1C9HA

Crystal structure of fkbp12.6 in complex with rapamycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
107
structure length
107
Chain Sequence
GVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP12.6
publication title Structure of FKBP12.6 in complex with rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 22
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1c9hA00
3O5FA 2VCDA 4JFIA 4ITZA 3NI6A 1W26A 4U86A 4DZ2A 2K8IA 3WH0A 2ITKA 4DIPA 1FKSA 1L1PA 1BKFA 2IF4A 1QZ2A 1QPLA 1FKJA 1YATA 4G2PA 3O5LA 3FAPA 4TYOA 3O5OA 2MLZA 3CGMA 5GPGA 2L2SA 3O5RA 2LPVA 3GPKA 2RURA 2DG3A 3O5IA 4O2TA 3UI4A 1JVWA 3TC5A 1NMWA 1ROTA 3UQIA 3O5PA 3UQAA 2DG9A 4JFLA 1NSGA 3O5KA 5HTGA 1ZK6A 1T11A 2LGOA 4DRMA 1Q6HA 4IPXA 3RFWA 3LUOA 2FKEA 4TNSA 3I6CA 4LAYA 4TW6A 4W9OA 2PV2A 1FKGA 1FKRA 5HW7A 2KI3A 1QPFA 3EY6A 3KZ7A 4U84A 3JXVA 1U79A 3RGCA 4LAWA 1FKDA 2D9FA 4JYSA 3O5JA 1FKTA 2JZVA 1YW5A 1Q6UA 2ZQSA 2DG4A 3PA7A 4ODQA 2LKNA 4ODLA 1KT0A 3OOBA 1D7JA 1FKIA 1FAPA 2ZR6A 1EQ3A 4JFKA 4ODMA 2PPNA 1FJDA 2RUCA 2ZR4A 2LJ4A 1FKBA 4W9PA 1M5YA 1JNSA 1ROUA 1A7XA 3H9RB 2XPAA 4DRQA 5J6EA 1J6YA 4JFMA 5HKGA 1FKLA 4NNRA 2MLXA 3KACA 5HUAA 2ZQVA 3O5DA 3UI5A 2XP3A 4J4NA 4JFJA 1NMVA 4DRPA 5HT1A 1Y0OA 3IK8A 5B8IC 4J4OA 4TW7A 4BF8A 3ODKA 5DIUA 1PINA 4IQCA 5HW8A 1TCOC 2KFWA 1J4HA 4FN2A 4DRIA 3KADA 3IKGA 4ODOA 2Q5AA 1C9HA 3UF8A 4DRJA 2F4EA 1ZCNA 3KABA 2MLYA 5BXJA 4DH0A 5DITA 1D7IA 2XP4A 1PBKA 3JYJA 1P5QA 1R9HA 2M1IA 2XP9A 2F2DA 2XP6A 2ZQTA 3JYMA 2PPPA 4G50A 1Q1CA 4QT2A 3IHZA 4FAPA 5I98A 4LAVA 3UI6A 3O5EA 4DZ3A 3NTPA 2AWGA 2XP8A 2XP7A 4GGQA 5HWBA 3KAHA 4W9QA 3MDYB 5D75A 1D6OA 2PPOA 3B7XA 4R0XA 4TX0A 1FD9A 2XPBA 1BL4A 4C02B 3PRBA 4ODNA 3TDBA 3NRKA 1JNTA 2PV3A 2F21A 2UZ5A 3KAFA 2MPHA 4ODPA 4QIBA 2M2AA 4MSPA 1HXVA 2RSEA 1F8AB 3KAGA 1J4IA 2M08A 3PRDA 4U85A 4DROA 4DRKA 2XP5A 3O5MA 4IQ2A 5HWCA 2FAPA 4LAXA 2PBCA 2KO7A 5DIVA 2ZR5A 4QT3A 1KT1A 4DT4A 2KR7A 2KE0A 2RQSA 2PV1A 1D7HA 2ZQUA 3KAIA 1FKFA 2OFNA 3CGNA 1EYMA 4GIVA 2RUDA 2MNTA 3VAWA 3O5GA 1FKKA 5HW6A 4ODRA 4DRNA 2VN1A 3O5QA 1Q6IA 1FKHA 1B6CA 1N1AA 2KGJA 2N87A 3KCEA 2Y78A 4MGVA 4N19A 3TCZA 3UQBA 1F40A 4TW8A 2RUQA 3IKDA 1J4RA 4ODKA 4DRHA 2MF9A
chains in the Genus database with same CATH superfamily
3O5FA 2VCDA 1X6LA 4MNLA 4XAKA 2F23A 2IF4A 4HARA 1QZ2A 4P8XA 1W9VA 3O5LA 4TYOA 3UI4A 1KFWA 2LPVA 3GPKA 2DG3A 1JVWA 1NMWA 1HJXA 3B9EA 3O5PA 4L72B 1NSGA 4R5EA 4Z2GA 2LGOA 4DRMA 3GTYX 2DT3A 4KQZA 4W9OA 1FKRA 1LL7A 4U84A 3PRAA 4LAWA 1E9LA 1JCHB 2ZQSA 3B9AA 1KT0A 1FKIA 3ARQA 2LJ4A 1FKBA 3WD2A 4Z2IA 3H9RB 2XPAA 4WKAA 3WD4A 1HKJA 1J6YA 5HUAA 1HJWA 2XP3A 3WD0A 5B8IC 4J4OA 1LL6A 3FY1A 1PINA 1J4HA 4FN2A 4DRIA 1ZBCA 2DSWA 3IKGA 1XHGA 4LGXA 4NSBA 1D7IA 3WQWA 1VF8A 1W1VA 3WL1A 4S3KA 2ZQTA 2PPPA 4G50A 1Q1CA 4P8VA 4QT2A 5I98A 4LAVA 4DZ3A 4GGQA 1W9UA 1E6PA 2PPOA 4TX0A 4R0XA 1BL4A 1WNOA 1RD6A 3ARWA 4ODNA 1UR8A 1E15A 2PV3A 4NZCA 2F21A 2YBTA 2UZ5A 2AOSA 2EULA 2M2AA 1HXVA 2DT0A 1J4IA 4DRKA 1D2KA 3CHEA 2PBCA 2ZR5A 2A3BA 1D7HA 3ARTA 3KAIA 2IUZA 3ARSA 2DPEA 2VN1A 1Q6IA 1N1AA 1ZBKA 4MGVA 4N19A 4PTMA 4ODKA 1J4RA 3G6LA 1NWSA 5HW7A 1H0GA 3AS1A 3NI6A 4U86A 4DWSB 4DZ2A 2K8IA 4DIPA 1FFRA 2WM0A 1QPLA 3FAPA 3UQIA 3UQAA 2DG9A 1T11A 4MNMA 4AY1A 1Q6HA 4IPXA 3LUOA 2FKEA 3I6CA 4LAYA 3WD1A 1FKGA 3AROA 3KZ7A 3ARYA 1GOIA 3RGCA 2YBUA 2D9FA 1GUVA 1YW5A 1EIBA 1Q6UA 2DG4A 2ZR6A 1H0IA 2DSVA 1W1PA 2PPNA 1M5YA 4WKFA 4JFMA 4NNRA 2OLHA 4JFJA 1HKMA 3BXWA 1NMVA 4DRPA 3ALGA 3IK8A 4BF8A 4WK9A 4IQCA 4HBEA 4MNKA 1WAWA 2KFWA 3KADA 4ODOA 2Q5AA 1ZB5A 3KABA 5BXJA 4DH0A 1TFVA 1P5QA 1R9HA 2F2DA 3B8SA 4IT4A 3O5EA 3BMBA 1W9PA 2PI6A 3RM8A 1SR0A 3KAHA 5D75A 3MDYB 3WKZA 4C02B 5HBFA 1SYTA 2WLYA 1E6RA 2DT1A 4QIBA 4W5UA 3KAFA 1ITXA 2KO7A 4QT3A 4DT4A 1XRVA 2RQSA 2PV1A 4GIVA 2RUDA 5GPRA 3O5GA 3VAWA 3GU0A 5HW6A 4ODRA 4DRNA 5JH8A 1E6NA 1FKHA 2KGJA 3UQBA 2WK2A 4S3JA 4TW8A 1EHNA 4DRHA 1ZBWA 4ITZA 1LL4A 1FKSA 1HJVA 4Z2JA 1LQ0A 1FKJA 1YATA 4G2PA 1OGBA 3CGMA 2RURA 3B9DA 1ROTA 3EIPA 4JFLA 1ZK6A 2G41A 3ARZA 1HKKA 4TW6A 1W1YA 3AS3A 2KI3A 1QPFA 3EY6A 1U79A 3AS2A 3O5JA 2FDMA 3WL0A 4ODQA 3CZ8A 4ODLA 4HBOA 1D7JA 1EQ3A 2WLZA 3AQUA 4JFKA 1FJDA 2RUCA 2A3AA 1JNEA 3CHCA 1OWQA 1ROUA 1A7XA 4DRQA 5J6EA 4MAVA 3AS0A 5HKGA 1FKLA 1E44A 3UI5A 1GRJA 4J4NA 1Y0OA 4MNJA 3ARPA 3ODKA 5DIUA 3FXYA 3W4RA 5HW8A 3WIJA 1C9HA 4WKHA 2MLYA 1LG1A 2QF8A 2XP4A 3JYJA 2M1IA 2XP9A 2XP6A 4UDMA 3UI6A 1NH6A 2AWGA 2XP7A 4WIWA 1D6OA 3B7XA 2XPBA 3TDBA 3NRKA 1JNTA 4KR0B 4MSPA 2RSEA 3OA5A 4U85A 4DROA 2A3EA 3RMEA 2XP5A 4LAXA 4DWSD 4ML4A 4Z2KA 5DIVA 2KE0A 2ESCA 2ZQUA 1FKFA 2OFNA 3CGNA 1EYMA 5GQBA 2O92A 1FKKA 1ZU8A 4Q22A 3O5QA 1HKIA 2N87A 2B31A 3KCEA 1ZBVA 3TCZA 3CHFA 4P8UA 1F40A 3WD3A 3IKDA 4Z2LA 2MF9A 1OGGA 4JFIA 1X6NA 1W26A 3WH0A 2ITKA 4P8WA 4DWSC 1IX5A 1L1PA 1BKFA 1FFQA 1CTNA 3O5OA 2MLZA 5GPGA 2L2SA 3O5RA 3O5IA 4MPKA 4O2TA 3TC5A 1EDQA 4L3NA 4DWSA 5HTGA 3O5KA 3WQVA 4ZPTR 1JNDA 3RFWA 4TNSA 2ETNA 2P4VA 1W1TA 2PV2A 4IT6A 2O9OA 4URIA 3JXVA 1FKDA 4JYSA 1FKTA 1NWRA 2JZVA 2DT2A 1ZL1A 3PA7A 2LKNA 3OOBA 3CHDA 1FAPA 4ODMA 4QZVB 2ZR4A 3QOKA 4W9PA 1JNSA 4Q7NA 4ZS6A 2MLXA 3KACA 2ZQVA 3O5DA 1NWUA 5HT1A 4TW7A 3ARVA 3ARUA 1TCOC 3RM4A 4MTVA 3RM9A 2DSUA 3UF8A 4DRJA 2F4EA 1ZCNA 5DF0A 5DITA 1WB0A 3ARRA 1PBKA 2A3CA 1E6ZA 5DO2A 3ALFA 3JYMA 5DEZA 4FAPA 2PN0A 3IHZA 2B5UB 1K9TA 3NTPA 3G6MA 2XP8A 3ARXA 5HWBA 4W9QA 4ZPWR 1FD9A 2DSZA 1LG2A 3PRBA 4ODPA 4Z2HA 1LJYA 2MPHA 1F8AB 3KAGA 2M08A 3PRDA 5HWCA 1GPFA 3O5MA 4IQ2A 2FAPA 1NWTA 2G8ZA 1KT1A 2KR7A 3PR9A 1UR9A 2MNTA 4ZPVR 1B6CA 2Y78A 3CH9A 2RUQA 4WJXA 1O6IA
chains in the Genus database with same CATH topology
3O5FA 2VCDA 1X6LA 4MNLA 4XAKA 2IF4A 4HARA 1QZ2A 4P8XA 1W9VA 3O5LA 4TYOA 3UI4A 1KFWA 2LPVA 3GPKA 2DG3A 1JVWA 1NMWA 1HJXA 3B9EA 3O5PA 4L72B 1NSGA 4R5EA 4Z2GA 2LGOA 4DRMA 2DT3A 4KQZA 4W9OA 1FKRA 1LL7A 4U84A 3PRAA 4LAWA 1E9LA 2ZQSA 3B9AA 1KT0A 1FKIA 3ARQA 2LJ4A 1FKBA 3WD2A 4Z2IA 3H9RB 2XPAA 4WKAA 3WD4A 1HKJA 1J6YA 5HUAA 1HJWA 2XP3A 3WD0A 5B8IC 4J4OA 1LL6A 3FY1A 1PINA 1J4HA 4FN2A 4DRIA 1ZBCA 2DSWA 3IKGA 1XHGA 4LGXA 4NSBA 1D7IA 3WQWA 1VF8A 1W1VA 3WL1A 4S3KA 2ZQTA 2PPPA 4G50A 1Q1CA 4P8VA 4QT2A 5I98A 4LAVA 4DZ3A 4GGQA 1W9UA 1E6PA 2PPOA 4TX0A 4R0XA 1BL4A 1WNOA 1RD6A 3ARWA 4ODNA 1UR8A 1E15A 2PV3A 4NZCA 2F21A 2UZ5A 2YBTA 2AOSA 1HXVA 2M2AA 2DT0A 1J4IA 4DRKA 1D2KA 3CHEA 2PBCA 2ZR5A 2A3BA 1D7HA 3ARTA 3KAIA 2IUZA 3ARSA 2DPEA 2VN1A 1Q6IA 1N1AA 1ZBKA 4MGVA 4N19A 4PTMA 4ODKA 1J4RA 3G6LA 1NWSA 5HW7A 1H0GA 3AS1A 3NI6A 4U86A 4DWSB 4DZ2A 2K8IA 4DIPA 1FFRA 2WM0A 1QPLA 3FAPA 3UQIA 3UQAA 2DG9A 1T11A 4MNMA 4AY1A 1Q6HA 4IPXA 3LUOA 2FKEA 3I6CA 4LAYA 3WD1A 1FKGA 3AROA 3KZ7A 3ARYA 1GOIA 3RGCA 2YBUA 2D9FA 1GUVA 1YW5A 1EIBA 1Q6UA 2DG4A 2ZR6A 1H0IA 2DSVA 1W1PA 2PPNA 1M5YA 4WKFA 4JFMA 4NNRA 2OLHA 4JFJA 1HKMA 3BXWA 1NMVA 4DRPA 3ALGA 3IK8A 4BF8A 4WK9A 4IQCA 4HBEA 4MNKA 1WAWA 2KFWA 3KADA 4ODOA 2Q5AA 1ZB5A 3KABA 5BXJA 4DH0A 1TFVA 1P5QA 1R9HA 2F2DA 3B8SA 4IT4A 3O5EA 1W9PA 2PI6A 3RM8A 1SR0A 3KAHA 5D75A 3MDYB 3WKZA 4C02B 5HBFA 1SYTA 2WLYA 1E6RA 2DT1A 4QIBA 4W5UA 3KAFA 1ITXA 2KO7A 4QT3A 4DT4A 1XRVA 2RQSA 2PV1A 4GIVA 2RUDA 5GPRA 3O5GA 3VAWA 5HW6A 4ODRA 4DRNA 5JH8A 1E6NA 1FKHA 2KGJA 3UQBA 2WK2A 4S3JA 4TW8A 1EHNA 4DRHA 1ZBWA 4ITZA 1LL4A 1FKSA 1HJVA 4Z2JA 1LQ0A 1FKJA 1YATA 4G2PA 1OGBA 3CGMA 2RURA 3B9DA 1ROTA 4JFLA 1ZK6A 2G41A 3ARZA 1HKKA 4TW6A 1W1YA 3AS3A 2KI3A 1QPFA 3EY6A 1U79A 3AS2A 3O5JA 2FDMA 3WL0A 4ODQA 3CZ8A 4ODLA 4HBOA 1D7JA 1EQ3A 2WLZA 3AQUA 4JFKA 1FJDA 2RUCA 2A3AA 1JNEA 3CHCA 1OWQA 1ROUA 1A7XA 4DRQA 5J6EA 4MAVA 3AS0A 5HKGA 1FKLA 3UI5A 4J4NA 1Y0OA 4MNJA 3ARPA 3ODKA 5DIUA 3FXYA 3W4RA 5HW8A 3WIJA 1C9HA 4WKHA 2MLYA 1LG1A 2QF8A 2XP4A 3JYJA 2M1IA 2XP9A 2XP6A 3UI6A 1NH6A 2AWGA 2XP7A 4WIWA 1D6OA 3B7XA 2XPBA 3TDBA 3NRKA 1JNTA 4KR0B 4MSPA 2RSEA 3OA5A 4U85A 4DROA 2A3EA 3RMEA 2XP5A 4LAXA 4DWSD 4ML4A 4Z2KA 5DIVA 2KE0A 2ESCA 2ZQUA 1FKFA 2OFNA 3CGNA 1EYMA 5GQBA 2O92A 1FKKA 1ZU8A 4Q22A 3O5QA 1HKIA 2N87A 2B31A 3KCEA 1ZBVA 3TCZA 3CHFA 4P8UA 1F40A 3WD3A 3IKDA 4Z2LA 2MF9A 1OGGA 4JFIA 1X6NA 1W26A 3WH0A 2ITKA 4P8WA 4DWSC 1IX5A 1L1PA 1BKFA 1FFQA 1CTNA 3O5OA 2MLZA 5GPGA 2L2SA 3O5RA 3O5IA 4MPKA 4O2TA 3TC5A 1EDQA 4L3NA 4DWSA 5HTGA 3O5KA 3WQVA 4ZPTR 1JNDA 3RFWA 4TNSA 1W1TA 2PV2A 4IT6A 2O9OA 4URIA 3JXVA 1FKDA 4JYSA 1FKTA 1NWRA 2JZVA 2DT2A 1ZL1A 3PA7A 2LKNA 3OOBA 3CHDA 1FAPA 4ODMA 4QZVB 2ZR4A 3QOKA 4W9PA 1JNSA 4Q7NA 4ZS6A 2MLXA 3KACA 2ZQVA 3O5DA 1NWUA 5HT1A 4TW7A 3ARVA 3ARUA 1TCOC 3RM4A 4MTVA 3RM9A 2DSUA 3UF8A 4DRJA 2F4EA 1ZCNA 5DF0A 5DITA 1WB0A 3ARRA 1PBKA 2A3CA 1E6ZA 5DO2A 3ALFA 3JYMA 5DEZA 4FAPA 3IHZA 1K9TA 3NTPA 3G6MA 2XP8A 3ARXA 5HWBA 4W9QA 4ZPWR 1FD9A 2DSZA 1LG2A 3PRBA 4ODPA 4Z2HA 1LJYA 2MPHA 1F8AB 3KAGA 2M08A 3PRDA 5HWCA 1GPFA 3O5MA 4IQ2A 2FAPA 1NWTA 2G8ZA 1KT1A 2KR7A 3PR9A 1UR9A 2MNTA 4ZPVR 1B6CA 2Y78A 3CH9A 2RUQA 4WJXA 1O6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5F A;  2VCD A;  4JFI A;  4ITZ A;  3NI6 A;  1W26 A;  4U86 A;  4DZ2 A;  2K8I A;  3WH0 A;  2ITK A;  4DIP A;  1FKS A;  1L1P A;  1BKF A;  2IF4 A;  1QZ2 A;  1QPL A;  1FKJ A;  1YAT A;  4G2P A;  3O5L A;  3FAP A;  4TYO A;  3O5O A;  2MLZ A;  3CGM A;  5GPG A;  2L2S A;  3O5R A;  2LPV A;  3GPK A;  2RUR A;  2DG3 A;  3O5I A;  4O2T A;  3UI4 A;  1JVW A;  3TC5 A;  1NMW A;  1ROT A;  3UQI A;  3O5P A;  3UQA A;  2DG9 A;  4JFL A;  1NSG A;  3O5K A;  5HTG A;  1ZK6 A;  1T11 A;  2LGO A;  4DRM A;  1Q6H A;  4IPX A;  3RFW A;  3LUO A;  2FKE A;  4TNS A;  3I6C A;  4LAY A;  4TW6 A;  4W9O A;  2PV2 A;  1FKG A;  1FKR A;  5HW7 A;  2KI3 A;  1QPF A;  3EY6 A;  3KZ7 A;  4U84 A;  3JXV A;  1U79 A;  3RGC A;  4LAW A;  1FKD A;  2D9F A;  4JYS A;  3O5J A;  1FKT A;  2JZV A;  1YW5 A;  1Q6U A;  2ZQS A;  2DG4 A;  3PA7 A;  4ODQ A;  2LKN A;  4ODL A;  1KT0 A;  3OOB A;  1D7J A;  1FKI A;  1FAP A;  2ZR6 A;  1EQ3 A;  4JFK A;  4ODM A;  2PPN A;  1FJD A;  2RUC A;  2ZR4 A;  2LJ4 A;  1FKB A;  4W9P A;  1M5Y A;  1JNS A;  1ROU A;  1A7X A;  3H9R B;  2XPA A;  4DRQ A;  5J6E A;  1J6Y A;  4JFM A;  5HKG A;  1FKL A;  4NNR A;  2MLX A;  3KAC A;  5HUA A;  2ZQV A;  3O5D A;  3UI5 A;  2XP3 A;  4J4N A;  4JFJ A;  1NMV A;  4DRP A;  5HT1 A;  1Y0O A;  3IK8 A;  5B8I C;  4J4O A;  4TW7 A;  4BF8 A;  3ODK A;  5DIU A;  1PIN A;  4IQC A;  5HW8 A;  1TCO C;  2KFW A;  1J4H A;  4FN2 A;  4DRI A;  3KAD A;  3IKG A;  4ODO A;  2Q5A A;  1C9H A;  3UF8 A;  4DRJ A;  2F4E A;  1ZCN A;  3KAB A;  2MLY A;  5BXJ A;  4DH0 A;  5DIT A;  1D7I A;  2XP4 A;  1PBK A;  3JYJ A;  1P5Q A;  1R9H A;  2M1I A;  2XP9 A;  2F2D A;  2XP6 A;  2ZQT A;  3JYM A;  2PPP A;  4G50 A;  1Q1C A;  4QT2 A;  3IHZ A;  4FAP A;  5I98 A;  4LAV A;  3UI6 A;  3O5E A;  4DZ3 A;  3NTP A;  2AWG A;  2XP8 A;  2XP7 A;  4GGQ A;  5HWB A;  3KAH A;  4W9Q A;  3MDY B;  5D75 A;  1D6O A;  2PPO A;  3B7X A;  4R0X A;  4TX0 A;  1FD9 A;  2XPB A;  1BL4 A;  4C02 B;  3PRB A;  4ODN A;  3TDB A;  3NRK A;  1JNT A;  2PV3 A;  2F21 A;  2UZ5 A;  3KAF A;  2MPH A;  4ODP A;  4QIB A;  2M2A A;  4MSP A;  1HXV A;  2RSE A;  1F8A B;  3KAG A;  1J4I A;  2M08 A;  3PRD A;  4U85 A;  4DRO A;  4DRK A;  2XP5 A;  3O5M A;  4IQ2 A;  5HWC A;  2FAP A;  4LAX A;  2PBC A;  2KO7 A;  5DIV A;  2ZR5 A;  4QT3 A;  1KT1 A;  4DT4 A;  2KR7 A;  2KE0 A;  2RQS A;  2PV1 A;  1D7H A;  2ZQU A;  3KAI A;  1FKF A;  2OFN A;  3CGN A;  1EYM A;  4GIV A;  2RUD A;  2MNT A;  3VAW A;  3O5G A;  1FKK A;  5HW6 A;  4ODR A;  4DRN A;  2VN1 A;  3O5Q A;  1Q6I A;  1FKH A;  1B6C A;  1N1A A;  2KGJ A;  2N87 A;  3KCE A;  2Y78 A;  4MGV A;  4N19 A;  3TCZ A;  3UQB A;  1F40 A;  4TW8 A;  2RUQ A;  3IKD A;  1J4R A;  4ODK A;  4DRH A;  2MF9 A; 
#chains in the Genus database with same CATH topology
 3O5F A;  2VCD A;  1X6L A;  4MNL A;  4XAK A;  2F23 A;  2IF4 A;  4HAR A;  1QZ2 A;  4P8X A;  1W9V A;  3O5L A;  4TYO A;  3UI4 A;  1KFW A;  2LPV A;  3GPK A;  2DG3 A;  1JVW A;  1NMW A;  1HJX A;  3B9E A;  3O5P A;  4L72 B;  1NSG A;  4R5E A;  4Z2G A;  2LGO A;  4DRM A;  3GTY X;  2DT3 A;  4KQZ A;  4W9O A;  1FKR A;  1LL7 A;  4U84 A;  3PRA A;  4LAW A;  1E9L A;  1JCH B;  2ZQS A;  3B9A A;  1KT0 A;  1FKI A;  3ARQ A;  2LJ4 A;  1FKB A;  3WD2 A;  4Z2I A;  3H9R B;  2XPA A;  4WKA A;  3WD4 A;  1HKJ A;  1J6Y A;  5HUA A;  1HJW A;  2XP3 A;  3WD0 A;  5B8I C;  4J4O A;  1LL6 A;  3FY1 A;  1PIN A;  1J4H A;  4FN2 A;  4DRI A;  1ZBC A;  2DSW A;  3IKG A;  1XHG A;  4LGX A;  4NSB A;  1D7I A;  3WQW A;  1VF8 A;  1W1V A;  3WL1 A;  4S3K A;  2ZQT A;  2PPP A;  4G50 A;  1Q1C A;  4P8V A;  4QT2 A;  5I98 A;  4LAV A;  4DZ3 A;  4GGQ A;  1W9U A;  1E6P A;  2PPO A;  4TX0 A;  4R0X A;  1BL4 A;  1WNO A;  1RD6 A;  3ARW A;  4ODN A;  1UR8 A;  1E15 A;  2PV3 A;  4NZC A;  2F21 A;  2YBT A;  2UZ5 A;  2AOS A;  2EUL A;  2M2A A;  1HXV A;  2DT0 A;  1J4I A;  4DRK A;  1D2K A;  3CHE A;  2PBC A;  2ZR5 A;  2A3B A;  1D7H A;  3ART A;  3KAI A;  2IUZ A;  3ARS A;  2DPE A;  2VN1 A;  1Q6I A;  1N1A A;  1ZBK A;  4MGV A;  4N19 A;  4PTM A;  4ODK A;  1J4R A;  3G6L A;  1NWS A;  5HW7 A;  1H0G A;  3AS1 A;  3NI6 A;  4U86 A;  4DWS B;  4DZ2 A;  2K8I A;  4DIP A;  1FFR A;  2WM0 A;  1QPL A;  3FAP A;  3UQI A;  3UQA A;  2DG9 A;  1T11 A;  4MNM A;  4AY1 A;  1Q6H A;  4IPX A;  3LUO A;  2FKE A;  3I6C A;  4LAY A;  3WD1 A;  1FKG A;  3ARO A;  3KZ7 A;  3ARY A;  1GOI A;  3RGC A;  2YBU A;  2D9F A;  1GUV A;  1YW5 A;  1EIB A;  1Q6U A;  2DG4 A;  2ZR6 A;  1H0I A;  2DSV A;  1W1P A;  2PPN A;  1M5Y A;  4WKF A;  4JFM A;  4NNR A;  2OLH A;  4JFJ A;  1HKM A;  3BXW A;  1NMV A;  4DRP A;  3ALG A;  3IK8 A;  4BF8 A;  4WK9 A;  4IQC A;  4HBE A;  4MNK A;  1WAW A;  2KFW A;  3KAD A;  4ODO A;  2Q5A A;  1ZB5 A;  3KAB A;  5BXJ A;  4DH0 A;  1TFV A;  1P5Q A;  1R9H A;  2F2D A;  3B8S A;  4IT4 A;  3O5E A;  3BMB A;  1W9P A;  2PI6 A;  3RM8 A;  1SR0 A;  3KAH A;  5D75 A;  3MDY B;  3WKZ A;  4C02 B;  5HBF A;  1SYT A;  2WLY A;  1E6R A;  2DT1 A;  4QIB A;  4W5U A;  3KAF A;  1ITX A;  2KO7 A;  4QT3 A;  4DT4 A;  1XRV A;  2RQS A;  2PV1 A;  4GIV A;  2RUD A;  5GPR A;  3O5G A;  3VAW A;  3GU0 A;  5HW6 A;  4ODR A;  4DRN A;  5JH8 A;  1E6N A;  1FKH A;  2KGJ A;  3UQB A;  2WK2 A;  4S3J A;  4TW8 A;  1EHN A;  4DRH A;  1ZBW A;  4ITZ A;  1LL4 A;  1FKS A;  1HJV A;  4Z2J A;  1LQ0 A;  1FKJ A;  1YAT A;  4G2P A;  1OGB A;  3CGM A;  2RUR A;  3B9D A;  1ROT A;  3EIP A;  4JFL A;  1ZK6 A;  2G41 A;  3ARZ A;  1HKK A;  4TW6 A;  1W1Y A;  3AS3 A;  2KI3 A;  1QPF A;  3EY6 A;  1U79 A;  3AS2 A;  3O5J A;  2FDM A;  3WL0 A;  4ODQ A;  3CZ8 A;  4ODL A;  4HBO A;  1D7J A;  1EQ3 A;  2WLZ A;  3AQU A;  4JFK A;  1FJD A;  2RUC A;  2A3A A;  1JNE A;  3CHC A;  1OWQ A;  1ROU A;  1A7X A;  4DRQ A;  5J6E A;  4MAV A;  3AS0 A;  5HKG A;  1FKL A;  1E44 A;  3UI5 A;  1GRJ A;  4J4N A;  1Y0O A;  4MNJ A;  3ARP A;  3ODK A;  5DIU A;  3FXY A;  3W4R A;  5HW8 A;  3WIJ A;  1C9H A;  4WKH A;  2MLY A;  1LG1 A;  2QF8 A;  2XP4 A;  3JYJ A;  2M1I A;  2XP9 A;  2XP6 A;  4UDM A;  3UI6 A;  1NH6 A;  2AWG A;  2XP7 A;  4WIW A;  1D6O A;  3B7X A;  2XPB A;  3TDB A;  3NRK A;  1JNT A;  4KR0 B;  4MSP A;  2RSE A;  3OA5 A;  4U85 A;  4DRO A;  2A3E A;  3RME A;  2XP5 A;  4LAX A;  4DWS D;  4ML4 A;  4Z2K A;  5DIV A;  2KE0 A;  2ESC A;  2ZQU A;  1FKF A;  2OFN A;  3CGN A;  1EYM A;  5GQB A;  2O92 A;  1FKK A;  1ZU8 A;  4Q22 A;  3O5Q A;  1HKI A;  2N87 A;  2B31 A;  3KCE A;  1ZBV A;  3TCZ A;  3CHF A;  4P8U A;  1F40 A;  3WD3 A;  3IKD A;  4Z2L A;  2MF9 A;  1OGG A;  4JFI A;  1X6N A;  1W26 A;  3WH0 A;  2ITK A;  4P8W A;  4DWS C;  1IX5 A;  1L1P A;  1BKF A;  1FFQ A;  1CTN A;  3O5O A;  2MLZ A;  5GPG A;  2L2S A;  3O5R A;  3O5I A;  4MPK A;  4O2T A;  3TC5 A;  1EDQ A;  4L3N A;  4DWS A;  5HTG A;  3O5K A;  3WQV A;  4ZPT R;  1JND A;  3RFW A;  4TNS A;  2ETN A;  2P4V A;  1W1T A;  2PV2 A;  4IT6 A;  2O9O A;  4URI A;  3JXV A;  1FKD A;  4JYS A;  1FKT A;  1NWR A;  2JZV A;  2DT2 A;  1ZL1 A;  3PA7 A;  2LKN A;  3OOB A;  3CHD A;  1FAP A;  4ODM A;  4QZV B;  2ZR4 A;  3QOK A;  4W9P A;  1JNS A;  4Q7N A;  4ZS6 A;  2MLX A;  3KAC A;  2ZQV A;  3O5D A;  1NWU A;  5HT1 A;  4TW7 A;  3ARV A;  3ARU A;  1TCO C;  3RM4 A;  4MTV A;  3RM9 A;  2DSU A;  3UF8 A;  4DRJ A;  2F4E A;  1ZCN A;  5DF0 A;  5DIT A;  1WB0 A;  3ARR A;  1PBK A;  2A3C A;  1E6Z A;  5DO2 A;  3ALF A;  3JYM A;  5DEZ A;  4FAP A;  2PN0 A;  3IHZ A;  2B5U B;  1K9T A;  3NTP A;  3G6M A;  2XP8 A;  3ARX A;  5HWB A;  4W9Q A;  4ZPW R;  1FD9 A;  2DSZ A;  1LG2 A;  3PRB A;  4ODP A;  4Z2H A;  1LJY A;  2MPH A;  1F8A B;  3KAG A;  2M08 A;  3PRD A;  5HWC A;  1GPF A;  3O5M A;  4IQ2 A;  2FAP A;  1NWT A;  2G8Z A;  1KT1 A;  2KR7 A;  3PR9 A;  1UR9 A;  2MNT A;  4ZPV R;  1B6C A;  2Y78 A;  3CH9 A;  2RUQ A;  4WJX A;  1O6I A; 
#chains in the Genus database with same CATH homology
 3O5F A;  2VCD A;  1X6L A;  4MNL A;  4XAK A;  2IF4 A;  4HAR A;  1QZ2 A;  4P8X A;  1W9V A;  3O5L A;  4TYO A;  3UI4 A;  1KFW A;  2LPV A;  3GPK A;  2DG3 A;  1JVW A;  1NMW A;  1HJX A;  3B9E A;  3O5P A;  4L72 B;  1NSG A;  4R5E A;  4Z2G A;  2LGO A;  4DRM A;  2DT3 A;  4KQZ A;  4W9O A;  1FKR A;  1LL7 A;  4U84 A;  3PRA A;  4LAW A;  1E9L A;  2ZQS A;  3B9A A;  1KT0 A;  1FKI A;  3ARQ A;  2LJ4 A;  1FKB A;  3WD2 A;  4Z2I A;  3H9R B;  2XPA A;  4WKA A;  3WD4 A;  1HKJ A;  1J6Y A;  5HUA A;  1HJW A;  2XP3 A;  3WD0 A;  5B8I C;  4J4O A;  1LL6 A;  3FY1 A;  1PIN A;  1J4H A;  4FN2 A;  4DRI A;  1ZBC A;  2DSW A;  3IKG A;  1XHG A;  4LGX A;  4NSB A;  1D7I A;  3WQW A;  1VF8 A;  1W1V A;  3WL1 A;  4S3K A;  2ZQT A;  2PPP A;  4G50 A;  1Q1C A;  4P8V A;  4QT2 A;  5I98 A;  4LAV A;  4DZ3 A;  4GGQ A;  1W9U A;  1E6P A;  2PPO A;  4TX0 A;  4R0X A;  1BL4 A;  1WNO A;  1RD6 A;  3ARW A;  4ODN A;  1UR8 A;  1E15 A;  2PV3 A;  4NZC A;  2F21 A;  2UZ5 A;  2YBT A;  2AOS A;  1HXV A;  2M2A A;  2DT0 A;  1J4I A;  4DRK A;  1D2K A;  3CHE A;  2PBC A;  2ZR5 A;  2A3B A;  1D7H A;  3ART A;  3KAI A;  2IUZ A;  3ARS A;  2DPE A;  2VN1 A;  1Q6I A;  1N1A A;  1ZBK A;  4MGV A;  4N19 A;  4PTM A;  4ODK A;  1J4R A;  3G6L A;  1NWS A;  5HW7 A;  1H0G A;  3AS1 A;  3NI6 A;  4U86 A;  4DWS B;  4DZ2 A;  2K8I A;  4DIP A;  1FFR A;  2WM0 A;  1QPL A;  3FAP A;  3UQI A;  3UQA A;  2DG9 A;  1T11 A;  4MNM A;  4AY1 A;  1Q6H A;  4IPX A;  3LUO A;  2FKE A;  3I6C A;  4LAY A;  3WD1 A;  1FKG A;  3ARO A;  3KZ7 A;  3ARY A;  1GOI A;  3RGC A;  2YBU A;  2D9F A;  1GUV A;  1YW5 A;  1EIB A;  1Q6U A;  2DG4 A;  2ZR6 A;  1H0I A;  2DSV A;  1W1P A;  2PPN A;  1M5Y A;  4WKF A;  4JFM A;  4NNR A;  2OLH A;  4JFJ A;  1HKM A;  3BXW A;  1NMV A;  4DRP A;  3ALG A;  3IK8 A;  4BF8 A;  4WK9 A;  4IQC A;  4HBE A;  4MNK A;  1WAW A;  2KFW A;  3KAD A;  4ODO A;  2Q5A A;  1ZB5 A;  3KAB A;  5BXJ A;  4DH0 A;  1TFV A;  1P5Q A;  1R9H A;  2F2D A;  3B8S A;  4IT4 A;  3O5E A;  1W9P A;  2PI6 A;  3RM8 A;  1SR0 A;  3KAH A;  5D75 A;  3MDY B;  3WKZ A;  4C02 B;  5HBF A;  1SYT A;  2WLY A;  1E6R A;  2DT1 A;  4QIB A;  4W5U A;  3KAF A;  1ITX A;  2KO7 A;  4QT3 A;  4DT4 A;  1XRV A;  2RQS A;  2PV1 A;  4GIV A;  2RUD A;  5GPR A;  3O5G A;  3VAW A;  5HW6 A;  4ODR A;  4DRN A;  5JH8 A;  1E6N A;  1FKH A;  2KGJ A;  3UQB A;  2WK2 A;  4S3J A;  4TW8 A;  1EHN A;  4DRH A;  1ZBW A;  4ITZ A;  1LL4 A;  1FKS A;  1HJV A;  4Z2J A;  1LQ0 A;  1FKJ A;  1YAT A;  4G2P A;  1OGB A;  3CGM A;  2RUR A;  3B9D A;  1ROT A;  4JFL A;  1ZK6 A;  2G41 A;  3ARZ A;  1HKK A;  4TW6 A;  1W1Y A;  3AS3 A;  2KI3 A;  1QPF A;  3EY6 A;  1U79 A;  3AS2 A;  3O5J A;  2FDM A;  3WL0 A;  4ODQ A;  3CZ8 A;  4ODL A;  4HBO A;  1D7J A;  1EQ3 A;  2WLZ A;  3AQU A;  4JFK A;  1FJD A;  2RUC A;  2A3A A;  1JNE A;  3CHC A;  1OWQ A;  1ROU A;  1A7X A;  4DRQ A;  5J6E A;  4MAV A;  3AS0 A;  5HKG A;  1FKL A;  3UI5 A;  4J4N A;  1Y0O A;  4MNJ A;  3ARP A;  3ODK A;  5DIU A;  3FXY A;  3W4R A;  5HW8 A;  3WIJ A;  1C9H A;  4WKH A;  2MLY A;  1LG1 A;  2QF8 A;  2XP4 A;  3JYJ A;  2M1I A;  2XP9 A;  2XP6 A;  3UI6 A;  1NH6 A;  2AWG A;  2XP7 A;  4WIW A;  1D6O A;  3B7X A;  2XPB A;  3TDB A;  3NRK A;  1JNT A;  4KR0 B;  4MSP A;  2RSE A;  3OA5 A;  4U85 A;  4DRO A;  2A3E A;  3RME A;  2XP5 A;  4LAX A;  4DWS D;  4ML4 A;  4Z2K A;  5DIV A;  2KE0 A;  2ESC A;  2ZQU A;  1FKF A;  2OFN A;  3CGN A;  1EYM A;  5GQB A;  2O92 A;  1FKK A;  1ZU8 A;  4Q22 A;  3O5Q A;  1HKI A;  2N87 A;  2B31 A;  3KCE A;  1ZBV A;  3TCZ A;  3CHF A;  4P8U A;  1F40 A;  3WD3 A;  3IKD A;  4Z2L A;  2MF9 A;  1OGG A;  4JFI A;  1X6N A;  1W26 A;  3WH0 A;  2ITK A;  4P8W A;  4DWS C;  1IX5 A;  1L1P A;  1BKF A;  1FFQ A;  1CTN A;  3O5O A;  2MLZ A;  5GPG A;  2L2S A;  3O5R A;  3O5I A;  4MPK A;  4O2T A;  3TC5 A;  1EDQ A;  4L3N A;  4DWS A;  5HTG A;  3O5K A;  3WQV A;  4ZPT R;  1JND A;  3RFW A;  4TNS A;  1W1T A;  2PV2 A;  4IT6 A;  2O9O A;  4URI A;  3JXV A;  1FKD A;  4JYS A;  1FKT A;  1NWR A;  2JZV A;  2DT2 A;  1ZL1 A;  3PA7 A;  2LKN A;  3OOB A;  3CHD A;  1FAP A;  4ODM A;  4QZV B;  2ZR4 A;  3QOK A;  4W9P A;  1JNS A;  4Q7N A;  4ZS6 A;  2MLX A;  3KAC A;  2ZQV A;  3O5D A;  1NWU A;  5HT1 A;  4TW7 A;  3ARV A;  3ARU A;  1TCO C;  3RM4 A;  4MTV A;  3RM9 A;  2DSU A;  3UF8 A;  4DRJ A;  2F4E A;  1ZCN A;  5DF0 A;  5DIT A;  1WB0 A;  3ARR A;  1PBK A;  2A3C A;  1E6Z A;  5DO2 A;  3ALF A;  3JYM A;  5DEZ A;  4FAP A;  3IHZ A;  1K9T A;  3NTP A;  3G6M A;  2XP8 A;  3ARX A;  5HWB A;  4W9Q A;  4ZPW R;  1FD9 A;  2DSZ A;  1LG2 A;  3PRB A;  4ODP A;  4Z2H A;  1LJY A;  2MPH A;  1F8A B;  3KAG A;  2M08 A;  3PRD A;  5HWC A;  1GPF A;  3O5M A;  4IQ2 A;  2FAP A;  1NWT A;  2G8Z A;  1KT1 A;  2KR7 A;  3PR9 A;  1UR9 A;  2MNT A;  4ZPV R;  1B6C A;  2Y78 A;  3CH9 A;  2RUQ A;  4WJX A;  1O6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...