4G2PA

Crystal structure of peptidyl-prolyl cis-trans isomerase domain ii of molecular chaperone sura from salmonella enterica subsp. enterica serovar typhimurium str. 14028s
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
AISVTEVHARHILLKPSPIMNDQQARLKLEEIAADIKSGKTTFAAAAKEYSQDPGSANQGGDLGWATPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLDTRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of peptidyl-prolyl cis-trans isomerase domain II of molecular chaperone SurA from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. 14028s
molecule tags Isomerase
molecule keywords Chaperone SurA
total genus 29
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4g2pA00
4TX0A 4DZ3A 2MNTA 4U84A 4JFKA 2M2AA 3H9RB 1F40A 5HW7A 1NSGA 1PBKA 3UI6A 1NMVA 2FKEA 4ODQA 3NTPA 4JFMA 3O5KA 2Q5AA 3O5LA 4IQCA 1QPLA 1EYMA 1KT1A 4R0XA 4U85A 3RGCA 3KABA 1T11A 3WH0A 3GPKA 2MLXA 5B8IC 2ZQVA 1ZCNA 3FAPA 3B7XA 1BKFA 1FAPA 4ODLA 4W9OA 2KGJA 4ODMA 2LKNA 3UQAA 4JFLA 4BF8A 4MSPA 4QT3A 3O5OA 2KO7A 5HTGA 5HT1A 1FJDA 2KI3A 4JFJA 1FKHA 3IK8A 1JVWA 1FKTA 3O5QA 4J4NA 2XP5A 3IHZA 2MLYA 2OFNA 3KCEA 3PRBA 4IPXA 4FN2A 4LAVA 4DRPA 1C9HA 1Q1CA 1TCOC 2F4EA 4NNRA 2ZR4A 2ITKA 3LUOA 2RURA 3O5RA 1D7IA 2LGOA 3MDYB 2LPVA 1F8AB 1KT0A 5HW6A 1YATA 3O5JA 1J4IA 3CGMA 3UI4A 4DRJA 5HW8A 2LJ4A 3O5FA 4ODKA 1QPFA 1J6YA 4W9QA 3JXVA 3JYMA 2RUQA 1J4RA 3O5MA 2M08A 3PRDA 1L1PA 2KR7A 1YW5A 5DIVA 4U86A 4G2PA 2ZQSA 3UI5A 1N1AA 1JNTA 2VCDA 2XP6A 4FAPA 3O5EA 4TYOA 4DT4A 1FKDA 2D9FA 1FKGA 2F2DA 3IKGA 2XP8A 4DRMA 1JNSA 4DRQA 1D7JA 3TCZA 1ROUA 3NRKA 2ZQTA 5HKGA 4MGVA 2ZR6A 2PV1A 3OOBA 1FKJA 1R9HA 3I6CA 1Y0OA 4DROA 1FKKA 1FKIA 2K8IA 3ODKA 3KAHA 1B6CA 4QT2A 2ZQUA 2KE0A 1Q6IA 4DIPA 4ODOA 1D7HA 4DRHA 1U79A 1ROTA 3KADA 3O5IA 4ODNA 2XPAA 4IQ2A 1FKFA 2PBCA 3KAIA 4JYSA 3UF8A 5DITA 1BL4A 2UZ5A 4TNSA 1J4HA 4ODPA 1QZ2A 2KFWA 2XP3A 3NI6A 4W9PA 4DZ2A 3CGNA 4N19A 1Q6HA 3TDBA 2XP7A 2M1IA 2PPNA 2VN1A 3JYJA 4QIBA 2DG9A 2AWGA 3VAWA 1PINA 1HXVA 2JZVA 2F21A 2ZR5A 5D75A 2PPOA 4TW7A 1FD9A 2PV3A 1FKBA 2MLZA 3EY6A 3IKDA 1W26A 2RUDA 4TW6A 1FKLA 4J4OA 2RSEA 2MF9A 2Y78A 4LAWA 4TW8A 2N87A 5BXJA 5I98A 4JFIA 4ITZA 5DIUA 3O5DA 1ZK6A 1FKSA 3KAFA 2MPHA 3O5GA 1P5QA 2PV2A 2PPPA 3KACA 1D6OA 3TC5A 4DRNA 5HWCA 2DG3A 3RFWA 3UQIA 4DH0A 4DRKA 1EQ3A 2DG4A 4LAXA 4O2TA 3KAGA 2RQSA 4GIVA 2FAPA 2L2SA 2XP9A 4ODRA 4C02B 4DRIA 2RUCA 5HWBA 5HUAA 2IF4A 4LAYA 1M5YA 2XP4A 3KZ7A 3UQBA 1Q6UA 5GPGA 1FKRA 3PA7A 3O5PA 2XPBA 1NMWA 1A7XA 4G50A 5J6EA 4GGQA
chains in the Genus database with same CATH superfamily
4TX0A 2MNTA 1E6NA 3H9RB 3RMEA 1F40A 4Z2IA 2FKEA 3ARXA 2DSVA 2Q5AA 1HXVA 4DRHA 3WH0A 4ZPWR 3KABA 3GPKA 2MLXA 1ZCNA 3FAPA 3B7XA 4W9OA 2KGJA 3G6LA 4P8XA 4JFLA 4BF8A 2KO7A 2ESCA 5HTGA 1FJDA 1FKHA 3IK8A 1WAWA 4WIWA 1FKTA 1TFVA 2G41A 1WNOA 2XP5A 1UR9A 2MLYA 4FN2A 2ETNA 4MNLA 1C9HA 2ZR4A 2ITKA 3ARTA 1F8AB 3RM4A 4DWSA 1YATA 2DT3A 3UI4A 4ZS6A 3O5FA 4WKFA 1K9TA 3GU0A 1J4RA 1FFQA 2M08A 3O5MA 1E6PA 4ML4A 2ZQSA 2XP6A 3CHDA 2O92A 1FKDA 3IKGA 1E15A 1D7JA 1ROUA 2WLZA 1ZB5A 2PV1A 3AS3A 1R9HA 3BXWA 3I6CA 1W9UA 1Y0OA 2K8IA 4DROA 1D7HA 1ROTA 3O5IA 2XPAA 3ARSA 1NWUA 5DITA 4DZ2A 1J4HA 4ODPA 3NI6A 3AS1A 1NWRA 1ZBKA 2VN1A 2EULA 3WD3A 2JZVA 5D75A 2PPOA 1FKBA 1GRJA 2RUDA 4LAWA 4TW8A 2N87A 5DIUA 4Z2JA 1FKSA 2OLHA 3KACA 1WB0A 5HWCA 3RFWA 4DH0A 3B9EA 4Q22A 3KAGA 2FAPA 4C02B 4LAYA 1M5YA 1O6IA 1FKRA 4Z2GA 3PA7A 4LGXA 3W4RA 3O5PA 1A7XA 4G50A 4GGQA 4HBOA 1VF8A 1LL4A 3WKZA 4WJXA 5HW7A 3UI6A 1NMVA 3O5KA 4IQCA 1EYMA 1KT1A 4ODMA 3UQAA 2LKNA 2WM0A 3AS0A 1W1YA 1LG2A 5HT1A 4Q7NA 4URIA 1JVWA 2DSWA 4WK9A 3O5QA 1LL7A 4HBEA 4IPXA 1ZL1A 3PRAA 1Q1CA 1TCOC 1E44A 3LUOA 2RURA 1HKMA 5HW6A 3FY1A 2A3BA 4Z2HA 3JXVA 2P4VA 1W1TA 3JYMA 2KR7A 1YW5A 4U86A 4G2PA 1N1AA 1JNTA 2VCDA 4FAPA 5GPRA 4TYOA 1OGGA 3FXYA 4DT4A 3EIPA 4DRQA 3TCZA 5GQBA 5HKGA 4MGVA 3ALFA 1SYTA 2DSUA 1LL6A 3KAHA 4ZPVR 4MNKA 1Q6IA 3KADA 3WD4A 4IQ2A 1BL4A 1JNDA 4TNSA 1QZ2A 2KFWA 2XP3A 1GOIA 3AROA 1D2KA 1JNEA 1X6LA 4N19A 2XP7A 4S3JA 2PPNA 4QIBA 4DWSB 3B9DA 4TW7A 2MLZA 4TW6A 1FKLA 4J4OA 2MF9A 4Z2KA 1ZBCA 3WQWA 4HARA 4JFIA 4MPKA 1ZK6A 2PN0A 4DRNA 4LAXA 3WIJA 1E9LA 2XP9A 4P8VA 5HUAA 4MNMA 3KZ7A 2XP4A 4R5EA 4W9QA 3AQUA 4WKHA 3WQVA 2M2AA 1IX5A 3B8SA 4IT4A 3NTPA 4JFMA 4R0XA 3RGCA 2A3CA 3WD1A 1T11A 4ODLA 1FAPA 1E6ZA 2DT0A 3RM9A 4MSPA 3AS2A 4JFJA 1W1PA 3IHZA 2OFNA 3PRBA 4LAVA 4DRPA 1H0GA 2F4EA 4L72B 2YBTA 1FFRA 3O5RA 1KT0A 4W5UA 1J4IA 1GPFA 3CGMA 3WL1A 1LG1A 4ODKA 1J6YA 2QF8A 4NSBA 3RM8A 1XRVA 1L1PA 4WKAA 2B5UB 3UI5A 3CHFA 3O5EA 2DT2A 2DSZA 2D9FA 1FKGA 2XP8A 1JNSA 1EHNA 4AY1A 4DWSD 4QT2A 1B6CA 2YBUA 2KE0A 1U79A 1KFWA 1NWTA 2PBCA 1NH6A 4UDMA 5JH8A 1ITXA 4W9PA 3CGNA 3CH9A 1Q6HA 3JYJA 1ZBVA 2AWGA 3VAWA 1PINA 2IUZA 3GTYX 2F21A 2ZR5A 2PV3A 3EY6A 3IKDA 1NWSA 2A3EA 2DPEA 1LQ0A 1W9PA 2RSEA 5BXJA 5I98A 4ITZA 1HKKA 1SR0A 1JCHB 2MPHA 4KQZA 1HKJA 1OGBA 2PV2A 4PTMA 5HBFA 2PPPA 2WK2A 2DG3A 3CHEA 1EQ3A 3ARQA 3ARRA 2DG4A 2DT1A 4MTVA 1OWQA 1ZBWA 4GIVA 2RQSA 5HWBA 3QOKA 4DRIA 2RUCA 3OA5A 3UQBA 5GPGA 3WD2A 1W1VA 2XPBA 2FDMA 5DF0A 1W9VA 4DZ3A 4U84A 4JFKA 1HJWA 1NSGA 1CTNA 1PBKA 4ODQA 4QZVB 3O5LA 4U85A 2A3AA 1QPLA 5B8IC 4IT6A 2ZQVA 1HKIA 4Z2LA 3ARPA 1BKFA 3ARYA 1X6NA 4QT3A 3O5OA 2KI3A 4J4NA 4MNJA 3KCEA 5DO2A 4NNRA 1HJVA 1D7IA 2LGOA 3MDYB 2LPVA 3O5JA 4DRJA 5HW8A 2LJ4A 1QPFA 1ZU8A 2RUQA 3WL0A 2F23A 2O9OA 3PRDA 5DIVA 1LJYA 2F2DA 2G8ZA 4DRMA 1GUVA 3NRKA 2ZQTA 1UR8A 2WLYA 2ZR6A 3OOBA 1FKJA 1FKKA 1FKIA 3ODKA 4S3KA 2ZQUA 3ARUA 4DIPA 4ODOA 4XAKA 4ODNA 3UF8A 1FKFA 3KAIA 4JYSA 2UZ5A 4DWSC 5DEZA 3TDBA 3ALGA 2M1IA 2DG9A 3G6MA 3ARWA 4NZCA 1FD9A 3ARZA 2PI6A 3PR9A 1W26A 2AOSA 4KR0B 3BMBA 1HJXA 2Y78A 1RD6A 4L3NA 3O5DA 4MAVA 3KAFA 3CHCA 3O5GA 1P5QA 3ARVA 1D6OA 3TC5A 1EDQA 4DRKA 3UQIA 2B31A 1XHGA 1H0IA 4O2TA 3CZ8A 4ODRA 1E6RA 2L2SA 4ZPTR 3B9AA 2IF4A 1Q6UA 4P8WA 3WD0A 1EIBA 4P8UA 1NMWA 5J6EA
chains in the Genus database with same CATH topology
4TX0A 2MNTA 1E6NA 3H9RB 3RMEA 1F40A 4Z2IA 2FKEA 3ARXA 2DSVA 2Q5AA 1HXVA 4DRHA 3WH0A 4ZPWR 3KABA 3GPKA 2MLXA 1ZCNA 3FAPA 3B7XA 4W9OA 2KGJA 3G6LA 4P8XA 4JFLA 4BF8A 2KO7A 2ESCA 5HTGA 1FJDA 1FKHA 3IK8A 1WAWA 4WIWA 1FKTA 1TFVA 2G41A 1WNOA 2XP5A 1UR9A 2MLYA 4FN2A 4MNLA 1C9HA 2ZR4A 2ITKA 3ARTA 1F8AB 3RM4A 4DWSA 1YATA 2DT3A 3UI4A 4ZS6A 3O5FA 4WKFA 1K9TA 1J4RA 1FFQA 2M08A 3O5MA 1E6PA 4ML4A 2ZQSA 2XP6A 3CHDA 2O92A 1FKDA 3IKGA 1E15A 1D7JA 1ROUA 2WLZA 1ZB5A 2PV1A 3AS3A 1R9HA 3BXWA 3I6CA 1W9UA 1Y0OA 2K8IA 4DROA 1D7HA 1ROTA 3O5IA 2XPAA 3ARSA 1NWUA 5DITA 4DZ2A 1J4HA 4ODPA 3NI6A 3AS1A 1NWRA 1ZBKA 2VN1A 3WD3A 2JZVA 5D75A 2PPOA 1FKBA 2RUDA 4LAWA 4TW8A 2N87A 5DIUA 4Z2JA 1FKSA 2OLHA 3KACA 1WB0A 5HWCA 3RFWA 4DH0A 3B9EA 4Q22A 3KAGA 2FAPA 4C02B 4LAYA 1M5YA 1O6IA 1FKRA 4Z2GA 3PA7A 4LGXA 3W4RA 3O5PA 1A7XA 4G50A 4GGQA 4HBOA 1VF8A 1LL4A 3WKZA 4WJXA 5HW7A 3UI6A 1NMVA 3O5KA 4IQCA 1EYMA 1KT1A 4ODMA 3UQAA 2LKNA 2WM0A 3AS0A 1W1YA 1LG2A 5HT1A 4Q7NA 4URIA 1JVWA 2DSWA 4WK9A 3O5QA 1LL7A 4HBEA 4IPXA 1ZL1A 3PRAA 1Q1CA 1TCOC 3LUOA 2RURA 1HKMA 5HW6A 3FY1A 2A3BA 4Z2HA 3JXVA 1W1TA 3JYMA 2KR7A 1YW5A 4U86A 4G2PA 1N1AA 1JNTA 2VCDA 4FAPA 5GPRA 4TYOA 1OGGA 3FXYA 4DT4A 4DRQA 3TCZA 5GQBA 5HKGA 4MGVA 3ALFA 1SYTA 2DSUA 1LL6A 3KAHA 4ZPVR 4MNKA 1Q6IA 3KADA 3WD4A 4IQ2A 1BL4A 1JNDA 4TNSA 1QZ2A 2KFWA 2XP3A 1GOIA 3AROA 1D2KA 1JNEA 1X6LA 4N19A 2XP7A 4S3JA 2PPNA 4QIBA 4DWSB 3B9DA 4TW7A 2MLZA 4TW6A 1FKLA 4J4OA 2MF9A 4Z2KA 1ZBCA 3WQWA 4HARA 4JFIA 4MPKA 1ZK6A 4DRNA 4LAXA 3WIJA 1E9LA 2XP9A 4P8VA 5HUAA 4MNMA 3KZ7A 2XP4A 4R5EA 4W9QA 3AQUA 4WKHA 3WQVA 2M2AA 1IX5A 3B8SA 4IT4A 3NTPA 4JFMA 4R0XA 3RGCA 2A3CA 3WD1A 1T11A 4ODLA 1FAPA 1E6ZA 2DT0A 3RM9A 4MSPA 3AS2A 4JFJA 1W1PA 3IHZA 2OFNA 3PRBA 4LAVA 4DRPA 1H0GA 2F4EA 4L72B 2YBTA 1FFRA 3O5RA 1KT0A 4W5UA 1J4IA 1GPFA 3CGMA 3WL1A 1LG1A 4ODKA 1J6YA 2QF8A 4NSBA 3RM8A 1XRVA 1L1PA 4WKAA 3UI5A 3CHFA 3O5EA 2DT2A 2DSZA 2D9FA 1FKGA 2XP8A 1JNSA 1EHNA 4AY1A 4DWSD 4QT2A 1B6CA 2YBUA 2KE0A 1U79A 1KFWA 1NWTA 2PBCA 1NH6A 5JH8A 1ITXA 4W9PA 3CGNA 3CH9A 1Q6HA 3JYJA 1ZBVA 2AWGA 3VAWA 1PINA 2IUZA 2F21A 2ZR5A 2PV3A 3EY6A 3IKDA 1NWSA 2A3EA 2DPEA 1LQ0A 1W9PA 2RSEA 5BXJA 5I98A 4ITZA 1HKKA 1SR0A 2MPHA 4KQZA 1HKJA 1OGBA 2PV2A 4PTMA 5HBFA 2PPPA 2WK2A 2DG3A 3CHEA 1EQ3A 3ARQA 3ARRA 2DG4A 2DT1A 4MTVA 1OWQA 1ZBWA 4GIVA 2RQSA 5HWBA 3QOKA 4DRIA 2RUCA 3OA5A 3UQBA 5GPGA 3WD2A 1W1VA 2XPBA 2FDMA 5DF0A 1W9VA 4DZ3A 4U84A 4JFKA 1HJWA 1NSGA 1CTNA 1PBKA 4ODQA 4QZVB 3O5LA 4U85A 2A3AA 1QPLA 5B8IC 4IT6A 2ZQVA 1HKIA 4Z2LA 3ARPA 1BKFA 3ARYA 1X6NA 4QT3A 3O5OA 2KI3A 4J4NA 4MNJA 3KCEA 5DO2A 4NNRA 1HJVA 1D7IA 2LGOA 3MDYB 2LPVA 3O5JA 4DRJA 5HW8A 2LJ4A 1QPFA 1ZU8A 2RUQA 3WL0A 2O9OA 3PRDA 5DIVA 1LJYA 2F2DA 2G8ZA 4DRMA 1GUVA 3NRKA 2ZQTA 1UR8A 2WLYA 2ZR6A 3OOBA 1FKJA 1FKKA 1FKIA 3ODKA 4S3KA 2ZQUA 3ARUA 4DIPA 4ODOA 4XAKA 4ODNA 3UF8A 1FKFA 3KAIA 4JYSA 2UZ5A 4DWSC 5DEZA 3TDBA 3ALGA 2M1IA 2DG9A 3G6MA 3ARWA 4NZCA 1FD9A 3ARZA 2PI6A 1W26A 2AOSA 3PR9A 4KR0B 1HJXA 2Y78A 1RD6A 4L3NA 3O5DA 4MAVA 3KAFA 3CHCA 3O5GA 1P5QA 3ARVA 1D6OA 3TC5A 1EDQA 4DRKA 3UQIA 2B31A 1XHGA 1H0IA 4O2TA 3CZ8A 4ODRA 1E6RA 2L2SA 4ZPTR 3B9AA 2IF4A 1Q6UA 4P8WA 3WD0A 1EIBA 4P8UA 1NMWA 5J6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TX0 A;  4DZ3 A;  2MNT A;  4U84 A;  4JFK A;  2M2A A;  3H9R B;  1F40 A;  5HW7 A;  1NSG A;  1PBK A;  3UI6 A;  1NMV A;  2FKE A;  4ODQ A;  3NTP A;  4JFM A;  3O5K A;  2Q5A A;  3O5L A;  4IQC A;  1QPL A;  1EYM A;  1KT1 A;  4R0X A;  4U85 A;  3RGC A;  3KAB A;  1T11 A;  3WH0 A;  3GPK A;  2MLX A;  5B8I C;  2ZQV A;  1ZCN A;  3FAP A;  3B7X A;  1BKF A;  1FAP A;  4ODL A;  4W9O A;  2KGJ A;  4ODM A;  2LKN A;  3UQA A;  4JFL A;  4BF8 A;  4MSP A;  4QT3 A;  3O5O A;  2KO7 A;  5HTG A;  5HT1 A;  1FJD A;  2KI3 A;  4JFJ A;  1FKH A;  3IK8 A;  1JVW A;  1FKT A;  3O5Q A;  4J4N A;  2XP5 A;  3IHZ A;  2MLY A;  2OFN A;  3KCE A;  3PRB A;  4IPX A;  4FN2 A;  4LAV A;  4DRP A;  1C9H A;  1Q1C A;  1TCO C;  2F4E A;  4NNR A;  2ZR4 A;  2ITK A;  3LUO A;  2RUR A;  3O5R A;  1D7I A;  2LGO A;  3MDY B;  2LPV A;  1F8A B;  1KT0 A;  5HW6 A;  1YAT A;  3O5J A;  1J4I A;  3CGM A;  3UI4 A;  4DRJ A;  5HW8 A;  2LJ4 A;  3O5F A;  4ODK A;  1QPF A;  1J6Y A;  4W9Q A;  3JXV A;  3JYM A;  2RUQ A;  1J4R A;  3O5M A;  2M08 A;  3PRD A;  1L1P A;  2KR7 A;  1YW5 A;  5DIV A;  4U86 A;  4G2P A;  2ZQS A;  3UI5 A;  1N1A A;  1JNT A;  2VCD A;  2XP6 A;  4FAP A;  3O5E A;  4TYO A;  4DT4 A;  1FKD A;  2D9F A;  1FKG A;  2F2D A;  3IKG A;  2XP8 A;  4DRM A;  1JNS A;  4DRQ A;  1D7J A;  3TCZ A;  1ROU A;  3NRK A;  2ZQT A;  5HKG A;  4MGV A;  2ZR6 A;  2PV1 A;  3OOB A;  1FKJ A;  1R9H A;  3I6C A;  1Y0O A;  4DRO A;  1FKK A;  1FKI A;  2K8I A;  3ODK A;  3KAH A;  1B6C A;  4QT2 A;  2ZQU A;  2KE0 A;  1Q6I A;  4DIP A;  4ODO A;  1D7H A;  4DRH A;  1U79 A;  1ROT A;  3KAD A;  3O5I A;  4ODN A;  2XPA A;  4IQ2 A;  1FKF A;  2PBC A;  3KAI A;  4JYS A;  3UF8 A;  5DIT A;  1BL4 A;  2UZ5 A;  4TNS A;  1J4H A;  4ODP A;  1QZ2 A;  2KFW A;  2XP3 A;  3NI6 A;  4W9P A;  4DZ2 A;  3CGN A;  4N19 A;  1Q6H A;  3TDB A;  2XP7 A;  2M1I A;  2PPN A;  2VN1 A;  3JYJ A;  4QIB A;  2DG9 A;  2AWG A;  3VAW A;  1PIN A;  1HXV A;  2JZV A;  2F21 A;  2ZR5 A;  5D75 A;  2PPO A;  4TW7 A;  1FD9 A;  2PV3 A;  1FKB A;  2MLZ A;  3EY6 A;  3IKD A;  1W26 A;  2RUD A;  4TW6 A;  1FKL A;  4J4O A;  2RSE A;  2MF9 A;  2Y78 A;  4LAW A;  4TW8 A;  2N87 A;  5BXJ A;  5I98 A;  4JFI A;  4ITZ A;  5DIU A;  3O5D A;  1ZK6 A;  1FKS A;  3KAF A;  2MPH A;  3O5G A;  1P5Q A;  2PV2 A;  2PPP A;  3KAC A;  1D6O A;  3TC5 A;  4DRN A;  5HWC A;  2DG3 A;  3RFW A;  3UQI A;  4DH0 A;  4DRK A;  1EQ3 A;  2DG4 A;  4LAX A;  4O2T A;  3KAG A;  2RQS A;  4GIV A;  2FAP A;  2L2S A;  2XP9 A;  4ODR A;  4C02 B;  4DRI A;  2RUC A;  5HWB A;  5HUA A;  2IF4 A;  4LAY A;  1M5Y A;  2XP4 A;  3KZ7 A;  3UQB A;  1Q6U A;  5GPG A;  1FKR A;  3PA7 A;  3O5P A;  2XPB A;  1NMW A;  1A7X A;  4G50 A;  5J6E A;  4GGQ A; 
#chains in the Genus database with same CATH topology
 4TX0 A;  2MNT A;  1E6N A;  3H9R B;  3RME A;  1F40 A;  4Z2I A;  2FKE A;  3ARX A;  2DSV A;  2Q5A A;  1HXV A;  4DRH A;  3WH0 A;  4ZPW R;  3KAB A;  3GPK A;  2MLX A;  1ZCN A;  3FAP A;  3B7X A;  4W9O A;  2KGJ A;  3G6L A;  4P8X A;  4JFL A;  4BF8 A;  2KO7 A;  2ESC A;  5HTG A;  1FJD A;  1FKH A;  3IK8 A;  1WAW A;  4WIW A;  1FKT A;  1TFV A;  2G41 A;  1WNO A;  2XP5 A;  1UR9 A;  2MLY A;  4FN2 A;  2ETN A;  4MNL A;  1C9H A;  2ZR4 A;  2ITK A;  3ART A;  1F8A B;  3RM4 A;  4DWS A;  1YAT A;  2DT3 A;  3UI4 A;  4ZS6 A;  3O5F A;  4WKF A;  1K9T A;  3GU0 A;  1J4R A;  1FFQ A;  2M08 A;  3O5M A;  1E6P A;  4ML4 A;  2ZQS A;  2XP6 A;  3CHD A;  2O92 A;  1FKD A;  3IKG A;  1E15 A;  1D7J A;  1ROU A;  2WLZ A;  1ZB5 A;  2PV1 A;  3AS3 A;  1R9H A;  3BXW A;  3I6C A;  1W9U A;  1Y0O A;  2K8I A;  4DRO A;  1D7H A;  1ROT A;  3O5I A;  2XPA A;  3ARS A;  1NWU A;  5DIT A;  4DZ2 A;  1J4H A;  4ODP A;  3NI6 A;  3AS1 A;  1NWR A;  1ZBK A;  2VN1 A;  2EUL A;  3WD3 A;  2JZV A;  5D75 A;  2PPO A;  1FKB A;  1GRJ A;  2RUD A;  4LAW A;  4TW8 A;  2N87 A;  5DIU A;  4Z2J A;  1FKS A;  2OLH A;  3KAC A;  1WB0 A;  5HWC A;  3RFW A;  4DH0 A;  3B9E A;  4Q22 A;  3KAG A;  2FAP A;  4C02 B;  4LAY A;  1M5Y A;  1O6I A;  1FKR A;  4Z2G A;  3PA7 A;  4LGX A;  3W4R A;  3O5P A;  1A7X A;  4G50 A;  4GGQ A;  4HBO A;  1VF8 A;  1LL4 A;  3WKZ A;  4WJX A;  5HW7 A;  3UI6 A;  1NMV A;  3O5K A;  4IQC A;  1EYM A;  1KT1 A;  4ODM A;  3UQA A;  2LKN A;  2WM0 A;  3AS0 A;  1W1Y A;  1LG2 A;  5HT1 A;  4Q7N A;  4URI A;  1JVW A;  2DSW A;  4WK9 A;  3O5Q A;  1LL7 A;  4HBE A;  4IPX A;  1ZL1 A;  3PRA A;  1Q1C A;  1TCO C;  1E44 A;  3LUO A;  2RUR A;  1HKM A;  5HW6 A;  3FY1 A;  2A3B A;  4Z2H A;  3JXV A;  2P4V A;  1W1T A;  3JYM A;  2KR7 A;  1YW5 A;  4U86 A;  4G2P A;  1N1A A;  1JNT A;  2VCD A;  4FAP A;  5GPR A;  4TYO A;  1OGG A;  3FXY A;  4DT4 A;  3EIP A;  4DRQ A;  3TCZ A;  5GQB A;  5HKG A;  4MGV A;  3ALF A;  1SYT A;  2DSU A;  1LL6 A;  3KAH A;  4ZPV R;  4MNK A;  1Q6I A;  3KAD A;  3WD4 A;  4IQ2 A;  1BL4 A;  1JND A;  4TNS A;  1QZ2 A;  2KFW A;  2XP3 A;  1GOI A;  3ARO A;  1D2K A;  1JNE A;  1X6L A;  4N19 A;  2XP7 A;  4S3J A;  2PPN A;  4QIB A;  4DWS B;  3B9D A;  4TW7 A;  2MLZ A;  4TW6 A;  1FKL A;  4J4O A;  2MF9 A;  4Z2K A;  1ZBC A;  3WQW A;  4HAR A;  4JFI A;  4MPK A;  1ZK6 A;  2PN0 A;  4DRN A;  4LAX A;  3WIJ A;  1E9L A;  2XP9 A;  4P8V A;  5HUA A;  4MNM A;  3KZ7 A;  2XP4 A;  4R5E A;  4W9Q A;  3AQU A;  4WKH A;  3WQV A;  2M2A A;  1IX5 A;  3B8S A;  4IT4 A;  3NTP A;  4JFM A;  4R0X A;  3RGC A;  2A3C A;  3WD1 A;  1T11 A;  4ODL A;  1FAP A;  1E6Z A;  2DT0 A;  3RM9 A;  4MSP A;  3AS2 A;  4JFJ A;  1W1P A;  3IHZ A;  2OFN A;  3PRB A;  4LAV A;  4DRP A;  1H0G A;  2F4E A;  4L72 B;  2YBT A;  1FFR A;  3O5R A;  1KT0 A;  4W5U A;  1J4I A;  1GPF A;  3CGM A;  3WL1 A;  1LG1 A;  4ODK A;  1J6Y A;  2QF8 A;  4NSB A;  3RM8 A;  1XRV A;  1L1P A;  4WKA A;  2B5U B;  3UI5 A;  3CHF A;  3O5E A;  2DT2 A;  2DSZ A;  2D9F A;  1FKG A;  2XP8 A;  1JNS A;  1EHN A;  4AY1 A;  4DWS D;  4QT2 A;  1B6C A;  2YBU A;  2KE0 A;  1U79 A;  1KFW A;  1NWT A;  2PBC A;  1NH6 A;  4UDM A;  5JH8 A;  1ITX A;  4W9P A;  3CGN A;  3CH9 A;  1Q6H A;  3JYJ A;  1ZBV A;  2AWG A;  3VAW A;  1PIN A;  2IUZ A;  3GTY X;  2F21 A;  2ZR5 A;  2PV3 A;  3EY6 A;  3IKD A;  1NWS A;  2A3E A;  2DPE A;  1LQ0 A;  1W9P A;  2RSE A;  5BXJ A;  5I98 A;  4ITZ A;  1HKK A;  1SR0 A;  1JCH B;  2MPH A;  4KQZ A;  1HKJ A;  1OGB A;  2PV2 A;  4PTM A;  5HBF A;  2PPP A;  2WK2 A;  2DG3 A;  3CHE A;  1EQ3 A;  3ARQ A;  3ARR A;  2DG4 A;  2DT1 A;  4MTV A;  1OWQ A;  1ZBW A;  4GIV A;  2RQS A;  5HWB A;  3QOK A;  4DRI A;  2RUC A;  3OA5 A;  3UQB A;  5GPG A;  3WD2 A;  1W1V A;  2XPB A;  2FDM A;  5DF0 A;  1W9V A;  4DZ3 A;  4U84 A;  4JFK A;  1HJW A;  1NSG A;  1CTN A;  1PBK A;  4ODQ A;  4QZV B;  3O5L A;  4U85 A;  2A3A A;  1QPL A;  5B8I C;  4IT6 A;  2ZQV A;  1HKI A;  4Z2L A;  3ARP A;  1BKF A;  3ARY A;  1X6N A;  4QT3 A;  3O5O A;  2KI3 A;  4J4N A;  4MNJ A;  3KCE A;  5DO2 A;  4NNR A;  1HJV A;  1D7I A;  2LGO A;  3MDY B;  2LPV A;  3O5J A;  4DRJ A;  5HW8 A;  2LJ4 A;  1QPF A;  1ZU8 A;  2RUQ A;  3WL0 A;  2F23 A;  2O9O A;  3PRD A;  5DIV A;  1LJY A;  2F2D A;  2G8Z A;  4DRM A;  1GUV A;  3NRK A;  2ZQT A;  1UR8 A;  2WLY A;  2ZR6 A;  3OOB A;  1FKJ A;  1FKK A;  1FKI A;  3ODK A;  4S3K A;  2ZQU A;  3ARU A;  4DIP A;  4ODO A;  4XAK A;  4ODN A;  3UF8 A;  1FKF A;  3KAI A;  4JYS A;  2UZ5 A;  4DWS C;  5DEZ A;  3TDB A;  3ALG A;  2M1I A;  2DG9 A;  3G6M A;  3ARW A;  4NZC A;  1FD9 A;  3ARZ A;  2PI6 A;  3PR9 A;  1W26 A;  2AOS A;  4KR0 B;  3BMB A;  1HJX A;  2Y78 A;  1RD6 A;  4L3N A;  3O5D A;  4MAV A;  3KAF A;  3CHC A;  3O5G A;  1P5Q A;  3ARV A;  1D6O A;  3TC5 A;  1EDQ A;  4DRK A;  3UQI A;  2B31 A;  1XHG A;  1H0I A;  4O2T A;  3CZ8 A;  4ODR A;  1E6R A;  2L2S A;  4ZPT R;  3B9A A;  2IF4 A;  1Q6U A;  4P8W A;  3WD0 A;  1EIB A;  4P8U A;  1NMW A;  5J6E A; 
#chains in the Genus database with same CATH homology
 4TX0 A;  2MNT A;  1E6N A;  3H9R B;  3RME A;  1F40 A;  4Z2I A;  2FKE A;  3ARX A;  2DSV A;  2Q5A A;  1HXV A;  4DRH A;  3WH0 A;  4ZPW R;  3KAB A;  3GPK A;  2MLX A;  1ZCN A;  3FAP A;  3B7X A;  4W9O A;  2KGJ A;  3G6L A;  4P8X A;  4JFL A;  4BF8 A;  2KO7 A;  2ESC A;  5HTG A;  1FJD A;  1FKH A;  3IK8 A;  1WAW A;  4WIW A;  1FKT A;  1TFV A;  2G41 A;  1WNO A;  2XP5 A;  1UR9 A;  2MLY A;  4FN2 A;  4MNL A;  1C9H A;  2ZR4 A;  2ITK A;  3ART A;  1F8A B;  3RM4 A;  4DWS A;  1YAT A;  2DT3 A;  3UI4 A;  4ZS6 A;  3O5F A;  4WKF A;  1K9T A;  1J4R A;  1FFQ A;  2M08 A;  3O5M A;  1E6P A;  4ML4 A;  2ZQS A;  2XP6 A;  3CHD A;  2O92 A;  1FKD A;  3IKG A;  1E15 A;  1D7J A;  1ROU A;  2WLZ A;  1ZB5 A;  2PV1 A;  3AS3 A;  1R9H A;  3BXW A;  3I6C A;  1W9U A;  1Y0O A;  2K8I A;  4DRO A;  1D7H A;  1ROT A;  3O5I A;  2XPA A;  3ARS A;  1NWU A;  5DIT A;  4DZ2 A;  1J4H A;  4ODP A;  3NI6 A;  3AS1 A;  1NWR A;  1ZBK A;  2VN1 A;  3WD3 A;  2JZV A;  5D75 A;  2PPO A;  1FKB A;  2RUD A;  4LAW A;  4TW8 A;  2N87 A;  5DIU A;  4Z2J A;  1FKS A;  2OLH A;  3KAC A;  1WB0 A;  5HWC A;  3RFW A;  4DH0 A;  3B9E A;  4Q22 A;  3KAG A;  2FAP A;  4C02 B;  4LAY A;  1M5Y A;  1O6I A;  1FKR A;  4Z2G A;  3PA7 A;  4LGX A;  3W4R A;  3O5P A;  1A7X A;  4G50 A;  4GGQ A;  4HBO A;  1VF8 A;  1LL4 A;  3WKZ A;  4WJX A;  5HW7 A;  3UI6 A;  1NMV A;  3O5K A;  4IQC A;  1EYM A;  1KT1 A;  4ODM A;  3UQA A;  2LKN A;  2WM0 A;  3AS0 A;  1W1Y A;  1LG2 A;  5HT1 A;  4Q7N A;  4URI A;  1JVW A;  2DSW A;  4WK9 A;  3O5Q A;  1LL7 A;  4HBE A;  4IPX A;  1ZL1 A;  3PRA A;  1Q1C A;  1TCO C;  3LUO A;  2RUR A;  1HKM A;  5HW6 A;  3FY1 A;  2A3B A;  4Z2H A;  3JXV A;  1W1T A;  3JYM A;  2KR7 A;  1YW5 A;  4U86 A;  4G2P A;  1N1A A;  1JNT A;  2VCD A;  4FAP A;  5GPR A;  4TYO A;  1OGG A;  3FXY A;  4DT4 A;  4DRQ A;  3TCZ A;  5GQB A;  5HKG A;  4MGV A;  3ALF A;  1SYT A;  2DSU A;  1LL6 A;  3KAH A;  4ZPV R;  4MNK A;  1Q6I A;  3KAD A;  3WD4 A;  4IQ2 A;  1BL4 A;  1JND A;  4TNS A;  1QZ2 A;  2KFW A;  2XP3 A;  1GOI A;  3ARO A;  1D2K A;  1JNE A;  1X6L A;  4N19 A;  2XP7 A;  4S3J A;  2PPN A;  4QIB A;  4DWS B;  3B9D A;  4TW7 A;  2MLZ A;  4TW6 A;  1FKL A;  4J4O A;  2MF9 A;  4Z2K A;  1ZBC A;  3WQW A;  4HAR A;  4JFI A;  4MPK A;  1ZK6 A;  4DRN A;  4LAX A;  3WIJ A;  1E9L A;  2XP9 A;  4P8V A;  5HUA A;  4MNM A;  3KZ7 A;  2XP4 A;  4R5E A;  4W9Q A;  3AQU A;  4WKH A;  3WQV A;  2M2A A;  1IX5 A;  3B8S A;  4IT4 A;  3NTP A;  4JFM A;  4R0X A;  3RGC A;  2A3C A;  3WD1 A;  1T11 A;  4ODL A;  1FAP A;  1E6Z A;  2DT0 A;  3RM9 A;  4MSP A;  3AS2 A;  4JFJ A;  1W1P A;  3IHZ A;  2OFN A;  3PRB A;  4LAV A;  4DRP A;  1H0G A;  2F4E A;  4L72 B;  2YBT A;  1FFR A;  3O5R A;  1KT0 A;  4W5U A;  1J4I A;  1GPF A;  3CGM A;  3WL1 A;  1LG1 A;  4ODK A;  1J6Y A;  2QF8 A;  4NSB A;  3RM8 A;  1XRV A;  1L1P A;  4WKA A;  3UI5 A;  3CHF A;  3O5E A;  2DT2 A;  2DSZ A;  2D9F A;  1FKG A;  2XP8 A;  1JNS A;  1EHN A;  4AY1 A;  4DWS D;  4QT2 A;  1B6C A;  2YBU A;  2KE0 A;  1U79 A;  1KFW A;  1NWT A;  2PBC A;  1NH6 A;  5JH8 A;  1ITX A;  4W9P A;  3CGN A;  3CH9 A;  1Q6H A;  3JYJ A;  1ZBV A;  2AWG A;  3VAW A;  1PIN A;  2IUZ A;  2F21 A;  2ZR5 A;  2PV3 A;  3EY6 A;  3IKD A;  1NWS A;  2A3E A;  2DPE A;  1LQ0 A;  1W9P A;  2RSE A;  5BXJ A;  5I98 A;  4ITZ A;  1HKK A;  1SR0 A;  2MPH A;  4KQZ A;  1HKJ A;  1OGB A;  2PV2 A;  4PTM A;  5HBF A;  2PPP A;  2WK2 A;  2DG3 A;  3CHE A;  1EQ3 A;  3ARQ A;  3ARR A;  2DG4 A;  2DT1 A;  4MTV A;  1OWQ A;  1ZBW A;  4GIV A;  2RQS A;  5HWB A;  3QOK A;  4DRI A;  2RUC A;  3OA5 A;  3UQB A;  5GPG A;  3WD2 A;  1W1V A;  2XPB A;  2FDM A;  5DF0 A;  1W9V A;  4DZ3 A;  4U84 A;  4JFK A;  1HJW A;  1NSG A;  1CTN A;  1PBK A;  4ODQ A;  4QZV B;  3O5L A;  4U85 A;  2A3A A;  1QPL A;  5B8I C;  4IT6 A;  2ZQV A;  1HKI A;  4Z2L A;  3ARP A;  1BKF A;  3ARY A;  1X6N A;  4QT3 A;  3O5O A;  2KI3 A;  4J4N A;  4MNJ A;  3KCE A;  5DO2 A;  4NNR A;  1HJV A;  1D7I A;  2LGO A;  3MDY B;  2LPV A;  3O5J A;  4DRJ A;  5HW8 A;  2LJ4 A;  1QPF A;  1ZU8 A;  2RUQ A;  3WL0 A;  2O9O A;  3PRD A;  5DIV A;  1LJY A;  2F2D A;  2G8Z A;  4DRM A;  1GUV A;  3NRK A;  2ZQT A;  1UR8 A;  2WLY A;  2ZR6 A;  3OOB A;  1FKJ A;  1FKK A;  1FKI A;  3ODK A;  4S3K A;  2ZQU A;  3ARU A;  4DIP A;  4ODO A;  4XAK A;  4ODN A;  3UF8 A;  1FKF A;  3KAI A;  4JYS A;  2UZ5 A;  4DWS C;  5DEZ A;  3TDB A;  3ALG A;  2M1I A;  2DG9 A;  3G6M A;  3ARW A;  4NZC A;  1FD9 A;  3ARZ A;  2PI6 A;  1W26 A;  2AOS A;  3PR9 A;  4KR0 B;  1HJX A;  2Y78 A;  1RD6 A;  4L3N A;  3O5D A;  4MAV A;  3KAF A;  3CHC A;  3O5G A;  1P5Q A;  3ARV A;  1D6O A;  3TC5 A;  1EDQ A;  4DRK A;  3UQI A;  2B31 A;  1XHG A;  1H0I A;  4O2T A;  3CZ8 A;  4ODR A;  1E6R A;  2L2S A;  4ZPT R;  3B9A A;  2IF4 A;  1Q6U A;  4P8W A;  3WD0 A;  1EIB A;  4P8U A;  1NMW A;  5J6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...