4G2PA

Crystal structure of peptidyl-prolyl cis-trans isomerase domain ii of molecular chaperone sura from salmonella enterica subsp. enterica serovar typhimurium str. 14028s
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
AISVTEVHARHILLKPSPIMNDQQARLKLEEIAADIKSGKTTFAAAAKEYSQDPGSANQGGDLGWATPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLDTRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of peptidyl-prolyl cis-trans isomerase domain II of molecular chaperone SurA from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. 14028s
molecule tags Isomerase
molecule keywords Chaperone SurA
total genus 29
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4g2pA00
4MSPA 1N1AA 1FKLA 3H9RB 5HUAA 1KT0A 1Y0OA 2KE0A 4ODOA 5DITA 1FD9A 2KFWA 2DG9A 2LPVA 4O2TA 3O5PA 4DRNA 3KACA 4ODRA 4TX0A 2RSEA 3UI5A 4ODKA 4DRKA 1QPLA 3ODKA 4R0XA 2N87A 2MNTA 2XP5A 2AWGA 4QIBA 4LAYA 4DH0A 2ZQVA 3PRDA 4QT2A 1FKGA 4TW8A 1NSGA 1JNTA 4W9PA 2KI3A 3TCZA 1FKHA 2D9FA 3FAPA 4IQCA 3O5DA 1J4RA 4DRMA 5DIUA 4W9OA 2KO7A 2MPHA 2ZR4A 1P5QA 2RUDA 5HW8A 1J4IA 2F2DA 4GIVA 4NNRA 2RUCA 2PPOA 4TW6A 1BKFA 3LUOA 3O5MA 4DRQA 4GGQA 2XP3A 2XPBA 3O5GA 4JFKA 3KAHA 1FKKA 4DZ2A 2Y78A 1YW5A 2PPPA 5GPGA 5HTGA 1EYMA 3NI6A 1A7XA 3O5EA 3O5IA 1FAPA 1FKTA 1PINA 3UI4A 2DG3A 3O5KA 2M08A 1D6OA 3WH0A 1J6YA 3VAWA 2XPAA 2K8IA 1BL4A 5B8IC 4BF8A 3KCEA 4LAWA 1FKBA 1NMVA 2ITKA 2XP7A 1FJDA 4G2PA 1JVWA 1ZCNA 3B7XA 2XP4A 4DRHA 4DT4A 2KR7A 4LAVA 5D75A 1T11A 3I6CA 1L1PA 2PBCA 2PPNA 1KT1A 3JYMA 3KAFA 1QZ2A 2VCDA 4W9QA 4ODQA 1NMWA 2OFNA 2LJ4A 1Q6HA 3EY6A 2ZQTA 4DRPA 2IF4A 5J6EA 1C9HA 3RGCA 4C02B 2MLXA 4TNSA 1QPFA 4TW7A 1D7JA 3NTPA 1D7IA 1FKIA 3UF8A 2LGOA 2RURA 3NRKA 5DIVA 2MLZA 3IKGA 4ITZA 4FN2A 3O5RA 4U84A 4JFJA 4DROA 5HW6A 2RQSA 4JFIA 2PV2A 1Q6IA 4N19A 4ODNA 1PBKA 5HWCA 2JZVA 4DIPA 4JFLA 1ROTA 2PV3A 4JYSA 2F21A 2DG4A 1Q1CA 2M1IA 4QT3A 2Q5AA 3TC5A 4ODPA 5I98A 1FKJA 3O5QA 3O5JA 1EQ3A 3IHZA 4IPXA 5BXJA 1F40A 1Q6UA 3UQIA 1F8AB 4JFMA 4ODLA 1J4HA 2ZR5A 3OOBA 1ZK6A 3TDBA 5HWBA 1HXVA 3O5FA 2KGJA 2ZQSA 4J4OA 2RUQA 4DRIA 3UQAA 3IKDA 3PA7A 1R9HA 3IK8A 2L2SA 3JXVA 3MDYB 1TCOC 3RFWA 4DRJA 2LKNA 2ZR6A 2M2AA 3KZ7A 1FKDA 2MF9A 4FAPA 2FKEA 3CGNA 4MGVA 3CGMA 3GPKA 3O5LA 4DZ3A 2FAPA 3UI6A 1FKRA 3UQBA 4U85A 1W26A 2XP9A 4G50A 1D7HA 2XP6A 2MLYA 1B6CA 3KADA 1FKFA 3KAGA 3O5OA 4U86A 4J4NA 5HT1A 1JNSA 3PRBA 4ODMA 2VN1A 3KABA 1M5YA 4TYOA 1YATA 2UZ5A 2ZQUA 3KAIA 4IQ2A 1FKSA 1ROUA 5HKGA 5HW7A 2F4EA 2XP8A 1U79A 2PV1A 3JYJA 4LAXA
chains in the Genus database with same CATH superfamily
1HJVA 1XHGA 1FD9A 2DG9A 3O5PA 4ODRA 3WKZA 3ODKA 3ARUA 4R0XA 2N87A 2MNTA 3ARSA 2ZQVA 2OLHA 1NSGA 2KI3A 3CHEA 1FKHA 3WD4A 4DRMA 1E15A 5DIUA 4W9OA 1WB0A 5HW8A 3CHDA 2PPOA 1BKFA 3O5MA 1W9UA 4GGQA 2XP3A 2Y78A 1GRJA 4P8UA 1PINA 3UI4A 2DG3A 3O5KA 4WKAA 1D6OA 3WQWA 3VAWA 1BL4A 1E6ZA 3BXWA 5GPRA 2XP4A 4DT4A 1KFWA 3FY1A 4ZPTR 1T11A 3CH9A 1KT1A 1EDQA 2VCDA 4ODQA 2O92A 2LJ4A 1OWQA 1ZL1A 4HARA 2ZQTA 2ESCA 5J6EA 4DWSC 3ARVA 4TNSA 3WD2A 1D7JA 4P8VA 2RURA 3NRKA 2MLZA 4Z2LA 4ITZA 4Q7NA 1JNEA 1W1YA 4U84A 5HW6A 4JFIA 1Q6IA 1VF8A 4ML4A 2M1IA 4ODPA 1H0IA 2G41A 1RD6A 3ARYA 4MPKA 4WJXA 4Q22A 1F40A 1Q6UA 3UQIA 4JFMA 2O9OA 1HXVA 3WD0A 1HKIA 4J4OA 4ZS6A 4DRIA 1SR0A 3RFWA 5JH8A 2LKNA 2ZR6A 3KZ7A 4S3KA 3B9AA 3G6MA 3G6LA 1E9LA 4FAPA 2DPEA 4MGVA 4DZ3A 4UDMA 1W26A 4G50A 1LL4A 3KAGA 3O5OA 4U86A 5HT1A 1JNSA 3PRBA 1W1VA 3KABA 2UZ5A 3KAIA 1ZBKA 5HKGA 1H0GA 4MNKA 5HW7A 3AROA 3RM9A 3IKDA 2PV1A 4HBEA 3ARPA 4LAXA 5HUAA 1Y0OA 5DITA 2P4VA 2KFWA 4L3NA 2LPVA 4O2TA 4DRNA 3KACA 2RSEA 4DRKA 4ODKA 3FXYA 1K9TA 4QIBA 3PRDA 4TW8A 4W9PA 3TCZA 2D9FA 4IQCA 3RM8A 4MNMA 4KQZA 1P5QA 1J4IA 2F2DA 1E6PA 3ALGA 4QZVB 2WLYA 2XPBA 2EULA 3KAHA 3O5GA 4JFKA 5DEZA 2PPPA 5GPGA 5HTGA 2PI6A 4R5EA 1FAPA 4KR0B 1EHNA 3WH0A 2K8IA 4LAWA 3AS3A 1SYTA 2XP7A 1FJDA 4G2PA 1JVWA 4Z2GA 4LAVA 2A3CA 2PPNA 4IT6A 4W9QA 1QZ2A 1NWUA 4IT4A 3ALFA 3EY6A 3EIPA 1W9PA 1QPFA 3B8SA 4TW7A 1FFQA 4W5UA 1LG2A 5DIVA 3IKGA 2B5UB 2IUZA 3WL0A 2RQSA 4N19A 4ODNA 1PBKA 2JZVA 4JFLA 1E44A 3WIJA 2PV3A 2F21A 5I98A 1EQ3A 5BXJA 2A3AA 1ZK6A 3AS0A 1UR8A 4MTVA 2ZQSA 1ZB5A 3UQAA 1R9HA 1ZBCA 2L2SA 4ZPWR 3ARTA 2AOSA 4Z2IA 2MF9A 2FKEA 3CGNA 3WD1A 4MAVA 1FKRA 2XP9A 3KADA 2XP6A 1FKFA 3WD3A 1FFRA 4J4NA 4ODMA 1M5YA 3CHFA 4WKFA 1YATA 2PN0A 1ROUA 1WAWA 1HJXA 1X6LA 4WKHA 3JYJA 4MSPA 2F23A 3H9RB 3ARXA 2DSWA 1KT0A 2KE0A 2DSVA 4ODOA 3RMEA 1GUVA 3CHCA 4MNJA 3GTYX 2XP5A 4HBOA 1JCHB 4DH0A 4QT2A 1FKGA 1JNTA 1LL6A 1J4RA 2DSUA 2MPHA 2RUDA 4WK9A 4GIVA 1LQ0A 2RUCA 4TW6A 3LUOA 4ZPVR 4Z2JA 1NWTA 1EIBA 1FKKA 1GPFA 4NSBA 1LJYA 1EYMA 4AY1A 1A7XA 1NWSA 2ETNA 1O6IA 2XPAA 4L72B 5B8IC 1FKBA 2ITKA 4DWSD 4S3JA 1ZCNA 5D75A 4URIA 3I6CA 1L1PA 3JYMA 3WL1A 2YBUA 4DRPA 2IF4A 4XAKA 4C02B 3NTPA 3B9EA 3UF8A 2LGOA 4DROA 5HWCA 1ROTA 3WQVA 4JYSA 1Q1CA 3TC5A 1FKJA 2FDMA 3IHZA 2DSZA 5GQBA 1F8AB 2ZR5A 1ZBVA 3W4RA 2DT3A 3O5FA 2WLZA 3PA7A 3IK8A 1TCOC 4DRJA 5DF0A 2M2AA 4NZCA 1FKDA 1HKMA 4MNLA 2DT0A 2QF8A 3CGMA 3UQBA 4U85A 1D7HA 2MLYA 1B6CA 3AS1A 1X6NA 2VN1A 3PRAA 2ZQUA 1OGGA 1IX5A 1FKSA 2F4EA 1U79A 1W1TA 1N1AA 1FKLA 1LL7A 4WIWA 4PTMA 4Z2KA 4TX0A 3UI5A 1QPLA 3RM4A 4Z2HA 2AWGA 4DWSB 4LAYA 1JNDA 3FAPA 3O5DA 2KO7A 2ZR4A 3AQUA 4NNRA 4DRQA 4DZ2A 1YW5A 3NI6A 3O5EA 3O5IA 1FKTA 1J6YA 2M08A 1NWRA 1TFVA 1WNOA 1ZU8A 3AS2A 1W1PA 1NMVA 3B9DA 3GU0A 3KCEA 4BF8A 5HBFA 3B7XA 4P8XA 4DRHA 2KR7A 3CZ8A 2PBCA 1CTNA 3KAFA 1NMWA 2OFNA 3ARRA 1Q6HA 1XRVA 4DWSA 1OGBA 1C9HA 3RGCA 2MLXA 1NH6A 2WK2A 2A3BA 1LG1A 1D7IA 1FKIA 3ARQA 3QOKA 3PR9A 4FN2A 3O5RA 4P8WA 1ZBWA 4JFJA 3ARWA 2WM0A 2PV2A 1HKKA 4DIPA 2DG4A 1ITXA 4QT3A 2Q5AA 1D2KA 5DO2A 3O5QA 2YBTA 3O5JA 3ARZA 4IPXA 2DT1A 4ODLA 1J4HA 3OOBA 3TDBA 5HWBA 3OA5A 2KGJA 1GOIA 2RUQA 2DT2A 3BMBA 3MDYB 3JXVA 1HJWA 4LGXA 2A3EA 1E6NA 2G8ZA 3GPKA 3O5LA 2FAPA 3UI6A 1UR9A 1E6RA 1W9VA 2B31A 4TYOA 4IQ2A 1HKJA 2XP8A
chains in the Genus database with same CATH topology
1HJVA 1XHGA 1FD9A 2DG9A 3O5PA 4ODRA 3WKZA 3ODKA 3ARUA 4R0XA 2N87A 2MNTA 3ARSA 2ZQVA 2OLHA 1NSGA 2KI3A 3CHEA 1FKHA 3WD4A 4DRMA 1E15A 5DIUA 4W9OA 1WB0A 5HW8A 3CHDA 2PPOA 1BKFA 3O5MA 1W9UA 4GGQA 2XP3A 2Y78A 4P8UA 1PINA 3UI4A 2DG3A 3O5KA 4WKAA 1D6OA 3WQWA 3VAWA 1BL4A 1E6ZA 3BXWA 5GPRA 2XP4A 4DT4A 1KFWA 3FY1A 4ZPTR 1T11A 3CH9A 1KT1A 1EDQA 2VCDA 4ODQA 2O92A 2LJ4A 1OWQA 1ZL1A 4HARA 2ZQTA 2ESCA 5J6EA 4DWSC 3ARVA 4TNSA 3WD2A 1D7JA 4P8VA 2RURA 3NRKA 2MLZA 4Z2LA 4ITZA 4Q7NA 1JNEA 1W1YA 4U84A 5HW6A 4JFIA 1Q6IA 1VF8A 4ML4A 2M1IA 4ODPA 1H0IA 2G41A 1RD6A 3ARYA 4MPKA 4WJXA 4Q22A 1F40A 1Q6UA 3UQIA 4JFMA 2O9OA 1HXVA 3WD0A 1HKIA 4J4OA 4ZS6A 4DRIA 1SR0A 3RFWA 5JH8A 2LKNA 2ZR6A 3KZ7A 4S3KA 3B9AA 3G6MA 3G6LA 1E9LA 4FAPA 2DPEA 4MGVA 4DZ3A 1W26A 4G50A 1LL4A 3KAGA 3O5OA 4U86A 5HT1A 1JNSA 3PRBA 1W1VA 3KABA 2UZ5A 3KAIA 1ZBKA 5HKGA 1H0GA 4MNKA 5HW7A 3AROA 3RM9A 3IKDA 2PV1A 4HBEA 3ARPA 4LAXA 5HUAA 1Y0OA 5DITA 2KFWA 4L3NA 2LPVA 4O2TA 4DRNA 3KACA 2RSEA 4DRKA 4ODKA 3FXYA 1K9TA 4QIBA 3PRDA 4TW8A 4W9PA 3TCZA 2D9FA 4IQCA 3RM8A 4MNMA 4KQZA 1P5QA 1J4IA 2F2DA 1E6PA 3ALGA 4QZVB 2WLYA 2XPBA 3O5GA 3KAHA 4JFKA 5DEZA 2PPPA 5GPGA 5HTGA 2PI6A 4R5EA 1FAPA 4KR0B 1EHNA 3WH0A 2K8IA 4LAWA 3AS3A 1SYTA 2XP7A 1FJDA 4G2PA 1JVWA 4Z2GA 4LAVA 2A3CA 2PPNA 4IT6A 4W9QA 1QZ2A 1NWUA 4IT4A 3ALFA 3EY6A 1W9PA 1QPFA 3B8SA 4TW7A 1FFQA 4W5UA 1LG2A 5DIVA 3IKGA 2IUZA 3WL0A 2RQSA 4N19A 4ODNA 1PBKA 2JZVA 4JFLA 3WIJA 2PV3A 2F21A 5I98A 1EQ3A 5BXJA 2A3AA 1ZK6A 3AS0A 1UR8A 4MTVA 2ZQSA 1ZB5A 3UQAA 1R9HA 1ZBCA 2L2SA 4ZPWR 3ARTA 2AOSA 4Z2IA 2MF9A 2FKEA 3CGNA 3WD1A 4MAVA 1FKRA 2XP9A 3KADA 2XP6A 1FKFA 3WD3A 1FFRA 4J4NA 4ODMA 1M5YA 3CHFA 4WKFA 1YATA 1ROUA 1WAWA 1HJXA 1X6LA 4WKHA 3JYJA 4MSPA 3H9RB 3ARXA 2DSWA 1KT0A 2KE0A 2DSVA 4ODOA 3RMEA 1GUVA 3CHCA 4MNJA 2XP5A 4HBOA 4DH0A 4QT2A 1FKGA 1JNTA 1LL6A 1J4RA 2DSUA 2MPHA 2RUDA 4WK9A 4GIVA 1LQ0A 2RUCA 4TW6A 3LUOA 4ZPVR 4Z2JA 1NWTA 1EIBA 1FKKA 1GPFA 4NSBA 1LJYA 1EYMA 4AY1A 1A7XA 1NWSA 1O6IA 2XPAA 4L72B 5B8IC 1FKBA 2ITKA 4DWSD 4S3JA 1ZCNA 5D75A 4URIA 3I6CA 1L1PA 3JYMA 3WL1A 2YBUA 4DRPA 2IF4A 4XAKA 4C02B 3NTPA 3B9EA 3UF8A 2LGOA 4DROA 5HWCA 1ROTA 3WQVA 4JYSA 1Q1CA 3TC5A 1FKJA 2FDMA 3IHZA 2DSZA 5GQBA 1F8AB 2ZR5A 1ZBVA 3W4RA 2DT3A 3O5FA 2WLZA 3PA7A 3IK8A 1TCOC 4DRJA 5DF0A 2M2AA 4NZCA 1FKDA 1HKMA 4MNLA 2DT0A 2QF8A 3CGMA 3UQBA 4U85A 1D7HA 2MLYA 1B6CA 3AS1A 1X6NA 2VN1A 3PRAA 2ZQUA 1OGGA 1IX5A 1FKSA 2F4EA 1U79A 1W1TA 1N1AA 1FKLA 1LL7A 4WIWA 4PTMA 4Z2KA 4TX0A 3UI5A 1QPLA 3RM4A 4Z2HA 2AWGA 4DWSB 4LAYA 1JNDA 3FAPA 3O5DA 2KO7A 2ZR4A 3AQUA 4NNRA 4DRQA 4DZ2A 1YW5A 3NI6A 3O5EA 3O5IA 1FKTA 1J6YA 2M08A 1NWRA 1TFVA 1WNOA 1ZU8A 3AS2A 1W1PA 1NMVA 3B9DA 3KCEA 4BF8A 5HBFA 3B7XA 4P8XA 4DRHA 2KR7A 3CZ8A 2PBCA 1CTNA 3KAFA 1NMWA 2OFNA 3ARRA 1Q6HA 1XRVA 4DWSA 1OGBA 1C9HA 3RGCA 2MLXA 1NH6A 2WK2A 2A3BA 1LG1A 1D7IA 1FKIA 3ARQA 3QOKA 3PR9A 4FN2A 3O5RA 4P8WA 1ZBWA 4JFJA 3ARWA 2WM0A 2PV2A 1HKKA 4DIPA 2DG4A 1ITXA 4QT3A 2Q5AA 1D2KA 5DO2A 3O5QA 2YBTA 3O5JA 3ARZA 4IPXA 2DT1A 4ODLA 1J4HA 3OOBA 3TDBA 5HWBA 3OA5A 2KGJA 1GOIA 2RUQA 2DT2A 3MDYB 3JXVA 1HJWA 4LGXA 2A3EA 1E6NA 2G8ZA 3GPKA 3O5LA 2FAPA 3UI6A 1UR9A 1E6RA 1W9VA 2B31A 4TYOA 4IQ2A 1HKJA 2XP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSP A;  1N1A A;  1FKL A;  3H9R B;  5HUA A;  1KT0 A;  1Y0O A;  2KE0 A;  4ODO A;  5DIT A;  1FD9 A;  2KFW A;  2DG9 A;  2LPV A;  4O2T A;  3O5P A;  4DRN A;  3KAC A;  4ODR A;  4TX0 A;  2RSE A;  3UI5 A;  4ODK A;  4DRK A;  1QPL A;  3ODK A;  4R0X A;  2N87 A;  2MNT A;  2XP5 A;  2AWG A;  4QIB A;  4LAY A;  4DH0 A;  2ZQV A;  3PRD A;  4QT2 A;  1FKG A;  4TW8 A;  1NSG A;  1JNT A;  4W9P A;  2KI3 A;  3TCZ A;  1FKH A;  2D9F A;  3FAP A;  4IQC A;  3O5D A;  1J4R A;  4DRM A;  5DIU A;  4W9O A;  2KO7 A;  2MPH A;  2ZR4 A;  1P5Q A;  2RUD A;  5HW8 A;  1J4I A;  2F2D A;  4GIV A;  4NNR A;  2RUC A;  2PPO A;  4TW6 A;  1BKF A;  3LUO A;  3O5M A;  4DRQ A;  4GGQ A;  2XP3 A;  2XPB A;  3O5G A;  4JFK A;  3KAH A;  1FKK A;  4DZ2 A;  2Y78 A;  1YW5 A;  2PPP A;  5GPG A;  5HTG A;  1EYM A;  3NI6 A;  1A7X A;  3O5E A;  3O5I A;  1FAP A;  1FKT A;  1PIN A;  3UI4 A;  2DG3 A;  3O5K A;  2M08 A;  1D6O A;  3WH0 A;  1J6Y A;  3VAW A;  2XPA A;  2K8I A;  1BL4 A;  5B8I C;  4BF8 A;  3KCE A;  4LAW A;  1FKB A;  1NMV A;  2ITK A;  2XP7 A;  1FJD A;  4G2P A;  1JVW A;  1ZCN A;  3B7X A;  2XP4 A;  4DRH A;  4DT4 A;  2KR7 A;  4LAV A;  5D75 A;  1T11 A;  3I6C A;  1L1P A;  2PBC A;  2PPN A;  1KT1 A;  3JYM A;  3KAF A;  1QZ2 A;  2VCD A;  4W9Q A;  4ODQ A;  1NMW A;  2OFN A;  2LJ4 A;  1Q6H A;  3EY6 A;  2ZQT A;  4DRP A;  2IF4 A;  5J6E A;  1C9H A;  3RGC A;  4C02 B;  2MLX A;  4TNS A;  1QPF A;  4TW7 A;  1D7J A;  3NTP A;  1D7I A;  1FKI A;  3UF8 A;  2LGO A;  2RUR A;  3NRK A;  5DIV A;  2MLZ A;  3IKG A;  4ITZ A;  4FN2 A;  3O5R A;  4U84 A;  4JFJ A;  4DRO A;  5HW6 A;  2RQS A;  4JFI A;  2PV2 A;  1Q6I A;  4N19 A;  4ODN A;  1PBK A;  5HWC A;  2JZV A;  4DIP A;  4JFL A;  1ROT A;  2PV3 A;  4JYS A;  2F21 A;  2DG4 A;  1Q1C A;  2M1I A;  4QT3 A;  2Q5A A;  3TC5 A;  4ODP A;  5I98 A;  1FKJ A;  3O5Q A;  3O5J A;  1EQ3 A;  3IHZ A;  4IPX A;  5BXJ A;  1F40 A;  1Q6U A;  3UQI A;  1F8A B;  4JFM A;  4ODL A;  1J4H A;  2ZR5 A;  3OOB A;  1ZK6 A;  3TDB A;  5HWB A;  1HXV A;  3O5F A;  2KGJ A;  2ZQS A;  4J4O A;  2RUQ A;  4DRI A;  3UQA A;  3IKD A;  3PA7 A;  1R9H A;  3IK8 A;  2L2S A;  3JXV A;  3MDY B;  1TCO C;  3RFW A;  4DRJ A;  2LKN A;  2ZR6 A;  2M2A A;  3KZ7 A;  1FKD A;  2MF9 A;  4FAP A;  2FKE A;  3CGN A;  4MGV A;  3CGM A;  3GPK A;  3O5L A;  4DZ3 A;  2FAP A;  3UI6 A;  1FKR A;  3UQB A;  4U85 A;  1W26 A;  2XP9 A;  4G50 A;  1D7H A;  2XP6 A;  2MLY A;  1B6C A;  3KAD A;  1FKF A;  3KAG A;  3O5O A;  4U86 A;  4J4N A;  5HT1 A;  1JNS A;  3PRB A;  4ODM A;  2VN1 A;  3KAB A;  1M5Y A;  4TYO A;  1YAT A;  2UZ5 A;  2ZQU A;  3KAI A;  4IQ2 A;  1FKS A;  1ROU A;  5HKG A;  5HW7 A;  2F4E A;  2XP8 A;  1U79 A;  2PV1 A;  3JYJ A;  4LAX A; 
#chains in the Genus database with same CATH topology
 1HJV A;  1XHG A;  1FD9 A;  2DG9 A;  3O5P A;  4ODR A;  3WKZ A;  3ODK A;  3ARU A;  4R0X A;  2N87 A;  2MNT A;  3ARS A;  2ZQV A;  2OLH A;  1NSG A;  2KI3 A;  3CHE A;  1FKH A;  3WD4 A;  4DRM A;  1E15 A;  5DIU A;  4W9O A;  1WB0 A;  5HW8 A;  3CHD A;  2PPO A;  1BKF A;  3O5M A;  1W9U A;  4GGQ A;  2XP3 A;  2Y78 A;  1GRJ A;  4P8U A;  1PIN A;  3UI4 A;  2DG3 A;  3O5K A;  4WKA A;  1D6O A;  3WQW A;  3VAW A;  1BL4 A;  1E6Z A;  3BXW A;  5GPR A;  2XP4 A;  4DT4 A;  1KFW A;  3FY1 A;  4ZPT R;  1T11 A;  3CH9 A;  1KT1 A;  1EDQ A;  2VCD A;  4ODQ A;  2O92 A;  2LJ4 A;  1OWQ A;  1ZL1 A;  4HAR A;  2ZQT A;  2ESC A;  5J6E A;  4DWS C;  3ARV A;  4TNS A;  3WD2 A;  1D7J A;  4P8V A;  2RUR A;  3NRK A;  2MLZ A;  4Z2L A;  4ITZ A;  4Q7N A;  1JNE A;  1W1Y A;  4U84 A;  5HW6 A;  4JFI A;  1Q6I A;  1VF8 A;  4ML4 A;  2M1I A;  4ODP A;  1H0I A;  2G41 A;  1RD6 A;  3ARY A;  4MPK A;  4WJX A;  4Q22 A;  1F40 A;  1Q6U A;  3UQI A;  4JFM A;  2O9O A;  1HXV A;  3WD0 A;  1HKI A;  4J4O A;  4ZS6 A;  4DRI A;  1SR0 A;  3RFW A;  5JH8 A;  2LKN A;  2ZR6 A;  3KZ7 A;  4S3K A;  3B9A A;  3G6M A;  3G6L A;  1E9L A;  4FAP A;  2DPE A;  4MGV A;  4DZ3 A;  4UDM A;  1W26 A;  4G50 A;  1LL4 A;  3KAG A;  3O5O A;  4U86 A;  5HT1 A;  1JNS A;  3PRB A;  1W1V A;  3KAB A;  2UZ5 A;  3KAI A;  1ZBK A;  5HKG A;  1H0G A;  4MNK A;  5HW7 A;  3ARO A;  3RM9 A;  3IKD A;  2PV1 A;  4HBE A;  3ARP A;  4LAX A;  5HUA A;  1Y0O A;  5DIT A;  2P4V A;  2KFW A;  4L3N A;  2LPV A;  4O2T A;  4DRN A;  3KAC A;  2RSE A;  4DRK A;  4ODK A;  3FXY A;  1K9T A;  4QIB A;  3PRD A;  4TW8 A;  4W9P A;  3TCZ A;  2D9F A;  4IQC A;  3RM8 A;  4MNM A;  4KQZ A;  1P5Q A;  1J4I A;  2F2D A;  1E6P A;  3ALG A;  4QZV B;  2WLY A;  2XPB A;  2EUL A;  3KAH A;  3O5G A;  4JFK A;  5DEZ A;  2PPP A;  5GPG A;  5HTG A;  2PI6 A;  4R5E A;  1FAP A;  4KR0 B;  1EHN A;  3WH0 A;  2K8I A;  4LAW A;  3AS3 A;  1SYT A;  2XP7 A;  1FJD A;  4G2P A;  1JVW A;  4Z2G A;  4LAV A;  2A3C A;  2PPN A;  4IT6 A;  4W9Q A;  1QZ2 A;  1NWU A;  4IT4 A;  3ALF A;  3EY6 A;  3EIP A;  1W9P A;  1QPF A;  3B8S A;  4TW7 A;  1FFQ A;  4W5U A;  1LG2 A;  5DIV A;  3IKG A;  2B5U B;  2IUZ A;  3WL0 A;  2RQS A;  4N19 A;  4ODN A;  1PBK A;  2JZV A;  4JFL A;  1E44 A;  3WIJ A;  2PV3 A;  2F21 A;  5I98 A;  1EQ3 A;  5BXJ A;  2A3A A;  1ZK6 A;  3AS0 A;  1UR8 A;  4MTV A;  2ZQS A;  1ZB5 A;  3UQA A;  1R9H A;  1ZBC A;  2L2S A;  4ZPW R;  3ART A;  2AOS A;  4Z2I A;  2MF9 A;  2FKE A;  3CGN A;  3WD1 A;  4MAV A;  1FKR A;  2XP9 A;  3KAD A;  2XP6 A;  1FKF A;  3WD3 A;  1FFR A;  4J4N A;  4ODM A;  1M5Y A;  3CHF A;  4WKF A;  1YAT A;  2PN0 A;  1ROU A;  1WAW A;  1HJX A;  1X6L A;  4WKH A;  3JYJ A;  4MSP A;  2F23 A;  3H9R B;  3ARX A;  2DSW A;  1KT0 A;  2KE0 A;  2DSV A;  4ODO A;  3RME A;  1GUV A;  3CHC A;  4MNJ A;  3GTY X;  2XP5 A;  4HBO A;  1JCH B;  4DH0 A;  4QT2 A;  1FKG A;  1JNT A;  1LL6 A;  1J4R A;  2DSU A;  2MPH A;  2RUD A;  4WK9 A;  4GIV A;  1LQ0 A;  2RUC A;  4TW6 A;  3LUO A;  4ZPV R;  4Z2J A;  1NWT A;  1EIB A;  1FKK A;  1GPF A;  4NSB A;  1LJY A;  1EYM A;  4AY1 A;  1A7X A;  1NWS A;  2ETN A;  1O6I A;  2XPA A;  4L72 B;  5B8I C;  1FKB A;  2ITK A;  4DWS D;  4S3J A;  1ZCN A;  5D75 A;  4URI A;  3I6C A;  1L1P A;  3JYM A;  3WL1 A;  2YBU A;  4DRP A;  2IF4 A;  4XAK A;  4C02 B;  3NTP A;  3B9E A;  3UF8 A;  2LGO A;  4DRO A;  5HWC A;  1ROT A;  3WQV A;  4JYS A;  1Q1C A;  3TC5 A;  1FKJ A;  2FDM A;  3IHZ A;  2DSZ A;  5GQB A;  1F8A B;  2ZR5 A;  1ZBV A;  3W4R A;  2DT3 A;  3O5F A;  2WLZ A;  3PA7 A;  3IK8 A;  1TCO C;  4DRJ A;  5DF0 A;  2M2A A;  4NZC A;  1FKD A;  1HKM A;  4MNL A;  2DT0 A;  2QF8 A;  3CGM A;  3UQB A;  4U85 A;  1D7H A;  2MLY A;  1B6C A;  3AS1 A;  1X6N A;  2VN1 A;  3PRA A;  2ZQU A;  1OGG A;  1IX5 A;  1FKS A;  2F4E A;  1U79 A;  1W1T A;  1N1A A;  1FKL A;  1LL7 A;  4WIW A;  4PTM A;  4Z2K A;  4TX0 A;  3UI5 A;  1QPL A;  3RM4 A;  4Z2H A;  2AWG A;  4DWS B;  4LAY A;  1JND A;  3FAP A;  3O5D A;  2KO7 A;  2ZR4 A;  3AQU A;  4NNR A;  4DRQ A;  4DZ2 A;  1YW5 A;  3NI6 A;  3O5E A;  3O5I A;  1FKT A;  1J6Y A;  2M08 A;  1NWR A;  1TFV A;  1WNO A;  1ZU8 A;  3AS2 A;  1W1P A;  1NMV A;  3B9D A;  3GU0 A;  3KCE A;  4BF8 A;  5HBF A;  3B7X A;  4P8X A;  4DRH A;  2KR7 A;  3CZ8 A;  2PBC A;  1CTN A;  3KAF A;  1NMW A;  2OFN A;  3ARR A;  1Q6H A;  1XRV A;  4DWS A;  1OGB A;  1C9H A;  3RGC A;  2MLX A;  1NH6 A;  2WK2 A;  2A3B A;  1LG1 A;  1D7I A;  1FKI A;  3ARQ A;  3QOK A;  3PR9 A;  4FN2 A;  3O5R A;  4P8W A;  1ZBW A;  4JFJ A;  3ARW A;  2WM0 A;  2PV2 A;  1HKK A;  4DIP A;  2DG4 A;  1ITX A;  4QT3 A;  2Q5A A;  1D2K A;  5DO2 A;  3O5Q A;  2YBT A;  3O5J A;  3ARZ A;  4IPX A;  2DT1 A;  4ODL A;  1J4H A;  3OOB A;  3TDB A;  5HWB A;  3OA5 A;  2KGJ A;  1GOI A;  2RUQ A;  2DT2 A;  3BMB A;  3MDY B;  3JXV A;  1HJW A;  4LGX A;  2A3E A;  1E6N A;  2G8Z A;  3GPK A;  3O5L A;  2FAP A;  3UI6 A;  1UR9 A;  1E6R A;  1W9V A;  2B31 A;  4TYO A;  4IQ2 A;  1HKJ A;  2XP8 A; 
#chains in the Genus database with same CATH homology
 1HJV A;  1XHG A;  1FD9 A;  2DG9 A;  3O5P A;  4ODR A;  3WKZ A;  3ODK A;  3ARU A;  4R0X A;  2N87 A;  2MNT A;  3ARS A;  2ZQV A;  2OLH A;  1NSG A;  2KI3 A;  3CHE A;  1FKH A;  3WD4 A;  4DRM A;  1E15 A;  5DIU A;  4W9O A;  1WB0 A;  5HW8 A;  3CHD A;  2PPO A;  1BKF A;  3O5M A;  1W9U A;  4GGQ A;  2XP3 A;  2Y78 A;  4P8U A;  1PIN A;  3UI4 A;  2DG3 A;  3O5K A;  4WKA A;  1D6O A;  3WQW A;  3VAW A;  1BL4 A;  1E6Z A;  3BXW A;  5GPR A;  2XP4 A;  4DT4 A;  1KFW A;  3FY1 A;  4ZPT R;  1T11 A;  3CH9 A;  1KT1 A;  1EDQ A;  2VCD A;  4ODQ A;  2O92 A;  2LJ4 A;  1OWQ A;  1ZL1 A;  4HAR A;  2ZQT A;  2ESC A;  5J6E A;  4DWS C;  3ARV A;  4TNS A;  3WD2 A;  1D7J A;  4P8V A;  2RUR A;  3NRK A;  2MLZ A;  4Z2L A;  4ITZ A;  4Q7N A;  1JNE A;  1W1Y A;  4U84 A;  5HW6 A;  4JFI A;  1Q6I A;  1VF8 A;  4ML4 A;  2M1I A;  4ODP A;  1H0I A;  2G41 A;  1RD6 A;  3ARY A;  4MPK A;  4WJX A;  4Q22 A;  1F40 A;  1Q6U A;  3UQI A;  4JFM A;  2O9O A;  1HXV A;  3WD0 A;  1HKI A;  4J4O A;  4ZS6 A;  4DRI A;  1SR0 A;  3RFW A;  5JH8 A;  2LKN A;  2ZR6 A;  3KZ7 A;  4S3K A;  3B9A A;  3G6M A;  3G6L A;  1E9L A;  4FAP A;  2DPE A;  4MGV A;  4DZ3 A;  1W26 A;  4G50 A;  1LL4 A;  3KAG A;  3O5O A;  4U86 A;  5HT1 A;  1JNS A;  3PRB A;  1W1V A;  3KAB A;  2UZ5 A;  3KAI A;  1ZBK A;  5HKG A;  1H0G A;  4MNK A;  5HW7 A;  3ARO A;  3RM9 A;  3IKD A;  2PV1 A;  4HBE A;  3ARP A;  4LAX A;  5HUA A;  1Y0O A;  5DIT A;  2KFW A;  4L3N A;  2LPV A;  4O2T A;  4DRN A;  3KAC A;  2RSE A;  4DRK A;  4ODK A;  3FXY A;  1K9T A;  4QIB A;  3PRD A;  4TW8 A;  4W9P A;  3TCZ A;  2D9F A;  4IQC A;  3RM8 A;  4MNM A;  4KQZ A;  1P5Q A;  1J4I A;  2F2D A;  1E6P A;  3ALG A;  4QZV B;  2WLY A;  2XPB A;  3O5G A;  3KAH A;  4JFK A;  5DEZ A;  2PPP A;  5GPG A;  5HTG A;  2PI6 A;  4R5E A;  1FAP A;  4KR0 B;  1EHN A;  3WH0 A;  2K8I A;  4LAW A;  3AS3 A;  1SYT A;  2XP7 A;  1FJD A;  4G2P A;  1JVW A;  4Z2G A;  4LAV A;  2A3C A;  2PPN A;  4IT6 A;  4W9Q A;  1QZ2 A;  1NWU A;  4IT4 A;  3ALF A;  3EY6 A;  1W9P A;  1QPF A;  3B8S A;  4TW7 A;  1FFQ A;  4W5U A;  1LG2 A;  5DIV A;  3IKG A;  2IUZ A;  3WL0 A;  2RQS A;  4N19 A;  4ODN A;  1PBK A;  2JZV A;  4JFL A;  3WIJ A;  2PV3 A;  2F21 A;  5I98 A;  1EQ3 A;  5BXJ A;  2A3A A;  1ZK6 A;  3AS0 A;  1UR8 A;  4MTV A;  2ZQS A;  1ZB5 A;  3UQA A;  1R9H A;  1ZBC A;  2L2S A;  4ZPW R;  3ART A;  2AOS A;  4Z2I A;  2MF9 A;  2FKE A;  3CGN A;  3WD1 A;  4MAV A;  1FKR A;  2XP9 A;  3KAD A;  2XP6 A;  1FKF A;  3WD3 A;  1FFR A;  4J4N A;  4ODM A;  1M5Y A;  3CHF A;  4WKF A;  1YAT A;  1ROU A;  1WAW A;  1HJX A;  1X6L A;  4WKH A;  3JYJ A;  4MSP A;  3H9R B;  3ARX A;  2DSW A;  1KT0 A;  2KE0 A;  2DSV A;  4ODO A;  3RME A;  1GUV A;  3CHC A;  4MNJ A;  2XP5 A;  4HBO A;  4DH0 A;  4QT2 A;  1FKG A;  1JNT A;  1LL6 A;  1J4R A;  2DSU A;  2MPH A;  2RUD A;  4WK9 A;  4GIV A;  1LQ0 A;  2RUC A;  4TW6 A;  3LUO A;  4ZPV R;  4Z2J A;  1NWT A;  1EIB A;  1FKK A;  1GPF A;  4NSB A;  1LJY A;  1EYM A;  4AY1 A;  1A7X A;  1NWS A;  1O6I A;  2XPA A;  4L72 B;  5B8I C;  1FKB A;  2ITK A;  4DWS D;  4S3J A;  1ZCN A;  5D75 A;  4URI A;  3I6C A;  1L1P A;  3JYM A;  3WL1 A;  2YBU A;  4DRP A;  2IF4 A;  4XAK A;  4C02 B;  3NTP A;  3B9E A;  3UF8 A;  2LGO A;  4DRO A;  5HWC A;  1ROT A;  3WQV A;  4JYS A;  1Q1C A;  3TC5 A;  1FKJ A;  2FDM A;  3IHZ A;  2DSZ A;  5GQB A;  1F8A B;  2ZR5 A;  1ZBV A;  3W4R A;  2DT3 A;  3O5F A;  2WLZ A;  3PA7 A;  3IK8 A;  1TCO C;  4DRJ A;  5DF0 A;  2M2A A;  4NZC A;  1FKD A;  1HKM A;  4MNL A;  2DT0 A;  2QF8 A;  3CGM A;  3UQB A;  4U85 A;  1D7H A;  2MLY A;  1B6C A;  3AS1 A;  1X6N A;  2VN1 A;  3PRA A;  2ZQU A;  1OGG A;  1IX5 A;  1FKS A;  2F4E A;  1U79 A;  1W1T A;  1N1A A;  1FKL A;  1LL7 A;  4WIW A;  4PTM A;  4Z2K A;  4TX0 A;  3UI5 A;  1QPL A;  3RM4 A;  4Z2H A;  2AWG A;  4DWS B;  4LAY A;  1JND A;  3FAP A;  3O5D A;  2KO7 A;  2ZR4 A;  3AQU A;  4NNR A;  4DRQ A;  4DZ2 A;  1YW5 A;  3NI6 A;  3O5E A;  3O5I A;  1FKT A;  1J6Y A;  2M08 A;  1NWR A;  1TFV A;  1WNO A;  1ZU8 A;  3AS2 A;  1W1P A;  1NMV A;  3B9D A;  3KCE A;  4BF8 A;  5HBF A;  3B7X A;  4P8X A;  4DRH A;  2KR7 A;  3CZ8 A;  2PBC A;  1CTN A;  3KAF A;  1NMW A;  2OFN A;  3ARR A;  1Q6H A;  1XRV A;  4DWS A;  1OGB A;  1C9H A;  3RGC A;  2MLX A;  1NH6 A;  2WK2 A;  2A3B A;  1LG1 A;  1D7I A;  1FKI A;  3ARQ A;  3QOK A;  3PR9 A;  4FN2 A;  3O5R A;  4P8W A;  1ZBW A;  4JFJ A;  3ARW A;  2WM0 A;  2PV2 A;  1HKK A;  4DIP A;  2DG4 A;  1ITX A;  4QT3 A;  2Q5A A;  1D2K A;  5DO2 A;  3O5Q A;  2YBT A;  3O5J A;  3ARZ A;  4IPX A;  2DT1 A;  4ODL A;  1J4H A;  3OOB A;  3TDB A;  5HWB A;  3OA5 A;  2KGJ A;  1GOI A;  2RUQ A;  2DT2 A;  3MDY B;  3JXV A;  1HJW A;  4LGX A;  2A3E A;  1E6N A;  2G8Z A;  3GPK A;  3O5L A;  2FAP A;  3UI6 A;  1UR9 A;  1E6R A;  1W9V A;  2B31 A;  4TYO A;  4IQ2 A;  1HKJ A;  2XP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...