1WB0A

Specificity and affinity of natural product cyclopentapeptide inhibitor argifin against human chitinase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
364
structure length
364
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity and Affinity of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human and Bacterial Chitinases
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CHITOTRIOSIDASE 1
total genus 128
structure length 364
sequence length 364
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2004-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF01607 CBM_14 Chitin binding Peritrophin-A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1wb0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1wb0A01
2VVNA 1G0CA 4D6FA 1XHGA 3BC9A 5IFTA 3ARVA 3LPGA 1TA3B 2BVDA 5D9MA 4MB4A 3AIRA 1JDAA 1VFOA 3WNNA 1ISVA 1BSIA 4D6GA 1V3HA 3CO4A 3PZGA 3GXFA 4RE4A 5FL0A 2G3MA 4IPLA 3L4UA 2J78A 4UQEA 1HL9A 3BAJA 4EE9A 3QGVA 5CSUA 3W81A 3NYDA 1FP9A 1BHGA 1XCXA 1HX0A 3RO8A 3N18A 3WDJA 4WKHA 3VMNA 1ZJAA 1OIFA 3II1A 4HMEA 4GKLA 4H04A 2EJ1A 1TZ7A 2Y8VA 4KRTA 4AMCA 5BWFA 4S3KA 2CERA 5IHSA 1NWTA 1R87A 3OLGA 4HTYA 5IXEA 3M7SA 4ZENA 2WKLA 1Q6DA 1UG6A 3SUSA 3WQ6A 3N15A 3WL1A 3W53A 1H0GA 1V02E 1XSKA 4PYSA 3SCOA 2VNCA 5EMYA 3VUPA 2WMFA 2Z1SA 1GOMA 3WEMA 3PZVA 3FAWA 4X0VA 2GFTA 4PTWA 1GQKA 1UKTA 3AMDA 3WD2A 5A6KA 2YDQA 1B2YA 2YBUA 4CD6A 3LPPA 4CCEA 3RILA 1AVAA 1H11A 3FY1A 1W1PA 4JFWA 2J8GA 1CDGA 3AROA 1QBAA 3IJ7A 3VU2A 4C7FA 2ZOXA 2DPEA 4QCEA 3JUGA 2WVUA 1UZ1A 4PMZA 4MJ2A 5D4YA 1W3KA 1XCWA 2HVMA 2D2OA 1KXVA 3ZM8A 1FP8A 4UTFA 1HP5A 1KB3A 1BVZA 3OBAA 1ZL1A 4CD8A 2A3BA 3ARTA 2WCSA 2E0PA 5I5RA 3PZIA 3O9NA 3ZJ8A 4PTMA 4OJYA 1ZBCA 2DSUA 4J3TA 2EEXA 2GJXA 1UA7A 4HA4A 4M56A 1V3MA 3QR3A 3CUHA 2YDSA 1ZBWA 1XSJA 5D8ZA 3AS0A 1LQ0A 1GUVA 3KZSA 4BS0A 4BQ3A 1KFWA 3ARQA 4GQQA 1MW3A 4H8UA 2Y4SA 4BQ4A 1UD4A 1VRXA 1WPCA 3U57A 1WE5A 2VZUA 4W89A 3SCRA 1JZ7A 2OYKA 1U30A 3W29A 1J18A 1E4IA 5A6SA 3OGVA 1QNOA 1DWFM 2EPOA 5E09A 2WHLA 2VZOA 4ACZB 2XFRA 1VEMA 4ZE5A 5D8WA 1N82A 2XSBA 1KWKA 3BXWA 3WEZA 1WAWA 1RP9A 5JIWA 4OBRA 1B0IA 1CGUA 3J7HA 2ZE0A 1E15A 4BA0A 3FXYA 1DP0A 1HNYA 2XIBA 1S46A 3BGAA 3VD4A 4AZCA 2JE8A 1HJUA 3AS3A 4M24A 3SCVA 3BLKA 4KWUA 1W1TA 4HA3A 4WSJA 1J0HA 2WHJA 4AZ6A 2WM0A 2GUYA 3O2LA 1QW8A 2ZUTA 4JIEA 3AIWA 3IK2A 1E6RA 3DYOA 4DUXA 1Q6CA 5A6BD 1KXTA 2CPUA 5A8PA 2YLLA 1JF5A 1K9EA 2A3AA 1OM0A 1E6NA 3VGHA 1JZ2A 2J62A 1YQ2A 3WDIA 4CD5A 5E0CA 1UD3A 5D9NA 3NCOA 4AZCB 1QI0A 2X0YA 1E1EA 5D9OA 4UR9A 1Y7VA 4ACZA 2VVSA 1AQ0A 3WBEA 2YBTA 5CPSA 1A3HA 4EKJA 2MANA 4B15A 3FHQA 1CLVA 4MJ4A 1AMYA 1ZS2A 1HN1A 4FMVA 3ARXA 4W84A 1E6QM 2ZX6A 4XZWA 3VGFA 2AMGA 5IDIA 4JL1A 3FN9A 4N42A 4AIUA 1LG2A 4W7WA 5BROA 4H7VA 4A3YA 2ZXDA 1JDCA 4OIFA 1WP6A 4A3HA 2W63A 3WUFA 4URIA 1B3VA 1KGWA 2B31A 4XUYA 4CGTA 4CVWA 2JALA 2WW5A 4W86A 1BFNA 5JUVA 2J25A 4UCFA 1BPLB 2QPUA 1KR0A 1QNQA 2G3NA 4YPJA 4CVUA 5BXSA 2ZX7A 3VGDA 3VMOA 1TA3A 3PZQA 1UD8A 2WMIB 2UWFA 1GQIA 1MW0A 1TVPA 4WKAA 3RJXA 1XSIA 3WH7A 3ZMRA 3WIJA 3GXDA 2FDMA 4CD7A 2ZUVA 4M29A 2OWXA 3B9EA 1B3ZA 1JNEA 3SURA 4XV0A 3PTKA 3PZTA 4W88A 4HPGA 1V3LA 1J0JA 4DM1A 1FA2A 2WB5A 4QDMA 3WUBA 4HOZA 3W0KA 1GVIA 3VOCA 3IAQA 4CCDA 4U33A 2VI0A 4P7OA 4AD1A 1E0XA 4B16A 2Y24A 2YA0A 5CLTA 2PC8A 1C7TA 1ZU8A 3F5LA 4MNMA 1OGSA 3ARPA 1KBKA 2VURA 3VX0A 3AXIA 1W3HA 4WF7A 3NUKA 3WUGA 3SUTA 3AXHA 1OGGA 3MANA 3N9KA 4DWSA 2PWEA 3W38A 1GHRA 3TA9A 1WO2A 2J8FA 2UY5A 3CHCA 1CEOA 3AMKA 3SCNA 4QLLA 5DEZA 2AAAA 1BGGA 1QHPA 4M82A 2WMHA 1ISYA 2ZUSA 3NSMA 3VDBA 3UG3A 2X09A 2WHKA 4MAVA 1V3KA 1LL4A 5A95A 3BAYA 1GONA 4PN2A 1IV8A 3S6TA 1R8LA 2VCBA 3K8KA 3ARZA 1NOWA 1JGIA 2Z1KA 4PMDA 1JYNA 2VO5A 3WL0A 4AEFA 3KE0A 3PBGA 1GVYA 1KXHA 5BXPA 3VNYA 1Q6EA 5GQBA 2VRQA 3QHNA 5ECUA 5A69A 1WDQA 1UR0A 1G5AA 3OGRA 3F4VA 5DO8A 1SR0A 3WKZA 4UOQA 5BYWA 1OT1A 3GXIA 2NT1A 1CIUA 2FHBA 3W25A 1JFHA 5ABHA 4JFVA 1E4MM 2J79A 1Z32X 3QHMA 2PWDA 1EOMA 2WMGA 5HPOA 1FH8A 1ISXA 5HNNA 5TD4A 1QHOA 2D3LA 4LYRA 1GPFA 4Z2LA 3RM9A 3WDHA 3QHOA 4F66A 1B31A 4ATLA 4UQAA 4HU0A 4CN6A 5BXRA 1KCLA 1H3GA 1G9HA 3CZLA 3MV11 1QOXA 1JIBA 3AMGA 1HKIA 2WVSA 2YL5A 1MVYA 3TOPA 4HZ6A 2V3DA 3AYSA 3K46A 1MFUA 4P7LA 2ZWZA 2ZX9A 4JKLA 2D0FA 3EMZA 4RE2A 5AYBA 5A8NA 1BYCA 4TVUA 4ZXLA 2V3GA 3VIOA 4M80A 2CKRA 4FF5A 3SCSA 2VUYA 2YLAA 2CNCA 1KQYA 4FLQA 5HBFA 4D1IA 5LA2A 5A2CA 1VEPA 3ARSA 4NI3A 3BAIA 3KL5A 4AC1X 3SUVA 3MSDA 1HJQA 3K8LA 1E40A 3GH5A 3WD4A 5A1AA 4GINA 4D6CA 2NW0A 1E71M 4W93A 3I3BA 4JZ5A 3VD9A 1HJXA 4M81A 1PJ9A 1I1XA 1UYQA 4GZIA 1GOQA 1WZKA 3VO0A 4AXNA 1EH9A 3BH4A 3GNRA 5M17A 1DEDA 2V3FA 4AD4A 2PWHA 2WNWA 4LQ1A 1W3JA 1BF2A 1US2A 3SCTA 2DT3A 1HKJA 3KL0A 1JYWA 2WC4A 3AZRA 3VVGA 5CJ5A 3MS8A 4QCFA 1UZ4A 1LLOA 3NSXA 1BLIA 1V3JA 1B90A 4KRUA 2Y8KA 2DH2A 1V6UA 1PZ3A 1W3LA 3WFZA 3DC0A 2WLYA 1WB0A 2DH3A 2VC9A 4W87A 2J7CA 3TTYA 2UY3A 2CBJA 2J7GA 2CEQA 2XFFA 5EBAA 4CU8A 2W61A 3GYCA 2VOTA 2VJXA 2CHNA 4JAWA 4ATWA 5I3DA 3DHUA 4D72A 1QW9A 1W9PA 1UA3A 1ISWA 1R7AA 3BSHA 4FK9A 4PMYA 2ZXQA 3RJYA 1SMAA 4NSBA 3AS2A 1MXDA 1MWOA 2XGIA 3WH8A 2ZICA 1L0PA 1JG9A 3VIIA 3D5HA 3ECQA 2WKGA 1HJWA 2BY1A 4W8AA 1W32A 2BHUA 4MNJA 1UHVA 4HMCA 2J74A 1HJSA 1L8NA 1G01A 3UERA 2X1IA 5LA0A 3GBDA 1NH6A 3PN8A 4HZ8A 3T2OA 5I6SA 3WNLA 3GZAA 3AJ7A 3POCA 2QHAA 5AY7A 2FHCA 3AZTA 2CBIA 1PZ2A 4KGLA 2XTKA 1I1WA 4Y7EA 1PX8A 7A3HA 4HA1A 1EO5A 4P8UA 1JI1A 2YJQA 4UFLA 2VCCA 1NP2A 1M7XA 4J28A 1W1VA 2DIJA 2DSZA 1WDRA 2NSXA 3WQ4A 4E2OA 4QLKA 4DUVA 1FH9A 4H41A 1O6IA 1X1NA 3PZMA 2WMIA 4QLJA 4XX6A 3EDDA 4HOWA 1OBAA 4B9YA 4F8XA 1UD6A 4Z2GA 2BY0A 3A4AA 1CBGA 2XM1A 2WLZA 1CXKA 5M03A 2G41A 3VPLA 2DSKA 3K4AA 3OIHA 4S3JA 1BYDA 4KGJA 3TTQA 1FFRA 2VR5A 4IM4A 2VMFA 3ZJ7A 2YL9A 1JF6A 1UKOA 3WY1A 3WF0A 3AIQA 4CU6A 1ODUA 3MUY1 1GORA 3WD3A 1QNSA 1NM9A 1XD1A 2J7BA 3OZOA 3VKKA 3CH9A 3AHVA 1D7FA 3VIKA 1OINA 3A3HA 2DSWA 3VD3A 2YIHA 3VGEA 3MV01 4MNKA 4J3XA 2JF7A 1XH2A 3T08A 1JXJA 2RGLA 2XVPA 9CGTA 1UR2A 4U5IA 1FH7A 5FL1A 4U2ZA 3RIKA 1WNOA 2J47A 3RMEA 2X05A 1OD0A 3I3EA 1FOBA 4OOZA 1JZ5A 3VM7A 2W92A 4CCCA 1W91A 5BCAA 3ARYA 2XVLA 4C7DA 4C7GA 4WSKA 3IANA 4E4PA 2GJRA 4NRRA 5A6JA 1MQPA 1B3YA 1MFVA 1GJUA 1V08A 1DWJM 3BAXA 2VX7A 1PAMA 2OWCA 4AZ7A 1NOUA 1M53A 2WWDA 3ZT5A 2BFGA 1TVNA 3L4XA 3SUUA 5DFAA 4E8DA 2ESCA 1Q6GA 2G4FA 5C71A 1XH1A 3AIUA 3SCPA 1Q4NX 1BYBA 3VDAA 3THDA 1UR8A 2X0HA 1O7AA 3THCA 4TTGA 4AZIA 5LA1A 3NDZA 2QF8A 4LX4A 1B1YA 2DT0A 4UFHA 4V2XA 4R5EA 1DWHM 3AFBA 4ZE4A 3MU7A 1UOKA 4TXEA 2ZX5A 2VRKA 2FGZA 3AISA 3T2QA 3AMLA 1VFFA 4ATDA 2PI6A 5E6YA 3AS1A 1HF6A 1M03A 3RPMA 1K9DA 3A47A 3W6LA 2WZIA 1EOKA 1RP8A 5FKYA 3N11A 4JHOA 1KCKA 1TFVA 1QNRA 1EDTA 4OBSA 1NQ6A 3CUJA 4E8CA 3VIGA 3ZIZA 1W2VA 1MYRA 1TCMA 4P7RA 1MXGA 4MB1A 1ITCA 1C3FA 2VX6A 3W24A 1C92A 4HP5A 3ZQ9A 2DT2A 3CGTA 3AQUA 4MTVA 3F5KA 3KEHA 4JFUA 3WD1A 3UEQA 3WNPA 3L2LA 3HU7A 1H0IA 1X6LA 4L4PA 1KXQA 4AD0A 2F8QA 1C8QA 3AHXA 5JBDA 1JL8A 1RPKA 1JZ4A 4NRSA 3AYRA 3WH5A 2CBVA 2UY4A 1UWTA 4Z2IA 1OSEA 2XFYA 2E9BA 1QVBA 1JYVA 4DWSD 3AIEA 3PZ9A 3T2PA 3CMGA 2A3HA 3WDQA 4BQ5A 3A4XA 4OKDA 1HL8A 3OZPA 2V38A 1CXEA 3MUIA 4DM2A 1GQLA 1R7OA 4P7NA 1YHTA 2XUCA 1EHNA 2DGAA 1XC6A 2GVYA 4MDOA 1NARA 4PCTA 2EXOA 2QMJA 1LJYA 5HXMA 4W7UA 5FIPA 2WZHA 2WCAA 1MW2A 2BXYA 1IZJA 4CKQA 2BHYA 5C8BB 2QV4A 4GIAA 2YL8A 2ZXAA 2BVYA 3CMJA 2BV9A 1UQZA 1JYXA 4PTXA 4UQDA 4B3KA 5ABFB 4TTUA 3WDPP 4AZ5A 3MMDA 1JAKA 2VL4A 5A3HA 2F2HA 3SUWA 2Y2WA 3UR7A 4QP0A 1OGBA 3WENA 1D3CA 4W8BA 2FH8A 4UNIA 1XGZA 5ABGA 4W7VA 3AXXA 1CTNA 2CKSA 3CHFA 5GNYA 1V03A 1CNVA 1J0KA 1CYGA 2CIPA 2PBOA 2WSPA 2WCGA 3LPOA 4AWEA 3B9DA 1W9BM 3TONA 3A4WA 3FW6A 4D71A 1GJWA 1LWHA 5C70A 2VQUA 1AQMA 3MKKA 1U33A 8CGTA 3GDBA 4U3AA 3VDCA 1OIMA 4JL2A 1FHLA 1E4NA 4AYSA 5JIPA 3AIBA 2YOCA 2XWEA 4UZUA 3L4YA 2XG9A 3PTQA 3WMSA 1ZJBA 1QI5A 3MMWA 1UH3A 1U2YA 1LF1A 1HT6A 1QBBA 1V6XA 1NWSA 3WMCA 5GPRA 3L4VA 1WZLA 2VZSA 1V6WA 5ABEA 4JFSA 2WAGA 2UY2A 2DSVA 2E8ZA 5I77A 2O9OA 4GO9A 5FCZA 4WK9A 3GNPA 5A6LA 6A3HA 1PPIA 2WVTA 4AEEA 3BAWA 3WH6A 5DMYA 2WBGA 1H1NA 3HN3A 3VIFA 4K68A 4UFIA 2BS9A 1GOIA 1VAHA 5A8MA 1V02A 3W37A 1E3XA 3WF2A 1HP4A 8A3HA 5CXPA 3G6LA 2CITA 4PMXA 4GXPA 1HKKA 4RL3A 2E3ZA 5E70A 2W91A 2ZIDA 3VNZA 2BY2A 4P8WA 3WQWA 3MSGA 5M3WA 3CHDA 4OUEA 3ALGA 2JFEX 4JHZA 1CZ1A 1VBRA 3CLWA 5I23A 4OOUA 2W4XA 3WELA 2A3EA 3BMWA 2W66A 4M1RA 5EFFA 3WBAA 1NOFA 1ITXA 2CBUA 5AC5A 2OYLA 3ZR6A 1EHAA 1US3A 3EDJA 1MQRA 2D0HA 2ZXBA 1E9LA 4MADA 1GCYA 1UWSA 2XM2A 5A8OA 4KMQA 2NT0A 2G3IA 1W1YA 2IXVA 4AW7A 3WDRA 1E6ZA 4EK7A 1GHSA 3WNMA 2ZWYA 4EANA 5M5DA 1M04A 5CPQA 3AMCA 3VIHA 5A94A 1EDGA 5A6BA 2E40A 1NWUA 3CUIA 3L4WA 2W62A 4LGXA 1J10A 2VZVA 2BY3A 2GJPA 4HZ7A 2XVKA 1J01A 2CCRA 2VX5A 3OA5A 2JIWA 5JBEA 2WVVA 2JEPA 4IUGA 4FLSA 1I75A 3CZEA 4GI8A 3RM8A 2A3CA 3VILA 1KR1A 2W5FA 4KH2A 3E1F1 1K6AA 2EPMX 2XSAA 4DWSB 2YKKA 3LPFA 5EB8A 1PIGA 4F9DA 1C93A 4TUFA 1UR1A 4U31A 3AIVA 4A4AA 4F9JA 1BGAA 4TVCA 1UH4A 1VIWA 1CGTA 1TE1A 1UR9A 3NDYA 3S2CA 3QOKA 4QAWA 3WSUA 3D3AA 3F5JA 2BNJA 2D23A 1DWIM 3MMUA 2DT1A 3MO4A 4HOXA 2GJXB 5E9AA 4MB3A 3EDEA 3ZO9A 2OSWA 5IHRA 1IZKA 3CTTA 1E70M 3PTMA 3PZOA 4AD3A 3GH4A 4TX6A 3VIMA 1CXFA 2WK2A 3GXMA 2GDVA 3CZJA 3N1AA 4Q7NA 1W9UA 1UKSA 2FHFA 1BYAA 3WF3A 3UCQA 5A8QA 2Q8XA 3ZT6A 1HKMA 3OLEA 1VFUA 1B9ZA 4GI6A 1CXIA 1EIBA 4PMQA 1JZ6A 1LWJA 3BAKA 4PTVA 1EGZA 1TR1A 2ZUNA 4TVDA 4WIWA 1CECA 1UWUA 2OSYA 4GZEA 5CLWA 3UETA 4MB5A 5KZ6A 3N04A 4BCEA 1JAEA 3LMYA 1GQJA 1V6YA 3AOFA 4JCMA 4UFKA 1A47A 1IT0A 3M6DA 1V3IA 2O9PA 2YL6A 3OB8A 4OZOA 4D6IA 1JD7A 3CPUA 2DIEA 1W2PA 3T0AA 4PSPA 4W8LA 3APGA 1E56A 4UZSA 3OLDA 2XIIA 1R86A 2V3EA 3NIYA 1HVXA 3U5UA 1J11A 1G1YA 2WXDM 5BRPA 4D6HA 1B30A 1J12A 1C7SA 1NWRA 2D22A 1E55A 3EBVA 3VGBA 2E4TA 1SMDA 3UG4A 1XD0A 3FAXA 4AZGA 1GOOA 1UKPA 2GDUA 4U2YA 3K1DA 3WF1A 1JI2A 1VF8A 1VJSA 1DWGM 2WHMA 2PB1A 4AISA 3N12A 3U7VA 2VX4A 5A6AA 5AC4A 2BVTA 3G6MA 4ML4A 1E5NA 4NZCA 2EPKX 5EFDA 1EA9C 1H4PA 3UR8A 3VIJA 3MUAA 3O6AA 4JKKA 2VR4A 3CZ8A 1F4HA 2V5CA 1QHZA 3WFLA 3ALFA 4YHGA 1VEOA 3W4RA 1BVNP 1XH0A 4ZXOA 3VGGA 3OG2A 4D6EA 4UOZA 1TG7A 5AYIA 3T09A 1EQCA 2WSKA 2WANA 3AICA 1ISZA 4B9ZA 4AIEA 1VJZA 3W6MA 2VT0A 4LYPA 3VTRA 1W9DM 3WH9A 1JNDA 2PWFA 4P7QA 3M07A 3WD0A 1PBGA 2PF0A 2WMKA 2D24A 1E5JA 2EO7A 2JIEA 2ZUUA 3U7BA 2XYLA 2DDXA 4GI9A 3T0BA 3TP4A 3WNOA 4J3WA 5CGTA 3GH7A 3K4DA 4L4OA 3RCNA 1JDDA 5IFPA 1J0IA 4RE3A 1XRVA 1FFQA 3UG5A 2J75A 3W28A 4BF7A 1HIZA 5JBFA 3T0DA 1NP0A 4PCSA 2PWGA 2WZEA 1XYFA 1CWYA 1UWQA 5BRQA 1ESWA 1GZJA 1V0NA 2E9LA 2C8NA 2F61A 3DHPA 5A6MA 1R85A 1P6WA 1VFMA 1UKQA 2V5DA 2HISA 3ARWA 4PMVA 4W85A 2VTFA 2EPNA 4BZYA 1VBUA 1PEZA 4XB3A 2X2YA 4FLRA 2D0GA 4PSRA 1BAGA 1QPKA 1HXJA 3BCDA 2D20A 1BG4A 3U5YA 3GM8A 1ZBVA 1MW1A 1WDPA 4UFMA 4F79A 1TUXA 4UOJA 1PIFA 5CPTA 3N17A 3FNDA 4UQ9A 4GO8A 3BSGA 3AHTA 1E6SM 1E0WA 2PBGA 3IAPA 1DWAM 3CZGA 2WPGA 4P8VA 5CGMA 3VD7A 1JZ3A 2WWCA 2EBNA 1W9VA 4ACYA 2DQXA 3EMQA 1UQYA 4TX8A 4AZHA 1AQHA 1ZB5A 5I0DA 2O9RA 3KL3A 3ZSSA 4PMNA 4AIOA 2XWDA 1FHDA 1B3XA 2CXGA 3VMPA 1UD5A 2XJ7A 1OT2A 4PRWA 3IJ9A 1UWRA 1LL6A 2E9MA 4X9YA 1V6VA 1GW1A 1UR4A 1H5VA 2EPLX 3TTSA 1SYTA 5KEZA 1QI3A 1KGUA 3VIPA 4H8HA 4R27A 4Q22A 3CZKA 1HJVA 3RM4A 1GOKA 1KQZA 3AI0A 2XHYA 4AZBA 2RGMA 4P8XA 2ZUMA 1D2KA 2CHOA 1OB0A 1VB9A 1CXLA 2WVVB 1XV8A 5CQ1A 1PX4A 1E72M 3ZJKA 4DUWA 2O92A 4JCLA 4LYQA 4PMUA 4QFUA 5CG0A 4FLOA 1GOWA 1XYZA 1GNXA 2XGBA 3DYPA 4WLCA 3A6OA 3WQVA 4XZBA 4CD4A 2ZX8A 3EMCA 3WNKA 3WQ5A 4PEEA 4PUEA 2CESA 1H09A 1CENA 1WZAA 1J9YA 2VZTA 5CSYA 2J7FA 4ZFMA 4U5KA 5I78A 2D3NA 3BCFA 5A2BA 1CGYA 3WN6A 3GTNA 1E0VA 1UUQA 1CPUA 4IISA 2OSXA 4MPKA 5FOOA 2W67A 4JFTA 4Z2JA 1C8XA 3N13A 1G94A 4NF7A 2GK1A 4CN4A 1JXKA 1TMQA 1KWGA 3ZOAA 4LXFA 4X0NA 1E73M 4TOQA 3MUZ1 3WEOA 4ZEPA 1E43A 2WBKA 4PUDA 4PMOA 3IJ8A 4HPHA 3ZT7A 3KWXA 1WKYA 3BMVA 4YHEA 1RD6A 5I79A 4MAZA 2QPSA 4D1JA 5HPCA 1Q6FA 4H2CA 3NSNA 4AY1A 1VENA 3AZSA 4W5ZA 3VD5A 3M46A 3L2MA 1DHKA 2E8YA 2G8ZA 2YDRA 4AD2A 2J7EA 5HOSA 3B8SA 3EYPA 5A2AA 3CUGA 4U3CA 1H2JA 4J7RA 4WJXA 1C8YA 5GNXA 4YN5A 5FD0A 2JF6A 3ZJ6A 3DYMA 2CYGA 1MQQA 2DEPA 4H8VA 3FHAA 5HDRA 1JD9A 1LG1A 4D6DA 1UWIA 3ZSTA 4EAMA 3ZR5A 2TAAA 1K9TA 1WZMA 2AOSA 5CZKA 4W5UA 3UESA 3L4ZA 2BHZA 4Z2HA 5LYRA 3WQ8A 3CUFA 3GBEA 6CGTA 1OWQA 4PMRA 4IPNB 2GSJA 1KBBA 2OLHA 2VQTA 4UQBA 2WC7A 3RDKA 5I2UA 2G3JA 1RH9A 3OGSA 1E6PA 3PZNA 1SFSA 2OYMA 2O9TA 6TAAA 3AHZA 3ARRA 4V27A 5F7UA 3HMCA 3ARUA 1V0LA 4GQRA 4MDPA 4GPNA 3DECA 2J7HA 2WC3A 4J3VA 3OLIA 4BQ2A 2QMKA 3TTOA 1EO7A 2YA2A 3VM5A 3VDHA 1H49A 2QLYA 3W27A 4B3LA 3WUEA 5DF0A 1CLXA 3W26A 1BQCA 2J7DA 3POHA 1QNPA 1CGXA 1WDSA 2XPKA 4GZJA 5ABFA 1UH2A 3HJEA 1JFXA 2VCAA 4M8UA 4V28A 4CU7A 1ZBKA 4N0RA 7CGTA 4PBGA 1X6NA 3VX1A 4UQCA 5D9PA 2XVNA 3QOMA 4J3SA 1QI4A 3NJ3A 3CIVA 1ODZA 2J77A 1EQPA 2EQDA 1CXHA 2ZUWA 3EDKA 4HU8A 3WF4A 2Y5EA 1C90A 2WMJA 3WMBA 1BTCA 1E4LA 1V0MA 1F4AA 1V0KA 4JKMA 1PX3A 2FH6A 3PHAA 1KGXA 2FGLA 1ECEA 1OD8A 1E3ZA 2WYSA 4CN1A 4D6JA 3SIMA 1EDQA 4HMDA 5E6ZA 1B3WA 5DT5A 1UD2A 3SCUA 4AD5A 3VINA 1JZ8A 4MNLA 2X8RA 4DWSC 4J27A 1DTUA 3B9AA 3AHYA 1CGWA 4Z2KA 2D1ZA 2JEQA 4UFJA 3SEPA 1WCGA 4WKFA 1J0ZA 1M01A 3CHEA 1J0YA 3EDFA 1EXPA 1H41A 1E6XM 4CUCA 3PZUA 3CBWA 3SCWA 5GNZA 1BG9A 2XVGA 1W9XA 2C0HA 5DT7A 1E1FA 3K8MA 2OWWA 2C7FA 2IUZA 2J4GA 5BXTA 3L4TA 3I3DA 2GK1B 1LL7A 4LPCA 2BXZA 3W82A 2IXUA 7TAAA 3SCQA 1OCQA 2YA1A 5I24A 3GNOA 1C91A 1K9FA 3BLPX 4J3UA 5JH8A 1QI2A 2VRJA 5E0FA 1HVQA 1CGVA 2CETA
chains in the Genus database with same CATH superfamily
1JCXA 3NYZA 4D6FA 1A5BA 1FX6A 2DZBA 3QTPA 4UIOA 3WNNA 2R82A 4LFYA 1ISVA 2Y85A 4PL2A 1V3HA 2VOMA 3PZGA 4NG3A 4RE4A 3TQVA 1EPVA 2G3MA 3L0KA 1HL9A 1XLBA 1X8FA 3THUA 1Z3NA 2LKNA 1P43A 4F0SA 3VC6A 2OZTA 3N2CA 3RO8A 3MYPA 3PPGA 3QC0A 3RLGA 4DXVA 2EJ1A 1TZ7A 1KT1A 4TV6A 3UNDA 4GIYA 3LB0A 3RPDA 2NWSA 4RXGA 3I6CA 3RFAA 3W01A 2PN0A 3WL1A 2Y70A 1H0GA 4HCDA 4A21A 3OA3A 3W02A 3VUPA 4XQ6A 1GOMA 4IPPA 3FAWA 4C6CA 4X0VA 1UKTA 5HWBA 2AAMA 3NOYA 1B2YA 3VFCA 1G6CA 3EX2A 3KAIA 2GVLA 2RUQA 3RILA 2YB1A 1V93A 4QEEA 4E3VA 4LF1A 2O4QA 1CDGA 3AROA 1R2TA 5FJTA 1IXPA 3VU2A 4FZIA 1OY0A 4NP7A 2DPEA 2F7FA 3ZR4A 2F2KA 1VQTA 3M0ZA 1SZEA 1XCWA 2D2OA 5HR6A 4JY8A 1XBYA 2PRLA 1SW7A 3TROA 2A3BA 3ARTA 5I5RA 3O9NA 3R58A 5CPNA 3ZJ8A 1S2UA 2EEXA 3KOZA 1XLLA 4GG9A 4GQ0A 4KWWA 1S5VA 3PBMA 2VDIA 3CUHA 3W7GA 1XSJA 3NR0A 1K4GA 3C4UA 1OX4B 3H8AA 4G7FA 3BDKA 5G5IA 3ARQA 3NQAA 1MW3A 3BLLA 1KRAC 1IXQA 3RU8X 4A3QA 1WE5A 2VZUA 3FSTA 1ZAIA 1E4IA 2OX4A 1OG6A 3KWSA 3OGVA 4GA8A 1QNOA 1DWFM 1R3RA 2O4MA 3ZVIA 5E09A 2WHLA 3L7RA 3MHUA 2QNEA 5D2WA 4Q7IA 4ACZB 1D7HA 1OC7A 4RUBA 2PLJA 5D8WA 4F48A 3NI6A 2ATSA 3OVPA 2Z29A 1RP9A 3FJNA 2YCLA 3QF0A 3J7HA 2ZE0A 3GK0A 1E15A 1SQ7A 3FXYA 1HNYA 3UFYA 2OOGA 1PHQA 5HANA 3I4EA 2AL2A 1Z89A 1DYSA 4ZQOA 3AJXA 4JPGA 1PHWA 1W1TA 1V6TA 5AC7A 3KCOA 4H9UA 4JIEA 4NJIA 3ITLA 3DYOA 3RR1A 4DUXA 4AF0A 1VYRA 4O50A 1R9HA 5A8PA 1GVSA 2EG6A 1OM0A 3PJWA 1E6NA 1A3WA 1OYBA 3VGHA 2J62A 5TIMA 2NUWA 3NCOA 4J3ZA 4GD0A 1UROA 3VNJA 3FFSA 5CPSA 4LW7A 3O3RA 2MANA 3FHQA 1FKJA 1CLVA 5IBXA 1JDFA 4W4QA 4ERIA 1E6QM 4DPQA 2XZ9A 3I7QA 2ZX6A 2QJJA 3A5FA 3VGFA 3QM3A 3BLDA 5I3FA 3TJLA 4AIUA 4IPXA 4O16A 3DI1A 4Q8VA 5BROA 2FVLA 4A3YA 4I5RA 1F74A 4NZ1A 4OIFA 5LNSA 4QNWA 1R9ZA 3CQIA 3RMJA 2FFCA 2W63A 3CEPA 3FA3A 1Z42A 3THAA 3TDFA 3WJZA 4JTDA 4NNAA 2O55A 4Y96A 4CVWA 1FWWA 1QMLA 1BFNA 4QZVB 2J25A 4UCFA 2QPUA 3KBJA 4R9XA 5I7GA 2G3NA 5BXSA 3H2AA 2ZX7A 3K4WA 3WCZA 2OZ8A 1CB2A 3M0JA 2Y7GA 3TW7A 2WMIB 1GQIA 4GRSA 1OC6A 1XSIA 4DYJA 4M7SA 3ZMRA 2OFNA 6REQB 2YYUA 1FKGA 1JCNA 2Z26A 3B9EA 4QGCA 3LLXA 3PTKA 3QSTA 1THFD 2WB5A 2BB0A 1PIIA 3LUOA 3IAQA 4CCDA 2VI0A 1T8QA 2Y24A 3LGDA 5IDZA 2PC8A 1C7TA 1ZU8A 4MNMA 3ARPA 2VURA 2V5JA 4F0KA 2UBPC 3NM3A 4BI7A 3MANA 2PWEA 1SFTA 2P8CA 2PZ0A 3OVRA 3JW7A 5FA5A 1WO2A 2UY5A 5HINA 4DRMA 1H7PA 4B2DD 4DRIA 4OFCA 5DEZA 4HBEA 3W7MA 1D3GA 1ISYA 2HBVA 4BEQA 2ZUSA 3GHTA 2HS8A 3VDBA 2X09A 3H7UA 3G1AA 2A4AA 3B4YA 4Y90A 1RCXB 4LC6A 5E5CA 3K8KA 3WQDA 4TV5A 2NQZA 4U10A 4PMDA 1JYNA 1N7KA 3ELFA 3WYZA 1GVYA 3VZZA 1OYAA 5BXPA 3OQEA 1Q6EA 2VRQA 3WK2A 2RQSA 2A2IA 3QHNA 4RE0A 5ECUA 5A69A 1FKKA 1WDQA 3SRKA 6XIAA 3F4VA 1FKTA 1P5BA 3NXFA 1K02A 5TBOA 1SJCA 3WKZA 5GJPA 5BYWA 4IFOA 1OT1A 3GXIA 4ADUA 3URNA 4JFVA 4QJ5B 1E4MM 1Z32X 3G22A 2ZZ1A 4R9OA 5E1QA 5HNNA 3RYSA 2D3LA 2QAFA 4Z2LA 3RM9A 4F66A 4UQAA 5E93A 3LLFA 3P67A 3IVSA 3CQKA 1KCLA 1LUCB 4K3ZA 4ZVJA 1DE6A 2WVSA 2YL5A 1EJSC 4V15A 2ZC8A 3NGJA 2V3DA 1S2WA 3AYSA 3ENLA 2MNTA 3K46A 1MFUA 4P7LA 1P0NA 4JKLA 2D0FA 4JY9A 5AYBA 1O1HA 4N9EA 1DOSA 1OK4A 3VIOA 3MWAA 3TR2A 1KQYA 4D1IA 5LA2A 5A2CA 3LHVA 4NI3A 3BAIA 3KL5A 2DW6A 4AC1X 2CLPA 3MSDA 3U2ZA 4WDUA 3Q67A 2PDKA 4DVOA 4MLRA 2NW0A 4HMNA 4POCA 3FA5A 2VC5A 3LUTA 5LGXA 1PJ9A 1S38A 1XXXA 1WZKA 4NAFB 3H4XA 2GVEA 4QG6A 5I3KA 4IG2A 2HPIA 3BH4A 4YS1A 3GNRA 5HQLA 2XN2A 1ZQ5A 1DEDA 5EMJA 2V67A 2A6NA 2FPVA 1BF2A 4O1AA 3A3XA 5CBBA 2ZR5A 1FKWA 3SCTA 4B5TA 2WC4A 4QCFA 3W85A 2ZKMX 3O16A 2W0UA 2DH2A 4N9DA 1Y5WA 3L23A 4GNKB 1UIOA 1PXGA 4LBRA 2PRMA 4JTCA 1WB0A 4C1NB 3KXQA 4AU0A 1S3HA 2J7CA 3MJMA 3TA6A 2B5UB 2QVHA 2J7GA 1W8GA 4DUOA 2CEQA 3O5FA 1OCNA 2XFFA 5EBAA 1DJHA 2Y62A 2VJXA 2CHNA 4ATWA 1X7IA 3LY0A 4ML9A 4NXSA 4A35A 3TC7A 4UTKA 1UA3A 1R7AA 4FK9A 3A23A 4R34A 2CWNA 4RZBA 1XBVA 3TK7A 3C0SA 3D5HA 3LHUA 4JIPA 2WKGA 4DBSA 3NQFA 4B5XA 4DH0A 2BHUA 1US0A 3SAZA 3EY6A 3B8DA 1KV8A 3UERA 5CC5A 5LA0A 4HZ8A 3UJEA 1Q3NA 3T2OA 2QF7A 3H2FA 2QHAA 5AY7A 2FHCA 5D04C 2CBIA 3KVLA 1PX8A 4Q4RA 1P1XA 2GQ8A 4OWGA 3CL8A 4ASTA 4P8UA 3VZXA 2VCCA 1NP2A 1QPRA 2IKHA 4DLMA 3TAOA 1XG4A 3Q65A 3E49A 3TV8A 2GVGA 4QLKA 3IV8A 4WOQA 3HURA 4QJ1A 4JFMA 4QLJA 4DRPA 3KOWA 1L1PA 3LA4A 3S1WA 4F8XA 4Y2WA 1KM3A 1FKSA 4MSPA 3I68A 4B5VA 1CXKA 3N29A 3VPLA 3TX9A 1F8IA 5TF0A 3K4AA 1AA1B 3PJTA 1FFRA 1RXOB 1AH0A 1UUMA 2YL9A 3WF0A 3AIQA 3B8TA 3N34A 3CL7A 2OR2A 3MUY1 1GORA 1XBZA 1KTBA 1H60A 1BKSA 1KM5A 1XD1A 3OZOA 4CQAA 3AHVA 4XBKA 3H24A 3THQA 1OINA 3HA1A 4K7VA 5G1MA 2YIHA 3MV01 4LU0A 4S39A 2OGYA 3LHYA 2JF7A 4NX0A 4WUIA 1BF6A 2RGLA 2XVPA 2GGEA 5REQB 1UR2A 2Q01A 1VH7A 5FL1A 3H22A 3NQ7A 1B54A 2J47A 2H3DA 1OEPA 3RMEA 1OD0A 2PPGA 1FOBA 5DY3A 3LERA 2W92A 1F3WA 3OVQA 4QROA 4LUTA 2XVLA 2OJPA 4ES4A 8TIMA 4QG8A 4J4KA 1H7RA 3WH0A 2RSEA 4NRRA 1GKQA 3W7QA 3ONCA 2XH4A 2PU0A 5KZDA 2PA6A 2WWDA 3E0VA 3PRAA 1R47A 1TIMA 1P0DA 4ZOAA 5DFAA 4E8DA 4H9VA 1Q6GA 1XFCA 1MUWA 2G4FA 3PPHA 3SCPA 3T44A 3T78A 4NU7A 4ZBCA 2NQ9A 1Q4NX 3VDAA 3M4HA 4O1DA 1A5UA 3KVKA 6ALDA 2X0HA 2FB2A 1QDSA 3MHGA 2C13A 3ANUA 3NDZA 4D8ZA 5J5DA 3RX3A 1E0UA 1JCJA 2V0TA 2DT0A 2VWSA 4B5NA 1T0OA 4JTKA 3MU7A 1C9HA 2HZGA 2PTZA 3T2QA 2PI6A 1ME7A 3W1AA 1ZJIA 4G1NA 3RPMA 3A47A 3W6LA 5CC3A 5HMDA 4N4QA 3CT2A 3N11A 1WUEA 1KCKA 2OOFA 1QNRA 1IT8A 3UWVA 5BW6A 3CUJA 3K13A 3W84A 1W2VA 1MYRA 4P7RA 2QPXA 1MXGA 2OKOA 1ITCA 1IE7C 1C92A 2BTMA 3ZQ9A 4A05A 3TYCA 1VGAA 1WX0A 4EPDC 3PPCA 4MTVA 4IQEA 1XDMA 3L12A 4AHOA 5A5WA 3L2LA 1H0IA 2ZBTA 3WJYA 4AD0A 4GGHA 4GH1A 3HIJA 1XINA 3QPEA 1K03A 4KEVA 1RPKA 4MJZA 3S1UA 4R33A 4RCXA 3RLVA 3T1GA 1JZ4A 2UY4A 3TN5A 1UWTA 4Z2IA 3HG3A 2E9BA 2DV0A 1JYVA 3M41A 3E2QA 5LIKX 1RSCA 2RKXA 3AU6A 4NJGA 3WDQA 3A4XA 4BQ5A 4GCAA 4F40A 4OKDA 1HL8A 4R3UA 3OZPA 2EPHA 2HE5A 1N2VA 3MUIA 3BJSA 3CEUA 3PSVA 4P7NA 1YHTA 4FO4A 1EHNA 1Y65A 2HK0A 2QYGA 3BLFA 2EXOA 3O7UA 4W7UA 1SO6A 2WCAA 4Q4PA 4X22A 3WG6A 4C1NA 5C8BB 2YL8A 2ZXAA 2BVYA 3EX1A 1R3YA 3DUGA 1JUEA 5BMXA 4G7EA 4HU4A 3S8HA 1JYXA 4UTWC 2H90A 1K8XA 2JK2A 4MMWA 2FIQA 2C71A 4RDYA 4QIUA 2J9YA 3WDPP 4AZ5A 3GG8A 3MMDA 2VL4A 4CNNA 2CLOA 4DIPA 4IQJA 4YVXA 1OGBA 3WENA 2VFFA 3PWIA 2PF8A 4IGHA 1I45A 1J0KA 4AWUA 2PBOA 4GKTA 3W7LA 2F38A 1IQ8A 2Q3RA 2FVKA 1HG3A 3CWHA 1M7JA 2ON3A 4E8GA 4DJFD 4IFKA 1TX0A 3P60A 1H61A 3L65A 2DU2A 3TONA 3FW6A 5DANA 3W2NA 2VQUA 3RR4A 2IPWA 5TAOA 3KZ7A 2A6LA 4IGSA 3CQJA 1OIMA 4XAKA 2V2CA 2YOCA 3PTQA 3T6CA 4HBOA 3Q94A 1MO0A 3I6EA 2VGFA 4QT2A 1U2YA 1VYSX 1QBBA 1V6XA 3B4UA 1JUKA 4QM1A 3L4VA 5GPRA 1WZLA 2R1PA 1YADA 3REQA 1XX1A 2W27A 2VZSA 1FCQA 2NXIA 3S46A 3WLJA 4I7VA 5ABEA 4BJHA 2NV2A 2AGTA 2WAGA 2QCHA 4JFSA 2UY2A 5FCZA 3UXAA 3F7JA 4WK9A 1W3IA 6A3HA 4LYKA 4DO7A 2BP1A 1Q8AA 2C3ZA 3ITCA 5ECVA 3BQ5A 3UA4A 1H1NA 1SM9A 1KLYA 3VIFA 1KV5A 4K68A 1GOIA 1V02A 1DQWA 5DXYA 3G6LA 5C5YA 2HWGA 2CITA 4Z08A 3NQ6A 3HO8A 4N6EA 4RW5A 3GC2A 2BGNE 3GDMA 1W1A1 1ITQA 3MSGA 4OUEA 3OODA 3I7RA 4JHZA 3GC4A 1VBRA 4O1EA 4OOUA 3WELA 3BMWA 1VPQA 2ATMA 5EFFA 4ILSA 2CBUA 4O0QA 3ZR6A 1US3A 4QJ3B 3EDJA 5AC6A 1FD9A 1GCYA 4PR4A 4CQDA 1KTNA 5H91A 1O5XA 3B40A 1WKEA 2G3IA 1FWHC 1XISA 4AW7A 4H7CA 4XIAA 5E9XA 4IJRA 3CV7A 2TYSA 5CPQA 4TX0A 2E40A 3WLOA 1NWUA 3L4WA 2W62A 2ZA2A 2JIWA 3TN6A 3PJUA 2DVTA 1YRRA 3RM8A 2AQWA 3EWBX 2FZBA 3VILA 3XIMA 1IEIA 3HG4A 1KR1A 3MBDA 2W5FA 1M5WA 3E1F1 4HNTA 2EPMX 4DWSB 1VP5A 1PIGA 2E25A 4F9DA 1KM0A 3W1XA 3DFTA 1UR1A 4A4AA 1UIPA 4MYAA 5DCDA 1UH4A 3TYUA 3NQ8A 1TE1A 3NDYA 4XKYB 4QAWA 4NZFA 3M0YA 4FB7A 5AHMA 5L9FA 3FGCA 4DELA 2DT1A 4KCWA 1YTDA 1OFBA 1S5NA 1VIZA 2PBCA 2PDJA 4A29A 4IL2A 3PTMA 2GGHA 2KR7A 3MBFA 4QNEA 3BG5A 2HS6A 3LTPA 4XTIA 2GDVA 4PCNA 4Q4MA 4HK6A 4Q7NA 4K39A 1C8VA 5LNWA 3E38A 3NO3A 5BOOA 2FHFA 1BYAA 3WF3A 3UCQA 5HA7A 5A8QA 2Q8XA 3IJIA 3OLEA 1NU5A 4GI6A 1EJ7L 4ONVA 3N2MA 4PMQA 1XLEA 4AUBA 2Q02A 4ZOBA 1R38A 2OSYA 4OGZA 5CLWA 1V7AA 4MY1A 4JTLA 4LY4A 3G2GA 2OQYA 3EOUA 1JAEA 3F4CA 4S3AA 5FAGA 3QRHA 1ZCOA 3LMYA 2Y63A 2PDCA 2PDFA 3RXZA 1IT0A 1V3IA 3CUZA 4HYVA 3STCA 3MP5A 4OZOA 4D6IA 1FWIC 1RBAA 3CPUA 3VFLA 1W2PA 4W8LA 1E56A 5M2FX 2NXHA 1XG3A 1EZ2A 3U5UA 3GDKA 3WLNA 3CB8A 3JU2A 4HJFA 4YLWA 2LJ4A 5F1VA 1FDYA 4KFOA 4V1XA 5XIAA 3HF3A 1S39A 2E4TA 5KETA 2XGZA 3KBMA 2PLCA 2FGBA 1GVRA 1GPWA 4AZGA 3EB3A 3O63A 4QT3A 4GY7A 5FJJA 2Y88A 3WF1A 1VF8A 4N19A 2V2DA 5C55A 1A7XA 3AU2A 2YXOA 4IMEA 1ZNNA 3N2BA 2VX4A 1Z6KA 2F4EA 4K2SA 4XAYA 3LNPA 3VIJA 5HUPA 1W17A 3QY6A 3MTWA 3U4FA 1E9IA 3TQ0A 4LBSA 4DF2A 4JKKA 4GUFA 3KAGA 3E2SA 5HJXA 1AZ1A 3CZ8A 1F4HA 3M0XA 1A5CA 1QASA 3FKKA 3WFLA 1VEOA 2QDEA 4GUIA 4INFA 4C6NA 4ZXOA 2Y7DA 1PZ0A 1Z9AA 4D6EA 4LB4A 3G3DA 1OVDA 1LBLA 3T09A 3NL6A 1PCWA 2WSKA 2WANA 3AO0A 2W6RA 1VJZA 3W6MA 2PP0A 4LYPA 3GUGA 1BTMA 3QYSA 1UC5A 4LEFA 5DBTA 3NFUA 3HQPA 2A21A 3ODKA 3S1VA 3U2OA 1EWDA 2DZWA 3NZ1A 1E5JA 2Z0IA 3U7BA 2XYLA 3LMZA 1Q6RA 1IGWA 4J3WA 3IIOA 3RCNA 1JDDA 3W9ZA 1FFQA 2PMQA 1FHVA 3T0DA 4REQA 4C6JA 2PWGA 1XKYA 5BRQA 1ESWA 2E9LA 5GJNA 3DHPA 1WYIA 4AY8A 1LLWA 1P6WA 1UKQA 3ARWA 4PMVA 1M41A 3EWDA 1RLCL 2RJGA 1PEZA 3KACA 1XFBA 1HXJA 3DXIA 1LRNA 1X39A 1MW1A 1P48A 5FF0A 3IRSA 4K38A 5CCZA 4ZGYA 3UQAA 4GNJA 1EJVC 2PGFA 1W1B1 4I7UA 1XIJA 1G7UA 4H6EA 3HPAA 5JMUA 5DY2A 3BSGA 2ASHA 2HCVA 3W70A 4HNOA 4L72B 1JZ3A 3P3BA 5JVLA 2EBNA 1QATA 2DZPA 3I4KA 4PUKA 2WSYA 4HVXA 2QIIA 2C1HA 4XIMA 1DIKA 3RGCA 4AZHA 4KQZA 1ZB5A 3T81A 3W1QA 4WY0F 1OFQA 1Y0OA 5LIYX 3VMPA 1KFCA 4PRWA 1SPQA 4LAKA 3MCOA 1VC4A 1H5VA 1SYTA 4ICNA 2V2HA 4R85A 3DFOA 3CK5A 2RDTA 3TW6A 3AI0A 2XHYA 2ZRYA 3TC6A 3B0VC 4PUUA 8RUCA 3DGRA 1VB9A 4MKSA 5MKGA 1Q2SA 4OV4A 1QTWA 1JPIA 1MEIA 5XINA 1XV8A 5CQ1A 3EXSA 1Q6QA 1PX4A 2P76A 2O92A 1FKHA 3NZRA 1T99A 4PMUA 4O1CA 3SGZA 1GNXA 2XGBA 4TX9A 4CD4A 2ZX8A 2FZMA 3VOGA 3NPVA 2L2SA 2INEA 2FTYA 1H09A 4ZOEA 3LYEA 3BZGA 1RLDA 4MSSA 4B91A 4U5KA 5LIUX 2TODA 3WN6A 1E0VA 3GTIA 4ZB0A 2W67A 3ABSA 3PUOA 4IX0A 3QXBA 4Y8EA 3VNDA 1JVWA 1XIDA 2GK1A 3R79A 3WLRA 1TRIA 1RR2A 3UT0A 1F6YA 1S1PA 3V0SA 1WOAA 1MEWA 4NKCA 1E51A 1NMVA 2PDUA 4ZEPA 4UNKA 1LT8A 4QG9A 2WBKA 5AECA 3KWXA 4GGBA 3A13A 1TTPA 4QSHA 2REQA 4D9PA 3LV5A 4A3RA 4D1JA 1Q6FA 4LS2A 2GSEA 4HNUA 3M46A 3RRXA 2J7EA 3R8HA 5A2AA 3KOXA 3CUGA 4J7RA 3KS6A 3NEVA 2JF6A 3IHZA 3O5GA 4N9BA 4NAEA 1MQQA 2DEPA 1RY8A 1JD9A 1QWKA 4HD5A 2QJGA 3ZSTA 2WM1A 4IQDA 1K9TA 3TMLA 2AOSA 4GBDA 5CZKA 2BHZA 2MNRA 4BF8A 5LYRA 3T4WA 4KFPA 2NVDA 3GBEA 3C2FA 2AKMA 3HG5A 2OLHA 1W5NA 3RDKA 2G3JA 4FIRA 2RUDA 3W1PA 3VK5A 2OZ3A 3IKGA 4WXZA 3ABXA 3DIPA 2DZSA 4JQ1A 1B6CA 4V27A 4UUIA 5LHEA 4AAJA 1V0LA 3BV4A 4P5UA 7REQA 3DECA 2J7HA 3GUWA 4CQ9A 2WC3A 3OLIA 2QMKA 1Q13A 3I65A 3TTOA 1R3SA 2QIWA 4O18A 4C1KA 1P0EA 4L9YA 4DY1A 1BQCA 1P0BA 2CLLA 3T0TA 3E74A 2JGQA 1WDSA 3WLPA 1H51A 1C9WA 5D05A 5T8GA 2QEZA 2VCAA 3W00A 3TSBA 2ZVIA 4CU7A 7CGTA 3QMTA 1S5TA 5BOEA 4L6OA 3LQGA 5D9PA 2XVNA 3QOMA 4J3SA 1ML1A 1ODZA 3UQNA 3W76A 2E5BA 2Y5EA 3QY8A 3F2DA 1KTCA 1V0MA 1Q1CA 5T9BG 2YB4A 1V0KA 1PDZA 4L80A 3TTEA 4O54A 4JKMA 1TZZA 2FH6A 4XKMA 1OD8A 4HARA 4D6JA 1F8MA 1F76A 1Q6OA 3C0QA 4MNLA 3FXGA 3OZYA 3KADA 4YCOA 2X8RA 3VI2A 3STGA 3W72A 4UFJA 2IW0A 3SEPA 1WCGA 4WKFA 3G1FA 1J0YA 3EDFA 4C5ZA 1H41A 2JKAA 4ODMA 1T8XA 5GNZA 5DT7A 1E1FA 2OWWA 1TE6A 2IUZA 1GEHA 1XLCA 4UMBA 2CXEA 1LL7A 5I3HA 1ZP3A 3QR0A 2GWNA 2FVMA 4XTDA 3PG8A 3GNXA 3CPRA 4FIQA 2PDLA 1OCQA 4MPQA 5I24A 5DIUA 3ME3A 2WO5A 4J3UA 5JH8A 3CT7A 1QPFA 3ZVHB 1K6WA 2CETA 1IR2A 1TJPA 1MRAA 4WJEA 3QJAA 4AH7A 2IQDA 1XHGA 4GXWA 5IFTA 3ARVA 3LPGA 3PS7A 2Y61A 1RBLA 4ORMA 1FCVA 1VFOA 3WQFA 4DAFA 1HKWA 1E9YB 3TJIA 5AHEA 4X9SA 5HR7A 2OODA 1U22A 1EEPA 2ZDRA 1A49A 1Q7QA 3GXFA 1YW5A 5FL0A 2QGYA 3GXNA 4IPLA 4ENLA 3UXLA 3BAJA 1RJRA 2YBVA 1JCHB 3A22A 3W7OA 3W81A 3NYDA 1M1BA 3ICJA 1GVFA 4EPEC 1HX0A 1ZJAA 1OIFA 5MKGB 3LM3A 2I17A 2PV1A 4JDBA 3S2LA 3EEZA 2HPMA 3VE7A 3MZNA 2Y8VA 3FYPA 4KRTA 4AMCA 4EP8C 5IHSA 1R87A 3OLGA 3S1GA 5EMLA 4HTYA 3EA3A 2YSWA 4ZENA 4FA3A 4U85A 2X41A 1FHUA 1Q6DA 5DMLA 4YWIA 3W53A 1XSKA 1YXYA 1HXVA 3QGKC 2X1RA 2WMFA 4O1FA 1BRLB 4MY9A 1RBOB 3AMDA 1FWGC 5G1TA 3P61A 2YBUA 1Y8BA 4CD6A 3LPPA 4CCEA 1W5MA 2Y6ZA 1GJPA 4ODNA 2X42A 1B9BA 3KRZA 3M0KA 4PZVA 1AVAA 2XN1A 1H11A 3IKDA 4FI4A 1Z8AA 4TO8A 1W1PA 3E2VA 2Z1BA 3GXTA 3MSYA 5FESA 1QBAA 4L4LA 2FTWA 5EMUA 4QCEA 2AMXA 4MF4A 2PDYA 2HVMA 1I0DA 3ZM8A 4UTFA 5C9RA 1KB3A 3EPMA 3OBAA 1ZL1A 4ODRA 1EIXA 4NZ3A 2ISSA 2WCSA 3V0TA 2E0PA 2QCFA 3C5QA 1ZBCA 1RA0A 1AW1A 2DVUA 4JICA 4BWLA 2NX3A 5LGZA 3TVAA 2E6DA 5FJOA 2ISDA 4ZQPA 4QTGA 1ICQA 5D8ZA 2PGWA 1GUVA 1G4TA 4ICCX 1TSIA 4HHHA 4BQ3A 2FDSA 3LXBA 1KRBC 1KD0A 1J2WA 4RR4A 4H8UA 3N6QA 1WPCA 3DH7A 4W89A 1J18A 3LDVA 1M7PA 3PRDA 3G24A 2UZ9A 1OF6A 3TYDA 1MUCA 3CH0A 5HUOA 3DOPA 1GVQA 4I7WA 4ZE5A 1N82A 1DJXA 2QKFA 4O0ZA 2XSBA 1KWKA 2E77A 4PBEA 4QISA 1TO3A 3E0LA 2DZVA 3WEZA 1KBLA 1LORA 3O0FA 2YZ5A 4OBRA 1S2VA 3CUXA 1TPDA 5BZAA 1ADOA 1DP0A 2XIBA 4JTUA 1FKRA 3BGAA 3VD4A 3PNZA 3GXPA 4XD6A 5FI8A 3AS3A 4ZOCA 3S6OA 1J0HA 2WHJA 2GUYA 1AH3A 3N9SA 1D7JA 1Q6CA 4DZHA 4JTJA 5TQLA 1I4NA 1KXTA 3B8UA 2E6FA 1JZ2A 1YQ2A 4CD5A 5E0CA 5AYZA 5D9NA 3BL3A 4XSLA 1XYBA 4AZCB 5D9OA 3KAFA 4ACZA 2VVSA 5LKYA 2G0WA 3SJNA 1AQ0A 3WBEA 1DL3A 1A3HA 2YX0A 3B3DA 3TWBA 5AVHA 1LROA 1ALDA 1AMYA 1ZS2A 3PJXA 5HJLA 3TCEA 3T8QA 3G1SA 4XZWA 1YW1A 4W7WA 4H7VA 3R2GA 1BVWA 2ALDA 5GVJA 4A3HA 3D6NA 4URIA 4YVVA 3WX7A 4O15A 2JALA 3UVIA 2WW5A 4W86A 1ICSA 1BPLB 2VEKA 1JULA 4O17A 3JYMA 1S5WA 1D8WA 4JX6A 4H1ZA 4JTFA 1MW0A 4PFMA 3WO8A 4GYPA 3RJXA 3O5IA 3IWPA 2ZADA 1W3TA 3WH7A 2XIJA 2C0AA 3ZVHA 2FDMA 4LNCA 4BWLC 3HMJG 4CD7A 2OWXA 4HYRA 1JNEA 3SURA 5G2HA 4XV0A 2YCJA 3VXGA 2E5CA 3LBOA 4QDMA 2HROA 2P88A 3GC5A 4O1BA 1LM1A 4P7OA 4AD1A 3VA8A 1W1IE 4PC8A 4B16A 3CTLA 2EG7A 5CLTA 2P8BA 3RF9A 1OGSA 1KBKA 1WOBA 3R10A 1TB3A 3WUGA 3SUTA 4GBUA 3N9KA 4DWSA 2PDBA 1MZRA 3T8LA 1P6BA 3ZFHA 3W38A 1YLVA 5IBXC 2XP8A 4LV9A 3U9IA 3W83A 1GHRA 1WV2A 2QUNA 3CHCA 3MT1A 3F4WA 3SCNA 2AAAA 3L5LA 2Z24A 4GNVA 3P7YA 2WMHA 3NSMA 3S9IA 3LLDA 1V8EA 2F6KA 2CLFA 1B4KA 5I3GA 4WX2A 5A95A 1GONA 1TMHA 3CU2A 2YPIA 4PN2A 1X6UA 3S6TA 4XWUA 3CM4A 2ZRVA 1DQUA 1JGIA 8XIMA 1HGWA 3CGNA 3FOKA 3HB9A 4AEFA 2YYTA 1UC4A 2OELA 1V5XA 3VNYA 2UV8G 2NUYA 5F2GA 1K3UA 1TMLA 4FNRA 5D2VA 5DO8A 3F4NA 1XYLA 2VHLA 1DJIA 4XZ9A 3UWWA 4PEKA 1YNQA 1CIUA 1JFHA 1YEYA 3O6YX 2WMGA 5HPOA 2HRWA 3GKFA 1ISXA 1N55A 3P5ZA 1QHOA 4FNUA 4LYRA 5I02A 1GPFA 5G1YA 4HYWA 5LIXX 4IIEA 3A64A 2A3LA 4HU0A 5HNUA 5AZ1A 2JKPA 2HQAA 1H3GA 3CC1A 1SZRA 2GGGA 1MVYA 1NSJA 2KZHA 5CBJA 1SZNA 3WLHA 1TELA 1TCDA 1RAKA 1DVJA 1Q66A 3VC5A 2B7OA 1YTEA 4RE2A 5CH9A 4ZXLA 2V3GA 4DIAA 2I14A 4WJ8A 4GI4A 2CLMA 2YR1A 2CKRA 2C19A 2VUYA 2YLAA 2JKEA 1ZAJA 5HBFA 1VEPA 1DHPA 1XQLA 3N25A 2QJNA 2PDXA 1E40A 1OABA 4ORIA 1BL4A 1VD6A 4JTEA 3TFCA 2C18A 1UMLA 3WD4A 4EVZA 3ANYA 4GINA 1E71M 3PNUA 1MDLA 1PKYA 2Z28A 1HJXA 4M81A 4ZL1A 5J6EA 2Z2AA 4Z42C 4OT7A 1ZAHA 3ANVA 2JZVA 4HGXA 3L0GA 3Q58A 1T5AA 2V3FA 4AD4A 4LAVA 2WNWA 1W3JA 2NX9A 2JQXA 3G1XA 2DT3A 3DERA 3KL0A 1JYWA 3BLIA 4AWTA 3VVGA 3AZRA 1OADA 3GR8A 4GZ7A 1OZQA 3CNYA 3SRHA 4YYFA 1V51A 4K1WA 3AC0A 4IQ2A 4DPPA 1PZ3A 1W3LA 3WFZA 5BMWA 2WLYA 1Z44A 4HCLA 7TIMA 1W0MA 4KR0B 4W87A 2WJZA 1XYMA 1OK6A 2FAPA 2VFEA 2ZFAA 2W61A 3LCWA 4CQBA 5I3DA 5CKSA 2BGQA 2GOKA 3M1ZA 1EX1A 1PWMA 1W9PA 2WJDA 3FDKA 4PMYA 3RJYA 1SMAA 3AS2A 4KERA 1X1ZA 1Z41A 3WH8A 3VIIA 3ECQA 2XP4A 1P1MA 4IIHA 3ORWA 5KITA 1W32A 2O56A 3STFA 3TR9A 1QPQA 4JN6A 4LS1A 1HJSA 2W79A 3GBDA 3POCA 4EAYA 3T07A 3AZTA 5BWAA 2XTKA 3R8GA 3M5XA 4JQ3A 1J6YA 4N02A 3RK8A 4LS0A 1H1YA 1FVPA 2WJEA 2YJQA 1M7XA 3NQBA 4J28A 4C65A 1OX4A 2DIJA 2Y0FA 4NASA 1WDRA 2NSXA 3UP8A 4DO4A 4DUVA 3RN6A 4NNCA 3P62A 1X1NA 4ZSTA 2PURA 3PZMA 3CYJA 5LXXA 2WMIA 3GNNA 1I60A 3LV6A 3PF3A 1MZHA 1TJRA 2BY0A 1N8WA 4QQUA 2OVLA 2WLZA 5D30A 5C2XA 1VBGA 5C0QA 4S3JA 1PKMA 4KGJA 3FJ4A 2VR5A 4IM4A 5D32A 1HGYA 1AODA 3BQ6A 3OO2A 3O5EA 4KCTA 1A5OC 1I2OA 3QKZA 1UASA 3GR4A 5SWUA 4LTSA 2J7BA 3CH9A 4GVIA 1D7FA 2RUCA 3MI6A 3R7MA 1J6OA 1QK0A 3VD3A 3OBKA 3SN4A 4QRNA 2EKGA 1XH2A 2I9UA 3BANA 3W86A 5K9XA 1J4HA 4U5IA 1FH7A 4U2ZA 3PUDA 3KW3A 3LEPA 4L1WA 5HWNA 4KEUA 1JZ5A 1MEHA 4I6VA 4CLMA 4LEQA 2H9AA 5BCAA 2G5WA 1EJTC 4DJEC 4C7DA 1VZWA 2X2GA 1R2RA 4UTHA 4WSKA 4G2DA 1EJRC 4P2VA 3W2KA 3TZNA 3KCEA 1TV4A 4GY0A 1B3YA 1GVOA 3GHSA 5K9CA 1PSCA 2VX7A 1VFLA 1XIFA 1R3VA 1UOZA 1M53A 1R30A 3KS5A 2POZA 4IL0A 4M5PA 3SUUA 5C71A 4MUZA 5CC7A 3THDA 1UR8A 4JYEA 3E12A 5CG7A 3LCIA 3THCA 2H6RA 2V68A 5LA1A 7PTDA 3B8VA 2HV5A 7ENLA 2QF8A 1R46A 1X7FA 5CGQA 5EMMA 3S3GA 4UFHA 2J9ZA 4ZO7A 1DWHM 1TPEA 3NWRA 1PKLA 4TXEA 2ZX5A 4UTWA 2FGZA 4Q6JA 2FZDA 3AISA 2I5IA 1FXPA 1TKKA 3A9IA 1HF6A 1ENUA 2WQPA 1U5VA 4E4FA 2WZIA 2Q3OA 1W37A 2REQB 1QPOA 2OX1A 1EOKA 1HQTA 4M51A 2VFGA 1OFEA 2C15A 1EDTA 1NQ6A 1RK5A 4X60A 4JEQA 1RQHA 3VIGA 4NAEB 3ZIZA 1TCMA 1TIWA 4LAWA 3QQWA 4G2PA 2IKIA 3W24A 2VX6A 2DT2A 4H9YA 3CGTA 1EA0A 3HGOA 3AQUA 4AB4A 4E2VA 1KM6A 3KEHA 3UEQA 3TJXA 4Z1BA 3TSDA 3HU7A 3WNPA 1X6LA 4M1BA 4NNBA 4L1GA 5EKYA 2ZRWA 3AHXA 1JL8A 1OYCA 3AYRA 3WH5A 2CBVA 3PB0A 3LHZA 2OO0A 4R7JA 5AFDA 5DRIA 3IGSA 1LTDA 5JU6A 1QVBA 4XZMX 4DWSD 3AIEA 1PUDA 3TNBA 3T2PA 2Q8LA 5EYWA 3MUCA 3NRKA 1CXEA 1XRTA 3M5VA 4DM2A 1WAUA 4HSHA 4JS3A 1E44A 2TRSA 2CFFA 1XC6A 1NEYA 2GVYA 4MDOA 3DFNA 4C6OA 3UI6A 5CZSA 1TRDA 4KETA 5FIPA 2EAWA 3QV7A 1A5AA 4GOAA 2INFA 3W22A 1FWEC 1MW2A 2BHYA 2QS8A 3DBPA 3GY1A 3CMJA 2BV9A 3UXDA 3SADA 5ABFB 2ZR4A 2XN0A 1ADDA 1D3CA 3SRFA 2V6AA 3KRBA 1VFTA 2FH8A 4UNIA 3IIXA 5BU6A 1WQ5A 3UA3A 2I57A 1J8VA 1LQ2A 1CYGA 3W7NA 2CIPA 2B7QA 4ZS6A 2YXGA 1SJBA 1O94A 3IUHA 3LI0A 1U79A 3VCNA 4AWEA 3H2OA 3WQPA 2FZ8A 1DIDA 3K30A 1GJWA 4NZJA 4W9PA 3CYVA 3MKKA 1K7XA 4ZQMA 3W74A 4JL2A 5D2YA 4NZ5A 1EB3A 2PCQA 5JIPA 3AIBA 3N2OA 1FY6A 5H8UA 1F9CA 4UZUA 2XG9A 3WMSA 3KCJA 1FDJA 3MMWA 1TJ1A 1LF1A 1HT6A 5M1TA 4G5DA 1OFPA 3WMCA 3DG7A 4KW2A 4XUGA 3VOFA 2E8ZA 4GO9A 3STEA 2Z1XA 1F05A 5A6LA 1PPIA 4AEEA 3WH6A 4A8LA 5DMYA 1FWJC 3QZAA 4JYDA 1FWRA 3AUJA 2OO6A 1J79A 4QE5A 1L2QA 3KBVA 1U1JA 4UFIA 5K4XA 3WK3A 5A8MA 3H6OA 3QVQA 3OIXA 5CEWA 3W37A 1YE6A 2IPGA 1SSGA 3GG7A 4N2YA 4F3HA 2ISVA 4JYSA 4JBRA 4L4MA 4PMXA 4GXPA 2OEMA 3CASA 4RNHA 5KTLA 2E3ZA 5E70A 2BY2A 3QV9A 3L66A 3BZJA 3IK8A 3CHDA 3ALGA 2JFEX 3W1TA 1TWZA 2W4XA 4WDXA 4RKAA 3WBAA 4IMGA 3OW1A 2XINA 3JRKA 5AC5A 2OYLA 4H00A 3VYLA 1UMYA 2X30A 1B5TA 4FAMA 5I3JA 1E9LA 3P84A 1D3HA 5C7HA 4HNCA 4YU1A 2XM2A 3CGMA 4GK8A 1TJ2A 1KCZA 2VEGA 3EX4A 4KMQA 4K36A 4MWAB 1W1YA 2IXVA 1XPGA 1WDWA 4IIDA 3N9RA 1IEXA 1ZLPA 1GHSA 3WNMA 3V3WA 4JTSA 4LSBA 4UMCA 1BD0A 4UCGA 1M04A 4QS6A 5A94A 4ZO6A 1EDGA 3N3TA 5DCBA 5T91A 4ZQRA 3IJ6A 5CJMA 3EWXA 3E0FA 3TQPA 1FXQA 2CCRA 2B81A 3CZEA 1PE1A 4ERAA 3MB9A 3DFYA 2A3CA 3Q4DA 4S1FA 1NTHA 3E0WA 2ZQSA 4RZ5A 5EB8A 3UF9A 2A7PA 1FJDA 1Q7ZA 3UPWA 1UPMB 4EWND 3AIVA 1EP2A 2E1DA 1UR9A 3GVGA 3D3AA 2PD5A 1M6JA 1LOLA 3MO4A 4HOXA 1XLDA 4XBJA 2PDIA 2GJXB 4IG2B 3ITOA 5IHRA 3ZZ1A 1E70M 4WHBA 3NL2A 3PZOA 4QDPA 2PDMA 4F4RA 3H2EA 4TX6A 2GL5A 1CXFA 2R1LA 2IPJA 4GX9A 3H54A 3GXMA 4AFYA 4WDTA 3O6DA 4M19A 1JUBA 3N1AA 3TYZA 4JYFA 1GWJA 4AVOA 4ZODA 2A7NA 3BOFA 1B9ZA 4ZQNA 4EF9A 2EHHA 1JZ6A 3S6DA 3BAKA 4GUGA 2F6XA 1TR1A 4LUSA 2QVNA 4WIWA 1CECA 4O12A 2DUAA 1UWUA 5G2WA 4PCPA 3UW6A 3ISIX 1O66A 4RW3A 4J2MA 4RJEA 1D6OA 5FACA 5KZ6A 2V69A 3RCMA 3O06A 3N04A 4XSMA 2QDGA 4O4VA 5B7YA 1G4SA 1HW6A 2O9PA 5ABTA 1N1AA 3PB2A 1JD7A 4L61A 3UY8A 4HPJA 4PSPA 3APGA 3W1UA 1I2NA 3LS9A 4GFIA 5HUAA 2QV5A 2E28A 3NIYA 1FWSA 1Q5MA 1YMYA 3QR1A 1J11A 3URQA 1PL9A 1J12A 1C7SA 4NJJA 3MSRA 4XD4A 4MGGA 1E55A 2A79A 1SMDA 4YCPA 3QQ0A 4I6KA 4TNSA 3QMRA 4U2YA 2GDUA 3IJQA 3K1DA 3MZ2A 1IYXA 2DUXA 2GWGA 2N87A 4YYCA 3P80A 4P61A 4O19A 5L6UA 1PDYA 3U7VA 5AC4A 4ML4A 4NZCA 2GZXA 2PU1A 3GDLA 4NL1A 2QUMA 3G1VA 1H4PA 1I0BA 3UR8A 3HG2A 5HKGA 4PBFA 3VKBA 3EKGA 1YE4A 2A1YA 4LAZA 3O6AA 4AXKA 4WQ6A 1AW5A 2P0OA 5FJUA 1TV3A 3KTCA 4NIRA 4DO5A 3IPWA 4RNFA 4IP5A 2VD8A 4DYKA 3SN0A 3W4RA 3KP0A 1XH0A 4YL2A 3BE7A 3QZEA 5J5RA 3UGVA 4UOZA 1S2TA 1F73A 2C91A 2PGEA 4Z1DA 3M0HA 4GISA 4AIEA 3HQOA 5DCEA 2VT0A 2QQ6A 4GWEA 2VGBA 1W9DM 2QW5A 1JNDA 3M07A 4JIHA 3WD0A 2J27A 3G8RA 1EP1A 2JIEA 2VN1A 2ZUUA 1JCTA 4E3TA 4LUTB 1PINA 3ITXA 3IVUA 5HMEA 3KHJA 3BOLA 1EC9A 2ICSA 4QR6A 1FWDC 1OG0A 3GH7A 3M16A 4AQLA 4L4OA 5IFPA 1J0IA 8XIAA 4RE3A 3BARA 4GH3A 1OZMA 4BF7A 1HIZA 5JBFA 1XLHA 2WZEA 1XYFA 2WJFA 3NGFA 2RH9A 1UWQA 3G0SA 3L5MA 3DDMA 5IOBA 2NX1A 4HA0A 3GG1A 4BZYA 2BSLA 1VBUA 2QGHA 1MNSA 3QPYA 1F5ZA 2X2YA 4FLRA 5CSRA 3H4GA 4O28A 4DRNA 3AXMA 3L5AA 2JBMA 1BG4A 3U5YA 2Q5AA 3S4TA 4F79A 4FALA 1PIFA 1FWCC 2NQ5A 3MDWA 3AHTA 3FVMA 1XIEA 5TNVA 1TTIA 1DWAM 3GTXA 4MIMA 5CGMA 3VE9A 3VD7A 2CZEA 1W9VA 3WLMA 1TWSA 5HQMA 2M08A 2OCZA 1Q2RA 2O9RA 1DJYA 9XIAA 3NM1A 4L56A 3F4DA 2CZDA 4GYFA 1FHDA 2CXGA 2XIOA 1VBHA 1OC5A 4DJFA 2XJ7A 3EA1A 2IKJA 5LSMA 1LL6A 4HZMA 4JXCA 1V6VA 4OHQA 2PP1A 3S9ZA 3OHMB 1KGUA 3VIPA 5HJYA 1L6WA 4R27A 2Z2BA 4RV3A 3CZKA 3GX9A 3RM4A 1IHIA 3RCYA 4JGDA 2CHOA 1TQJA 2ABBA 2PTWA 1OB0A 4PCFA 4J4OA 1PCKA 3CAQA 3M44A 4RNJA 4DUWA 2PPPA 1QZ2A 1D8CA 4KWVA 4R88A 1NIUA 4LYQA 4QFUA 3SM0A 5CG0A 4FLOA 2GLKA 3DYPA 4HIBA 4L65A 2Q09A 4XZBA 2RDUA 3WK0A 3C2RA 1ONRA 3WQ5A 1T6MA 5LNUA 1TYGA 1LBMA 3MC5A 2CESA 1NDWA 1CENA 1J9YA 3GDTA 2VZTA 3C2EA 2J7FA 5G4WA 4G7EB 4WEVX 3GIPA 4K7YA 4DRHA 2C16A 1CGYA 1SZGA 3GTNA 1VCFA 1UUQA 2MPHA 1CPUA 1O1ZA 3M43A 4H6QA 4JFTA 2PCEA 4TU1A 4PUWA 1C8XA 3S5NA 4NF7A 4A8NA 3V4BA 3E96A 2XP5A 4HN8A 1JXKA 3V5OA 4JD4A 4CQCA 4X0NA 3RX4A 3WEOA 6TIMA 3O5JA 1AJ2A 2VC6A 3E5BA 4PMOA 3IJ8A 3BMVA 2ZA3A 1Q65A 3T9PA 1F6PA 5I79A 4JNMA 1ZK6A 4G50A 3LX9A 2ZZ3A 1QUMA 4JTIA 2QPSA 3MMTA 5B80A 3NSNA 1VENA 1IEQA 5B7ZA 1WBHA 5FEPA 5LZLA 1IGSA 2D2JA 3H12A 5HOSA 3B8SA 3EYPA 4HJWA 3VUSA 4MZ1A 5FD0A 1EX5A 4MKNA 1EC7A 2CYGA 5HDRA 3A3WA 3MO7A 3NQMA 1XLFA 2V63A 2ABAA 3TXVA 1UWIA 3UI4A 5BNKA 4GLEA 5I00A 3O5KA 3EXRA 1BWLA 4V1YA 3NTPA 3W7JA 4HPNA 4KCVA 2GUUA 4PB3A 1BXNA 2F21A 1KA9F 2GSJA 1JCMP 4UQBA 2VQTA 2WC7A 1EYEA 3MA8A 5AYXA 5I2UA 3BW2A 3OGSA 1E6PA 2ZZ2A 1UP2A 3P82A 5F1UA 3KABA 1Q85A 4WR3A 4JX4A 2X16A 1D7KA 2PDQA 2V5KA 2VFIA 4MDPA 2ZZ5A 5AC8A 3EOSA 2YDAA 4GPNA 4OV9A 4J3VA 3N6HA 4BQ2A 4WDWA 1VFSA 3TOYA 1EO7A 3VDHA 1CX9A 4L3NA 1MDRA 2QCMA 1GT8A 4B3LA 1GYLA 2J7DA 2PUZA 1RHCA 4GZJA 5ABFA 4Y9NA 3GLCA 4Z1YA 4JIIX 1PV8A 3H2NA 1NDVA 4UQCA 3FSUA 3GYEA 3CIVA 4GVHA 4B2DA 1QAPA 3EX3A 3EDKA 4KS0A 2FMNA 4E0CA 4BFAA 1YPFA 2FGLA 2I56A 3ES8A 4JTRA 2WYSA 3ITYA 2XPBA 3VNKA 3FIGA 4YWSA 2FLIA 4UTLA 5DT5A 5G4HC 5U4NA 3VINA 1JZ8A 2MLXA 4DWSC 2ZC1A 4MWAA 3NL3A 1CGWA 4QE1A 4XO7A 1FCBA 1J0ZA 3DEQA 4O13A 2DP3A 4XZLX 4CUCA 3PZUA 1BG9A 1HO1A 2XVGA 1W9XA 4DI9A 3IS4A 4FR6A 2J4GA 3LTSA 1VYPX 1NELA 2J6VA 3A5VA 3B7XA 1VPYA 1H7OA 3CAVA 4LPCA 4WD0A 1EEXA 4NJKA 2FMOA 2ACQA 2IXUA 4LCRA 4XKYA 7TAAA 3URBA 5LIWX 1XF0A 4M6PA 4QIBA 3URAA 1K9FA 1AUSL 2WNNA 1QI2A 4RZ4A 1TPFA 4LAYA 5E0FA 3APTA 1MI3A 4FNQA 3NVDA 3GQYA 2VFHA 4IP7A 2FZ9A 2CLKA 1G0CA 3IUDA 4QDWA 3UWZA 5LNRA 5A6TC 3VKCA 3MI3A 3G8EA 1OCBA 1A5KC 1I2QA 1PYMA 1SFJA 3IV3A 4GIEA 3SI9A 2NXGA 3TAKA 3L4UA 2J78A 4UQEA 3LG3A 2V5BA 3C6CA 1BHGA 1VRDA 2OMAA 2DUZA 3UF8A 3WDJA 3D46A 4MHBA 4HMEA 4HKPA 3PR2A 3HPXA 3W7DA 4XAGA 3IARA 1JGMA 1DXFA 5BWFA 4S3KA 2CERA 5CPOA 2A0NA 3NQ2A 2I7GA 2MLYA 2KGJA 1Q8JA 3M7SA 3PPFA 3RHGA 3SUSA 2D9FA 3N15A 4PYSA 1V02E 3SCOA 3B0XA 1P5QA 1O12A 2Z1SA 3FYOA 4JTAA 3PZVA 2ETNA 2GFTA 1IT7A 3GS6A 4PTWA 1GQKA 4EACA 4LT9A 3DFQA 2NUXA 1TJ0A 2YDQA 4G8TA 5HULA 3H2MA 3UZWA 2Y7EA 1DTNA 4IICA 1KKOA 4JFWA 2V9DA 4JTHA 4JQ2A 2ZRZA 4UTTC 2ZOXA 3KBWA 3PSWA 1G69A 4N6FA 1UZ1A 4S3EA 4MJ2A 1QJWA 3M47A 1W3KA 2ACRA 3H4WA 3RGTA 2VP8A 2ACUA 2D2GA 1S5MA 1KXVA 3PANA 2PRHA 1HP5A 3LRLA 2PDPA 1LRQA 1EP3A 2E67A 4CD8A 1GOXA 1JR1A 4ZMGA 5MHBA 3TE9A 4PTMA 4OJYA 2DSUA 2GJXA 4Z0SA 1UA7A 4I3GA 4A2SA 4RDWA 4M56A 2GJLA 3EPOA 1V3MA 3QR3A 1VHNA 1RCOB 4S3GA 4LVAA 2YDSA 3NPUA 1LQ0A 1DPMA 1X96A 4BS0A 4GGQA 4J1OA 1ZFJA 5LNVA 5HWCA 2FJKA 2AQOA 2OXNA 1FDZA 4Y8FA 1SJDA 3F1QA 2FFIA 2Y4SA 1T96A 4BQ4A 5I06A 1VRXA 1VPXA 3U57A 3UXIA 1JZ7A 4YNGA 2OYKA 1U30A 3W29A 4Y6GA 4O2TA 3O1NA 5KZEA 3ERPA 1L6FA 4XO6A 1Z69A 4IQCA 4JHMA 2XFRA 1VEMA 3R0KA 1A4MA 1JRCA 5C6MA 2YFOA 3BXWA 3QMSA 4L1XA 1AK5A 1CGUA 2AWGA 4PRTA 4O8RA 4BA0A 1GG0A 4LUIA 2OT0A 4YVPA 1LBFA 4DZ2A 3SCVA 4KWUA 2VEMA 4HA3A 4WSJA 2HJPA 4EF8A 2HNEA 3CV1A 3AIWA 2E1WA 3GIYA 5A6BD 3M0VA 2PODA 5HMFA 1JF5A 4FNPA 3WLTA 2A3AA 3VZYA 4FN2A 1UJQA 3S2MA 3R0UA 4IFRA 1UD3A 2P1FA 1E1EA 2Z2UA 4UR9A 4Q3MA 3HV8A 3TUUA 3AUOA 3W1MA 4EKJA 1I9CB 1QOQA 4B15A 3PBVA 4TW7A 2TSYA 2XIQA 4FMVA 4PRRA 1KRCC 5K4ZA 2XH0A 1FWAC 2AMGA 2J24A 2Y8UA 3UYIA 3D3FA 4DJFC 2ZXDA 1GZGA 2Z4GA 2FZNA 4DWDA 5DIVA 3WUFA 4XD3A 3W73A 2XIMA 3LGEA 3MCMA 1KGWA 1SJAA 4O11A 4O10A 4XUYA 3MCNA 3B9NA 1XIBA 3OZMA 2DIKA 1W1ZA 1G67A 4XAPA 5D2XA 1KR0A 3G0UA 3WZ0E 1QNQA 2IMRA 4YPJA 4CVUA 3R12A 2OQHA 4AX7A 3VGDA 1BEUA 1JPHA 2YCEA 4DX3A 2UWFA 5AZ0A 4WKAA 4H9MA 3WIJA 3NQCA 3TEVA 4C6KA 4QEHA 4R53A 4RPQA 4N9CA 3W6YA 4YMZA 4W88A 4HPGA 4EXAA 3OOBA 4REQB 1J0JA 1ZCNA 1FA2A 4Q8TA 4ODQA 4HOZA 1GVIA 3KTSA 4U33A 3FK4A 1E0XA 4XVDA 3BG3A 2YA0A 3W71A 1GQNA 2WZTA 2J6XA 3TQKA 2QCLA 3VX0A 1DJNA 3EA2A 1MRQA 1W3HA 5DELA 4KPLA 2IF4A 1OGGA 2OB3A 3AXHA 1OCJA 4YTUA 4UTIA 1IXNA 2NVAA 2ITKA 4UTUA 4MVAA 2J8FA 1AJ0A 4ERGA 2F9RA 1H7XA 3AMKA 1W6TA 4QLLA 3SGUA 5LXEA 4U28A 1BGGA 1QHPA 4M82A 2DORA 3C61A 3UG3A 1EUNA 2WHKA 2PDGA 3EWWA 1V3KA 1LL4A 1KC7A 1U1HA 3W7PA 1IV8A 4GJJA 3BLOA 1XJBA 3ARZA 2Z1KA 5K2ZA 1EQ3A 2V82A 4NX5A 1YYAA 2VO5A 1RVGA 3PBGA 4O57A 2XISA 3IACA 3V0UA 1QNVA 1UR0A 4TMCA 3OGRA 3I6RA 3O5LA 2R1NA 3EOOA 4PUNA 4UOQA 3UD6A 3N6JA 2FHBA 3W25A 4DRKA 4CNOA 5ABHA 4Q7BA 2BGSA 1XDJA 5CPLA 3QHMA 2PWDA 4H6KA 4WCJA 1EOMA 4C1LA 4GY1A 4HT3A 1FH8A 3AXKA 5TD4A 1DXIA 4LRTA 1SO4A 4MGVA 1B31A 5FEWA 4ATLA 5CZ0A 3XISA 3EGJA 4C6EA 4LCSA 2G96A 1XR2A 1AG1O 4GIRA 3MV11 1ME8A 1QOXA 1GTEA 1JIBA 4YTQA 3B0UX 1QOPA 3I10A 5K7JA 4HZ6A 2VXNA 2YCIX 1UJPA 1ZPTA 2VDHA 3LCFA 2P5NA 3O5OA 3P0WA 1SW0A 3G1YA 4GJIA 2ZX9A 3EEGA 3EMZA 5A8NA 3N2TA 1H5YA 4ZO8A 3C56A 3MY9A 4M80A 4KKXA 4FF5A 3LRKA 2CNCA 2IQTA 4FLQA 4HHMA 2VDGA 2J13A 3LRMA 3QSRA 1ONXA 1TV7A 2BLEA 3K8LA 3DU0A 3GH5A 1YDOA 4ZB5A 4WVXA 1EFZA 4D6CA 3TJ4A 3I3BA 4JZ5A 4HB7A 2HVOA 3CV6A 4H4IA 1A5LC 3WJXA 3EWUA 3A9BA 4FX8A 3CQ0A 1ROTA 1P7TA 4GZIA 4Q8QA 1ZP4A 3BG9A 1GOQA 4Q4KA 3VO0A 2QT3A 4GFSA 4AXNA 5HW6A 3GFZA 3LTYA 1EH9A 4PH6A 5M17A 4OECA 4MM1A 2QDDA 3MI2A 4G9PA 1TPWA 1US2A 3QPZA 1MSSA 1EL3A 2QR6A 4HSOA 2XFWA 4YTSA 1H7WA 3CAWA 4KFNA 2BX7A 1LLOA 1BLIA 2OQLA 1V3JA 4HNVA 1B90A 4JTQA 3VDGA 4IPIA 3E6EA 3GSMA 5K3VA 3E02A 2QJMA 1XI3A 3DC0A 3SFKA 1KCXA 3UZXA 2VC9A 5HQEA 3UZ5A 1K4HA 2CU0A 1P7TB 2HK1A 3FDGA 2YW3A 2AKZA 3GYCA 3DHUA 1OQFA 1QW9A 2E6AA 2R9RA 3NQVA 2XP6A 2ZXQA 4PFHA 2PTYA 4NSBA 1MWOA 2XGIA 1EPXA 2ZICA 1JG9A 4BI6A 2I5QA 4YIWA 3EWZA 2GQ3A 1XYAA 1GEQA 2BY1A 4MNJA 1UHVA 2J74A 2P4VA 1Y0EA 1G01A 5LHFA 2QUUA 3PN8A 3SR7A 2BOEX 3M6YA 5I6SA 4I90A 3BOXA 4CNUA 3IEBA 1EKOA 3AJ7A 2CW6A 1W31A 2NLYA 1PZ2A 4Y7EA 3IJDA 3VNIA 3O5MA 1EO5A 1JI1A 4UFLA 3B05A 3F2BA 4BEUA 1W1VA 3RG6A 3GG0A 2DSZA 1JPKA 4E2OA 2P3EA 2CWXA 1O6IA 2A7RA 5KINA 3Q45A 2AL1A 4QX4A 4XX6A 2Y5SA 3EDDA 1OBAA 3UPBA 1KT0A 1UD6A 2POTA 3A4AA 1CBGA 3S5YA 1PS9A 2G41A 2DSKA 2ZZ6A 3U8GA 3OIHA 1BYDA 3TTQA 2VMFA 4HCHA 3GHUA 2OTDA 1JF6A 5G2IA 4UC5A 1FUYA 3LD5A 4NNRA 1QNSA 1NM9A 2H8ZA 3K2GA 3VKKA 4M0XA 3A3HA 2DSWA 1R9XA 2Q6ZA 3UCDA 3V5FA 1SZFA 3VGEA 2C6QA 4E6MA 4J3XA 3U0HA 3ES7A 1UUOA 3H7VA 9CGTA 1NDYA 1HO4A 1BXBA 3RLUA 3IGXA 2FJUB 3RIKA 5HMSA 1NFBA 3GTFA 4PB5A 3EAUA 4LUJA 3UJRA 1NVMA 4KEMA 3VM7A 1IIHA 4HNNA 3FV9A 4QE4A 4QXIA 4ZPWR 3N4AA 3QH2A 1AD4A 4MZ8A 4E4PA 4EOUA 5RUBA 2M2AA 1TV8A 4KT2A 3FCPA 4JQ4A 3Q2DA 1XLKA 2VENA 1MFVA 1XP3A 1GJUA 4C90A 3IGUA 3H23A 4TW6A 1J5SA 2OWCA 2RDWA 3L68A 3R11A 1HZYA 2X40A 3G18A 4US5D 4CNTA 1RUSA 4XZIA 4DBEA 1TVNA 3L4XA 1HUVA 3MWCA 6REQA 1XH1A 4RV8A