1C9HA

Crystal structure of fkbp12.6 in complex with rapamycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
107
structure length
107
Chain Sequence
GVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FKBP12.6
publication title Structure of FKBP12.6 in complex with rapamycin.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1c9hA00
4DRHA 2MLYA 3PRBA 1F8AB 1U79A 2KI3A 4LAVA 3KAHA 4O2TA 1B6CA 2OFNA 5BXJA 4DIPA 3IHZA 4ITZA 5I98A 3O5RA 2ZR6A 4TNSA 3RGCA 4DRQA 3CGMA 2XP3A 4TW7A 3TC5A 4FN2A 4ODMA 3I6CA 1EYMA 5GPGA 3UI5A 1Q6IA 2PV3A 2RUCA 1JNSA 3PRDA 3JYMA 3UF8A 4DRIA 1QPFA 2KR7A 5D75A 1C9HA 1L1PA 4JFKA 2LJ4A 1EQ3A 4JFJA 4TW8A 2ZR4A 4C02B 2DG4A 1YATA 4R0XA 1ZCNA 4J4OA 2IF4A 1JVWA 1FKDA 2MNTA 1R9HA 2KO7A 3LUOA 4IQCA 4DRNA 2MPHA 4N19A 3O5IA 4G50A 4QT2A 3PA7A 1J6YA 5HUAA 1QZ2A 4JFLA 4DRKA 1FKRA 4DH0A 3KZ7A 1FAPA 3VAWA 2M2AA 1D7JA 2L2SA 5B8IC 2RQSA 2Y78A 2F2DA 1Q1CA 2MLXA 2RURA 2ZQTA 3JYJA 3O5JA 4JYSA 1J4RA 1D6OA 2VN1A 3TDBA 3H9RB 2M1IA 1FKFA 1FKJA 1BL4A 4QT3A 2RUDA 2XP8A 4DROA 3B7XA 4DRPA 3KAGA 3JXVA 3NI6A 3O5LA 1NMVA 2FAPA 2ITKA 1ROUA 1YW5A 1PBKA 1Y0OA 2XP7A 4DT4A 2XPAA 3KAFA 4ODKA 5DIUA 5HWBA 1FKIA 2MF9A 3IK8A 3UI6A 5HW6A 4LAWA 1J4IA 3UI4A 2PBCA 4U85A 2MLZA 3OOBA 2ZQUA 2VCDA 1FKLA 1KT0A 3KCEA 3KADA 2F4EA 4ODOA 1FKHA 2RSEA 3FAPA 4FAPA 1FKKA 2M08A 2Q5AA 2PV1A 2ZQSA 3O5DA 4LAXA 1ROTA 4TW6A 1FKSA 5DITA 5HWCA 2F21A 2DG9A 1TCOC 4U86A 5HKGA 1D7IA 4ODNA 3UQBA 2XP5A 4DRJA 2FKEA 3O5MA 5HT1A 3O5OA 3IKGA 4JFMA 4IQ2A 4NNRA 1NSGA 4W9QA 4W9PA 1Q6UA 1BKFA 2PPNA 2XPBA 4DZ3A 5HTGA 2PPOA 2D9FA 2ZQVA 2K8IA 1ZK6A 1D7HA 4G2PA 2KFWA 2N87A 1J4HA 3KABA 3WH0A 3O5FA 1N1AA 4ODPA 5J6EA 3O5KA 3MDYB 3NRKA 2XP9A 3O5EA 4LAYA 1FKBA 2PPPA 4ODQA 4JFIA 3RFWA 5HW8A 4QIBA 1T11A 2ZR5A 2LPVA 2RUQA 1A7XA 4ODLA 4DZ2A 3CGNA 2LKNA 3KACA 1QPLA 2UZ5A 4IPXA 3UQAA 1HXVA 4ODRA 4BF8A 1PINA 4GIVA 1W26A 4GGQA 2JZVA 4W9OA 2KGJA 1M5YA 3EY6A 3KAIA 3O5QA 2XP6A 1FKTA 3IKDA 2KE0A 4TYOA 1Q6HA 4MSPA 4MGVA 5DIVA 3TCZA 3O5PA 1F40A 3GPKA 1JNTA 1FD9A 1P5QA 2DG3A 5HW7A 1FJDA 1KT1A 1NMWA 4TX0A 1FKGA 2PV2A 4J4NA 2LGOA 3O5GA 3ODKA 3UQIA 3NTPA 4U84A 4DRMA 2AWGA 2XP4A
chains in the Genus database with same CATH superfamily
1HKKA 3PRBA 2F23A 1B6CA 2OFNA 4DIPA 3AS1A 3O5RA 2FDMA 4Z2GA 4MNKA 4P8WA 4DWSB 4MNJA 5DEZA 2A3CA 3PRDA 1LL4A 3G6LA 1QPFA 1ZBVA 4MAVA 1JCHB 4DWSC 4JFKA 4JFJA 1E15A 2ESCA 1W1TA 1GOIA 1ZCNA 4S3KA 1E44A 2IF4A 4J4OA 4R5EA 4G50A 1NWUA 3WL0A 3PA7A 1ZBWA 1J6YA 2DSWA 5HUAA 3VAWA 3ARWA 2RQSA 1OGGA 2MLXA 2Y78A 2ZQTA 3CHDA 1FFRA 2VN1A 1FKJA 4QT3A 2RUDA 3O5LA 4Q7NA 1ROUA 4P8UA 1Y0OA 3ARPA 3CH9A 4ODKA 3IK8A 4DWSD 5HW6A 4LAWA 2AOSA 4Z2KA 2DT1A 4U85A 1KT0A 3KADA 1FKHA 4LAXA 4LGXA 3ARSA 1E6NA 1LQ0A 1TCOC 2XP5A 2FKEA 3O5MA 3O5OA 4JFMA 2EULA 4W5UA 4W9QA 4W9PA 1BKFA 4DZ3A 1N1AA 3ARTA 3WQWA 3NRKA 3O5EA 4LAYA 2PPPA 4JFIA 3RFWA 4QIBA 4IT4A 4ODLA 4ZPTR 1LG2A 1NWTA 2DSVA 3CGNA 4IPXA 3ALGA 1OWQA 4KR0B 4MPKA 4WKFA 3ARZA 2JZVA 3RMEA 3EY6A 1FKTA 4KQZA 4TYOA 2WLZA 4MGVA 5DIVA 3TCZA 1JNTA 5HW7A 1KT1A 1NMWA 2PV2A 3NTPA 4DRMA 2XP6A 2XP4A 1U79A 1E6RA 4UDMA 3IHZA 5DF0A 5I98A 4TNSA 2WLYA 2PV3A 2RUCA 2DT0A 3UF8A 2WM0A 4DRIA 2KR7A 1L1PA 1C9HA 2LJ4A 4TW8A 4S3JA 4C02B 4AY1A 3CHFA 3ARVA 1FKDA 2MNTA 4DRNA 3B9AA 2DPEA 3WQVA 3BMBA 4QT2A 4Z2LA 1FKRA 1O6IA 2A3EA 2M2AA 1D7JA 2L2SA 4Z2JA 1UR8A 5B8IC 2F2DA 3O5JA 1D6OA 3H9RB 2M1IA 3RM8A 1FKFA 3AS0A 1NWSA 4MNMA 1GRJA 4DROA 3B7XA 4DRPA 1OGBA 3JXVA 2ITKA 2XP7A 4DT4A 5HWBA 1W1VA 1FKIA 2VCDA 2G41A 2RSEA 3FAPA 1FKKA 2M08A 3O5DA 1E6ZA 2PV1A 4TW6A 5DITA 2F21A 3QOKA 4NSBA 1ZB5A 3UQBA 4DRJA 3ARRA 4DWSA 5GPRA 4NNRA 1HKJA 1SYTA 1HJVA 5HTGA 2B31A 2D9FA 2ZQVA 3CZ8A 1D7HA 3ARXA 3PRAA 3WH0A 1JNDA 3ALFA 4ODPA 4Q22A 3O5KA 1ZBCA 1ZU8A 2XP9A 1FKBA 5JH8A 4WJXA 2ZR5A 2LPVA 4L72B 4WKHA 1CTNA 2RUQA 1A7XA 2IUZA 4QZVB 3GTYX 2UZ5A 1LJYA 3UQAA 1HXVA 4BF8A 1NWRA 4GIVA 1W26A 1M5YA 2O92A 1HKMA 3WD2A 2KE0A 2DSZA 3O5PA 1HJWA 1FD9A 2B5UB 4ML4A 1VF8A 3OA5A 3ARYA 2AWGA 1K9TA 4DRHA 1KFWA 2A3AA 2KI3A 4LAVA 4O2TA 3KAHA 4P8XA 3WL1A 2ZR6A 3CHEA 3CGMA 2XP3A 4TW7A 4NZCA 3TC5A 3I6CA 5GPGA 1Q6IA 1JNSA 1LL7A 3JYMA 1EHNA 1YATA 2KO7A 2MPHA 1E9LA 3B9DA 4WKAA 2DT3A 4WIWA 1SR0A 1XHGA 1QZ2A 4DH0A 1FAPA 4JYSA 1J4RA 3TDBA 3WIJA 1IX5A 1W1PA 3FXYA 3KAGA 2FAPA 3WD1A 2XPAA 5DIUA 2O9OA 3UI6A 2ETNA 1J4IA 3UI4A 3AS2A 2PBCA 4URIA 4ODOA 2ZQSA 1ROTA 1FKSA 3WD3A 4Z2HA 1EIBA 2DG9A 3AS3A 4U86A 1D7IA 3GU0A 1JNEA 3IKGA 1X6LA 4IQ2A 1Q6UA 3RM4A 2YBTA 1J4HA 3KABA 3O5FA 4HARA 1H0GA 5J6EA 1W1YA 1TFVA 1HKIA 5HW8A 4WK9A 1GPFA 2YBUA 4DZ2A 4Z2IA 3B8SA 1PINA 4W9OA 1UR9A 2KGJA 3KAIA 4ZS6A 3WKZA 4MSPA 1X6NA 3AQUA 3ARUA 3GPKA 1P5QA 2DG3A 1FJDA 1FKGA 3O5GA 3ODKA 4U84A 4L3NA 2MLYA 3WD4A 5HBFA 1F8AB 3RM9A 5BXJA 4ITZA 3CHCA 3RGCA 3ARQA 1W9UA 4DRQA 4MTVA 1LG1A 4FN2A 4ODMA 1ZBKA 1EYMA 3UI5A 5D75A 1EQ3A 2ZR4A 2DG4A 2G8ZA 4R0XA 1HJXA 1JVWA 4IQCA 1R9HA 3LUOA 4N19A 3O5IA 4DRKA 4JFLA 3KZ7A 3JYJA 1Q1CA 2RURA 5DO2A 5GQBA 4ZPWR 1BL4A 2XP8A 3NI6A 1NMVA 1NH6A 3AROA 1YW5A 2OLHA 1PBKA 1H0IA 3KAFA 3B9EA 2MF9A 3PR9A 4IT6A 1GUVA 4HBOA 2MLZA 3EIPA 3OOBA 2ZQUA 1FKLA 3KCEA 2F4EA 1XRVA 4FAPA 2Q5AA 5HWCA 1WAWA 4XAKA 3G6MA 5HKGA 4ODNA 1LL6A 5HT1A 1NSGA 2PPNA 2XPBA 2PPOA 2K8IA 1ZK6A 4G2PA 2KFWA 2N87A 2P4VA 3BXWA 2DSUA 2PI6A 3MDYB 3W4RA 4MNLA 4ODQA 4PTMA 1T11A 2DT2A 1WNOA 4P8VA 2LKNA 3KACA 1QPLA 1EDQA 1FFQA 4ODRA 4GGQA 2QF8A 2PN0A 3FY1A 1ZL1A 1W9VA 3O5QA 2A3BA 2WK2A 3IKDA 1ITXA 1Q6HA 1RD6A 1D2KA 1WB0A 1F40A 4HBEA 4TX0A 1E6PA 4ZPVR 1W9PA 4J4NA 2LGOA 3UQIA 3WD0A
chains in the Genus database with same CATH topology
1HKKA 3PRBA 1B6CA 2OFNA 4DIPA 3AS1A 3O5RA 2FDMA 4Z2GA 4MNKA 4P8WA 4DWSB 4MNJA 5DEZA 2A3CA 3PRDA 1LL4A 3G6LA 1QPFA 1ZBVA 4MAVA 4DWSC 4JFKA 4JFJA 1E15A 2ESCA 1W1TA 1GOIA 1ZCNA 4S3KA 4J4OA 2IF4A 4R5EA 4G50A 1NWUA 3WL0A 3PA7A 1ZBWA 1J6YA 2DSWA 5HUAA 3VAWA 3ARWA 2RQSA 1OGGA 2MLXA 2Y78A 2ZQTA 3CHDA 1FFRA 2VN1A 1FKJA 4QT3A 2RUDA 3O5LA 4Q7NA 1ROUA 4P8UA 1Y0OA 3ARPA 3CH9A 4ODKA 3IK8A 4DWSD 5HW6A 4LAWA 2AOSA 4Z2KA 2DT1A 4U85A 1KT0A 3KADA 1FKHA 4LAXA 4LGXA 3ARSA 1E6NA 1LQ0A 1TCOC 2XP5A 2FKEA 3O5MA 3O5OA 4JFMA 4W5UA 4W9QA 4W9PA 1BKFA 4DZ3A 1N1AA 3ARTA 3WQWA 3NRKA 3O5EA 4LAYA 2PPPA 4JFIA 3RFWA 4QIBA 4IT4A 4ODLA 4ZPTR 1LG2A 1NWTA 2DSVA 3CGNA 4IPXA 3ALGA 1OWQA 4KR0B 4MPKA 4WKFA 2JZVA 3ARZA 3RMEA 3EY6A 1FKTA 4KQZA 4TYOA 2WLZA 4MGVA 5DIVA 3TCZA 1JNTA 5HW7A 1KT1A 1NMWA 2PV2A 3NTPA 4DRMA 2XP6A 2XP4A 1U79A 1E6RA 3IHZA 5DF0A 5I98A 4TNSA 2WLYA 2PV3A 2RUCA 2DT0A 3UF8A 2WM0A 4DRIA 2KR7A 1L1PA 1C9HA 2LJ4A 4TW8A 4S3JA 4C02B 4AY1A 3CHFA 3ARVA 1FKDA 2MNTA 4DRNA 3B9AA 2DPEA 3WQVA 4QT2A 4Z2LA 1FKRA 1O6IA 2A3EA 2M2AA 1D7JA 2L2SA 4Z2JA 1UR8A 5B8IC 2F2DA 3O5JA 1D6OA 3H9RB 2M1IA 3RM8A 1FKFA 3AS0A 1NWSA 4MNMA 4DROA 3B7XA 4DRPA 1OGBA 3JXVA 2ITKA 2XP7A 4DT4A 5HWBA 1W1VA 1FKIA 2VCDA 2G41A 2RSEA 3FAPA 1FKKA 2M08A 3O5DA 1E6ZA 2PV1A 4TW6A 5DITA 2F21A 3QOKA 4NSBA 1ZB5A 3UQBA 4DRJA 3ARRA 4DWSA 5GPRA 4NNRA 1HKJA 1SYTA 1HJVA 5HTGA 2B31A 2D9FA 2ZQVA 3CZ8A 1D7HA 3ARXA 3PRAA 3WH0A 1JNDA 3ALFA 4ODPA 4Q22A 3O5KA 1ZBCA 1ZU8A 2XP9A 1FKBA 5JH8A 4WJXA 2ZR5A 2LPVA 4L72B 4WKHA 1CTNA 2RUQA 1A7XA 2IUZA 4QZVB 2UZ5A 1LJYA 3UQAA 1HXVA 4BF8A 1NWRA 4GIVA 1W26A 1M5YA 2O92A 1HKMA 3WD2A 2KE0A 2DSZA 3O5PA 1HJWA 1FD9A 4ML4A 1VF8A 3OA5A 3ARYA 2AWGA 1K9TA 4DRHA 1KFWA 2A3AA 2KI3A 4LAVA 4O2TA 3KAHA 4P8XA 3WL1A 2ZR6A 3CHEA 3CGMA 2XP3A 4TW7A 4NZCA 3TC5A 3I6CA 5GPGA 1Q6IA 1JNSA 1LL7A 3JYMA 1EHNA 1YATA 2KO7A 2MPHA 1E9LA 3B9DA 4WKAA 2DT3A 4WIWA 1SR0A 1XHGA 1QZ2A 4DH0A 1FAPA 4JYSA 1J4RA 3TDBA 3WIJA 1IX5A 1W1PA 3FXYA 3KAGA 2FAPA 3WD1A 2XPAA 5DIUA 2O9OA 3UI6A 1J4IA 3UI4A 3AS2A 2PBCA 4URIA 4ODOA 2ZQSA 1ROTA 1FKSA 3WD3A 4Z2HA 1EIBA 2DG9A 3AS3A 4U86A 1D7IA 1JNEA 3IKGA 1X6LA 4IQ2A 1Q6UA 3RM4A 2YBTA 1J4HA 3KABA 3O5FA 4HARA 1H0GA 5J6EA 1W1YA 1TFVA 1HKIA 5HW8A 4WK9A 1GPFA 2YBUA 4DZ2A 4Z2IA 3B8SA 1PINA 4W9OA 1UR9A 2KGJA 3KAIA 4ZS6A 3WKZA 4MSPA 1X6NA 3AQUA 3ARUA 3GPKA 1P5QA 2DG3A 1FJDA 1FKGA 3O5GA 3ODKA 4U84A 4L3NA 2MLYA 3WD4A 5HBFA 1F8AB 3RM9A 5BXJA 4ITZA 3CHCA 3RGCA 3ARQA 1W9UA 4DRQA 4MTVA 1LG1A 4FN2A 4ODMA 1ZBKA 1EYMA 3UI5A 5D75A 1EQ3A 2ZR4A 2DG4A 2G8ZA 4R0XA 1HJXA 1JVWA 4IQCA 1R9HA 3LUOA 4N19A 3O5IA 4DRKA 4JFLA 3KZ7A 3JYJA 1Q1CA 2RURA 5DO2A 5GQBA 4ZPWR 1BL4A 2XP8A 3NI6A 1NMVA 1NH6A 3AROA 1YW5A 2OLHA 1PBKA 1H0IA 3KAFA 3B9EA 2MF9A 3PR9A 4IT6A 1GUVA 4HBOA 2MLZA 3OOBA 2ZQUA 1FKLA 3KCEA 2F4EA 1XRVA 4FAPA 2Q5AA 5HWCA 1WAWA 4XAKA 3G6MA 5HKGA 4ODNA 1LL6A 5HT1A 1NSGA 2PPNA 2XPBA 2PPOA 2K8IA 1ZK6A 4G2PA 2KFWA 2N87A 3BXWA 2DSUA 2PI6A 3MDYB 3W4RA 4MNLA 4ODQA 4PTMA 1T11A 2DT2A 1WNOA 4P8VA 2LKNA 3KACA 1QPLA 1EDQA 1FFQA 4ODRA 4GGQA 2QF8A 3FY1A 1ZL1A 1W9VA 3O5QA 2A3BA 2WK2A 3IKDA 1ITXA 1Q6HA 1RD6A 1D2KA 1WB0A 1F40A 4HBEA 4TX0A 1E6PA 4ZPVR 1W9PA 4J4NA 2LGOA 3UQIA 3WD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRH A;  2MLY A;  3PRB A;  1F8A B;  1U79 A;  2KI3 A;  4LAV A;  3KAH A;  4O2T A;  1B6C A;  2OFN A;  5BXJ A;  4DIP A;  3IHZ A;  4ITZ A;  5I98 A;  3O5R A;  2ZR6 A;  4TNS A;  3RGC A;  4DRQ A;  3CGM A;  2XP3 A;  4TW7 A;  3TC5 A;  4FN2 A;  4ODM A;  3I6C A;  1EYM A;  5GPG A;  3UI5 A;  1Q6I A;  2PV3 A;  2RUC A;  1JNS A;  3PRD A;  3JYM A;  3UF8 A;  4DRI A;  1QPF A;  2KR7 A;  5D75 A;  1C9H A;  1L1P A;  4JFK A;  2LJ4 A;  1EQ3 A;  4JFJ A;  4TW8 A;  2ZR4 A;  4C02 B;  2DG4 A;  1YAT A;  4R0X A;  1ZCN A;  4J4O A;  2IF4 A;  1JVW A;  1FKD A;  2MNT A;  1R9H A;  2KO7 A;  3LUO A;  4IQC A;  4DRN A;  2MPH A;  4N19 A;  3O5I A;  4G50 A;  4QT2 A;  3PA7 A;  1J6Y A;  5HUA A;  1QZ2 A;  4JFL A;  4DRK A;  1FKR A;  4DH0 A;  3KZ7 A;  1FAP A;  3VAW A;  2M2A A;  1D7J A;  2L2S A;  5B8I C;  2RQS A;  2Y78 A;  2F2D A;  1Q1C A;  2MLX A;  2RUR A;  2ZQT A;  3JYJ A;  3O5J A;  4JYS A;  1J4R A;  1D6O A;  2VN1 A;  3TDB A;  3H9R B;  2M1I A;  1FKF A;  1FKJ A;  1BL4 A;  4QT3 A;  2RUD A;  2XP8 A;  4DRO A;  3B7X A;  4DRP A;  3KAG A;  3JXV A;  3NI6 A;  3O5L A;  1NMV A;  2FAP A;  2ITK A;  1ROU A;  1YW5 A;  1PBK A;  1Y0O A;  2XP7 A;  4DT4 A;  2XPA A;  3KAF A;  4ODK A;  5DIU A;  5HWB A;  1FKI A;  2MF9 A;  3IK8 A;  3UI6 A;  5HW6 A;  4LAW A;  1J4I A;  3UI4 A;  2PBC A;  4U85 A;  2MLZ A;  3OOB A;  2ZQU A;  2VCD A;  1FKL A;  1KT0 A;  3KCE A;  3KAD A;  2F4E A;  4ODO A;  1FKH A;  2RSE A;  3FAP A;  4FAP A;  1FKK A;  2M08 A;  2Q5A A;  2PV1 A;  2ZQS A;  3O5D A;  4LAX A;  1ROT A;  4TW6 A;  1FKS A;  5DIT A;  5HWC A;  2F21 A;  2DG9 A;  1TCO C;  4U86 A;  5HKG A;  1D7I A;  4ODN A;  3UQB A;  2XP5 A;  4DRJ A;  2FKE A;  3O5M A;  5HT1 A;  3O5O A;  3IKG A;  4JFM A;  4IQ2 A;  4NNR A;  1NSG A;  4W9Q A;  4W9P A;  1Q6U A;  1BKF A;  2PPN A;  2XPB A;  4DZ3 A;  5HTG A;  2PPO A;  2D9F A;  2ZQV A;  2K8I A;  1ZK6 A;  1D7H A;  4G2P A;  2KFW A;  2N87 A;  1J4H A;  3KAB A;  3WH0 A;  3O5F A;  1N1A A;  4ODP A;  5J6E A;  3O5K A;  3MDY B;  3NRK A;  2XP9 A;  3O5E A;  4LAY A;  1FKB A;  2PPP A;  4ODQ A;  4JFI A;  3RFW A;  5HW8 A;  4QIB A;  1T11 A;  2ZR5 A;  2LPV A;  2RUQ A;  1A7X A;  4ODL A;  4DZ2 A;  3CGN A;  2LKN A;  3KAC A;  1QPL A;  2UZ5 A;  4IPX A;  3UQA A;  1HXV A;  4ODR A;  4BF8 A;  1PIN A;  4GIV A;  1W26 A;  4GGQ A;  2JZV A;  4W9O A;  2KGJ A;  1M5Y A;  3EY6 A;  3KAI A;  3O5Q A;  2XP6 A;  1FKT A;  3IKD A;  2KE0 A;  4TYO A;  1Q6H A;  4MSP A;  4MGV A;  5DIV A;  3TCZ A;  3O5P A;  1F40 A;  3GPK A;  1JNT A;  1FD9 A;  1P5Q A;  2DG3 A;  5HW7 A;  1FJD A;  1KT1 A;  1NMW A;  4TX0 A;  1FKG A;  2PV2 A;  4J4N A;  2LGO A;  3O5G A;  3ODK A;  3UQI A;  3NTP A;  4U84 A;  4DRM A;  2AWG A;  2XP4 A; 
#chains in the Genus database with same CATH topology
 1HKK A;  3PRB A;  2F23 A;  1B6C A;  2OFN A;  4DIP A;  3AS1 A;  3O5R A;  2FDM A;  4Z2G A;  4MNK A;  4P8W A;  4DWS B;  4MNJ A;  5DEZ A;  2A3C A;  3PRD A;  1LL4 A;  3G6L A;  1QPF A;  1ZBV A;  4MAV A;  1JCH B;  4DWS C;  4JFK A;  4JFJ A;  1E15 A;  2ESC A;  1W1T A;  1GOI A;  1ZCN A;  4S3K A;  1E44 A;  2IF4 A;  4J4O A;  4R5E A;  4G50 A;  1NWU A;  3WL0 A;  3PA7 A;  1ZBW A;  1J6Y A;  2DSW A;  5HUA A;  3VAW A;  3ARW A;  2RQS A;  1OGG A;  2MLX A;  2Y78 A;  2ZQT A;  3CHD A;  1FFR A;  2VN1 A;  1FKJ A;  4QT3 A;  2RUD A;  3O5L A;  4Q7N A;  1ROU A;  4P8U A;  1Y0O A;  3ARP A;  3CH9 A;  4ODK A;  3IK8 A;  4DWS D;  5HW6 A;  4LAW A;  2AOS A;  4Z2K A;  2DT1 A;  4U85 A;  1KT0 A;  3KAD A;  1FKH A;  4LAX A;  4LGX A;  3ARS A;  1E6N A;  1LQ0 A;  1TCO C;  2XP5 A;  2FKE A;  3O5M A;  3O5O A;  4JFM A;  2EUL A;  4W5U A;  4W9Q A;  4W9P A;  1BKF A;  4DZ3 A;  1N1A A;  3ART A;  3WQW A;  3NRK A;  3O5E A;  4LAY A;  2PPP A;  4JFI A;  3RFW A;  4QIB A;  4IT4 A;  4ODL A;  4ZPT R;  1LG2 A;  1NWT A;  2DSV A;  3CGN A;  4IPX A;  3ALG A;  1OWQ A;  4KR0 B;  4MPK A;  4WKF A;  3ARZ A;  2JZV A;  3RME A;  3EY6 A;  1FKT A;  4KQZ A;  4TYO A;  2WLZ A;  4MGV A;  5DIV A;  3TCZ A;  1JNT A;  5HW7 A;  1KT1 A;  1NMW A;  2PV2 A;  3NTP A;  4DRM A;  2XP6 A;  2XP4 A;  1U79 A;  1E6R A;  4UDM A;  3IHZ A;  5DF0 A;  5I98 A;  4TNS A;  2WLY A;  2PV3 A;  2RUC A;  2DT0 A;  3UF8 A;  2WM0 A;  4DRI A;  2KR7 A;  1L1P A;  1C9H A;  2LJ4 A;  4TW8 A;  4S3J A;  4C02 B;  4AY1 A;  3CHF A;  3ARV A;  1FKD A;  2MNT A;  4DRN A;  3B9A A;  2DPE A;  3WQV A;  3BMB A;  4QT2 A;  4Z2L A;  1FKR A;  1O6I A;  2A3E A;  2M2A A;  1D7J A;  2L2S A;  4Z2J A;  1UR8 A;  5B8I C;  2F2D A;  3O5J A;  1D6O A;  3H9R B;  2M1I A;  3RM8 A;  1FKF A;  3AS0 A;  1NWS A;  4MNM A;  1GRJ A;  4DRO A;  3B7X A;  4DRP A;  1OGB A;  3JXV A;  2ITK A;  2XP7 A;  4DT4 A;  5HWB A;  1W1V A;  1FKI A;  2VCD A;  2G41 A;  2RSE A;  3FAP A;  1FKK A;  2M08 A;  3O5D A;  1E6Z A;  2PV1 A;  4TW6 A;  5DIT A;  2F21 A;  3QOK A;  4NSB A;  1ZB5 A;  3UQB A;  4DRJ A;  3ARR A;  4DWS A;  5GPR A;  4NNR A;  1HKJ A;  1SYT A;  1HJV A;  5HTG A;  2B31 A;  2D9F A;  2ZQV A;  3CZ8 A;  1D7H A;  3ARX A;  3PRA A;  3WH0 A;  1JND A;  3ALF A;  4ODP A;  4Q22 A;  3O5K A;  1ZBC A;  1ZU8 A;  2XP9 A;  1FKB A;  5JH8 A;  4WJX A;  2ZR5 A;  2LPV A;  4L72 B;  4WKH A;  1CTN A;  2RUQ A;  1A7X A;  2IUZ A;  4QZV B;  3GTY X;  2UZ5 A;  1LJY A;  3UQA A;  1HXV A;  4BF8 A;  1NWR A;  4GIV A;  1W26 A;  1M5Y A;  2O92 A;  1HKM A;  3WD2 A;  2KE0 A;  2DSZ A;  3O5P A;  1HJW A;  1FD9 A;  2B5U B;  4ML4 A;  1VF8 A;  3OA5 A;  3ARY A;  2AWG A;  1K9T A;  4DRH A;  1KFW A;  2A3A A;  2KI3 A;  4LAV A;  4O2T A;  3KAH A;  4P8X A;  3WL1 A;  2ZR6 A;  3CHE A;  3CGM A;  2XP3 A;  4TW7 A;  4NZC A;  3TC5 A;  3I6C A;  5GPG A;  1Q6I A;  1JNS A;  1LL7 A;  3JYM A;  1EHN A;  1YAT A;  2KO7 A;  2MPH A;  1E9L A;  3B9D A;  4WKA A;  2DT3 A;  4WIW A;  1SR0 A;  1XHG A;  1QZ2 A;  4DH0 A;  1FAP A;  4JYS A;  1J4R A;  3TDB A;  3WIJ A;  1IX5 A;  1W1P A;  3FXY A;  3KAG A;  2FAP A;  3WD1 A;  2XPA A;  5DIU A;  2O9O A;  3UI6 A;  2ETN A;  1J4I A;  3UI4 A;  3AS2 A;  2PBC A;  4URI A;  4ODO A;  2ZQS A;  1ROT A;  1FKS A;  3WD3 A;  4Z2H A;  1EIB A;  2DG9 A;  3AS3 A;  4U86 A;  1D7I A;  3GU0 A;  1JNE A;  3IKG A;  1X6L A;  4IQ2 A;  1Q6U A;  3RM4 A;  2YBT A;  1J4H A;  3KAB A;  3O5F A;  4HAR A;  1H0G A;  5J6E A;  1W1Y A;  1TFV A;  1HKI A;  5HW8 A;  4WK9 A;  1GPF A;  2YBU A;  4DZ2 A;  4Z2I A;  3B8S A;  1PIN A;  4W9O A;  1UR9 A;  2KGJ A;  3KAI A;  4ZS6 A;  3WKZ A;  4MSP A;  1X6N A;  3AQU A;  3ARU A;  3GPK A;  1P5Q A;  2DG3 A;  1FJD A;  1FKG A;  3O5G A;  3ODK A;  4U84 A;  4L3N A;  2MLY A;  3WD4 A;  5HBF A;  1F8A B;  3RM9 A;  5BXJ A;  4ITZ A;  3CHC A;  3RGC A;  3ARQ A;  1W9U A;  4DRQ A;  4MTV A;  1LG1 A;  4FN2 A;  4ODM A;  1ZBK A;  1EYM A;  3UI5 A;  5D75 A;  1EQ3 A;  2ZR4 A;  2DG4 A;  2G8Z A;  4R0X A;  1HJX A;  1JVW A;  4IQC A;  1R9H A;  3LUO A;  4N19 A;  3O5I A;  4DRK A;  4JFL A;  3KZ7 A;  3JYJ A;  1Q1C A;  2RUR A;  5DO2 A;  5GQB A;  4ZPW R;  1BL4 A;  2XP8 A;  3NI6 A;  1NMV A;  1NH6 A;  3ARO A;  1YW5 A;  2OLH A;  1PBK A;  1H0I A;  3KAF A;  3B9E A;  2MF9 A;  3PR9 A;  4IT6 A;  1GUV A;  4HBO A;  2MLZ A;  3EIP A;  3OOB A;  2ZQU A;  1FKL A;  3KCE A;  2F4E A;  1XRV A;  4FAP A;  2Q5A A;  5HWC A;  1WAW A;  4XAK A;  3G6M A;  5HKG A;  4ODN A;  1LL6 A;  5HT1 A;  1NSG A;  2PPN A;  2XPB A;  2PPO A;  2K8I A;  1ZK6 A;  4G2P A;  2KFW A;  2N87 A;  2P4V A;  3BXW A;  2DSU A;  2PI6 A;  3MDY B;  3W4R A;  4MNL A;  4ODQ A;  4PTM A;  1T11 A;  2DT2 A;  1WNO A;  4P8V A;  2LKN A;  3KAC A;  1QPL A;  1EDQ A;  1FFQ A;  4ODR A;  4GGQ A;  2QF8 A;  2PN0 A;  3FY1 A;  1ZL1 A;  1W9V A;  3O5Q A;  2A3B A;  2WK2 A;  3IKD A;  1ITX A;  1Q6H A;  1RD6 A;  1D2K A;  1WB0 A;  1F40 A;  4HBE A;  4TX0 A;  1E6P A;  4ZPV R;  1W9P A;  4J4N A;  2LGO A;  3UQI A;  3WD0 A; 
#chains in the Genus database with same CATH homology
 1HKK A;  3PRB A;  1B6C A;  2OFN A;  4DIP A;  3AS1 A;  3O5R A;  2FDM A;  4Z2G A;  4MNK A;  4P8W A;  4DWS B;  4MNJ A;  5DEZ A;  2A3C A;  3PRD A;  1LL4 A;  3G6L A;  1QPF A;  1ZBV A;  4MAV A;  4DWS C;  4JFK A;  4JFJ A;  1E15 A;  2ESC A;  1W1T A;  1GOI A;  1ZCN A;  4S3K A;  4J4O A;  2IF4 A;  4R5E A;  4G50 A;  1NWU A;  3WL0 A;  3PA7 A;  1ZBW A;  1J6Y A;  2DSW A;  5HUA A;  3VAW A;  3ARW A;  2RQS A;  1OGG A;  2MLX A;  2Y78 A;  2ZQT A;  3CHD A;  1FFR A;  2VN1 A;  1FKJ A;  4QT3 A;  2RUD A;  3O5L A;  4Q7N A;  1ROU A;  4P8U A;  1Y0O A;  3ARP A;  3CH9 A;  4ODK A;  3IK8 A;  4DWS D;  5HW6 A;  4LAW A;  2AOS A;  4Z2K A;  2DT1 A;  4U85 A;  1KT0 A;  3KAD A;  1FKH A;  4LAX A;  4LGX A;  3ARS A;  1E6N A;  1LQ0 A;  1TCO C;  2XP5 A;  2FKE A;  3O5M A;  3O5O A;  4JFM A;  4W5U A;  4W9Q A;  4W9P A;  1BKF A;  4DZ3 A;  1N1A A;  3ART A;  3WQW A;  3NRK A;  3O5E A;  4LAY A;  2PPP A;  4JFI A;  3RFW A;  4QIB A;  4IT4 A;  4ODL A;  4ZPT R;  1LG2 A;  1NWT A;  2DSV A;  3CGN A;  4IPX A;  3ALG A;  1OWQ A;  4KR0 B;  4MPK A;  4WKF A;  2JZV A;  3ARZ A;  3RME A;  3EY6 A;  1FKT A;  4KQZ A;  4TYO A;  2WLZ A;  4MGV A;  5DIV A;  3TCZ A;  1JNT A;  5HW7 A;  1KT1 A;  1NMW A;  2PV2 A;  3NTP A;  4DRM A;  2XP6 A;  2XP4 A;  1U79 A;  1E6R A;  3IHZ A;  5DF0 A;  5I98 A;  4TNS A;  2WLY A;  2PV3 A;  2RUC A;  2DT0 A;  3UF8 A;  2WM0 A;  4DRI A;  2KR7 A;  1L1P A;  1C9H A;  2LJ4 A;  4TW8 A;  4S3J A;  4C02 B;  4AY1 A;  3CHF A;  3ARV A;  1FKD A;  2MNT A;  4DRN A;  3B9A A;  2DPE A;  3WQV A;  4QT2 A;  4Z2L A;  1FKR A;  1O6I A;  2A3E A;  2M2A A;  1D7J A;  2L2S A;  4Z2J A;  1UR8 A;  5B8I C;  2F2D A;  3O5J A;  1D6O A;  3H9R B;  2M1I A;  3RM8 A;  1FKF A;  3AS0 A;  1NWS A;  4MNM A;  4DRO A;  3B7X A;  4DRP A;  1OGB A;  3JXV A;  2ITK A;  2XP7 A;  4DT4 A;  5HWB A;  1W1V A;  1FKI A;  2VCD A;  2G41 A;  2RSE A;  3FAP A;  1FKK A;  2M08 A;  3O5D A;  1E6Z A;  2PV1 A;  4TW6 A;  5DIT A;  2F21 A;  3QOK A;  4NSB A;  1ZB5 A;  3UQB A;  4DRJ A;  3ARR A;  4DWS A;  5GPR A;  4NNR A;  1HKJ A;  1SYT A;  1HJV A;  5HTG A;  2B31 A;  2D9F A;  2ZQV A;  3CZ8 A;  1D7H A;  3ARX A;  3PRA A;  3WH0 A;  1JND A;  3ALF A;  4ODP A;  4Q22 A;  3O5K A;  1ZBC A;  1ZU8 A;  2XP9 A;  1FKB A;  5JH8 A;  4WJX A;  2ZR5 A;  2LPV A;  4L72 B;  4WKH A;  1CTN A;  2RUQ A;  1A7X A;  2IUZ A;  4QZV B;  2UZ5 A;  1LJY A;  3UQA A;  1HXV A;  4BF8 A;  1NWR A;  4GIV A;  1W26 A;  1M5Y A;  2O92 A;  1HKM A;  3WD2 A;  2KE0 A;  2DSZ A;  3O5P A;  1HJW A;  1FD9 A;  4ML4 A;  1VF8 A;  3OA5 A;  3ARY A;  2AWG A;  1K9T A;  4DRH A;  1KFW A;  2A3A A;  2KI3 A;  4LAV A;  4O2T A;  3KAH A;  4P8X A;  3WL1 A;  2ZR6 A;  3CHE A;  3CGM A;  2XP3 A;  4TW7 A;  4NZC A;  3TC5 A;  3I6C A;  5GPG A;  1Q6I A;  1JNS A;  1LL7 A;  3JYM A;  1EHN A;  1YAT A;  2KO7 A;  2MPH A;  1E9L A;  3B9D A;  4WKA A;  2DT3 A;  4WIW A;  1SR0 A;  1XHG A;  1QZ2 A;  4DH0 A;  1FAP A;  4JYS A;  1J4R A;  3TDB A;  3WIJ A;  1IX5 A;  1W1P A;  3FXY A;  3KAG A;  2FAP A;  3WD1 A;  2XPA A;  5DIU A;  2O9O A;  3UI6 A;  1J4I A;  3UI4 A;  3AS2 A;  2PBC A;  4URI A;  4ODO A;  2ZQS A;  1ROT A;  1FKS A;  3WD3 A;  4Z2H A;  1EIB A;  2DG9 A;  3AS3 A;  4U86 A;  1D7I A;  1JNE A;  3IKG A;  1X6L A;  4IQ2 A;  1Q6U A;  3RM4 A;  2YBT A;  1J4H A;  3KAB A;  3O5F A;  4HAR A;  1H0G A;  5J6E A;  1W1Y A;  1TFV A;  1HKI A;  5HW8 A;  4WK9 A;  1GPF A;  2YBU A;  4DZ2 A;  4Z2I A;  3B8S A;  1PIN A;  4W9O A;  1UR9 A;  2KGJ A;  3KAI A;  4ZS6 A;  3WKZ A;  4MSP A;  1X6N A;  3AQU A;  3ARU A;  3GPK A;  1P5Q A;  2DG3 A;  1FJD A;  1FKG A;  3O5G A;  3ODK A;  4U84 A;  4L3N A;  2MLY A;  3WD4 A;  5HBF A;  1F8A B;  3RM9 A;  5BXJ A;  4ITZ A;  3CHC A;  3RGC A;  3ARQ A;  1W9U A;  4DRQ A;  4MTV A;  1LG1 A;  4FN2 A;  4ODM A;  1ZBK A;  1EYM A;  3UI5 A;  5D75 A;  1EQ3 A;  2ZR4 A;  2DG4 A;  2G8Z A;  4R0X A;  1HJX A;  1JVW A;  4IQC A;  1R9H A;  3LUO A;  4N19 A;  3O5I A;  4DRK A;  4JFL A;  3KZ7 A;  3JYJ A;  1Q1C A;  2RUR A;  5DO2 A;  5GQB A;  4ZPW R;  1BL4 A;  2XP8 A;  3NI6 A;  1NMV A;  1NH6 A;  3ARO A;  1YW5 A;  2OLH A;  1PBK A;  1H0I A;  3KAF A;  3B9E A;  2MF9 A;  3PR9 A;  4IT6 A;  1GUV A;  4HBO A;  2MLZ A;  3OOB A;  2ZQU A;  1FKL A;  3KCE A;  2F4E A;  1XRV A;  4FAP A;  2Q5A A;  5HWC A;  1WAW A;  4XAK A;  3G6M A;  5HKG A;  4ODN A;  1LL6 A;  5HT1 A;  1NSG A;  2PPN A;  2XPB A;  2PPO A;  2K8I A;  1ZK6 A;  4G2P A;  2KFW A;  2N87 A;  3BXW A;  2DSU A;  2PI6 A;  3MDY B;  3W4R A;  4MNL A;  4ODQ A;  4PTM A;  1T11 A;  2DT2 A;  1WNO A;  4P8V A;  2LKN A;  3KAC A;  1QPL A;  1EDQ A;  1FFQ A;  4ODR A;  4GGQ A;  2QF8 A;  3FY1 A;  1ZL1 A;  1W9V A;  3O5Q A;  2A3B A;  2WK2 A;  3IKD A;  1ITX A;  1Q6H A;  1RD6 A;  1D2K A;  1WB0 A;  1F40 A;  4HBE A;  4TX0 A;  1E6P A;  4ZPV R;  1W9P A;  4J4N A;  2LGO A;  3UQI A;  3WD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...