4G2PA

Crystal structure of peptidyl-prolyl cis-trans isomerase domain ii of molecular chaperone sura from salmonella enterica subsp. enterica serovar typhimurium str. 14028s
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
AISVTEVHARHILLKPSPIMNDQQARLKLEEIAADIKSGKTTFAAAAKEYSQDPGSANQGGDLGWATPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLDTRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone SurA
publication title Crystal structure of peptidyl-prolyl cis-trans isomerase domain II of molecular chaperone SurA from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. 14028s
molecule tags Isomerase
total genus 29
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4g2pA00
4DH0A 1FKIA 5HUAA 2LKNA 3GPKA 2F21A 1FKJA 4TYOA 3IKGA 1P5QA 4W9PA 2L2SA 4IQ2A 5HWCA 2F2DA 4GGQA 3EY6A 1D7JA 2RSEA 3UI6A 4DRHA 1FKDA 1JVWA 1HXVA 1FKBA 2KR7A 2OFNA 4ODLA 3NTPA 4DRIA 2FAPA 2MLYA 4FN2A 3H9RB 4DT4A 4U86A 3IK8A 4ITZA 5D75A 4O2TA 3WH0A 4DRPA 4ODOA 1EQ3A 3LUOA 2KE0A 1QZ2A 1J6YA 3KZ7A 3O5DA 4DRQA 2ZR5A 4ODKA 1U79A 2XP3A 2XP9A 2KI3A 5GPGA 2KO7A 2RUQA 2M2AA 3KAHA 3UI4A 4DROA 3TDBA 1C9HA 4JFLA 1FKTA 3TCZA 2ZQSA 2RUCA 1A7XA 2ZQUA 4W9OA 1R9HA 1ZK6A 4FAPA 2LPVA 1BKFA 2VN1A 1FKGA 1D7HA 2RQSA 1Q6IA 3PRDA 2IF4A 5B8IC 1F8AB 3O5PA 4JYSA 1FKHA 3VAWA 1YATA 1FKFA 2Q5AA 4JFIA 2MPHA 4JFMA 2ZR6A 5HW8A 5DIVA 2MLZA 1BL4A 5HW6A 2PPNA 5HW7A 2DG4A 4ODNA 1J4IA 1ROTA 2MF9A 2PV3A 4JFJA 5HWBA 4TW8A 1QPFA 2K8IA 1KT0A 2DG9A 2PV1A 4ODQA 2PV2A 2XP5A 3ODKA 4NNRA 1FKRA 2XP4A 3KACA 3KABA 3O5MA 4GIVA 4TX0A 4LAYA 2VCDA 1J4HA 2MNTA 1KT1A 2PPOA 1T11A 4J4OA 4LAXA 3JXVA 4J4NA 3KAGA 1FKLA 4TW6A 1Y0OA 2PPPA 1TCOC 4ODPA 3KADA 5HTGA 1PBKA 2KGJA 2XP6A 2ZR4A 1NMWA 2M08A 2DG3A 2MLXA 2KFWA 3NI6A 1NMVA 4TNSA 4DRNA 3NRKA 3O5OA 2LGOA 4DRKA 5BXJA 2ITKA 1FAPA 1JNTA 1QPLA 3O5LA 4G2PA 3UQBA 1L1PA 3O5JA 1FKKA 2FKEA 2LJ4A 4G50A 3OOBA 2XP8A 4U85A 4C02B 2XP7A 3KCEA 4DZ2A 3I6CA 4ODRA 3UQAA 1FJDA 1JNSA 1Q6HA 4W9QA 2JZVA 3PRBA 4DRMA 4N19A 2XPAA 2AWGA 3IKDA 1ZCNA 1PINA 1W26A 1N1AA 2M1IA 1J4RA 4IQCA 3IHZA 1YW5A 3FAPA 3PA7A 4DRJA 3MDYB 4IPXA 2RUDA 1FKSA 3KAIA 4R0XA 5HKGA 1B6CA 3JYJA 2ZQVA 4JFKA 4TW7A 2PBCA 5HT1A 3O5KA 5J6EA 4LAWA 4MGVA 2ZQTA 2RURA 1D6OA 3CGMA 1Q1CA 3O5RA 3O5IA 4LAVA 4QT3A 2UZ5A 4U84A 1ROUA 4QT2A 3UI5A 4ODMA 4MSPA 3O5GA 1FD9A 3TC5A 5I98A 3CGNA 3RFWA 1F40A 1M5YA 3O5EA 3B7XA 5DIUA 4BF8A 1D7IA 1EYMA 3UQIA 4DIPA 4QIBA 2F4EA 2Y78A 5DITA 4DZ3A 3O5QA 2XPBA 3JYMA 2N87A 1Q6UA 3RGCA 1NSGA 3UF8A 3KAFA 3O5FA 2D9FA
chains in the Genus database with same CATH superfamily
1FFRA 1JCHB 1FKJA 1SYTA 1P5QA 1D7JA 1FKDA 2OFNA 3NTPA 4DWSB 1W9PA 4ODOA 1H0IA 3PR9A 5DF0A 2KE0A 4AY1A 2XP3A 1NWRA 4QZVB 1C9HA 3WD0A 4W9OA 1R9HA 2WM0A 4FAPA 2DT1A 1E15A 1D7HA 4WKFA 2IF4A 3ARVA 3EIPA 3O5PA 4L3NA 1FKHA 1LJYA 4JFIA 2MPHA 2MLZA 1BL4A 2PPNA 1H0GA 2DG4A 4ODNA 2MF9A 1UR8A 4TW8A 3WL0A 2K8IA 2PV1A 3ODKA 4NNRA 3CHCA 3KACA 3AS0A 4HBEA 4WIWA 5JH8A 1E6RA 2A3AA 4LAXA 1T11A 1E6NA 3JXVA 4J4NA 1ZB5A 5HBFA 3KAGA 3ARRA 3QOKA 3AS3A 3G6LA 4TNSA 2KFWA 4DRNA 1NMVA 5BXJA 4G2PA 1KFWA 1HJXA 4C02B 3UQAA 2XP7A 2JZVA 4DRMA 1LQ0A 4NZCA 3B9EA 1OWQA 1N1AA 4L72B 1YW5A 4HBOA 4KQZA 1RD6A 1IX5A 5HKGA 3JYJA 5HT1A 4WKAA 4Z2IA 1D6OA 1Q1CA 4U84A 1W9UA 3TC5A 4MSPA 1FD9A 3O5EA 5DIUA 1EYMA 5DEZA 4KR0B 4DZ3A 3O5QA 2N87A 1Q6UA 3RGCA 2PN0A 4DT4A 5HUAA 1FKIA 3IKGA 5HWCA 2WLYA 3EY6A 4DRHA 2ESCA 1HXVA 4FN2A 3H9RB 3FY1A 4ITZA 4U86A 1EQ3A 4Z2JA 1QZ2A 3KZ7A 1W9VA 3RMEA 2DPEA 2AOSA 3WQWA 2KI3A 2M2AA 3UI4A 1ZBWA 1FKTA 3TCZA 2RUCA 1A7XA 3WKZA 1ZK6A 1E9LA 1W1TA 4P8WA 1ITXA 1FKGA 2RQSA 4MNMA 4JYSA 3ARXA 1EIBA 2B31A 4JFMA 2ZR6A 5HW7A 4NSBA 4ZPWR 2PV3A 5HWBA 4LGXA 3CHDA 3RM9A 2XP5A 4P8XA 3KABA 3O5MA 4S3KA 1J4HA 1OGGA 1KT1A 4J4OA 4MNLA 1FKLA 1Y0OA 2PPPA 5HTGA 3ARZA 2XP6A 1NWTA 3ALFA 2M08A 1LL4A 2DG3A 3NI6A 4S3JA 2ITKA 1QPLA 1JNTA 4ZS6A 1LL6A 1X6NA 3ARSA 3O5JA 3OA5A 4G50A 3OOBA 3WD1A 4ODRA 4URIA 2DSVA 3RM4A 1W26A 4DWSC 1WAWA 3MDYB 3ARPA 3WD3A 2RUDA 5J6EA 2ZQVA 3AS1A 3B9DA 3WQVA 4MGVA 3GU0A 1X6LA 1HKJA 5I98A 3AQUA 3RFWA 4QIBA 2F4EA 3FXYA 2XPBA 1NSGA 3PRAA 3KAFA 4DH0A 1NWUA 2F21A 4TYOA 4W9PA 2L2SA 4IQ2A 4GGQA 2RSEA 1JVWA 1W1YA 2FAPA 3IK8A 3WH0A 1XHGA 3LUOA 1HJVA 3O5DA 2DSWA 4ODKA 2XP9A 5DO2A 2KO7A 2RUQA 4JFLA 2DT2A 2ZQUA 1JNEA 2WLZA 2LPVA 4ZPTR 5B8IC 1WB0A 1FKFA 2Q5AA 4XAKA 2G8ZA 5HW8A 4WKHA 1ZU8A 2DSUA 3AS2A 1QPFA 4ODQA 2O9OA 2XP4A 4GIVA 4MAVA 2P4VA 3WIJA 2VCDA 2MNTA 3CH9A 3GTYX 3RM8A 3BXWA 4ODPA 3KADA 1PBKA 1ZBVA 3ARQA 2ZR4A 1CTNA 1NMWA 1E6ZA 4DWSA 1D2KA 1EHNA 3NRKA 3UQBA 1FAPA 3O5LA 1GUVA 4ZPVR 4P8VA 4U85A 2LJ4A 2F23A 2XP8A 1HKMA 4Z2KA 1JNSA 3I6CA 1Q6HA 3CHFA 3PRBA 4N19A 3IKDA 4HARA 2G41A 3WL1A 3IHZA 3FAPA 4IPXA 2QF8A 2A3EA 4R0XA 4TW7A 4JFKA 2PBCA 3O5KA 4MNJA 1LG1A 3G6MA 2RURA 1NH6A 4DZ2A 1ROUA 4QT2A 4ODMA 1F40A 1ZBCA 1M5YA 3B7XA 3UQIA 2Y78A 5DITA 1ZL1A 2PI6A 1GOIA 3O5FA 2A3BA 1EDQA 3ARUA 4MNKA 1K9TA 2LKNA 4P8UA 3GPKA 4Z2GA 1HJWA 1E6PA 1TFVA 1E44A 2F2DA 4MTVA 3UI6A 2YBTA 3WD4A 1VF8A 1JNDA 1FKBA 2KR7A 2YBUA 4ODLA 1LL7A 2IUZA 4DRIA 2MLYA 3CZ8A 4DRPA 5D75A 4O2TA 1J6YA 4UDMA 3CHEA 1SR0A 4DRQA 2ZR5A 1U79A 5GPGA 3KAHA 4WJXA 4DROA 3TDBA 2WK2A 2ZQSA 3ARWA 2VN1A 1BKFA 1NWSA 2A3CA 1Q6IA 3PRDA 1LG2A 1F8AB 3VAWA 1YATA 4W5UA 5DIVA 2B5UB 5HW6A 1J4IA 1ROTA 4JFJA 1KT0A 2DG9A 4WK9A 2PV2A 1FKRA 2DT3A 4TX0A 4Q22A 2DSZA 4LAYA 1GPFA 2PPOA 4DWSD 3ARTA 1W1PA 1HKIA 4TW6A 1TCOC 3ALGA 2KGJA 4IT6A 4Z2HA 2MLXA 3O5OA 2LGOA 4DRKA 1L1PA 3B8SA 1FKKA 2FKEA 4ML4A 5GPRA 2OLHA 1OGBA 3KCEA 1FJDA 2EULA 3B9AA 2DT0A 4W9QA 3WD2A 5GQBA 2XPAA 2AWGA 3ARYA 1ZCNA 1PINA 2M1IA 1J4RA 4IQCA 4DRJA 3AROA 3PA7A 1W1VA 1WNOA 2O92A 2FDMA 4PTMA 3W4RA 4Z2LA 1FKSA 3BMBA 3KAIA 1B6CA 4Q7NA 4LAWA 1ZBKA 2ZQTA 3O5IA 1FFQA 3CGMA 3O5RA 4LAVA 4QT3A 2UZ5A 3UI5A 1UR9A 3O5GA 2ETNA 3CGNA 4BF8A 1D7IA 4DIPA 1O6IA 1HKKA 4R5EA 3JYMA 3UF8A 1GRJA 4MPKA 4IT4A 1XRVA 2D9FA
chains in the Genus database with same CATH topology
1FFRA 1FKJA 1SYTA 1P5QA 1D7JA 1FKDA 2OFNA 3NTPA 4DWSB 1W9PA 4ODOA 1H0IA 3PR9A 5DF0A 2KE0A 4AY1A 2XP3A 1NWRA 4QZVB 1C9HA 3WD0A 4W9OA 1R9HA 2WM0A 4FAPA 2DT1A 1E15A 1D7HA 4WKFA 2IF4A 3ARVA 3O5PA 4L3NA 1FKHA 1LJYA 4JFIA 2MPHA 2MLZA 1BL4A 2PPNA 1H0GA 2DG4A 4ODNA 2MF9A 1UR8A 4TW8A 3WL0A 2K8IA 2PV1A 3ODKA 4NNRA 3CHCA 3KACA 3AS0A 4HBEA 4WIWA 5JH8A 1E6RA 2A3AA 4LAXA 1T11A 1E6NA 3JXVA 4J4NA 1ZB5A 5HBFA 3KAGA 3ARRA 3QOKA 3AS3A 3G6LA 4TNSA 2KFWA 4DRNA 1NMVA 5BXJA 4G2PA 1KFWA 1HJXA 4C02B 3UQAA 2XP7A 2JZVA 4DRMA 1LQ0A 4NZCA 3B9EA 1OWQA 1N1AA 4L72B 1YW5A 4HBOA 4KQZA 1RD6A 1IX5A 5HKGA 3JYJA 5HT1A 4WKAA 4Z2IA 1D6OA 1Q1CA 4U84A 1W9UA 3TC5A 4MSPA 1FD9A 3O5EA 5DIUA 1EYMA 5DEZA 4KR0B 4DZ3A 3O5QA 2N87A 1Q6UA 3RGCA 4DT4A 5HUAA 1FKIA 3IKGA 5HWCA 2WLYA 3EY6A 4DRHA 2ESCA 1HXVA 4FN2A 3H9RB 3FY1A 4ITZA 4U86A 1EQ3A 4Z2JA 1QZ2A 3KZ7A 1W9VA 3RMEA 2DPEA 2AOSA 3WQWA 2KI3A 2M2AA 3UI4A 1ZBWA 1FKTA 3TCZA 2RUCA 1A7XA 3WKZA 1ZK6A 1E9LA 1W1TA 4P8WA 1ITXA 1FKGA 2RQSA 4MNMA 4JYSA 3ARXA 1EIBA 2B31A 4JFMA 2ZR6A 5HW7A 4NSBA 4ZPWR 2PV3A 5HWBA 4LGXA 3CHDA 3RM9A 2XP5A 4P8XA 3KABA 3O5MA 4S3KA 1J4HA 1OGGA 1KT1A 4J4OA 4MNLA 1FKLA 1Y0OA 2PPPA 5HTGA 3ARZA 2XP6A 1NWTA 3ALFA 2M08A 1LL4A 2DG3A 3NI6A 4S3JA 2ITKA 1QPLA 1JNTA 4ZS6A 1LL6A 1X6NA 3ARSA 3O5JA 3OA5A 4G50A 3OOBA 3WD1A 4ODRA 4URIA 2DSVA 3RM4A 1W26A 4DWSC 1WAWA 3MDYB 3ARPA 3WD3A 2RUDA 5J6EA 2ZQVA 3AS1A 3B9DA 3WQVA 4MGVA 1X6LA 1HKJA 5I98A 3AQUA 3RFWA 4QIBA 2F4EA 3FXYA 2XPBA 1NSGA 3PRAA 3KAFA 4DH0A 1NWUA 2F21A 4TYOA 4W9PA 2L2SA 4IQ2A 4GGQA 2RSEA 1JVWA 1W1YA 2FAPA 3IK8A 3WH0A 1XHGA 3LUOA 1HJVA 3O5DA 2DSWA 4ODKA 2XP9A 5DO2A 2KO7A 2RUQA 4JFLA 2DT2A 2ZQUA 1JNEA 2WLZA 2LPVA 4ZPTR 5B8IC 1WB0A 1FKFA 2Q5AA 4XAKA 2G8ZA 5HW8A 4WKHA 1ZU8A 2DSUA 3AS2A 1QPFA 4ODQA 2O9OA 2XP4A 4GIVA 4MAVA 3WIJA 2VCDA 2MNTA 3CH9A 3RM8A 3BXWA 4ODPA 3KADA 1PBKA 1ZBVA 3ARQA 2ZR4A 1CTNA 1NMWA 1E6ZA 4DWSA 1D2KA 1EHNA 3NRKA 3UQBA 1FAPA 3O5LA 1GUVA 4ZPVR 4P8VA 4U85A 2LJ4A 2XP8A 1HKMA 4Z2KA 1JNSA 3I6CA 1Q6HA 3CHFA 3PRBA 4N19A 3IKDA 4HARA 2G41A 3WL1A 3IHZA 3FAPA 4IPXA 2QF8A 2A3EA 4R0XA 4TW7A 4JFKA 2PBCA 3O5KA 4MNJA 1LG1A 3G6MA 2RURA 1NH6A 4DZ2A 1ROUA 4QT2A 4ODMA 1F40A 1ZBCA 1M5YA 3B7XA 3UQIA 2Y78A 5DITA 1ZL1A 2PI6A 1GOIA 3O5FA 2A3BA 1EDQA 3ARUA 4MNKA 1K9TA 2LKNA 4P8UA 3GPKA 4Z2GA 1HJWA 1E6PA 1TFVA 2F2DA 3WD4A 4MTVA 3UI6A 2YBTA 1VF8A 1JNDA 1FKBA 2KR7A 2YBUA 4ODLA 1LL7A 2IUZA 4DRIA 2MLYA 3CZ8A 4DRPA 5D75A 4O2TA 1J6YA 3CHEA 1SR0A 4DRQA 2ZR5A 1U79A 5GPGA 3KAHA 4WJXA 4DROA 3TDBA 2WK2A 2ZQSA 3ARWA 2VN1A 1BKFA 1NWSA 2A3CA 1Q6IA 3PRDA 1LG2A 1F8AB 3VAWA 1YATA 4W5UA 5DIVA 5HW6A 1J4IA 1ROTA 4JFJA 1KT0A 2DG9A 4WK9A 2PV2A 1FKRA 2DT3A 4TX0A 4Q22A 2DSZA 4LAYA 1GPFA 2PPOA 4DWSD 3ARTA 1W1PA 1HKIA 4TW6A 1TCOC 3ALGA 2KGJA 4IT6A 4Z2HA 2MLXA 3O5OA 2LGOA 4DRKA 1L1PA 3B8SA 1FKKA 2FKEA 4ML4A 5GPRA 2OLHA 1OGBA 3KCEA 1FJDA 3B9AA 2DT0A 4W9QA 3WD2A 5GQBA 2XPAA 2AWGA 3ARYA 1ZCNA 1PINA 2M1IA 1J4RA 4IQCA 4DRJA 3AROA 3PA7A 1W1VA 1WNOA 2O92A 2FDMA 4PTMA 3W4RA 4Z2LA 1FKSA 3KAIA 1B6CA 4Q7NA 4LAWA 1ZBKA 2ZQTA 3O5IA 1FFQA 3CGMA 3O5RA 4LAVA 4QT3A 2UZ5A 3UI5A 1UR9A 3O5GA 3CGNA 4BF8A 1D7IA 4DIPA 1O6IA 1HKKA 4R5EA 3JYMA 3UF8A 4MPKA 4IT4A 1XRVA 2D9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DH0 A;  1FKI A;  5HUA A;  2LKN A;  3GPK A;  2F21 A;  1FKJ A;  4TYO A;  3IKG A;  1P5Q A;  4W9P A;  2L2S A;  4IQ2 A;  5HWC A;  2F2D A;  4GGQ A;  3EY6 A;  1D7J A;  2RSE A;  3UI6 A;  4DRH A;  1FKD A;  1JVW A;  1HXV A;  1FKB A;  2KR7 A;  2OFN A;  4ODL A;  3NTP A;  4DRI A;  2FAP A;  2MLY A;  4FN2 A;  3H9R B;  4DT4 A;  4U86 A;  3IK8 A;  4ITZ A;  5D75 A;  4O2T A;  3WH0 A;  4DRP A;  4ODO A;  1EQ3 A;  3LUO A;  2KE0 A;  1QZ2 A;  1J6Y A;  3KZ7 A;  3O5D A;  4DRQ A;  2ZR5 A;  4ODK A;  1U79 A;  2XP3 A;  2XP9 A;  2KI3 A;  5GPG A;  2KO7 A;  2RUQ A;  2M2A A;  3KAH A;  3UI4 A;  4DRO A;  3TDB A;  1C9H A;  4JFL A;  1FKT A;  3TCZ A;  2ZQS A;  2RUC A;  1A7X A;  2ZQU A;  4W9O A;  1R9H A;  1ZK6 A;  4FAP A;  2LPV A;  1BKF A;  2VN1 A;  1FKG A;  1D7H A;  2RQS A;  1Q6I A;  3PRD A;  2IF4 A;  5B8I C;  1F8A B;  3O5P A;  4JYS A;  1FKH A;  3VAW A;  1YAT A;  1FKF A;  2Q5A A;  4JFI A;  2MPH A;  4JFM A;  2ZR6 A;  5HW8 A;  5DIV A;  2MLZ A;  1BL4 A;  5HW6 A;  2PPN A;  5HW7 A;  2DG4 A;  4ODN A;  1J4I A;  1ROT A;  2MF9 A;  2PV3 A;  4JFJ A;  5HWB A;  4TW8 A;  1QPF A;  2K8I A;  1KT0 A;  2DG9 A;  2PV1 A;  4ODQ A;  2PV2 A;  2XP5 A;  3ODK A;  4NNR A;  1FKR A;  2XP4 A;  3KAC A;  3KAB A;  3O5M A;  4GIV A;  4TX0 A;  4LAY A;  2VCD A;  1J4H A;  2MNT A;  1KT1 A;  2PPO A;  1T11 A;  4J4O A;  4LAX A;  3JXV A;  4J4N A;  3KAG A;  1FKL A;  4TW6 A;  1Y0O A;  2PPP A;  1TCO C;  4ODP A;  3KAD A;  5HTG A;  1PBK A;  2KGJ A;  2XP6 A;  2ZR4 A;  1NMW A;  2M08 A;  2DG3 A;  2MLX A;  2KFW A;  3NI6 A;  1NMV A;  4TNS A;  4DRN A;  3NRK A;  3O5O A;  2LGO A;  4DRK A;  5BXJ A;  2ITK A;  1FAP A;  1JNT A;  1QPL A;  3O5L A;  4G2P A;  3UQB A;  1L1P A;  3O5J A;  1FKK A;  2FKE A;  2LJ4 A;  4G50 A;  3OOB A;  2XP8 A;  4U85 A;  4C02 B;  2XP7 A;  3KCE A;  4DZ2 A;  3I6C A;  4ODR A;  3UQA A;  1FJD A;  1JNS A;  1Q6H A;  4W9Q A;  2JZV A;  3PRB A;  4DRM A;  4N19 A;  2XPA A;  2AWG A;  3IKD A;  1ZCN A;  1PIN A;  1W26 A;  1N1A A;  2M1I A;  1J4R A;  4IQC A;  3IHZ A;  1YW5 A;  3FAP A;  3PA7 A;  4DRJ A;  3MDY B;  4IPX A;  2RUD A;  1FKS A;  3KAI A;  4R0X A;  5HKG A;  1B6C A;  3JYJ A;  2ZQV A;  4JFK A;  4TW7 A;  2PBC A;  5HT1 A;  3O5K A;  5J6E A;  4LAW A;  4MGV A;  2ZQT A;  2RUR A;  1D6O A;  3CGM A;  1Q1C A;  3O5R A;  3O5I A;  4LAV A;  4QT3 A;  2UZ5 A;  4U84 A;  1ROU A;  4QT2 A;  3UI5 A;  4ODM A;  4MSP A;  3O5G A;  1FD9 A;  3TC5 A;  5I98 A;  3CGN A;  3RFW A;  1F40 A;  1M5Y A;  3O5E A;  3B7X A;  5DIU A;  4BF8 A;  1D7I A;  1EYM A;  3UQI A;  4DIP A;  4QIB A;  2F4E A;  2Y78 A;  5DIT A;  4DZ3 A;  3O5Q A;  2XPB A;  3JYM A;  2N87 A;  1Q6U A;  3RGC A;  1NSG A;  3UF8 A;  3KAF A;  3O5F A;  2D9F A; 
#chains in the Genus database with same CATH topology
 1FFR A;  1JCH B;  1FKJ A;  1SYT A;  1P5Q A;  1D7J A;  1FKD A;  2OFN A;  3NTP A;  4DWS B;  1W9P A;  4ODO A;  1H0I A;  3PR9 A;  5DF0 A;  2KE0 A;  4AY1 A;  2XP3 A;  1NWR A;  4QZV B;  1C9H A;  3WD0 A;  4W9O A;  1R9H A;  2WM0 A;  4FAP A;  2DT1 A;  1E15 A;  1D7H A;  4WKF A;  2IF4 A;  3ARV A;  3EIP A;  3O5P A;  4L3N A;  1FKH A;  1LJY A;  4JFI A;  2MPH A;  2MLZ A;  1BL4 A;  2PPN A;  1H0G A;  2DG4 A;  4ODN A;  2MF9 A;  1UR8 A;  4TW8 A;  3WL0 A;  2K8I A;  2PV1 A;  3ODK A;  4NNR A;  3CHC A;  3KAC A;  3AS0 A;  4HBE A;  4WIW A;  5JH8 A;  1E6R A;  2A3A A;  4LAX A;  1T11 A;  1E6N A;  3JXV A;  4J4N A;  1ZB5 A;  5HBF A;  3KAG A;  3ARR A;  3QOK A;  3AS3 A;  3G6L A;  4TNS A;  2KFW A;  4DRN A;  1NMV A;  5BXJ A;  4G2P A;  1KFW A;  1HJX A;  4C02 B;  3UQA A;  2XP7 A;  2JZV A;  4DRM A;  1LQ0 A;  4NZC A;  3B9E A;  1OWQ A;  1N1A A;  4L72 B;  1YW5 A;  4HBO A;  4KQZ A;  1RD6 A;  1IX5 A;  5HKG A;  3JYJ A;  5HT1 A;  4WKA A;  4Z2I A;  1D6O A;  1Q1C A;  4U84 A;  1W9U A;  3TC5 A;  4MSP A;  1FD9 A;  3O5E A;  5DIU A;  1EYM A;  5DEZ A;  4KR0 B;  4DZ3 A;  3O5Q A;  2N87 A;  1Q6U A;  3RGC A;  2PN0 A;  4DT4 A;  5HUA A;  1FKI A;  3IKG A;  5HWC A;  2WLY A;  3EY6 A;  4DRH A;  2ESC A;  1HXV A;  4FN2 A;  3H9R B;  3FY1 A;  4ITZ A;  4U86 A;  1EQ3 A;  4Z2J A;  1QZ2 A;  3KZ7 A;  1W9V A;  3RME A;  2DPE A;  2AOS A;  3WQW A;  2KI3 A;  2M2A A;  3UI4 A;  1ZBW A;  1FKT A;  3TCZ A;  2RUC A;  1A7X A;  3WKZ A;  1ZK6 A;  1E9L A;  1W1T A;  4P8W A;  1ITX A;  1FKG A;  2RQS A;  4MNM A;  4JYS A;  3ARX A;  1EIB A;  2B31 A;  4JFM A;  2ZR6 A;  5HW7 A;  4NSB A;  4ZPW R;  2PV3 A;  5HWB A;  4LGX A;  3CHD A;  3RM9 A;  2XP5 A;  4P8X A;  3KAB A;  3O5M A;  4S3K A;  1J4H A;  1OGG A;  1KT1 A;  4J4O A;  4MNL A;  1FKL A;  1Y0O A;  2PPP A;  5HTG A;  3ARZ A;  2XP6 A;  1NWT A;  3ALF A;  2M08 A;  1LL4 A;  2DG3 A;  3NI6 A;  4S3J A;  2ITK A;  1QPL A;  1JNT A;  4ZS6 A;  1LL6 A;  1X6N A;  3ARS A;  3O5J A;  3OA5 A;  4G50 A;  3OOB A;  3WD1 A;  4ODR A;  4URI A;  2DSV A;  3RM4 A;  1W26 A;  4DWS C;  1WAW A;  3MDY B;  3ARP A;  3WD3 A;  2RUD A;  5J6E A;  2ZQV A;  3AS1 A;  3B9D A;  3WQV A;  4MGV A;  3GU0 A;  1X6L A;  1HKJ A;  5I98 A;  3AQU A;  3RFW A;  4QIB A;  2F4E A;  3FXY A;  2XPB A;  1NSG A;  3PRA A;  3KAF A;  4DH0 A;  1NWU A;  2F21 A;  4TYO A;  4W9P A;  2L2S A;  4IQ2 A;  4GGQ A;  2RSE A;  1JVW A;  1W1Y A;  2FAP A;  3IK8 A;  3WH0 A;  1XHG A;  3LUO A;  1HJV A;  3O5D A;  2DSW A;  4ODK A;  2XP9 A;  5DO2 A;  2KO7 A;  2RUQ A;  4JFL A;  2DT2 A;  2ZQU A;  1JNE A;  2WLZ A;  2LPV A;  4ZPT R;  5B8I C;  1WB0 A;  1FKF A;  2Q5A A;  4XAK A;  2G8Z A;  5HW8 A;  4WKH A;  1ZU8 A;  2DSU A;  3AS2 A;  1QPF A;  4ODQ A;  2O9O A;  2XP4 A;  4GIV A;  4MAV A;  2P4V A;  3WIJ A;  2VCD A;  2MNT A;  3CH9 A;  3GTY X;  3RM8 A;  3BXW A;  4ODP A;  3KAD A;  1PBK A;  1ZBV A;  3ARQ A;  2ZR4 A;  1CTN A;  1NMW A;  1E6Z A;  4DWS A;  1D2K A;  1EHN A;  3NRK A;  3UQB A;  1FAP A;  3O5L A;  1GUV A;  4ZPV R;  4P8V A;  4U85 A;  2LJ4 A;  2F23 A;  2XP8 A;  1HKM A;  4Z2K A;  1JNS A;  3I6C A;  1Q6H A;  3CHF A;  3PRB A;  4N19 A;  3IKD A;  4HAR A;  2G41 A;  3WL1 A;  3IHZ A;  3FAP A;  4IPX A;  2QF8 A;  2A3E A;  4R0X A;  4TW7 A;  4JFK A;  2PBC A;  3O5K A;  4MNJ A;  1LG1 A;  3G6M A;  2RUR A;  1NH6 A;  4DZ2 A;  1ROU A;  4QT2 A;  4ODM A;  1F40 A;  1ZBC A;  1M5Y A;  3B7X A;  3UQI A;  2Y78 A;  5DIT A;  1ZL1 A;  2PI6 A;  1GOI A;  3O5F A;  2A3B A;  1EDQ A;  3ARU A;  4MNK A;  1K9T A;  2LKN A;  4P8U A;  3GPK A;  4Z2G A;  1HJW A;  1E6P A;  1TFV A;  1E44 A;  2F2D A;  4MTV A;  3UI6 A;  2YBT A;  3WD4 A;  1VF8 A;  1JND A;  1FKB A;  2KR7 A;  2YBU A;  4ODL A;  1LL7 A;  2IUZ A;  4DRI A;  2MLY A;  3CZ8 A;  4DRP A;  5D75 A;  4O2T A;  1J6Y A;  4UDM A;  3CHE A;  1SR0 A;  4DRQ A;  2ZR5 A;  1U79 A;  5GPG A;  3KAH A;  4WJX A;  4DRO A;  3TDB A;  2WK2 A;  2ZQS A;  3ARW A;  2VN1 A;  1BKF A;  1NWS A;  2A3C A;  1Q6I A;  3PRD A;  1LG2 A;  1F8A B;  3VAW A;  1YAT A;  4W5U A;  5DIV A;  2B5U B;  5HW6 A;  1J4I A;  1ROT A;  4JFJ A;  1KT0 A;  2DG9 A;  4WK9 A;  2PV2 A;  1FKR A;  2DT3 A;  4TX0 A;  4Q22 A;  2DSZ A;  4LAY A;  1GPF A;  2PPO A;  4DWS D;  3ART A;  1W1P A;  1HKI A;  4TW6 A;  1TCO C;  3ALG A;  2KGJ A;  4IT6 A;  4Z2H A;  2MLX A;  3O5O A;  2LGO A;  4DRK A;  1L1P A;  3B8S A;  1FKK A;  2FKE A;  4ML4 A;  5GPR A;  2OLH A;  1OGB A;  3KCE A;  1FJD A;  2EUL A;  3B9A A;  2DT0 A;  4W9Q A;  3WD2 A;  5GQB A;  2XPA A;  2AWG A;  3ARY A;  1ZCN A;  1PIN A;  2M1I A;  1J4R A;  4IQC A;  4DRJ A;  3ARO A;  3PA7 A;  1W1V A;  1WNO A;  2O92 A;  2FDM A;  4PTM A;  3W4R A;  4Z2L A;  1FKS A;  3BMB A;  3KAI A;  1B6C A;  4Q7N A;  4LAW A;  1ZBK A;  2ZQT A;  3O5I A;  1FFQ A;  3CGM A;  3O5R A;  4LAV A;  4QT3 A;  2UZ5 A;  3UI5 A;  1UR9 A;  3O5G A;  2ETN A;  3CGN A;  4BF8 A;  1D7I A;  4DIP A;  1O6I A;  1HKK A;  4R5E A;  3JYM A;  3UF8 A;  1GRJ A;  4MPK A;  4IT4 A;  1XRV A;  2D9F A; 
#chains in the Genus database with same CATH homology
 1FFR A;  1FKJ A;  1SYT A;  1P5Q A;  1D7J A;  1FKD A;  2OFN A;  3NTP A;  4DWS B;  1W9P A;  4ODO A;  1H0I A;  3PR9 A;  5DF0 A;  2KE0 A;  4AY1 A;  2XP3 A;  1NWR A;  4QZV B;  1C9H A;  3WD0 A;  4W9O A;  1R9H A;  2WM0 A;  4FAP A;  2DT1 A;  1E15 A;  1D7H A;  4WKF A;  2IF4 A;  3ARV A;  3O5P A;  4L3N A;  1FKH A;  1LJY A;  4JFI A;  2MPH A;  2MLZ A;  1BL4 A;  2PPN A;  1H0G A;  2DG4 A;  4ODN A;  2MF9 A;  1UR8 A;  4TW8 A;  3WL0 A;  2K8I A;  2PV1 A;  3ODK A;  4NNR A;  3CHC A;  3KAC A;  3AS0 A;  4HBE A;  4WIW A;  5JH8 A;  1E6R A;  2A3A A;  4LAX A;  1T11 A;  1E6N A;  3JXV A;  4J4N A;  1ZB5 A;  5HBF A;  3KAG A;  3ARR A;  3QOK A;  3AS3 A;  3G6L A;  4TNS A;  2KFW A;  4DRN A;  1NMV A;  5BXJ A;  4G2P A;  1KFW A;  1HJX A;  4C02 B;  3UQA A;  2XP7 A;  2JZV A;  4DRM A;  1LQ0 A;  4NZC A;  3B9E A;  1OWQ A;  1N1A A;  4L72 B;  1YW5 A;  4HBO A;  4KQZ A;  1RD6 A;  1IX5 A;  5HKG A;  3JYJ A;  5HT1 A;  4WKA A;  4Z2I A;  1D6O A;  1Q1C A;  4U84 A;  1W9U A;  3TC5 A;  4MSP A;  1FD9 A;  3O5E A;  5DIU A;  1EYM A;  5DEZ A;  4KR0 B;  4DZ3 A;  3O5Q A;  2N87 A;  1Q6U A;  3RGC A;  4DT4 A;  5HUA A;  1FKI A;  3IKG A;  5HWC A;  2WLY A;  3EY6 A;  4DRH A;  2ESC A;  1HXV A;  4FN2 A;  3H9R B;  3FY1 A;  4ITZ A;  4U86 A;  1EQ3 A;  4Z2J A;  1QZ2 A;  3KZ7 A;  1W9V A;  3RME A;  2DPE A;  2AOS A;  3WQW A;  2KI3 A;  2M2A A;  3UI4 A;  1ZBW A;  1FKT A;  3TCZ A;  2RUC A;  1A7X A;  3WKZ A;  1ZK6 A;  1E9L A;  1W1T A;  4P8W A;  1ITX A;  1FKG A;  2RQS A;  4MNM A;  4JYS A;  3ARX A;  1EIB A;  2B31 A;  4JFM A;  2ZR6 A;  5HW7 A;  4NSB A;  4ZPW R;  2PV3 A;  5HWB A;  4LGX A;  3CHD A;  3RM9 A;  2XP5 A;  4P8X A;  3KAB A;  3O5M A;  4S3K A;  1J4H A;  1OGG A;  1KT1 A;  4J4O A;  4MNL A;  1FKL A;  1Y0O A;  2PPP A;  5HTG A;  3ARZ A;  2XP6 A;  1NWT A;  3ALF A;  2M08 A;  1LL4 A;  2DG3 A;  3NI6 A;  4S3J A;  2ITK A;  1QPL A;  1JNT A;  4ZS6 A;  1LL6 A;  1X6N A;  3ARS A;  3O5J A;  3OA5 A;  4G50 A;  3OOB A;  3WD1 A;  4ODR A;  4URI A;  2DSV A;  3RM4 A;  1W26 A;  4DWS C;  1WAW A;  3MDY B;  3ARP A;  3WD3 A;  2RUD A;  5J6E A;  2ZQV A;  3AS1 A;  3B9D A;  3WQV A;  4MGV A;  1X6L A;  1HKJ A;  5I98 A;  3AQU A;  3RFW A;  4QIB A;  2F4E A;  3FXY A;  2XPB A;  1NSG A;  3PRA A;  3KAF A;  4DH0 A;  1NWU A;  2F21 A;  4TYO A;  4W9P A;  2L2S A;  4IQ2 A;  4GGQ A;  2RSE A;  1JVW A;  1W1Y A;  2FAP A;  3IK8 A;  3WH0 A;  1XHG A;  3LUO A;  1HJV A;  3O5D A;  2DSW A;  4ODK A;  2XP9 A;  5DO2 A;  2KO7 A;  2RUQ A;  4JFL A;  2DT2 A;  2ZQU A;  1JNE A;  2WLZ A;  2LPV A;  4ZPT R;  5B8I C;  1WB0 A;  1FKF A;  2Q5A A;  4XAK A;  2G8Z A;  5HW8 A;  4WKH A;  1ZU8 A;  2DSU A;  3AS2 A;  1QPF A;  4ODQ A;  2O9O A;  2XP4 A;  4GIV A;  4MAV A;  3WIJ A;  2VCD A;  2MNT A;  3CH9 A;  3RM8 A;  3BXW A;  4ODP A;  3KAD A;  1PBK A;  1ZBV A;  3ARQ A;  2ZR4 A;  1CTN A;  1NMW A;  1E6Z A;  4DWS A;  1D2K A;  1EHN A;  3NRK A;  3UQB A;  1FAP A;  3O5L A;  1GUV A;  4ZPV R;  4P8V A;  4U85 A;  2LJ4 A;  2XP8 A;  1HKM A;  4Z2K A;  1JNS A;  3I6C A;  1Q6H A;  3CHF A;  3PRB A;  4N19 A;  3IKD A;  4HAR A;  2G41 A;  3WL1 A;  3IHZ A;  3FAP A;  4IPX A;  2QF8 A;  2A3E A;  4R0X A;  4TW7 A;  4JFK A;  2PBC A;  3O5K A;  4MNJ A;  1LG1 A;  3G6M A;  2RUR A;  1NH6 A;  4DZ2 A;  1ROU A;  4QT2 A;  4ODM A;  1F40 A;  1ZBC A;  1M5Y A;  3B7X A;  3UQI A;  2Y78 A;  5DIT A;  1ZL1 A;  2PI6 A;  1GOI A;  3O5F A;  2A3B A;  1EDQ A;  3ARU A;  4MNK A;  1K9T A;  2LKN A;  4P8U A;  3GPK A;  4Z2G A;  1HJW A;  1E6P A;  1TFV A;  2F2D A;  3WD4 A;  4MTV A;  3UI6 A;  2YBT A;  1VF8 A;  1JND A;  1FKB A;  2KR7 A;  2YBU A;  4ODL A;  1LL7 A;  2IUZ A;  4DRI A;  2MLY A;  3CZ8 A;  4DRP A;  5D75 A;  4O2T A;  1J6Y A;  3CHE A;  1SR0 A;  4DRQ A;  2ZR5 A;  1U79 A;  5GPG A;  3KAH A;  4WJX A;  4DRO A;  3TDB A;  2WK2 A;  2ZQS A;  3ARW A;  2VN1 A;  1BKF A;  1NWS A;  2A3C A;  1Q6I A;  3PRD A;  1LG2 A;  1F8A B;  3VAW A;  1YAT A;  4W5U A;  5DIV A;  5HW6 A;  1J4I A;  1ROT A;  4JFJ A;  1KT0 A;  2DG9 A;  4WK9 A;  2PV2 A;  1FKR A;  2DT3 A;  4TX0 A;  4Q22 A;  2DSZ A;  4LAY A;  1GPF A;  2PPO A;  4DWS D;  3ART A;  1W1P A;  1HKI A;  4TW6 A;  1TCO C;  3ALG A;  2KGJ A;  4IT6 A;  4Z2H A;  2MLX A;  3O5O A;  2LGO A;  4DRK A;  1L1P A;  3B8S A;  1FKK A;  2FKE A;  4ML4 A;  5GPR A;  2OLH A;  1OGB A;  3KCE A;  1FJD A;  3B9A A;  2DT0 A;  4W9Q A;  3WD2 A;  5GQB A;  2XPA A;  2AWG A;  3ARY A;  1ZCN A;  1PIN A;  2M1I A;  1J4R A;  4IQC A;  4DRJ A;  3ARO A;  3PA7 A;  1W1V A;  1WNO A;  2O92 A;  2FDM A;  4PTM A;  3W4R A;  4Z2L A;  1FKS A;  3KAI A;  1B6C A;  4Q7N A;  4LAW A;  1ZBK A;  2ZQT A;  3O5I A;  1FFQ A;  3CGM A;  3O5R A;  4LAV A;  4QT3 A;  2UZ5 A;  3UI5 A;  1UR9 A;  3O5G A;  3CGN A;  4BF8 A;  1D7I A;  4DIP A;  1O6I A;  1HKK A;  4R5E A;  3JYM A;  3UF8 A;  4MPK A;  4IT4 A;  1XRV A;  2D9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...