4G2PA

Crystal structure of peptidyl-prolyl cis-trans isomerase domain ii of molecular chaperone sura from salmonella enterica subsp. enterica serovar typhimurium str. 14028s
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
b'AISVTEVHARHILLKPSPIMNDQQARLKLEEIAADIKSGKTTFAAAAKEYSQDPGSANQGGDLGWATPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLDTRKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone SurA
publication title Crystal structure of peptidyl-prolyl cis-trans isomerase domain II of molecular chaperone SurA from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. 14028s
molecule tags Isomerase
total genus 29
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4g2pA00
1T11A 3IHZA 3O5GA 3O5DA 2KFWA 2RSEA 2KE0A 1D7JA 2ZQUA 3O5KA 4DRPA 3UQAA 2RUDA 4LAYA 4U85A 4W9QA 5HW8A 1NMVA 4ITZA 1Q1CA 4ODOA 5HW7A 3O5QA 4U84A 2DG9A 1J4RA 1FJDA 4DRNA 4GGQA 4JYSA 4QIBA 1JVWA 2ZQTA 1ZK6A 2F4EA 2ZQSA 4BF8A 1NSGA 1P5QA 3KADA 2DG3A 3O5OA 1FKGA 2KGJA 4FN2A 1D6OA 4DRHA 1FKHA 2K8IA 5DITA 3KACA 3PRDA 3TCZA 2VCDA 4DRKA 1BKFA 2ZR6A 4ODQA 4W9PA 4DH0A 1D7IA 2MPHA 3NTPA 2ITKA 2XP9A 4TYOA 2KO7A 1J4HA 2D9FA 3RGCA 4MGVA 4ODMA 3IKGA 4G50A 5BXJA 4U86A 3KAFA 4JFKA 5DIVA 3O5PA 4LAXA 3MDYB 5HT1A 1FKDA 1FKLA 3KAHA 1QPLA 2FAPA 4TW8A 5GPGA 3O5JA 3OOBA 4DZ2A 3KAGA 3O5IA 3TDBA 1KT1A 3O5MA 2AWGA 1HXVA 4W9OA 4DRIA 2ZQVA 4N19A 1FKTA 4LAWA 1NMWA 3UQIA 2XPAA 2XP8A 4IQCA 3WH0A 2OFNA 4J4NA 4TNSA 4FAPA 3UI5A 2XP7A 3H9RB 5HWBA 2N87A 3O5EA 1FKRA 3RFWA 1KT0A 4LAVA 3CGMA 4DT4A 2Y78A 4ODKA 4NNRA 2PPOA 4TX0A 5HKGA 2UZ5A 4J4OA 2M08A 4TW7A 2KI3A 3LUOA 1U79A 3O5FA 1C9HA 3TC5A 4C02B 4JFJA 2F21A 2XP3A 4ODLA 2MLXA 4O2TA 4DRQA 1EQ3A 3KABA 2PV1A 1W26A 2LPVA 1D7HA 1PBKA 2XP6A 2M1IA 2LKNA 4G2PA 2ZR4A 2PBCA 1FKSA 4ODNA 1JNTA 3VAWA 2MLYA 3B7XA 2RURA 2M2AA 4ODPA 2PV2A 2Q5AA 4R0XA 5HTGA 1L1PA 2XPBA 1F8AB 1FKIA 4DIPA 3UF8A 1FKJA 2VN1A 3JYJA 1YATA 5HUAA 3JXVA 1M5YA 3UI6A 5HWCA 4JFLA 4GIVA 1JNSA 3UI4A 2IF4A 1FD9A 1QPFA 1ZCNA 5D75A 3O5LA 1R9HA 4DZ3A 2MF9A 4IQ2A 4JFIA 1J4IA 3EY6A 1N1AA 1FKBA 2MNTA 4QT2A 2MLZA 1ROUA 2XP5A 4JFMA 3NRKA 1J6YA 3ODKA 1FKFA 2KR7A 3CGNA 4MSPA 2L2SA 3FAPA 1EYMA 2ZR5A 3GPKA 3O5RA 1A7XA 1FKKA 1Q6IA 5B8IC 3KAIA 2JZVA 4DRMA 1TCOC 4QT3A 1F40A 3NI6A 2PPNA 1FAPA 5J6EA 1Y0OA 2RQSA 2XP4A 3IK8A 1ROTA 1BL4A 4IPXA 4DRJA 5HW6A 2FKEA 2LGOA 5DIUA 5I98A 3PRBA 2DG4A 1YW5A 2F2DA 2RUCA 4TW6A 2PV3A 2LJ4A 3JYMA 3PA7A 3UQBA 3IKDA 1Q6UA 3KZ7A 1PINA 3KCEA 4ODRA 2PPPA 2RUQA 1QZ2A 3I6CA 1B6CA 4DROA 1Q6HA
chains in the Genus database with same CATH superfamily
2PI6A 3O5DA 1EHNA 1CTNA 1D7JA 3ARZA 4S3KA 4DRPA 3ARPA 5HW8A 1HKJA 4GGQA 4QIBA 1HKMA 1JVWA 1EIBA 3RMEA 2F4EA 2ZQSA 4BF8A 1P5QA 3O5OA 2KGJA 1W9PA 1D6OA 1ITXA 4DWSC 5DITA 2VCDA 1BKFA 4ODQA 3NTPA 2XP9A 3FY1A 1LL4A 4UDMA 2D9FA 1E6ZA 1HJXA 3MDYB 1FKLA 1QPLA 4TW8A 1NWTA 3O5IA 3O5MA 1HXVA 4W9OA 4MNJA 3UQIA 2XPAA 3WH0A 4FAPA 2O92A 5DO2A 3RFWA 3CGMA 3WD2A 3EIPA 1W1TA 2PPOA 1E15A 4S3JA 4Z2JA 2DPEA 3RM9A 4MNMA 4NSBA 3TC5A 4C02B 4JFJA 4DRQA 3ARUA 1EQ3A 3KABA 2LPVA 2LKNA 1FKSA 1HJWA 4R0XA 2M2AA 2PV2A 1L1PA 2XPBA 1E44A 1FKJA 4R5EA 1YATA 1M5YA 3UI6A 3CHFA 1FD9A 1ZCNA 5D75A 3ARTA 1OWQA 4JFIA 2DT2A 2MLZA 3CH9A 4JFMA 4DWSB 4L3NA 4MAVA 5DF0A 4Q7NA 2ZR5A 3GPKA 1FKKA 3ARXA 2OLHA 3RM8A 4IT4A 3NI6A 2PPNA 1W1PA 1Y0OA 4ZPVR 4IPXA 5I98A 3PRBA 1SYTA 4DWSD 3ALFA 2RUCA 5GQBA 3JYMA 3CHDA 4Z2HA 4NZCA 2YBTA 4IT6A 3WD1A 2A3AA 3O5GA 1NWRA 2KFWA 3BMBA 4WKAA 4U85A 5HW7A 2DG9A 1W1YA 2ETNA 1GPFA 1GUVA 2ZQTA 4WJXA 4P8XA 1FKGA 4ZS6A 4WKHA 4DRHA 1FKHA 3CHEA 4Z2KA 3PRDA 4DRKA 3WD4A 4DH0A 4W9PA 4MTVA 1D7IA 1HKIA 2KO7A 4ODMA 4U86A 4JFKA 4LAXA 5GPGA 2FAPA 3OOBA 3TDBA 1H0GA 1KT1A 2AWGA 2A3CA 2G8ZA 2IUZA 1FKTA 4LAWA 1W9VA 4TNSA 3UI5A 1W1VA 3H9RB 3O5EA 1JNEA 1FKRA 1KT0A 3RM4A 1LJYA 1WNOA 4J4OA 1K9TA 2KI3A 3O5FA 1U79A 1UR8A 2G41A 4O2TA 4ZPTR 3GU0A 1W26A 4Z2GA 1D7HA 1E6PA 2XP6A 2M1IA 3VAWA 4ZPWR 3B9AA 2Q5AA 5HTGA 1F8AB 3ARYA 4DIPA 3UF8A 2DSWA 2VN1A 3JYJA 2F23A 3JXVA 1VF8A 4L72B 4GIVA 1ZBWA 3ARVA 3UI4A 2IF4A 1W9UA 4DZ3A 2MF9A 4IQ2A 3OA5A 1ROUA 1J6YA 2KR7A 2L2SA 3FAPA 1EYMA 2WLZA 3O5RA 1H0IA 1TCOC 5J6EA 1HKKA 2A3BA 3IK8A 1JCHB 1BL4A 1ROTA 5HW6A 2LGOA 5DIUA 4KQZA 4TW6A 3WD3A 2PV3A 3PA7A 1Q6UA 1FAPA 3CHCA 4DROA 2FDMA 2RSEA 2KE0A 3O5KA 2ZQUA 3ARQA 3UQAA 2RUDA 4LAYA 4MNKA 4W9QA 1Q1CA 4U84A 1J4RA 1FJDA 3W4RA 1GRJA 1ZK6A 2O9OA 3AS2A 1NSGA 2DT3A 3GTYX 2DG3A 4FN2A 1E9LA 2ESCA 3AQUA 2QF8A 2K8IA 3KACA 3TCZA 2ZR6A 2ITKA 5DEZA 4Z2LA 1J4HA 3RGCA 3IKGA 4G50A 5BXJA 3B9EA 5DIVA 1NH6A 2WLYA 2PN0A 3KAGA 3QOKA 2A3EA 4HARA 4N19A 3G6LA 2XP8A 4IQCA 2OFNA 4J4NA 2DT0A 4MNLA 2XP7A 1NWSA 1HJVA 2DT1A 4DT4A 2DSUA 1WAWA 4NNRA 4ODKA 4TX0A 5HKGA 2P4VA 2UZ5A 4TW7A 1LL7A 4P8VA 1NWUA 3ARWA 2F21A 1XHGA 1D2KA 2PV1A 1UR9A 1O6IA 4Z2IA 4QZVB 2ZR4A 2PBCA 3AS3A 3FXYA 1IX5A 1X6LA 5HWCA 1JNSA 3WQWA 1FFQA 1QPFA 1R9HA 1JNDA 3G6MA 3EY6A 1N1AA 1KFWA 3BXWA 2XP5A 3NRKA 5GPRA 3ODKA 3CGNA 4MSPA 1RD6A 4ML4A 2B31A 1F40A 3CZ8A 4DRJA 1ZB5A 2FKEA 3ARRA 4P8WA 2DG4A 2F2DA 1TFVA 2B5UB 2LJ4A 4DWSA 4KR0B 4WKFA 3KZ7A 2YBUA 3ALGA 4PTMA 2RUQA 1E6RA 1QZ2A 1T11A 3IHZA 2WK2A 5JH8A 1NMVA 4ITZA 1EDQA 4ODOA 1ZBKA 3O5QA 1ZU8A 5HBFA 4WIWA 1WB0A 4W5UA 4DRNA 4JYSA 3B9DA 3AS0A 1ZL1A 3KADA 2MPHA 4TYOA 4MPKA 4MGVA 3KAFA 5HT1A 3O5PA 1FKDA 3KAHA 3O5JA 4DZ2A 1LG2A 4DRIA 2ZQVA 1NMWA 3PRAA 1ZBCA 1LG1A 5HWBA 2N87A 4LAVA 4AY1A 2Y78A 4Q22A 2M08A 3WKZA 3LUOA 1C9HA 1XRVA 2DSZA 1E6NA 4ODLA 2XP3A 2WM0A 2MLXA 4HBEA 1ZBVA 3WL1A 1PBKA 1X6NA 3AROA 4G2PA 4ODNA 1JNTA 3WD0A 2DSVA 2MLYA 2RURA 3B7XA 4ODPA 1FKIA 3B8SA 5HUAA 4HBOA 4JFLA 1SR0A 3O5LA 1J4IA 1FKBA 2MNTA 4QT2A 3PR9A 1FKFA 3ARSA 5B8IC 1A7XA 1OGBA 1Q6IA 4URIA 4LGXA 3KAIA 2JZVA 4DRMA 3WL0A 4QT3A 1OGGA 4P8UA 1LQ0A 4WK9A 2XP4A 2RQSA 2EULA 3AS1A 1LL6A 1GOIA 1YW5A 3WIJA 1FFRA 3WQVA 4XAKA 3UQBA 3IKDA 2AOSA 4ODRA 1PINA 3KCEA 2PPPA 3I6CA 1B6CA 1Q6HA
chains in the Genus database with same CATH topology
2PI6A 3O5DA 1EHNA 1CTNA 1D7JA 3ARZA 4S3KA 4DRPA 3ARPA 5HW8A 1HKJA 4GGQA 4QIBA 1HKMA 1JVWA 1EIBA 3RMEA 2F4EA 2ZQSA 4BF8A 1P5QA 3O5OA 2KGJA 1W9PA 1D6OA 1ITXA 4DWSC 5DITA 2VCDA 1BKFA 4ODQA 3NTPA 2XP9A 3FY1A 1LL4A 2D9FA 1E6ZA 1HJXA 3MDYB 1FKLA 1QPLA 4TW8A 1NWTA 3O5IA 3O5MA 1HXVA 4W9OA 4MNJA 3UQIA 2XPAA 3WH0A 4FAPA 2O92A 5DO2A 3RFWA 3CGMA 3WD2A 1W1TA 2PPOA 1E15A 4S3JA 4Z2JA 2DPEA 3RM9A 4MNMA 4NSBA 3TC5A 4C02B 4JFJA 4DRQA 3ARUA 1EQ3A 3KABA 2LPVA 2LKNA 1FKSA 1HJWA 4R0XA 2M2AA 2PV2A 1L1PA 2XPBA 1FKJA 4R5EA 1YATA 1M5YA 3UI6A 3CHFA 1FD9A 1ZCNA 5D75A 3ARTA 1OWQA 4JFIA 2DT2A 2MLZA 3CH9A 4JFMA 4DWSB 4L3NA 4MAVA 5DF0A 4Q7NA 2ZR5A 3GPKA 1FKKA 3ARXA 2OLHA 3RM8A 4IT4A 3NI6A 2PPNA 1W1PA 1Y0OA 4ZPVR 4IPXA 5I98A 3PRBA 1SYTA 4DWSD 3ALFA 2RUCA 5GQBA 3JYMA 3CHDA 4Z2HA 4NZCA 2YBTA 4IT6A 3WD1A 2A3AA 3O5GA 1NWRA 2KFWA 4WKAA 4U85A 5HW7A 2DG9A 1W1YA 1GPFA 1GUVA 2ZQTA 4WJXA 4P8XA 1FKGA 4ZS6A 4WKHA 4DRHA 1FKHA 3CHEA 4Z2KA 3PRDA 4DRKA 3WD4A 4DH0A 4W9PA 4MTVA 1D7IA 1HKIA 2KO7A 4ODMA 4U86A 4JFKA 4LAXA 5GPGA 2FAPA 3OOBA 3TDBA 1H0GA 1KT1A 2AWGA 2A3CA 2G8ZA 2IUZA 1FKTA 4LAWA 1W9VA 4TNSA 3UI5A 1W1VA 3H9RB 3O5EA 1JNEA 1FKRA 1KT0A 3RM4A 1LJYA 1WNOA 4J4OA 1K9TA 2KI3A 3O5FA 1U79A 1UR8A 2G41A 4O2TA 4ZPTR 1W26A 4Z2GA 1D7HA 1E6PA 2XP6A 2M1IA 3VAWA 4ZPWR 3B9AA 2Q5AA 5HTGA 1F8AB 3ARYA 4DIPA 3UF8A 2DSWA 2VN1A 3JYJA 3JXVA 1VF8A 4L72B 4GIVA 1ZBWA 3ARVA 3UI4A 2IF4A 1W9UA 4DZ3A 2MF9A 4IQ2A 3OA5A 1ROUA 1J6YA 2KR7A 2L2SA 3FAPA 1EYMA 2WLZA 3O5RA 1H0IA 1TCOC 5J6EA 1HKKA 2A3BA 3IK8A 1ROTA 1BL4A 5HW6A 2LGOA 5DIUA 4KQZA 4TW6A 3WD3A 2PV3A 3PA7A 1Q6UA 1FAPA 3CHCA 4DROA 2FDMA 2RSEA 2KE0A 3O5KA 2ZQUA 3ARQA 3UQAA 2RUDA 4LAYA 4MNKA 4W9QA 1Q1CA 4U84A 1J4RA 1FJDA 3W4RA 1ZK6A 2O9OA 3AS2A 1NSGA 2DT3A 2DG3A 4FN2A 1E9LA 2ESCA 3AQUA 2QF8A 2K8IA 3KACA 3TCZA 2ZR6A 2ITKA 5DEZA 4Z2LA 1J4HA 3RGCA 3IKGA 4G50A 5BXJA 3B9EA 5DIVA 1NH6A 2WLYA 3KAGA 3QOKA 2A3EA 4HARA 4N19A 3G6LA 2XP8A 4IQCA 2OFNA 4J4NA 2DT0A 4MNLA 2XP7A 1NWSA 1HJVA 2DT1A 4DT4A 2DSUA 1WAWA 4NNRA 4ODKA 4TX0A 5HKGA 2UZ5A 4TW7A 1LL7A 4P8VA 1NWUA 3ARWA 2F21A 1XHGA 1D2KA 2PV1A 1UR9A 1O6IA 4Z2IA 4QZVB 2ZR4A 2PBCA 3AS3A 3FXYA 1IX5A 1X6LA 5HWCA 1JNSA 3WQWA 1FFQA 1QPFA 1R9HA 1JNDA 3G6MA 3EY6A 1N1AA 1KFWA 3BXWA 2XP5A 3NRKA 5GPRA 3ODKA 3CGNA 4MSPA 1RD6A 4ML4A 2B31A 1F40A 3CZ8A 4DRJA 1ZB5A 2FKEA 3ARRA 4P8WA 2DG4A 2F2DA 1TFVA 2LJ4A 4DWSA 4KR0B 4WKFA 3KZ7A 2YBUA 3ALGA 4PTMA 2RUQA 1E6RA 1QZ2A 1T11A 3IHZA 2WK2A 5JH8A 1NMVA 4ITZA 1EDQA 4ODOA 1ZBKA 3O5QA 1ZU8A 5HBFA 4WIWA 1WB0A 4W5UA 4DRNA 4JYSA 3B9DA 3AS0A 1ZL1A 3KADA 2MPHA 4TYOA 4MPKA 4MGVA 3KAFA 5HT1A 3O5PA 1FKDA 3KAHA 3O5JA 4DZ2A 1LG2A 4DRIA 2ZQVA 1NMWA 3PRAA 1ZBCA 1LG1A 5HWBA 2N87A 4LAVA 4AY1A 2Y78A 4Q22A 2M08A 3WKZA 3LUOA 1C9HA 1XRVA 2DSZA 1E6NA 4ODLA 2XP3A 2WM0A 2MLXA 4HBEA 1ZBVA 3WL1A 1PBKA 1X6NA 3AROA 4G2PA 4ODNA 1JNTA 3WD0A 2DSVA 2MLYA 2RURA 3B7XA 4ODPA 1FKIA 3B8SA 5HUAA 4HBOA 4JFLA 1SR0A 3O5LA 1J4IA 1FKBA 2MNTA 4QT2A 3PR9A 1FKFA 3ARSA 5B8IC 1A7XA 1OGBA 1Q6IA 4URIA 4LGXA 3KAIA 2JZVA 4DRMA 3WL0A 4QT3A 1OGGA 4P8UA 1LQ0A 4WK9A 2XP4A 2RQSA 3AS1A 1LL6A 1GOIA 1YW5A 3WIJA 1FFRA 3WQVA 4XAKA 3UQBA 3IKDA 2AOSA 4ODRA 1PINA 3KCEA 2PPPA 3I6CA 1B6CA 1Q6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T11 A;  3IHZ A;  3O5G A;  3O5D A;  2KFW A;  2RSE A;  2KE0 A;  1D7J A;  2ZQU A;  3O5K A;  4DRP A;  3UQA A;  2RUD A;  4LAY A;  4U85 A;  4W9Q A;  5HW8 A;  1NMV A;  4ITZ A;  1Q1C A;  4ODO A;  5HW7 A;  3O5Q A;  4U84 A;  2DG9 A;  1J4R A;  1FJD A;  4DRN A;  4GGQ A;  4JYS A;  4QIB A;  1JVW A;  2ZQT A;  1ZK6 A;  2F4E A;  2ZQS A;  4BF8 A;  1NSG A;  1P5Q A;  3KAD A;  2DG3 A;  3O5O A;  1FKG A;  2KGJ A;  4FN2 A;  1D6O A;  4DRH A;  1FKH A;  2K8I A;  5DIT A;  3KAC A;  3PRD A;  3TCZ A;  2VCD A;  4DRK A;  1BKF A;  2ZR6 A;  4ODQ A;  4W9P A;  4DH0 A;  1D7I A;  2MPH A;  3NTP A;  2ITK A;  2XP9 A;  4TYO A;  2KO7 A;  1J4H A;  2D9F A;  3RGC A;  4MGV A;  4ODM A;  3IKG A;  4G50 A;  5BXJ A;  4U86 A;  3KAF A;  4JFK A;  5DIV A;  3O5P A;  4LAX A;  3MDY B;  5HT1 A;  1FKD A;  1FKL A;  3KAH A;  1QPL A;  2FAP A;  4TW8 A;  5GPG A;  3O5J A;  3OOB A;  4DZ2 A;  3KAG A;  3O5I A;  3TDB A;  1KT1 A;  3O5M A;  2AWG A;  1HXV A;  4W9O A;  4DRI A;  2ZQV A;  4N19 A;  1FKT A;  4LAW A;  1NMW A;  3UQI A;  2XPA A;  2XP8 A;  4IQC A;  3WH0 A;  2OFN A;  4J4N A;  4TNS A;  4FAP A;  3UI5 A;  2XP7 A;  3H9R B;  5HWB A;  2N87 A;  3O5E A;  1FKR A;  3RFW A;  1KT0 A;  4LAV A;  3CGM A;  4DT4 A;  2Y78 A;  4ODK A;  4NNR A;  2PPO A;  4TX0 A;  5HKG A;  2UZ5 A;  4J4O A;  2M08 A;  4TW7 A;  2KI3 A;  3LUO A;  1U79 A;  3O5F A;  1C9H A;  3TC5 A;  4C02 B;  4JFJ A;  2F21 A;  2XP3 A;  4ODL A;  2MLX A;  4O2T A;  4DRQ A;  1EQ3 A;  3KAB A;  2PV1 A;  1W26 A;  2LPV A;  1D7H A;  1PBK A;  2XP6 A;  2M1I A;  2LKN A;  4G2P A;  2ZR4 A;  2PBC A;  1FKS A;  4ODN A;  1JNT A;  3VAW A;  2MLY A;  3B7X A;  2RUR A;  2M2A A;  4ODP A;  2PV2 A;  2Q5A A;  4R0X A;  5HTG A;  1L1P A;  2XPB A;  1F8A B;  1FKI A;  4DIP A;  3UF8 A;  1FKJ A;  2VN1 A;  3JYJ A;  1YAT A;  5HUA A;  3JXV A;  1M5Y A;  3UI6 A;  5HWC A;  4JFL A;  4GIV A;  1JNS A;  3UI4 A;  2IF4 A;  1FD9 A;  1QPF A;  1ZCN A;  5D75 A;  3O5L A;  1R9H A;  4DZ3 A;  2MF9 A;  4IQ2 A;  4JFI A;  1J4I A;  3EY6 A;  1N1A A;  1FKB A;  2MNT A;  4QT2 A;  2MLZ A;  1ROU A;  2XP5 A;  4JFM A;  3NRK A;  1J6Y A;  3ODK A;  1FKF A;  2KR7 A;  3CGN A;  4MSP A;  2L2S A;  3FAP A;  1EYM A;  2ZR5 A;  3GPK A;  3O5R A;  1A7X A;  1FKK A;  1Q6I A;  5B8I C;  3KAI A;  2JZV A;  4DRM A;  1TCO C;  4QT3 A;  1F40 A;  3NI6 A;  2PPN A;  1FAP A;  5J6E A;  1Y0O A;  2RQS A;  2XP4 A;  3IK8 A;  1ROT A;  1BL4 A;  4IPX A;  4DRJ A;  5HW6 A;  2FKE A;  2LGO A;  5DIU A;  5I98 A;  3PRB A;  2DG4 A;  1YW5 A;  2F2D A;  2RUC A;  4TW6 A;  2PV3 A;  2LJ4 A;  3JYM A;  3PA7 A;  3UQB A;  3IKD A;  1Q6U A;  3KZ7 A;  1PIN A;  3KCE A;  4ODR A;  2PPP A;  2RUQ A;  1QZ2 A;  3I6C A;  1B6C A;  4DRO A;  1Q6H A; 
#chains in the Genus database with same CATH topology
 2PI6 A;  3O5D A;  1EHN A;  1CTN A;  1D7J A;  3ARZ A;  4S3K A;  4DRP A;  3ARP A;  5HW8 A;  1HKJ A;  4GGQ A;  4QIB A;  1HKM A;  1JVW A;  1EIB A;  3RME A;  2F4E A;  2ZQS A;  4BF8 A;  1P5Q A;  3O5O A;  2KGJ A;  1W9P A;  1D6O A;  1ITX A;  4DWS C;  5DIT A;  2VCD A;  1BKF A;  4ODQ A;  3NTP A;  2XP9 A;  3FY1 A;  1LL4 A;  4UDM A;  2D9F A;  1E6Z A;  1HJX A;  3MDY B;  1FKL A;  1QPL A;  4TW8 A;  1NWT A;  3O5I A;  3O5M A;  1HXV A;  4W9O A;  4MNJ A;  3UQI A;  2XPA A;  3WH0 A;  4FAP A;  2O92 A;  5DO2 A;  3RFW A;  3CGM A;  3WD2 A;  3EIP A;  1W1T A;  2PPO A;  1E15 A;  4S3J A;  4Z2J A;  2DPE A;  3RM9 A;  4MNM A;  4NSB A;  3TC5 A;  4C02 B;  4JFJ A;  4DRQ A;  3ARU A;  1EQ3 A;  3KAB A;  2LPV A;  2LKN A;  1FKS A;  1HJW A;  4R0X A;  2M2A A;  2PV2 A;  1L1P A;  2XPB A;  1E44 A;  1FKJ A;  4R5E A;  1YAT A;  1M5Y A;  3UI6 A;  3CHF A;  1FD9 A;  1ZCN A;  5D75 A;  3ART A;  1OWQ A;  4JFI A;  2DT2 A;  2MLZ A;  3CH9 A;  4JFM A;  4DWS B;  4L3N A;  4MAV A;  5DF0 A;  4Q7N A;  2ZR5 A;  3GPK A;  1FKK A;  3ARX A;  2OLH A;  3RM8 A;  4IT4 A;  3NI6 A;  2PPN A;  1W1P A;  1Y0O A;  4ZPV R;  4IPX A;  5I98 A;  3PRB A;  1SYT A;  4DWS D;  3ALF A;  2RUC A;  5GQB A;  3JYM A;  3CHD A;  4Z2H A;  4NZC A;  2YBT A;  4IT6 A;  3WD1 A;  2A3A A;  3O5G A;  1NWR A;  2KFW A;  3BMB A;  4WKA A;  4U85 A;  5HW7 A;  2DG9 A;  1W1Y A;  2ETN A;  1GPF A;  1GUV A;  2ZQT A;  4WJX A;  4P8X A;  1FKG A;  4ZS6 A;  4WKH A;  4DRH A;  1FKH A;  3CHE A;  4Z2K A;  3PRD A;  4DRK A;  3WD4 A;  4DH0 A;  4W9P A;  4MTV A;  1D7I A;  1HKI A;  2KO7 A;  4ODM A;  4U86 A;  4JFK A;  4LAX A;  5GPG A;  2FAP A;  3OOB A;  3TDB A;  1H0G A;  1KT1 A;  2AWG A;  2A3C A;  2G8Z A;  2IUZ A;  1FKT A;  4LAW A;  1W9V A;  4TNS A;  3UI5 A;  1W1V A;  3H9R B;  3O5E A;  1JNE A;  1FKR A;  1KT0 A;  3RM4 A;  1LJY A;  1WNO A;  4J4O A;  1K9T A;  2KI3 A;  3O5F A;  1U79 A;  1UR8 A;  2G41 A;  4O2T A;  4ZPT R;  3GU0 A;  1W26 A;  4Z2G A;  1D7H A;  1E6P A;  2XP6 A;  2M1I A;  3VAW A;  4ZPW R;  3B9A A;  2Q5A A;  5HTG A;  1F8A B;  3ARY A;  4DIP A;  3UF8 A;  2DSW A;  2VN1 A;  3JYJ A;  2F23 A;  3JXV A;  1VF8 A;  4L72 B;  4GIV A;  1ZBW A;  3ARV A;  3UI4 A;  2IF4 A;  1W9U A;  4DZ3 A;  2MF9 A;  4IQ2 A;  3OA5 A;  1ROU A;  1J6Y A;  2KR7 A;  2L2S A;  3FAP A;  1EYM A;  2WLZ A;  3O5R A;  1H0I A;  1TCO C;  5J6E A;  1HKK A;  2A3B A;  3IK8 A;  1JCH B;  1BL4 A;  1ROT A;  5HW6 A;  2LGO A;  5DIU A;  4KQZ A;  4TW6 A;  3WD3 A;  2PV3 A;  3PA7 A;  1Q6U A;  1FAP A;  3CHC A;  4DRO A;  2FDM A;  2RSE A;  2KE0 A;  3O5K A;  2ZQU A;  3ARQ A;  3UQA A;  2RUD A;  4LAY A;  4MNK A;  4W9Q A;  1Q1C A;  4U84 A;  1J4R A;  1FJD A;  3W4R A;  1GRJ A;  1ZK6 A;  2O9O A;  3AS2 A;  1NSG A;  2DT3 A;  3GTY X;  2DG3 A;  4FN2 A;  1E9L A;  2ESC A;  3AQU A;  2QF8 A;  2K8I A;  3KAC A;  3TCZ A;  2ZR6 A;  2ITK A;  5DEZ A;  4Z2L A;  1J4H A;  3RGC A;  3IKG A;  4G50 A;  5BXJ A;  3B9E A;  5DIV A;  1NH6 A;  2WLY A;  2PN0 A;  3KAG A;  3QOK A;  2A3E A;  4HAR A;  4N19 A;  3G6L A;  2XP8 A;  4IQC A;  2OFN A;  4J4N A;  2DT0 A;  4MNL A;  2XP7 A;  1NWS A;  1HJV A;  2DT1 A;  4DT4 A;  2DSU A;  1WAW A;  4NNR A;  4ODK A;  4TX0 A;  5HKG A;  2P4V A;  2UZ5 A;  4TW7 A;  1LL7 A;  4P8V A;  1NWU A;  3ARW A;  2F21 A;  1XHG A;  1D2K A;  2PV1 A;  1UR9 A;  1O6I A;  4Z2I A;  4QZV B;  2ZR4 A;  2PBC A;  3AS3 A;  3FXY A;  1IX5 A;  1X6L A;  5HWC A;  1JNS A;  3WQW A;  1FFQ A;  1QPF A;  1R9H A;  1JND A;  3G6M A;  3EY6 A;  1N1A A;  1KFW A;  3BXW A;  2XP5 A;  3NRK A;  5GPR A;  3ODK A;  3CGN A;  4MSP A;  1RD6 A;  4ML4 A;  2B31 A;  1F40 A;  3CZ8 A;  4DRJ A;  1ZB5 A;  2FKE A;  3ARR A;  4P8W A;  2DG4 A;  2F2D A;  1TFV A;  2B5U B;  2LJ4 A;  4DWS A;  4KR0 B;  4WKF A;  3KZ7 A;  2YBU A;  3ALG A;  4PTM A;  2RUQ A;  1E6R A;  1QZ2 A;  1T11 A;  3IHZ A;  2WK2 A;  5JH8 A;  1NMV A;  4ITZ A;  1EDQ A;  4ODO A;  1ZBK A;  3O5Q A;  1ZU8 A;  5HBF A;  4WIW A;  1WB0 A;  4W5U A;  4DRN A;  4JYS A;  3B9D A;  3AS0 A;  1ZL1 A;  3KAD A;  2MPH A;  4TYO A;  4MPK A;  4MGV A;  3KAF A;  5HT1 A;  3O5P A;  1FKD A;  3KAH A;  3O5J A;  4DZ2 A;  1LG2 A;  4DRI A;  2ZQV A;  1NMW A;  3PRA A;  1ZBC A;  1LG1 A;  5HWB A;  2N87 A;  4LAV A;  4AY1 A;  2Y78 A;  4Q22 A;  2M08 A;  3WKZ A;  3LUO A;  1C9H A;  1XRV A;  2DSZ A;  1E6N A;  4ODL A;  2XP3 A;  2WM0 A;  2MLX A;  4HBE A;  1ZBV A;  3WL1 A;  1PBK A;  1X6N A;  3ARO A;  4G2P A;  4ODN A;  1JNT A;  3WD0 A;  2DSV A;  2MLY A;  2RUR A;  3B7X A;  4ODP A;  1FKI A;  3B8S A;  5HUA A;  4HBO A;  4JFL A;  1SR0 A;  3O5L A;  1J4I A;  1FKB A;  2MNT A;  4QT2 A;  3PR9 A;  1FKF A;  3ARS A;  5B8I C;  1A7X A;  1OGB A;  1Q6I A;  4URI A;  4LGX A;  3KAI A;  2JZV A;  4DRM A;  3WL0 A;  4QT3 A;  1OGG A;  4P8U A;  1LQ0 A;  4WK9 A;  2XP4 A;  2RQS A;  2EUL A;  3AS1 A;  1LL6 A;  1GOI A;  1YW5 A;  3WIJ A;  1FFR A;  3WQV A;  4XAK A;  3UQB A;  3IKD A;  2AOS A;  4ODR A;  1PIN A;  3KCE A;  2PPP A;  3I6C A;  1B6C A;  1Q6H A; 
#chains in the Genus database with same CATH homology
 2PI6 A;  3O5D A;  1EHN A;  1CTN A;  1D7J A;  3ARZ A;  4S3K A;  4DRP A;  3ARP A;  5HW8 A;  1HKJ A;  4GGQ A;  4QIB A;  1HKM A;  1JVW A;  1EIB A;  3RME A;  2F4E A;  2ZQS A;  4BF8 A;  1P5Q A;  3O5O A;  2KGJ A;  1W9P A;  1D6O A;  1ITX A;  4DWS C;  5DIT A;  2VCD A;  1BKF A;  4ODQ A;  3NTP A;  2XP9 A;  3FY1 A;  1LL4 A;  2D9F A;  1E6Z A;  1HJX A;  3MDY B;  1FKL A;  1QPL A;  4TW8 A;  1NWT A;  3O5I A;  3O5M A;  1HXV A;  4W9O A;  4MNJ A;  3UQI A;  2XPA A;  3WH0 A;  4FAP A;  2O92 A;  5DO2 A;  3RFW A;  3CGM A;  3WD2 A;  1W1T A;  2PPO A;  1E15 A;  4S3J A;  4Z2J A;  2DPE A;  3RM9 A;  4MNM A;  4NSB A;  3TC5 A;  4C02 B;  4JFJ A;  4DRQ A;  3ARU A;  1EQ3 A;  3KAB A;  2LPV A;  2LKN A;  1FKS A;  1HJW A;  4R0X A;  2M2A A;  2PV2 A;  1L1P A;  2XPB A;  1FKJ A;  4R5E A;  1YAT A;  1M5Y A;  3UI6 A;  3CHF A;  1FD9 A;  1ZCN A;  5D75 A;  3ART A;  1OWQ A;  4JFI A;  2DT2 A;  2MLZ A;  3CH9 A;  4JFM A;  4DWS B;  4L3N A;  4MAV A;  5DF0 A;  4Q7N A;  2ZR5 A;  3GPK A;  1FKK A;  3ARX A;  2OLH A;  3RM8 A;  4IT4 A;  3NI6 A;  2PPN A;  1W1P A;  1Y0O A;  4ZPV R;  4IPX A;  5I98 A;  3PRB A;  1SYT A;  4DWS D;  3ALF A;  2RUC A;  5GQB A;  3JYM A;  3CHD A;  4Z2H A;  4NZC A;  2YBT A;  4IT6 A;  3WD1 A;  2A3A A;  3O5G A;  1NWR A;  2KFW A;  4WKA A;  4U85 A;  5HW7 A;  2DG9 A;  1W1Y A;  1GPF A;  1GUV A;  2ZQT A;  4WJX A;  4P8X A;  1FKG A;  4ZS6 A;  4WKH A;  4DRH A;  1FKH A;  3CHE A;  4Z2K A;  3PRD A;  4DRK A;  3WD4 A;  4DH0 A;  4W9P A;  4MTV A;  1D7I A;  1HKI A;  2KO7 A;  4ODM A;  4U86 A;  4JFK A;  4LAX A;  5GPG A;  2FAP A;  3OOB A;  3TDB A;  1H0G A;  1KT1 A;  2AWG A;  2A3C A;  2G8Z A;  2IUZ A;  1FKT A;  4LAW A;  1W9V A;  4TNS A;  3UI5 A;  1W1V A;  3H9R B;  3O5E A;  1JNE A;  1FKR A;  1KT0 A;  3RM4 A;  1LJY A;  1WNO A;  4J4O A;  1K9T A;  2KI3 A;  3O5F A;  1U79 A;  1UR8 A;  2G41 A;  4O2T A;  4ZPT R;  1W26 A;  4Z2G A;  1D7H A;  1E6P A;  2XP6 A;  2M1I A;  3VAW A;  4ZPW R;  3B9A A;  2Q5A A;  5HTG A;  1F8A B;  3ARY A;  4DIP A;  3UF8 A;  2DSW A;  2VN1 A;  3JYJ A;  3JXV A;  1VF8 A;  4L72 B;  4GIV A;  1ZBW A;  3ARV A;  3UI4 A;  2IF4 A;  1W9U A;  4DZ3 A;  2MF9 A;  4IQ2 A;  3OA5 A;  1ROU A;  1J6Y A;  2KR7 A;  2L2S A;  3FAP A;  1EYM A;  2WLZ A;  3O5R A;  1H0I A;  1TCO C;  5J6E A;  1HKK A;  2A3B A;  3IK8 A;  1ROT A;  1BL4 A;  5HW6 A;  2LGO A;  5DIU A;  4KQZ A;  4TW6 A;  3WD3 A;  2PV3 A;  3PA7 A;  1Q6U A;  1FAP A;  3CHC A;  4DRO A;  2FDM A;  2RSE A;  2KE0 A;  3O5K A;  2ZQU A;  3ARQ A;  3UQA A;  2RUD A;  4LAY A;  4MNK A;  4W9Q A;  1Q1C A;  4U84 A;  1J4R A;  1FJD A;  3W4R A;  1ZK6 A;  2O9O A;  3AS2 A;  1NSG A;  2DT3 A;  2DG3 A;  4FN2 A;  1E9L A;  2ESC A;  3AQU A;  2QF8 A;  2K8I A;  3KAC A;  3TCZ A;  2ZR6 A;  2ITK A;  5DEZ A;  4Z2L A;  1J4H A;  3RGC A;  3IKG A;  4G50 A;  5BXJ A;  3B9E A;  5DIV A;  1NH6 A;  2WLY A;  3KAG A;  3QOK A;  2A3E A;  4HAR A;  4N19 A;  3G6L A;  2XP8 A;  4IQC A;  2OFN A;  4J4N A;  2DT0 A;  4MNL A;  2XP7 A;  1NWS A;  1HJV A;  2DT1 A;  4DT4 A;  2DSU A;  1WAW A;  4NNR A;  4ODK A;  4TX0 A;  5HKG A;  2UZ5 A;  4TW7 A;  1LL7 A;  4P8V A;  1NWU A;  3ARW A;  2F21 A;  1XHG A;  1D2K A;  2PV1 A;  1UR9 A;  1O6I A;  4Z2I A;  4QZV B;  2ZR4 A;  2PBC A;  3AS3 A;  3FXY A;  1IX5 A;  1X6L A;  5HWC A;  1JNS A;  3WQW A;  1FFQ A;  1QPF A;  1R9H A;  1JND A;  3G6M A;  3EY6 A;  1N1A A;  1KFW A;  3BXW A;  2XP5 A;  3NRK A;  5GPR A;  3ODK A;  3CGN A;  4MSP A;  1RD6 A;  4ML4 A;  2B31 A;  1F40 A;  3CZ8 A;  4DRJ A;  1ZB5 A;  2FKE A;  3ARR A;  4P8W A;  2DG4 A;  2F2D A;  1TFV A;  2LJ4 A;  4DWS A;  4KR0 B;  4WKF A;  3KZ7 A;  2YBU A;  3ALG A;  4PTM A;  2RUQ A;  1E6R A;  1QZ2 A;  1T11 A;  3IHZ A;  2WK2 A;  5JH8 A;  1NMV A;  4ITZ A;  1EDQ A;  4ODO A;  1ZBK A;  3O5Q A;  1ZU8 A;  5HBF A;  4WIW A;  1WB0 A;  4W5U A;  4DRN A;  4JYS A;  3B9D A;  3AS0 A;  1ZL1 A;  3KAD A;  2MPH A;  4TYO A;  4MPK A;  4MGV A;  3KAF A;  5HT1 A;  3O5P A;  1FKD A;  3KAH A;  3O5J A;  4DZ2 A;  1LG2 A;  4DRI A;  2ZQV A;  1NMW A;  3PRA A;  1ZBC A;  1LG1 A;  5HWB A;  2N87 A;  4LAV A;  4AY1 A;  2Y78 A;  4Q22 A;  2M08 A;  3WKZ A;  3LUO A;  1C9H A;  1XRV A;  2DSZ A;  1E6N A;  4ODL A;  2XP3 A;  2WM0 A;  2MLX A;  4HBE A;  1ZBV A;  3WL1 A;  1PBK A;  1X6N A;  3ARO A;  4G2P A;  4ODN A;  1JNT A;  3WD0 A;  2DSV A;  2MLY A;  2RUR A;  3B7X A;  4ODP A;  1FKI A;  3B8S A;  5HUA A;  4HBO A;  4JFL A;  1SR0 A;  3O5L A;  1J4I A;  1FKB A;  2MNT A;  4QT2 A;  3PR9 A;  1FKF A;  3ARS A;  5B8I C;  1A7X A;  1OGB A;  1Q6I A;  4URI A;  4LGX A;  3KAI A;  2JZV A;  4DRM A;  3WL0 A;  4QT3 A;  1OGG A;  4P8U A;  1LQ0 A;  4WK9 A;  2XP4 A;  2RQS A;  3AS1 A;  1LL6 A;  1GOI A;  1YW5 A;  3WIJ A;  1FFR A;  3WQV A;  4XAK A;  3UQB A;  3IKD A;  2AOS A;  4ODR A;  1PIN A;  3KCE A;  2PPP A;  3I6C A;  1B6C A;  1Q6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...