4G2PA

Crystal structure of peptidyl-prolyl cis-trans isomerase domain ii of molecular chaperone sura from salmonella enterica subsp. enterica serovar typhimurium str. 14028s
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
AISVTEVHARHILLKPSPIMNDQQARLKLEEIAADIKSGKTTFAAAAKEYSQDPGSANQGGDLGWATPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLDTRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone SurA
publication title Crystal structure of peptidyl-prolyl cis-trans isomerase domain II of molecular chaperone SurA from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. 14028s
molecule tags Isomerase
total genus 29
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4g2pA00
4JYSA 4IQCA 3CGNA 1F40A 1PINA 4IQ2A 2XP9A 2ZR5A 3O5EA 2ZQSA 2XP5A 2DG9A 3MDYB 3FAPA 4JFKA 3NTPA 4ODNA 4W9QA 5HT1A 4DRMA 3O5GA 2MF9A 3O5DA 3KABA 1J4RA 2XP6A 2LPVA 4DRPA 4QT2A 4J4NA 2LGOA 1FKTA 1T11A 5HWCA 2N87A 1ROUA 2PPNA 4TW8A 2MLXA 3IK8A 1JNSA 2PPOA 1PBKA 2KGJA 3JXVA 4DROA 4LAVA 3O5OA 2MLZA 4G2PA 1FKJA 2FKEA 1BKFA 1KT1A 3UI6A 5BXJA 3TDBA 4TNSA 1FKLA 2DG4A 3RFWA 5B8IC 2M2AA 4U85A 3PRBA 5I98A 1YATA 2L2SA 1M5YA 1FKKA 2AWGA 5DIVA 4DZ3A 3O5JA 1KT0A 4G50A 4QT3A 5HTGA 1Y0OA 1ZK6A 3IKGA 3O5LA 2ZQUA 3KCEA 3KACA 4DRHA 5HKGA 5DITA 1FJDA 1FKFA 1C9HA 2XP4A 1Q6UA 2ZR6A 3UQBA 2Q5AA 3KADA 3EY6A 1NMWA 1R9HA 2M08A 2MPHA 3RGCA 2PV2A 2KI3A 4W9OA 4DT4A 2XP3A 1ROTA 5HW7A 1FKGA 3KAFA 4JFIA 3UQIA 1EQ3A 4DRKA 2M1IA 1P5QA 3I6CA 1JVWA 2KE0A 1QPLA 4U86A 4DRJA 3IKDA 3O5KA 3IHZA 3NRKA 1BL4A 4W9PA 2VN1A 4ODMA 2RQSA 1F8AB 4QIBA 1D7JA 1FKBA 2PPPA 4ODPA 4DH0A 4IPXA 2ZQVA 5GPGA 5DIUA 2ZR4A 5HW8A 2LJ4A 2RUQA 3NI6A 3JYJA 4MGVA 4DZ2A 4ITZA 2RUDA 4ODLA 4DRIA 3ODKA 3TC5A 3O5QA 2PV3A 2RURA 1ZCNA 3O5RA 4DIPA 3JYMA 2F4EA 1B6CA 3PRDA 3GPKA 2RUCA 1QPFA 2F21A 2F2DA 1NMVA 2XP8A 4TW7A 4TYOA 1J4IA 1J4HA 1D6OA 4ODKA 3UF8A 2RSEA 4LAXA 3UQAA 1FAPA 2KO7A 3KAHA 3UI4A 2MLYA 1YW5A 3O5MA 2PV1A 4R0XA 1N1AA 4BF8A 4J4OA 5HW6A 4ODOA 3LUOA 4DRQA 4C02B 2D9FA 2XPAA 2XP7A 1Q6HA 3CGMA 4NNRA 3UI5A 4DRNA 4MSPA 1FKRA 1EYMA 3KAGA 1J6YA 1D7IA 1Q1CA 2OFNA 3H9RB 2KR7A 3KZ7A 3O5IA 4JFJA 1FKSA 1Q6IA 1FD9A 4GGQA 5HUAA 4LAWA 3VAWA 4FAPA 1NSGA 1U79A 5D75A 2IF4A 5HWBA 3O5PA 2KFWA 2ZQTA 3PA7A 3KAIA 2JZVA 4ODQA 2MNTA 2DG3A 4GIVA 3WH0A 1L1PA 1HXVA 1A7XA 2K8IA 1TCOC 4JFMA 4N19A 1W26A 4TW6A 1FKDA 2XPBA 4LAYA 4JFLA 4ODRA 4O2TA 2Y78A 1QZ2A 1D7HA 2VCDA 5J6EA 2ITKA 2PBCA 4TX0A 1FKHA 1FKIA 1JNTA 2LKNA 2UZ5A 3OOBA 4FN2A 3B7XA 3TCZA 3O5FA 4U84A 2FAPA
chains in the Genus database with same CATH superfamily
4JYSA 1F40A 1PINA 4IQ2A 3O5EA 3MDYB 4DRMA 1E44A 2YBTA 2XP6A 1HJWA 5JH8A 2LGOA 1T11A 5HWCA 2N87A 2PPNA 4TW8A 2MLXA 4AY1A 4WKFA 3O5OA 2DSVA 3TDBA 4TNSA 3AS0A 3RFWA 1E9LA 5B8IC 4IT4A 3PRBA 1FKKA 5DIVA 3B8SA 1Y0OA 3IKGA 5DITA 3UQBA 4Z2IA 1FKGA 4NZCA 2B5UB 2M1IA 4W5UA 1HKKA 3IKDA 4MNMA 5DEZA 1E6PA 4QIBA 1D7JA 4ODPA 2PN0A 1GPFA 2ZQVA 2FDMA 3CHCA 2ZR4A 5HW8A 3NI6A 4MGVA 4DZ2A 4DRIA 3O5QA 2RURA 3JYMA 3CHFA 3GPKA 2XP8A 1QPFA 2F21A 3ARSA 1ZU8A 3UF8A 1HKIA 2O92A 5HW6A 1LL6A 3LUOA 1LG2A 4P8XA 2D9FA 3RM4A 2XPAA 2XP7A 4NNRA 3G6LA 1J6YA 1Q1CA 2OFNA 3O5IA 1FKSA 5HUAA 1SYTA 4ZPTR 1EHNA 1JNEA 1XHGA 5DO2A 3ARPA 3O5PA 2MNTA 3ARTA 1UR9A 1L1PA 4LAYA 2DSZA 3B9DA 2ITKA 4FN2A 4DWSD 3TCZA 2EULA 4U84A 4IQCA 3PR9A 2ZR5A 1UR8A 2XP5A 4JFKA 1LL7A 2MF9A 1J4RA 2LPVA 3CZ8A 2A3AA 3ARUA 1ROUA 3GU0A 1W1PA 4P8WA 3JXVA 4LAVA 4G2PA 1FKJA 1NWUA 2DT2A 3WD3A 4URIA 5I98A 4DZ3A 2AWGA 2AOSA 1KT0A 4G50A 4Z2JA 2ZQUA 3KCEA 1FFRA 4DRHA 4Z2LA 1C9HA 2ZR6A 3FY1A 1NMWA 1R9HA 3RGCA 2DT0A 2KI3A 3WD1A 4DT4A 1ROTA 1W9PA 5HW7A 5GQBA 3BXWA 3KAFA 1LQ0A 3UQIA 1EQ3A 2WK2A 1ITXA 4DRKA 4NSBA 1O6IA 4DWSA 4W9PA 3B9EA 4ODMA 4WJXA 2WM0A 5GPRA 5GPGA 2RUQA 1ZBWA 3B9AA 3JYJA 2RUDA 3ODKA 2PV3A 4DIPA 4DWSB 1W9VA 1NMVA 4TW7A 1ZBVA 4LAXA 3UQAA 2KO7A 3KAHA 3AS1A 1YW5A 1H0IA 1N1AA 1NWRA 4ODOA 3QOKA 2IUZA 4DRQA 4DRNA 1EYMA 3KZ7A 2DT3A 4MPKA 1E6ZA 2DT1A 1ZL1A 1WB0A 4FAPA 1E6RA 5HWBA 2ZQTA 3CHEA 2JZVA 3WH0A 1X6NA 1GRJA 4HBEA 4QZVB 4WIWA 1NWSA 2DSWA 4ODRA 4ZPVR 3WD0A 5HBFA 4Z2GA 2PBCA 1FKHA 1FKIA 3B7XA 2FAPA 1LL4A 3CGNA 4UDMA 2XP9A 2ZQSA 1KFWA 3WL0A 3WD4A 4W9QA 2A3CA 3O5DA 3KABA 1WNOA 4J4NA 3WKZA 4IT6A 4Z2KA 3IK8A 1JNSA 2PPOA 1PBKA 2KGJA 4DROA 4S3JA 4P8UA 3UI6A 1KT1A 5BXJA 4ML4A 2P4VA 1E6NA 1FKLA 2YBUA 4LGXA 4U85A 1X6LA 2ETNA 2OLHA 2L2SA 1M5YA 3O5JA 1FFQA 1ZK6A 3O5LA 1FJDA 1FKFA 1NWTA 3ARVA 2Q5AA 1ZBKA 2MPHA 4W9OA 2O9OA 4JFIA 4KQZA 1W1TA 1LJYA 4L72B 3I6CA 4ZPWR 2KE0A 4DRJA 1EIBA 4L3NA 3O5KA 3NRKA 1BL4A 2RQSA 1FKBA 2WLZA 2PPPA 1W9UA 4DH0A 3ARYA 1D2KA 4PTMA 4XAKA 2B31A 2LJ4A 3WL1A 3ARWA 2DPEA 2WLYA 3CHDA 3TC5A 3AS2A 3EIPA 1VF8A 4Z2HA 1CTNA 2ESCA 1XRVA 1B6CA 3AS3A 3PRDA 4Q22A 2RUCA 1OGBA 1J4IA 4ODKA 1D6OA 2RSEA 1FAPA 3G6MA 2MLYA 2PV1A 4R0XA 4BF8A 1TFVA 1E15A 3ALGA 1JNDA 3CGMA 3UI5A 4MSPA 3CH9A 1D7IA 3H9RB 2KR7A 4MTVA 1Q6IA 4P8VA 4LAWA 1SR0A 3PA7A 3KAIA 4Q7NA 4ODQA 2DG3A 4HARA 2K8IA 4JFMA 1NH6A 4TW6A 3AROA 1FKDA 2XPBA 1ZBCA 4JFLA 4O2TA 2G8ZA 2VCDA 3BMBA 4TX0A 4MAVA 2UZ5A 3O5FA 4ODNA 3PRAA 2DG9A 3FAPA 1K9TA 3NTPA 5HT1A 4KR0B 3ARRA 3O5GA 4DRPA 4QT2A 1FKTA 3ARQA 4DWSC 3WQVA 3ARZA 4WK9A 3AQUA 4S3KA 3W4RA 2MLZA 2FKEA 1BKFA 1WAWA 2DG4A 4ZS6A 2M2AA 1YATA 1OWQA 4QT3A 1GOIA 5HTGA 3ALFA 3KACA 1HKJA 4WKHA 5HKGA 3WIJA 2XP4A 3RM9A 1Q6UA 4MNLA 3KADA 2A3EA 2M08A 3EY6A 1HKMA 2PV2A 3WQWA 2XP3A 1P5QA 1JVWA 1QPLA 2F23A 4U86A 4WKAA 3IHZA 3GTYX 3RMEA 2VN1A 1F8AB 1W1YA 1HJXA 4IPXA 1GUVA 5DF0A 5DIUA 3ARXA 1RD6A 4ITZA 2PI6A 4ODLA 1EDQA 3O5RA 1ZCNA 2F4EA 4R5EA 2F2DA 3RM8A 4TYOA 1J4HA 1HJVA 3UI4A 3O5MA 4MNKA 4J4OA 4C02B 1JCHB 3WD2A 1FKRA 1Q6HA 1LG1A 3KAGA 1H0GA 4JFJA 2A3BA 3OA5A 2G41A 1W1VA 1FD9A 4GGQA 3VAWA 3FXYA 1NSGA 1U79A 5D75A 2IF4A 2KFWA 4GIVA 4HBOA 1HXVA 1A7XA 1TCOC 4N19A 1W26A 1OGGA 2Y78A 1QZ2A 1D7HA 4MNJA 5J6EA 2DSUA 1IX5A 2LKNA 1JNTA 3OOBA 1ZB5A 2QF8A
chains in the Genus database with same CATH topology
4JYSA 1F40A 1PINA 4IQ2A 3O5EA 3MDYB 4DRMA 2YBTA 2XP6A 1HJWA 5JH8A 2LGOA 1T11A 5HWCA 2N87A 2PPNA 4TW8A 2MLXA 4AY1A 4WKFA 3O5OA 2DSVA 3TDBA 4TNSA 3AS0A 3RFWA 1E9LA 5B8IC 4IT4A 3PRBA 1FKKA 5DIVA 3B8SA 1Y0OA 3IKGA 5DITA 3UQBA 4Z2IA 1FKGA 4NZCA 2M1IA 4W5UA 1HKKA 3IKDA 4MNMA 5DEZA 1E6PA 4QIBA 1D7JA 4ODPA 1GPFA 2ZQVA 2FDMA 3CHCA 2ZR4A 5HW8A 3NI6A 4MGVA 4DZ2A 4DRIA 3O5QA 2RURA 3JYMA 3CHFA 3GPKA 2XP8A 1QPFA 2F21A 3ARSA 1ZU8A 3UF8A 1HKIA 2O92A 5HW6A 1LL6A 3LUOA 1LG2A 4P8XA 2D9FA 3RM4A 2XPAA 2XP7A 4NNRA 3G6LA 1J6YA 1Q1CA 2OFNA 3O5IA 1FKSA 5HUAA 1SYTA 4ZPTR 1EHNA 1JNEA 1XHGA 5DO2A 3ARPA 3O5PA 2MNTA 3ARTA 1UR9A 1L1PA 4LAYA 2DSZA 3B9DA 2ITKA 4FN2A 4DWSD 3TCZA 4U84A 4IQCA 3PR9A 2ZR5A 1UR8A 2XP5A 4JFKA 1LL7A 2MF9A 1J4RA 2LPVA 3CZ8A 2A3AA 3ARUA 1ROUA 1W1PA 4P8WA 3JXVA 4LAVA 4G2PA 1FKJA 1NWUA 2DT2A 3WD3A 4URIA 5I98A 4DZ3A 2AWGA 2AOSA 1KT0A 4G50A 4Z2JA 2ZQUA 3KCEA 1FFRA 4DRHA 4Z2LA 1C9HA 2ZR6A 3FY1A 1NMWA 1R9HA 3RGCA 2DT0A 2KI3A 3WD1A 4DT4A 1ROTA 1W9PA 5HW7A 5GQBA 3BXWA 3KAFA 1LQ0A 3UQIA 1EQ3A 2WK2A 1ITXA 4DRKA 4NSBA 1O6IA 4DWSA 4W9PA 3B9EA 4ODMA 4WJXA 2WM0A 5GPRA 5GPGA 2RUQA 1ZBWA 3B9AA 3JYJA 2RUDA 3ODKA 2PV3A 4DIPA 4DWSB 1W9VA 1NMVA 4TW7A 1ZBVA 4LAXA 3UQAA 2KO7A 3KAHA 3AS1A 1YW5A 1H0IA 1N1AA 1NWRA 4ODOA 3QOKA 2IUZA 4DRQA 4DRNA 1EYMA 3KZ7A 2DT3A 4MPKA 1E6ZA 2DT1A 1ZL1A 1WB0A 4FAPA 1E6RA 5HWBA 2ZQTA 3CHEA 2JZVA 3WH0A 1X6NA 4HBEA 4QZVB 4WIWA 1NWSA 2DSWA 4ODRA 4ZPVR 3WD0A 5HBFA 4Z2GA 2PBCA 1FKHA 1FKIA 3B7XA 2FAPA 1LL4A 3CGNA 2XP9A 2ZQSA 1KFWA 3WL0A 3WD4A 4W9QA 2A3CA 3O5DA 3KABA 1WNOA 4J4NA 3WKZA 4IT6A 4Z2KA 3IK8A 1JNSA 2PPOA 1PBKA 2KGJA 4DROA 4S3JA 4P8UA 3UI6A 1KT1A 5BXJA 4ML4A 1E6NA 1FKLA 2YBUA 4LGXA 4U85A 1X6LA 2OLHA 2L2SA 1M5YA 3O5JA 1FFQA 1ZK6A 3O5LA 1FJDA 1FKFA 1NWTA 3ARVA 2Q5AA 1ZBKA 2MPHA 4W9OA 2O9OA 4JFIA 4KQZA 1W1TA 1LJYA 4L72B 3I6CA 4ZPWR 2KE0A 4DRJA 1EIBA 4L3NA 3O5KA 3NRKA 1BL4A 2RQSA 1FKBA 2WLZA 2PPPA 1W9UA 4DH0A 3ARYA 1D2KA 4PTMA 4XAKA 2B31A 2LJ4A 3WL1A 3ARWA 2DPEA 2WLYA 3CHDA 3TC5A 3AS2A 1VF8A 4Z2HA 1CTNA 2ESCA 1XRVA 1B6CA 3AS3A 3PRDA 4Q22A 2RUCA 1OGBA 1J4IA 4ODKA 1D6OA 2RSEA 1FAPA 3G6MA 2MLYA 2PV1A 4R0XA 4BF8A 1TFVA 1E15A 3ALGA 1JNDA 3CGMA 3UI5A 4MSPA 3CH9A 1D7IA 3H9RB 2KR7A 4MTVA 1Q6IA 4P8VA 4LAWA 1SR0A 3PA7A 3KAIA 4Q7NA 4ODQA 2DG3A 4HARA 2K8IA 4JFMA 1NH6A 4TW6A 3AROA 1FKDA 2XPBA 1ZBCA 4JFLA 4O2TA 2G8ZA 2VCDA 4TX0A 4MAVA 2UZ5A 3O5FA 4ODNA 3PRAA 2DG9A 3FAPA 1K9TA 3NTPA 5HT1A 4KR0B 3ARRA 3O5GA 4DRPA 4QT2A 1FKTA 3ARQA 4DWSC 3WQVA 3ARZA 4WK9A 3AQUA 4S3KA 3W4RA 2MLZA 2FKEA 1BKFA 1WAWA 2DG4A 4ZS6A 2M2AA 1YATA 1OWQA 4QT3A 1GOIA 5HTGA 3ALFA 3KACA 1HKJA 4WKHA 5HKGA 3WIJA 2XP4A 3RM9A 1Q6UA 4MNLA 3KADA 2A3EA 2M08A 3EY6A 1HKMA 2PV2A 3WQWA 2XP3A 1P5QA 1JVWA 1QPLA 4U86A 4WKAA 3IHZA 3RMEA 2VN1A 1F8AB 1W1YA 1HJXA 4IPXA 1GUVA 5DF0A 5DIUA 3ARXA 1RD6A 4ITZA 2PI6A 4ODLA 1EDQA 3O5RA 1ZCNA 2F4EA 4R5EA 2F2DA 3RM8A 4TYOA 1J4HA 1HJVA 3UI4A 3O5MA 4MNKA 4J4OA 4C02B 3WD2A 1FKRA 1Q6HA 1LG1A 3KAGA 1H0GA 4JFJA 2A3BA 3OA5A 2G41A 1W1VA 1FD9A 4GGQA 3VAWA 3FXYA 1NSGA 1U79A 5D75A 2IF4A 2KFWA 4GIVA 4HBOA 1HXVA 1A7XA 1TCOC 4N19A 1W26A 1OGGA 2Y78A 1QZ2A 1D7HA 4MNJA 5J6EA 2DSUA 1IX5A 2LKNA 1JNTA 3OOBA 1ZB5A 2QF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYS A;  4IQC A;  3CGN A;  1F40 A;  1PIN A;  4IQ2 A;  2XP9 A;  2ZR5 A;  3O5E A;  2ZQS A;  2XP5 A;  2DG9 A;  3MDY B;  3FAP A;  4JFK A;  3NTP A;  4ODN A;  4W9Q A;  5HT1 A;  4DRM A;  3O5G A;  2MF9 A;  3O5D A;  3KAB A;  1J4R A;  2XP6 A;  2LPV A;  4DRP A;  4QT2 A;  4J4N A;  2LGO A;  1FKT A;  1T11 A;  5HWC A;  2N87 A;  1ROU A;  2PPN A;  4TW8 A;  2MLX A;  3IK8 A;  1JNS A;  2PPO A;  1PBK A;  2KGJ A;  3JXV A;  4DRO A;  4LAV A;  3O5O A;  2MLZ A;  4G2P A;  1FKJ A;  2FKE A;  1BKF A;  1KT1 A;  3UI6 A;  5BXJ A;  3TDB A;  4TNS A;  1FKL A;  2DG4 A;  3RFW A;  5B8I C;  2M2A A;  4U85 A;  3PRB A;  5I98 A;  1YAT A;  2L2S A;  1M5Y A;  1FKK A;  2AWG A;  5DIV A;  4DZ3 A;  3O5J A;  1KT0 A;  4G50 A;  4QT3 A;  5HTG A;  1Y0O A;  1ZK6 A;  3IKG A;  3O5L A;  2ZQU A;  3KCE A;  3KAC A;  4DRH A;  5HKG A;  5DIT A;  1FJD A;  1FKF A;  1C9H A;  2XP4 A;  1Q6U A;  2ZR6 A;  3UQB A;  2Q5A A;  3KAD A;  3EY6 A;  1NMW A;  1R9H A;  2M08 A;  2MPH A;  3RGC A;  2PV2 A;  2KI3 A;  4W9O A;  4DT4 A;  2XP3 A;  1ROT A;  5HW7 A;  1FKG A;  3KAF A;  4JFI A;  3UQI A;  1EQ3 A;  4DRK A;  2M1I A;  1P5Q A;  3I6C A;  1JVW A;  2KE0 A;  1QPL A;  4U86 A;  4DRJ A;  3IKD A;  3O5K A;  3IHZ A;  3NRK A;  1BL4 A;  4W9P A;  2VN1 A;  4ODM A;  2RQS A;  1F8A B;  4QIB A;  1D7J A;  1FKB A;  2PPP A;  4ODP A;  4DH0 A;  4IPX A;  2ZQV A;  5GPG A;  5DIU A;  2ZR4 A;  5HW8 A;  2LJ4 A;  2RUQ A;  3NI6 A;  3JYJ A;  4MGV A;  4DZ2 A;  4ITZ A;  2RUD A;  4ODL A;  4DRI A;  3ODK A;  3TC5 A;  3O5Q A;  2PV3 A;  2RUR A;  1ZCN A;  3O5R A;  4DIP A;  3JYM A;  2F4E A;  1B6C A;  3PRD A;  3GPK A;  2RUC A;  1QPF A;  2F21 A;  2F2D A;  1NMV A;  2XP8 A;  4TW7 A;  4TYO A;  1J4I A;  1J4H A;  1D6O A;  4ODK A;  3UF8 A;  2RSE A;  4LAX A;  3UQA A;  1FAP A;  2KO7 A;  3KAH A;  3UI4 A;  2MLY A;  1YW5 A;  3O5M A;  2PV1 A;  4R0X A;  1N1A A;  4BF8 A;  4J4O A;  5HW6 A;  4ODO A;  3LUO A;  4DRQ A;  4C02 B;  2D9F A;  2XPA A;  2XP7 A;  1Q6H A;  3CGM A;  4NNR A;  3UI5 A;  4DRN A;  4MSP A;  1FKR A;  1EYM A;  3KAG A;  1J6Y A;  1D7I A;  1Q1C A;  2OFN A;  3H9R B;  2KR7 A;  3KZ7 A;  3O5I A;  4JFJ A;  1FKS A;  1Q6I A;  1FD9 A;  4GGQ A;  5HUA A;  4LAW A;  3VAW A;  4FAP A;  1NSG A;  1U79 A;  5D75 A;  2IF4 A;  5HWB A;  3O5P A;  2KFW A;  2ZQT A;  3PA7 A;  3KAI A;  2JZV A;  4ODQ A;  2MNT A;  2DG3 A;  4GIV A;  3WH0 A;  1L1P A;  1HXV A;  1A7X A;  2K8I A;  1TCO C;  4JFM A;  4N19 A;  1W26 A;  4TW6 A;  1FKD A;  2XPB A;  4LAY A;  4JFL A;  4ODR A;  4O2T A;  2Y78 A;  1QZ2 A;  1D7H A;  2VCD A;  5J6E A;  2ITK A;  2PBC A;  4TX0 A;  1FKH A;  1FKI A;  1JNT A;  2LKN A;  2UZ5 A;  3OOB A;  4FN2 A;  3B7X A;  3TCZ A;  3O5F A;  4U84 A;  2FAP A; 
#chains in the Genus database with same CATH topology
 4JYS A;  1F40 A;  1PIN A;  4IQ2 A;  3O5E A;  3MDY B;  4DRM A;  1E44 A;  2YBT A;  2XP6 A;  1HJW A;  5JH8 A;  2LGO A;  1T11 A;  5HWC A;  2N87 A;  2PPN A;  4TW8 A;  2MLX A;  4AY1 A;  4WKF A;  3O5O A;  2DSV A;  3TDB A;  4TNS A;  3AS0 A;  3RFW A;  1E9L A;  5B8I C;  4IT4 A;  3PRB A;  1FKK A;  5DIV A;  3B8S A;  1Y0O A;  3IKG A;  5DIT A;  3UQB A;  4Z2I A;  1FKG A;  4NZC A;  2B5U B;  2M1I A;  4W5U A;  1HKK A;  3IKD A;  4MNM A;  5DEZ A;  1E6P A;  4QIB A;  1D7J A;  4ODP A;  2PN0 A;  1GPF A;  2ZQV A;  2FDM A;  3CHC A;  2ZR4 A;  5HW8 A;  3NI6 A;  4MGV A;  4DZ2 A;  4DRI A;  3O5Q A;  2RUR A;  3JYM A;  3CHF A;  3GPK A;  2XP8 A;  1QPF A;  2F21 A;  3ARS A;  1ZU8 A;  3UF8 A;  1HKI A;  2O92 A;  5HW6 A;  1LL6 A;  3LUO A;  1LG2 A;  4P8X A;  2D9F A;  3RM4 A;  2XPA A;  2XP7 A;  4NNR A;  3G6L A;  1J6Y A;  1Q1C A;  2OFN A;  3O5I A;  1FKS A;  5HUA A;  1SYT A;  4ZPT R;  1EHN A;  1JNE A;  1XHG A;  5DO2 A;  3ARP A;  3O5P A;  2MNT A;  3ART A;  1UR9 A;  1L1P A;  4LAY A;  2DSZ A;  3B9D A;  2ITK A;  4FN2 A;  4DWS D;  3TCZ A;  2EUL A;  4U84 A;  4IQC A;  3PR9 A;  2ZR5 A;  1UR8 A;  2XP5 A;  4JFK A;  1LL7 A;  2MF9 A;  1J4R A;  2LPV A;  3CZ8 A;  2A3A A;  3ARU A;  1ROU A;  3GU0 A;  1W1P A;  4P8W A;  3JXV A;  4LAV A;  4G2P A;  1FKJ A;  1NWU A;  2DT2 A;  3WD3 A;  4URI A;  5I98 A;  4DZ3 A;  2AWG A;  2AOS A;  1KT0 A;  4G50 A;  4Z2J A;  2ZQU A;  3KCE A;  1FFR A;  4DRH A;  4Z2L A;  1C9H A;  2ZR6 A;  3FY1 A;  1NMW A;  1R9H A;  3RGC A;  2DT0 A;  2KI3 A;  3WD1 A;  4DT4 A;  1ROT A;  1W9P A;  5HW7 A;  5GQB A;  3BXW A;  3KAF A;  1LQ0 A;  3UQI A;  1EQ3 A;  2WK2 A;  1ITX A;  4DRK A;  4NSB A;  1O6I A;  4DWS A;  4W9P A;  3B9E A;  4ODM A;  4WJX A;  2WM0 A;  5GPR A;  5GPG A;  2RUQ A;  1ZBW A;  3B9A A;  3JYJ A;  2RUD A;  3ODK A;  2PV3 A;  4DIP A;  4DWS B;  1W9V A;  1NMV A;  4TW7 A;  1ZBV A;  4LAX A;  3UQA A;  2KO7 A;  3KAH A;  3AS1 A;  1YW5 A;  1H0I A;  1N1A A;  1NWR A;  4ODO A;  3QOK A;  2IUZ A;  4DRQ A;  4DRN A;  1EYM A;  3KZ7 A;  2DT3 A;  4MPK A;  1E6Z A;  2DT1 A;  1ZL1 A;  1WB0 A;  4FAP A;  1E6R A;  5HWB A;  2ZQT A;  3CHE A;  2JZV A;  3WH0 A;  1X6N A;  1GRJ A;  4HBE A;  4QZV B;  4WIW A;  1NWS A;  2DSW A;  4ODR A;  4ZPV R;  3WD0 A;  5HBF A;  4Z2G A;  2PBC A;  1FKH A;  1FKI A;  3B7X A;  2FAP A;  1LL4 A;  3CGN A;  4UDM A;  2XP9 A;  2ZQS A;  1KFW A;  3WL0 A;  3WD4 A;  4W9Q A;  2A3C A;  3O5D A;  3KAB A;  1WNO A;  4J4N A;  3WKZ A;  4IT6 A;  4Z2K A;  3IK8 A;  1JNS A;  2PPO A;  1PBK A;  2KGJ A;  4DRO A;  4S3J A;  4P8U A;  3UI6 A;  1KT1 A;  5BXJ A;  4ML4 A;  2P4V A;  1E6N A;  1FKL A;  2YBU A;  4LGX A;  4U85 A;  1X6L A;  2ETN A;  2OLH A;  2L2S A;  1M5Y A;  3O5J A;  1FFQ A;  1ZK6 A;  3O5L A;  1FJD A;  1FKF A;  1NWT A;  3ARV A;  2Q5A A;  1ZBK A;  2MPH A;  4W9O A;  2O9O A;  4JFI A;  4KQZ A;  1W1T A;  1LJY A;  4L72 B;  3I6C A;  4ZPW R;  2KE0 A;  4DRJ A;  1EIB A;  4L3N A;  3O5K A;  3NRK A;  1BL4 A;  2RQS A;  1FKB A;  2WLZ A;  2PPP A;  1W9U A;  4DH0 A;  3ARY A;  1D2K A;  4PTM A;  4XAK A;  2B31 A;  2LJ4 A;  3WL1 A;  3ARW A;  2DPE A;  2WLY A;  3CHD A;  3TC5 A;  3AS2 A;  3EIP A;  1VF8 A;  4Z2H A;  1CTN A;  2ESC A;  1XRV A;  1B6C A;  3AS3 A;  3PRD A;  4Q22 A;  2RUC A;  1OGB A;  1J4I A;  4ODK A;  1D6O A;  2RSE A;  1FAP A;  3G6M A;  2MLY A;  2PV1 A;  4R0X A;  4BF8 A;  1TFV A;  1E15 A;  3ALG A;  1JND A;  3CGM A;  3UI5 A;  4MSP A;  3CH9 A;  1D7I A;  3H9R B;  2KR7 A;  4MTV A;  1Q6I A;  4P8V A;  4LAW A;  1SR0 A;  3PA7 A;  3KAI A;  4Q7N A;  4ODQ A;  2DG3 A;  4HAR A;  2K8I A;  4JFM A;  1NH6 A;  4TW6 A;  3ARO A;  1FKD A;  2XPB A;  1ZBC A;  4JFL A;  4O2T A;  2G8Z A;  2VCD A;  3BMB A;  4TX0 A;  4MAV A;  2UZ5 A;  3O5F A;  4ODN A;  3PRA A;  2DG9 A;  3FAP A;  1K9T A;  3NTP A;  5HT1 A;  4KR0 B;  3ARR A;  3O5G A;  4DRP A;  4QT2 A;  1FKT A;  3ARQ A;  4DWS C;  3WQV A;  3ARZ A;  4WK9 A;  3AQU A;  4S3K A;  3W4R A;  2MLZ A;  2FKE A;  1BKF A;  1WAW A;  2DG4 A;  4ZS6 A;  2M2A A;  1YAT A;  1OWQ A;  4QT3 A;  1GOI A;  5HTG A;  3ALF A;  3KAC A;  1HKJ A;  4WKH A;  5HKG A;  3WIJ A;  2XP4 A;  3RM9 A;  1Q6U A;  4MNL A;  3KAD A;  2A3E A;  2M08 A;  3EY6 A;  1HKM A;  2PV2 A;  3WQW A;  2XP3 A;  1P5Q A;  1JVW A;  1QPL A;  2F23 A;  4U86 A;  4WKA A;  3IHZ A;  3GTY X;  3RME A;  2VN1 A;  1F8A B;  1W1Y A;  1HJX A;  4IPX A;  1GUV A;  5DF0 A;  5DIU A;  3ARX A;  1RD6 A;  4ITZ A;  2PI6 A;  4ODL A;  1EDQ A;  3O5R A;  1ZCN A;  2F4E A;  4R5E A;  2F2D A;  3RM8 A;  4TYO A;  1J4H A;  1HJV A;  3UI4 A;  3O5M A;  4MNK A;  4J4O A;  4C02 B;  1JCH B;  3WD2 A;  1FKR A;  1Q6H A;  1LG1 A;  3KAG A;  1H0G A;  4JFJ A;  2A3B A;  3OA5 A;  2G41 A;  1W1V A;  1FD9 A;  4GGQ A;  3VAW A;  3FXY A;  1NSG A;  1U79 A;  5D75 A;  2IF4 A;  2KFW A;  4GIV A;  4HBO A;  1HXV A;  1A7X A;  1TCO C;  4N19 A;  1W26 A;  1OGG A;  2Y78 A;  1QZ2 A;  1D7H A;  4MNJ A;  5J6E A;  2DSU A;  1IX5 A;  2LKN A;  1JNT A;  3OOB A;  1ZB5 A;  2QF8 A; 
#chains in the Genus database with same CATH homology
 4JYS A;  1F40 A;  1PIN A;  4IQ2 A;  3O5E A;  3MDY B;  4DRM A;  2YBT A;  2XP6 A;  1HJW A;  5JH8 A;  2LGO A;  1T11 A;  5HWC A;  2N87 A;  2PPN A;  4TW8 A;  2MLX A;  4AY1 A;  4WKF A;  3O5O A;  2DSV A;  3TDB A;  4TNS A;  3AS0 A;  3RFW A;  1E9L A;  5B8I C;  4IT4 A;  3PRB A;  1FKK A;  5DIV A;  3B8S A;  1Y0O A;  3IKG A;  5DIT A;  3UQB A;  4Z2I A;  1FKG A;  4NZC A;  2M1I A;  4W5U A;  1HKK A;  3IKD A;  4MNM A;  5DEZ A;  1E6P A;  4QIB A;  1D7J A;  4ODP A;  1GPF A;  2ZQV A;  2FDM A;  3CHC A;  2ZR4 A;  5HW8 A;  3NI6 A;  4MGV A;  4DZ2 A;  4DRI A;  3O5Q A;  2RUR A;  3JYM A;  3CHF A;  3GPK A;  2XP8 A;  1QPF A;  2F21 A;  3ARS A;  1ZU8 A;  3UF8 A;  1HKI A;  2O92 A;  5HW6 A;  1LL6 A;  3LUO A;  1LG2 A;  4P8X A;  2D9F A;  3RM4 A;  2XPA A;  2XP7 A;  4NNR A;  3G6L A;  1J6Y A;  1Q1C A;  2OFN A;  3O5I A;  1FKS A;  5HUA A;  1SYT A;  4ZPT R;  1EHN A;  1JNE A;  1XHG A;  5DO2 A;  3ARP A;  3O5P A;  2MNT A;  3ART A;  1UR9 A;  1L1P A;  4LAY A;  2DSZ A;  3B9D A;  2ITK A;  4FN2 A;  4DWS D;  3TCZ A;  4U84 A;  4IQC A;  3PR9 A;  2ZR5 A;  1UR8 A;  2XP5 A;  4JFK A;  1LL7 A;  2MF9 A;  1J4R A;  2LPV A;  3CZ8 A;  2A3A A;  3ARU A;  1ROU A;  1W1P A;  4P8W A;  3JXV A;  4LAV A;  4G2P A;  1FKJ A;  1NWU A;  2DT2 A;  3WD3 A;  4URI A;  5I98 A;  4DZ3 A;  2AWG A;  2AOS A;  1KT0 A;  4G50 A;  4Z2J A;  2ZQU A;  3KCE A;  1FFR A;  4DRH A;  4Z2L A;  1C9H A;  2ZR6 A;  3FY1 A;  1NMW A;  1R9H A;  3RGC A;  2DT0 A;  2KI3 A;  3WD1 A;  4DT4 A;  1ROT A;  1W9P A;  5HW7 A;  5GQB A;  3BXW A;  3KAF A;  1LQ0 A;  3UQI A;  1EQ3 A;  2WK2 A;  1ITX A;  4DRK A;  4NSB A;  1O6I A;  4DWS A;  4W9P A;  3B9E A;  4ODM A;  4WJX A;  2WM0 A;  5GPR A;  5GPG A;  2RUQ A;  1ZBW A;  3B9A A;  3JYJ A;  2RUD A;  3ODK A;  2PV3 A;  4DIP A;  4DWS B;  1W9V A;  1NMV A;  4TW7 A;  1ZBV A;  4LAX A;  3UQA A;  2KO7 A;  3KAH A;  3AS1 A;  1YW5 A;  1H0I A;  1N1A A;  1NWR A;  4ODO A;  3QOK A;  2IUZ A;  4DRQ A;  4DRN A;  1EYM A;  3KZ7 A;  2DT3 A;  4MPK A;  1E6Z A;  2DT1 A;  1ZL1 A;  1WB0 A;  4FAP A;  1E6R A;  5HWB A;  2ZQT A;  3CHE A;  2JZV A;  3WH0 A;  1X6N A;  4HBE A;  4QZV B;  4WIW A;  1NWS A;  2DSW A;  4ODR A;  4ZPV R;  3WD0 A;  5HBF A;  4Z2G A;  2PBC A;  1FKH A;  1FKI A;  3B7X A;  2FAP A;  1LL4 A;  3CGN A;  2XP9 A;  2ZQS A;  1KFW A;  3WL0 A;  3WD4 A;  4W9Q A;  2A3C A;  3O5D A;  3KAB A;  1WNO A;  4J4N A;  3WKZ A;  4IT6 A;  4Z2K A;  3IK8 A;  1JNS A;  2PPO A;  1PBK A;  2KGJ A;  4DRO A;  4S3J A;  4P8U A;  3UI6 A;  1KT1 A;  5BXJ A;  4ML4 A;  1E6N A;  1FKL A;  2YBU A;  4LGX A;  4U85 A;  1X6L A;  2OLH A;  2L2S A;  1M5Y A;  3O5J A;  1FFQ A;  1ZK6 A;  3O5L A;  1FJD A;  1FKF A;  1NWT A;  3ARV A;  2Q5A A;  1ZBK A;  2MPH A;  4W9O A;  2O9O A;  4JFI A;  4KQZ A;  1W1T A;  1LJY A;  4L72 B;  3I6C A;  4ZPW R;  2KE0 A;  4DRJ A;  1EIB A;  4L3N A;  3O5K A;  3NRK A;  1BL4 A;  2RQS A;  1FKB A;  2WLZ A;  2PPP A;  1W9U A;  4DH0 A;  3ARY A;  1D2K A;  4PTM A;  4XAK A;  2B31 A;  2LJ4 A;  3WL1 A;  3ARW A;  2DPE A;  2WLY A;  3CHD A;  3TC5 A;  3AS2 A;  1VF8 A;  4Z2H A;  1CTN A;  2ESC A;  1XRV A;  1B6C A;  3AS3 A;  3PRD A;  4Q22 A;  2RUC A;  1OGB A;  1J4I A;  4ODK A;  1D6O A;  2RSE A;  1FAP A;  3G6M A;  2MLY A;  2PV1 A;  4R0X A;  4BF8 A;  1TFV A;  1E15 A;  3ALG A;  1JND A;  3CGM A;  3UI5 A;  4MSP A;  3CH9 A;  1D7I A;  3H9R B;  2KR7 A;  4MTV A;  1Q6I A;  4P8V A;  4LAW A;  1SR0 A;  3PA7 A;  3KAI A;  4Q7N A;  4ODQ A;  2DG3 A;  4HAR A;  2K8I A;  4JFM A;  1NH6 A;  4TW6 A;  3ARO A;  1FKD A;  2XPB A;  1ZBC A;  4JFL A;  4O2T A;  2G8Z A;  2VCD A;  4TX0 A;  4MAV A;  2UZ5 A;  3O5F A;  4ODN A;  3PRA A;  2DG9 A;  3FAP A;  1K9T A;  3NTP A;  5HT1 A;  4KR0 B;  3ARR A;  3O5G A;  4DRP A;  4QT2 A;  1FKT A;  3ARQ A;  4DWS C;  3WQV A;  3ARZ A;  4WK9 A;  3AQU A;  4S3K A;  3W4R A;  2MLZ A;  2FKE A;  1BKF A;  1WAW A;  2DG4 A;  4ZS6 A;  2M2A A;  1YAT A;  1OWQ A;  4QT3 A;  1GOI A;  5HTG A;  3ALF A;  3KAC A;  1HKJ A;  4WKH A;  5HKG A;  3WIJ A;  2XP4 A;  3RM9 A;  1Q6U A;  4MNL A;  3KAD A;  2A3E A;  2M08 A;  3EY6 A;  1HKM A;  2PV2 A;  3WQW A;  2XP3 A;  1P5Q A;  1JVW A;  1QPL A;  4U86 A;  4WKA A;  3IHZ A;  3RME A;  2VN1 A;  1F8A B;  1W1Y A;  1HJX A;  4IPX A;  1GUV A;  5DF0 A;  5DIU A;  3ARX A;  1RD6 A;  4ITZ A;  2PI6 A;  4ODL A;  1EDQ A;  3O5R A;  1ZCN A;  2F4E A;  4R5E A;  2F2D A;  3RM8 A;  4TYO A;  1J4H A;  1HJV A;  3UI4 A;  3O5M A;  4MNK A;  4J4O A;  4C02 B;  3WD2 A;  1FKR A;  1Q6H A;  1LG1 A;  3KAG A;  1H0G A;  4JFJ A;  2A3B A;  3OA5 A;  2G41 A;  1W1V A;  1FD9 A;  4GGQ A;  3VAW A;  3FXY A;  1NSG A;  1U79 A;  5D75 A;  2IF4 A;  2KFW A;  4GIV A;  4HBO A;  1HXV A;  1A7X A;  1TCO C;  4N19 A;  1W26 A;  1OGG A;  2Y78 A;  1QZ2 A;  1D7H A;  4MNJ A;  5J6E A;  2DSU A;  1IX5 A;  2LKN A;  1JNT A;  3OOB A;  1ZB5 A;  2QF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...