1TFVA

Crystal structure of a buffalo signaling glycoprotein (spb-40) secreted during involution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF A BUFFALO SIGNALING GLYCOPROTEIN (SPB-40) SECRETED DURING INVOLUTION
rcsb
molecule tags Signaling protein
molecule keywords mammary gland protein 40
total genus 107
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1tfvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tfvA01
5HOSA 3BH4A 5CLWA 5IXEA 1QHZA 3OB8A 2XIIA 5DT5A 2WC7A 3CHCA 1MW2A 1H09A 4Z2KA 2OWWA 4Z2GA 1V6VA 3MKKA 3A4XA 1V3LA 4M80A 2UY4A 2WMIB 4H8HA 1EXPA 3OGRA 4XUYA 3IJ9A 4W8BA 1CDGA 1L0PA 2CHNA 3MMDA 5A8NA 3WL0A 4HMEA 4PMOA 5M5DA 1EA9C 3WF4A 1MFVA 1MQPA 1JZ2A 1EDTA 3VIMA 4PSRA 3ARWA 3CBWA 3WUGA 1H0IA 4U2ZA 2VL4A 4NRSA 1R7OA 2PB1A 3WH7A 2GSJA 5ABFA 2WSKA 1PBGA 3BAIA 2J7DA 4F66A 3WDHA 3WFZA 2V5CA 1I75A 1JI2A 1XGZA 4W5ZA 4W85A 4EKJA 1J0KA 2EEXA 1ODZA 2G3IA 3VGGA 3UR8A 2WVSA 1B2YA 4HZ8A 2OYMA 1BAGA 1BFNA 3OA5A 1EHAA 1CLVA 1UWQA 2E8YA 2ZE0A 2FDMA 4QCEA 3FY1A 2WMHA 4BA0A 4J27A 1QI3A 1JDDA 1UZ1A 1EOMA 1WDPA 4C7GA 1UD6A 4J3TA 2IUZA 2ZX8A 3MUIA 3EBVA 4D71A 1LG2A 4RE3A 2XM2A 3CIVA 1QHOA 4C7DA 1Q6CA 5CGTA 4J28A 3AIWA 2XG9A 1MW1A 1G1YA 4GXPA 3MV11 1O7AA 2A3AA 1W9XA 2WHLA 1E3XA 1D2KA 3AHYA 5JUVA 1V0NA 4W86A 2X09A 1BF2A 3PZVA 3AHZA 1DWHM 3VIOA 1CEOA 1R7AA 4CD5A 2PWDA 4IISA 1WAWA 3AIBA 3WQWA 1E4IA 4Z2JA 4P7OA 1DWJM 1H4PA 1LL4A 1R86A 4DUXA 2WWCA 2DH2A 2GJXB 3THCA 1QW8A 1UWSA 4OOZA 1E6ZA 3W24A 4F9JA 2OLHA 3NSMA 3AQUA 2E0PA 2IXUA 1W1YA 4D6DA 1GVIA 2Y24A 3ZT7A 4A3YA 2YL5A 1OT1A 4J7RA 3PZNA 1X6NA 2X2YA 4C7FA 5IDIA 5A95A 9CGTA 1DWAM 1EDGA 2WW5A 3PZMA 1CGVA 1CXFA 3POHA 2Y5EA 5IHSA 3ARYA 3T09A 2WB5A 5JIWA 1VB9A 3BXWA 1CPUA 1V6WA 2X05A 1KWKA 1GONA 2BVYA 2JALA 1NP2A 1EH9A 2D1ZA 1UKTA 1VFMA 3BAJA 4BQ3A 2WMIA 3PTQA 3ZJ6A 1JAEA 4B3LA 2VC9A 4EK7A 1ODUA 5I78A 1D7FA 2DQXA 4AZGA 2D24A 5D9MA 2FGLA 2DSUA 5CXPA 4ZXOA 1H11A 4TTGA 2VMFA 1UQYA 4UTFA 2VUYA 5F7UA 2BVTA 2ZXBA 3NUKA 2DSZA 1QI2A 1H1NA 2FHFA 1JFXA 3I3DA 3VTRA 4M24A 1CGUA 1NQ6A 1E56A 2ZXAA 2VURA 4WKAA 4U5IA 3T0AA 1QNSA 2NSXA 2DT1A 1AVAA 1V02A 4BF7A 5ABEA 1KQZA 1HJVA 4E8DA 3D5HA 2PWEA 1ISZA 4D1IA 2J7FA 3FW6A 3M46A 3UG5A 3TOPA 3CUFA 3UETA 1C93A 1K9TA 2ZXDA 1J0YA 1UH4A 5GPRA 4H7VA 4W93A 1MW0A 2ESCA 1OSEA 4PMUA 3KL0A 4Z2IA 3EMQA 3WD2A 1VFUA 5TD4A 3FXYA 1HNYA 1MQQA 2DT0A 1C8QA 2QLYA 2GJXA 1V3IA 2C7FA 1NWTA 1V08A 4P7RA 2G3NA 1E4MM 5BXPA 4TX8A 4J3UA 1HL8A 1VFOA 2UY5A 1BYBA 1TA3A 4AD5A 2NT1A 1M04A 2VJXA 1FA2A 3K8MA 4MDOA 3WENA 1H49A 5AY7A 1V02E 2WMJA 4P8VA 2W91A 4JIEA 1FP9A 5CZKA 4JFSA 1FFQA 4UFMA 4ACYA 2Y4SA 3BCDA 3WNPA 3K8LA 2EO7A 3MSGA 5A8PA 1VAHA 1H41A 4X0VA 3OLIA 1OB0A 3VDCA 2GDVA 2WC4A 4ZE4A 4AEFA 1ZL1A 1JI1A 1K9FA 4D6CA 4TUFA 4CCDA 2DT3A 1IZJA 1X1NA 4QCFA 4HTYA 2VCBA 4JCLA 3GM8A 3MUZ1 1CECA 1JZ6A 4MB4A 1CXLA 4PRWA 2NW0A 3WEZA 4GO8A 2YLLA 4KGJA 1UQZA 4ZFMA 5D8ZA 5E09A 4AXNA 1TVPA 3A3HA 2ZXQA 4AY1A 2PWGA 2XVKA 3AS3A 1FH8A 1H0GA 2QF8A 4NZCA 1G0CA 1US3A 1JXJA 3OLEA 4UFJA 1P6WA 4S3JA 3CZ8A 1C3FA 1UD5A 1VJSA 1KGUA 3T0BA 1KFWA 1MXDA 1WDRA 2ZX9A 3AS0A 2E40A 5E9AA 4JAWA 3CHEA 2DIEA 3GH7A 3O2LA 2J25A 8CGTA 5BWFA 3MUAA 1DWIM 3NIYA 2D0GA 3W27A 2J7GA 2X8RA 1UG6A 2DH3A 4GZJA 3K46A 4W7WA 2YL6A 3SCPA 3L2LA 4GZEA 2VQUA 5A6MA 3RDKA 2YKKA 3BLPX 3ALGA 1J0JA 3EMCA 3BMWA 5CQ1A 3WDPP 3OZOA 3IJ7A 3WQVA 5A6BD 1OINA 3AMKA 1J0ZA 3GNRA 3ZJKA 2ZOXA 2YIHA 3IAPA 2ZWYA 1BHGA 4PBGA 3T0DA 3W4RA 3N18A 7TAAA 1E6QM 2JF6A 5JBEA 1LQ0A 4X9YA 3VGHA 3RMEA 1CXKA 1UH3A 2Y8VA 5C71A 3AXIA 3JUGA 3KZSA 1EOKA 4FK9A 1NH6A 3N11A 4OBSA 5GQBA 4HA1A 2NT0A 4QP0A 3SCRA 4PMRA 3VIHA 1LF1A 1TA3B 4HP5A 1GCYA 2GJRA 4BQ4A 1OIFA 3EMZA 4WJXA 1ZBWA 4BZYA 1BVNP 2O92A 4RE2A 4QDMA 4W7VA 1ZB5A 2VZSA 3WQ8A 3B9AA 3CLWA 3W82A 1GW1A 4UFKA 4IUGA 4J3SA 4WSJA 1F4HA 2A3HA 3NCOA 1RP9A 3W6MA 3AS1A 3ECQA 3ZJ8A 3WMBA 3TP4A 3UEQA 3VD7A 3F4VA 6A3HA 4XZBA 1BGGA 2WHJA 3GZAA 1KBKA 4ZE5A 4CN4A 5E0FA 2Z1SA 2J47A 1W3KA 2XVNA 1B9ZA 3RM8A 3QHMA 3AHXA 5EMYA 4AIOA 3VPLA 5HXMA 1J0IA 1JD9A 2CXGA 5DF0A 2XPKA 4QLLA 1MQRA 4MJ4A 4CD4A 2E9LA 1FHDA 3FHQA 1HXJA 2HISA 2D2OA 4HOWA 1ITCA 1UZ4A 3W29A 5A69A 1GVYA 2WMKA 4URIA 4L4OA 3WUBA 3NYDA 3SCTA 4JFVA 3WF2A 1X6LA 1V0KA 4K68A 5A8QA 1KR0A 2PBOA 3WF1A 5EB8A 1HJWA 1BLIA 2VZUA 1U30A 1CXEA 1PZ3A 1V6XA 1ZJAA 3N17A 2XFYA 3K4AA 4CD8A 2GFTA 3AIEA 5JBDA 4U33A 1KXQA 4X0NA 4DUWA 3RCNA 4AMCA 3ZT6A 4YHGA 5A6SA 3VGBA 5ABFB 1HVXA 1RH9A 2CETA 2VVNA 4PCTA 2O9OA 2WHMA 4M81A 3VNZA 3CO4A 3VVGA 1V0MA 3AIVA 1J18A 1HL9A 3ZR5A 1PX8A 1Q6FA 5AC4A 1E6SM 4PTVA 1JFHA 3GTNA 1UR1A 3BSHA 3VM5A 1LLOA 1DWGM 3MU7A 5D4YA 5GNZA 1WKYA 1CZ1A 5CPTA 2V3FA 4NI3A 3WNOA 3LMYA 2ZUVA 2CPUA 2WANA 2JEQA 3OGVA 4W5UA 2CKRA 2A3BA 2W4XA 2WZIA 5HPCA 2YOCA 1UKOA 2BV9A 4U31A 4PMXA 2J74A 2QPSA 3QHNA 3L4WA 4A4AA 1KGWA 1OM0A 1BGAA 3QGVA 3UG4A 1B3ZA 2VOTA 2QPUA 4AZ5A 2VT0A 3EDKA 1IT0A 3L4ZA 3AZTA 3CHFA 3WBEA 4GPNA 3BCFA 3QOKA 2EXOA 1VEOA 5GNXA 1UWUA 5DMYA 3AISA 2WWDA 2WVTA 1UR9A 3OG2A 1FH9A 4KWUA 1YQ2A 3UG3A 4AC1X 3SUSA 1LJYA 1NOFA 2W92A 5FIPA 1DWFM 3ARRA 2YA2A 2DSWA 2O9TA 1G01A 5D9OA 4GI8A 4D6GA 4DWSC 1US2A 2DEPA 1WE5A 3AIRA 1W3JA 5FKYA 1XYZA 4AZCA 2ZX6A 1DEDA 3TTSA 1UD4A 4FLSA 1QNQA 1EO7A 3WD1A 1OT2A 1XRVA 1PIFA 1R87A 2GK1A 2JEPA 3DYPA 4NRRA 1LWHA 1NWRA 1QBAA 5A94A 4M29A 2XJ7A 3VO0A 4J3WA 1CXHA 1QW9A 3PZUA 4QLJA 1H5VA 4YN5A 3I3EA 4JHOA 2VQTA 1KR1A 6CGTA 1JZ5A 2ZUSA 3W0KA 1J01A 2BY1A 1JF5A 1PX3A 3GBEA 1U33A 2VZVA 5LA1A 1RD6A 1OIMA 2D3LA 3MUY1 1WZLA 1JYVA 5I79A 2RGMA 1ZJBA 4FLQA 2D3NA 4FF5A 2QV4A 2A3CA 1G9HA 2VRQA 2WYSA 1KXHA 1V3HA 3SEPA 2FHCA 3THDA 1Q6DA 3L4YA 2J77A 5I77A 1MW3A 2G3MA 1S46A 4CCCA 1TFVA 1M03A 3VD4A 1CWYA 4E8CA 4E2OA 5M03A 1M01A 2PBGA 3L4UA 2J8GA 3IANA 3WNNA 3VGFA 2VI0A 4ATLA 3VMPA 5GNYA 1VBRA 1VJZA 4D6JA 4UQBA 2XIBA 2J7HA 4D6EA 2A3EA 2QMJA 3E1F1 5I3DA 4MPKA 4DM2A 4AEEA 1QVBA 1ZBVA 2J7BA 2BY3A 2QHAA 4ATDA 4LYRA 3W6LA 3AYRA 1HKIA 2BHZA 2X1IA 2WCSA 3CMJA 1NOUA 4AZIA 2YA0A 3BSGA 1JG9A 5JH8A 1ZU8A 4MNLA 1HKMA 3GNOA 1UA3A 3AMLA 4CD7A 3WELA 2X0YA 5DFAA 3AZRA 5ECUA 1JZ3A 1B3WA 2VR4A 3WUFA 5A2BA 1YHTA 4QLKA 3PHAA 2WNWA 3AHTA 4OIFA 2C0HA 4HPHA 2W62A 2WBKA 2YJQA 5CPSA 4UOZA 1ITXA 3FAXA 1RPKA 1WDQA 1C7SA 5BXRA 1W32A 2V3DA 5D9NA 3W38A 3L4XA 2BVDA 3RM9A 3WD4A 2E9MA 1XSKA 1SMAA 3ARZA 4JFWA 4MAZA 4NF7A 3CGTA 1UD8A 2D20A 2RGLA 2YL8A 7CGTA 2WXDM 1EO5A 5IFPA 1E6NA 1V03A 3HMCA 3VIKA 1VEPA 3N12A 3WEOA 1GOKA 3B9EA 1JGIA 2WSPA 3DYMA 2AAAA 3W53A 3PZTA 3ARQA 5A8OA 2OWXA 5C70A 4XV0A 2XVGA 1GHSA 3VGDA 3WDQA 2G41A 2WZHA 3PZOA 4HA4A 1XSIA 4PSPA 5BRQA 3VD9A 1UD2A 5CSUA 1W9UA 2VZTA 3ZSTA 2J7EA 4JCMA 2XGBA 1Y7VA 3ARPA 2ZUMA 5A2AA 3TTQA 1E43A 4P8XA 2XYLA 1HKKA 4IPLA 3AROA 1UKSA 1XH2A 4AWEA 1NARA 2OSXA 1E15A 1KXTA 3CZLA 2BY0A 2J79A 4GKLA 1JAKA 4JHZA 1B3YA 3N15A 3MSDA 2DT2A 3PBGA 1SFSA 1UD3A 2D0FA 3S2CA 4ZEPA 1W2VA 1E0XA 1E3ZA 3WY1A 1WZKA 1BTCA 1CXIA 2C8NA 1UA7A 1C92A 4AD3A 4JL1A 3SCSA 1E70M 4KRTA 5E70A 3AI0A 4LGXA 1QI5A 3CUGA 4BQ5A 1VEMA 4UZUA 4CVUA 1E4NA 3EYPA 4P8WA 1GPFA 1CYGA 4UZSA 2AMGA 1WZMA 5E0CA 4CU6A 4QFUA 1DP0A 5C8BB 3EDEA 3GYCA 4MNMA 1XH1A 5I23A 5IFTA 2CBUA 1E0VA 3VIJA 4HOXA 4D72A 1V3MA 4KH2A 1VENA 3PN8A 4HPGA 1EHNA 4AD1A 3AZSA 3DECA 1OBAA 4P8UA 3WQ6A 2CCRA 4GQRA 1TUXA 1W3HA 2EPNA 2D23A 2OWCA 3BAKA 5KZ6A 3WDRA 3L4TA 3QHOA 3WN6A 1JYWA 1MYRA 4AZHA 2B31A 3VIPA 3A6OA 8A3HA 2V3GA 4HA3A 1QNRA 1V6YA 2W5FA 3AIUA 1JYXA 3OLDA 3LPFA 3OBAA 1G5AA 4ZENA 4U5KA 4B3KA 3CTTA 4PEEA 2J62A 1E6PA 3GXDA 1UKQA 4EE9A 4OKDA 2WLYA 1GOWA 1QPKA 1Z32X 4UOQA 1A47A 3DYOA 3SUVA 1KB3A 4UQAA 3VD5A 2OSWA 3ARXA 1NOWA 3EDDA 2G8ZA 3APGA 4D6IA 3LPGA 1WNOA 5A6BA 3SIMA 1OGGA 3GBDA 2W63A 2BHUA 4JFTA 1W91A 1JIBA 3DHPA 4H8VA 1WPCA 5KEZA 1PIGA 3ZM8A 3SUUA 2WMGA 4EANA 4JZ5A 4UQCA 1KWGA 4PTXA 1C8YA 3VILA 3HU7A 1UR2A 3GXMA 4PTMA 3U5YA 5CLTA 2UY2A 1FH7A 2CYGA 4LX4A 3WDJA 1BVZA 5BXSA 3VDHA 2O9RA 3WD0A 5IHRA 4W88A 4CCEA 6TAAA 4XX6A 3VD3A 1SR0A 1HJQA 2BHYA 1VF8A 4GI9A 2WAGA 2TAAA 2XWEA 5A1AA 3SUTA 1PZ2A 3F5KA 1JZ4A 2D0HA 3PZIA 1XC6A 4GZIA 3KL3A 2BY2A 2PF0A 4TX6A 4LYPA 1O6IA 1IV8A 2WK2A 4FLRA 3ZOAA 2ZUNA 1GJWA 3PZGA 4B9YA 3DC0A 1E73M 1UWIA 3HJEA 3VX0A 4OZOA 4W8AA 3G6MA 3WEMA 5CGMA 1TMQA 2J4GA 3II1A 2JE8A 1E1FA 1J10A 3W28A 4XB3A 2E3ZA 3K4DA 2WMFA 5AYBA 2W67A 2J8FA 1ISXA 4MDPA 3KE0A 3N1AA 4F8XA 1SMDA 1BQCA 2XFFA 2HVMA 1QI0A 3WMCA 3F5JA 1W9PA 3SCWA 1GQJA 1ZBKA 4OJYA 1CLXA 3NJ3A 1JDCA 1BPLB 3WF3A 1H3GA 4PUEA 4ACZB 1KQYA 1JXKA 4WSKA 2DDXA 1SYTA 3CH9A 1TVNA 3NSNA 2FHBA 1HT6A 4ML4A 3K1DA 4WKFA 1TE1A 4WK9A 1AQ0A 4F79A 3AICA 3VGEA 1M53A 5FCZA 2UWFA 3NDZA 1E9LA 3WH6A 3OZPA 4UFLA 1KGXA 3I3BA 1HX0A 3TONA 2EPKX 4E4PA 3W26A 2YDQA 3W37A 1GJUA 2WM0A 4HZ6A 1E71M 5AC5A 5ABHA 1UR0A 4MJ2A 3FAWA 3BGAA 5ABGA 5JIPA 3TTOA 3WNMA 1I1XA 2VVSA 1I1WA 3CMGA 3IJ8A 2V38A 1GORA 1NWUA 3GXIA 1GOMA 3VINA 1QOXA 5A8MA 3CZEA 2WPGA 1OWQA 1LWJA 5A2CA 4RE4A 3QR3A 2Y8KA 2XM1A 2AOSA 4PN2A 1MXGA 2V3EA 4U2YA 1LL7A 4TVUA 1HF6A 1K6AA 4WKHA 2YA1A 1TR1A 1EQPA 2CNCA 3M6DA 4PMDA 3U7VA 2G4FA 3WBAA 3VIIA 1PX4A 4M8UA 3VU2A 5LA2A 3PZ9A 1CIUA 2WLZA 4J3XA 2DSKA 5A6JA 1FP8A 2E4TA 2XSBA 4AISA 4RL3A 3WNKA 3RJXA 4PMNA 1J9YA 3PTKA 4OBRA 2QMKA 4MAVA 4M56A 4TVCA 3HN3A 1KXVA 4PMVA 2WKLA 1RP8A 2WHKA 1M7XA 5I24A 4V28A 5D9PA 4CKQA 2WVVA 5HNNA 1U2YA 3T2OA 4ZXLA 4P7QA 1CGWA 1E5JA 3DHUA 3AYSA 4W8LA 5BRPA 1B1YA 2OYLA 5A6KA 5A6AA 5E6ZA 5EFFA 1B3VA 5FOOA 3N04A 4GIAA 4FMVA 5CG0A 2CEQA 2ZUTA 3CUJA 4EAMA 1PPIA 4KMQA 2ZUWA 4L4PA 1W1VA 4R27A 4GQQA 3WL1A 3VDAA 1E72M 1PJ9A 3A4AA 1XYFA 5FD0A 5FL1A 5BROA 4M82A 5DT7A 4UFIA 1JYNA 2CKSA 1GOOA 2WC3A 4AZCB 3ARUA 4JKKA 2CITA 4BCEA 2X0HA 2VZOA 1XHGA 1E1EA 3CZKA 1KBBA 1PEZA 3CUHA 5CPQA 2CBIA 1XSJA 3AXHA 4Y7EA 2VX5A 3ZSSA 5I2UA 3O6AA 3W25A 1CGYA 4PCSA 1Q4NX 2WCGA 3N13A 5LA0A 4UQDA 1E4LA 2PI6A 1R85A 1HIZA 1XV8A 3VX1A 1MWOA 5EFDA 3VIFA 1HJSA 1NM9A 2ZX5A 2Q8XA 3IK2A 3MS8A 1KCLA 4H41A 3MMWA 1HP5A 1OGBA 4U3CA 1W9VA 3GNPA 4PUDA 2VRJA 1QNOA 2GUYA 4MB3A 2XHYA 3RO8A 3GXFA 2DSVA 5BXTA 4AIUA 4V27A 5E6YA 1W3LA 3OIHA 2PC8A 3S6TA 3RIKA 1E6RA 1ZS2A 4DWSB 1PAMA 3WFLA 4UQ9A 2GDUA 4OUEA 1BG9A 1TCMA 4UCFA 1W1TA 3A47A 5D8WA 3PTMA 3MO4A 3WH8A 1B30A 3M7SA 2J75A 2D22A 3BLKA 1GNXA 2O9PA 5M3WA 1FOBA 2WVUA 4R5EA 4IPNB 5DEZA 2YBTA 1XD0A 1BYCA 4TVDA 1W9DM 4PMQA 4AD2A 4B15A 4BS0A 1IZKA 3RM4A 2CERA 3AMGA 4P7LA 1C91A 3VMNA 2E9BA 4HMCA 2XUCA 4P7NA 2BXYA 1B90A 4PMYA 3RPMA 1L8NA 4Z2HA 3OLGA 4DM1A 1EQCA 2OSYA 1AMYA 2F61A 4AZ6A 1GQLA 1W9BM 1WB0A 1W1PA 2EPOA 4HU0A 1GOQA 1EDQA 4DWSA 3ALFA 4LQ1A 4D6FA 3KWXA 5A6LA 4S3KA 2VCCA 2BFGA 1GHRA 1WZAA 4AW7A 1GZJA 1OD0A 1CTNA 2CHOA 4AZBA 3QOMA 2YLAA 4HZ7A 1LL6A 4LYQA 3G6LA 4CN6A 2GVYA 1BYDA 3SURA 5EBAA 3FHAA 3GDBA 2JF7A 4W84A 3T2QA 1GQIA 1UOKA 2XVPA 1C8XA 3BC9A 4FLOA 3RILA 4LPCA 1E0WA 4W89A 1R8LA 5AYIA 3U5UA 4D1JA 3T08A 4F9DA 3LPPA 1MVYA 3ZJ7A 1GUVA 1JNDA 4MNKA 3SCNA 3ZIZA 2EBNA 5CSYA 4CVWA 2E8ZA 3CZGA 1BYAA 3WNLA 1V0LA 4PTWA 1DTUA 2ZIDA 2XTKA 4XZWA 2CIPA 3ARVA 1HN1A 1WCGA 3ARTA 2ZICA 4NSBA 4N42A 2WBGA 3N9KA 2VO5A 4QAWA 3WD3A 2XSAA 3SUWA 2XVLA 3W81A 4Q7NA 2VTFA 2VX7A 4TTUA 4N0RA 1UH2A 1XH0A 2DPEA 4CD6A 2MANA 1E5NA 2Y2WA 4H04A 3CUIA 4YHEA 3UESA 3BAYA 1H2JA 3CZJA 4LXFA 3WH9A 2FGZA 3U57A 2BXZA 4HU8A 3AOFA 3UR7A 4J3VA 4UFHA 1B0IA 4D6HA 2VX4A 4MNJA 3WKZA 4MB1A 1F4AA 2WCAA 3ZR6A 1BSIA 5DO8A 1K9EA 3AFBA 3M07A 1FHLA 2CBVA 2WZEA 4H8UA 4PMZA 2J78A 1CENA 1C90A 3TTYA 3WIJA 4U3AA 3ARSA 4MTVA 1Q6EA 3SCUA 3MV01 3OGSA 3L4VA 3WDIA 3T2PA 1EIBA 3BAWA 4W87A 3BAXA 3KEHA 1VIWA 2JIWA 3SCVA 1AQHA 3VIGA 4UNIA 3VUPA 3WSUA 1XD1A 1JL8A 1JZ8A 4KGLA 1UWRA 3BMVA 1GQKA 1NP0A 3WF0A 4Z2LA 5LYRA 1KCKA 2VRKA 1V3JA 1HVQA 2XWDA 1AQMA 3CHDA 4AZ7A 3AS2A 4ACZA 4JKMA 1E6XM 4A3HA 2XFRA 4WLCA 4GO9A 3VMOA 1JF6A 2YDRA 3PZQA 3ZQ9A 1J0HA 1WDSA 4WF7A 4GI6A 2V5DA 5I6SA 2YL9A 1HP4A 4B16A 4UQEA 5CJ5A 4W7UA 1G94A 3ZT5A 2VR5A 4CU7A 3B8SA 3AIQA 2G3JA 3AMDA 3KL5A 3O9NA 1BG4A 2JFEX 1JDAA 4DUVA 2VCAA 4V2XA 2EQDA 2ZUUA 3VKKA 2J7CA 2W66A 3WUEA 4B9ZA 5JBFA 2GJPA 3EDFA 2FH6A 3ZO9A 1FFRA 4Q22A 1QNPA 1W2PA 3AXXA 4CN1A 3SCOA 4AD0A 4M1RA 3AMCA 3RJYA 2PWHA 1B3XA 1UYQA 3VNYA 2YBUA 1OD8A 4OOUA 1VBUA 2UY3A 1XCWA 5HPOA 1K9DA 1CGXA 1ECEA 1CNVA 1UHVA 3MANA 1EGZA 3AJ7A 4JL2A 3WH5A 3K8KA 2ZX7A 1V3KA 4YPJA 3NDYA 2EPMX 5I0DA 2Z1KA 4CUCA 1WO2A 3UCQA 1B31A 1JD7A 4HOZA 4UR9A 3L2MA 4ATWA 3WMSA 4GINA 1UR4A 2W61A 5I5RA 1OCQA 1LG1A 1UUQA 1JZ7A 3CPUA 2VX6A 1TZ7A 5A3HA 1HJXA 3GH4A 2EPLX 3TA9A 4KRUA 1WP6A 5M17A 1GOIA 3UERA 2DIJA 4JKLA 2EJ1A 2JIEA 1C7TA 1VRXA 3NSXA 4IM4A 4CU8A 2PWFA 2YDSA 5FL0A 2IXVA 1UR8A 2OYKA 1QI4A 3FN9A 4UOJA 3WQ4A 3AHVA 1UKPA 1OGSA 2XGIA 1J11A 2ZWZA 2BS9A 2BNJA 4HMDA 1QHPA 2DGAA 4AD4A 1ZBCA 3B9DA 5HBFA 4CGTA 1JNEA 1V6UA 4PYSA 1NWSA 3J7HA 3U7BA 3IAQA 4H2CA 1ESWA 1XCXA 2CESA 4JFUA 1E40A 2F8QA 1N82A 2F2HA 2FH8A 7A3HA 1E55A 1VFFA 3D3AA 1ISVA 1CGTA 2CBJA 1UWTA 3POCA 3LPOA 2WVVB 4AIEA 1QBBA 2VNCA 3A4WA 2GK1B 1ISYA 4TOQA 3VDBA 3SCQA 5BCAA 1J12A 4TXEA 1D3CA 1ISWA 1Q6GA 4AYSA 1HJUA 5BYWA 5HDRA 4WIWA 3WQ5A 1CBGA 1TG7A 1MFUA 1HKJA 4BQ2A 3MMUA 3VM7A 3GH5A 4MB5A 1A3HA 3ZMRA 3FNDA 3EDJA 3F5LA 4MADA 4DWSD 3VOCA 1DHKA 2WKGA
chains in the Genus database with same CATH superfamily
5HOSA 3BVJA 3S1XA 4DAIA 2LPVA 4EVZA 3GDRA 3EZ4A 5CLWA 3PVFA 4GVFA 5DT5A 1JPDX 1S2WA 3FK4A 1A0DA 5D05A 4Z2KA 3APYA 1PKLA 4YYCA 3MKKA 3O5DA 3MHFA 1XLJA 4XAKA 4H8HA 4L80A 2CC0A 1L0PA 3CT7A 3BE7A 3H4GA 4HBKA 4CNOA 4PMOA 5M5DA 1IXNA 3EGJA 3TA6A 4Y96A 1JZ2A 1EDTA 3THQA 2F21A 4DJED 4PSRA 5LIKX 3AUJA 4GGBA 4AHPA 4U2ZA 2HE8A 3UVIA 1R7OA 3H2NA 1O12A 3W71A 2ZADA 4N19A 1AW5A 2GSJA 4NAFA 1Z6KA 1DHPA 1W5MA 1FVPA 2J7DA 4N2YA 2CLFA 1ZAJA 3OZMA 3RU6A 4A35A 1SO4A 2V5CA 6REQB 4JBRA 4EKJA 1J0KA 3Q67A 2V6AA 5CAHA 4RKAA 3VGGA 1DQXA 1BAGA 1EHAA 5DRIA 4RNFA 2FDMA 4WUIA 5HJXA 2BOGX 2YGYA 1EOMA 3W02A 1T11A 3SR7A 1UD6A 4Q8TA 1XFCA 3MUIA 3EBVA 4D71A 4FAMA 3VE7A 2KE0A 5CGTA 3GR8A 1MW1A 4JEQA 4HK7A 3MV11 2YX0A 2C71A 1E3XA 4I8YA 1V0NA 2X09A 3VZZA 1BF2A 3BOXA 1NVMA 2MLZA 5LSMA 1HGWA 3UI6A 4H9MA 1KNWA 2QJIA 1R7AA 4CD5A 3TTEA 2PWDA 1B5TA 2PLMA 3VI2A 3KACA 3HQPA 1R86A 1VFHA 5CSSA 1YX1A 2GJXB 3L67A 4OOZA 4WDUA 4F0RA 4L6OA 3FSUA 1A5NC 4JS3A 3AQUA 2QDGA 4D6DA 2PCQA 1XCFA 3C3UA 1GVIA 2Y24A 3GIPA 3UXIA 1RHCA 1W3IA 2RDXA 5IDIA 2AQVA 1CXFA 4S3AA 4L9YA 5BMWA 2Y5EA 3ERPA 2PUZA 4US6A 2ITKA 4WRHA 1CPUA 3TSDA 2IPJA 2NUXA 4DYEA 2JALA 1EH9A 4L6DA 1S5WA 1NSJA 3BAJA 4U4MA 1GEHA 3IRDA 2VC9A 2HS8A 3O7UA 4BF5A 1H11A 3KP0A 3GHSA 3P82A 5DY3A 4TTGA 4O4VA 2VMFA 1XDMA 4IPJA 2VUYA 5F7UA 4IMFA 2P3ZA 3NXFA 1KTNA 3LXBA 3RPTA 3ITVA 3ABSA 1AW2A 1E56A 4DROA 1DL3A 3LTSA 2VC5A 3ITCA 4U5IA 2X40A 3B7XA 1W0MA 1XYLA 3MSYA 2DT1A 1QK0A 2ZYFA 1AVAA 3GTIA 4K37A 2BGQA 4D1IA 6PTDA 3GVWA 3HF3A 3FA3A 4NL1A 3TN4A 2AL2B 4C90A 1C93A 1K9TA 3W00A 4M6PA 1KO0A 4LSBA 2ZXDA 3A5VA 2H8XA 1MMFA 4K1WA 4H7VA 1TPH1 3LV6A 3TVAA 1OSEA 1FKGA 2Y5SA 3VABA 5DITA 3GZ3A 3EMQA 1K8CA 1A5BA 3P8IA 4DNMA 1Y5XA 2DT0A 4ZB5A 1C8QA 1DKWA 3GUGA 4NVTA 4AU0A 1E4MM 2A6LA 5DX7A 1Y5VA 3UJEA 1HL8A 4JN6A 2UY5A 1LROA 1WXYA 1TA3A 2NT1A 3HBLA 2VJXA 1FA2A 3K8MA 1VYRA 3OJGA 1VS1A 3R79A 5AY7A 3C86A 1LQAA 1J6YA 4G2PA 1TTQA 3AO0A 4JFSA 4QT3A 1FFQA 4ACYA 4Q6JA 4KIRA 2EO7A 2O55A 2ISSA 4A29A 2DZVA 5A8PA 4X0VA 5FEWA 2QDEA 5I3JA 3VDCA 5K3VA 2G95A 1XQKA 3KAGA 4XKYA 4HTYA 3GM8A 3CUZA 3MP4A 5L6UA 4ES4A 4DZ5A 1JZ6A 4DZ2A 3NQFA 2NW0A 4GO8A 3GHRA 2YLLA 4V1YA 1W8GA 2MPHA 2TPSA 1CLKA 3UXDA 2PN0A 2PV2A 2OQYA 4AXNA 3A3HA 3C4UA 3MT1A 3TC5A 3MWAA 1H0GA 2VWSA 1G0CA 4OFCA 5E93A 3KADA 4UFJA 5CC7A 1TJPA 2E6YA 1RJPA 3T0BA 1WDRA 3H12A 4GCXA 1RK5A 4NI8A 1E44A 1DJHA 5BWFA 1DWIM 3A23A 2B5UB 2QDDA 2HS6A 2PTZA 1JCLA 3EKZA 4I3GA 3GHTA 2GL5A 2FB2A 1EYEA 4BK9A 3BLPX 2FZNA 5K4ZA 3UI4A 2NQLA 3CIWA 4Q33A 2YXXA 3RGTA 1VCGA 4CNUA 3UPBA 2PZNA 3BMWA 3W01A 4AH7A 3OZOA 4AMAA 1OINA 3EB3A 2QS8A 3BGJA 4DRJA 1J0ZA 3GNRA 2V81A 2C91A 2ZOXA 4IQ2A 4DO6A 3I7QA 2GOUA 1J8VA 2P1FA 3SQLA 3NZPA 3LHYA 4PBGA 3T0DA 2F7FA 1WKEA 3N18A 3CQHA 7TAAA 3DFNA 3VKAA 2F84A 3QKZA 4L1WA 5JBEA 3RMEA 2HK1A 2GVEA 4GY1A 3KZSA 3M9YA 1KBIA 3STPA 4HA1A 3VIHA 2GJRA 3EWUA 3CPGA 3EMZA 4WJXA 1TPFA 1VBJA 4BZYA 3U3HA 1FKBA 2MF9A 3UI5A 4R53A 1TREA 3GU2A 3HZ3A 1T41A 1Q2SA 2Q01A 4B5UA 2VZSA 3CLWA 1B9BA 1GW1A 1VH7A 3O0FA 1UPPA 4OHQA 4IUGA 4L61A 2A3HA 1RP9A 3JYJA 3ECQA 4L65A 3HO8A 3WMBA 3TP4A 3UEQA 5I06A 4XTDA 4ASTA 3KABA 4KCUA 4AY8A 1K8ZA 4PL2A 2QF7A 4Q7IA 3GZAA 4RW5A 3ANUA 1KBKA 4EWND 4X3ZA 2J47A 1R6WA 1VJIA 1S2CA 2VGGA 3PPCA 4LUTB 1JD9A 2CXGA 5DF0A 1M41A 1TJ1A 2Y63A 3FYPA 3THAA 3NTYA 1FKJA 1REQA 3KCOA 3PB2A 3E2RA 2ISFA 2DW6A 3W29A 2WMKA 3KUMA 5C0QA 4OV9A 2J9XA 3UF9A 4V15A 4CCZA 1GPWA 4IQEA 4Q8NA 3GS6A 1CCWB 5DRCA 4K68A 2J6VA 3LYEA 4FI4A 4O57A 3WF1A 3V5FA 2YXGA 4NJIA 2GFTA 3AIEA 3AXMA 1KXQA 1UBSA 1M5YA 4DZHA 1F9CA 3O6DA 4WHBA 3ZT6A 2OT0A 5EMKA 4ODQA 3CB8A 4YHGA 3GO2A 3IJIA 1HVXA 1V0MA 1HL9A 3TFXA 1SO3A 1PX8A 4GYFA 2C6QA 4X2RA 4PTVA 3CWHA 3OQEA 2DY3A 4JIHA 5H8PA 5B80A 2PDJA 3QMSA 1LLOA 3OOBA 1R38A 1TRIA 1ZRQA 4LNCA 1CZ1A 2D2GA 2V3FA 3LMYA 2ZUVA 3EEGA 5HUOA 3OGVA 3N9RA 4DI8A 2CKRA 2A3BA 2WZIA 1EA0A 1UROA 2BV9A 4U31A 4P61A 5D03A 3QHNA 3L4WA 1KGWA 4ZVJA 1EC8A 1EL3A 4AZ5A 2VT0A 2MNRA 3S5YA 5J6EA 1AG1O 3AZTA 5CBJA 1H7WA 3BCFA 2P8BA 3G2GA 5GNXA 1UWUA 4H19A 5HW8A 3N19B 4Q7BA 3PBMA 1QPRA 3S1WA 4Z08A 1YQ2A 3F2BA 4DZ3A 1FKWA 3ISIX 4AC1X 3GW3A 4XIMA 1NOFA 1US0A 2W92A 3TXZA 4OECA 4WXYA 2ZQUA 4U86A 3G1VA 3ABRA 4QS6A 2Z4GA 4ALDA 5D9OA 2H6RA 1JCYA 1US2A 3WLOA 4IGMA 2C1HA 1DQUA 3NTPA 3OTRA 2VWTA 1UD4A 1QNQA 4GKTA 3TYDA 3EWZA 3SRDA 4IX2A 1EKOA 4H6KA 2GK1A 3DYPA 3W7IA 5A94A 1PBKA 4OTKA 2JGQA 1H5VA 4M6UA 4JHOA 2VQTA 1TV8A 1KR1A 4GWEA 5DMLA 1JZ5A 2ZUSA 2BY1A 1PX3A 3GBEA 1VC4A 1U33A 2DP3A 1W56A 2VZVA 4G5DA 1I2RA 4S3CA 2PAJA 1JYVA 2RGMA 4LAMA 1ZJBA 5T26A 3VNDA 1MNZA 1AL7A 1PKYA 3M0ZA 3SEPA 2TYSA 4Y9MA 3HGOA 2J77A 5I77A 1I2OA 4CCCA 2TODA 1TFVA 2NQ5A 2QUMA 2D73A 3S9ZA 3S8HA 2VXNA 2J8GA 2AL1A 3WNNA 2VHLA 4AYGA 4IQJA 3A22A 1VJZA 1LRQA 4UQBA 2J7HA 4ZA0A 3E1F1 4ODOA 4M1BA 3E5BA 2FMNA 4FIRA 3V18A 2J7BA 4NIRA 1FKRA 1QPLA 1XGDA 1MSSA 3H26A 4HYVA 1UR3M 5DANA 4S38A 1NDVA 3NM1A 4DI9A 3QXBA 4NNRA 3LENA 2FZMA 3RF9A 2NXGA 3G0UA 3GTFA 4ADSA 1JZ3A 4MJMA 4MYAA 1FD9A 4M51A 1FAPA 4GI4A 1IR1A 4XQ6A 1YHTA 4DXVA 1QPOA 4FOJA 1MDLA 4FN2A 4EIVA 4JTLA 4HPHA 4PBEA 1B4KA 4UOZA 1ITXA 4OT7A 4NAEA 1OJXA 1T99A 1C7SA 5RUBA 1W32A 1BQGA 4OE7A 2RUQA 3WD4A 4IGHA 2WZMA 1F07A 1M65A 1SMAA 3CWNA 3WX7A 3URQA 2D20A 5DIVA 3QPZA 3BQ5A 3GNXA 1V03A 3HMCA 3BQ6A 4ZBCA 3C2EA 3WEOA 1LWIA 2A85A 2WSPA 4IJBA 1MO0A 4GH1A 5I3KA 2OWXA 5C70A 2FKPA 2XVGA 5D2XA 4EAYA 3V16A 5CSUA 1W9UA 3BO9A 3GTXA 4B4FA 5KZEA 1P0KA 2BASA 1M9HA 3HG5A 3N14A 3ARPA 3R2GA 4LAVA 3N29A 3NDOA 4P8XA 1J4RA 1HKKA 5AYYA 2PP1A 1UKSA 4AWEA 1XH2A 1KXTA 1GZ1A 1Q85A 2BY0A 1WKDA 3JVAA 3MBFA 4KKXA 2DT2A 3S1VA 1Q7MA 1SFSA 3S2CA 3VZXA 1E3ZA 2HSAA 6XIMA 1WZKA 4AVNA 2YZ5A 3AUOA 5CAKA 4FF7A 2GGEA 2ASHA 1Q6QA 1QI5A 1JR1A 3MHGA 4N9EA 1BKFA 2PE4A 3EYPA 4DJDC 1CYGA 2DFAA 1G7VA 3U8GA 4IUOA 5I23A 1HFBA 3UYIA 4Z1YA 4C1NB 3E38A 3O6YX 4HPGA 4XVEA 1EHNA 3DGBA 3DECA 2CCRA 4GQRA 1TUXA 2OWCA 1IWBA 1ZUAX 3STCA 1G7UA 4UXDA 5KZ6A 3L4TA 3EWBX 1JYWA 4MSSA 3LA4A 4GIEA 1MYRA 1TV4A 3DFOA 4DRSA 3QV6A 2YCLB 3W7GA 2V3GA 1QNRA 3SB0A 3W2UA 2QUUA 4XSLA 1LZOA 1JYXA 4DF0A 3LPFA 4PEEA 1E6PA 1YPXA 3S2LA 3JRKA 1QPKA 3JR2A 1Z32X 3M0HA 3ZR4A 1OC6A 3VD5A 4EWJA 4E2VA 4CLMA 1NOWA 3E0FA 2CLEA 1V5XA 4S3EA 3ITOA 3QR1A 3IK8A 1PL9A 5A6BA 1MRQA 3D47A 5JQ9A 4J4KA 4D8ZA 2B7NA 1W91A 1JIBA 5EBUA 1PIGA 3B03A 3SUUA 4H6QA 4EANA 4JZ5A 1EX5A 4UQCA 3Q65A 3DU0A 3VC6A 1UUMA 4IXXA 1C8YA 3HQ1A 4GUJA 5CLTA 4DQWA 3H2CA 3H21A 4LX4A 4QJ3B 3WH0A 1TR9A 3A4JA 3M0JA 5BXSA 5D2WA 2O9RA 4BI5A 1A5KC 4XX6A 2VDHA 5KSWA 1HJQA 3PUEA 3TSBA 1EUAA 4HIBA 2Z6IA 4R33A 3ZWTA 1W3TA 1JZ4A 3SM0A 4GZIA 5F1VA 4QG9A 3KL3A 4A05A 2AKZA 3QTPA 2H9AB 4XBSA 3L0GA 4N6FA 2VFDA 3G3DA 5T8GA 4J9JA 1EC7A 1UWIA 3BZGA 3G6MA 3R8GA 2QCLA 3P14A 2J4GA 4WSHA 4XBJA 3II1A 2J88A 2JE8A 1E1FA 4HNUA 4E2BA 2E3ZA 2G3FA 3KCJA 1A3WA 4QJ5B 4O4WA 2ZC1A 2DUAA 3KE0A 4PUMA 1Q6RA 2XFFA 4DY1A 3TH6A 3IHZA 3WMCA 3PP7A 5HWJA 4ILSA 3VKDA 1PYMA 7ODCA 4UC5A 2ALRA 4QM1A 5CBIA 2OLSA 1CI1A 3TNOA 3WJZA 3EPOA 1Y8BA 3O0KA 1DJZA 3IGHX 1K03A 3NVTA 3MI2A 3NSNA 4UBPC 1SSGA 3K1DA 1DJIA 1ONWA 3AICA 2HBXA 3S3GA 5TIMA 2NV2A 3KBSA 3OZPA 2G0WA 3EXRA 1HX0A 2DZBA 4E4PA 3W26A 2G5WA 4B2DA 2VP8A 1QW7A 3W37A 1GJUA 3BGAA 5ABGA 2NX3A 1NU5A 4DELA 4P5UA 3KTXA 2PCEA 1X1OA 4YVVA 4DO5A 4S3DA 1QOXA 2JGYA 1X38A 3QV8A 2KAUC 3MKCA 2BVWA 3PSWA 3LY0A 2AOSA 4IT1A 1MXGA 2V3EA 1LL7A 2X1RA 2YA1A 4DPQA 2EGZA 3E0WA 2G4FA 3GG8A 4MHBA 1Q7QA 4A8LA 3HPSA 4WGXA 3WBAA 3VIIA 1TIWA 1CIUA 1O94A 3UFYA 5A6JA 3M16A 3WQFA 3QY6A 2E4TA 2PDCA 3G0XA 4RL3A 4PFHA 1E9YB 3MSRA 3USZA 3A64A 5H1WA 2XP3A 3BMXA 3MCOA 1OCNA 2DUZA 2IKJA 5I24A 5D9PA 2WVVA 4MYXA 1U2YA 2ZZ2A 1TMLA 3T2OA 3R6IA 1CGWA 1HG3A 1RVGA 4HK5A 2AQWA 4O12A 2OYLA 5C7VA 1SVDA 5EFFA 2HXTA 1B3VA 3H2EA 3P6LA 5FOOA 3OW1A 4JN8A 1ZQ5A 3U9IA 3UWVA 1FXQA 2ZUTA 3CUJA 1PPIA 4KMQA 1SW0A 4GLEA 2ZUWA 5I00A 1JPIA 1LUCB 3WL1A 1TRDA 3A4AA 3VDAA 1Q1CA 1XYFA 5FL1A 5BROA 1VCFA 4UFIA 1GOOA 3N9SA 1F7BA 2Z2BA 3ARUA 1XLIA 4O18A 1V7AA 4Q8VA 1XHGA 3QZEA 3R12A 1PEZA 5B7ZA 5BZAA 1VFTA 5CPQA 2CBIA 4GYPA 3PF3A 2KI3A 1EGVA 3MDYB 2CFFA 3KHDA 4KEUA 1B4EA 2ZQ0A 3TJ4A 4LW7A 3MCMA 3UW6A 1KT1A 3VNLA 4ITZA 1HIZA 3VX1A 2Z1BA 1MWOA 2QEZA 3VIFA 1NM9A 3PR9A 4TU1A 3P67A 4QG6A 1Q6IA 4KW2A 2WSYA 3EXTA 2Q8XA 1T8QA 3IK2A 4H41A 1QXLA 3CV6A 4U3CA 4GXWA 3TEVA 1W9VA 3GNPA 1QNOA 3PFRA 3RO8A 4D8AA 2DSVA 4DBDA 3A5FA 2CZ5A 5E6YA 3S9YA 5HJYA 1UMYA 3QPEA 4IF2A 1G4EA 3VCRA 1FKLA 3WK1A 1X8CA 2ZTJA 3UF8A 3F2DA 3NPUA 2R6OA 1LRTA 2WZTA 4U28A 3BK0A 3WH8A 5LXXA 3BLKA 3AU6A 5TQLA 3DC8A 3S5OA 2E77A 4IPNB 4YTTA 1Q4WA 5A5WA 2X30A 1XD0A 3VNMA 1BYCA 3ID7A 2PDUA 5EU9A 4AD2A 3OIXA 1VPQA 2A0NA 5AHFA 1RY0A 3RM4A 2CZEA 4LRTA 1XLLA 4FXRA 1DJXA 2NQ9A 2E9BA 2XUCA 4C6DA 1EEXA 5ENLA 2BXYA 1B90A 1NDZA 4PMYA 5EMJA 3RPMA 3TJIA 4Q8MA 1FJDA 3ZVHA 6XIAA 4XG1A 3U4FA 1EJUC 1W1PA 1XDLA 1KLZA 3L68A 2PU1A 4H6EA 3MWCA 4D6FA 3W1RA 1GW9A 3W9ZA 4DPPA 5CZTA 1OD0A 1CTNA 4AZBA 1QAPA 3QOMA 2NXIA 4LF2A 3CTLA 1OQFA 3S5NA 1H1ZA 2ACQA 2DW7A 4JQ4A 1BYDA 4J35A 2WM1A 5EBAA 3FHAA 2XVPA 4Y9PA 1C8XA 3BC9A 3CNYA 4LPCA 1VBGA 2Y7EA 4R34A 4HZMA 4AIBA 1LOQA 4TW7A 1TJ0A 3IIVA 2POZA 3LPPA 5KETA 4DBWA 1PZ1A 2OZ0A 4QDWA 3SGGA 1EUNA 3F4NA 3ZIZA 4JY8A 4PTWA 3DBNA 4HSHA 3EWDA 2DVUA 3QGKC 2I9EA 5JU6A 3ARVA 4NSBA 4QAWA 2XSAA 1RSCA 2VTFA 4N0RA 5EMMA 1Y65A 3LQLA 3UD6A 2R91A 2Y2WA 3LCXA 4HPJA 4ML9A 2QCFA 5CPNA 1QPQA 1V7YA 3LG3A 1LT8A 4U84A 1D8WA 1FCBA 2BXZA 1O60A 1OCBA 3LXCA 4J3VA 4UFHA 3W2JA 1B0IA 4D6HA 2HE5A 2VX4A 1QMLA 1UC5A 3W6YA 3GVRA 2PF8A 2Q3RA 2I56A 3NAVA 3TTYA 1Q6EA 3KRUA 1QRQA 4GNVA 2ZR6A 3U2ZA 4G56A 5J04A 4C6NA 2VEKA 3T2PA 1EIBA 1O5KA 4UR7A 3KEHA 3A24A 2QJHA 1AFSA 3UY7A 1LDCA 1DPMA 3WSUA 1ZJIA 3S4TA 1JZ8A 3WF0A 4Z2LA 2QZRA 3ATZA 1RXOB 4RDVA 1HVQA 3H2FA 1AQMA 3CHDA 4D2JA 2B7PA 3LCIA 4DRQA 3OA3A 4A3HA 4B2DD 4RV8A 4GO9A 3ZQ9A 2UBPC 1J0HA 1JUBA 1TPVA 1WDSA 4GI6A 1GTHA 2YL9A 3H22A 3D6NA 4M6QA 4UTTC 3ZT5A 1GT8A 2B7QA 4E38A 3B8SA 3AIQA 3L66A 1UIOA 2ZRUA 4LVAA 2G3JA 3STFA 3KL5A 4DUVA 2GQ3A 4YIWA 2GZXA 1A53A 2PD5A 4V2XA 2CXEA 2ZUUA 5HR6A 4Q8QA 4WY0A 3E0VA 1YNPA 3ZO9A 3SECA 2OFNA 1W2PA 4GRSA 2PP3A 1A4MA 1FKDA 1KKOA 1OD8A 4OU1A 3COTA 2UY3A 4DYKA 1XCWA 2TSYA 1HL2A 3QY8A 1K9DA 5BOFA 1A5LC 1CGXA 4RDYA 5CCZA 1UHVA 1EGZA 3AJ7A 4K7YA 4MOZA 1W1ZA 1FWJC 1NQKA 2IQ0A 5FJPA 2YCKX 4ZQPA 3UCCA 4CUCA 4ZOEA 1B31A 4FNTA 3BPWA 3L2MA 5F4WA 4UUIA 4GINA 1NDYA 1DE5A 3QZAA 2Q6ZA 3CAVA 3CPUA 3GXPA 1JRBA 3RLGA 3UQIA 3VOFA 1FWWA 4RPQA 4DJEC 3V0UA 3GH4A 3TA9A 2HPMA 4WVXA 1AJ2A 2DIJA 4LUTA 4M19A 4TV6A 4WCJA 3ABZA 4ORIA 2IXVA 2OYKA 2MNTA 1J6PA 3FN9A 3GK0A 2RH9A 3PUOA 1OGSA 1M7JA 3OEXA 2BS9A 2FPYA 4HMDA 2OVLA 2XZ9A 5HBFA 1V6UA 1A49A 4Z17A 4OV4A 4WDWA 3U7BA 4BR1A 4OWGA 4U85A 3WLSA 4IL0A 1E40A 3TW6A 2Y0FA 8TIMA 5D33A 7A3HA 5HWNA 3ELFA 2XPAA 5D02A 1LORA 1UPMB 5ECVA 1FTXA 4Q8OA 5BU6A 4J40A 3KLKA 2A6NA 3TAKA 1ISYA 5DY2A 3VDBA 3FFSA 3PBWA 3UG8A 2DVTA 1ONRA 1Q6GA 2A7RA 4RZBA 5BYWA 4WIWA 1FKTA 3W7DA 4DX3A 1QUMA 1Q13A 3UY8A 1MFUA 3NO5A 4I5RA 3GH5A 4MB5A 4LTSA 3ZMRA 3F5LA 4MADA 1XM3A 1Q6HA 1DHKA 3W7JA 3CL6A 1BXNA 3I68A 5LNVA 3NM3A 4QE1A 1QHZA 4HNVA 2GGIA 3M64A 4LJ3A 2PBCA 1MW2A 1H09A 4YLWA 1GRJA 1XXXA 1M7PA 5HWBA 2VKZG 2OWWA 4QJ4B 3QQWA 4NQ1A 2XH7A 4PC8A 1RUSA 2ZQTA 1R9ZA 1V3LA 1LYXA 2UY4A 3OGRA 2DZSA 3IVSA 1O66A 3MMDA 1L9WA 1DE6A 4HMEA 5FJTA 1Z48A 3CAQA 1EA9C 3W7KA 2M2AA 1MFVA 1MQPA 2EKGA 3A3XA 4Q4KA 3VIMA 5HK4A 3VZYA 1JCHB 3CBWA 3WLMA 3PJUA 5GVJA 2O7SA 4X60A 1MEIA 4F0MA 2OKTA 1N7KA 3ABOA 5JMUA 5ABFA 4XD4A 2WSKA 1BRLB 2WNZA 4GOAA 1XUUA 9RUBA 3WDHA 3WFZA 3GAYA 1XW8A 4L1XA 1JI2A 3B8UA 4W5ZA 3VDGA 1ODZA 3FVMA 3UWEA 3O5PA 5KTLA 3B8TA 3RG6A 5MKGB 1IE7C 1B2YA 1PZ0A 4HZ8A 1OYBA 4QBXA 4NG3A 3KRBA 3G8EA 1JDDA 3WLRA 1NJJA 1WDPA 4XIAA 1QO5A 4XSMA 3TNBA 4XAPA 2ZX8A 2XM2A 3UZYA 3UZWA 1QHOA 4KERA 1Q6CA 4J28A 1TIMA 2XG9A 4GY0A 3W7PA 4CNSA 4IPXA 3D3FA 4LU0A 3TJXA 4GXPA 2A3AA 3I65A 2WHLA 3AHYA 1V6TA 4RK8A 3AHZA 2DUXA 4AB4A 1CEOA 4FHAA 2XU2A 3HQOA 2XISA 3WQWA 5KITA 2Z6JA 4MMWA 4H9XA 2QCDA 4P7OA 2MLXA 1XLCA 2VGIA 1R3SA 3THCA 3GLCA 4GA8A 3SY1A 3NSMA 3WBYA 4INFA 1KV8A 2IXUA 2PURA 3GR4A 3PG9A 3ZT7A 2CZVA 4A3YA 2YL5A 1OT1A 2PPOA 2ACSA 2E25A 3ZLGA 3FYOA 2X2YA 4ODMA 9CGTA 2WW5A 3PZMA 5HTGA 5AHMA 5CG7A 1EF2A 2HNEA 3BSMA 4UMAA 1S5TA 5HAOA 1VB9A 1V6WA 2X05A 1KWKA 1GONA 1TZZA 3F1QA 1RA5A 1YKWA 4BQ3A 3A13A 4O15A 1JAEA 4O11A 4NJJA 4AZGA 3SZ8A 2BTMA 1N8FA 2D24A 1IIHA 5D9MA 2DSUA 4ZXOA 4HN8A 1H1NA 1ME8A 2FHFA 2GWGA 1A5OC 1KRCC 1K7EA 3LQGA 4MKSA 5K7JA 1K70A 3DGRA 1T0OA 4JXCA 3WFAA 4JTUA 4HSNA 4M24A 3VK5A 2VEGA 4NY2A 1QDSA 2PRHA 2OR2A 3T0AA 1QNSA 1A5MC 5F2IA 1V02A 5C9ZA 5ABEA 3W1XA 3ATYA 1HJVA 4E8DA 3D5HA 2H90A 1ISZA 3R11A 4LBUA 2QXWA 3PS7A 2J7FA 3N4AA 4HHPA 2VFHA 3TOPA 3RLHA 3UETA 4X63A 3IKGA 2CLHA 2QCHA 2I5GA 4W93A 2WJEA 4Q3MA 3GD6A 3USBA 3B0XA 2V82A 1MEHA 4Z2IA 1EC9A 3KBVA 1VLWA 1H7RA 2WJFA 3FXYA 1PCKA 3EPNA 1WOBA 4KFOA 3CUXA 1PYFA 1QO2A 1V08A 4L5ZA 4P7RA 2G3NA 3C3NA 5BXPA 5K9CA 3IWPA 2OJPA 4I5UA 1GK8A 5DMMA 4TX8A 3URNA 3OVQA 1BYBA 4JX4A 1M04A 2DZPA 1Q5MA 2GGJA 5B7YA 3WENA 5GPGA 1P1XA 1H49A 4PL1A 1DBTA 1V02E 4P8VA 1FP9A 5CZKA 2FVLA 1FKSA 4WY0B 2AKMA 3K8LA 2R1LA 4EXAA 4DWDA 1H5YA 5K4XA 3OLIA 4Y9NA 2E1DA 4ZE4A 4RNHA 4S3FA 1ZL1A 3GDMA 1OZQA 3P93A 1X1NA 4QCFA 4PRTA 5FEPA 3NQEA 4DO4A 3SADA 4I90A 1YLVA 3EOUA 3MI3A 3TZNA 4A3UA 5D8ZA 5E09A 4AY1A 2PWGA 1VYPX 1FH8A 2QF8A 1XIHA 4MY8A 1US3A 4NAFB 2KZHA 4H7CA 3TDFA 2QJGA 2X2GA 2ZR5A 3ZS4A 3ITLA 2ZDRA 4GQBA 3CZ8A 1C3FA 4N9DA 1KFWA 1NMWA 1J5SA 1BWKA 3AS0A 5HNRA 3CHEA 4JAWA 8CGTA 1K02A 1FXPA 3O5IA 3FVDA 2JZVA 3MUAA 3MZNA 4JTSA 1PKMA 3NIYA 5LNRA 3W27A 2J7GA 3WK3A 4LOCA 2DH3A 2OCZA 2VN1A 3L2LA 4YTUA 5A6MA 3RR4A 4MUPA 1HKVA 2VFFA 5A6BD 4B5NA 4YTRA 2HV5A 3AMKA 1U1HA 4DJDD 3ZJKA 1W6TA 3IAPA 3TFCA 1ZCNA 3IV8A 3R43A 1BRLA 2F23A 4XAYA 3W4RA 1E6QM 4GIRA 5PTDA 1CXKA 3IARA 1RY8A 3KOXA 4FK9A 3RX2A 4S3GA 4QNWA 4QP0A 1QNVA 3SCRA 3B4YA 4PMRA 4NJKA 3LS9A 4GK8A 1Z42A 1LP6A 4XO7A 2WO5A 2BXVA 4QDPA 4UTLA 4YJ5A 3V36A 3LSCA 4HB7A 3MB9A 1QWKA 1ZB5A 3WQ8A 4JYDA 1P6CA 3W82A 2ZQSA 1IEWA 2O4MA 1FWFC 2XIJA 3T55A 1M5WA 1KC7A 1K1DA 4UFKA 4J3SA 1F4HA 3R0KA 4QQ3A 3LB0A 3AS1A 3QMRA 3N2OA 3MI6A 1XIBA 1WBJA 2IPWA 4XZNX 2OGYA 3F4VA 3G77A 6A3HA 3G5EA 4E8GA 2WHJA 3E96A 1XJBA 3V75A 4ZPWR 4KFPA 3PJTA 2XVNA 3RM8A 2A2IA 1K8YA 3QHMA 1U83A 1BD0A 5D37A 3AHXA 4AC7C 4KEVA 1H62A 1WX0A 1XRSA 1ZJHA 3CV7A 3F4CA 4XZMX 3T78A 4PUJA 4MJ4A 5FF2A 4CD4A 3W88A 1HXVA 5J5RA 1X6UA 2E9LA 1FHDA 3WJSA 3FHQA 1HXJA 4KPLA 4EXQA 1ITCA 4IQLA 2PV3A 1UZ4A 4M7SA 2AGKA 4XZHA 3WCZA 4XUGA 4R88A 1V0KA 2MUCA 4KIEA 1HJWA 4FPSA 4K8GA 3R4IA 3BW3A 1U30A 3HG4A 1PZ3A 4MKVA 3DDMA 2XFYA 4CD8A 4YXGA 5JBDA 4Y9AA 3C56A 3T40A 3NL5A 2KGJA 3VGBA 5ABFB 1RH9A 4PCTA 1PTGA 1PTDA 3CO4A 2PLKA 3AIVA 3ZR5A 3FGCB 5G1TA 3KTCA 5FI8A 1OX4A 3ZFHA 3LEPA 3VM5A 1DWGM 3MU7A 4TMBA 4BY3A 3CYVA 1WKYA 1SZNA 2W3ZA 2CPUA 2WANA 1OFEA 1XL9A 2VEIA 5HPCA 3RFAA 1UKOA 2J74A 3SFKA 4A4AA 1OK4A 1BGAA 3N4FA 1SUXA 4AEOA 5EY5A 1FKIA 1B3ZA 2VOTA 4AWSA 3OHMB 3EDKA 1IT0A 3O05A 2QJMA 4GPNA 1FWNA 1ROUA 3BLIA 1VEOA 1C9HA 2P10A 5DMYA 1P0BA 3B8IA 1AK5A 2NVCA 2R1PA 2NWRA 3SUSA 3P60A 3GDTA 4L4LA 1DWFM 2O9TA 1G01A 2DEPA 5FACA 1WE5A 5M2FX 3AIRA 1W3JA 5FKYA 2ZX6A 4ODRA 3BURA 4FO4A 4GG9A 4FLSA 1EO7A 4W9TA 4IQDA 2JK2A 1XRVA 5EGRA 4JTCA 4NRRA 5LGZA 1SGJA 3CS2A 1QBAA 1Z69A 3VO0A 4J3WA 4JHMA 1QW9A 1UOZA 4TO8A 1JEZA 1YXCA 3SN0A 3NWRA 4XAZA 1TTIA 4HPNA 3GHUA 1W1B1 4N9BA 3BANA 5LA1A 5BXJA 2V30A 2D3LA 4ERGA 3TMLA 5CZ0A 4RZ5A 1L6WA 3HV9A 5I79A 4KCWA 1V3HA 5FSDC 3NEHA 3THDA 1FWHC 3L4YA 1TWZA 1D6OA 2G3MA 7REQA 4E2OA 2QCCA 1FWSA 1M01A 2PBGA 2TMDA 1Q6LA 4O50A 2DG9A 3W7OA 3IANA 2INEA 3VGFA 1F6PA 3KRZA 3M0YA 3HOJA 4LAWA 3HQNA 3PFMA 1ICQA 3AWOA 4DM2A 4H00A 1ZBVA 5C6MA 4IIGA 3L5LA 1SFTA 4KF1A 4M7TA 1AD1A 2VELA 4ATDA 4LYRA 3QY7A 4N7QA 4IFKA 1I2QA 3RMJA 1BSLA 2X1IA 1ICPA 4S39A 3CMJA 4AZIA 4IGNA 3W2KA 3BSGA 1JG9A 3GNOA 2R8WA 6ENLA 3H7RA 4QEHA 3MHUA 2X0YA 3WELA 4UTHA 2DV0A 4MY9A 4MY1A 3UYCA 2C16A 1M1BA 3UVAA 3UQAA 3VC5A 1R46A 4CNTA 5K9DA 4C6QA 3HV8A 5KINA 4QLKA 2FVMA 2WNWA 3PHAA 3L12A 2W62A 4MZ8A 2BMBA 2VGFA 1OG0A 5BXRA 4MWAE 2V3DA 3W38A 3L4XA 1X7IA 2EPHA 4LUJA 4Q4PA 2P5NA 4K8EA 3NNTA 1XSKA 4GACA 3ZYZA 4JFWA 4H8NA 3HURA 4NZJA 1S2TA 1J6OA 2PFHA 3VIKA 4L9XA 3LBMA 1HO4A 3N12A 2RDTA 1GOKA 1UP0A 3B9EA 3JS3A 1Q45A 3DYMA 1OFPA 2AAAA 3M7WA 3ARQA 2FQIA 5A8OA 1NF0A 3G1RA 4LS1A 1TWSA 4XZIA 5AFDA 1GHSA 1REQB 3WDQA 3PZOA 1I0BA 4PGLA 3VD9A 1UD2A 3QQ0A 2FTYA 4E4UA 2ZVRA 1WYIA 2NWSA 4XZ9A 4JCMA 4R9XA 3KS6A 3N2TA 1RQHA 1K6WA 5FF0A 4IPLA 3DFSA 3FJNA 4GKLA 4JHZA 3XIMA 2LGOA 3RXZA 1B3YA 2F9RA 1OFAA 2OQHA 5CKSA 2ZZ6A 2D0FA 1O1ZA 2PPGA 4ZEPA 1SSDA 1E0XA 3GG1A 1LUCA 3UZZA 3LU2A 1H51A 4YS1A 1MUWA 1UA7A 4AD3A 3KW3A 4XD6A 4XK2A 3AYVA 3AI0A 1IEVA 4R7OA 4LGXA 1H7NA 4UZUA 3NQ8A 1E4NA 4P8WA 4JX6A 3TQPA 2AMGA 3LHTA 3M5VA 4O1EA 1WZMA 4CU6A 2VEFA 2OZTA 3CO8A 2OZ8A 4LB4A 3EDEA 3GYCA 3FAPA 3URBA 3PPGA 3S1GA 2QIWA 1I60A 5IFTA 1FUYA 3UQNA 2Q5AA 3ONBA 2B7OA 5JXQA 1VENA 5HA7A 3LGEA 4O0KA 2PTYA 3V0SA 1KFBA 2HDJA 3P0WA 3OU8A 2E6DA 1W3HA 3G1DA 3WDRA 3DFPA 3K1GA 1UASA 4IIDA 3VNKA 3LLDA 5HULA 1F6YA 2B31A 4ZOAA 3QM3A 4D8LA 8A3HA 3M0IA 5HNUA 1V6YA 3S2JA 4NZ5A 1PWLA 1A0CA 4PUUA 1KM2A 1S5NA 1Z89A 4OKDA 2WLYA 1GOWA 3UXAA 4UOQA 4FSAA 1F8IA 3SUVA 1KD0A 1KB3A 4ORMA 2I14A 3ARXA 4ZQCA 4K39A 3SN1A 1WNOA 3SIMA 2BHUA 5KEZA 1X1ZA 3DHPA 4DVOA 1EF3A 4H8VA 2WMGA 4B3ZA 1FBAA 1TJ2A 3T0CA 4JFIA 1MUCA 1UR2A 2BBFA 3GXMA 3U5YA 4IL2A 3QEZA 1FH7A 2CYGA 3M47A 1WUEA 1KRMA 3WD0A 3DFYA 1SFLA 4W88A 6TAAA 5DIUA 3JYMA 4W4QA 3O5MA 3VD3A 1SR0A 4JIRA 3MY9A 2WAGA 2XWEA 4AWUA 1IGSA 3SRHA 2X1UA 1IXQA 3F5KA 4U10A 2D0HA 3PZIA 1XC6A 4GC3A 4GD0A 2BY2A 3V0TA 1L8PA 6REQA 2JBMA 4BHYA 4LYPA 1UB3A 2WK2A 3LGDA 3I6CA 3DENA 3ABQA 4FLRA 1ICSA 3PZGA 4G6CA 4B9YA 1E73M 1IWPA 2CWXA 3HJEA 3GU0A 4XO6A 2PP0A 5CGMA 1FWEC 1TMQA 3TMQA 3MPGA 1X96A 1RK6A 3Q58A 3LCGA 3OVGA 3DESA 1IT8A 2P76A 4PB4A 3I6TA 4C91A 1TMHA 5AYBA 2J8FA 4WXZA 3VCNA 1JNTA 4KEZA 3O8AA 4JQ2A 4HNOA 4ECLA 3T8QA 4R7WA 1Y0EA 5XIAA 3F5JA 1W9PA 3UT0A 4PULA 5LHFA 1ZBKA 2W0UA 2ABAA 5E9XA 1F76A 5T91A 3L21A 1A5CA 1QWGA 1PINA 2Q02A 5BOEA 4GVIA 4HYRA 1CB2A 2WQDA 1KQYA 3NL6A 4WSKA 5AKQA 3EX6A 1TVNA 3PBVA 1VP5A 2FHBA 3C2FA 4ML4A 5HW7A 3OBKA 4WK9A 4F79A 3LOTA 2AL2A 2QR6A 3NL2A 1ZAHA 2UWFA 4KR0B 3C2VA 3WH6A 1E0UA 4EF8A 3AC0A 3NQGA 3N6HA 3E5PA 2FZBA 2YB1A 2YR1A 4HU3A 1YNYA 4JQ1A 4HZ6A 3PBUA 4J2PA 1MRAA 3CMGA 3MP5A 4O28A 3XISA 2X7WA 1VIZA 1NWUA 5F4SA 1ZFJA 3GXIA 3MVTA 3S2MA 5A8MA 3CZEA 3LRLA 5F1UA 4GGHA 3C6CA 4WY0F 3Q2DA 4PN2A 4Z1BA 4U2YA 4WKHA 4ZTXA 3RO6A 1TR1A 1EQPA 4PMDA 1EPXA 3U7VA 4XWUA 1KFKA 3VU2A 4N4PA 1NTHA 4CEXC 2WLZA 3B0UX 2DSKA 4AISA 2PMQA 3WNKA 1NIUA 5H8MA 4OQVA 4PMNA 3B04A 1XKJA 1J9YA 3PWAA 5G4HC 1ZTVA 3PTKA 4NJGA 2QUNA 1TYGA 4H01A 2WV8A 4RJEA 1OYCA 3EB2A 3W73A 4LAOA 1W31A 3TC3A 4PMVA 1SZGA 1RP8A 1PUDA 2V68A 4L6HA 4V28A 4CKQA 1V51A 3H2AA 1I2NA 4B91A 4P7QA 1E5JA 1XI3A 3DHUA 4JTRA 5A6KA 3H2OA 1TPWA 2F2DA 4GIAA 3EY6A 3T44A 4FMVA 5CG0A 2MLYA 2GLKA 1P48A 4EAMA 4XKMA 3N34A 1W1VA 3LN3A 1QR7A 1VGAA 5FD0A 2Z28A 2M1IA 2WC3A 2PTXA 3G1YA 4H9YA 4JKKA 2CITA 1FWCC 2PWVA 1ITUA 4TW8A 1E1EA 3CZKA 1K8XA 1KBBA 5BMXA 3CUHA 4JIPA 4A22A 5E5CA 1MDRA 3LHZA 2XN1A 4Y7EA 2OG9A 2VX5A 4OUIA 1RR2A 1YE4A 5I2UA 3O6AA 3EPMA 4IICA 1CGYA 2Z2UA 1EBGA 2V2CA 2E5DA 2P0OA 3N13A 4UQDA 1E4LA 4AF0B 1R85A 2KX9A 1IF2A 1W54A 1XV8A 7ENLA 1NMVA 2JKEA 9XIMA 4IIEA 1KCLA 2GUBA 3ONCA 3QKEA 4PUDA 2GUYA 2BDQA 3GXFA 3QGAC 4UNLA 3KLLA 1ADDA 1E51A 4ZFCA 1Q3NA 1P0NA 2C3ZA 1W3LA 3SSJA 4RX0A 1DXEA 3E9AA 3IPWA 4ZCWA 3RIKA 1E6RA 1ZS2A 3TR2A 4C6EA 2NVAA 1PAMA 4FOKA 1G69A 4G8TA 2VC7A 4TQTA 4TX9A 1SO5A 1ENUA 3IVUA 2H9AA 4ZODA 4TNSA 2ZBTA 3MO4A 4OGZA 3W1PA 4J5NA 5M3WA 1FOBA 2WVUA 3SSZA 2EF9A 4FX6M 4WZHA 4DYJA 4BS0A 1X97A 1SJBA 1ZNNA 4IP7A 4LUSB 4P7LA 4UDMA 4PUNA 5I07A 4HMCA 2ZTKA 3PY2A 2RQSA 3QSTA 4QTGA 3SJNA 1GGOA 2OSYA 5LZLA 4XAGA 3TZFA 4AFYA 3VAVA 1F61A 1W9BM 1U22A 3SGUA 1KFCA 3IEBA 4MVAA 1GOQA 3WO8A 1GG1A 3ALFA 4LQ1A 3WQGA 3VFCA 3NPVA 4JEJA 5A6LA 1PDYA 1O4UA 2Z29A 4S3KA 3L0KA 2VCCA 2BFGA 4GXMA 4AW7A 1F8AB 4YTQA 3P5ZA 4DZIA 2FFCA 3PPHA 4HZ7A 5AOUA 2ADAA 4CN6A 2GVYA 4G7EB 3SURA 5MF5A 2HEJA 1ECQA 3NQDA 3LLXA 3LZ3A 3GDBA 2JF7A 4NAEB 4ZTYA 1FCUA 1AW1A 4O8RA 3VOGA 4FLOA 2A21A 3RILA 4ROQA 2V5KA 4NUWA 3T9PA 2BG5A 2DG4A 3CGMA 2E6AA 1EP2A 1XPGA 1I6NA 4HNTA 1FKKA 3WK2A 3WQDA 1A3XA 1RD5A 3GYEA 5CSYA 3S6OA 2E8ZA 3TYZA 3IIOA 5XIMA 3HPFA 2KR7A 3S83A 1Q2RA 1DTUA 2ZIDA 1D7HA 5HINA 2XTKA 3TYCA 2ZICA 5CSRA 2PWUA 1HKWA 5EMLA 2PLCA 1GVRA 1GVEA 2XVLA 3W81A 4TTUA 1UH2A 2DPEA 4MGVA 4ODPA 2I5IA 4YHEA 4NASA 3UU0A 2FGZA 4RDZA 3AOFA 3UR7A 1OF6A 4Q8UA 1VKFA 4MNJA 3JU2A 3H4XA 3SFWA 3WKZA 2QKFA 1G4PA 3ZR6A 3EKGA 4JPGA 3KDOA 4AY7A 4CNPA 1FHLA 1T6MA 2CBVA 2WZEA 1SPQA 1KKRA 5LNWA 1TCDA 4H8UA 1FKXA 2J78A 3JXVA 1CENA 3WIJA 4MTVA 1HZYA 1FHVA 3B4UA 3CLMA 3P81A 4B90A 3WDIA 4G2DA 1VD6A 3EX1A 4AX6A 4GX9A 1WV2A 1AQHA 1L6YA 3R5EA 2G37A 2H8ZA 1XD1A 1JL8A 5F2LA 3HM7A 1UWRA 3BMVA 1F8MA 2FVKA 3OP2A 1V77A 5LYRA 3W7NA 1KCKA 1V3JA 3O5LA 1HUVA 2J8TA 2Y88A 4A6GA 2OGJA 4W9PA 3AS2A 1GWJA 1E6XM 1W1A1 2Z1XA 2CU0A 3GC5A 2XFRA 4F2TA 3PZQA 1R2TA 1A5SA 2SFPA 4Z1CA 2YW4A 4WF7A 1ZK6A 5DMNA 3MCNA 1FWBC 5FJIA 4MM1A 1HP4A 4RNIA 4UTMA 4W7UA 4LVBA 4DRPA 1PDZA 1V4YA 4WQ6A 1Z9AA 4N4QA 4C6OA 5EPDA 3REQA 2C1IA 3M0LA 1Y5WA 1DIKA 4GY7A 4YVPA 1R2SA 4XBKA 2ZDSA 5IOBA 4R0XA 4GHRA 5JBFA 3EDFA 2FH6A 4Q22A 3B9NA 1SW7A 3NRKA 2RDWA 3G1XA 3SCOA 3LNMA 4A21A 4AD0A 4LFYA 1UMLA 3ICJA 3AMCA 3RJYA 2PWHA 5AC7A 2YBUA 4JTJA 4OOUA 3B05A 3FKKA 1VBUA 1NFGA 2O56A 1JVNA 3WJXA 4ZPVR 2OOGA 5LIYX 4IMGA 3S6DA 3B40A 1CNVA 4DJFD 4JL2A 3WLIA 3K8KA 2ZX7A 1ZAIA 3CWOX 1XYCA 4DRHA 2EPMX 5I0DA 3INPA 4O54A 1IEIA 1S3HA 3E02A 4UR9A 4AX7A 3FX4A 3OO2A 1RA0A 1XIFA 5G4WA 1UR4A 2W61A 1JCTA 2AQOA 5FF4A 3ES8A 5TBOA 1RV8A 4UTWC 1R30A 1OCQA 4Q4SA 1BKHA 3GTHA 1K3UA 3BLFA 1UBPC 3G1FA 4QE4A 3TAOA 1WP6A 5M17A 3UERA 4JKLA 4ADUA 3E2QA 4WD0A 3AYTA 1KFJA 1OC5A 1VRXA 2C18A 3U4AA 2PWFA 2YDSA 1QI4A 3WQ4A 3AHVA 2DQWA 3WQPA 4XD5A 1L2UA 3GKAA 3RUBL 2ZWZA 3F4DA 1EZ2A 2PDHA 4AD4A 1JNEA 4PYSA 1TWDA 4LH8A 1X39A 4H2CA 1ESWA 5C2XA 3S5SA 1N82A 1YE6A 1F3EA 2F2HA 3APTA 1VFFA 3D3AA 1ISVA 1UWTA 3POCA 1XWYA 1T7LA 3ITTA 3B0PA 3RU8X 4N02A 3ZVIA 1NF7A 3CT2A 3SCQA 3QC0A 5FEZA 1KRAC 3AALA 2RSEA 3KAFA 4PA8A 1Y0OA 1J12A 4TXEA 1D3CA 3WLHA 2FLIA 3H23A 2O7QA 4W9OA 4AYSA 1HJUA 1T5AA 1AZ1A 5HDRA 1ADOA 4TIMA 3CV2A 4RXGA 3KDNA 4MJZA 4G50A 1HKJA 3VM7A 2IQDA 3EDJA 4ERIA 4PUKA 1F3TA 3TW9A 3VOCA 3DAQA 3BH4A 3F03K 5IXEA 3OB8A 1NSGA 3PG8A 4NZFA 2WC7A 1M6JA 3CHCA 1YXDA 1V6VA 4AHOA 1HGYA 3A4XA 3NO3A 4M80A 3WQCA 1FWAC 1EXPA 4XUYA 3IJ9A 1CDGA 3UWYA 2CHNA 3V1PA 5A8NA 3WL0A 3L5MA 3WF4A 2PDXA 1EYMA 2DZXA 4LANA 2QT3A 3WLJA 3ARWA 4WDTA 2OU4A 4F0HA 2FPTA 1H0IA 3WH7A 3Q45A 4NU7A 2ZZ3A 3BAIA 1UC4A 3HJZA 3Q94A 2ZRWA 4F66A 2VENA 1I75A 3E3HA 3HGRA 3NQ2A 4JNMA 3LXAA 1XGZA 3QV9A 3RX4A 2EEXA 4GCAA 1I45A 4LRSA 3TE9A 4GABA 1VFLA 2Y5JA 4IP5A 3LDVA 3UR8A 3V3WA 2OYMA 5I3HA 2Z26A 1BFNA 3I4EA 1CLVA 1UWQA 2E8YA 3FY1A 2WMHA 3B8DA 1QI3A 4CEUC 1EP3A 4HBEA 2QCEA 5CEWA 1U5HA 4GH3A 1E1CB 3P0XA 4J3TA 4IFRA 2WOQA 3TXVA 5TAOA 1ZPTA 3GE7A 4GC4A 4QNEA 4C7DA 4TW6A 1G1YA 1A5UA 3VOIA 4LBSA 3LTYA 4IIFA 1W9XA 6TIMA 1VZWA 5DO2A 4C6MA 3PZVA 5A6TC 4XISA 4Z42C 1D3GA 3KM8A 4H9VA 1OZMA 3DI1A 1WAWA 4K3ZA 4YWSA 2X7VA 1S1PA 3M41A 1E9ZB 4H3DA 1DWJM 1EJSC 3N6QA 1MZHA 4EF9A 2WWCA 2V2HA 5G2IA 4FNQA 2DH2A 2RJGA 4IWWA 5EYWA 3NURA 3P3BA 3M5YA 2WPBA 5GJMA 5CC5A 1W1YA 4J7RA 3PZNA 3UQBA 1XLBA 4C7FA 2PDPA 4GFIA 5IHSA 4DAFA 2PDFA 3ARYA 3LCFA 2PDWA 3KOZA 3BXWA 3REQB 3N3TA 1W1IE 3IIXA 3T42A 1KCZA 4F2UA 2BVYA 2D1ZA 1H61A 4HMNA 4P2VA 3L9CA 4ZR8A 1VFMA 2G4JA 2WMIA 3PTQA 1FWTA 3H53A 2C19A 4O13A 4B3LA 4EK7A 1U1UA 1ODUA 5I78A 1BXBA 1D9EA 1D7FA 1RQEA 5LIUX 3C8FA 3N4EA 3RCMA 5HQEA 1ELSA 4UNKA 2FGLA 4R9OA 5CXPA 4E3VA 3UR2A 5AHEA 4UTFA 2ZXBA 3G22A 4KEMA 3NUKA 3H4WA 4PH6A 4WOQA 4YMZA 4JFKA 1PCWA 4HD5A 2E67A 4ZO9A 1JFXA 3I3DA 4LVGA 1C8VA 4ZGYA 3VTRA 4IQCA 2ZXAA 2VURA 4JYFA 4QRNA 4GNJA 1EJTC 3P62A 4R7JA 1EYWA 1B57A 4IPPA 3EWYA 1KA9F 1IQ8A 1C9WA 2R1MA 3ZWSA 3K13A 3WK0A 1TE6A 3UG5A 3P8JA 3NR0A 4REQB 3R7MA 3OVPA 4LV4A 2XSXA 3VOHA 1YTKA 1UH4A 5GPRA 4CQBA 3N2XA 3TLQA 3RRAA 1MW0A 2ESCA 1UCWA 1V93A 3O07A 3URAA 3PWIA 1KFEA 1VFUA 5TD4A 3TN3A 3N73A 2D2HA 1HNYA 1EQ3A 1MQQA 3EX2A 1W3NA 1VBHA 2QLYA 1XIMA 1ZHAA 1IWAA 1TO3A 4IIBA 2C7FA 1HTIA 3WBWA 1ZSXA 2GGHA 3PTDA 4O10A 2ZC8A 4MDOA 3KRSA 2WMJA 4HBOA 1OYAA 4ZB2A 4XD3A 3O5GA 4JIEA 5IM51 3LBOA 3N2BA 3LI1A 5CGQA 1EX1A 2WJZA 4Y9OA 1QJWA 5FJUA 2EHHA 3MSGA 1VAHA 4LUYA 1H41A 1PWMA 4RW3A 4G9PA 4LUSA 2GDVA 2XGZA 1JI1A 2WQPA 3F7JA 4D6CA 3I4KA 4CCDA 4LUIA 2Z25A 2VCBA 2HWGA 2BP1A 3MUZ1 1CECA 1TPC1 2C15A 3T7VA 3S1UA 4MB4A 4NX0A 1XDJA 5CC6A 4KGJA 1TVPA 2ZXQA 2XVKA 3AS3A 2GVLA 1EJRC 3PR2A 4NZCA 3M0VA 5CZJA 1WA3A 3LHWA 1W37A 3OLEA 4B5TA 3KOFA 1P6WA 4S3JA 1UD5A 4MPQA 1DVJA 4QAIA 4RZ4A 1KGUA 1VHNA 1MXDA 5I02A 2Y6ZA 2ZX9A 1GYLA 2E40A 1AUSL 3BLLA 1S39A 2DIEA 3GH7A 3O2LA 2J25A 4L56A 2J24A 4CNNA 2REQB 5C2GA 5D75A 2D0GA 1ONXA 2POTA 2X8RA 1UG6A 1GVOA 2Z1VA 4HGXA 1BXCA 1XIDA 1Z44A 3LNPA 3RDKA 2YKKA 3ALGA 1J0JA 4CQCA 4J4OA 3SY8A 5CQ1A 3B06A 4N6EA 1KM4A 2JQXA 1Z3NA 4KRZA 5H8UA 5HNTA 3QC3A 2YIHA 4JTFA 3NGFA 2RURA 4XAFA 2Y7FA 1LQ0A 4X9YA 2YCLA 5IDZA 1UH3A 1OABA 1FDJA 3AXIA 3JUGA 3C0SA 1EOKA 2NSOA 3RR1A 3NO1A 5HMSA 2ZA2A 1NH6A 3N11A 3I10A 4OBSA 5GQBA 2NT0A 5DCDA 4JX5A 3PM6A 1LF1A 4E4FA 1EWDA 1GCYA 4BQ4A 4QGCA 1ZBWA 4UTJA 1QOPA 4QSFA 2O92A 3W2NA 1TPEA 3R10A 2FB3A 4V33A 1AD4A 4QDMA 5DLCA 3GY1A 3TWBA 3LRKA 2R14A 1WXJA 5DELA 3W6MA 1JUKA 4JFJA 3ZJ8A 3LUTA 1JDFA 1IR2A 1RPXA 1J79A 4HQVA 4O0QA 3VD7A 3NQVA 2IQTA 2E7FA 4HHMA 5U7SA 2JKPA 4QEEA 2R9RA 4ZE5A 4CN4A 4HKPA 3BUVA 1P7TB 4JTDA 4YTSA 4BF9A 5EMYA 4AIOA 5HXMA 4PTNA 4XTIA 1J0IA 1ME9A 1VQTA 5EMUA 2XPKA 3ODKA 1KFLA 1D7IA 3UJSA 3W1AA 1ZP3A 1DIOA 1YTDA 3GC4A 1JCNA 5AYZA 3DKLA 3D46A 3IV3A 4YWIA 2PGRA 2Q09A 3DCPA 5A69A 3C52A 1XBZA 3CK5A 1IZCA 4L4OA 4PMJA 3NYDA 1KLYA 3GPKA 8XIMA 2XPBA 5LHEA 2P4VA 1B6CA 1BWVA 1R2RA 4PZVA 1VCVA 2PBOA 4A2RA 4GX8A 4O1AA 2HXUA 3MO7A 3IJQA 1CXEA 4Q8PA 2YFOA 2VFGA 3ZZ1A 2OQLA 4DHGA 4UTKA 4C6FA 1B3OA 3K4AA 3EWWA 4MWAB 4U33A 1ONEA 4X0NA 3IGSA 4KT2A 4YL2A 3RNDA 1E0TA 4KWSA 2E1WA 2CETA 2O9OA 4M81A 2WHMA 1S38A 2Y61A 3VNZA 5KMYA 1J18A 4UWMA 4HPXA 4N9CA 4Q8WA 3VA8A 3FV9A 4IMDA 1UR1A 3BSHA 5HQMA 1E9IA 2FPVA 1BWLA 1RCOB 1JPMA 5D4YA 5GNZA 3NQBA 4JR5A 5CPTA 4NI3A 3CL7A 1J4IA 4HHHA 1FRBA 2JEQA 4S2BA 4W5UA 2W79A 3HFYA 2YOCA 4HARA 3UNDA 2QPSA 1R3TA 1SM9A 3NZRA 3TIMA 1EEPA 1GVFA 1KM6A 4O52A 3DBPA 4QR6A 3KAHA 3GAKA 4KWVA 1LBMA 1TV3A 2V63A 1I4NA 5LGXA 2OTDA 4W9QA 3L4ZA 3CHFA 3WBEA 1M7OA 3QOKA 2EXOA 2ATMA 3GFXA 3TC6A 1SO6A 4YCPA 1EWEA 4GUIA 3QR0A 1AJZA 1UR9A 3OG2A 1FH9A 3UG3A 3PJXA 2LLEA 3UJ2A 3FA4A 5FIPA 3E0IA 2CZDA 1KTBA 2VD9A 2A4AA 3ARRA 2F4EA 4DWSC 2QPXA 1UP3A 3GB6A 5AVNA 4ZQRA 4HN4A 1RCQA 1XYZA 4AZCA 3KX6A 1GG0A 3BDKA 4B5XA 3V4BA 3WD1A 1OT2A 1PIFA 1R87A 4R3UA 1GVSA 3KBWA 3QZ6A 4AWTA 1LWHA 1R3QA 2QCGA 4M29A 3PNZA 1CXHA 2DJLA 3PZUA 3RFWA 4YN5A 1CT5A 1Z7AA 3I3EA 5B8IC 1OADA 4IG2A 1FX6A 2CHRA 4IT4A 1JF5A 1W5NA 3KOWA 1PS9A 3U2EA 3N2MA 1OIMA 3MUY1 3TDBA 1WZLA 3LLFA 4X61A 2D3NA 4LC8A 2A3CA 4F2BA 2QGHA 2GYIA 4JTIA 4RE0A 1PXGA 1MW3A 3G18A 1S46A 3L5AA 4JOMA 2ZR4A 4MLRA 1XKYA 2VI0A 1XFBA 4IPIA 4ATLA 3MTWA 2QV5A 5GNYA 4D6JA 3QVQA 4Z0SA 2A3EA 4QXIA 4MPKA 1ZALA 3QFEA 4UIOA 3IRSA 3S5ZA 3AWNA 3TN5A 1MI3A 3AU2A 4LCRA 4B5SA 2Q8LA 5C7HA 3UR5A 1HKIA 4BJHA 1H63A 4DF2A 1XX1A 1NOUA 1KM3A 3BG9A 4LVDA 4O0ZA 1O1HA 3FJ6A 5D2VA 1ZU8A 4MNLA 1QFEA 3AMLA 4CD7A 2REQA 5ECUA 3E2VA 2P50A 3T6CA 3ZLFA 4IOTA 2VR4A 3WUFA 2OEKA 3RLUA 2R94A 3MYOA 1VRDA 3AHTA 4F0KA 6ALDA 2HVOA 2QAPA 5BW6A