1WB0A

Specificity and affinity of natural product cyclopentapeptide inhibitor argifin against human chitinase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
364
structure length
364
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity and Affinity of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human and Bacterial Chitinases
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CHITOTRIOSIDASE 1
total genus 128
structure length 364
sequence length 364
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2004-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF01607 CBM_14 Chitin binding Peritrophin-A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1wb0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1wb0A01
1EQPA 1KCKA 3L4XA 3BAXA 3MO4A 3WDPP 1ECEA 3WNLA 4B9YA 2CETA 1V6UA 1LL4A 3VDBA 5FIPA 2WK2A 1R87A 1E6ZA 4P7OA 4PMOA 1WPCA 5CXPA 3ARQA 1HJUA 2V3DA 1C90A 5GQBA 2EPMX 3WDQA 4D6JA 1OIFA 2CHOA 3D5HA 1WB0A 5EB8A 3K46A 1ISYA 1KXHA 1EIBA 4GKLA 2YLAA 4D1JA 1CGYA 4BZYA 1ZBWA 1C7SA 3DC0A 1V3MA 2ZOXA 4QFUA 4C7DA 5F7UA 2J7FA 1W1VA 2WVVA 4UQBA 3MV01 3OLGA 3QOKA 4HMCA 5E09A 4JZ5A 1HJQA 3TP4A 1WDQA 3K8MA 1BGGA 2UY3A 1QI0A 1U2YA 4LXFA 4CVWA 1BSIA 1OB0A 4AD2A 2CBJA 2WB5A 3W25A 1E40A 4EKJA 5IFTA 5IHSA 3AS3A 1DWHM 2ESCA 3EDKA 1ZJBA 2VRQA 2YL5A 1E56A 4UQCA 1W3KA 1E71M 3ZIZA 3BAJA 1CXEA 3KWXA 1PBGA 4M56A 4CD5A 1N82A 3CTTA 2J8FA 3AIEA 1LWHA 2VCBA 3AS0A 3CO4A 4W93A 2J7EA 4B9ZA 3AXIA 3L4TA 3AYRA 1VRXA 1UQZA 2BS9A 3WH8A 2C7FA 1JZ7A 4AZCA 3WEZA 4DWSC 1M03A 3VGGA 2PWHA 1WDSA 3N17A 3W29A 3WD1A 2OSXA 2WVUA 1VFOA 3WQ4A 3CUGA 4UQEA 2UWFA 4D6DA 1BPLB 4J3XA 5GPRA 2WXDM 2ZUWA 3AJ7A 2Y8VA 2CERA 3QOMA 4XZBA 5I79A 4X9YA 1HJVA 1UWQA 1PX4A 1G01A 3UERA 1WZAA 2J4GA 4ATLA 3WD3A 2YA2A 2IUZA 1J18A 4DUWA 1BVZA 5DF0A 2E8YA 4BQ4A 3ZO9A 2O9TA 4E8CA 3I3DA 3BGAA 2XYLA 3PZQA 1OWQA 1TE1A 4XUYA 1KQYA 3UG5A 3CMGA 3GXFA 2PWEA 4PMRA 1VEOA 2VMFA 4ZXLA 3WDIA 3POCA 3T2OA 3FW6A 3VKKA 2YIHA 1W91A 3AHZA 2CXGA 2J7CA 3WN6A 2YKKA 1OCQA 4OIFA 1E4LA 2HISA 1W1PA 3WQ5A 1BYDA 2W62A 3RIKA 2BHYA 1OGGA 3CUIA 4PYSA 4B16A 2XVGA 4LPCA 1K6AA 4NRSA 4OUEA 3RM4A 5ECUA 3U7VA 4UFJA 1QHZA 4CU7A 3U5UA 2J7DA 3N04A 3CPUA 3M7SA 4PCTA 2X1IA 2CEQA 3AHVA 1JD7A 3UETA 5A6MA 1EO5A 2TAAA 3CIVA 1H0GA 2W63A 1GOQA 3O9NA 5DEZA 3WH7A 1WKYA 3HU7A 4FLOA 3WD0A 3WH9A 1OSEA 2V3GA 1QNQA 4NZCA 4OBSA 3U7BA 3AROA 3WNNA 3CBWA 1E5NA 2D24A 1E70M 2JEQA 6A3HA 4F8XA 4A3HA 1V0MA 2PWDA 3F5JA 2GVYA 2VZTA 4CN1A 4JCLA 1ISVA 2VJXA 4AIUA 3IJ9A 3WUFA 5TD4A 2OWCA 3GNOA 2WLYA 3N12A 4UFLA 3OGVA 4LYRA 3WUBA 2ZUUA 1UQYA 3L4WA 5BXSA 5BCAA 2D20A 2BY3A 3TTYA 1E1FA 2WCSA 2W4XA 5CG0A 4CD8A 1UH4A 1JDDA 2O9PA 1Q6CA 4TX6A 4YN5A 4CN6A 4M82A 1ISXA 2BXZA 4DWSA 3AS2A 4GO8A 4C7GA 4BCEA 4TXEA 4AEEA 4GI8A 3W0KA 4IPLA 3CMJA 3BAIA 3DYOA 4HMDA 3RDKA 1BYBA 4D71A 2VO5A 1TUXA 3WBEA 1C92A 1O6IA 1CIUA 3VM7A 1V6VA 3DYPA 4ATWA 1CENA 4PMQA 2JF7A 4PTMA 1TZ7A 3ZJKA 1B0IA 2PWGA 3IK2A 3K4AA 3VNZA 4OJYA 1BFNA 3VU2A 1JZ8A 1Q6GA 2J62A 3KL5A 1JYXA 2CIPA 4J28A 5FD0A 1P6WA 3WY1A 3ALGA 2YOCA 1UR2A 1UD5A 2YLLA 2BV9A 4AIEA 4NF7A 5I2UA 3EYPA 4CCDA 3W53A 4DUVA 3AHYA 5ABFB 2X2YA 1W3HA 2YBUA 1E6QM 1HJWA 4GXPA 3WL0A 5CGMA 5GNYA 5CJ5A 2V3EA 1R85A 1QNRA 4PMZA 4MDOA 1MFVA 2WW5A 2ZUMA 1EHAA 3GYCA 4URIA 3B9DA 4U31A 5DFAA 4CU6A 2X0YA 3ZT6A 3HN3A 2G3NA 4AC1X 3AICA 1HVXA 4XZWA 4BQ3A 1W9DM 1TA3B 1CGXA 1V0NA 2JE8A 4WKFA 1PX8A 3WQVA 1B30A 1J11A 1HL9A 1VF8A 3NUKA 4PTXA 4CD4A 4DM2A 1D2KA 1K9EA 2BVTA 5CLWA 3WD2A 4X0VA 4PMVA 3WH5A 1ZB5A 4Q22A 1KWGA 3N9KA 1TG7A 2WWDA 4MB3A 3APGA 1M53A 1JD9A 4D6HA 1HJSA 2XFRA 4OKDA 1JAEA 4MB1A 3VIKA 1SFSA 1ZS2A 1HKKA 4QCEA 4D72A 1KQZA 3ARYA 4HZ6A 1DP0A 2ZE0A 1E4MM 3VIMA 5DT7A 1V3IA 1GOOA 4F79A 4IISA 4H8VA 2ZUTA 1JZ4A 4JIEA 3AIWA 3G6LA 4Z2IA 4DWSB 1TCMA 3SCQA 1JAKA 3MV11 3UESA 1E0VA 3W4RA 5HPCA 2VZUA 2A3HA 2OSYA 3NSNA 2DSUA 4BF7A 2AAAA 4D6FA 4PTVA 2WBGA 1VIWA 4TTUA 3N11A 1W1TA 2XIIA 4MNJA 2WHJA 4JFWA 5HNNA 3BCFA 1E1EA 3FHQA 3W24A 5I5RA 3ZOAA 1KR0A 1FHDA 3T2QA 4U5KA 5HOSA 1NP2A 3SCWA 4JFTA 1QNSA 5JUVA 4E8DA 4MNLA 4YHEA 1OINA 3PZVA 1NWSA 4J3UA 3QR3A 4CD6A 4WJXA 4HTYA 3A4XA 4W89A 4ACZA 1K9FA 4LYQA 1GQKA 2GFTA 2VRKA 2VVSA 1XCXA 4AIOA 4KRTA 1UH2A 2PB1A 4CUCA 1NH6A 3VIHA 5BYWA 1BYAA 1H1NA 3F4VA 4AD4A 4PMNA 1VBUA 1CXHA 3PHAA 1V3KA 4W7VA 2O92A 3IAPA 3K8LA 3OG2A 4F66A 3B9AA 2WHMA 3FAXA 5M17A 1GVIA 1SMAA 2VCCA 2WVVB 2DH2A 3CLWA 3L2LA 1NOWA 4DUXA 1RD6A 3PTKA 1W3JA 3AIUA 1E15A 3I3BA 5A6BD 2BY2A 2O9RA 2QMJA 3WBAA 4P7RA 2VQUA 2CITA 1U33A 2FGLA 1E6XM 3AMLA 3PZMA 1GCYA 3NJ3A 3CZJA 3N15A 5ABHA 3AOFA 1GQIA 2YDQA 2GJXB 1VJSA 1ESWA 5BRQA 3ZM8A 1OM0A 2AOSA 4TUFA 4AXNA 4PMUA 4MTVA 2ZUNA 4AD5A 1YHTA 5CSUA 4H7VA 2XSAA 1UWSA 1UR9A 5BXTA 1DWAM 1E73M 1HKIA 4U5IA 1JYVA 2DIJA 3RCNA 3OLIA 5D9PA 1J0JA 4PUDA 3FY1A 4PMDA 2G4FA 5HBFA 2DIEA 3SUVA 4Z2GA 4QLKA 1CXFA 1JGIA 2DT3A 1DWIM 3CHFA 3I3EA 2O9OA 1H49A 4GINA 5C70A 3VGFA 1JDAA 2BVYA 3LPGA 4KMQA 4ATDA 2RGLA 3GBEA 2GK1A 1UA7A 4U3AA 2DT0A 1L0PA 4N0RA 3WMSA 1XSIA 4CN4A 4D6IA 3GBDA 4ZXOA 2ZXBA 1J0HA 1UOKA 7A3HA 2D3NA 3TONA 3VOCA 4AZGA 4GQRA 1KGXA 5D9OA 4GPNA 5DO8A 5LA1A 3THCA 3ARZA 1CPUA 3TTQA 2W66A 2VQTA 2XVKA 4X0NA 1UD3A 4YHGA 3PTMA 5CPTA 3PBGA 1CXIA 1J9YA 1BF2A 2X05A 4JFVA 4W5ZA 1H41A 3DECA 3MKKA 4D6EA 3WDHA 1MVYA 3L4VA 4UFHA 2CKRA 7CGTA 2ZX6A 4HPGA 1V6WA 4PUEA 3ZR6A 1A3HA 1EDGA 5A6AA 3TOPA 4U33A 4GZJA 2VR4A 5A8NA 2OSWA 3RO8A 1OGBA 1PJ9A 3M07A 2GUYA 4JL2A 2WNWA 3ZSTA 1M7XA 2D23A 3BXWA 1SR0A 1JNEA 2QV4A 4DWSD 1QNPA 1CLXA 2DEPA 3WMCA 3A3HA 5E70A 3HMCA 3ZT7A 2J25A 1BYCA 1QW8A 1XGZA 2CYGA 4HU8A 2BXYA 1C93A 2CKSA 2VTFA 2QPSA 2D22A 2MANA 1ODZA 3T08A 2E9MA 4AW7A 1D7FA 3OLEA 5A2CA 1JZ3A 4W88A 4M8UA 5IHRA 5CPQA 3WF4A 1WDPA 2QPUA 3GTNA 3MU7A 1Q6DA 2W92A 6CGTA 2XIBA 3K8KA 4RE4A 3ALFA 4NI3A 3UR8A 4LYPA 3PZ9A 1GHSA 5BRPA 4W8AA 1HL8A 3GXDA 1WP6A 4WF7A 1KFWA 1VEMA 2WMJA 3LPOA 1QNOA 1V08A 3VGBA 2GDUA 1BGAA 1H11A 3SUSA 3BAKA 3VIJA 1WE5A 1WNOA 3OGSA 4OBRA 3HJEA 1FP9A 5HPOA 3W28A 8A3HA 4A4AA 3CZKA 3AMKA 2XG9A 2YA0A 8CGTA 4YPJA 2VZSA 4LX4A 4CD7A 1K9TA 2EPKX 1F4AA 3II1A 5DT5A 5EBAA 3QHMA 4R27A 3W27A 1GNXA 4H04A 3ZJ7A 5C8BB 2VX6A 4PEEA 2VC9A 2G8ZA 1J01A 4HU0A 5D9MA 5A95A 4P8UA 2UY2A 4E4PA 3EDFA 4F9DA 3WFZA 5FCZA 1UKOA 3RJYA 1BAGA 2VZVA 5A3HA 4V2XA 1KBBA 1H5VA 2CNCA 2ZX9A 2IXUA 1PZ2A 1JL8A 3G6MA 1ITXA 2EPLX 3A4AA 4ZEPA 3VUPA 1EHNA 2XGBA 3NIYA 2V38A 3SCTA 1E4IA 3L4UA 4XB3A 4OOZA 2J79A 5CQ1A 1RPKA 1UA3A 2GK1B 3SCSA 5AC4A 1UD2A 2WSPA 4WLCA 3AQUA 4UCFA 4UZUA 4J3VA 1LLOA 3EMZA 3W82A 4PN2A 4ACZB 3KE0A 2BNJA 3OB8A 4W84A 1JF6A 2W5FA 4HA1A 1W9BM 4MAZA 1IV8A 2JFEX 4W8LA 4B3KA 3TTSA 5AYBA 4M29A 1E4NA 1R8LA 2Z1SA 3ARTA 4MAVA 3N1AA 3T0DA 2J7GA 1BHGA 1B3XA 4CKQA 3RPMA 3VDAA 4IUGA 2VRJA 2WVTA 1CGTA 2OWWA 2EPOA 1JDCA 2QLYA 2YBTA 5A2AA 1JZ6A 1WZMA 2WMKA 1NOUA 1OIMA 1S46A 4FLQA 3WH6A 3ZJ6A 4V28A 2WVSA 1KXQA 5I78A 4D6GA 3AZTA 4W87A 4LGXA 3UCQA 1MWOA 4QP0A 4AZIA 3EDDA 3W38A 1NOFA 3AXHA 1GJUA 3PZTA 3MUY1 2HVMA 2YDSA 3WF2A 1QI4A 5FOOA 1E9LA 1E55A 2WKLA 3VGHA 2CHNA 2W61A 5CGTA 4JHOA 1XD1A 4UTFA 4UZSA 1DHKA 3SCRA 2YL8A 4EE9A 4GZEA 4U3CA 5D9NA 3VD3A 1QHOA 2E40A 1JI2A 1E5JA 1TVNA 5JIWA 3CGTA 3AIBA 1PPIA 1UD6A 3VD4A 2WM0A 3TA9A 1DEDA 2VCAA 1HP4A 1E43A 1V0KA 3F5KA 5BXRA 2XPKA 3VD9A 2VZOA 3AIRA 1ZBCA 3IANA 4HMEA 3K1DA 4P8XA 3N18A 2WMIA 3VPLA 4AMCA 1JXJA 1V6XA 4U2YA 3B9EA 4JL1A 3D3AA 2GSJA 1EXPA 5I0DA 1R7OA 1J0ZA 2F8QA 3NYDA 3AMDA 2J74A 1GQJA 2XUCA 4TTGA 2YA1A 4TVCA 1JI1A 1C8YA 4KGJA 2VR5A 3OGRA 4XX6A 3ZSSA 1UH3A 4AZ5A 4J7RA 3N13A 2EEXA 3W37A 4PSRA 3WDRA 2VURA 2D1ZA 2WHLA 2WWCA 1G1YA 4QDMA 3M46A 2BHZA 1I1WA 5CLTA 2DPEA 1CGWA 2PF0A 1QBBA 1AQ0A 5IFPA 3CHEA 5A8QA 2WCGA 2OYKA 1V0LA 3VMNA 4MJ4A 2BY1A 2EJ1A 3SIMA 1HJXA 4TOQA 1LG1A 5AC5A 1MFUA 3MMWA 2XM2A 3SCUA 3FNDA 3OIHA 1MQQA 1E6NA 1ZBKA 1MYRA 3KL3A 1JNDA 1M01A 3EMCA 1OD8A 3ECQA 2CPUA 3OLDA 2PI6A 2JIWA 3VD5A 1QI3A 2CESA 1NQ6A 2WMGA 1MQRA 4W8BA 2DQXA 1WAWA 4ZE4A 1ZL1A 1VEPA 1I75A 4RE2A 1KGWA 2W91A 1BG9A 1PAMA 1R86A 3AXXA 2PC8A 1PIFA 2PBGA 3BSHA 1DTUA 2E9LA 2DT1A 1Q6EA 3ZQ9A 1EQCA 3K4DA 5A8MA 1MXGA 4MNMA 1Q4NX 2WHKA 3BC9A 1AQMA 1B31A 3ARRA 2BY0A 2OYMA 1FA2A 1HKMA 3J7HA 3DYMA 1JXKA 3AMCA 5EFDA 2DSWA 3BLPX 3EBVA 1JYWA 2BFGA 1UR1A 3UG4A 3ZT5A 5BROA 5AY7A 2XGIA 3MMUA 1DWGM 4W7UA 1RH9A 5FKYA 5IDIA 4GQQA 1RP8A 4JAWA 4DM1A 5EMYA 4WKHA 4ZE5A 1LL6A 1V03A 4FK9A 4NRRA 1E72M 5A1AA 3IJ8A 3SUTA 2DH3A 3MUZ1 4H8UA 1DWJM 1QPKA 3SURA 2EO7A 1H09A 4PMYA 1B3YA 4AZ6A 1WO2A 3O6AA 2Y5EA 1ISZA 1EGZA 1UKPA 1QI5A 5A6KA 2A3BA 1BVNP 3T0AA 5D4YA 1E0XA 1X6NA 1B1YA 5FL1A 3QGVA 4AD0A 1ZBVA 3MANA 2E9BA 4AZ7A 1JIBA 3GZAA 3WIJA 3VX0A 2G3JA 1J10A 1UZ1A 5IXEA 2WC3A 1EH9A 3CZLA 1KGUA 3CHDA 2XVNA 4GIAA 3VGEA 4MPKA 4WKAA 2WPGA 5JBEA 1B3WA 2ZWZA 1C8QA 1XSJA 1UD8A 1C91A 1UUQA 5DMYA 1GOIA 4HZ8A 1JFXA 2IXVA 2YL9A 2F2HA 2DT2A 5CPSA 3CZ8A 5I77A 1ODUA 1C7TA 2DSKA 1M04A 3SEPA 1VB9A 3EMQA 1TMQA 3L4ZA 1VFUA 4FLSA 1CZ1A 1QI2A 3WQWA 3VIIA 3VVGA 4B15A 4UFMA 2QHAA 2GDVA 3ARVA 2VOTA 1HNYA 1MW0A 3IAQA 1V3LA 2FHCA 1EO7A 4UQ9A 4NSBA 4JHZA 3BAYA 4J3WA 1HP5A 4K68A 1NM9A 3ZMRA 1QVBA 2D3LA 3WDJA 5E0FA 3WUGA 4CCEA 2J7HA 3W6MA 2WKGA 3RJXA 3GH4A 4BQ2A 1KBKA 1TVPA 5JBFA 4UOZA 1XHGA 3UR7A 3WF0A 3CZEA 1GQLA 1EOMA 4S3JA 4J3TA 1CXKA 1VAHA 1H0IA 2EQDA 2J75A 1KCLA 4E2OA 1O7AA 4Q7NA 3AMGA 1PZ3A 3VILA 1R7AA 4B3LA 2A3CA 4JKKA 1W2PA 2WZIA 1C3FA 1XH0A 4PRWA 1XH2A 3VIPA 3B8SA 1TR1A 5BXPA 1B3VA 1MW1A 4GO9A 1W1YA 4ZENA 1CGVA 3PZOA 1V3HA 3AZRA 3IJ7A 1A47A 3WNMA 4L4PA 1IZKA 3OZOA 4U2ZA 3FAWA 4AZHA 3WKZA 3WFLA 2VT0A 1X6LA 2ZXDA 5CSYA 1CXLA 1MQPA 2QMKA 3PZUA 3ARPA 2V5DA 2GJRA 2ZUSA 4MB5A 1UKQA 1RP9A 2WBKA 3WNOA 3BAWA 2Y2WA 1E6PA 5JIPA 1CYGA 4F9JA 1JZ2A 1UKTA 2ZX8A 4BA0A 4P7QA 2WSKA 1FH8A 2DDXA 5LYRA 2FHFA 3CUJA 5A8PA 5LA2A 1KR1A 2B31A 2BVDA 4HA3A 1UG6A 2E3ZA 1G94A 1CECA 2W67A 1GOWA 1VFFA 2J8GA 1FFQA 3PZIA 4CVUA 4CU8A 1XYFA 1MW2A 2FGZA 1AMYA 3WF3A 1W9XA 3W26A 1TFVA 3VNYA 1JZ5A 3W81A 1UWTA 1FP8A 1UR8A 2XSBA 1NARA 1HVQA 3WELA 1FOBA 3A6OA 1J0YA 5AYIA 1X1NA 2EXOA 2XFFA 1EOKA 1OGSA 4IM4A 1LG2A 2V5CA 3KL0A 4GI9A 2EBNA 3T09A 2Y4SA 2BHUA 1XCWA 2NW0A 3WMBA 3PN8A 3THDA 1WCGA 4GZIA 3LPPA 3AZSA 1XYZA 2XFYA 1HT6A 2VI0A 4JCMA 4EANA 1TA3A 1Q6FA 5ABEA 3E1F1 1GJWA 5M3WA 2VNCA 1QOXA 2XM1A 4UQAA 4HOZA 4CGTA 3OA5A 3BH4A 5BWFA 1Z32X 3SUUA 2VX4A 2J47A 3VIFA 4S3KA 1GOKA 2WC4A 1KXTA 4A3YA 3U5YA 3BSGA 2D0HA 1US3A 5I24A 3BCDA 5I6SA 4AZBA 4HZ7A 3O2LA 3SUWA 3AYSA 2ZUVA 3AFBA 2WLZA 1LWJA 3CUHA 3PZNA 4Z2JA 4UR9A 5D8WA 3WF1A 1QHPA 1B90A 5GNXA 4HPHA 1C8XA 4KRUA 2D2OA 1XSKA 3VIGA 5JH8A 1H4PA 1W9UA 3WUEA 2YJQA 1ZU8A 3VINA 1W9PA 1US2A 1LF1A 3UEQA 2GJPA 2C0HA 5KZ6A 4JKLA 3MSDA 1VJZA 4BS0A 2OYLA 3T2PA 4UOQA 3ZJ8A 2NT1A 2XVPA 3GDBA 2V3FA 5I23A 1WDRA 1FH7A 1E3ZA 5A2BA 3MUAA 5I3DA 3VX1A 3WENA 1UD4A 4QLJA 1MXDA 4PBGA 1ISWA 3GXIA 5E9AA 2XHYA 3SCOA 1V3JA 4EK7A 1W3LA 3EDJA 3GH7A 3FXYA 5CZKA 4H41A 3M6DA 2XJ7A 2J77A 2UY4A 3S6TA 3DHUA 4W5UA 3WEOA 1H2JA 1OT1A 3KEHA 1J12A 3AHXA 4HOWA 1B9ZA 5LA0A 4M1RA 3RMEA 2VUYA 4UNIA 4QCFA 4BQ5A 1PEZA 3T0BA 1GHRA 1GOMA 4R5EA 4TX8A 5A8OA 2G3MA 3AI0A 3MUIA 1XRVA 1E3XA 1BLIA 1DWFM 1PIGA 1ZJAA 5A94A 2QF8A 3NCOA 4AY1A 2VVNA 1HN1A 3LPFA 3W6LA 1FH9A 4UOJA 1ITCA 1V02A 1HX0A 1K9DA 4CCCA 3AS1A 1KWKA 4AYSA 2C8NA 3RM8A 4TVUA 4H2CA 4GI6A 1E0WA 2DSZA 1UR4A 3NDZA 5C71A 4C7FA 3SCNA 3WNPA 1XD0A 9CGTA 2ZX7A 4MNKA 1NWRA 1UR0A 3VIOA 2XTKA 4N42A 4KWUA 4WSKA 1F4HA 4FMVA 1XC6A 4QAWA 2G3IA 2XVLA 5ABFA 3WNKA 3JUGA 3LMYA 2WZHA 4P8VA 4PTWA 1UWRA 2WMFA 3AIVA 4MDPA 2X8RA 4J3SA 3BMWA 3VDCA 1KB3A 3CZGA 3RM9A 3NDYA 1JG9A 3OZPA 1UKSA 3VMPA 2OLHA 4EAMA 1I1XA 3CH9A 1EDQA 4JFUA 3A4WA 1J0IA 1OBAA 3U57A 1W32A 1CNVA 2WCAA 5M5DA 2PBOA 3GM8A 2AMGA 1GZJA 2JALA 2J78A 5A6BA 2YL6A 5E6ZA 1LQ0A 5KEZA 4W85A 4P7NA 4OOUA 6TAAA 3CUFA 4V27A 1QW9A 4KH2A 3L2MA 1GUVA 1UHVA 1CEOA 2F61A 5ABGA 2J7BA 4AISA 3SCVA 2X0HA 3RILA 4UQDA 4Z2LA 1FHLA 1Y7VA 4RE3A 1VFMA 2WMIB 4MADA 4PCSA 4M24A 4AZCB 3ARXA 1L8NA 2D0FA 2Y8KA 1VENA 1J0KA 2NT0A 2WANA 4W86A 3ARWA 4MB4A 5HXMA 4QLLA 2E4TA 4TVDA 1WZKA 1D3CA 3ARUA 2FHBA 1JF5A 2CBIA 1KXVA 5M03A 4PSPA 3WEMA 1HXJA 1NWTA 5A6SA 1YQ2A 2ZIDA 3VD7A 4HA4A 1H3GA 2FH6A 1UWUA 5A6JA 2ZXQA 1CDGA 4M81A 4L4OA 1XH1A 3DHPA 4D1IA 4WSJA 1E6SM 1SYTA 3VDHA 1CWYA 5A69A 1IT0A 3QHNA 2UY5A 1QBAA 1V6YA 2JIEA 1UWIA 4RL3A 2VL4A 1IZJA 1HIZA 1B3ZA 2XWEA 2Y24A 4W7WA 4H8HA 3A47A 2ZX5A 1VBRA 2WZEA 1BTCA 4JFSA 3GH5A 4WK9A 2WYSA 4MJ2A 4Z2HA 3CHCA 3BLKA 4WIWA 3EDEA 4FF5A 2E8ZA 2JF6A 3VM5A 4AD1A 4P8WA 3POHA 1OT2A 1AQHA 3VMOA 1GPFA 3QHOA 1HKJA 2ZICA 4IPNB 1JYNA 4Z2KA 1XV8A 1NWUA 1JFHA 2YDRA 3ZR5A 2FH8A 4HOXA 2PWFA 4UFIA 3AISA 1PX3A 2ZWYA 3KZSA 2WAGA 1GW1A 1G0CA 1G5AA 4OZOA 3PZGA 4LQ1A 3UG3A 1E6RA 2VX5A 4AD3A 4ACYA 2JEPA 2CCRA 1UZ4A 1MW3A 5FL0A 4D6CA 1GONA 3GNPA 3WQ8A 2GJXA 1BQCA 2A3AA 5JBDA 4AEFA 4HP5A 4M80A 1GORA 3PTQA 2X09A 1HF6A 4J27A 5E6YA 3VGDA 3VO0A 3MMDA 3WSUA 4AWEA 3WD4A 1BG4A 1W2VA 2CBVA 4UFKA 1CLVA 4ML4A 1U30A 1EA9C 2A3EA 3AIQA 4KGLA 3WL1A 2RGMA 1UYQA 1OD0A 2G41A 2ZXAA 3FN9A 5A6LA 1LJYA 1AVAA 1NP0A 2D0GA 3NSXA 2WC7A 1B2YA 7TAAA 1CBGA 4JKMA 4PMXA 4XV0A 5EFFA 2E0PA 3F5LA 1WZLA 3BMVA 4Y7EA 3WQ6A 5D8ZA 2NSXA 2WMHA 2Z1KA 1SMDA 2XWDA 3GNRA 3NSMA 3S2CA 1W9VA 4FLRA 2DSVA 1CGUA 3ARSA 2VX7A 3L4YA 2Q8XA 3MSGA 2FDMA 5GNZA 3OBAA 1GVYA 3TTOA 1G9HA 3GXMA 4ZFMA 3AHTA 1LL7A 3FHAA 3MS8A 2CBUA 2EPNA 3SCPA 4P7LA 5HDRA 3VTRA 2DGAA 1V02E 1CTNA 2OWXA 1FFRA 1EDTA 5E0CA
chains in the Genus database with same CATH superfamily
1IX5A 1EQPA 3O8AA 5AVNA 4A3RA 2XP5A 3WDPP 1ECEA 4B9YA 1LL4A 3VDBA 1B5TA 5HJYA 3N14A 5FIPA 1QPOA 1PXGA 3CAQA 2J9YA 1R47A 1WPCA 5G1TA 1HJUA 5G2IA 3RLHA 3WDQA 1R3QA 1MZHA 3D5HA 1WB0A 4DO4A 3LTSA 2PTZA 3C0LA 3TJLA 1C7SA 2CLFA 2FAPA 4C7DA 1GEQA 4GC4A 5EBUA 6ENLA 2WVVA 3LI1A 4RZ5A 4GQGA 1VLWA 4FP1A 4U4MA 1AD4A 2VEIA 2VP8A 1OB0A 3ES8A 1R9ZA 2WB5A 3TTEA 4NT0A 1E40A 4JFMA 1TWZA 1BKFA 1XIJA 4LB4A 1EIXA 2QGYA 4UQCA 1I2RA 3RPDA 1CXEA 1PBGA 5KZEA 3O6DA 3TCEA 1R3VA 2VCBA 4IIEA 4ZO9A 4B9ZA 2PMQA 3AXIA 3LHYA 2BOFX 3AYRA 3QW3A 1VRXA 3TC3A 3S1XA 2BS9A 1LBMA 3LXBA 4QISA 4DWSC 5TIMA 1P6BA 1VFTA 5LGZA 3CNYA 3QV9A 1REQB 2EPHA 1XLJA 2WVUA 1VFOA 3GG8A 3WQ4A 1DJIA 3WLIA 4BI7A 3NGJA 3C56A 1Q66A 1EBHA 3B8DA 4HTBA 3S5SA 1E44A 3TSMA 3VC6A 1LM1A 2WXDM 4O1AA 2Y8VA 4IOTA 4MWAA 5F4SA 3QY8A 4GFSA 4XZBA 5I79A 3FJ6A 5DCDA 3GFXA 1JPIA 4O50A 2C18A 3TW6A 3UERA 2WKJA 1WV2A 1VCVA 3NZGA 4ATLA 4RNJA 1UROA 4ODOA 3UU0A 1FCBA 3ZO9A 1EEXA 3BGAA 3QGKC 3VK5A 4XUYA 3MT1A 4BF8A 3GXFA 3H23A 1RK5A 4PMRA 3H12A 4F2BA 4ZXLA 4C6BA 5DBUA 3VKKA 3AHZA 1EXBA 3QMRA 2E28A 3GG0A 4GY0A 1F8AB 3ID7A 1E4LA 1W1PA 3WQ5A 4MWAD 5CBIA 1YKWA 2GWGA 1N8IA 1BYDA 2DP3A 2W62A 1A5OC 2E1DA 4IIFA 4MKNA 4PYSA 2VWTA 2CLHA 2XVGA 1K6AA 1KW1A 4DZ5A 3UCCA 3UXIA 1D7KA 5ECUA 3ZLFA 2CLOA 2E6YA 3TV8A 2FVKA 4AFYA 4I90A 2X1IA 2CEQA 2QDDA 5A6MA 3DDMA 3R8RA 4KETA 1AW5A 1B4KA 3JRKA 2W63A 1ZAHA 4EP8C 3WQGA 4B5UA 1WKYA 2EJAA 3WD0A 4FLOA 3WH9A 1N55A 1NDVA 1TZ9A 3RRXA 3C2VA 1P0BA 3WNNA 4FALA 3TSBA 3E12A 2FJKA 1PHQA 1OF6A 2JEQA 3SM0A 6A3HA 2Y61A 3UJ2A 1ZCOA 2PWDA 3F5JA 1TPUA 4L1WA 5AC7A 2GVYA 3SQMA 4CN1A 4JICA 5LKYA 5TD4A 3WLOA 3GNOA 2QDEA 2AQOA 3E6EA 3N12A 1VLIA 4UFLA 3WUBA 3OOBA 3SJNA 3L4WA 1OCBA 2BY3A 3H2OA 1E1FA 5CG0A 4RNIA 4UMCA 5HQLA 2P50A 2O9PA 4TX6A 4LWWA 5G2WA 3LGGA 5AVHA 1ISXA 3T8LA 3AS2A 1UB3A 4GO8A 4JS3A 4BCEA 3RCYA 2YB1A 2P8BA 4AEEA 3MTWA 3ENLA 1JR1A 1A7XA 1PS9A 3BAIA 3RDKA 2VO5A 3NA8A 1CENA 1R0MA 3G1XA 3BW4A 1B0IA 1XC4A 2BASA 1Q6GA 2J62A 2PRHA 1JYXA 2CIPA 4J28A 3WY1A 2YLLA 3K4WA 4DUVA 3AHYA 2F2KA 5ABFB 1SZNA 4NJHA 4QGCA 3L9CA 1HJWA 2PUZA 4BI6A 1TVLA 3BZGA 3WL0A 4GXPA 4P61A 1ZGDA 1I9CB 1SU5A 1QNRA 1MFVA 3M0MA 4QZVB 3MVTA 1X6UA 1TTQA 1G7VA 1KM5A 2ALDA 3RLGA 3PUOA 4AC1X 3AICA 3K2GA 5EMMA 2WNQA 3NNTA 4WKFA 1PX8A 2Z2AA 3W1UA 1VF8A 4PTXA 1R46A 1TREA 1TG7A 4HD5A 4MB3A 5TAOA 1EGVA 1ZUAX 1JD9A 1DTNA 1DIEA 2XFRA 4OKDA 2CLKA 1HKKA 2B4GA 3NPVA 5DX7A 2IKHA 3KRZA 3SSJA 4HZ6A 1G6CA 2V2DA 4WGXA 5CC7A 4K2SA 3WJXA 5DT7A 3FX4A 1GOOA 4IISA 3L67A 4NIRA 3S1VA 1JUKA 2ABAA 4B5WA 4Z2IA 1JQXA 1TCMA 3SCQA 4K3ZA 1JAKA 2RH9A 3UESA 2J24A 3WLKX 1EZ2A 3D3FA 2D2GA 1S2VA 2P3ZA 1OJXA 2DSUA 2XISA 2AAAA 4D6FA 4N9EA 3DFHA 3HQPA 2WBGA 3L65A 3LX9A 4IMGA 3W86A 3QY6A 3VA8A 4EX4A 4MNJA 2WZMA 2WHJA 4JFWA 3SAZA 2FIQA 5I5RA 3ZYZA 2ADAA 3T2QA 1PKYA 3P62A 4U5KA 2NQZA 3JZEA 2IF4A 1NP2A 1XG3A 2GJNA 4XZLX 3G8RA 4DX3A 4C6PA 1Q3NA 4NZ1A 4E8DA 3QEZA 4US5A 1AJ0A 3I6EA 4IX2A 4Q6JA 1QOQA 4J3UA 3CL6A 4CD6A 4EXAA 2KR7A 5LIYX 1X98A 1CCWB 3NQBA 1GQKA 2VRKA 3TW7A 2VVSA 3PA7A 3O5MA 5H8UA 4XSLA 1V93A 3IRSA 3PHAA 4M6PA 4W7VA 4AG0A 4WY0F 4F66A 3P74A 2WHMA 4XK2A 4FR6A 3VCNA 3MKVA 4DUXA 2Y7DA 1H7NA 1PCWA 1I45A 1A5LC 1XRTA 4K1GA 4NAFB 2GVGA 5A6BD 1L6SA 4E4FA 5CBJA 1OEPA 4P7RA 4NKCA 2CITA 1U33A 2WNZA 3ZXWA 2DZUA 2FGLA 3AMLA 1VBHA 3BQ5A 3B03A 4CQDA 3H26A 5ABHA 5CKSA 1GOXA 3AOFA 3TU9A 1GQIA 2GJXB 4GD0A 3SW6A 3CU2A 1VJSA 1F05A 5BRQA 1OM0A 2AOSA 4K6AA 1Q6IA 1YE4A 4E6MA 5F2IA 1OZMA 1RQBA 2V2CA 1BXCA 3R6IA 4B3ZA 4OVXA 3OLIA 3RU8X 2PD9A 4RUBA 2GDQA 3BANA 2DVUA 3R58A 2G4FA 1O68A 4GYKA 5HBFA 5H8PA 1E51A 1FWIC 3SUVA 2DUZA 3P80A 2PLCA 2X42A 4GINA 3W84A 1GGOA 1P0EA 4J2MA 3UQAA 3RPTA 4O10A 4U3AA 3U2EA 4Q32A 5HQEA 3EWBX 1EF2A 3GBDA 4ZXOA 2ZXBA 1QUMA 4G7EB 4O0KA 1F6PA 1NQKA 4ZR8A 4HB7A 4J4KA 3GIQA 5D9OA 3KOXA 5JMUA 5HW8A 5LA1A 3UNDA 2PZ0A 3SSZA 1UD3A 2LJ4A 1ONXA 4O11A 2HNEA 1YW5A 3LMZA 2X05A 3MKKA 4KEZA 3L4VA 4NXSA 3UQIA 3C3NA 2CKRA 3ZVHA 1V6WA 3ZR6A 5BZAA 1E1CB 5A8NA 1POKA 3IK4A 9XIMA 3WLQA 4JL2A 2ZRVA 4S3GA 4WQ6A 3NEVA 3ZFHA 2JGYA 4DWSD 1QNPA 2P76A 3W87A 1R3SA 1Q6RA 1R2RA 2XN2A 3A3HA 4I6KA 1M5WA 4NASA 3IJLA 2R9RA 4LUSA 2DQWA 3V5CA 2QPSA 5C5YA 3PWAA 4ENLA 1ODZA 4HMNA 4TQTA 1JZ3A 4J5NA 3O5JA 1K7FA 2IPGA 4M8UA 5IHRA 3GDKA 3DESA 3WF4A 2QPUA 2PPGA 4LV9A 1PL9A 3GTNA 1VFSA 1QFEA 6CGTA 4IQCA 3NZ1A 1W26A 2CZEA 2BBFA 1VYRA 2PRMA 1H50A 3H2FA 4JPGA 4WX2A 2B0MA 3GE7A 3MCMA 4JYEA 3BAKA 3SN1A 1IIGA 1WNOA 1CX9A 3OGSA 1WKEA 3DH7A 5FI8A 3HJEA 1FP9A 3EX2A 1P0NA 3AMKA 2P8CA 4TW8A 2YA0A 4YNGA 4EVZA 2VFEA 2VZSA 4CD7A 1K9TA 3AAMA 2EPKX 3II1A 3QQ0A 4QBXA 4R27A 4UNKA 3CAVA 1VPQA 4V33A 3GXPA 3M5VA 3ZJ7A 3GYEA 2A21A 4M5PA 2G8ZA 3UYIA 3O0FA 3SN0A 2Z1BA 3W2UA 4P8UA 4WVXA 2UY2A 2GGHA 4F9DA 1UKOA 3E96A 3LCGA 2PGFA 3P81A 1KBBA 3NQ6A 3LHTA 1O12A 1TJ1A 2WJDA 4RDZA 4R9XA 1ITXA 3IS4A 3VUPA 3NIYA 5KINA 4DH0A 3BJSA 2V38A 3SCTA 1QMLA 4OOZA 5CQ1A 2GK1B 4XTIA 1UCWA 3AQUA 2ISVA 3DCPA 3FSTA 1X1ZA 3OHMB 1LLOA 4JTTA 4PN2A 3KE0A 2AL2B 3OB8A 1BKHA 3GG1A 2W5FA 4HA1A 1IV8A 1TV2A 4B3KA 1E4NA 2OLAA 3A24A 2Z1SA 4N9DA 2NUXA 3ARTA 3W7PA 1NFPA 3P67A 3T0DA 1DXIA 1BHGA 1B3XA 4QDPA 3RPMA 3VDAA 2C1HA 2VRJA 5FAGA 2WVTA 4TW6A 3BV7A 1YATA 5ECVA 2OWWA 2OCZA 1EB3A 1YMYA 3N19B 4KIRA 3UXDA 1JZ6A 1WOAA 2PWUA 1WZMA 2OKOA 1OIMA 1JPDX 1UP2A 3ZJ6A 1DJGA 5LZLA 1XLEA 3SY8A 3GRIA 4JIRA 4W87A 1XICA 1MWOA 3VKBA 4AMAA 4AZIA 1YNQA 4C6NA 2PODA 3PZTA 3MUY1 3LQGA 4RZ6A 2CHNA 3OO2A 1RSCA 2VENA 4AC7C 3LGEA 5CGTA 1XD1A 1FWFC 1OX4B 4UMBA 4L4LA 5FACA 1M7PA 5A6TC 2B7OA 2I16A 3G0UA 3V16A 4EE9A 4UTTA 1QHOA 2E40A 3VD4A 1AZ1A 3TA9A 1DEDA 2VCAA 3LTPA 3VOIA 1NF0A 2HSAA 4EWND 1T8XA 3VD9A 3IANA 4HMEA 4DJEC 3KCEA 4MJMA 3OP2A 4H6EA 3B9EA 4HZMA 3SFWA 3M0ZA 1FDYA 1EC8A 4E2DA 5I0DA 3SRKA 2WSQA 1W0MA 3B8UA 1FRBA 3AMDA 4NG3A 4TTGA 1XISA 2E67A 4W4QA 4TVCA 3R4IA 3OGRA 1UH3A 3LV6A 1QXLA 1TWWA 3W37A 4PSRA 3PSVA 1JQVA 2I5GA 1GTEA 1RALA 1D3GA 3NQAA 3P8JA 4DIAA 4JFKA 1I1WA 1O5XA 2CLMA 5CLTA 3JYJA 4PUJA 3CHEA 3KBNA 4BHYA 1T11A 2WCGA 3VMNA 3MP3A 1LDCA 1ME7A 3LNPA 4MHBA 2GGJA 1BD0A 1XLCA 3T78A 3O1NA 1MMFA 1A0DA 3OIXA 2VM8A 1KRAC 1XQKA 1HG3A 4QIBA 1SO4A 3KL3A 2AAMA 5DQPA 3EMCA 1EKOA 3E0IA 3LLXA 1OD8A 1QWKA 2PN0A 1POJA 3OLDA 5IDZA 1R3RA 1Q4WA 2JIWA 3SRHA 1MQRA 3IJQA 2DQXA 1IEQA 1WAWA 3S5ZA 4FN2A 5I07A 1SJDA 1K02A 2ODOA 4ERIA 1PAMA 4RX0A 1ZQ5A 3CTLA 3SFKA 2Z25A 3UVIA 2J88A 1T0OA 2E9LA 2DT1A 3MDYB 2QR6A 1H51A 3LERA 5A8MA 4MNMA 3BC9A 4DXXA 1B31A 4HCHA 4JQAA 5FF0A 2ZQTA 3DYMA 5EFDA 3UA4A 4WR3A 2VEMA 3UG4A 1GVOA 2GOUA 5AY7A 1K1DA 3MMUA 3CV6A 1RH9A 2YCJA 2ZZ4A 3AJXA 2Y0FA 3O05A 4DM1A 4ZE5A 2PDCA 1LL6A 1V03A 3UQNA 1TKKA 1UBPC 5A1AA 1WXJA 3PPFA 3IJ8A 4LVGA 3TYCA 4LAKA 3NVDA 4KWVA 4PGLA 5HMFA 1YLVA 1XPYA 3WK3A 1DWJM 2G50A 3SURA 2EO7A 3W7QA 3O6AA 2Y5EA 3A22A 1YBQA 2K8IA 1TJRA 2IQ0A 2QQ6A 4X3ZA 5PTDA 2Q6ZA 3GWQA 3QGVA 5LNRA 3MANA 4O4VA 3P82A 1EJVC 4R7OA 3QVQA 4ZB2A 3VNMA 4HHHA 4TMBA 1ZCNA 3CZLA 3CHDA 4GIAA 3VGEA 4MPKA 4WKAA 2ZWZA 3S83A 4HSHA 1C91A 3PR2A 4G56A 1L6GA 4W9QA 3VNLA 3MP5A 5I77A 3RU6A 2OO0A 2ZRYA 4H9TA 3TVAA 1CZ1A 4KKXA 5CAHA 4IT4A 1RXOB 1JNTA 4YL2A 3VE7A 3T40A 1SSDA 3GR8A 4DI9A 5HWNA 4ZPWR 3IHZA 3GC4A 4DBEA 4ORMA 3QZ6A 1JRCA 3KCOA 3T4CA 3IAQA 4WGHA 1GZ1A 2ISWA 4UQ9A 2VFFA 4NSBA 2ZZ5A 2GQ3A 4XIMA 3IIPA 3EA2A 3ZMRA 3WDJA 3WUGA 2J7HA 2PU1A 1S2AA 3OZMA 4Q8UA 2WKGA 3DENA 2ZZ3A 1N1AA 5D03A 3TYAA 1ADSA 5D02A 1VAHA 4YU1A 4ADUA 2D2HA 3EX3A 5C2XA 3UPMA 1PZ3A 2PLMA 4GJJA 5REQA 4QTGA 1RR2A 3OZYA 3CJPA 4B3LA 3SBFA 3C0SA 4IP4A 2CZFA 2WZIA 3T9PA 1C3FA 1XH0A 2NVDA 1XH2A 3VIPA 3B8SA 3UZJA 5BXPA 2POTA 4GO9A 4BY3A 1W1YA 2PEVA 3WNMA 4L4PA 3WH0A 4Q8OA 4QRNA 3OZOA 2BTMA 1P5QA 2VT0A 1PDZA 1Y5XA 3TNBA 3I4KA 3ARPA 4ZL1A 2P4VA 3ITXA 1UKQA 1RP9A 4MB5A 2WBKA 4C6LA 4H9MA 3UWEA 2DW7A 3TC5A 4LF2A 1UKTA 3JYMA 1R30A 3NXFA 4BA0A 4GUIA 1MRQA 1FH8A 4QR6A 2FHFA 1AJZA 4H01A 1J4IA 2RDWA 2B31A 2BVDA 1J4EA 4HA3A 4HBEA 3R7MA 3P93A 3LUTA 2E3ZA 1CECA 1XG4A 1DJNA 2EG6A 2DZTA 2W67A 1FFQA 2QCEA 5F2LA 4YWIA 1Q7ZA 2ZQVA 1W9XA 3W26A 4B2DD 1RY8A 1JZ5A 3ITVA 2H8XA 5I3JA 2QIIA 2ZR6A 1DIOA 2EXOA 1DOSA 1GWJA 2REQA 5FJPA 5BRBA 2REQB 4EXBA 3FCPA 3UR5A 2EBNA 3NURA 3T09A 2Y4SA 2NW0A 4GWEA 3VDGA 3LPPA 2NQ5A 4LVBA 3W7LA 1P0DA 3LK6A 5B80A 4WOZA 4GYPA 3E1F1 3NVTA 4C90A 1LUCA 3PFMA 1TE6A 4HOZA 4O13A 3OA5A 1KM6A 2Y70A 2CLPA 3LZ5A 4S3KA 1GOKA 1VIZA 3WBYA 3G3MA 5I24A 1NFBA 5HNUA 1GT8A 2CWXA 3VAVA 4M0XA 2ZUVA 2ZTJA 1TV5A 4NNRA 1WOBA 3EIPA 3H9RB 2HS6A 4Q33A 3GD6A 4UR9A 2BGQA 2DVTA 5GNXA 4HPHA 1C8XA 2D2OA 3GTYX 3KS5A 1TR9A 4JIHA 5JH8A 1H4PA 3KTSA 1G67A 3NL6A 3UEQA 5C2CA 5D04C 4Q8TA 4AY8A 3NM1A 2OMAA 1XYCA 4B90A 5KZ6A 5ENLA 3S42A 5D38A 3BGGA 2OYLA 1VZWA 3T2PA 3U48A 3CYVA 2XVPA 1IR1A 1XLIA 1H5YA 5REQB 1NEYA 1E3ZA 4WDXA 4LUYA 5I3DA 1XPGA 1B57A 2RHGA 1QASA 1KBLA 1PBKA 4IFOA 1FKFA 1THFD 4ZQCA 1WAUA 2Y8UA 2SFPA 4QJ3B 1S2WA 5AKQA 2OFJA 1QPLA 2XHYA 1V3JA 2O4MA 3C86A 3GAYA 2BLEA 2IPFA 3UCDA 4H41A 3W02A 5EU9A 3L0GA 2J77A 4HK7A 2UY4A 3DHUA 3MCOA 2V30A 1H2JA 4FSAA 1FHVA 2YCEA 3YPIA 4QSFA 5AC8A 4HOWA 1IXPA 3DU0A 1XKJA 4UWMA 1L6FA 1OK4A 1HQTA 5KMYA 3EWZA 4A35A 4HNCA 4ZOEA 4RPQA 4DEFA 1YNYA 1TPB1 5A8OA 1F40A 3GSMA 1OFOA 4QNWA 3IJ6A 2QV5A 2ZQSA 3MUIA 1BLIA 1DWFM 1R5YA 1YDYA 3S4TA 2FZMA 2MNRA 5FF3A 2HK1A 4IMFA 2NQ9A 4Y2WA 3PAJA 1V02A 3AS1A 3EAUA 2C8NA 2ZRZA 1E0WA 2DSZA 2CZVA 3UY8A 5C71A 3NWRA 3ZWSA 1Q8AA 2Y6ZA 1MUCA 1QOPA 3WQEA 3MDWA 1UC4A 3WNPA 1XD0A 4GE8A 1NWRA 1UR0A 3VIOA 4N42A 5EPDA 3FLUA 2BG5A 1TMHA 1F4HA 3C8FA 4QAWA 3JUGA 4HJFA 1A5CA 1UWRA 2RUQA 4X60A 2Z27A 2X8RA 3VDCA 1KB3A 3RUBL 3RM9A 4IL2A 3OZPA 2ATMA 3W1NA 3VMPA 4EAMA 3T81A 4Q4QA 5HNTA 4WXZA 1X8CA 1OBAA 2G4JA 5HULA 3RFAA 2V2HA 1CLKA 3TE9A 2PBOA 2AMGA 2JALA 1GTHA 3KUMA 2Y89A 2YL6A 5E6ZA 4EPBC 1JPMA 3M0XA 3LCWA 3OG3A 4HSOA 3NPUA 4KH2A 4AX7A 4UTLA 3C2RA 2E6DA 3ANUA 4XISA 2OLSA 1XLFA 3IGHX 3SCVA 4QQUA 1R6WA 3G77A 3RILA 4JTUA 4UQDA 4Z2LA 3UA3A 3LB0A 4JEJA 4RE3A 3RX2A 1VFMA 2WMIB 3LZ3A 5JQ9A 4GH3A 2CU0A 4W86A 4QE5A 1PKLA 3FDGA 3TQKA 1DXFA 4MB4A 1Y0EA 1VR6A 4Z1CA 2E4TA 4TVDA 4O2TA 1D3CA 3ARUA 2PDQA 3OPSA 3EB3A 3W1AA 4PSPA 3HGSA 4FNTA 4HA4A 1H3GA 3SQSA 1J2WA 4HNLA 4XAZA 4IFRA 3LRMA 1J79A 3HFTA 4R34A 4M81A 1H1YA 2XIQA 4L4OA 1U22A 4GVGA 2OB3A 1XH1A 4TX0A 1EQ3A 1S1PA 3DHPA 4V1XA 4D1IA 2YCKX 1JCYA 3PNUA 1CWYA 4XSMA 4JTCA 1LRQA 3QHNA 3VKCA 1V6YA 4AWUA 3IVTA 4RL3A 2ATSA 4XD3A 5MHBA 3GW3A 1U1HA 2I56A 1TPEA 4ZPTR 5A8GA 4JFSA 1EBGA 2WYSA 2X40A 2VEPA 3VZZA 3APTA 1Q6QA 3EDEA 5AHIA 4FF5A 2JF6A 3PPHA 3P84A 3VM5A 1VYSX 5C2GA 1P0KA 1OT2A 1LLZA 3GXNA 4IPNB 4B91A 4UFIA 5FAJA 3VCRA 3TDFA 3KZSA 2WAGA 2V82A 1JVWA 1G5AA 3PC0A 4OZOA 3FOKA 2VX5A 4Y9NA 1MZRA 3UQBA 4GQ0A 4AB4A 1FD9A 1A0EA 3G8EA 3H70A 4GCAA 5LNSA 4XD5A 2A3AA 4AEFA 2IPWA 2ZVRA 4M80A 4NX5A 3MZ2A 3NAVA 3L0NA 1R3WA 2X09A 3PTQA 3VGDA 2OOGA 4DT4A 3WSUA 1YADA 3DGRA 4E2BA 1W2VA 1LLWA 2CBVA 2BGNE 4XG1A 4ML4A 1U30A 1EA9C 3M43A 3C3UA 1SFTA 2BVWA 2RDUA 4X2PA 1JCJA 4EF8A 3KOZA 1UYQA 3CIWA 4QX4A 2QDGA 4LAMA 5F1UA 4ERAA 5RUBA 4DJDD 3NSXA 2WC7A 1UW9A 3EOSA 2FPYA 7TAAA 3UWQA 4J35A 4XV0A 4IL0A 5EFFA 3F5LA 2VUNA 4K8HA 4Y7EA 3UZ5A 2BB0A 1W37A 2NSXA 3GNRA 3S2CA 1RVKA 1FWJC 3OQ8A 2Q8XA 3MSGA 2FDMA 2FZ9A 3W1XA 3OBAA 1GVYA 3SRFA 2BMBA 1G9HA 3ITTA 3TIMA 4JIPA 7REQA 1XQLA 4GI4A 3LBCA 1PWMA 1W3TA 2OXNA 3KAFA 1L1PA 3TYEA 3BCJA 4MUZA 3N2XA 4E5TA 2ZRUA 1HGWA 2HQAA 4GBUA 4JFIA 2OOFA 5CEWA 3UI5A 4MGGA 3PS7A 4O15A 1V6UA 2H3DA 3CEPA 2ANUA 3JVAA 3OA3A 1HUVA 3OYXA 3PFRA 5CXPA 3ARQA 3S2LA 5GQBA 1A3XA 2EPMX 1QCWA 3MY9A 2CHOA 3PAOA 4AX6A 3BICA 2UZ9A 4FIQA 3W71A 2VYOA 2NWRA 4B92A 1KTBA 1EJSC 3FJLA 4ODNA 3DC0A 2BDQA 5F7UA 2PAJA 1KA9F 3QOKA 4QAIA 4HMCA 1TTPA 4JZ5A 1WDQA 3STCA 2UY3A 5HAOA 1S5VA 4CVWA 4IF2A 1EX5A 2Z28A 3W25A 1FKJA 1LT7A 5IHSA 4JFJA 3HGJA 3EDKA 3BMBA 2IKJA 1F61A 4L64A 1VCGA 2Z2BA 4YLWA 4ZB0A 3EOLA 1BEUA 1E71M 1EC7A 3ZIZA 2CWNA 5AZ0A 1N82A 3CTTA 3VOGA 4I8YA 2F6XA 3AIEA 2ONEA 1X96A 2OQYA 2KZHA 1DQXA 1KBIA 2F9RA 2QZRA 3NQGA 3O0KA 1GJPA 4H7CA 3HTWA 1ZPTA 4AZCA 1JZ7A 4NNAA 4ZTYA 1DJWA 6ALDA 1I60A 3Q94A 2FVLA 3TLQA 3LUOA 4U86A 2C19A 5F2MA 3HURA 2OSXA 3TC6A 1PIIA 2FTWA 2UWFA 2DVXA 3TN6A 3IEBA 4JIQA 4J3XA 5LNUA 3DHFA 3QTPA 1MRAA 1HJVA 2KO7A 1X1OA 3U4FA 5L6UA 2X7WA 1PX4A 1G01A 2M08A 3MBFA 2PDHA 2A3LA 4LCQA 4LANA 2J4GA 4XBSA 5HMDA 1JPKA 5DITA 2LGOA 1XIMA 3LU2A 4IIBA 4ADSA 4F0LA 4XZMX 4B5TA 1RZMA 5DF0A 2BX7A 3PG8A 3C5QA 1XFCA 4K1WA 1TX2A 3PZQA 1OWQA 1J5SA 1R9HA 2RQSA 1E0UA 1KTNA 2Q8ZA 1OF8A 1KQYA 4EWJA 3CMGA 2PWEA 4GVIA 2E09A 1XIHA 3V0UA 5LNWA 3WDIA 3M1ZA 3POCA 3R0DA 2GGGA 2VOMA 2CXGA 2J7CA 3WN6A 1OCQA 3MKCA 4OIFA 3T07A 2O0TA 2HISA 1A4LA 3QXBA 4Z1AA 3L5LA 2ZQ0A 4B16A 4LPCA 1NFGA 4NRSA 3JXVA 4UFJA 3DGBA 1T40A 4PUUA 4RXGA 4CU7A 4IWWA 4DYJA 3U5UA 2J7DA 1RUSA 3MJMA 3N04A 3IGXA 3AHVA 1JD7A 3H4WA 4LAVA 4L80A 4DROA 2VFIA 3DEQA 3KOYA 1EO5A 2WQPA 4GABA 3UXKA 1H0GA 1GOQA 2VGFA 1WBHA 3BURA 4LU0A 5DEZA 3WH7A 3KOFA 2QAPA 4MSPA 1PDYA 5BOOA 2ZBTA 2QCMA 4OBSA 2CLIA 3AROA 1QNVA 2A7PA 4LOCA 1OY0A 5LIKX 1TRDA 1Z69A 2QCDB 1E70M 3T0TA 2XP7A 3W1TA 4L4MA 2VZTA 3I68A 2WJFA 2HE5A 3WUFA 1EF3A 3LGDA 1P6CA 4OQVA 1BWLA 3ITOA 1YBQB 4S3AA 3S5NA 4C6KA 2ZUUA 4O1CA 4BWLC 5F4WA 4LTSA 3Q2DA 2D20A 5GJMA 1ME8A 4AEOA 5TBOA 2W4XA 4CD8A 1W17A 4ZO7A 2RKXA 1TJ0A 1Q6CA 4IT6A 2BXZA 2QUTA 3W0KA 3T6CA 1QJWA 3DYOA 4DZ2A 2VDIA 1CIUA 3FVDA 1V6VA 2JF7A 2A7NA 4JX4A 3LEPA 3LM3A 4OJYA 1BFNA 5JVLA 3KL5A 5T9CE 2VFDA 2YOCA 1UR2A 2QUNA 1Y8BA 4INFA 2BV9A 2ZDRA 4NF7A 6XIAA 5FEPA 3KACA 4RCXA 3VNJA 2PV1A 5K2ZA 4S3CA 2OZTA 2PF8A 4B2DA 4UTKA 3GDLA 3S3GA 3WLHA 5CJ5A 2ZRWA 2WOQA 4H83A 2V3EA 4PMZA 4MDOA 1TQJA 3IKGA 3B9DA 3INPA 2NWSA 3WJZA 3VFCA 5AB3A 4LCRA 1LROA 4CU6A 2G3NA 1KFLA 4LAYA 2VGBA 1M68A 4BQ3A 5CC3A 5CCZA 3G18A 3BJTA 1TA3B 1JULA 2DV0A 2OT1A 1J11A 3NUKA 1D2KA 1K9EA 2BVTA 1KFCA 3WD2A 2MLZA 1D7JA 4RJEA 4Q22A 2FKEA 4M6VA 2EAWA 3DERA 3H53A 4N4PA 4CEXC 4NNBA 2QUUA 5I98A 1O66A 1SFJA 4GX9A 4AAJA 3LXAA 5EYWA 3CMFA 4E38A 1TO3A 2AGTA 1SFSA 4D72A 4HBKA 2GQ9A 4ZMGA 4D8ZA 3ARYA 4GX8A 4MF4A 2ZE0A 3VIMA 4RV8A 4B5VA 2QCNA 3LDVA 1V3IA 4F79A 4C1LA 4H8VA 4ES4A 2ZUTA 3IGUA 1JZ4A 4JIEA 1NDYA 4F0MA 3NEHA 3AIWA 2XP4A 4LFYA 4DWSB 1HKWA 3VNIA 3NFUA 2BOGX 5J5RA 1IGWA 3E38A 2FQIA 3W4RA 2VZUA 4LCSA 3KBSA 2OSYA 4C5YA 3W76A 1YDVA 1IHIA 2F4EA 4OT7A 2ISFA 4PTVA 3JR2A 3QH2A 1H61A 3R10A 3B0XA 3CPGA 3IARA 3BCFA 1XGEA 3KP1A 1SR9A 5B7YA 3LHVA 1EYEA 3R1ZA 1KR0A 1FHDA 2ZC8A 3MI3A 3O07A 5FF7A 4S1FA 4JFTA 1QNSA 4NJKA 5JUVA 4ZQMA 4L72B 1OC7A 1VFHA 3URAA 2PDIA 1LWIA 3P2VA 5BWAA 1R2TA 3P3BA 4K8EA 1K9FA 5FESA 2GFTA 4Y9AA 1XCXA 4AIOA 4KRTA 3VXGA 4IIDA 2PB1A 3U9IA 3LSBA 3QKEA 2E5CA 1ONEA 3F4VA 4BK9A 1CXHA 3LS9A 1Q6UA 5HANA 2O92A 2VXNA 3SZ8A 2PTDA 1RQHA 2G95A 3G1DA 1TJ2A 4JHMA 3GU2A 2QAFA 2WVVB 2DH2A 1NOWA 3G24A 5GJNA 4G1KA 3O5LA 3QW4B 2RUDA 4R88A 3PTKA 3AIUA 3I3BA 3URBA 1HGYA 2QMJA 3THAA 1SZRA 4IP5A 1GCYA 5H2ZA 3CZJA 5LXXA 3DG3A 2NXGA 2N87A 4DNMA 1EJWC 3LTYA 1AODA 4MTVA 5CZSA 2ZUNA 4B5SA 3C2OA 3LCXA 2J13A 3HPAA 3NQVA 1UR9A 3M4HA 3NQEA 3AUJA 5BXTA 1T99A 3UPWA 4KQZA 5XIAA 5E0KA 1HKIA 1ZJHA 1JYVA 4US5D 1Z8AA 1XL9A 2DIJA 3H2CA 1JCMP 2EG7A 1J0JA 1DQWA 3I6RA 2VKZG 4PUDA 1U79A 3B0YA 1WA3A 4PMDA 4N4QA 5I3HA 3RK8A 1OFBA 1XIIA 3CHFA 3I3EA 4FAMA 1A5MC 3WX7A 4ODQA 3GDRA 5H8MA 2RJGA 1ALDA 2Q3RA 1OVDA 5IBXA 1JDAA 1DBTA 3B9OA 4KMQA 3GBEA 4N0RA 1VS1A 3NTYA 4ZS6A 4D9PA 3W85A 3OJGA 4O14A 4TR9A 2NQHA 3LV5A 1PHWA 3VOCA 4FNRA 4XWUA 2QDHA 3KAIA 3H4GA 5AC6A 5DO8A 1PE1A 4FXFA 4ERGA 3RGTA 3NL3A 3KWSA 4X0NA 4B4FA 5LHFA 4HU4A 1L8PA 5DCBA 2YDAA 3UZXA 3PBGA 1SJBA 4QE1A 3B97A 3DECA 4D6EA 3TROA 3PANA 1MVYA 1UR3M 3MPGA 1FX6A 4PUEA 2GUBA 1EDGA 2P88A 3TOPA 2NV2A 3NXLA 1R2SA 4OECA 3GK0A 4RV3A 1M9HA 4GISA 2Y78A 4A3QA 1CLXA 2V68A 3E9AA 1XCFA 4TU1A 3HMCA 2ACQA 1QZ2A 4L9ZA 3ZT7A 2J25A 4W9PA 4O57A 1Q63A 2BOEX 2CFFA 2X1SA 1C93A 2VTFA 4O1BA 3RG6A 1FWTA 3CWNA 5GVJA 3T08A 4WOQA 2LKNA 1ONRA 4DO5A 1D7FA 3OLEA 4W88A 3EWDA 1VH7A 1KC7A 1WDPA 4WDUA 3CAWA 1U5JA 4IIGA 3K8KA 3M0KA 4ZODA 3ALFA 3O5KA 3RHGA 3UR8A 4LUSB 4LYPA 3PZ9A 2FZDA 1FWEC 1GHSA 2VC5A 5BRPA 3UF8A 1HL8A 2G37A 1XFBA 4XAPA 3EA1A 5C54A 5HUOA 3VGBA 3V0TA 1Z6KA 4IQDA 2Z1WA 3CV2A 4IPJA 1TCDA 4PB3A 3VIJA 1QT1A 1WE5A 1YNPA 4Z1YA 2CW6A 1RAKA 4TV6A 5HPOA 2XG9A 8CGTA 4S3FA 4NJGA 4G7EA 3QM3A 3B40A 1JNSA 1Y65A 4Y8EA 3LHUA 1BTMA 5EBAA 3N6JA 3MBDA 2W27A 4XO7A 3IV3A 1XKYA 4H04A 5I3FA 1XBVA 2VC9A 5D9MA 3RLUA 3FA5A 5T91A 4LT9A 5HINA 3SN4A 2V69A 4FS9A 3SECA 1BAGA 4PUWA 4CQBA 5A3HA 3UI4A 2IXUA 3HO8A 3QPEA 3G6MA 1E9IA 4ASTA 2EPLX 4ZEPA 1OC5A 5K9CA 2XGBA 4HPXA 2ZYFA 2HEJA 4DPQA 3MUCA 2J79A 3MWCA 1RPKA 1W1A1 1UA3A 5MKGA 3P60A 3JS3A 3ANVA 4WCJA 4FXRA 4RPPA 3W82A 4ACZB 3NPXA 2B5UB 1EP1A 4Q8PA 4XAFA 1W9BM 4MAZA 2JFEX 4W8LA 5D37A 3WLSA 1G4SA 5FEXA 1KM2A 4BWLA 3G1SA 3N1AA 4LAUA 2AQVA 4E0CA 2PDLA 1O94A 4DAFA 5TF0A 3QFWA 2PPPA 1Y5WA 2WMKA 1ZENA 5C6MA 2Q71A 4UR7A 2JKEA 1K8XA 4JTSA 3DX5A 1KXQA 3VZXA 4MYAA 4GHRA 2X41A 2QT3A 4I5XA 4QP0A 1ZJIA 5C7HA 3W38A 2F6UA 4JQ4A 4KRZA 2YDSA 3WF2A 3RNDA 4FNSA 2WKLA 3ONBA 5IRPA 1A5KC 4L65A 4OUIA 3QZEA 2YW3A 4JHOA 1DVJA 2LPVA 4UZSA 1DHKA 3SCRA 2YL8A 5D9NA 2C16A 3VD3A 3CGTA 4UTIA 1HP4A 3F5KA 4G50A 2PDKA 2VZOA 1ZBCA 4H00A 4F48A 2E5BA 3K1DA 3NG3A 3LCLA 3GVGA 3E5PA 1SM9A 1S1RA 5H1WA 4M6QA 2BZNA 2J9ZA 2QCDA 4DZHA 2F8QA 2DIKA 4YYFA 4XX6A 1FWWA 3RITA 4Y9MA 4J7RA 3N13A 4ODPA 5HW7A 1DV7A 4J40A 1NMVA 3M41A 1G1YA 4JBRA 3BLDA 2BHZA 4CNOA 3S9YA 4HQVA 5EA9A 2DPEA 3W7GA 1CGWA 2PF0A 4FNQA 4ZOCA 4HCLA 3CO8A 3DFSA 4OBTA 1SUXA 2BY1A 3DFNA 5D32A 3TNOA 3HZ3A 3FSUA 4ODRA 5EMUA 4TOQA 4S3EA 2ZR5A 1MFUA 3MMWA 3G5EA 1F6KA 3BTNA 3A3WA 5G1YA 3SCUA 2DG4A 4KFPA 4A22A 1PYMA 1M01A 4BKNA 4I9MA 4ICMA 1O5QA 3SDOA 2H6RA 2PI6A 3A64A 3DKJA 1QI3A 2CESA 5F4XA 1D7HA 3GVQA 1WXZA 2KI3A 4XKYA 1NSJA 4RE2A 3I7RA 2E7FA 5D2TA 1KGWA 2HPMA 1R86A 4IMDA 3CUXA 2HTMA 3BSHA 4NYUA 5CSRA 3STEA 2VDHA 5DMNA 1WQ5A 3EEZA 2XP6A 3CQHA 3ICJA 3KP0A 3V1PA 1XGDA 1MXGA 5HWCA 1KT0A 2WHKA 3KX6A 4XZIA 5CGQA 1AQMA 2BY0A 2OYMA 1HKMA 3J7HA 2ACUA 1JXKA 3AMCA 1EPVA 2OR2A 2DSWA 1TV4A 3BLPX 2OQHA 4MG4A 1CB2A 1QU4A 2GVJA 4GXWA 1DWGM 3SI9A 3SY1A 4GQQA 4Z17A 3JU2A 1VP5A 2OZ3A 5GPGA 4REQB 1ONWA 4X22A 2DH3A 4G8TA 4I6VA 2OG9A 2QXWA 1H09A 1B3YA 2I5IA 4TV5A 3PPGA 4DXKA 2G97A 1ISZA 1EGZA 4ZCWA 1PZ1A 4H9YA 3UZZA 1E0XA 4H6KA 1FDJA 3AWOA 4AD0A 3UI6A 1RJRA 1IEVA 1W8SA 2E9BA 2O56A 2PGEA 1JIBA 3SQLA 5D2YA 4MVAA 2Z7GA 3GZAA 3WIJA 1OG6A 1KRBC 1J10A 4Q4PA 1FKBA 1PWLA 1UZ1A 1KV5A 3W23A 5AYYA 2HMCA 1GVQA 4IGHA 3UT0A 5KZMA 1B3WA 3PY2A 1C8QA 3P5YA 1UD8A 4GUJA 4PODA 4HZ8A 2Y88A 5CPSA 2ITKA 2Q01A 3CZ8A 1ZY9A 3ZVIA 1AW2A 4AQLA 1M04A 1VB9A 4DLMA 2TRSA 4GRSA 3EMQA 4C6CA 3IVUA 2L5HA 1VFUA 2QYGA 1YTDA 3VIIA 3PP7A 3M0IA 2UV8G 1EL3A 3GHUA 3NZQA 3DG7A 3CQ0A 4UFMA 2QHAA 3ARVA 2PFHA 3S5YA 2PLKA 4JR5A 3EXTA 4C6EA 3LM7A 4AH7A 4J3WA 3I6CA 4K68A 5HUAA 3GS6A 1QVBA 5E0FA 3TLLA 3HA1A 2HXTA 3W6MA 4BQ2A 3WG6A 1FWAC 2OQLA 4PA8A 5JBFA 5KSWA 1XHGA 2Y7EA 2PGWA 3WF0A 3CZEA 3ZR4A 2ISSA 1EOMA 2FZNA 2H90A 4J3TA 1CXKA 3MO7A 3OVQA 2J75A 4XKMA 3ISIX 4E2OA 1JDFA 4LBSA 2NLYA 3AMGA 3QQ1A 5FEWA 4IPPA 4NQ1A 4E3VA 1P4CA 2Q8LA 1U1JA 2I57A 3M0LA 3P61A 1W5OA 1KO0A 4ZZ9A 4PRWA 4B4HA 3HPSA 3OU8A 1FY6A 3W2KA 1RCXB 3PZOA 1V3HA 4IQJA 1IZKA 4U2ZA 3CC1A 3FAWA 4AZHA 3WFLA 4MZ8A 2GPTA 3DZ1A 3LHZA 1J5TA 5CSYA 1CXLA 2QMKA 3B8VA 2V5DA 2PA6A 2Z0IA 4IMEA 2Y2WA 1K4GA 1CYGA 4A6GA 4F9JA 4KEVA 2EHHA 5AHMA 4P7QA 2OEKA 3O7UA 4PC8A 1KR1A 4FF7A 4JTEA 4DIPA 3FJNA 3EPNA 2P53A 3W7OA 3UD6A 1TMLA 3KRSA 3H24A 2QPXA 3UPBA 3PZIA 3EWCA 4CVUA 4HU3A 1MW2A 2P10A 2R1LA 3WF3A 3TSDA 1TPVA 3W81A 2HVOA 3N2OA 1FP8A 1NARA 6REQA 5CBBA 1XLKA 4XQ6A 1X1NA 1F9CA 2XFFA 1X38A 3K13A 4YCOA 4IM4A 4O0ZA 1P7TA 4GI9A 4HN4A 1VCFA 3PUDA 1XDLA 4ML9A 3THDA 1XBXA 4H9XA 1GJWA 1I2NA 4V15A 1QOXA 3UWUA 4UQAA 4U28A 4CGTA 3BH4A 5BWFA 1Z32X 3WLNA 1BRLB 1MDLA 1NMWA 4DRPA 1FWBC 4O1EA 3LBOA 4MFEA 3I7SA 4DRQA 2HPIA 4KERA 5DXXA 2FB2A 4A3YA 3W3OA 2QUVA 3BG3A 3U5YA 1L2UA 1US3A 3BCDA 5I6SA 2W9MA 3VYLA 3W2LA 4ECLA 2OODA 4QEEA 3TR2A 2WLZA 4Q8QA 4L1GA 4ICNA 4Z2JA 1AJ2A 3WF1A 3CQKA 1QHPA 4DRKA 1B90A 1Q6LA 1UZHA 1XSKA 3TX9A 4FAPA 5K4XA 4IHCA 1W9UA 2YJQA 1W9PA 1Q6HA 3C0JA 5LIWX 1SW7A 4FHAA 2YZ5A 5EL1A 5BMWA 4KCUA 1G4TA 3MSDA 3T0CA 1VJZA 3FYOA 3ZJ8A 2NT1A 1KV8A 4JTRA 5HUPA 3GQYA 3MUAA 3DI0A 2F23A 2PDGA 2PDNA 3PB2A 1UD4A 3PPCA 3CXOA 4C1NB 4GH1A 4JTIA 2YCLA 1FWRA 1HXVA 4PBGA 3NOYA 3V36A 4LF1A 1W3LA 3GH7A 2VR2A 2VCDA 3EDJA 1RQEA 3FXYA 2FMNA 4LBRA 5CZKA 4TW7A 1F5ZA 1RLCL 5GJPA 7ENLA 3KEHA 4LAOA 1IEWA 2R91A 1A80A 3Q45A 3E0VA 3HPXA 3ME3A 3RRAA 2QNEA 3W7EA 2RFGA 4G1NA 2Y5JA 3T0BA 3GX9A 4AWTA 1GOMA 3HQNA 2HS8A 4R5EA 3HF3A 3HIJA 5LSMA 1TWIA 1LOSA 3A4JA 3EX1A 5CJMA 4JNZA 3AI0A 2XGZA 1E3XA 4H3DA 1FXQA 1AFSA 2HWGA 3IACA 3NCOA 4AY1A 5T26A 3W6LA 5M1TA 3AU2A 1ITCA 1HX0A 1K9DA 4CCCA 5DELA 3RM8A 3Q65A 1UR4A 4HARA 1XWYA 3OYZA 4GOAA 3LNMA 4NJIA 3AU6A 4LUTA 4Y8FA 4DZ3A 9CGTA 3O5DA 3BUVA 2XVLA 2A6NA 3ORWA 1IR2A 4P8VA 3NZPA 4PTWA 4PCFA 1SZFA 5K9DA 3H7VA 2WMFA 4DBDA 3GG7A 4MDPA 1UUOA 1WBJA 1J2BA 1XLMA 5C9RA 3RGCA 3CEUA 2YCIX 3XINA 3WLRA 1ITUA 1DPMA 2OLHA 1T8QA 1Q45A 2OO6A 3KDNA 2QJMA 3H22A 1K7EA 3A4WA 1XI3A 4G2PA 4BF9A 1GZJA 1F7BA 2J78A 5A6BA 3FEMA 2Y1HA 5B8IC 4UC5A 4P7NA 4OOUA 5LNVA 1J6PA 4V27A 4Q6XA 2GSEA 3L2MA 4GYPC 3DIPA 2VN1A 1UHVA 1OK6A 1AH0A 3C8NA 1JPHA 3MQTA 5ABGA 2J7BA 4AISA 2X7VA 3W7DA 3ATZA 1FHLA 3M64A 3CT7A 3PWIA 3LY0A 4AZCB 1RCQA 2Y8KA 1D8WA 1VENA 3L2IA 1NELA 3B04A 1PCKA 2TMDA 4WEVX 1W5QA 1YXYA 2G3FA 1BVWA 1YPIA 1DIKA 3N3MA 2FHBA 1JF5A 2CBIA 3MB9A 1NWTA 2ZIDA 3BV4A 2QCFA 2Z2UA 3HGOA 2FFCA 1ZALA 5EGRA 1UWUA 4IH3A 5A6JA 3K5XA 1XLHA 2ZXQA 2KGJA 1IEXA 1CDGA 3T4WA 1E6SM 2ZZ6A 4FI4A 3VDHA 1DHPA 4H6RA 2ZTKA 2UY5A 5FEZA 3R11A 3E0FA 2JIEA 8XIAA 4MWAC 1XBZA 1B3ZA 2XWEA 3ELFA 4W7WA 1SO6A 1V7YA 3A47A 2ZX5A 4WK9A 1S39A 4DY1A 2F21A 3BLKA 4KBXA 3L66A 4LUTB 5HQMA 1US0A 3POHA 1AQHA 5C55A 1GPFA 3TA6A 2DJXA 2ZICA 4Z2KA 2MPHA 3AYTA 3W83A 1F3EA 2YDRA 3ZR5A 3DN5A 3AISA 2ZWYA 3U8GA 3EKLA 1GW1A 3WJWA 4LQ1A 1QW7A 3Q67A 3D6NA 4O52A 4DJDC 4AD3A 2IPJA 7PTDA 2PDJA 1MW3A 3R0UA 5FL0A 1IWBA 2WPBA 4D6CA 1S2TA 2KE0A 1GONA 3GNPA 2G5WA 1KM1A 2QJHA 5JBDA 3I7QA 5CPMA 3DBNA 4O8RA 2AMXA 3RN6A 3S2JA 1HF6A 4GJIA 5E6YA 1QR7A 4LBUA 3KHDA 1OFRA 3GNNA 3MMDA 3WD4A 4N6EA 1XLBA 3B05A 4UFKA 3S9IA 1XS2A 4KGLA 3WL1A 4N6FA 2ZXAA 3O5IA 1AVAA 1NTHA 3RR4A 4GGQA 1NY1A 2Z6JA 1NP0A 5EKYA 2QJGA 2Y63A 1CBGA 3BW2A 1ICPA 4C1NA 2ACSA 2E0PA 1WZLA 4JTDA 2DZVA 3WQ6A 5D8ZA 3PJTA 3BL3A 4RDYA 2RJHA 2Z1KA 2XWDA 3NSMA 5LIXX 1W9VA 4FLRA 2DSVA 1DKWA 4DAIA 2VX7A 4S3DA 1YDNA 4UTWA 1TV8A 4QS6A 3TTOA 2YPIA 3MI2A 4ZFMA 3N73A 1FKSA 4LUIA 2CBUA 4GG9A 1AQFA 3SCPA 3E2RA 4QEHA 2OWXA 3PK7A 1FFRA 1EDTA 4FEZA 3KDOA 1IEIA 3L4XA 4HGXA 2W0UA 1UIPA 5FJOA 3M9YA 1OCNA 5AYXA 2Y7GA 4ZB5A 3E2VA 2V3DA 3KRUA 3W74A 4H7ZA 3EX4A 4LVAA 3TWAA 1F6YA 5EB8A 3K46A 1JCXA 4AHOA 4GFIA 1EIBA 4GKLA 1Q7QA 1RLDA 3EOEA 2JZVA 1ZBWA 7ODCA 3KBVA 3S1UA 1FKXA 3QMTA 1W1VA 3UWYA 3OLGA 3QR0A 2V8ZA 3TP4A 3DFQA 4U84A 3K8MA 2DUXA 2ZZ7A 3WLLA 2CBJA 4PEKA 5IFTA 3MUXA 1J6YA 3AS3A 3TMLA 2ZADA 2ESCA 2A2IA 2DZBA 3GHRA 4IPXA 2D9FA 1E56A 1LOLA 2PDUA 3BAJA 3KWXA 4J2PA 3WK1A 4CD5A 1EYWA 2J8FA 1FKWA 3M6YA 3PVFA 2Z6IA 1IXQA 1JCHB 3CO4A 2IKGA 4W93A 3O6CA 1MI3A 2PRLA 3L4TA 3UWZA 3LCFA 1L2QA 2V5BA 2C15A 4JOMA 3WH8A 5DRCA 2O7QA 3GHSA 4ORIA 2XH7A 5CPOA 3VGGA 2PWHA 1WDSA 1DJYA 4GK8A 5EY5A 4U85A 3W29A 2INEA 3KZPA 3HGRA 3WD1A 1B9BA 1RD5A 2X1RA 4UQEA 1XYLA 4A2RA 2I9UA 5GPRA 2Z00A 3GY1A 3W7HA 1K8CA 2CERA 3IIZA 3NQ7A 3QYSA 3QOMA 4NVTA 4KIEA 4JTKA 5G4WA 4C02B 1WZAA 4PFHA 4RE0A 4ZSUA 2C0AA 2IUZA 4MGVA 1EP2A 4HYWA 1QPRA 4DUWA 4LS2A 1UASA 2R6OA 5C7VA 4V1YA 4BQ4A 2HVNA 2O9TA 1FTXA 4E8CA 1K03A 4NU7A 4C6FA 3SGGA 2GYIA 2XIMA 2WV8A 4MYXA 4Z1BA 1RJPA 1VEOA 2PDXA 2VMFA 3T2OA 3FW6A 3KTXA 3N4AA 2YIHA 1W91A 4E4UA 1KKOA 1D6OA 3CYJA 3GTXA 4M6UA 5DMLA 2YKKA 3E2SA 4MM1A 3U2OA 1Z9AA 3DXIA 2BHYA 1AH3A 1OGGA 2AGKA 3T05A 3RM4A 3W22A 4DO7A 2POZA 3U7VA 1FWHC 1QHZA 2I7GA 1FBAA 4PCTA 4Q4KA 1TWDA 2B7QA 1W3NA 1MDRA 1F3XA 1Z7AA 2TAAA 3CIVA 4FXSA 5LGXA 3OW1A 2Q02A 3BK0A 2Y7FA 3EWWA 1IF2A 1EP3A 2AWGA 2NV1A 2V3GA 3SR7A 3ABZA 1KFBA 4NZCA 3F4DA 3KBWA 3FV9A 3IIVA 4F8XA 2HZGA 4A3HA 1V0MA 2MLYA 1REQA 4F0RA 1ISVA 1MSSA 2PPOA 1UMLA 2VJXA 4AIUA 3IJ9A 2OWCA 5G5IA 2FZBA 3OGVA 1OQFA 2C1GA 3L23A 5BXSA 5LHEA 1SW3A 3TTYA 2XP8A 1TWSA 2WCSA 2G96A 5DY2A 3FKRA 1X97A 4YN5A 4C7GA 3W88A 4TXEA 3M5YA 3R89A 4IPLA 5C9WA 1SZGA 3CMJA 4L56A 3TDBA 1EUNA 5DBTA 1BYBA 4D71A 1SPQA 1TUXA 3WBEA 2CLLA 4PMQA 1GZGA 2HRWA 4LSBA 1XW8A 2ASHA 4RKAA 4PTMA 1VFLA 3ZJKA 3IK2A 3K4AA 3VNZA 3Q37A 4I9TA 2WZTA 1P6WA 1K8ZA 3ALGA 1UD5A 4IZGA 3REQA 4I7WA 1SGJA 2DFAA 1T7LA 3W53A 1J8VA 2X2YA 1W3HA 2YBUA 1E6QM 2ZC1A 3ZS4A 4HCDA 2FLIA 3S6OA 4N9BA 1S3HA 2ZUMA 1EHAA 1KCZA 4URIA 4HT3A 4U31A 5H6HA 2X0YA 3ZT6A 3HN3A 1BWKA 1HVXA 4JDBA 1W9DM 2IW0A 3O5GA 1V0NA 3WQVA 1HL9A 2C91A 2NV9A 3L68A 1TUFA 1WDDA 2WSYA 4X0VA 4PMVA 1ZLPA 3WH5A 1LBFA 1ZB5A 4G7FA 1KLZA 1TPFA 3APGA 4XAKA 4NAFA 1ML1A 1WXYA 4XBKA 2NX1A 1O5RA 1TV7A 1LCOA 3CIXA 4LALA 3UXAA 1JAEA 4MB1A 1ZS2A 4QCEA 1KQZA 4CCZA 2NUWA 1E4MM 4IICA 1O1ZA 3IIOA 3WK2A 1XJBA 4KWOA 4K8GA 4S23A 1LORA 4MZYA 3G1HA 2BXVA 4KS0A 1XM3A 4EAYA 1EFZA 1PKMA 5HPCA 2GQAA 5HWJA 4OV4A 4BF7A 1J96A 1GW9A 4H2HA 4EIVA 1OHLA 3V35A 1OX6A 4HA0A 4HVXA 1W1TA 2QCCA 4DWDA 3UBPC 4IQLA 5HNNA 1E1EA 1V51A 1BL4A 3ZOAA 1YIXA 3OBKA 4LVDA 4E2VA 1I4NA 1O4UA 4FA3A 4Q8VA 5HOSA 4TIMA 3ZLHA 3SCWA 2Y5SA 4KCTA 2EF9A 2EKGA 4PULA 4I9AA 4MLJA 4MNLA 3NO5A 1ME9A 5AHNA 1OINA 1JCNA 4UIOA 3PZVA 5CSSA 4GIVA 3QR3A 2YGYA 3EGJA 2QW5A 3UWWA 2ZFAA 1A5AA 4ACZA 1XIEA 3VUSA 2YXXA 1HO1A 3W7CA 1ENUA 1BYAA 1H1NA 4GUGA 4QNEA 1VBUA 2ZCGA 5TNVA 5BU9A 4JYSA 2ZRXA 3IAPA 3K8LA 3OVGA 3DAQA 3B9AA 4Z0SA 3MHGA 3FAXA 1GVIA 1RCOB 3A3XA 3VZYA 2VCCA 3LA4A 3CLWA 3L2LA 1SZEA 3RF9A 5M2FX 4O4WA 4RDWA 1W3JA 3P14A 1E15A 1FKIA 1V77A 1A5UA 3DC8A 1TJPA 3WBAA 4BEQA 2GQ8A 3TYZA 3MHFA 3NJ3A 4L5ZA 3N15A 2I1OA 4QG6A 2RURA 2YDQA 3P7YA 4JX6A 3M0HA 5E9XA 3LYEA 1ESWA 3ZM8A 2NQLA 3IJDA 3U2ZA 1YYAA 3GDTA 3ABSA 4E8GA 5CSUA 2G0WA 2OX1A 2A1YA 4UB9A 1DWAM 3IKDA 1E73M 3GFYA 4U5IA 5LIUX 1H63A 4MSSA 4ZOBA 3F4CA 3V7PA 1W1ZA 2DIEA 3SIZA 3VOFA 4A8IA 4Z2GA 3IK8A 3CM4A 2DT3A 2PURA 1ZCCA 1H49A 5C70A 4NYYA 1VPYA 1PINA 3EXSA 3LPGA 4ATDA 1LZOA 2NVAA 1UA7A 4XD4A 3ZVHB 4QM1A 4YIWA 4J4NA 3WMSA 4UTMA 2ZZ2A 1DQUA 4OTKA 3QZAA 4OU1A 1J0HA 2GZXA 5KTLA 1OFQA 4KQNA 1K8YA 4WDTA 2D3NA 2L2SA 3TONA 1M6JA 4GQRA 3IV8A 3TYDA 2J9XA 3OVRA 1ECQA 3ARZA 1CPUA 3QPZA 3LLDA 3MCNA 4G2DA 3TTQA 2VQTA 4R7JA 2XVKA 3REQB 3NI6A 3A21A 3PTMA 1VBGA 5CPTA 1CXIA 1FVPA 2H9AA 5HWBA 1BF2A 3VKJA 4W5ZA 1H41A 4C65A 3CV7A 3WDHA 4ITZA 4UFHA 7CGTA 7XIMA 3L12A 1A3HA 1K77A 5A6AA 5BXJA 4O19A 2VDGA 4GZJA 3DG6A 4RZ4A 4L61A 2OSWA 5HTGA 3EB2A 3RO8A 2PPNA 1JCTA 1PJ9A 2PCEA 3M07A 3W2MA 4CNNA 3TXZA 1JNEA 2QV4A 4QITA 2DEPA 3F2DA 4RNHA 3QC3A 4PBEA 2PDWA 4D8LA 5AHFA 3DUGA 1UC5A 1BYCA 2XN0A 1QW8A 1XGZA 2CYGA 4HU8A 3XIMA 4KCVA 1Q1CA 3IWPA 3L5AA 2MANA 4HPJA 3LBMA 4ROQA 3T1GA 2E9MA 4AW7A 3V5FA 3W7JA 5A2CA 1S3TC 5K4ZA 5CPQA 1OCJA 1M65A 2IQDA 5CPLA 3EWXA 3MU7A 1WKDA 1Q6DA 2XIBA 3GUGA 4NI3A 2OU4A 4W8AA 3LG3A 3GXDA 3ZZ1A 4W9OA 5DANA 2QJNA 1VEMA 2CZDA 3M0VA 2WMJA 4WUIA 2E1WA 4JN7A 2C13A 1P5BA 2RSEA 1H11A 3SUSA 3GXTA 2UZ5A 1U5HA 4OBRA 1O1HA 4R7WA 2OX4A 3BOXA 3W28A 8A3HA 4A4AA 3CZKA 1ZFJA 1W3IA 4FOJA 5D2VA 3S46A 3QHMA 2YCLB 5FSDC 1BF6A 1PB0A 1DYSA 4GQBA 2ACRA 4HSNA 4IXXA 2VX6A 4QIUA 4PEEA 3BOLA 1UPPA 4HU0A 4DVOA 1H1ZA 5A95A 1IGSA 3RX4A 3QV8A 3UJSA 3M16A 3H7UA 4IJRA 2VZVA 4XO6A 1XR2A 1PZ2A 3ITLA 1S5TA 4WY0B 4MWAE 4WJ8A 2CLEA 1EHNA 1MEWA 1T5AA 4S3BA 4H9UA 4GIYA 3GFZA 4F40A 3L4UA 4XB3A 1H7WA 3KAOA 4GA8A 1Q7MA 1J4RA 1A3WA 3NO1A 5AC4A 1UD2A 4UCFA 1UZDA 1GK8A