 2NT1A 2CBVA 6A3HA 4O12A 4CD7A 1SR0A 3DBPA 1R2SA 4H6KA 4JTJA 4L56A 2BGQA 3ABSA 2I7GA 3O5DA 4NX0A 4X2RA 4QJ4B 1J2BA 3PRAA 1F5ZA 2E5BA 1NH6A 2NSOA 1TTIA 3W00A 4O16A 3BJTA 2Y7DA 1P5QA 4IX0A 4ES4A 3VILA 5KZ6A 3LV6A 2DEPA 4XX6A 2QF7A 1OCBA 4I7UA 1WZMA 5FL0A 3VNKA 2XIOA 4E5TA 3MDUA 3NRKA 3KVMA 3TK7A 4AF0A 2KZHA 1XISA 1O1HA 2EPKX 4KEVA 2CZ5A 3I4KA 3T40A 4TO8A 3QGKC 3S2MA 1LM1A 3NOYA 3GZ3A 2DW7A 2WQDA 4DJEA 1R2RA 1ZHAA 2F2HA 1VIZA 2VEGA 4JNYA 1V3MA 5CJNA 4E2DA 1XBXA 3AXXA 3WLHA 3OTRA 4CU6A 1SO6A 2E68A 3G1XA 3OA5A 1E40A 5A69A 1H63A 3ERPA 5CZTA 5F4WA 5BMXA 1YATA 2DZPA 3PZUA 4IM4A 2E25A 3NQCA 3S2NA 4G7EA 3KP1A 4XVDA 2DDXA 2NX9A 4ZEPA 4ILSA 5DBUA 5D09A 2XM2A 4HYWA 1XGZA 4MWAD 1O68A 3UY7A 1BLIA 1CTNA 2WVVB 3IGSA 4UMBA 4ADSA 2V82A 4I5XA 1O12A 3OU8A 1KLYA 2EPMX 4DI9A 3Q4DA 3OVRA 3PSVA 3N3TA 6ENLA 1KFKA 2E8ZA 2PC8A 3K4DA 3R79A 5AECA 4JKKA 3HPAA 4O54A 3FV9A 3PBVA 5C8BB 1PUDA 3IGUA 4G9PA 4D71A 3ARSA 3C0JA 4UFLA 5HNRA 1LOSA 5FESA 1OFRA 1QNVA 2XFYA 4A22A 3NL5A 1MEWA 4J2PA 5LIUX 4P7LA 1IGSA 1OABA 5HTGA 4FP1A 2CKSA 2JEQA 5CC5A 2GGHA 1PHQA 1TJ2A 2PD5A 4HNCA 3REQA 2WSPA 4LEQA 1VEOA 3H53A 1HXVA 3VX1A 1BQGA 4YYCA 3CQJA 2ZZ4A 4GIAA 3RLGA 1XYBA 1EQPA 4UTIA 2ZVRA 1EZ2A 3HQ1A 4H2CA 3W75A 3PA7A 3QYQA 4XAZA 4JCLA 1A3WA 1H7RA 4O52A 5JBEA 1B9BA 4BQ4A 1I45A 4TTUA 1KB3A 6TIMA 3MB9A 4DJFC 5HDRA 2R94A 3M64A 1U5HA 3USZA 4MY1A 4JKLA 1M03A 1XIJA 1OGGA 3EOUA 2GLKA 5TF0A 3GNPA 1FKSA 3WQ5A 1F3XA 4NNBA 5CJMA 4E0CA 2OEJA 3UPMA 1GRJA 3O7UA 2GVLA 1GQKA 1WDRA 3T2PA 3IRSA 2WANA 3T0AA 4LUJA 2GK1B 2OGYA 2GSEA 3KRZA 5B8IC 4LRSA 4PMOA 2GVJA 1H5VA 5A3HA 3PUGA 1HTIA 4S2BA 1JDDA 2CW6A 5LHEA 2QJIA 1QBAA 4R7JA 1A4LA 2PWVA 3KRBA 3RMEA 4AHOA 4IIFA 1ODUA 1UH3A 1JNEA 3KL5A 2O56A 3TMLA 1LTDA 1GZ1A 3WH7A 2Y4SA 1SFSA 4DN1A 3WZ0E 3P8JA 2OTDA 1FWTA 3QH2A 3E0LA 3GNXA 3GE7A 2C14A 4L4MA 4IHCA 1G0CA 3ZMRA 4NAEB 3CMGA 4L5ZA 4IIDA 1AODA 3KXQA 3GR4A 1PS9A 4NU7A 3GTNA 4V2XA 2H6RA 3Q65A 4C60A 2CIPA 3GYEA 3EYPA 5DMNA 3KOFA 3QV6A 4JIHA 1H51A 3FKKA 2ZZ5A 1KM5A 4OZOA 3NURA 1XQLA 3HPZA 4JTRA 3UJRA 3MMDA 2PGEA 3N2OA 2IMRA 2RH9A 3VO0A 5G5IA 2P8CA 3WMCA 3TUUA 4N2YA 1KT0A 3GVQA 2YL8A 1V5XA 1VB9A 1T7LA 2QV4A 1ZBVA 4GI6A 3DHPA 2RURA 4HZ7A 1Q1CA 4LYRA 3VOIA 3QFWA 3TFCA 3M43A 1JRBA 1E43A 4DJDA 1EZWA 2CKRA 5M5DA 3HO8A 2X1SA 3W76A 1K9EA 1D6OA 1FKWA 3SUWA 5G1YA 3GG0A 2WKGA 2Y61A 2WVSA 1BKFA 4C6BA 2PRLA 3NL6A 4O1DA 1QXLA 2FPYA 4EXBA 4EX4A 1M1BA 3IIVA 1EBHA 2XFRA 4R7WA 2E7FA 4CCDA 1ZU8A 2FVKA 3KZSA 5HMEA 4W7WA 2ZIDA 3RO6A 3AIQA 4JHZA 4KWWA 1FWWA 1KFCA 4HOXA 3TV8A 5C2CA 1JVNA 4YVPA 1RQBA 2ZQVA 1VP5A 4J4NA 1ME7A 2VFDA 1VFMA 1E0WA 3W27A 3EAUA 3PNZA 4UBPC 4KT2A 5CPQA 1L8NA 3ABRA 4FF5A 2NXHA 2VZOA 1V6XA 3SQMA 1G7UA 1XKJA 3W3OA 2EJ1A 3OYZA 4I5UA 1C92A 1F3EA 3V16A 4LF1A 3G8RA 1P0KA 4R27A 4CUCA 3LY0A 2X41A 4O11A 3CBWA 1QJWA 4RNJA 3RPDA 3EDEA 5CCZA 1UMYA 3AHVA 1LQ2A 4JKMA 4YTTA 2DH3A 1XWYA 4LAUA 5BOOA 4QQ3A 3FX4A 1E9IA 3NO5A 3LQGA 4NXKA 3UXAA 3RCMA 2XP9A 2ZUMA 4ZB0A 4TVCA 1V3LA 5H6HA 3VFCA 3NPVA 1R5YA 3IUIA 3S47A 3CQHA 2QCCA 4DXVA 2GSHA 1H7XA 1XICA 1YMYA 2PD9A 1NOWA 4I7WA 2GSJA 2VD8A 1CB7B 1WXYA 2BBFA 1JG9A 3M0YA 2RGMA 1R3WA 4GYPC 4R34A 1I1XA 1RZMA 3LS9A 5AHFA 5D75A 4FZIA 1Q4WA 4M7SA 3OG2A 3GXPA 4ICCX 3M47A 1FWNA 3HTWA 3N11A 3TXVA 3AHXA 3VIFA 2QCFA 4PSPA 2WCGA 5FSDC 1NDYA 2PV2A 1TA3B 1YPIA 3EPMA 4QROA 1VJZA 1E6ZA 2BY1A 2Z6IA 2GJRA 3WLRA 1XHGA 3BLKA 1NELA 5CQ1A 2HQAA 3BOFA 4GD0A 4AD0A 3VKJA 2R1PA 2PDCA 3HGJA 1EP1A 4PMYA 3H7RA 3MZ2A 4UOQA 1QDSA 5AC4A 1KO0A 5K9DA 3VTRA 4DM2A 3LZ3A 3EPOA 5LNWA 3E9AA 1FOBA 5KETA 1ZPTA 3R13A 3W1QA 2WPBA 4CQAA 1IEQA 3ZT6A 1G1YA 2OZ8A 1EO5A 4FX7A 4HJFA 1WUEA 1FCVA 3H2MA 4IZGA 4ZQMA 3BL3A 3RM8A 3ITOA 3BV7A 2ESCA 3HIJA 3AYTA 1YIXA 5KMYA 1RQHA 1HT6A 1WZKA 4HIBA 2WW5A 1GQJA 4ZQNA 3E5PA 3ITVA 4M19A 1JXKA 3UY8A 1I0BA 3W70A 1WYIA 1E1CA 2PI6A 1HKIA 1OC7A 3D47A 2EF9A 3CTLA 3PTMA 3M0MA 1MSSA 3HURA 3P74A 1C9WA 3APYA 4ZQOA 1TCOC 4O4VA 2QDHA 4BF8A 2I56A 2I1OA 3HJEA 4JQ3A 2PLMA 3T42A 3SY5A 3R6IA 2YJQA 1TMLA 2NUXA 1S3HA 1ZALA 1E6NA 2E3ZA 3EX4A 1DE6A 4HPNA 2NUYA 2X1RA 2KAUC 5HWBA 5A6MA 3SZ8A 1GZGA 4XD3A 5DQPA 3EWDA 1W32A 2HSAA 4JX5A 4ERGA 5DMMA 1MW1A 2Y2WA 4F0HA 2ATMA 3A24A 4CD4A 2VR4A 4TW8A 2OWWA 2VRJA 3LN3A 2XIQA 1OY0A 3VCCA 4DM1A 1EJWC 3CAWA 3ZT5A 4LBRA 2F61A 5IM51 4GUHA 2WPGA 4QG9A 1M7JA 1QZ2A 4HU4A 3TOYA 3H2EA 2NT0A 1FD9A 3LRMA 4Z1YA 5ABTA 6CGTA 2FJKA 3D5HA 4ZPVR 4QLKA 1PKMA 1ZQ5A 1TIMA 1W2PA 2ZUNA 4BWLC 4NYUA 4MG4A 4LUSB 3KM8A 1R7OA 1V3IA 5T91A 2VI0A 3TC7A 1UWAA 4PR4A 3TE9A 2WCSA 4E2VA 1QCWA 5D2VA 2Z24A 3DFQA 1BXCA 1YPXA 4UR7A 4GGBA 4IICA 2JF6A 3U5YA 4Q8NA 1LBLA 4U33A 3DERA 3UA3A 3PBUA 1SVDA 3VGEA 1C8XA 1B1YA 2JKAA 2VN1A 3BTNA 1KA9F 3L7RA 1XF0A 3WQCA 5AB3A 4DT4A 2DG9A 2NUWA 4QDMA 3AHTA 1DHKA 3R7MA 1H1NA 5KZEA 2W67A 3DXIA 2YFNA 3V3WA 1U1JA 3VIMA 2MLXA 4K38A 1VFLA 4KCVA 4AU0A 2HBVA 4X3ZA 3URQA 3O5KA 1W1IE 2Y7GA 3QYSA 3EDDA 1EIBA 2XIIA 1A0CA 1S39A 3W6YA 4NZ5A 3PUOA 3UQAA 4FNTA 2E40A 1MI3A 3W7HA 4Q4KA 4XQ6A 1P43A 1H0IA 1EUNA 2PBGA 4D6GA 3ANYA 2QR6A 3UQIA 1KV8A 4ZXLA 1SO3A 1TV5A 3ARWA 3AZTA 5D9OA 3H23A 3EA2A 1E4LA 1WQ5A 3ZXWA 7REQA 1OFEA 1VFSA 2DZTA 3R8HA 2ALDA 2XFFA 2G3IA 1W26A 2Q71A 3FEQA 4KMQA 4NX5A 4XSMA 2V2HA 5IXEA 3IS4A 2UZ5A 2TYSA 1KM4A 1NDVA 1W0MA 4FOJA 3V75A 4AC1X 1XLKA 1G5AA 1XGEA 4MUZA 4Q8QA 2XGZA 2Q6ZA 1P7TA 3F4CA 3WK1A 3AICA 3WF0A 1Q63A 2IF4A 1AFSA 5CLTA 4FR6A 1BRLA 4QE5A 1DTUA 4AD3A 4XAKA 3BW4A 3QY7A 3GDRA 4UQ9A 2KFWA 3WDJA 1KTCA 2A7RA 1WX0A 4FX6M 2BVWA 9CGTA 1WOBA 4IF2A 4Q4OA 1W3IA 3OGSA 2G95A 3RN6A 2X16A 1TPVA 4OUIA 1ONEA 4Y8EA 3OLDA 1C8YA 4DF1A 4OECA 5ABFB 1ITXA 1TQXA 3P2VA 4PN2A 4C7GA 1A5NC 5E93A 4Q4QA 2ADAA 2FKEA 4DI8A 1TPC1 2I9UA 4AWSA 1M53A 1U83A 2X7VA 1L6WA 1R47A 3MCMA 2CXEA 1M5WA 1OIMA 1J01A 4QIUA 1HZYA 4QBXA 1VCGA 3KLKA 3K8LA 4LU0A 2XTKA 3STGA 3M16A 2ISDA 2V5CA 3V5CA 3TCEA 4F0SA 3B4YA 2PDGA 1Q6EA 5A6JA 4QJ5B 1UIPA 2X7WA 4WIWA 1UWTA 3BQ5A 4O53A 2DV0A 4A3RA 3P5ZA 4OV4A 1NQKA 3ISIX 4QE4A 1PL9A 1ZNNA 5CKSA 5CGMA 2HV5A 4JQ4A 1WDQA 2A5HA 3LXAA 5CGTA 3OVPA 4PFHA 2QPSA 4M6UA 3SUVA 1K7FA 1KFBA 2G37A 3QHOA 1KFWA 2CBJA 1OFPA 3WQ4A 1VBHA 3S2LA 4KEMA 5BMWA 1Q4NX 2QIWA 3NIYA 1UW9A 4LAVA 1KM3A 1A5AA 3DYOA 4REQB 1E1EA 2VO5A 1N8FA 3B9EA 5LIXX 4WVXA 2J27A 5JH2A 4FALA 4RDVA 1H62A 3CGTA 1QNRA 3E0VA 3JU2A 3F4VA 1X7IA 4Y6GA 3FLUA 3RXZA 4A05A 2VZSA 1VPQA 2TODA 3IEBA 4L9ZA 4DJFA 5HULA 4C6NA 7ODCA 3VGBA 3S8HA 3A4JA 3OIHA 4UOJA 2ZDRA 3RITA 5I3JA 1DHPA 4LS2A 2W9MA 1I2QA 3TA9A 2ZUTA 3IJ9A 1A5OC 5KINA 2HXUA 5FD0A 4U5IA 2IS7A 1V77A 3VFLA 5LNUA 2YXGA 1QWKA 2CLHA 3L67A 1NVMA 1JYXA 4NZCA 2HBXA 1KFJA 4B91A 3ID7A 1V0NA 3EIPA 4M80A 1Y7VA 4ZPTR 3I3EA 3WLKX 3AOFA 3JS3A 1XIDA 3SUUA 1JJKA 2RDXA 2VOTA 3DBNA 3EY6A 3QSTA 2X1UA 1M5YA 2WC7A 4B5XA 3HQPA 4GC4A 5FEPA 5IRPA 2BODX 4PMZA 3NSXA 2FZ8A 4C1NA 4DAFA 3SI9A 2IKJA 3GS6A 3W26A 2IKIA 4JFIA 4CQBA 4O4WA 3TN6A 1W9DM 1XGDA 1Q7ZA 1TJRA 3KL3A 3KOYA 4C6OA 1IT0A 1ME8A 5FJIA 3IPWA 3UPWA 3O9NA 3DG7A 3NI6A 5HATA 4LAYA 3P61A 1RCQA 7TIMA 3N17A 4Z2HA 2VVSA 2E77A 3PJUA 2R6OA 4DZAA 5IBXA 3FS2A 3MHGA 2EO7A 3DGRA 1TPFA 5EBAA 4IWWA 4BF5A 4EP8C 3IK2A 4IIHA 4LC8A 4UCGA 5I00A 3M6DA 1XIMA 1ZSXA 4GINA 3B8SA 2WHJA 4Z2LA 2D1ZA 4RL3A 2ZICA 3N2CA 4O1EA 4E4PA 1TPDA 2A3BA 3S9YA 4B3KA 3S1UA 3S1WA 1FKJA 4W86A 5DCBA 5FAJA 5ECVA 3C4UA 3W7CA 1F74A 2DIKA 1UA3A 2EKCA 2QCMA 3BC9A 4LSBA 3ZVHA 3B4UA 1RBOB 3B8VA 1AVAA 1SW3A 3VNDA 5I09A 3DFPA 1POJA 4WXZA 3PF3A 2CZVA 4D72A 2DT0A 4LVFA 3O5JA 1PWMA 1MNSA 1KBKA 2R9RA 4GABA 3CZLA 5BU6A 3P14A 3GVGA 4LUTA 4U2YA 2M2AA 1J4IA 3RHGA 1RK6A 3G3DA 1E6QM 2DSWA 4K8EA 3K1DA 4JHMA 3VIPA 4G2PA 1IF2A 1RBLA 3LCFA 4JNMA 4DXXA 4TV6A 3CIXA 3E1F1 4D8ZA 3SN1A 2RQSA 4M6QA 4WK9A 3KCJA 4MSPA 4OIFA 1SZGA 3MA8A 3CQ0A 1FHUA 5M3WA 2ZQ0A 3OB8A 4GQRA 2XZ7A 4HHHA 4WX2A 5JUVA 2NQZA 1F8MA 1MQPA 3CAVA 3AAMA 2NQJA 3MSGA 3DN5A 2XGIA 2VCCA 4A8NA 3SRKA 4H8VA 3ZYZA 1MXGA 3NQDA 2Y8VA 1AQFA 1R9XA 2G4JA 4DJED 3O6AA 5CZSA 3UPBA 3GBDA 3AHZA 2GL5A 4HZMA 1ZFJA 2TAAA 5ABGA 1CXIA 4H8UA 3C3NA 1D7KA 2V5JA 3UBPC 4IXHA 1N82A 4C6LA 2J7CA 3CYVA 4CCCA 3TYUA 2QEZA 3CB3A 4S3CA 4R9OA 5DO8A 2Z1BA 1L2UA 2OEKA 4XIAA 5FOOA 4CEUC 4F2TA 4DELA 1NSGA 3K46A 4D6IA 1K9TA 5J5DA 3VNZA 4D6EA 1V03A 5H1WA 3U2OA 3P0XA 2PDWA 3PJWA 2JBMA 4GISA 1E55A 4HSNA 4JYFA 1RV8A 2XP4A 3KTXA 4GYPA 5KSWA 1W9UA 1ZZMA 3IV3A 3JYJA 2J13A 4UTJA 2FTYA 1Q2SA 3BCFA 4DRIA 3WD3A 1JAEA 2GGGA 2PMQA 1MRQA 2GJNA 2BASA 4A35A 3BSMA 5GNZA 3GVVA 1ADDA 4TNSA 1JPKA 4A3UA 5TNVA 2C0HA 3LENA 2WC4A 1W9VA 3XISA 3GY1A 1L6SA 2OX1A 4MAVA 3GH5A 1D9EA 1Q8AA 1ZBWA 1ZRQA 1EHNA 2P50A 4E2BA 3QR1A 1K02A 1R3TA 2HS6A 4DUXA 3WNNA 4QE1A 1L9WA 3KBJA 2YPIA 3SCWA 5GPGA 2GDQA 4CN4A 4AWUA 3VOGA 4GO8A 3N73A 4GA8A 1MRAA 2ZTJA 3IVTA 4AAJA 4HNLA 5I79A 2ZQTA 3BGGA 2WJEA 1OFQA 3AISA 3T9PA 3E0FA 4U31A 1ITQA 4GRSA 4GUIA 3W7DA 3T1GA 4MB4A 1GTEA 1K6AA 2W79A 1YDYA 4GCXA 1XBYA 1JCHB 2ZA3A 1J6OA 1SFLA 4LH8A 3LGDA 1QW8A 3MKCA 3VNIA 3FGCB 4HYRA 1LLWA 3WK2A 3BMXA 3YPIA 3PY2A 2BDQA 4I5RA 3IWPA 1NWSA 4ZVJA 5I24A 3THUA 2GJXA 2CWNA 4L9YA 1E71M 3A23A 2HE5A 3N6HA 1WZLA 2AL1A 5HR6A 3I3DA 4ITZA 2Q3RA 3AROA 5TQLA 4H6QA 1VFOA 2GZXA 4W85A 4P5UA 4C1LA 3TVAA 3K5XA 3N9RA 1LL7A 1S5MA 2CLLA 1H1ZA 3KS6A 1IT8A 3BO9A 2Y85A 5AHIA 3C8NA 4NNAA 2QULA 5CG0A 5D33A 3MSRA 3H12A 1U22A 5FACA 1IEIA 2BWGA 2C1IA 4Q7BA 4DEFA 5C54A 4C6EA 4H8HA 4BWLA 2FFCA 2SFPA 3QPYA 1EUAA 5LKYA 3W01A 2ACUA 3QGVA 4QGCA 5K9CA 1EF2A 4ZMGA 3WH0A 3SIZA 3UI6A 1RY0A 1AQHA 3C0LA 3GIPA 2QV5A 2R1NA 3ZOAA 4IMFA 4RE3A 2MLZA 1OCJA 2GWGA 1YE6A 3UU0A 2IXVA 1W6TA 5LGXA 3U3HA 4RK8A 2V67A 1L6GA 1GOMA 3KHDA 1X7FA 4AQLA 3SCRA 2Z7GA 1B3VA 2NWSA 1BVWA 1E3ZA 3B8UA 4IFOA 4FK9A 2CC0A 2ZA1A 1TCDA 3IHZA 4G7FA 3VOJA 4JICA 3UCQA 2YCLA 2P53A 4OOUA 2QPXA 3O05A 2KE0A 2L5HA 4DJDD 3VDBA 4YNGA 4OQVA 1G67A 2D22A 1XLBA 2MUCA 3WY1A 4W7VA 1Q6IA 3AMGA 4IQJA 5DY3A 2B31A 4O0QA 4M82A 1XFCA 1M65A 4WKFA 4ZB5A 3ABOA 3CAKA 4RV3A 3WL1A 3IJDA 4X63A 3A4WA 1QHPA 5G2HA 2PC4A 4JCMA 4BCEA 5CXPA 3HZ3A 2QKFA 4ZFMA 3L5LA 1Z32X 2O55A 2WOQA 2Z0IA 1HKVA 4UFHA 1HL9A 3DU0A 4YTUA 3UG8A 4BF9A 5DLCA 8A3HA 4ZE4A 2IPGA 3ITTA 4MKSA 3MO4A 3NQBA 4GQBA 2ZTKA 5CLWA 3U2ZA 3M5VA 4W4QA 4ONVA 3UXLA 3CM4A 4LEFA 1QPFA 3VM5A 5RUBA 3G6LA 4HKPA 1LORA 1PAMA 4IMGA 4WJEA 5B80A 3UGVA 1A3XA 4TTGA 3M0IA 1UWRA 4J4OA 4LTSA 4NZFA 2PP1A 1RP8A 2Q8ZA 1EGVA 2X30A 3BG3A 1EA0A 4N4PA 1ITUA 3BMWA 4UQBA 1OWQA 3W72A 5AC6A 1FTXA 3NGJA 4FO4A 3CV1A 2DZVA 2E5CA 1JCNA 1FH7A 1U1HA 2PN0A 4GBDA 4TR9A 1JFXA 2INEA 4WDTA 4CNUA 2WB5A 3EWZA 5AHLA 3NNTA 4S39A 1UMLA 4PH6A 4HA3A 2Y78A 2A3EA 3MDYB 4LGXA 2A2IA 3MWCA 2QCDA 3NZPA 2C0AA 3BH4A 3MP5A 5K4XA 1TRIA 4GUJA 3TAKA 5DANA 3NJ3A 2V5DA 4GIEA 2D2HA 2CHNA 1QTWA 1XV8A 3WBAA 4HBKA 2B7NA 4H3DA 1P0DA 2PPPA 1BEUA 2P0IA 5REQB 3EOLA 4JFUA 3VDCA 3H4GA 2VEFA 5A2AA 3CJPA 3NEVA 4NZJA 3C3UA 4IT4A 3OEXA 3N4FA 2G3FA 3P0WA 3NQ2A 2D2JA 1MDRA 2XPBA 3SSJA 3ZSTA 3W6MA 3ARQA 4YWIA 3BW2A 2YBVA 1DP0A 4AZ7A 3HPXA 1GW1A 3W1XA 1XD1A 3KRSA 1Q6CA 2WXDM 3GG8A 4XZWA 1TTPA 1R86A 1J0JA 3G3MA 4F79A 2HCVA 1ZY9A 5EMJA 4CNOA 4UTMA 1SQ7A 1Q8JA 1FWHC 2E9LA 1FH9A 1MUMA 2XH2A 3ZR6A 1NWRA 2DJLA 1F6PA 1DKWA 3WH6A 3PTQA 4IUGA 2XP3A 5E6ZA 4IQLA 1WE5A 3QR3A 1GZJA 5IDZA 5EB8A 4Y96A 3VGGA 3I68A 1HVXA 2GQ9A 3G1YA 1JCYA 3KW3A 3GZAA 4WHBA 3LA4A 3VOFA 1HNYA 1NAL1 4QFUA 3LBCA 2QDGA 2W92A 2G3JA 3EEZA 4YPJA 1JUKA 4B4FA 4BKNA 4NZ3A 3PZNA 1EC9A 2BGSA 3MVTA 4LW7A 1EPXA 1QPQA 2OX4A 1BVNP 3HGRA 3WEMA 4K8HA 5K3VA 4LYQA 1P0BA 3VVGA 1DQWA 5XIAA 1C3FA 2J74A 4AMAA 4P7OA 5E0FA 4A3QA 1PBGA 2J78A 1MW2A 2E67A 3T7VA 1E1FA 1S5NA 3T0CA 2GQAA 1GG0A 4CKQA 5I3FA 4D6JA 5DITA 2VELA 3V5FA 1B54A 1R3RA 3GG1A 5HANA 1F9CA 3VIHA 4W84A 1UWUA 3WLIA 3R25A 2RHGA 1MFUA 2OSXA 4DH0A 4JN7A 3NSNA 1KR1A 2JQXA 5EMYA 1W1VA 5D04C 4GJJA 3ZO9A 2I57A 2VX7A 5HKGA 3C2RA 3AS2A 1V6TA 2QJHA 4JL1A 3DIPA 3LRLA 3W24A 1BSIA 4DVOA 4U3AA 1UKPA 5LNSA 1MQRA 1FDYA 3W7IA 1W8SA 2YGYA 3W84A 5DT7A 2OSYA 2DT2A 1WXJA 1HN1A 2JZVA 1NF0A 2QYGA 2Z28A 1UYQA 3O8AA 2Z1WA 4G6CA 4B15A 5A6BA 2CLIA 2QJGA 3HFYA 6XIAA 1C9DA 4RW3A 3OOBA 3VX0A 4X9SA 1E51A 1ML1A 2PV1A 3SCPA 2WNNA 4RNFA 2PDFA 2FQIA 4GO9A 4O13A 3WSUA 1SW0A 5J8LA 3O06A 3SUSA 3VOCA 3CHEA 4O8RA 2WNZA 3GKAA 1F6YA 4QT3A 2YW3A 1IX5A 1M41A 1WDWA 3NSMA 1BHGA 1LZOA 4UZUA 3R8RA 5EGRA 5F4SA 3T55A 1D8WA 1DWJM 1XPYA 1XJBA 4PB3A 9XIAA 2XPAA 3SGUA 2V38A 4GG9A 4JAWA 1J5TA 4QS5A 3W1LA 2O0TA 3R43A 3GNOA 3B9AA 3CWNA 3VMNA 1PINA 1R3SA 4JTHA 1XYMA 2CZFA 3AHYA 3V1HA 3SADA 3B0XA 2P5NA 3A4XA 3PZVA 4ZSUA 3DFSA 3S6OA 3TXZA 2WVTA 4LFYA 4PB5A 4UNIA 5DIVA 3TC5A 1CGYA 4XUYA 4F0KA 3OJGA 2CERA 2J8GA 1R8LA 3BZGA 2VZTA 2V81A 1FHVA 5G2WA 4S3EA 4FLSA 3EWCA 1O5RA 2YSWA 4N6FA 3ARRA 2RUQA 2GYIA 2QHAA 2JEPA 4TVUA 1TELA 4IJBA 2Q5AA 4FNRA 1OC5A 3IJ7A 3DEQA 2PGRA 3GHRA 4JX6A 1H7WA 2VHLA 1DIDA 1TIWA 3F4WA 3PZTA 4MY9A 2EEXA 4WLCA 2NX3A 3I7QA 1VYPX 4DO6A 3W81A 4ZO9A 1GOWA 5E0KA 2DVXA 1JYWA 2XYLA 4TU1A 3UA4A 2O7SA 3AJ7A 4K1WA 1XRSA 1V8EA 4Q4SA 5G2IA 4C6PA 3KAOA 3Q45A 1ADOA 1FWIC 1LBMA 3EDKA 4WCJA 1VFFA 3SY1A 3WLPA 1UQZA 1Q6DA 3AXKA 3G1HA 3URNA 3BK0A 1R38A 2G3MA 5DN1A 2YLLA 4US5A 5HWCA 1PV8A 1J96A 3LTSA 3A47A 1RLDA 3DHFA 3HFTA 3BAYA 4HB7A 2J7DA 4AXKA 3B9NA 4DWSB 4CEXC 1V0KA 1JI1A 4P2VA 1LJYA 2WK2A 4GI8A 5IDIA 4ICMA 4PMQA 2CNCA 3BLOA 1LG2A 1QI2A 2XUCA 4JTGA 4P7QA 3GG7A 4PCFA 2FGZA 4QHRA 3AMCA 4BI6A 1GJPA 4H9VA 1XCXA 3S6DA 3WIJA 3H70A 3JRKA 5ENLA 4EACA 2E6AA 2XP5A 5U7SA 1DXFA 3M7SA 2QMJA 3CT7A 4JTDA 3JZUA 5FKYA 1VBJA 4ZOAA 3GH7A 2JE8A 3VIOA 4FA3A 4LAWA 8TIMA 1ESWA 1UKSA 3CEUA 3B7XA 4JFWA 4S3FA 4BEQA 4H7VA 2D0HA 1ZJIA 3QPZA 3UD6A 3PRDA 4R7OA 3C2FA 4DRHA 2OO0A 1EJSC 2WHLA 1SJAA 1UD2A 5C9ZA 1KBJA 1GOQA 3PJTA 3VNMA 3L4VA 2DZWA 2PCEA 2D69A 3FY1A 2YA2A 3G1RA 3S42A 1OX4B 2FMNA 5DT5A 3C86A 3UI4A 2OT1A 3LLFA 3AC0A 4C1NB 4B5WA 2ZUUA 3P84A 3SQSA 3L21A 1K8XA 3NPWA 4LV4A 4MHBA 4HQVA 3HG2A 4WXYA 4JL2A 1YPFA 1JQXA 4OHQA 1PE1A 2BVDA 4I3GA 2BGNE 4I9TA 1UOZA 2BHUA 5LA2A 4B3LA 3POHA 1A0DA 4L9XA 1HG3A 4F2UA 3IANA 4DJFD 2VFHA 3L2MA 3G18A 1FKKA 4Q7IA 4IIEA 1ICQA 3TZFA 4ZXOA 4M7TA 5LGZA 2ZRUA 3KTSA 4YS1A 4JQ1A 2EG8A 3VINA 3IAQA 3URBA 4XKYB 3AIVA 1ONXA 2ZUVA 3LMZA 4IQ2A 4C6KA 5K7JA 1WA3A 3W87A 1FWCC 3U7VA 4ZSTA 3AS3A 3PFRA 1QBBA 1FWBC 1QHZA 3W7OA 4Q3MA 5DELA 4L1WA 1NWTA 1VFUA 1REQA 5HINA 3ZJ7A 1VYSX 3W1UA 3STEA 3HPSA 3DFYA 3KS5A 2CITA 1UBSA 4AYSA 2E28A 3W74A 3L4WA 3KVKA 4LYPA 1DWIM 4XBKA 1TMQA 3UG4A 4WUIA 2XGBA 1WNOA 5CH9A 4ORIA 4IQCA 2QAFA 2LLEA 3W7LA 2RGLA 2ONEA 2VGBA 1XBZA 5A5WA 1QAPA 4ZOEA 3V0SA 2QUTA 3O0KA 3PP7A 4JDBA 4ML9A 2PWGA 4M6PA 1UC5A 2ZX9A 3KBWA 3GIQA 1FWAC 1UR4A 1NP2A 3WQ8A 2PDBA 5BU9A 4HNVA 2DP3A 4UTKA 3VYLA 3TQKA 3CH0A 3A13A 1KXVA 3B8TA 1A5LC 1I60A 2G96A 1B3XA 1IR2A 4K68A 5C7HA 1PKLA 4L6DA 3FYYA 1AQ0A 1Q3NA 4MMWA 5HXMA 2YA1A 3OPSA 4NAFB 3R0KA 7ENLA 1EO7A 1PKYA 1TV2A 3CHVA 1TWDA 1H49A 4PBFA 3ZT7A 3IGHX 2XSXA 4HHMA 5C9UA 1UWSA 4X0VA 4FLRA 1RD5A 4PRWA 3Q37A 2NQLA 2ZZ2A 1S2UA 2ZOXA 3LHUA 1ALDA 1T11A 2QDDA 4UTFA 1XYLA 4Z2KA 4Z1BA 2ZRVA 2M1IA 4JFKA 1EHAA 3W7PA 2CBIA 1W1A1 4MWAE 1LBFA 3NGFA 5FEZA 1JXJA 5CGQA 4FSAA 3O5OA 7CGTA 4HPHA 1Z8AA 1V02A 3F1QA 3LNPA 3N29A 4LVDA 3UNTA 2WSYA 2WM1A 3CT2A 4XZ9A 1BAGA 2VENA 4FNSA 3MW7A 3OW1A 4HU3A 3WMBA 1UWQA 4XTIA 2GGEA 3N2MA 3IIZA 3UZYA 1H0GA 3S5OA 1Q45A 5F1UA 2ZC8A 3AZRA 3UCCA 4KGJA 2G5WA 3ZLGA 2HPMA 3ZJ6A 3F5LA 5EFFA 3QMSA 3T0TA 3EPNA 4Q6JA 2PAJA 2NSXA 4WD0A 3GDBA 5LHFA 4IP7A 3HV8A 3GHSA 1KFLA 2W27A 4W8BA 1OSEA 3HGOA 3HM7A 4W7UA 4KERA 5JBFA 4ZOCA 2ZRYA 3WBXA 1KM1A 1YBQA 1IEXA 3VMPA 4TW6A 1VENA 1XFBA 2VC5A 1UWIA 5AOUA 1GOKA 1LL6A 3BW3A 3A21A 3FSUA 3VI2A 1WXZA 1OVDA 3EB2A 3O1NA 1VRDA 3VXGA 5G4EA 2YL9A 3JYMA 3EBVA 4NKCA 2HZGA 4UQDA 2F6KA 1F6KA 3I3BA 4DROA 4CU8A 1CLXA 3IVSA 3FKRA 5HUPA 1X1ZA 3VABA 2DUZA 3AU6A 1FCBA 3NVDA 3N2BA 2F4EA 4D6HA 4IL2A 3TQPA 4LALA 2Y8KA 3UXIA 5C71A 5A6SA 1I1WA 2VR5A 1DWGM 5CBBA 1NF7A 2OOGA 3TYBA 1XG4A 1I4NA 3MHUA 2CETA 2QVHA 2C13A 4ACYA 1FHLA 3KEHA 5HMSA 4L80A 3V36A 1E73M 2VCDA 1T99A 2QXWA 4K2SA 4NY2A 4J7RA 3TH6A 4CNPA 3DFNA 4D2JA 3KOZA 4BA0A 3WDPP 4DRMA 3QBUA 3WO8A 3W1AA 2DG4A 3BAIA 1D3HA 2XZ9A 3FCPA 3QGAC 2REQA 4MYAA 5G1MA 1W3HA 2DGAA 2E0PA 2Q8XA 4CU7A 1XLHA 1EKOA 5LZLA 2W4XA 5AYYA 1PHWA 1V3JA 3B9DA 3ABXA 3E49A 1CZ1A 6REQB 1UH4A 3CL7A 5EY5A 3POCA 3TSMA 2WKLA 1NMWA 4A6GA 4MNJA 3HG3A 4FPSA 2OODA 3TN5A 3PAJA 1HO1A 1Q6RA 3JR2A 2CEQA 2HTMA 4YCOA 1S1PA 3UNDA 3AS1A 3B8WA 5D02A 3NA8A 3I4EA 2YB4A 5EMLA 3V5OA 4PRRA 1EA9C 1UHVA 1JZ6A 2VX4A 3LHTA 1T5AA 1W1ZA 3RLUA 3RUBL 3O0FA 4ODNA 4A21A 1DVJA 1A5CA 2VUYA 4DZHA 2QJJA 1UC4A 1FCUA 1QU4A 3U0HA 3GTYX 1GYMA 3T05A 3M0LA 4AC7C 1NP0A 1DJYA 1PVNA 5BYWA 3M0HA 1IYXA 4LVGA 4BFAA 3SFKA 5CSUA 3UWYA 5HW8A 1CDGA 2GOKA 1M04A 2PFHA 3OGVA 4NG3A 4PMXA 3CHDA 4INFA 1ENUA 1TVNA 3I7SA 3LYEA 3BWWA 1VLIA 4GCAA 3N4AA 3N9KA 4FAPA 4ACZA 3HU7A 3VZXA 3HV9A 3ONBA 4AEFA 5BWAA 3NR0A 4GX9A 5TIMA 4FI4A 4WRHA 3KFTA 1EJRC 1LUCA 5HNNA 3W07A 4RXGA 1G4EA 2VFEA 1E70M 2VUNA 4LNYA 1EQCA 2MNTA 3EX3A 4Y9OA 5LA0A 3UJFA 3ARZA 2EPOA 3T78A 2J7GA 1TR9A 4HHLA 1PYMA 4GBUA 1CECA 1FQ0A 4AX7A</