4G2PA

Crystal structure of peptidyl-prolyl cis-trans isomerase domain ii of molecular chaperone sura from salmonella enterica subsp. enterica serovar typhimurium str. 14028s
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
AISVTEVHARHILLKPSPIMNDQQARLKLEEIAADIKSGKTTFAAAAKEYSQDPGSANQGGDLGWATPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLDTRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords Chaperone SurA
publication title Crystal structure of peptidyl-prolyl cis-trans isomerase domain II of molecular chaperone SurA from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. 14028s
total genus 29
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4g2pA00
1YATA 1Q6IA 3MDYB 3JYMA 2M08A 4JYSA 1YW5A 1FD9A 1A7XA 3PRBA 2N87A 4JFLA 4N19A 4W9QA 2F21A 3OOBA 3KABA 3UF8A 5J6EA 4QT2A 2XP8A 3FAPA 5DITA 2LGOA 1M5YA 3O5PA 3O5DA 4TNSA 2KR7A 3KADA 2ZQSA 2IF4A 4FN2A 4R0XA 1D6OA 2RUQA 4DRQA 3PRDA 1JNSA 5D75A 3I6CA 4DRKA 4LAWA 1FKHA 1J4HA 2LKNA 3O5JA 5GPGA 1EQ3A 2AWGA 3KAIA 2M1IA 3KAGA 3O5MA 2DG3A 3TC5A 1TCOC 2RQSA 5DIVA 1D7HA 1PBKA 4ODKA 2M2AA 5I98A 2ITKA 1D7IA 2MLYA 4DRPA 1J4RA 1FKFA 4ODMA 2FKEA 3O5RA 1Q1CA 3KACA 4BF8A 4QIBA 3EY6A 1FKDA 1NMVA 3O5KA 2MF9A 3UQBA 4J4OA 4G2PA 4MSPA 2RUDA 2PV2A 2XP3A 2XP7A 4DRJA 2PPPA 1J6YA 1F40A 1BL4A 4QT3A 5BXJA 1ROUA 4DRMA 2DG9A 2L2SA 4LAXA 4DZ3A 4ITZA 1W26A 4TX0A 3CGMA 3WH0A 3O5OA 4W9PA 4NNRA 4W9OA 3TDBA 2RUCA 4TW6A 3CGNA 3IHZA 3IKGA 2MNTA 3NRKA 4LAVA 1FKTA 2F2DA 1Q6HA 5HTGA 2K8IA 4G50A 1FKLA 3O5IA 2PV3A 4ODPA 5HWCA 1NMWA 3NTPA 2XPBA 1KT0A 3O5GA 3RGCA 4FAPA 1FKGA 2KE0A 2PPNA 2ZQUA 2MPHA 4JFMA 5HW7A 5DIUA 3GPKA 4ODQA 3O5FA 2KO7A 4GIVA 1QPFA 4ODNA 1P5QA 3O5LA 4DRIA 4ODOA 3UQAA 4IPXA 2F4EA 4IQCA 4JFIA 2LPVA 2XP4A 1EYMA 1FKSA 4TW8A 2PPOA 1FKJA 2UZ5A 3UQIA 4LAYA 1HXVA 3O5EA 4TW7A 2PBCA 2PV1A 1JNTA 2Y78A 1PINA 1R9HA 1F8AB 5HWBA 1Q6UA 2KFWA 2MLXA 3UI6A 3ODKA 3LUOA 4ODLA 5HW8A 1NSGA 3O5QA 2KGJA 4JFKA 4U85A 4U86A 1J4IA 4GGQA 4DRNA 4DH0A 2ZR4A 4DT4A 4DROA 4O2TA 4TYOA 2RURA 1KT1A 3IK8A 3JYJA 3KZ7A 3NI6A 3KAHA 2ZR6A 4DRHA 1B6CA 2VN1A 2XP6A 2DG4A 3H9RB 2XP5A 2ZQVA 3B7XA 2XPAA 1T11A 4JFJA 1FJDA 5HKGA 1Y0OA 3VAWA 3JXVA 4ODRA 3UI4A 4C02B 1D7JA 5HW6A 1FKIA 1N1AA 2Q5AA 1FKKA 1L1PA 1FKRA 1BKFA 3PA7A 4J4NA 1U79A 4MGVA 3UI5A 1ZK6A 5HT1A 1JVWA 3TCZA 5B8IC 2FAPA 1ROTA 2ZR5A 2VCDA 1QZ2A 3KAFA 1FKBA 3RFWA 4DIPA 4DZ2A 2RSEA 2JZVA 4U84A 1QPLA 2LJ4A 2OFNA 2ZQTA 1FAPA 4IQ2A 3IKDA 2D9FA 2MLZA 2XP9A 1C9HA 3KCEA 2KI3A 5HUAA 1ZCNA
chains in the Genus database with same CATH superfamily
4JFLA 2N87A 3KABA 4AY1A 5DEZA 2LGOA 2DSVA 3KADA 2IF4A 3B8SA 3FXYA 1ITXA 2EULA 2DT0A 2PI6A 4P8WA 4LAWA 1EQ3A 1X6LA 5GQBA 1NH6A 3KAGA 4Z2JA 3B9EA 1ZBVA 1ZL1A 1D7HA 4ODKA 5I98A 1D7IA 3WD0A 5JH8A 3ARVA 4Q22A 3O5RA 3KACA 1FKDA 1LL4A 1ZB5A 2RUDA 4MNLA 2XP3A 2PPPA 1F40A 1BL4A 1KFWA 4QT3A 2DG9A 1HJWA 4DZ3A 4ITZA 1W26A 3WH0A 4W9PA 4NNRA 2RUCA 4TW6A 2MNTA 4LAVA 3CHDA 1Q6HA 4WKAA 2K8IA 4ODPA 3NTPA 3G6MA 4FAPA 4JFMA 4ZPWR 2MPHA 3GPKA 4ODQA 2IUZA 2A3EA 3O5FA 2YBUA 1IX5A 4ODOA 4IQCA 2LPVA 1FKSA 3OA5A 4WK9A 3CHCA 2UZ5A 4LAYA 1JNDA 4ZPTR 1UR9A 2PBCA 1JNTA 1TFVA 1R9HA 2G8ZA 5HWBA 2DT2A 1OGGA 3ODKA 3LUOA 4ODLA 2KGJA 4XAKA 1XRVA 1UR8A 2A3AA 2RURA 3KAHA 4DWSA 1ZU8A 4DRHA 2VN1A 2DG4A 1E6NA 3H9RB 2XPAA 5HKGA 1Y0OA 4MNMA 1H0IA 1D7JA 1ZBCA 1GPFA 2WLYA 1BKFA 3PA7A 1ZBWA 4P8XA 5B8IC 1QZ2A 4WJXA 4DZ2A 2DPEA 3CZ8A 2ZQTA 4IQ2A 3IKDA 3RM9A 2B31A 3RGCA 2KI3A 1A7XA 1LL6A 3JYMA 2OLHA 1VF8A 1H0GA 3PRBA 1HKIA 3GU0A 1HJXA 1M5YA 3WD4A 3O5PA 3O5DA 4HBOA 4FN2A 2P4VA 1HJVA 4DWSB 2LKNA 3O5MA 2DG3A 2RQSA 5DIVA 3ARQA 2ITKA 1E9LA 1X6NA 3W4RA 1Q1CA 4BF8A 4QIBA 3UQBA 4G2PA 4MSPA 4MNJA 2XP7A 2ETNA 3ARSA 3WQVA 1WNOA 2L2SA 2A3CA 3O5OA 3RM8A 3CGNA 4DWSC 3NRKA 4L72B 1CTNA 1FKTA 2F2DA 4G50A 3O5IA 1NMWA 3O5GA 1KT0A 4MNKA 5DIUA 4Z2KA 1FFQA 4ODNA 3G6LA 3O5LA 4ML4A 2F4EA 4JFIA 2PPOA 3EIPA 3UQIA 2AOSA 1W9UA 2FDMA 4WKHA 3CH9A 3O5EA 2PV1A 4ZS6A 3FY1A 5HW8A 4LGXA 1NSGA 4U85A 4U86A 3WD3A 1SYTA 4DRNA 1HKJA 4DT4A 4O2TA 3IK8A 1LQ0A 3JYJA 3NI6A 4S3KA 4PTMA 3ARYA 2F23A 1GOIA 1EHNA 3ARWA 3JXVA 4ODRA 3UI4A 4C02B 4HARA 1FKIA 5HBFA 1LG1A 1EDQA 1FKRA 4MGVA 2A3BA 2O9OA 4J4NA 5HT1A 3WIJA 1JCHB 1JVWA 3AROA 2FAPA 2ZR5A 1FKBA 4Q7NA 2RSEA 1K9TA 2OFNA 2B5UB 2D9FA 2MLZA 1W1YA 1Q6IA 1W9VA 1YW5A 1FD9A 4N19A 2F21A 5J6EA 3UF8A 3WQWA 5DITA 4Z2IA 2DT3A 3B9DA 2ZQSA 1E6PA 3RM4A 1D6OA 4DRQA 1JNSA 3I6CA 1RD6A 1FKHA 2AWGA 3KAIA 2M1IA 2O92A 1TCOC 3CHFA 4S3JA 2M2AA 3PRAA 1GRJA 2MLYA 4DRPA 3PR9A 2FKEA 2MF9A 2WK2A 2PV2A 4DRJA 1ROUA 1E44A 2DT1A 4LAXA 2WM0A 4TX0A 3CGMA 2YBTA 4W9OA 2DSWA 3IHZA 3IKGA 3WD2A 2WLZA 3AS1A 2PV3A 5HWCA 3WL1A 1LJYA 2PPNA 2ZQUA 5HW7A 2KO7A 4GIVA 1QPFA 1E15A 1WB0A 4IPXA 1WAWA 3ARUA 1W9PA 2XP4A 1EYMA 4MTVA 4P8UA 3AS3A 1PINA 2MLXA 3UI6A 3O5QA 4JFKA 1J4IA 4GGQA 3ARPA 4Z2LA 2ZR4A 4DROA 1LL7A 1KT1A 3KZ7A 3ALFA 2XP5A 2ZQVA 3B7XA 1T11A 3BMBA 2PN0A 3VAWA 4QZVB 1N1AA 2ESCA 1FKKA 3WKZA 4WIWA 3AS0A 1U79A 2G41A 3RMEA 3TCZA 2VCDA 3B9AA 3KAFA 1FFRA 4DIPA 4NZCA 1QPLA 2LJ4A 1LG2A 1FAPA 3CHEA 1OGBA 1EIBA 1C9HA 3KCEA 2QF8A 4DWSD 5HUAA 1ZCNA 1YATA 4JYSA 3MDYB 4KQZA 2M08A 1HKMA 4W9QA 3OOBA 2XP8A 3FAPA 1SR0A 1HKKA 2DSUA 4TNSA 2KR7A 3AQUA 1GUVA 1NWUA 4R0XA 2RUQA 3PRDA 5D75A 1W1PA 3ARXA 4DRKA 4UDMA 1J4HA 3O5JA 1W1VA 5GPGA 3WL0A 1NWSA 3TC5A 1O6IA 1PBKA 4URIA 4NSBA 5DF0A 1XHGA 1J4RA 1FKFA 4MPKA 4ODMA 1D2KA 4IT4A 3EY6A 1NMVA 3ALGA 3O5KA 4J4OA 1E6ZA 3WD1A 1J6YA 3GTYX 5BXJA 4DRMA 3ARTA 1JNEA 3TDBA 5HTGA 1E6RA 1FKLA 2XPBA 3BXWA 1FKGA 2KE0A 4Z2GA 3AS2A 4DRIA 1P5QA 1NWTA 3UQAA 4TW8A 1FKJA 1HXVA 2DSZA 4TW7A 2Y78A 1F8AB 4L3NA 4W5UA 4HBEA 1Q6UA 2KFWA 1OWQA 4ZPVR 4MAVA 4P8VA 3ARRA 4DH0A 3QOKA 4TYOA 1ZBKA 4KR0B 2ZR6A 1B6CA 2XP6A 4JFJA 1FJDA 5HW6A 2Q5AA 4R5EA 1NWRA 4Z2HA 3ARZA 1L1PA 3UI5A 1ZK6A 1ROTA 1W1TA 5GPRA 3RFWA 4WKFA 2JZVA 4U84A 5DO2A 4IT6A 2XP9A 4QT2A
chains in the Genus database with same CATH topology
4JFLA 2N87A 3KABA 4AY1A 5DEZA 2LGOA 2DSVA 3KADA 2IF4A 3B8SA 3FXYA 1ITXA 2DT0A 2PI6A 4P8WA 4LAWA 1EQ3A 1X6LA 5GQBA 1NH6A 3KAGA 4Z2JA 3B9EA 1ZBVA 1ZL1A 1D7HA 4ODKA 5I98A 1D7IA 3WD0A 5JH8A 3ARVA 4Q22A 3O5RA 3KACA 1FKDA 1LL4A 1ZB5A 2RUDA 4MNLA 2XP3A 2PPPA 1F40A 1BL4A 1KFWA 4QT3A 2DG9A 1HJWA 4DZ3A 4ITZA 1W26A 3WH0A 4W9PA 4NNRA 2RUCA 4TW6A 2MNTA 4LAVA 3CHDA 1Q6HA 4WKAA 2K8IA 4ODPA 3NTPA 3G6MA 4FAPA 4JFMA 4ZPWR 2MPHA 3GPKA 4ODQA 2IUZA 2A3EA 3O5FA 2YBUA 1IX5A 4ODOA 4IQCA 2LPVA 1FKSA 3OA5A 4WK9A 3CHCA 2UZ5A 4LAYA 1JNDA 4ZPTR 1UR9A 2PBCA 1JNTA 1TFVA 1R9HA 2G8ZA 5HWBA 2DT2A 1OGGA 3ODKA 3LUOA 4ODLA 2KGJA 4XAKA 1XRVA 1UR8A 2A3AA 2RURA 3KAHA 4DWSA 1ZU8A 4DRHA 2VN1A 2DG4A 1E6NA 3H9RB 2XPAA 5HKGA 1Y0OA 4MNMA 1H0IA 1D7JA 1ZBCA 1GPFA 2WLYA 1BKFA 3PA7A 1ZBWA 4P8XA 5B8IC 1QZ2A 4WJXA 4DZ2A 2DPEA 3CZ8A 2ZQTA 4IQ2A 3IKDA 3RM9A 2B31A 3RGCA 2KI3A 1A7XA 1LL6A 3JYMA 2OLHA 1VF8A 1H0GA 3PRBA 1HKIA 1HJXA 1M5YA 3WD4A 3O5PA 3O5DA 4HBOA 4FN2A 1HJVA 4DWSB 2LKNA 3O5MA 2DG3A 2RQSA 5DIVA 3ARQA 2ITKA 1E9LA 1X6NA 3W4RA 1Q1CA 4BF8A 4QIBA 3UQBA 4G2PA 4MSPA 4MNJA 2XP7A 3ARSA 3WQVA 1WNOA 2L2SA 2A3CA 3O5OA 3RM8A 3CGNA 4DWSC 3NRKA 4L72B 1CTNA 1FKTA 2F2DA 4G50A 3O5IA 1NMWA 3O5GA 1KT0A 4MNKA 5DIUA 4Z2KA 1FFQA 4ODNA 3G6LA 3O5LA 4ML4A 2F4EA 4JFIA 2PPOA 3UQIA 2AOSA 1W9UA 2FDMA 4WKHA 3CH9A 3O5EA 2PV1A 4ZS6A 3FY1A 5HW8A 4LGXA 1NSGA 4U85A 4U86A 3WD3A 1SYTA 4DRNA 1HKJA 4DT4A 4O2TA 3IK8A 1LQ0A 3JYJA 3NI6A 4S3KA 4PTMA 3ARYA 1GOIA 1EHNA 3ARWA 3JXVA 4ODRA 3UI4A 4C02B 4HARA 1FKIA 5HBFA 1LG1A 1EDQA 1FKRA 4MGVA 2A3BA 2O9OA 4J4NA 5HT1A 3WIJA 1JVWA 3AROA 2FAPA 2ZR5A 1FKBA 4Q7NA 2RSEA 1K9TA 2OFNA 2D9FA 2MLZA 1W1YA 1Q6IA 1W9VA 1YW5A 1FD9A 4N19A 2F21A 5J6EA 3UF8A 3WQWA 5DITA 4Z2IA 2DT3A 3B9DA 2ZQSA 1E6PA 3RM4A 1D6OA 4DRQA 1JNSA 3I6CA 1RD6A 1FKHA 2AWGA 3KAIA 2M1IA 2O92A 1TCOC 3CHFA 4S3JA 2M2AA 3PRAA 2MLYA 4DRPA 3PR9A 2FKEA 2MF9A 2WK2A 2PV2A 4DRJA 1ROUA 2DT1A 4LAXA 2WM0A 4TX0A 3CGMA 2YBTA 4W9OA 2DSWA 3IHZA 3IKGA 3WD2A 2WLZA 3AS1A 2PV3A 5HWCA 3WL1A 1LJYA 2PPNA 2ZQUA 5HW7A 2KO7A 4GIVA 1QPFA 1E15A 1WB0A 4IPXA 1WAWA 3ARUA 1W9PA 2XP4A 1EYMA 4MTVA 4P8UA 3AS3A 1PINA 2MLXA 3UI6A 3O5QA 4JFKA 1J4IA 4GGQA 3ARPA 4Z2LA 2ZR4A 4DROA 1LL7A 1KT1A 3KZ7A 3ALFA 2XP5A 2ZQVA 3B7XA 1T11A 3VAWA 4QZVB 1N1AA 2ESCA 1FKKA 3WKZA 4WIWA 3AS0A 1U79A 2G41A 3RMEA 3TCZA 2VCDA 3B9AA 3KAFA 1FFRA 4DIPA 4NZCA 1QPLA 2LJ4A 1LG2A 1FAPA 3CHEA 1OGBA 1EIBA 1C9HA 3KCEA 2QF8A 4DWSD 5HUAA 1ZCNA 1YATA 4JYSA 3MDYB 4KQZA 2M08A 1HKMA 4W9QA 3OOBA 2XP8A 3FAPA 1SR0A 1HKKA 2DSUA 4TNSA 2KR7A 3AQUA 1GUVA 1NWUA 4R0XA 2RUQA 3PRDA 5D75A 1W1PA 3ARXA 4DRKA 1J4HA 3O5JA 1W1VA 5GPGA 3WL0A 1NWSA 3TC5A 1O6IA 1PBKA 4URIA 4NSBA 5DF0A 1XHGA 1J4RA 1FKFA 4MPKA 4ODMA 1D2KA 4IT4A 3EY6A 1NMVA 3ALGA 3O5KA 4J4OA 1E6ZA 3WD1A 1J6YA 5BXJA 4DRMA 3ARTA 1JNEA 3TDBA 5HTGA 1E6RA 1FKLA 2XPBA 3BXWA 1FKGA 2KE0A 4Z2GA 3AS2A 4DRIA 1P5QA 1NWTA 3UQAA 4TW8A 1FKJA 1HXVA 2DSZA 4TW7A 2Y78A 1F8AB 4L3NA 4W5UA 4HBEA 1Q6UA 2KFWA 1OWQA 4ZPVR 4MAVA 4P8VA 3ARRA 4DH0A 3QOKA 4TYOA 1ZBKA 4KR0B 2ZR6A 1B6CA 2XP6A 4JFJA 1FJDA 5HW6A 2Q5AA 4R5EA 1NWRA 4Z2HA 3ARZA 1L1PA 3UI5A 1ZK6A 1ROTA 1W1TA 5GPRA 3RFWA 4WKFA 2JZVA 4U84A 5DO2A 4IT6A 2XP9A 4QT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YAT A;  1Q6I A;  3MDY B;  3JYM A;  2M08 A;  4JYS A;  1YW5 A;  1FD9 A;  1A7X A;  3PRB A;  2N87 A;  4JFL A;  4N19 A;  4W9Q A;  2F21 A;  3OOB A;  3KAB A;  3UF8 A;  5J6E A;  4QT2 A;  2XP8 A;  3FAP A;  5DIT A;  2LGO A;  1M5Y A;  3O5P A;  3O5D A;  4TNS A;  2KR7 A;  3KAD A;  2ZQS A;  2IF4 A;  4FN2 A;  4R0X A;  1D6O A;  2RUQ A;  4DRQ A;  3PRD A;  1JNS A;  5D75 A;  3I6C A;  4DRK A;  4LAW A;  1FKH A;  1J4H A;  2LKN A;  3O5J A;  5GPG A;  1EQ3 A;  2AWG A;  3KAI A;  2M1I A;  3KAG A;  3O5M A;  2DG3 A;  3TC5 A;  1TCO C;  2RQS A;  5DIV A;  1D7H A;  1PBK A;  4ODK A;  2M2A A;  5I98 A;  2ITK A;  1D7I A;  2MLY A;  4DRP A;  1J4R A;  1FKF A;  4ODM A;  2FKE A;  3O5R A;  1Q1C A;  3KAC A;  4BF8 A;  4QIB A;  3EY6 A;  1FKD A;  1NMV A;  3O5K A;  2MF9 A;  3UQB A;  4J4O A;  4G2P A;  4MSP A;  2RUD A;  2PV2 A;  2XP3 A;  2XP7 A;  4DRJ A;  2PPP A;  1J6Y A;  1F40 A;  1BL4 A;  4QT3 A;  5BXJ A;  1ROU A;  4DRM A;  2DG9 A;  2L2S A;  4LAX A;  4DZ3 A;  4ITZ A;  1W26 A;  4TX0 A;  3CGM A;  3WH0 A;  3O5O A;  4W9P A;  4NNR A;  4W9O A;  3TDB A;  2RUC A;  4TW6 A;  3CGN A;  3IHZ A;  3IKG A;  2MNT A;  3NRK A;  4LAV A;  1FKT A;  2F2D A;  1Q6H A;  5HTG A;  2K8I A;  4G50 A;  1FKL A;  3O5I A;  2PV3 A;  4ODP A;  5HWC A;  1NMW A;  3NTP A;  2XPB A;  1KT0 A;  3O5G A;  3RGC A;  4FAP A;  1FKG A;  2KE0 A;  2PPN A;  2ZQU A;  2MPH A;  4JFM A;  5HW7 A;  5DIU A;  3GPK A;  4ODQ A;  3O5F A;  2KO7 A;  4GIV A;  1QPF A;  4ODN A;  1P5Q A;  3O5L A;  4DRI A;  4ODO A;  3UQA A;  4IPX A;  2F4E A;  4IQC A;  4JFI A;  2LPV A;  2XP4 A;  1EYM A;  1FKS A;  4TW8 A;  2PPO A;  1FKJ A;  2UZ5 A;  3UQI A;  4LAY A;  1HXV A;  3O5E A;  4TW7 A;  2PBC A;  2PV1 A;  1JNT A;  2Y78 A;  1PIN A;  1R9H A;  1F8A B;  5HWB A;  1Q6U A;  2KFW A;  2MLX A;  3UI6 A;  3ODK A;  3LUO A;  4ODL A;  5HW8 A;  1NSG A;  3O5Q A;  2KGJ A;  4JFK A;  4U85 A;  4U86 A;  1J4I A;  4GGQ A;  4DRN A;  4DH0 A;  2ZR4 A;  4DT4 A;  4DRO A;  4O2T A;  4TYO A;  2RUR A;  1KT1 A;  3IK8 A;  3JYJ A;  3KZ7 A;  3NI6 A;  3KAH A;  2ZR6 A;  4DRH A;  1B6C A;  2VN1 A;  2XP6 A;  2DG4 A;  3H9R B;  2XP5 A;  2ZQV A;  3B7X A;  2XPA A;  1T11 A;  4JFJ A;  1FJD A;  5HKG A;  1Y0O A;  3VAW A;  3JXV A;  4ODR A;  3UI4 A;  4C02 B;  1D7J A;  5HW6 A;  1FKI A;  1N1A A;  2Q5A A;  1FKK A;  1L1P A;  1FKR A;  1BKF A;  3PA7 A;  4J4N A;  1U79 A;  4MGV A;  3UI5 A;  1ZK6 A;  5HT1 A;  1JVW A;  3TCZ A;  5B8I C;  2FAP A;  1ROT A;  2ZR5 A;  2VCD A;  1QZ2 A;  3KAF A;  1FKB A;  3RFW A;  4DIP A;  4DZ2 A;  2RSE A;  2JZV A;  4U84 A;  1QPL A;  2LJ4 A;  2OFN A;  2ZQT A;  1FAP A;  4IQ2 A;  3IKD A;  2D9F A;  2MLZ A;  2XP9 A;  1C9H A;  3KCE A;  2KI3 A;  5HUA A;  1ZCN A; 
#chains in the Genus database with same CATH topology
 4JFL A;  2N87 A;  3KAB A;  4AY1 A;  5DEZ A;  2LGO A;  2DSV A;  3KAD A;  2IF4 A;  3B8S A;  3FXY A;  1ITX A;  2EUL A;  2DT0 A;  2PI6 A;  4P8W A;  4LAW A;  1EQ3 A;  1X6L A;  5GQB A;  1NH6 A;  3KAG A;  4Z2J A;  3B9E A;  1ZBV A;  1ZL1 A;  1D7H A;  4ODK A;  5I98 A;  1D7I A;  3WD0 A;  5JH8 A;  3ARV A;  4Q22 A;  3O5R A;  3KAC A;  1FKD A;  1LL4 A;  1ZB5 A;  2RUD A;  4MNL A;  2XP3 A;  2PPP A;  1F40 A;  1BL4 A;  1KFW A;  4QT3 A;  2DG9 A;  1HJW A;  4DZ3 A;  4ITZ A;  1W26 A;  3WH0 A;  4W9P A;  4NNR A;  2RUC A;  4TW6 A;  2MNT A;  4LAV A;  3CHD A;  1Q6H A;  4WKA A;  2K8I A;  4ODP A;  3NTP A;  3G6M A;  4FAP A;  4JFM A;  4ZPW R;  2MPH A;  3GPK A;  4ODQ A;  2IUZ A;  2A3E A;  3O5F A;  2YBU A;  1IX5 A;  4ODO A;  4IQC A;  2LPV A;  1FKS A;  3OA5 A;  4WK9 A;  3CHC A;  2UZ5 A;  4LAY A;  1JND A;  4ZPT R;  1UR9 A;  2PBC A;  1JNT A;  1TFV A;  1R9H A;  2G8Z A;  5HWB A;  2DT2 A;  1OGG A;  3ODK A;  3LUO A;  4ODL A;  2KGJ A;  4XAK A;  1XRV A;  1UR8 A;  2A3A A;  2RUR A;  3KAH A;  4DWS A;  1ZU8 A;  4DRH A;  2VN1 A;  2DG4 A;  1E6N A;  3H9R B;  2XPA A;  5HKG A;  1Y0O A;  4MNM A;  1H0I A;  1D7J A;  1ZBC A;  1GPF A;  2WLY A;  1BKF A;  3PA7 A;  1ZBW A;  4P8X A;  5B8I C;  1QZ2 A;  4WJX A;  4DZ2 A;  2DPE A;  3CZ8 A;  2ZQT A;  4IQ2 A;  3IKD A;  3RM9 A;  2B31 A;  3RGC A;  2KI3 A;  1A7X A;  1LL6 A;  3JYM A;  2OLH A;  1VF8 A;  1H0G A;  3PRB A;  1HKI A;  3GU0 A;  1HJX A;  1M5Y A;  3WD4 A;  3O5P A;  3O5D A;  4HBO A;  4FN2 A;  2P4V A;  1HJV A;  4DWS B;  2LKN A;  3O5M A;  2DG3 A;  2RQS A;  5DIV A;  3ARQ A;  2ITK A;  1E9L A;  1X6N A;  3W4R A;  1Q1C A;  4BF8 A;  4QIB A;  3UQB A;  4G2P A;  4MSP A;  4MNJ A;  2XP7 A;  2ETN A;  3ARS A;  3WQV A;  1WNO A;  2L2S A;  2A3C A;  3O5O A;  3RM8 A;  3CGN A;  4DWS C;  3NRK A;  4L72 B;  1CTN A;  1FKT A;  2F2D A;  4G50 A;  3O5I A;  1NMW A;  3O5G A;  1KT0 A;  4MNK A;  5DIU A;  4Z2K A;  1FFQ A;  4ODN A;  3G6L A;  3O5L A;  4ML4 A;  2F4E A;  4JFI A;  2PPO A;  3EIP A;  3UQI A;  2AOS A;  1W9U A;  2FDM A;  4WKH A;  3CH9 A;  3O5E A;  2PV1 A;  4ZS6 A;  3FY1 A;  5HW8 A;  4LGX A;  1NSG A;  4U85 A;  4U86 A;  3WD3 A;  1SYT A;  4DRN A;  1HKJ A;  4DT4 A;  4O2T A;  3IK8 A;  1LQ0 A;  3JYJ A;  3NI6 A;  4S3K A;  4PTM A;  3ARY A;  2F23 A;  1GOI A;  1EHN A;  3ARW A;  3JXV A;  4ODR A;  3UI4 A;  4C02 B;  4HAR A;  1FKI A;  5HBF A;  1LG1 A;  1EDQ A;  1FKR A;  4MGV A;  2A3B A;  2O9O A;  4J4N A;  5HT1 A;  3WIJ A;  1JCH B;  1JVW A;  3ARO A;  2FAP A;  2ZR5 A;  1FKB A;  4Q7N A;  2RSE A;  1K9T A;  2OFN A;  2B5U B;  2D9F A;  2MLZ A;  1W1Y A;  1Q6I A;  1W9V A;  1YW5 A;  1FD9 A;  4N19 A;  2F21 A;  5J6E A;  3UF8 A;  3WQW A;  5DIT A;  4Z2I A;  2DT3 A;  3B9D A;  2ZQS A;  1E6P A;  3RM4 A;  1D6O A;  4DRQ A;  1JNS A;  3I6C A;  1RD6 A;  1FKH A;  2AWG A;  3KAI A;  2M1I A;  2O92 A;  1TCO C;  3CHF A;  4S3J A;  2M2A A;  3PRA A;  1GRJ A;  2MLY A;  4DRP A;  3PR9 A;  2FKE A;  2MF9 A;  2WK2 A;  2PV2 A;  4DRJ A;  1ROU A;  1E44 A;  2DT1 A;  4LAX A;  2WM0 A;  4TX0 A;  3CGM A;  2YBT A;  4W9O A;  2DSW A;  3IHZ A;  3IKG A;  3WD2 A;  2WLZ A;  3AS1 A;  2PV3 A;  5HWC A;  3WL1 A;  1LJY A;  2PPN A;  2ZQU A;  5HW7 A;  2KO7 A;  4GIV A;  1QPF A;  1E15 A;  1WB0 A;  4IPX A;  1WAW A;  3ARU A;  1W9P A;  2XP4 A;  1EYM A;  4MTV A;  4P8U A;  3AS3 A;  1PIN A;  2MLX A;  3UI6 A;  3O5Q A;  4JFK A;  1J4I A;  4GGQ A;  3ARP A;  4Z2L A;  2ZR4 A;  4DRO A;  1LL7 A;  1KT1 A;  3KZ7 A;  3ALF A;  2XP5 A;  2ZQV A;  3B7X A;  1T11 A;  3BMB A;  2PN0 A;  3VAW A;  4QZV B;  1N1A A;  2ESC A;  1FKK A;  3WKZ A;  4WIW A;  3AS0 A;  1U79 A;  2G41 A;  3RME A;  3TCZ A;  2VCD A;  3B9A A;  3KAF A;  1FFR A;  4DIP A;  4NZC A;  1QPL A;  2LJ4 A;  1LG2 A;  1FAP A;  3CHE A;  1OGB A;  1EIB A;  1C9H A;  3KCE A;  2QF8 A;  4DWS D;  5HUA A;  1ZCN A;  1YAT A;  4JYS A;  3MDY B;  4KQZ A;  2M08 A;  1HKM A;  4W9Q A;  3OOB A;  2XP8 A;  3FAP A;  1SR0 A;  1HKK A;  2DSU A;  4TNS A;  2KR7 A;  3AQU A;  1GUV A;  1NWU A;  4R0X A;  2RUQ A;  3PRD A;  5D75 A;  1W1P A;  3ARX A;  4DRK A;  4UDM A;  1J4H A;  3O5J A;  1W1V A;  5GPG A;  3WL0 A;  1NWS A;  3TC5 A;  1O6I A;  1PBK A;  4URI A;  4NSB A;  5DF0 A;  1XHG A;  1J4R A;  1FKF A;  4MPK A;  4ODM A;  1D2K A;  4IT4 A;  3EY6 A;  1NMV A;  3ALG A;  3O5K A;  4J4O A;  1E6Z A;  3WD1 A;  1J6Y A;  3GTY X;  5BXJ A;  4DRM A;  3ART A;  1JNE A;  3TDB A;  5HTG A;  1E6R A;  1FKL A;  2XPB A;  3BXW A;  1FKG A;  2KE0 A;  4Z2G A;  3AS2 A;  4DRI A;  1P5Q A;  1NWT A;  3UQA A;  4TW8 A;  1FKJ A;  1HXV A;  2DSZ A;  4TW7 A;  2Y78 A;  1F8A B;  4L3N A;  4W5U A;  4HBE A;  1Q6U A;  2KFW A;  1OWQ A;  4ZPV R;  4MAV A;  4P8V A;  3ARR A;  4DH0 A;  3QOK A;  4TYO A;  1ZBK A;  4KR0 B;  2ZR6 A;  1B6C A;  2XP6 A;  4JFJ A;  1FJD A;  5HW6 A;  2Q5A A;  4R5E A;  1NWR A;  4Z2H A;  3ARZ A;  1L1P A;  3UI5 A;  1ZK6 A;  1ROT A;  1W1T A;  5GPR A;  3RFW A;  4WKF A;  2JZV A;  4U84 A;  5DO2 A;  4IT6 A;  2XP9 A;  4QT2 A; 
#chains in the Genus database with same CATH homology
 4JFL A;  2N87 A;  3KAB A;  4AY1 A;  5DEZ A;  2LGO A;  2DSV A;  3KAD A;  2IF4 A;  3B8S A;  3FXY A;  1ITX A;  2DT0 A;  2PI6 A;  4P8W A;  4LAW A;  1EQ3 A;  1X6L A;  5GQB A;  1NH6 A;  3KAG A;  4Z2J A;  3B9E A;  1ZBV A;  1ZL1 A;  1D7H A;  4ODK A;  5I98 A;  1D7I A;  3WD0 A;  5JH8 A;  3ARV A;  4Q22 A;  3O5R A;  3KAC A;  1FKD A;  1LL4 A;  1ZB5 A;  2RUD A;  4MNL A;  2XP3 A;  2PPP A;  1F40 A;  1BL4 A;  1KFW A;  4QT3 A;  2DG9 A;  1HJW A;  4DZ3 A;  4ITZ A;  1W26 A;  3WH0 A;  4W9P A;  4NNR A;  2RUC A;  4TW6 A;  2MNT A;  4LAV A;  3CHD A;  1Q6H A;  4WKA A;  2K8I A;  4ODP A;  3NTP A;  3G6M A;  4FAP A;  4JFM A;  4ZPW R;  2MPH A;  3GPK A;  4ODQ A;  2IUZ A;  2A3E A;  3O5F A;  2YBU A;  1IX5 A;  4ODO A;  4IQC A;  2LPV A;  1FKS A;  3OA5 A;  4WK9 A;  3CHC A;  2UZ5 A;  4LAY A;  1JND A;  4ZPT R;  1UR9 A;  2PBC A;  1JNT A;  1TFV A;  1R9H A;  2G8Z A;  5HWB A;  2DT2 A;  1OGG A;  3ODK A;  3LUO A;  4ODL A;  2KGJ A;  4XAK A;  1XRV A;  1UR8 A;  2A3A A;  2RUR A;  3KAH A;  4DWS A;  1ZU8 A;  4DRH A;  2VN1 A;  2DG4 A;  1E6N A;  3H9R B;  2XPA A;  5HKG A;  1Y0O A;  4MNM A;  1H0I A;  1D7J A;  1ZBC A;  1GPF A;  2WLY A;  1BKF A;  3PA7 A;  1ZBW A;  4P8X A;  5B8I C;  1QZ2 A;  4WJX A;  4DZ2 A;  2DPE A;  3CZ8 A;  2ZQT A;  4IQ2 A;  3IKD A;  3RM9 A;  2B31 A;  3RGC A;  2KI3 A;  1A7X A;  1LL6 A;  3JYM A;  2OLH A;  1VF8 A;  1H0G A;  3PRB A;  1HKI A;  1HJX A;  1M5Y A;  3WD4 A;  3O5P A;  3O5D A;  4HBO A;  4FN2 A;  1HJV A;  4DWS B;  2LKN A;  3O5M A;  2DG3 A;  2RQS A;  5DIV A;  3ARQ A;  2ITK A;  1E9L A;  1X6N A;  3W4R A;  1Q1C A;  4BF8 A;  4QIB A;  3UQB A;  4G2P A;  4MSP A;  4MNJ A;  2XP7 A;  3ARS A;  3WQV A;  1WNO A;  2L2S A;  2A3C A;  3O5O A;  3RM8 A;  3CGN A;  4DWS C;  3NRK A;  4L72 B;  1CTN A;  1FKT A;  2F2D A;  4G50 A;  3O5I A;  1NMW A;  3O5G A;  1KT0 A;  4MNK A;  5DIU A;  4Z2K A;  1FFQ A;  4ODN A;  3G6L A;  3O5L A;  4ML4 A;  2F4E A;  4JFI A;  2PPO A;  3UQI A;  2AOS A;  1W9U A;  2FDM A;  4WKH A;  3CH9 A;  3O5E A;  2PV1 A;  4ZS6 A;  3FY1 A;  5HW8 A;  4LGX A;  1NSG A;  4U85 A;  4U86 A;  3WD3 A;  1SYT A;  4DRN A;  1HKJ A;  4DT4 A;  4O2T A;  3IK8 A;  1LQ0 A;  3JYJ A;  3NI6 A;  4S3K A;  4PTM A;  3ARY A;  1GOI A;  1EHN A;  3ARW A;  3JXV A;  4ODR A;  3UI4 A;  4C02 B;  4HAR A;  1FKI A;  5HBF A;  1LG1 A;  1EDQ A;  1FKR A;  4MGV A;  2A3B A;  2O9O A;  4J4N A;  5HT1 A;  3WIJ A;  1JVW A;  3ARO A;  2FAP A;  2ZR5 A;  1FKB A;  4Q7N A;  2RSE A;  1K9T A;  2OFN A;  2D9F A;  2MLZ A;  1W1Y A;  1Q6I A;  1W9V A;  1YW5 A;  1FD9 A;  4N19 A;  2F21 A;  5J6E A;  3UF8 A;  3WQW A;  5DIT A;  4Z2I A;  2DT3 A;  3B9D A;  2ZQS A;  1E6P A;  3RM4 A;  1D6O A;  4DRQ A;  1JNS A;  3I6C A;  1RD6 A;  1FKH A;  2AWG A;  3KAI A;  2M1I A;  2O92 A;  1TCO C;  3CHF A;  4S3J A;  2M2A A;  3PRA A;  2MLY A;  4DRP A;  3PR9 A;  2FKE A;  2MF9 A;  2WK2 A;  2PV2 A;  4DRJ A;  1ROU A;  2DT1 A;  4LAX A;  2WM0 A;  4TX0 A;  3CGM A;  2YBT A;  4W9O A;  2DSW A;  3IHZ A;  3IKG A;  3WD2 A;  2WLZ A;  3AS1 A;  2PV3 A;  5HWC A;  3WL1 A;  1LJY A;  2PPN A;  2ZQU A;  5HW7 A;  2KO7 A;  4GIV A;  1QPF A;  1E15 A;  1WB0 A;  4IPX A;  1WAW A;  3ARU A;  1W9P A;  2XP4 A;  1EYM A;  4MTV A;  4P8U A;  3AS3 A;  1PIN A;  2MLX A;  3UI6 A;  3O5Q A;  4JFK A;  1J4I A;  4GGQ A;  3ARP A;  4Z2L A;  2ZR4 A;  4DRO A;  1LL7 A;  1KT1 A;  3KZ7 A;  3ALF A;  2XP5 A;  2ZQV A;  3B7X A;  1T11 A;  3VAW A;  4QZV B;  1N1A A;  2ESC A;  1FKK A;  3WKZ A;  4WIW A;  3AS0 A;  1U79 A;  2G41 A;  3RME A;  3TCZ A;  2VCD A;  3B9A A;  3KAF A;  1FFR A;  4DIP A;  4NZC A;  1QPL A;  2LJ4 A;  1LG2 A;  1FAP A;  3CHE A;  1OGB A;  1EIB A;  1C9H A;  3KCE A;  2QF8 A;  4DWS D;  5HUA A;  1ZCN A;  1YAT A;  4JYS A;  3MDY B;  4KQZ A;  2M08 A;  1HKM A;  4W9Q A;  3OOB A;  2XP8 A;  3FAP A;  1SR0 A;  1HKK A;  2DSU A;  4TNS A;  2KR7 A;  3AQU A;  1GUV A;  1NWU A;  4R0X A;  2RUQ A;  3PRD A;  5D75 A;  1W1P A;  3ARX A;  4DRK A;  1J4H A;  3O5J A;  1W1V A;  5GPG A;  3WL0 A;  1NWS A;  3TC5 A;  1O6I A;  1PBK A;  4URI A;  4NSB A;  5DF0 A;  1XHG A;  1J4R A;  1FKF A;  4MPK A;  4ODM A;  1D2K A;  4IT4 A;  3EY6 A;  1NMV A;  3ALG A;  3O5K A;  4J4O A;  1E6Z A;  3WD1 A;  1J6Y A;  5BXJ A;  4DRM A;  3ART A;  1JNE A;  3TDB A;  5HTG A;  1E6R A;  1FKL A;  2XPB A;  3BXW A;  1FKG A;  2KE0 A;  4Z2G A;  3AS2 A;  4DRI A;  1P5Q A;  1NWT A;  3UQA A;  4TW8 A;  1FKJ A;  1HXV A;  2DSZ A;  4TW7 A;  2Y78 A;  1F8A B;  4L3N A;  4W5U A;  4HBE A;  1Q6U A;  2KFW A;  1OWQ A;  4ZPV R;  4MAV A;  4P8V A;  3ARR A;  4DH0 A;  3QOK A;  4TYO A;  1ZBK A;  4KR0 B;  2ZR6 A;  1B6C A;  2XP6 A;  4JFJ A;  1FJD A;  5HW6 A;  2Q5A A;  4R5E A;  1NWR A;  4Z2H A;  3ARZ A;  1L1P A;  3UI5 A;  1ZK6 A;  1ROT A;  1W1T A;  5GPR A;  3RFW A;  4WKF A;  2JZV A;  4U84 A;  5DO2 A;  4IT6 A;  2XP9 A;  4QT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...