1TFVA

Crystal structure of a buffalo signaling glycoprotein (spb-40) secreted during involution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mammary gland protein 40
publication title CRYSTAL STRUCTURE OF A BUFFALO SIGNALING GLYCOPROTEIN (SPB-40) SECRETED DURING INVOLUTION
rcsb
molecule tags Signaling protein
total genus 107
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1tfvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tfvA01
1XCXA 4UOJA 3VNZA 2WBKA 4OUEA 2J77A 4KRUA 1BPLB 4AEFA 4ML4A 3T08A 5JIPA 1X1NA 1CXLA 1VRXA 2WVVA 2J25A 1Q6DA 2J79A 3SURA 1UH2A 3WNPA 2Y4SA 3BSHA 1JZ3A 4NF7A 4IM4A 5DF0A 3OLEA 3T0AA 3QHNA 4F79A 2BFGA 5DFAA 4UZUA 5CGMA 1EHAA 5CZKA 3WMSA 3MANA 1OM0A 4BA0A 5KZ6A 4W5ZA 1UKOA 3AIUA 4KGJA 5F7UA 2FHCA 1W9XA 2WHJA 3UESA 4UQBA 1NARA 1CGWA 4AD2A 4HOWA 1AMYA 4B9ZA 1MW1A 1E5NA 1C7TA 1OIMA 4RE3A 4P7OA 2ZUNA 1SR0A 5BRPA 4A4AA 1PPIA 3N17A 5FL1A 5A8OA 1JYXA 2G3NA 1ZBVA 1DWAM 1Q6GA 2OWCA 3U7VA 1XH1A 2WW5A 4R27A 5A3HA 1X6LA 3GNRA 2UY5A 3AXXA 4D6GA 2PF0A 1W9DM 3CHFA 1UR1A 1UHVA 2OYMA 1KXTA 4V28A 5A8QA 2VZSA 3BCFA 4AISA 1CGXA 4GKLA 1E6QM 3ARXA 1KCLA 3ZSTA 3CZ8A 2WZIA 1OD0A 1TR1A 2W91A 2E40A 4PUDA 1K9DA 1C91A 1IT0A 2J75A 3GBDA 4LXFA 4ZXOA 2X1IA 4P8VA 4FLSA 2CXGA 2BXYA 3N11A 1UKQA 2QV4A 1QOXA 3AI0A 1HF6A 1B3YA 1W9PA 1KGUA 4PCTA 1EGZA 2ZX7A 5JH8A 2D0GA 1J0KA 1UWIA 4E4PA 1H1NA 1V0KA 4HU0A 5DT7A 2UY3A 1V0LA 3CGTA 4MDOA 4OBSA 2J7HA 3VMNA 1W9UA 1C92A 4IPLA 1H09A 1B30A 4JFTA 5CSYA 1GOMA 2ZICA 1OT2A 4BF7A 1KQYA 1W2VA 5D9MA 3WSUA 4CCCA 4UFJA 4AIEA 2UY2A 1J9YA 4JFSA 2WMHA 5TD4A 1JZ5A 2YA0A 4W8LA 3QHOA 2VQUA 4RE2A 3UG4A 5DT5A 8A3HA 1ZJBA 4LYQA 1XH2A 3K8MA 1QI2A 1EOMA 5LA1A 2GJRA 2DSZA 3U5YA 1KCKA 2ZUWA 3IAPA 4M29A 2QMJA 3DC0A 2YL6A 4PMUA 5HOSA 2J7FA 3PN8A 1GOWA 4JKLA 4UR9A 5E6YA 1CLXA 1UWRA 1BYBA 2WSKA 1BYCA 3N04A 1I1XA 1BG9A 3ARYA 2VR4A 4FMVA 3ZR5A 1UWSA 5BXPA 3N15A 3RDKA 4KMQA 1UKTA 2DT0A 1QNSA 4PSRA 3TTQA 1JZ7A 4B3LA 1DWHM 3CZGA 4F8XA 3VD9A 3UR7A 1VF8A 4H04A 4W8AA 4MB4A 4UQCA 3EYPA 5HPOA 1JDDA 5ECUA 4HA1A 1VIWA 1L0PA 1WPCA 3AFBA 4HMCA 1KFWA 2OSXA 1V08A 1ECEA 2JIEA 3SUUA 2YDQA 5A94A 3IJ9A 3MSGA 2YLLA 1MVYA 3VM7A 1HJQA 2DH2A 1PIGA 4AXNA 3A3HA 4EANA 3ARZA 5A6KA 1TUXA 5A8PA 3SCRA 3PHAA 3GYCA 3NSMA 1NWTA 2FHBA 3W0KA 5HBFA 1W3KA 2ZWYA 3UG5A 2J8GA 1J01A 2XHYA 2DSUA 4CCEA 3FW6A 2FGLA 3DECA 1HVXA 3B9DA 1JZ4A 3I3EA 2BY1A 3WEMA 2DH3A 1GJWA 1UD8A 4KWUA 3BAJA 3L2MA 4LGXA 3RM9A 1I1WA 2PBGA 3AIEA 1E0XA 3PZ9A 1UD2A 1GOQA 4CU8A 5A6BA 2OLHA 3ZMRA 3CH9A 2V3FA 4JL2A 1A47A 4J3TA 1RPKA 3ZIZA 4LYRA 1WO2A 3E1F1 3I3BA 2QMKA 3NDYA 2DT3A 1WZLA 2OYKA 4ZFMA 3POCA 3VO0A 3WL0A 1W3LA 2MANA 2BHUA 1QI0A 1V3MA 4W7WA 2W66A 1KBBA 5CPTA 3WF0A 3N13A 2EPLX 1UZ1A 3MMWA 3GXFA 5E09A 1H5VA 2Y8KA 4M82A 2JF7A 4MJ4A 3M6DA 2VRQA 1LF1A 4PMYA 1ITXA 4R5EA 4F9JA 4GI8A 1DEDA 3MKKA 3OLIA 4U2ZA 3BAWA 1YQ2A 4CD5A 3F4VA 1M01A 3AISA 4BQ3A 3WUFA 1HKKA 2GK1B 3HMCA 3NUKA 1GNXA 2BS9A 4TVUA 5I24A 1OB0A 4IPNB 1XH0A 1MFVA 2WLZA 3QOKA 5BXSA 5I6SA 3MUIA 1JNEA 3VIPA 3WUBA 3GXIA 1JYNA 3AS1A 1E40A 3ZQ9A 4MNMA 3EDKA 1LL7A 4L4OA 1TA3B 4ZEPA 3N12A 4AZIA 4OZOA 4PRWA 2PB1A 5FCZA 4JHZA 1H4PA 4UFIA 3S6TA 5D8WA 1B9ZA 2CEQA 3MS8A 4GQQA 2ZIDA 1PX4A 5A69A 2EPKX 1DWJM 1FFRA 2WVTA 2A3CA 4P7QA 3SCVA 5A2CA 2WMGA 2GDUA 3WFLA 4UFHA 5IFTA 4Z2GA 3TA9A 2JE8A 3AJ7A 1E4NA 1QI3A 8CGTA 4AZ5A 2XJ7A 1VJSA 4DWSB 2VCAA 3WDJA 2WWDA 4NRRA 3RPMA 1ODZA 3K8LA 3HN3A 2PWHA 4URIA 1KXHA 2VCBA 2NSXA 2YL5A 2WPGA 3AHYA 3T2OA 2XFFA 4P8UA 1KBKA 3APGA 1K6AA 1PX3A 1ZJAA 1J11A 5CXPA 1NP2A 2WMIA 5A6LA 5D8ZA 2ZUVA 1E4MM 2A3HA 5LA2A 3MSDA 3EDFA 4TTUA 2PWDA 3VGFA 1W2PA 2VVSA 5AC4A 1E6XM 2IXUA 4BCEA 2FHFA 4AIOA 3W37A 5D9OA 1JG9A 2VNCA 5BWFA 1CXKA 3W38A 4M80A 3G6LA 2PBOA 3VIMA 3AICA 3VU2A 4Q22A 1B1YA 1JDAA 1XYZA 2YA1A 3AZSA 4JHOA 3WD2A 1GQKA 2VT0A 3LPFA 4M1RA 4CU6A 5I79A 3FHQA 4FF5A 4Y7EA 3CMJA 2A3BA 2VCCA 1W9BM 1M03A 3L4TA 4EAMA 1J12A 4UQ9A 3VKKA 1JXJA 2EPMX 3BCDA 1B0IA 4UQDA 3CLWA 1G9HA 4OOZA 3VX0A 3F5LA 3WF4A 5I5RA 3SCWA 2A3AA 4UTFA 4KGLA 1BAGA 5I77A 1BVNP 3WELA 5JBEA 1J10A 2XVLA 2V3DA 3GM8A 3UEQA 1E6RA 3PZMA 4ATLA 2FDMA 1Q6CA 5E70A 4WJXA 4HMDA 3PZOA 1XD0A 5I23A 2PWFA 1B3WA 3ZJ8A 1QW8A 5D9NA 4P7RA 1J18A 3AZTA 3K4AA 1KR1A 2CHNA 4PTWA 4HMEA 2ZXQA 4DM1A 3WF1A 2EO7A 2D22A 1JAEA 5ABEA 4WKAA 3M46A 3WNMA 4U33A 1E5JA 4CU7A 3FN9A 2JEQA 1B3VA 5A95A 3AIBA 2VZUA 2YOCA 1Q4NX 1HJSA 1UYQA 4U5KA 2VJXA 1J0HA 4CN1A 4GZIA 2VC9A 1E43A 4AEEA 2BXZA 2WNWA 1BFNA 2WMIB 2YJQA 2WM0A 1BQCA 1FA2A 1HL9A 4GZJA 1CBGA 3B9AA 2NT1A 1HL8A 4B3KA 1ISZA 1WE5A 5D4YA 1QHPA 2WCGA 3TONA 3A6OA 3WDQA 2G41A 3OB8A 3ARSA 3ZT5A 1W3JA 1JYVA 1CDGA 5EFDA 2VO5A 4PYSA 4GQRA 3A47A 3ARRA 3WKZA 1BVZA 4W88A 3ECQA 4YHGA 2X09A 5E6ZA 3EMQA 1OT1A 4Z2KA 3VVGA 3VD7A 2VX7A 2G8ZA 1UA3A 1V6WA 2CPUA 3VNYA 4TVCA 3WUGA 1CGYA 4F9DA 3VGDA 1NOUA 3AS0A 3CZLA 4TVDA 1JL8A 2YKKA 4BQ5A 3BMWA 1GORA 3BH4A 2CBJA 3KL3A 1EIBA 2PI6A 3GXMA 1J0ZA 2VRKA 3WFZA 4GXPA 2WC7A 1PEZA 1OGGA 3S2CA 1C8XA 1Y7VA 3GTNA 4J3VA 3BXWA 2WKGA 1H2JA 1QW9A 2DPEA 4AZGA 3EMCA 2EEXA 1TCMA 1V3IA 2GJXB 3TTYA 1JFHA 1OGSA 1TG7A 2CCRA 4UNIA 3CO4A 4MPKA 3WNLA 5JUVA 2ZOXA 4MJ2A 1M04A 2WZEA 4DUVA 2VQTA 5HPCA 1EXPA 1PX8A 3SUSA 5BCAA 2WVUA 4N0RA 2JEPA 1KWGA 2VX4A 1VFMA 2WCSA 4M24A 4H8VA 3AMLA 2X8RA 2XVPA 7A3HA 3VD4A 2V5CA 3AIRA 3NSNA 1V6VA 2Z1SA 4JFUA 1VENA 4TXEA 5DEZA 2W62A 4MNKA 4JCMA 4XB3A 1E0WA 1L8NA 3AHTA 3WDRA 4LYPA 4AMCA 5BXTA 3AYRA 1W1TA 4Z2LA 3GH4A 4W93A 4TX6A 2E8YA 4LPCA 1FOBA 4H41A 4HZ7A 3AIQA 5IDIA 2UWFA 2BY0A 3PZUA 3WQ8A 1LG2A 4FLRA 1FH8A 4V27A 4UQAA 3GNPA 1IZJA 3OGVA 4HOZA 1NM9A 1CXIA 2WBGA 4OOUA 3W27A 3W29A 2F61A 2V38A 2JFEX 4D71A 2B31A 2GVYA 4HZ8A 3L4VA 2XGBA 1UD6A 1QHZA 1GONA 3FAWA 4CN6A 1XYFA 1PAMA 1VEPA 2E9MA 4C7FA 1DP0A 4K68A 2PWEA 4AD0A 3KL0A 4MAVA 2W61A 3PTMA 3QOMA 3ARTA 4MB5A 3VX1A 2X2YA 4U31A 2CKSA 4Z2JA 3RJXA 2XVNA 3IJ8A 2G3JA 4PMNA 3WNOA 2Q8XA 9CGTA 2DSWA 5AC5A 1CNVA 4JKKA 1ESWA 3SCQA 2RGLA 1I75A 1VFUA 4MAZA 1QNOA 4DUWA 1JYWA 4S3JA 3N18A 3F5KA 1BLIA 3L4UA 3VIKA 1MW3A 3T09A 1CXHA 3VD3A 4CD7A 3WD0A 4UZSA 2WK2A 1FP9A 1GQJA 1HKMA 1QI5A 1CWYA 3II1A 3CMGA 2BHYA 2WHLA 5ABGA 3SUWA 3VM5A 3W81A 5IHSA 3G6MA 1OWQA 1MWOA 1GW1A 5M3WA 3J7HA 2OWWA 1ISWA 2FH6A 2WKLA 1C93A 4GIAA 4JIEA 5JBFA 1US2A 2CESA 1DWIM 4FK9A 1HN1A 4PN2A 1OBAA 4AZCB 3MV01 2WZHA 3WF3A 1ITCA 3BC9A 1JFXA 2ZX9A 3DYOA 3A4WA 2V3GA 3A4AA 4AC1X 2GK1A 4W85A 3WD3A 2WMJA 3W82A 3ARPA 1BYDA 4AYSA 1M53A 1Q6FA 3WMBA 3CHEA 1JAKA 4AZHA 1UA7A 1US3A 1FH9A 4RL3A 2WMFA 2DIJA 3AOFA 4U3CA 1EDQA 1YHTA 4CD4A 1DHKA 3CZJA 3WDPP 1W91A 5E0CA 1W9VA 1EQCA 4J27A 3U5UA 3VTRA 1TA3A 2BNJA 2CBUA 4ACZB 4CCDA 3RIKA 3ZR6A 3SIMA 5ABFB 5I2UA 4X0VA 4WLCA 2ZWZA 4PMDA 7CGTA 1HP4A 3WD4A 1UR9A 3BLKA 1G0CA 3QR3A 1GCYA 1WNOA 1MW0A 4CGTA 1J0YA 1W3HA 1U30A 4PBGA 1ZB5A 1U33A 3MV11 1XSIA 4DWSA 1WP6A 1MFUA 3FY1A 2WXDM 1PIFA 4BQ2A 3ZJ7A 2X05A 5CJ5A 1BGAA 1UUQA 5CGTA 2BVYA 1E6SM 5I3DA 4QLJA 2JALA 1RP9A 4P8XA 1E1EA 3AS3A 3GZAA 4PMQA 2WCAA 4XV0A 4GI9A 1GOKA 5CG0A 2WAGA 1E4IA 3WMCA 1DTUA 1ZU8A 1LLOA 1KR0A 1PZ3A 4NSBA 4P7NA 4PMRA 1SMAA 2WHMA 2Y24A 1H3GA 4TTGA 5M03A 2VVNA 2VURA 4MDPA 2ZE0A 3W6LA 6CGTA 2ZUSA 3W25A 4HOXA 1HJVA 1G01A 3CUFA 2C0HA 2WC4A 4FLQA 1UH3A 4PTVA 1UG6A 5AYIA 4E8CA 4QFUA 2O9PA 5A1AA 2ESCA 3GBEA 1LL6A 2C7FA 1MYRA 2AAAA 2XWEA 3ARVA 3VOCA 5CLTA 5CSUA 4ZE5A 5EB8A 2YIHA 4QCFA 4S3KA 1AQMA 3UETA 4DWSC 4Q7NA 3TTOA 1WZAA 3KZSA 1QHOA 2DT1A 1XRVA 4ZXLA 2Y8VA 2HISA 2VMFA 5AYBA 5CPSA 3RM8A 4AW7A 4XX6A 1K9TA 4WIWA 4H8UA 1A3HA 1B2YA 3MUZ1 3GXDA 3VDBA 1E73M 4JL1A 1EO5A 2GSJA 4AD4A 4WSJA 2EQDA 1CZ1A 1H41A 3W26A 3OA5A 1HNYA 1WDRA 3O2LA 3WENA 3T2QA 4CVWA 3ARUA 4W89A 2D3LA 4HA3A 1VEMA 3VGEA 2EJ1A 2VX5A 4JCLA 2WSPA 3WNNA 2ZXAA 5HDRA 2GFTA 2CERA 2WYSA 2V3EA 3NYDA 3AIWA 1EDTA 1OSEA 4OBRA 3TP4A 4H2CA 2TAAA 3CTTA 5FOOA 1CGTA 4OIFA 1NH6A 3EDEA 4Z2IA 2D20A 2J7DA 3MMUA 4J3WA 1LWHA 4D6CA 1HVQA 2C8NA 2XIBA 3DHPA 4WKHA 2QLYA 3WY1A 4AWEA 3SCNA 3N1AA 3RILA 3VDHA 4QP0A 2CETA 3AQUA 4D6IA 4JZ5A 1V0MA 3AZRA 1LL4A 2XWDA 2Y2WA 2D23A 1FFQA 1B90A 2VZVA 3FXYA 3CUGA 3WDHA 4CD6A 1QI4A 1WKYA 2XFYA 1FHDA 3THCA 1WDSA 2X0YA 3NDZA 4MB3A 5IFPA 4OKDA 3W6MA 5EFFA 4MTVA 1OIFA 2E3ZA 4PMXA 5A6SA 4YHEA 5BXRA 5GNXA 1X6NA 3AMDA 2W5FA 1NP0A 2VZTA 3A4XA 1BG4A 5KEZA 2WB5A 2O9RA 3WH6A 2RGMA 2WLYA 2CBIA 3O6AA 4D1JA 2CBVA 1XSJA 2AMGA 1UD5A 6TAAA 2DQXA 1QBBA 3VGBA 3AXIA 3DYMA 2JF6A 4GINA 1NOFA 1H0GA 1B3ZA 4PEEA 1R86A 4D72A 2GJXA 1UWQA 2E8ZA 3GNOA 4JFVA 1VBUA 1DWFM 3FHAA 4AIUA 3U7BA 2GUYA 3M7SA 4EE9A 2WANA 2EBNA 3CZKA 3T0BA 2XUCA 1AQ0A 3VIOA 2CITA 2XGIA 1G1YA 1UWUA 2F2HA 3THDA 5FL0A 5BRQA 4MADA 4XUYA 4LQ1A 4TX8A 2VTFA 5A8MA 3BAIA 3L4WA 3VMOA 4DM2A 1GZJA 2J4GA 2YA2A 1W32A 1FHLA 4PCSA 2Y5EA 5EBAA 1WZMA 4JKMA 1JXKA 1IV8A 3SCSA 1WDQA 1NQ6A 4D6JA 1BHGA 5A8NA 3VIGA 1GHRA 1TVNA 2W67A 3M07A 1PBGA 4PTXA 1R7AA 3PZQA 3AHXA 2EXOA 1E3XA 4CN4A 2VR5A 4ATWA 2XM1A 1NOWA 4M56A 1B31A 2YBTA 3WBEA 3FNDA 1PJ9A 3OBAA 4UCFA 3ZJKA 1C3FA 3NSXA 1TVPA 4RE4A 1JD9A 3T0DA 2G3MA 1G5AA 1RP8A 1ISYA 2QF8A 4L4PA 1E70M 2J7GA 3RMEA 1V6YA 2VRJA 4U2YA 3L2LA 2GDVA 5A6BD 1OD8A 1UR8A 2VOTA 2ZUMA 2BVDA 5BROA 3MMDA 1ODUA 1R87A 4DWSD 2XSAA 4CD8A 5D9PA 3ARWA 1V3KA 5DMYA 2IXVA 1QPKA 4XZBA 4D1IA 2UY4A 3ARQA 4WSKA 1BYAA 1TFVA 1CENA 1MQPA 3SCPA 1UKPA 1VFOA 4W7UA 3CHCA 3VIJA 4X9YA 3K1DA 3BSGA 1EDGA 3F5JA 3OZPA 2HVMA 4C7DA 2CKRA 5JBDA 4PMZA 1BSIA 2W63A 4F66A 5C71A 2O9OA 3PZTA 5M17A 1QVBA 1EQPA 2ZUTA 4YPJA 3BMVA 2J7BA 3NJ3A 3HU7A 1EOKA 4AD5A 1MXGA 2DEPA 5C70A 1GHSA 2BY2A 2ZXBA 4E8DA 1UH4A 3VUPA 1E4LA 1C90A 4IISA 3WIJA 4AZCA 1WZKA 5A2BA 3ZM8A 4JFWA 4AZBA 5IHRA 4P8WA 2YDSA 4ZENA 1UR2A 3ZJ6A 2VX6A 3ALFA 3BLPX 3ZOAA 2E9LA 5A2AA 1KXVA 3ZSSA 1E1FA 1HX0A 4KRTA 1JNDA 5JIWA 1HJUA 4A3YA 4C7GA 3PTKA 1D3CA 4QLLA 2J62A 2VI0A 3RJYA 2OWXA 4BZYA 3VIIA 4J28A 4D6FA 5A6AA 1W1VA 1GPFA 4ACZA 1J0IA 2G4FA 4FLOA 1QNRA 4HPHA 3WQ5A 3WUEA 5ABFA 2D24A 2XG9A 3D5HA 3VDCA 4IUGA 4U5IA 4DUXA 4NRSA 2G3IA 1E55A 3VD5A 1XCWA 2D2OA 4M81A 1E9LA 1GUVA 2YBUA 3LPPA 1AVAA 1F4HA 2WVVB 1SMDA 1XC6A 4J7RA 1LG1A 4W7VA 4MB1A 1KQZA 3L4YA 1GOIA 2WMKA 2XM2A 4PMOA 1Q6EA 3BAYA 3CUJA 3K46A 2QHAA 3JUGA 4GPNA 1Z32X 1K9EA 2E0PA 1LWJA 2A3EA 1JI1A 5DO8A 1CECA 1HKJA 4B16A 2DDXA 1H11A 4J3UA 3GH5A 1ZBWA 1VBRA 4AD3A 3AHZA 4JAWA 1JF6A 1H49A 5HXMA 2QPSA 2PC8A 1E0VA 1JZ2A 4AD1A 3T2PA 4WF7A 1EA9C 1VFFA 3KWXA 1UR4A 1V02A 2JIWA 3WD1A 2NT0A 1H0IA 3WN6A 3ZT6A 4BQ4A 4OJYA 1BGGA 4W84A 1GQLA 3WH9A 1SYTA 3AYSA 1HP5A 1OCQA 3OLDA 4ZE4A 1E15A 3TTSA 1W1YA 3PZGA 2YLAA 1UOKA 3MO4A 3VMPA 3OZOA 2E9BA 3ALGA 3PZVA 3VDAA 3ZT7A 1GVYA 4QAWA 1XSKA 4PTMA 3L4ZA 5HNNA 1MQRA 1J0JA 3WF2A 2CYGA 3SUVA 3WBAA 3HJEA 1UR0A 1WB0A 3WDIA 1D7FA 4HU8A 1JDCA 3NIYA 1MQQA 1XV8A 1KGWA 1M7XA 1F4AA 4AZ6A 1WAWA 5CQ1A 3CUHA 3UCQA 1VAHA 3CUIA 4GI6A 1GJUA 2VUYA 3WQWA 1HIZA 2J47A 1HKIA 1KXQA 2VZOA 2J7EA 2O9TA 4N42A 1JZ8A 4HA4A 3VILA 2XPKA 3N9KA 3CPUA 2WC3A 3I3DA 1KB3A 1U2YA 1XGZA 4W5UA 4QCEA 2EPNA 4D6EA 1AQHA 5FKYA 1UKSA 4W86A 1CGUA 5GQBA 3L4XA 7TAAA 5BYWA 2BY3A 4KH2A 1NWUA 4CUCA 2W4XA 1HJWA 3SCTA 3DYPA 3CBWA 3W53A 1JD7A 4EKJA 5A6MA 1WDPA 4D6HA 1E56A 3SCOA 1P6WA 2DSKA 3CHDA 3GH7A 3VIFA 1V0NA 3AIVA 3WQ6A 1E6PA 5CPQA 4U3AA 4CVUA 3CZEA 3LMYA 3WH8A 1GVIA 5I78A 3IK2A 1CLVA 2DSVA 5GNZA 2IUZA 3KL5A 3SCUA 3RCNA 2BHZA 2OSYA 2X0HA 3WQ4A 1MW2A 4J3SA 1VB9A 2VL4A 1V03A 5C8BB 1ISXA 3WL1A 2XVKA 1CYGA 2Z1KA 5M5DA 4XZWA 2YDRA 4AY1A 3KE0A 1HT6A 4UFMA 5EMYA 1OGBA 4PMVA 1QNQA 1R7OA 3K8KA 1XHGA 2XSBA 5A6JA 2D1ZA 1GQIA 1C7SA 3LPOA 1EH9A 4X0NA 4CKQA 2ZX8A 4TOQA 1FH7A 3BAKA 2FGZA 3EDDA 2E4TA 2D0HA 4GZEA 1UQYA 1UQZA 1CXFA 1N82A 3RO8A 1CPUA 3WH7A 3AMKA 1QNPA 3VIHA 2DIEA 3K4DA 4HZ6A 3BGAA 1W1PA 5FIPA 1R8LA 1D2KA 1XD1A 5I0DA 1JZ6A 2ZUUA 3TOPA 3AMCA 3EBVA 2YL9A 3CIVA 3D3AA 3EMZA 4EK7A 1MXDA 3PBGA 1V3JA 4B15A 3OLGA 3VGGA 3O9NA 1EHNA 1B3XA 4HP5A 1UD3A 2BV9A 4E2OA 4PUEA 3PZIA 1GOOA 1DWGM 1PZ2A 1RD6A 3OG2A 1TZ7A 4MNJA 5GNYA 5E0FA 4H8HA 4NZCA 3SEPA 1CXEA 4P7LA 3OIHA 3W4RA 2WHKA 4YN5A 3AS2A 1KGXA 3WEZA 4BS0A 4QDMA 2WVSA 1CIUA 1R85A 3RM4A 3AROA 2CNCA 4W87A 2J7CA 4Z2HA 1JIBA 1TMQA 1QBAA 4ACYA 1V3LA 1BF2A 1HJXA 1NWSA 4UOZA 3B9EA 1RH9A 1E6ZA 1EO7A 3UR8A 5ABHA 5E9AA 4A3HA 1JI2A 3IANA 1ISVA 1E72M 2OSWA 2J8FA 1NWRA 2ZX6A 3OGRA 4V2XA 2QPUA 1TE1A 3POHA 5CLWA 1ZL1A 5GPRA 3B8SA 2ZXDA 3GDBA 3W24A 5IXEA 5LA0A 2XIIA 4M8UA 1JF5A 1C8QA 3AHVA 1ZBCA 4HPGA 4TUFA 1OINA 5FD0A 1SFSA 2XTKA 3IJ7A 1CGVA 1LJYA 3WEOA 3FAXA 1K9FA 1O6IA 1G94A 1E71M 1FP8A 2O92A 2NW0A 2YL8A 4GO9A 4W8BA 3SUTA 4WKFA 1C8YA 1S46A 2XYLA 3QGVA 3OGSA 2AOSA 3UG3A 5LYRA 1V3HA 1VJZA 1V6UA 4AZ7A 3DHUA 2XVGA 4MNLA 2F8QA 4UOQA 1O7AA 3WNKA 1E6NA 2D0FA 3MUY1 1CEOA 4NI3A 3VPLA 3W28A 3NCOA 4J3XA 3WQVA 3PTQA 2V5DA 3QHMA 2CHOA 3U57A 1ZBKA 1UZ4A 1VEOA 3AXHA 4UFKA 1LQ0A 3MUAA 4UFLA 4B9YA 2DT2A 3LPGA 2OYLA 1V6XA 2WWCA 4UQEA 5AY7A 3AMGA 2J78A 6A3HA 4HTYA 3IAQA 2DGAA 3WH5A 3BAXA 4LX4A 1CTNA 4ATDA 2ZX5A 1WCGA 2BVTA 3VGHA 4GO8A 3PZNA 2CIPA 4QLKA 1V02E 3ZO9A 1UWTA 2D3NA 1BTCA 1HXJA 2FH8A 4D6DA 1IZKA 1ZS2A 4WK9A 2PWGA 2W92A 1UD4A 1E3ZA 1JGIA 3EDJA 4H7VA 4PSPA 2J74A 2EPOA 2GJPA 1KWKA 2XFRA 3MU7A 3UERA 3VINA 3KEHA
chains in the Genus database with same CATH superfamily
1A5LC 4AB4A 2J77A 4FXSA 4QS5A 1BPLB 2F6KA 4CNPA 4GUGA 3G1HA 1CXLA 3HG4A 1OVDA 1Q13A 1VRXA 3MYOA 1LWIA 3W07A 1Q8AA 2J25A 5SWUA 4IPJA 2J79A 1UH2A 1K70A 1PZ1A 2Y4SA 3BSHA 2C79A 3A5VA 1JZ3A 4NF7A 1SR9A 5EMJA 5C9RA 4XKYA 1EB3A 3MJYA 2XH2A 3PRDA 4YYFA 4GGBA 4TV5A 4XZ9A 5CGMA 5CZKA 1X6UA 4GK8A 3URAA 1M1BA 4GIRA 3BPWA 5F7UA 2FHCA 1W9XA 1E44A 1XIMA 4KEVA 4UQBA 4I5RA 1EYWA 1NELA 4DRKA 4QZVB 1A5NC 1OIMA 1ITQA 1SM9A 1SR0A 3IGSA 1JYXA 1IT7A 3U7VA 2XINA 4WOZA 4Q8VA 4LEQA 3UZXA 3TXZA 4FHAA 2D2GA 2UY5A 3AXXA 4D6GA 2PF0A 4BF9A 1W9DM 3SBFA 3GUGA 4V28A 5C9XA 2O7QA 1CGXA 4IICA 4LVFA 1E6QM 3ARXA 1FJDA 1R3SA 1OK4A 1QK2A 5F2LA 3N4AA 1OD0A 3VAWA 2XH0A 4DZAA 2VFDA 1IT0A 1GKPA 2J75A 1WXYA 3GBDA 4DRMA 1Q65A 4LRTA 1DJIA 2CXGA 4PB3A 4IHCA 3SGGA 4BJHA 2A2IA 1D3GA 1GVEA 1HUVA 5B8IC 1EGZA 2ZX7A 1N1AA 7TIMA 1RALA 1XUUA 1R3TA 2JGYA 1G4PA 4LEFA 3MCOA 2UY3A 2OO6A 2J24A 4KF1A 1V0LA 3QMRA 1C92A 3V36A 2NUXA 3APYA 3EAUA 4JFTA 2B7QA 1OFPA 1W2VA 2V8ZA 4AIEA 4UTHA 1EBHA 1J9YA 4NZ5A 2WMHA 5TD4A 5CJMA 4C6KA 3QHOA 4RE2A 3UZYA 1FWJC 4LB4A 4LYQA 3UYIA 4PUKA 4IQJA 4LUYA 2DG3A 1YTEA 3H2NA 3CLMA 5JXQA 3IAPA 2ZUWA 3DC0A 1IT8A 5H1WA 4DJED 1XYAA 1I1XA 3QW4B 1BG9A 1UWSA 3UGVA 1D9EA 1UZHA 2ZCGA 3N15A 4E4FA 3TTQA 4B3LA 2EKGA 1DWHM 1H7RA 3BURA 3LDVA 1J4RA 3I4KA 1UJPA 2E5BA 4UTKA 1CLKA 5HPOA 2I56A 4NJKA 1FCVA 5ECUA 3N6HA 1OF8A 4HMCA 1LOQA 3MSGA 4N02A 2YLLA 1K1DA 4ASTA 3VM7A 3UZWA 3A23A 1BWVA 4EANA 3ARZA 5A6KA 2MUCA 1Q66A 2ONEA 2E67A 3IJDA 6ENLA 3GB6A 1XLCA 4OVXA 4GUHA 3B9NA 4RDZA 3U6WA 1NWTA 4ZB2A 3W0KA 4CCZA 1R3RA 2NVAA 1Q6LA 1W3KA 4O13A 1UMLA 1J01A 1LCOA 4RNJA 5AZ0A 4CCEA 1AZ1A 1YBQB 1F3XA 3B9DA 4FNRA 1H7NA 4DBUA 3I3EA 4DIPA 3URNA 3L2MA 3HGJA 3O8AA 3W7GA 2N87A 2PBGA 4RZ6A 4PA8A 3S6DA 1D8CA 3ZMRA 3CH9A 5J04A 4JL2A 1E1CB 3H8AA 2W27A 4C1LA 1WO2A 3E1F1 5LIKX 4FF7A 4U4MA 5GVJA 5LNUA 3NDYA 1RQEA 5D37A 4JY9A 5HANA 3VO0A 2VEPA 3MDWA 3NAVA 2BHUA 1QI0A 3M7WA 3L7RA 3KCLA 3ANVA 2EPLX 3LNPA 5C7HA 3MMWA 4IL2A 4CNOA 1J4IA 2BMBA 1X39A 2YGYA 5FJPA 1JPMA 4K8EA 2VRQA 1H60A 3W1MA 5CBJA 2PLJA 3KS6A 3DDMA 3S1VA 3C2RA 3CYVA 3T7VA 4GI8A 3I6EA 1DEDA 1Q4WA 3OLIA 4XUGA 3V5FA 1TV5A 2PDMA 5JH2A 2VELA 3AISA 4KFPA 1KTCA 3WUFA 1HKKA 1GNXA 3QV8A 5I24A 4IPNB 1MFVA 2WSRA 1WKDA 4A3QA 3NO5A 3MI2A 1FCBA 5HQLA 3TC3A 3FYOA 4HK5A 2P88A 1E40A 4FPSA 3MUCA 2ZADA 2FGBA 4BK9A 1QUMA 1LL7A 1X98A 3ITXA 2CZEA 1TA3B 3GX9A 5KMYA 1GW9A 4XWUA 5A6TC 4OZOA 5FCZA 2ALDA 4JHZA 4UFIA 5D8WA 1B9ZA 2QGHA 3TA6A 3W2KA 4GQQA 2XP9A 1PX4A 4AWSA 1DWJM 1W1IE 4Q8QA 3SCVA 5LXXA 2GDUA 3FIGA 5AC6A 2FYMA 3NEHA 1PVNA 2D69A 3PR2A 2JE8A 3AJ7A 5KITA 5D32A 4MY9A 3LS9A 3WDJA 4GFSA 4XO7A 2PWHA 4URIA 4JTRA 1J5TA 1ZJAA 1J11A 1JUEA 3S2NA 2MLYA 2I5IA 4RUBA 2PWDA 1KV5A 3IIOA 1Q2RA 5AC4A 4BCEA 4DI9A 1OHLA 1JG9A 3NA8A 2PBOA 3BCJA 4GQGA 2F2KA 3OIXA 3QFEA 4RV8A 4IQCA 3VU2A 5DXYA 5LIWX 2PV3A 2DVXA 3G1VA 1RY8A 1JDAA 1XYZA 3NZ1A 3SJNA 3NR0A 3LPFA 4CU6A 2J9ZA 1H5YA 4I7WA 3KCJA 4MZYA 4QDPA 2A3BA 2PFHA 4GXMA 3L4TA 1KT1A 3P7YA 3NM1A 1G9HA 4POCA 3S5ZA 3UJEA 1GKRA 3HGRA 3VX0A 2Z2BA 3EOEA 4JN6A 2A3AA 1O94A 3TLQA 5JBEA 2R1KA 1KTNA 2V3DA 4PH6A 1ZZMA 1E6RA 1I2RA 3A4JA 3PZMA 4MJZA 1J6YA 4ATLA 1Q6CA 4WJXA 4PFMA 1XD0A 4L64A 1Y5VA 1XCFA 5A5WA 2QEZA 4NZ3A 3AZTA 3RFWA 2R1PA 3M6YA 4ES4A 3CASA 4DJEC 4IFKB 2HCVA 4YIWA 3WF1A 1EZWA 2D22A 2DUZA 4Y90A 3O15A 3BJFA 4WKAA 1R3YA 2C0AA 3IHZA 3B8IA 2VZUA 3O5JA 4OQVA 4B4FA 5MHBA 3SJ3A 3UW6A 3ZLFA 4CN1A 3QR1A 3GIPA 3UNDA 1E43A 1YXCA 4QG6A 2WM0A 1BQCA 1HL9A 3THUA 5CBIA 1HL8A 3PULA 2RDUA 3GG7A 3TONA 5JH1A 3A6OA 2Y5SA 3ARSA 1ZCCA 1ZFJA 2OFNA 2ACQA 1W3JA 1CDGA 3TOYA 2EKCA 4PYSA 4GQRA 1GYNA 3U2OA 4IIHA 4W88A 1K8CA 4R53A 1DOSA 5CGQA 2YB4A 1MZHA 3VVGA 1AQFA 1X8FA 2XISA 2CPUA 1U1JA 3VNYA 4TVCA 3WUGA 3CL7A 1OEPA 3VGDA 1TE6A 5CCZA 1JL8A 3BMWA 3O5LA 1J0ZA 3A9IA 4DZ5A 4GXPA 4XQ6A 2DG9A 4L72B 4H9UA 4DZIA 1OC6A 1Z89A 1Y7VA 3BXWA 4ICMA 4DBDA 3QZEA 3H2EA 4WDWA 2XP6A 2BLEA 3TTYA 1ZGDA 2VUNA 3QLLA 4A2RA 4AVFA 3O06A 4MWAB 3GS6A 1RQHA 3VUSA 3WNLA 2ZOXA 3GQYA 2WZEA 1E0UA 3B06A 1EXPA 3DERA 3PBWA 3CAWA 3DX5A 4ICNA 2QCHA 5E0KA 4N0RA 4DQWA 4Q4SA 2YSWA 2X8RA 2XVPA 1KNWA 4LUSB 3AIRA 1XPGA 1S2UA 4GD0A 4TXEA 1H7WA 2WOQA 4MNKA 2ZTJA 4XB3A 3B4UA 3WLMA 4H00A 1KV8A 3HMJG 3P82A 3KBNA 1OC5A 4AMCA 4D9PA 5BXTA 2A3LA 1OFBA 2QCLA 3PSWA 1W1TA 1T5AA 5JMUA 1R9HA 4TX6A 2CFFA 4LPCA 3PJTA 1FAPA 3E02A 3AIQA 5IDIA 3WQ8A 3NL2A 2C18A 2WSQA 4R0XA 4UQAA 3GTHA 4ICCX 3WCZA 3FKRA 4LY8A 2F61A 1P6BA 4D71A 1UD6A 1QHZA 1GONA 1WA3A 4CN6A 4FALA 1YBQA 2FJKA 1VEPA 3VNDA 5HQEA 4IQLA 4FXRA 4AD0A 1VFHA 4IMGA 4DPPA 3BZGA 4JTIA 2OGJA 4HIBA 2QDEA 2NSOA 3IGUA 2X2YA 2FMOA 4U31A 3ZZ1A 2QCCA 1UWAA 1TZZA 2GZXA 4PL1A 2ZRVA 2G3JA 1QO2A 3USBA 3AUJA 1I0DA 9CGTA 4JIPA 2FLIA 4C6IA 3DAQA 1Q6QA 2YW4A 1E1CA 1ESWA 1I75A 4JIRA 4FP1A 1QNOA 3M0VA 5HUPA 1JYWA 1Q2SA 2DUAA 1MW3A 4LVBA 1CXHA 1UMYA 4HNVA 1P48A 2AL2B 1QZ2A 2WK2A 2INFA 4RV3A 3SZ8A 1QI5A 1S39A 3TJ4A 5EBUA 2PGRA 3SUWA 3HG5A 3HV8A 1DQWA 1TWSA 3CMFA 3CTLA 4PZVA 2WKLA 5JBFA 1KBJA 1JRBA 4O1BA 1YDYA 1PSCA 3WQFA 1HN1A 3TCZA 1OBAA 1ITCA 5BU9A 2E28A 4AFYA 3GTYX 3DYOA 4G2DA 4L6DA 4H8NA 4BWLC 4GC4A 3MMTA 2KI3A 3W82A 1EYMA 1K4GA 3BGJA 4AZHA 4MOZA 5CJNA 3Q65A 1XLIA 1L1PA 2DIJA 1EFZA 1RR2A 3AOFA 4U3CA 1EDQA 3MI6A 1YHTA 4CD4A 1DHKA 2BWGA 2OKTA 2YBVA 2Q09A 5E0CA 2DW6A 3U2ZA 1TA3A 3LSBA 4ACZB 4CCDA 4N6FA 3EB3A 1QOQA 4HYWA 5I2UA 3SN4A 4B5UA 4EIVA 3G1AA 4KCTA 2ZWZA 4UC5A 1FKKA 1T8XA 4XZHA 2ZBTA 4MIMA 3ES8A 2VC6A 3FDKA 1WNOA 2I16A 1J0YA 1W3HA 5F2MA 3SQMA 3OOBA 3GO2A 4YXGA 5FAGA 1WP6A 2J66A 1MFUA 4O0ZA 2WXDM 2M2AA 4TMBA 2VDGA 4BI5A 1U22A 3NQBA 4I90A 5KINA 3EWUA 4XVEA 3GE7A 3VA8A 1ZU8A 4WVXA 2DZSA 1LLOA 3DN5A 4Z0JA 1RD5A 3BGGA 3LCXA 4P7NA 3L0KA 3TFCA 4TTGA 3QM3A 3PUOA 4Q8UA 2VVNA 2I5GA 2ZE0A 1IQ8A 1PDYA 5HUOA 3W25A 5REQB 3OA3A 1PUDA 1UH3A 3E49A 1DYSA 1UG6A 3QBUA 2QUNA 3PFMA 2WV8A 3UBPC 5AYIA 4KQZA 4QFUA 4O4VA 3NQ2A 3O5OA 1KFEA 3KHJA 1OC7A 1EQ3A 1MYRA 4M7SA 4GACA 3ARVA 5CSUA 3VNKA 3BJTA 3I6CA 3THQA 3STPA 3GTIA 4AMAA 3CIXA 4DWSC 4Q7NA 3TTOA 3KZSA 2WKJA 5TQLA 2DT1A 4EXBA 2Y8VA 1XLLA 5AYBA 3R6IA 3KCEA 4AW7A 3L65A 4XX6A 2ISWA 4WIWA 1DIOA 3H22A 3KZ7A 4JL1A 1Q7ZA 3MB9A 4XIAA 3L21A 4PULA 1OCNA 4HBEA 1ZY9A 3O2LA 1WDRA 3VI2A 4YJ5A 3WO8A 3T2QA 4IFKA 4JTKA 1F74A 3QY7A 2D3LA 1VEMA 4DNHA 2HPIA 3UI6A 4YWSA 3QYQA 3BLLA 2Y6ZA 1YADA 4OBRA 3N6JA 3TP4A 4A8NA 4GVHA 3E0LA 3O5KA 1CGTA 4OIFA 1SVDA 2GOUA 4ZPVR 3PNZA 1HVQA 4K1WA 1SFJA 5G2HA 1SJDA 4PUUA 3EXRA 5F1VA 4NXKA 1RHCA 1YNQA 1Z48A 1FFQA 2CWNA 3LGEA 1BKHA 1Q7MA 2Y7GA 2XFYA 3R1ZA 1AD1A 2F84A 2X0YA 4OKDA 3W6MA 2E3ZA 4PMXA 1DJZA 1I2PA 1LLZA 5K9XA 4GGHA 1X6NA 2W9MA 1XLGA 3AMDA 2W5FA 3BMBA 2R1LA 1EXBA 1RA5A 2WLYA 2ZDSA 2FZBA 5HR6A 3RNDA 3EWDA 4ZA0A 4D1JA 1CB2A 3D46A 2ISSA 1ICPA 4IMAA 3W74A 4IPIA 1T40A 1FCUA 4Q6JA 3UXAA 2QKFA 3RU6A 3CT2A 1GVRA 1TWIA 2CW6A 2JF6A 1NOFA 1PZ0A 2F38A 1ZTVA 1QXLA 3O6YX 4GBUA 3G2GA 3H24A 4JFVA 1VBUA 3U7BA 2QCDB 2GUYA 2VGFA 3VIOA 2CITA 4AEOA 1XLDA 4JPGA 3U2EA 5FF0A 1TWWA 1VFSA 4R7OA 3KS5A 5FL0A 5LZLA 3DFSA 4XZMX 4LQ1A 4Y9NA 4GYPA 4ENLA 3L4WA 4DM2A 3AO0A 4WRHA 4Q32A 1W32A 1FHLA 3C8NA 1NFGA 4H1ZA 2ZRWA 2PU0A 3MQTA 1TV2A 1K7EA 4QAIA 3P61A 3M07A 4ODQA 3AHXA 1WXZA 4AAJA 2VR5A 1EC7A 2XM1A 5HNRA 3IGXA 2FFCA 2PGFA 2E09A 1MEIA 3DFHA 2W79A 1FWAC 1HO1A 3FNDA 3A21A 3LI0A 1XC4A 3T8QA 4B5TA 3NSXA 1PKLA 4RE4A 1QNVA 2P4VA 4ZQCA 3MW7A 2J7GA 3YPIA 4JFMA 2Z29A 5AHEA 2G95A 3CV2A 3DFPA 1ZAJA 2ZUMA 3G1XA 3DFNA 2XSAA 1LBMA 4GA8A 1V5XA 4CD8A 4HYRA 5D9PA 4LAVA 1KKOA 4J2PA 1F8AB 3ARQA 1OX4A 1FWSA 2P76A 1CENA 1MQPA 2POZA 1QPOA 1RBLA 4LCSA 2V67A 7ODCA 1UKPA 1WXJA 3S2MA 1ONRA 3CHCA 1A49A 3F5JA 4XAGA 4P2VA 4C7DA 2CKRA 2AL2A 4ZSUA 3P3BA 2W63A 3E74A 2OODA 3W2NA 2HRWA 2Z7KA 5D33A 3BMVA 3KBWA 4AY8A 3MHFA 2E6AA 1WKFA 3NJ3A 4DHGA 3ZVHB 1EOKA 3WLOA 3R79A 2DEPA 5DMMA 5C70A 3GPKA 3MP3A 3UR2A 3W7EA 1GHSA 4DH0A 4JTJA 2BY2A 4E8DA 1UH4A 4N9EA 5G1MA 3VUPA 2JKPA 3LHTA 3KP0A 3ZLHA 3WQPA 5A2BA 4S39A 4AZBA 5IHRA 2V9DA 2Z6IA 4NX5A 1UR2A 1XPYA 2VX6A 4CQDA 1KA9F 3W76A 3KBVA 3G0UA 1KXVA 3ZSSA 1E51A 3L68A 3E0VA 3UZJA 1Z44A 3WQOA 1JNDA 2R1NA 1XIBA 4LJ3A 3CPRA 3TV8A 3TYZA 4A3YA 3PTKA 4LNCA 1D3CA 1WYIA 2J62A 2VI0A 2OWXA 1W1A1 5A6AA 1EGMA 4ACZA 1J0IA 1LORA 3T81A 3VKCA 2G4FA 4FLOA 3O16A 4HPHA 1T96A 4E3VA 4IGHA 3IKDA 5CSRA 4U5IA 3AXMA 1P6CA 2ZQTA 1PXGA 3NQVA 1E9LA 1GUVA 2NUWA 3O63A 2YBUA 1AVAA 1CCWB 4RDWA 1O66A 4J7RA 4W7VA 4MB1A 1R3WA 2XM2A 3NL5A 3CUJA 1VQTA 3N19B 4H6EA 2PEVA 3F03K 2QHAA 1XINA 1Z32X 1K9EA 1OFQA 3MP5A 3FYYA 1VJIA 3Q37A 1LTDA 3V1HA 4J3UA 1PO9A 1LRNA 1DIKA 4LU0A 1PYFA 3U8GA 4JAWA 5MKGB 5HXMA 2D2HA 1E0VA 4ITZA 1VBJA 3T2PA 3PPHA 1EA9C 4L56A 4Q4MA 2VEIA 4WY0B 2FKPA 1E9ZB 4UXDA 4LALA 1FHVA 4QSHA 1H0IA 2ALRA 4IGSA 3WQGA 3WN6A 4HSNA 1EUAA 4RZ5A 1BGGA 2RKXA 1LBFA 2ZZ5A 2KE0A 3RU8X 5PTDA 2IQ0A 3GG0A 3L5MA 3VOFA 6TIMA 3KTSA 3W1TA 1QPFA 3PUGA 1NF7A 4UMAA 3OO2A 3L4ZA 3MP4A 1W1B1 1MQRA 3S5YA 2ZQSA 3UJ2A 2HK0A 4OE7A 3HJEA 4JTGA 5FEZA 1UR0A 1WB0A 3HIJA 4LS0A 1AH4A 1JDCA 4B90A 1MQQA 1XWYA 3M0YA 1WAWA 5CQ1A 3QJAA 1DJWA 3MBDA 4O1CA 3PF3A 4GI6A 4XKMA 3P6LA 3WQWA 3KXQA 3B97A 1G67A 2C1GA 3QGAC 2VZOA 3FCPA 2AQWA 1R47A 4GNVA 3TZFA 3EX6A 3VILA 3CPUA 4LAUA 4FR6A 3P0XA 1XGZA 1T0OA 9XIAA 4GZ7A 1RQBA 3QY8A 1L6GA 3R7MA 2V2CA 1O68A 2IF4A 4Y8EA 4WCJA 7TAAA 2BY3A 1GPWA 1HW6A 1P0DA 4V15A 1U5JA 4C1NB 4IXXA 3IUIA 3SCTA 1M7JA 3DBNA 1JD7A 1N2VA 3C2OA 4NVTA 3TTEA 1E56A 3SCOA 2R9RA 1P6WA 3VIFA 3AIVA 1F7BA 3F4CA 1FWRA 2NV1A 2GWGA 4LBUA 4PBEA 4U85A 5I78A 4G6CA 3C52A 3DESA 2DSVA 1DIEA 5HATA 3RCNA 3EWWA 2BHZA 3W70A 2I57A 1MW2A 4J3SA 4M19A 4TIMA 1V03A 4JTEA 1ISXA 1RV8A 4S38A 4LV9A 1GTHA 4E2DA 4XZWA 5J5DA 1RK6A 1VZWA 1OGBA 4PMVA 4PUMA 1W26A 2PDUA 5A6JA 2D1ZA 4RZBA 4X0NA 3W1PA 4CKQA 4TOQA 1SZRA 4LVDA 4XTIA 3N2TA 4TX9A 2QGYA 1Q63A 2E4TA 2VEMA 2D0HA 1XG4A 3ITCA 5C7VA 1FWFC 3VOJA 4O0KA 3RO8A 3W2MA 3GDTA 1CPUA 2P5NA 4GC3A 1KBIA 4U86A 2DIEA 3UWWA 3PG8A 3EPOA 3BGAA 5FIPA 1D2KA 2ZUUA 4KEUA 1PKNA 5I3KA 2QCDA 3D3AA 3ERPA 4DZHA 4B15A 1VH7A 2X42A 3VGGA 3O9NA 4GOAA 1FUYA 3TSMA 2AMXA 1GOOA 2PPPA 1PZ2A 1NIUA 3FJNA 3OG2A 1TZ7A 4FO4A 5LGXA 1IXPA 1XYCA 4NZCA 3W4RA 1KO0A 2QJHA 3BDKA 4NZJA 4YN5A 3AS2A 4TMCA 3W7IA 4S2BA 3RM4A 3RK8A 2J7CA 2ATSA 4Z2HA 4JTSA 4GJIA 4Q7IA 1JIBA 5D02A 1TMQA 1QBAA 1OZMA 2P0OA 4HNUA 1KM3A 2YFNA 1V3LA 2OEJA 3GHSA 1OYBA 2VGGA 1XIGA 3A64A 5HA7A 5CG7A 5AFDA 4A8IA 4BHYA 2OSWA 2J8FA 3RLVA 2Q02A 2PTDA 2EAWA 3BK0A 4V2XA 2QPUA 3V7PA 5TF0A 4WDXA 3K2GA 5CLWA 3KABA 3GFYA 4G1NA 3W24A 5IXEA 1F73A 4R34A 1JF5A 4XD6A 2C1IA 1EF3A 4PGLA 1OINA 5FD0A 1Q7QA 3GNXA 2FZMA 3LNMA 1SFSA 1D7JA 3WEOA 3S47A 3V0TA 2O92A 2Y88A 2YL8A 4GO9A 4QROA 3JR2A 3T05A 1OZQA 4J4NA 1D3HA 2Y8UA 1DJHA 3RR1A 2RJGA 1JR1A 1V3HA 4Z17A 4IH3A 1Q6RA 4X61A 3H6OA 2XVGA 3WLJA 2ZRYA 4Y9AA 5F4XA 1TREA 1KM4A 1OFAA 1SZEA 4UOQA 3KM8A 5TIMA 1SZGA 1E6NA 1CEOA 4NI3A 4AXKA 3NCOA 4J3XA 3WQVA 1ZBKA 3AXHA 1LUCB 1NDVA 1LQ0A 4JFIA 3N3TA 2MNRA 3B40A 4JX4A 4UFLA 2ZA1A 2HROA 2DT2A 2OYLA 4W9OA 1KRMA 1C9HA 3RCYA 2V2DA 2PGWA 5JVLA 2B4GA 1J93A 3IAQA 5CPMA 1RXOB 2A5HA 4ATDA 1B5TA 1WCGA 4QNEA 4WEVX 4XISA 3U48A 1L6FA 3PZNA 2ZKMX 5XIMA 3OW1A 4PB5A 3ZO9A 4DPQA 1ZS2A 4WK9A 1G69A 2PWGA 3KAIA 2HMCA 3LZ5A 1JGIA 3EDJA 4H7VA 4IMFA 4PSPA 2HBVA 4G9PA 4IFRA 2OQLA 3UYCA 1XIDA 1M3UA 3KUMA 3MU7A 3V18A 4RXGA 3WLQA 3SGUA 4O1EA 3OHMB 3VNZA 1MUWA 2WBKA 2Z00A 4ML4A 5B7ZA 1X1NA 4MZ8A 1QK0A 1KFCA 1XKJA 3WNPA 4GQ0A 8XIMA 3PR9A 1WV2A 1G7UA 3F2CA 4JYDA 4UDMA 5D09A 3GDMA 3T0AA 3CH0A 4ZB0A 4AF0B 2GVGA 4FSAA 3BLDA 3EKGA 5DFAA 4UZUA 3MANA 2I7GA 2X7WA 2PTYA 3P80A 1L2QA 3AIUA 4FNQA 3KHDA 3KLKA 3FJ6A 4MUZA 5MKGA 2A4AA 2FTYA 3NQCA 1MW1A 3QPYA 3W6YA 4P7OA 4DJFD 4QT3A 5BRPA 4ERGA 3KVJA 4A4AA 1PPIA 2PDCA 2G3NA 2OWCA 4JQAA 1FKRA 4GG9A 1TO3A 3ABSA 4EF9A 3BJSA 3RMJA 5A3HA 1UC5A 3LLXA 4UTWA 4QBXA 3RCMA 3TAKA 5GJMA 1MNZA 1UR1A 1XFCA 1OFEA 1UHVA 2FB2A 2OYMA 2YX0A 3S5SA 2ISVA 4H9TA 3E0IA 2VZSA 2Z26A 1LQ2A 2OEKA 3BANA 3LX9A 2JBMA 3ZSTA 1KCLA 1M9HA 4C60A 2W91A 3QZ6A 5F2GA 1LZOA 3LHYA 1QFEA 1T6MA 1KLYA 4LXFA 4ZXOA 4AH7A 4UTLA 3WQCA 2XP5A 2BXYA 2QV4A 4MF4A 1R2TA 4NNCA 4PTNA 1HF6A 5DRIA 3BOXA 1JNSA 2AKZA 3FVMA 4PCTA 2RUCA 5JH8A 1VGAA 1H1NA 4Y9OA 2GQ3A 5DT7A 5HJXA 4YYCA 1QWKA 4LAWA 3W2LA 1TPUA 5J5RA 3VMNA 2J7HA 1W9UA 2WQPA 3ME3A 4WUIA 3KVKA 3G1RA 1I45A 5CSYA 1A5AA 4C1NA 3G22A 1E0TA 2GVLA 3WSUA 1PYMA 2Y70A 3CQ0A 1TUFA 3C5QA 3C4UA 2QJNA 3F4WA 3SQLA 2VQUA 1FDJA 3OP2A 1NQKA 1TV7A 5DT5A 5A8GA 1H1ZA 1XDMA 1A3WA 5GPGA 2MPHA 1EOMA 1BQGA 2GJRA 3U5YA 3GG1A 2ZRXA 1EGVA 5HOSA 2J7FA 1ZENA 5E6YA 2WJEA 2C6QA 3ZR4A 2WSKA 1BYCA 2NWSA 3N04A 5DX7A 3COTA 3T9PA 1IGWA 1JNTA 3SM0A 4A6GA 3P8JA 3RDKA 4PSRA 2DT0A 3CZGA 2OPJA 1DE5A 4AUBA 3EX1A 2F23A 4N4PA 4GLEA 1JUKA 4PR4A 2V5LA 1KFWA 2VENA 1V08A 2YDQA 4IGNA 4AG0A 1KM5A 1PIGA 1ME8A 1SSGA 3DCPA 4QS6A 3AYVA 2CZVA 3SCRA 2QNEA 4C6LA 4UIOA 5E93A 1O5QA 4XTDA 5HBFA 2J13A 3OZYA 1I8JA 3O6CA 3FW6A 1RPXA 2OQYA 4C90A 1JZ4A 3N3MA 4E4UA 3LLFA 5EGRA 1XM3A 3WEMA 3TFXA 1UD8A 4KWUA 3BAJA 5KZMA 4XD4A 3TSDA 3PZ9A 2J9YA 1GOQA 3TNOA 3N9SA 3QEZA 1HG3A 2PD5A 3S1GA 3GKFA 2V3FA 1Z69A 2ZFAA 2INZA 3ZIZA 2DUXA 4RE0A 4QT2A 3KRSA 1MXSA 1I2NA 2DT3A 1WZLA 5D04C 2OYKA 4ZFMA 3W1UA 3POCA 1P1MA 3VNJA 4KETA 2MANA 4H9YA 4NKCA 3TYDA 4NJGA 3U9IA 1KBBA 3KACA 3WF0A 4NL1A 1XW8A 3R8RA 4NNBA 1EA0A 1H1YA 5L9FA 2ZRUA 3DG6A 4OTKA 2L5HA 2OX1A 3B04A 3UJRA 2GGIA 2QVNA 2RDWA 3W1XA 3MJMA 4DLMA 2NZLA 1T7LA 1YQ2A 4GUJA 4MUPA 4N19A 3BVJA 2ZVRA 1M01A 4BQ3A 3SRFA 3KRUA 3ATZA 1O5KA 2PDGA 3HMCA 4C91A 4JFLA 3ITOA 4KFOA 5FF7A 2BS9A 4O4WA 4TVUA 1OB0A 1P7TB 3PSVA 2YCLB 5D2TA 2HZGA 3STFA 3WUBA 3AS1A 1GEQA 1UASA 3ZQ9A 1SW0A 3JS3A 3EDKA 4L4OA 1GJPA 3GXTA 4RPPA 3N12A 2DQWA 1MZRA 3CU2A 5U7SA 4LVGA 1A5SA 4PRWA 2Q01A 4YMZA 1IR1A 3NYZA 5CZTA 4XD3A 3S6TA 1YPFA 1LUCA 2I9EA 3MS8A 2B81A 3W73A 5A69A 1K03A 1AFSA 4LF2A 1EUNA 2WVTA 5A2CA 3GZ3A 4AHOA 4KT2A 1BVWA 3ELFA 3R89A 1RJPA 5IFTA 1YMYA 1J6PA 3TA9A 2RJHA 3EX2A 3JVAA 3NEVA 2VFHA 5JU6A 1QI3A 1TQJA 8CGTA 3DFOA 1VJSA 4DWSB 2VCAA 1TJ2A 2WWDA 3GW3A 3K8LA 3HN3A 4F2UA 3PP7A 3AHYA 2WPGA 3T2OA 3W1NA 4G8TA 1AK5A 4P8UA 1KBKA 3WK3A 3XISA 5CXPA 3W1RA 3T1GA 1EPXA 5D8ZA 5A6LA 2E5DA 1T41A 2A3HA 3MSDA 1XIJA 4ODNA 1W2PA 2QUTA 2VVSA 1E6XM 2FHFA 3W38A 1PINA 2AQOA 3N73A 2ZC8A 3VIMA 4O53A 4DXKA 3VCCA 3MVTA 3PAOA 2YZRA 4LFYA 1GQKA 4M1RA 2ZZ6A 3A12A 1FBAA 1R0MA 1TWZA 3FHQA 2C1HA 3EWCA 3CMJA 3CQHA 2VCCA 1IEWA 4O50A 1W9BM 4UCGA 4EAMA 2GJNA 3VKKA 5K4XA 3BCDA 3PPCA 4JQ4A 1B0IA 4UQDA 3NG3A 5FESA 3RLGA 2HE8A 4NG3A 4AF0A 1XKYA 4US5A 1IXOA 3FK4A 4UTFA 1BVNP 4NT0A 3VC6A 4DRPA 4GH1A 3WLPA 1FWGC 4H19A 5CZ0A 3A9BA 3PZOA 4XZLX 2RAGA 1B3WA 1QW8A 5D9NA 2GL5A 4P7RA 2V68A 2HV5A 1J18A 4GHRA 3KLLA 1LT7A 1VIZA 1XGDA 2PURA 1B3OA 4AWTA 2FJUB 4DN1A 2Q3OA 4QE5A 1UUMA 3M46A 2G37A 3FN9A 3N4FA 3EOSA 4HYVA 2JEQA 1B3VA 3HPSA 4R7JA 1F40A 1M68A 4ADUA 1Q4NX 1FDYA 5T8GA 1J0HA 3PBUA 2F2DA 3TCEA 4GZIA 3G0SA 4U84A 2WMIB 5K3VA 1FA2A 1CBGA 2AGKA 3LCIA 3B9AA 2NT1A 4J9JA 1WE5A 3CT7A 5D4YA 2PDXA 2HTMA 4UTUA 2HS6A 2WCGA 4QE1A 3M0LA 3UQBA 3NNTA 4MLRA 3W75A 1VPYA 2VKZG 1JYVA 2O56A 1OADA 4C65A 1XFBA 4XAYA 4YVVA 3QQWA 1LBLA 1XI3A 2X09A 5E6ZA 4Z2KA 2TYSA 3P8IA 3VD7A 2VX7A 3C0LA 4QIUA 1NJJA 4RCXA 1NOUA 4UTTC 5FJOA 3CZLA 4TVDA 3H2OA 4O10A 3KRZA 3WLIA 4IMCA 3M0HA 4LUIA 1GORA 2CBJA 2PI6A 1XLKA 4JEJA 3WFZA 2INEA 3T4WA 2NQLA 1PEZA 2R6OA 4J3VA 1H2JA 5HK4A 3EMCA 2EEXA 1V3IA 2GJXB 4NILA 3BO9A 4GH3A 1JFHA 1OGSA 2PBCA 3LV5A 1QMLA 2CCRA 4Q4KA 3HPZA 3M0JA 4MPKA 3IJLA 1TTJA 3AUOA 4ZL1A 1V51A 5JUVA 5AYYA 4QG9A 2Y7DA 5HJLA 3U4FA 3BOFA 3SUSA 2WVUA 2Y7EA 2VX4A 2WCSA 1OCJA 4O1FA 5F4SA 1VENA 2CLKA 4C6PA 2YXGA 5DBUA 2W62A 3LZ3A 3FS2A 2PWUA 3GK0A 3HQOA 4DXXA 1RCQA 2DZAA 2VFFA 3W1QA 3GW0A 1IF2A 1FOBA 1OABA 2WNZA 2UWFA 2BY0A 3PZUA 1LG2A 5F4WA 4GGQA 4V27A 4HCHA 3OGVA 1CXIA 6ALDA 3RF9A 3L23A 2JFEX 2B31A 4ODPA 3FA3A 1YW5A 1TQXA 5K7JA 1XYFA 2E9MA 1X97A 3LCGA 5HINA 3LV6A 4MAVA 3UWEA 3JXVA 2TPSA 3ARTA 1XLMA 4IXHA 4BWLA 5G2WA 1FKJA 3GLCA 1AG1O 3WNOA 4QSFA 3ZWSA 4DUOA 3TN3A 2DSWA 4Q8TA 5AC5A 3SW6A 1D7HA 3BV4A 4HNTA 1FXPA 2YPIA 1Y5XA 3W7KA 2CXEA 4MAZA 1IX5A 3P62A 3GYEA 4CQAA 4W9QA 3PB2A 1W5NA 3HOJA 3T09A 3VD3A 4JQ1A 4UZSA 3PANA 5AB3A 3NZRA 3D0CA 5G4EA 1GQJA 1HKMA 1CWYA 2OEMA 1VR6A 3PBMA 4S2CA 5ABGA 3VM5A 3W81A 2ITKA 3G6MA 4M51A 5IHSA 1MWOA 2ZQ0A 1VYRA 3IJQA 4GIAA 4HNCA 4JIEA 3NQ7A 3TIMA 1PDZA 4UB9A 5G4HC 4G7FA 2EULA 4G5DA 1TWDA 4O12A 3MKVA 1JFXA 1HXVA 1RVKA 3H70A 1YXDA 4W85A 3N6QA 4LH8A 4S3DA 4QISA 3WMBA 3CHEA 1ADOA 1P7TA 2WJDA 3NM3A 3N2MA 3JW7A 3M5ZA 3G8RA 4QEEA 4EOUA 1QPLA 3CZJA 5FF4A 3NL3A 3WDPP 3SRKA 2G97A 2KGJA 1EQCA 3HM7A 4J27A 5DY2A 4MM1A 4DELA 3N25A 4Y2WA 3QXBA 2OLSA 5ABFB 5G1YA 3QV6A 4RPQA 5CPLA 3QYSA 4CNTA 4PMDA 1HP4A 1TRIA 3WK2A 3BLKA 2IW0A 1GCYA 1MW0A 1IWPA 2A7RA 4CGTA 3NWRA 4HB7A 3EOUA 1ZB5A 1UB3A 4XD5A 5ENLA 3S2JA 2ZQUA 1XSIA 4HPJA 4DWSA 4F0SA 3G77A 2ZR6A 3FY1A 4NP7A 3CAQA 1VPQA 4BQ2A 3KZPA 2VYOA 3ZJ7A 2X05A 7PTDA 1UUQA 4QLJA 2X1RA 2JALA 4QQUA 1YE4A 1E1EA 3AS3A 3GZAA 1NDWA 2WCAA 3N4EA 1A0EA 5DRCA 4ZVJA 3BLIA 5HULA 3LXCA 4LNYA 5CG0A 1UBSA 1E4IA 3WMCA 2TODA 2IKHA 1PZ3A 4PMRA 3B8TA 2WHMA 2X41A 1PKYA 5M03A 3ABZA 1FKXA 2RURA 2A7PA 4V33A 3HPFA 1PE1A 6CGTA 5FJJA 4HOXA 1HJVA 5XINA 4M3PA 3M5XA 4FLQA 2QIWA 2PU1A 3A3WA 4E8CA 1WUEA 1L6YA 3KOYA 5A1AA 3UP8A 2DJXA 2GPTA 3VOCA 4QTGA 5EB8A 3F4NA 3ZVIA 2JK2A 3P0WA 1WZAA 1O5XA 5D03A 3MYPA 4EX4A 3IWPA 1XRVA 1XXXA 2VMFA 2GGJA 3IIZA 3QH2A 3ABOA 4KWWA 2E7FA 3MBFA 1K9TA 1N7KA 1A3HA 2V82A 3GXDA 3CNYA 3GU9A 3H2CA 2GSJA 4M6UA 3MT1A 4JICA 3IJIA 1KW1A 2EQDA 1QR7A 3M4HA 1H41A 3W26A 2C13A 5FI8A 1JULA 3OA5A 3WQEA 4HQVA 2GVJA 3PJXA 4FX8A 3WENA 3GAYA 2XP8A 2EJ1A 2VX5A 4JCLA 1ONEA 1HFBA 3WNNA 5HDRA 4BI6A 3VKAA 2GFTA 2CERA 2WYSA 5LIUX 4LB3A 3AIWA 4HVXA 3NZQA 4GRSA 3IKGA 3CV1A 2TAAA 2DW7A 1DPMA 3OG3A 1NH6A 1LWHA 4OECA 3HZ3A 2XIBA 4NZ4A 3JYJA 3GR4A 4WKHA 3WY1A 4D6IA 4Z1YA 2G50A 1LL4A 3GNNA 3DFQA 2DZTA 1GVFA 3HTWA 2VZVA 3FXYA 1E9IA 4CD6A 3THCA 3WLKX 3NDZA 4MB3A 5IFPA 4MTVA 1OIFA 4I9TA 5A6SA 2F4EA 3RG6A 4D2JA 3PUEA 1VKFA 2XZ7A 1FKSA 3A4XA 6REQA 2XH4A 1A50A 4CQBA 5AN7A 3TEVA 4JNYA 3GR8A 3W1LA 4IF2A 1ZRQA 2AMGA 2FZNA 1ONXA 2DQXA 1O12A 3LTYA 3S9YA 4RR4A 2BDQA 1POJA 3UWUA 1KTBA 1H0GA 4TYOA 2YB1A 3FV9A 4PEEA 4D72A 2X1UA 2GJXA 2PP1A 1NEYA 5HAOA 3W7CA 4ORMA 1XF0A 1ECQA 2EBNA 3CZKA 2YR1A 1TV8A 1WBJA 4UMBA 2A6NA 5CAKA 1UWUA 1A7XA 5H2ZA 2F2HA 4W9TA 5KZDA 4DF2A 1KKRA 3ODKA 3R4IA 2POTA 3OVPA 5BRQA 5E1QA 4XUYA 3IPWA 3BLFA 1TYGA 5A8MA 3BAIA 5AECA 2PPNA 4S3GA 2R8WA 2DU2A 2FZ8A 1GZJA 2HNHA 3E12A 4LS1A 4TO8A 3IIXA 4O8AA 1QT1A 3C0QA 1OG0A 3T40A 2Z2AA 5KZEA 3DKJA 3GTFA 1NQ6A 5A8NA 1GHRA 3PG9A 3WG6A 3SFWA 1EP1A 3M0ZA 3UWVA 4MGVA 3KFTA 2R24A 3BW2A 1E9YB 3OBAA 2D2JA 2V5JA 4UCFA 1VP5A 3ZJKA 8XIAA 1GRJA 7REQB 1JPKA 1G5AA 1XP3A 1E70M 5CEWA 1TCDA 3RMEA 1F3WA 3W1AA 4KWSA 2VRJA 2QVHA 4NHVA 1YXYA 4J3ZA 1Q6HA 3L2LA 5A6BD 1GZ1A 3SFKA 1UR8A 3O1NA 4NUWA 1R2RA 2XFWA 1XDJA 4MKVA 3W9ZA 1R87A 3VOGA 1UOZA 3PVFA 5DMYA 1QPKA 2XSXA 5DQPA 2H6RA 3BQ5A 1IHIA 1VYSX 1ADDA 3B7XA 4XZBA 4EPDC 2UY4A 2AL1A 1IZCA 1BYAA 3PWGA 3FA4A 4IP7A 1OCBA 4WXZA 2FTWA 3EWXA 3ISIX 1T99A 3KTCA 1VS1A 3CUZA 3GG8A 5C6MA 2HVMA 4PMZA 4YU1A 2VM8A 4F66A 1SZFA 5C71A 1QPNA 3UGRA 1QVBA 3LQGA 3W7MA 1RVGA 3MZNA 3PWAA 5LNRA 5DO2A 1IWBA 3LMZA 4DRJA 3TSBA 1Y0OA 4F0KA 3V1PA 2GSEA 2V6AA 4E8GA 2PDHA 3UPMA 1TCOC 3WIJA 2J27A 4V1YA 2WNNA 2OT0A 3ZM8A 4JFWA 4P8WA 2YDSA 4ZENA 4HNOA 3P5ZA 3E0WA 3ZJ6A 2QV5A 5DLCA 3ZOAA 1OFOA 4PUWA 4KRTA 3T4CA 3UJSA 2ZZ3A 3LRKA 1S2CA 4C7GA 2QCMA 4LSBA 3VIIA 4DZ3A 4J28A 3QTGA 4QX4A 3QF0A 1M7OA 1A5BA 3FJLA 5IM51 4KFNA 1OYAA 5ABFA 3VDCA 2VN1A 3P74A 4DUXA 2DVUA 2XH7A 3CV6A 4HA0A 3CGMA 3VKJA 3MCNA 1XCWA 2HNEA 3M1ZA 1DVJA 1F4HA 2D73A 2WVVB 2TSYA 4IG2B 2OLAA 3L4YA 1GOIA 4NJJA 3PTDA 3JRKA 3VC5A 3PS7A 1CECA 1HKJA 2A6LA 4B16A 4UBPC 3W71A 1FTXA 2XP7A 1VBRA 4AD3A 2E68A 2YCKX 4OT7A 3AHZA 2VWSA 4GIYA 3EB4A 5T91A 4MSPA 3PJUA 3GDKA 2QPSA 3W84A 2ZA2A 3KWXA 4FX6M 2FVMA 1UR4A 1XIEA 3WD1A 2JIWA 3N29A 3AYSA 1HP5A 1E15A 5DIUA 2WNQA 1W1YA 3PZGA 1UOKA 3VMPA 1ZJHA 2E9BA 4DNMA 3BARA 3PZVA 3VDAA 4P5UA 4JR5A 4QAWA 1XSKA 3S1WA 4PTDA 1J0JA 4RDVA 4DYKA 2QAPA 2FTPA 3SUVA 3WBAA 3WDIA 4DRIA 5I3JA 4K8HA 3NIYA 1VBGA 3H23A 3ABQA 1XV8A 1G4SA 2OO0A 3WLSA 1F4AA 1FHUA 2W3ZA 4MWAD 1NU5A 1VAHA 4AVNA 3W7QA 2E25A 1KFJA 1GJUA 1RA0A 3MSRA 3RPDA 1KRCC 2J47A 1HKIA 1ZUAX 3NI6A 1KXQA 3O07A 2J7EA 2ZZ1A 5DCEA 3WX7A 1TB3A 3AWNA 3I3DA 1KB3A 1U2YA 1U1HA 3QN3A 2EPNA 4D6EA 5EKYA 3KRBA 4JFKA 2Y5JA 4Y9PA 3NQGA 4ZB5A 4YLWA 1DORA 4EXAA 3IVSA 1EX5A 2W4XA 2QIIA 4DBSA 2E77A 3GU0A 3GNDA 4LW7A 4W9PA 5LIXX 1YX1A 4EKJA 1WDPA 1P0KA 4OV9A 3EWYA 3CHDA 1V0NA 2J88A 4X2PA 3O5RA 4Q6XA 3WQ6A 3GIQA 5CPQA 3CXOA 3KAHA 3TCSA 4CVUA 2G5WA 3CZEA 2GLKA 2CLOA 3IK2A 1CLVA 3MZ2A 4ADSA 2IUZA 2NLYA 2OSYA 3SO7A 4KWOA 5ABTA 5C8BB 4JXCA 2Z1KA 5C9WA 3B0XA 2YDRA 4AY1A 1CX9A 1S38A 1HT6A 2NUYA 2V5KA 3PC0A 3LBMA 1QNQA 2HWGA 1R7OA 3K8KA 4N2YA 3UPBA 1XHGA 1BRLB 1W8GA 2XSBA 1GQIA 1C7SA 2ZX8A 1FH7A 1F2JA 4MFDA 1EJWC 2FGZA 1X1OA 2CZFA 4GZEA 1UPMB 3KAOA 1LRTA 3VZZA 4W4QA 3N2OA 3WH7A 1CB7B 1A4LA 3WJWA 5LHEA 3D6NA 3VNMA 1MEHA 2FKEA 1I9CB 1R8LA 1JZ6A 2NQ9A 3AMCA 5CBBA 4GVGA 2YL9A 3CIVA 3EMZA 1V3JA 1QPQA 3G5EA 3H2FA 4HP5A 3CEUA 1UD3A 4JNZA 1TTPA 4F2BA 4C1KA 3MPGA 4ORIA 1DTNA 2GOKA 1RD6A 5I07A 4FOUA 2KO7A 1DL3A 5E0FA 4H8HA 3SEPA 2Y78A 1RY0A 3OIHA 4ML9A 1FKIA 1PCKA 3WEZA 4BS0A 2V2HA 1LDCA 3U4AA 1HGYA 3Q45A 1R85A 3TVAA 3UA3A 4OBTA 4HN8A 2NQJA 5DIVA 1S3TC 4JOMA 1JPHA 3E3HA 1NWSA 1DXIA 4ERAA 1GVSA 5KTLA 3QGKC 1PWLA 4K7YA 2VC7A 4Z0SA 1E6ZA 4JTTA 3UR8A 5ABHA 5E9AA 4A3HA 3L66A 4QJ1A 1FKBA 3UF9A 1E72M 2PMQA 1ICSA 5HJYA 2BP1A 2XN0A 3OGRA 3RX3A 1TE1A 3KAFA 7REQA 1TMHA 5IBXC 4NY2A 1JCYA 4X9SA 2XIIA 1ZBCA 5I3IA 2XPBA 1J2WA 2PTWA 3C0SA 4JDBA 1IWAA 2I5QA 1CGVA 1M6JA 3FAXA 5GJNA 4K38A 2V81A 2BX7A 2NW0A 3CAKA 3R8HA 2QULA 3TXVA 3RHGA 3QV7A 1C8YA 2XYLA 4GCXA 3ITYA 3OGSA 5LYRA 4GNJA 2RSEA 1SU5A 1V6UA 1K7FA 3E5BA 5CPNA 1ITUA 3W87A 1VPXA 3EPMA 3WNKA 2D0FA 3TYEA 3PTQA 2V5DA 2XN2A 3QHMA 2CHOA 1UZ4A 1IYXA 3NTYA 3WYZA 2FVKA 1M5WA 4UWMA 4B9YA 3PAJA 1I4NA 4QJ3B 2PC4A 1FX6A 1ZHAA 5AY7A 3AMGA 1XLJA 5LSMA 3L12A 4Q3MA 5IRPA 2HVNA 4GIVA 4NAFB 3I7QA 3BAXA 3UQAA 4IJCA 3BWWA 3S8HA 1CTNA 1JCNA 3M44A 4ZQPA 1F6KA 2BVTA 4BR1A 4LOCA 1AW5A 1KFBA 1UWTA 3EZ4A 1BTCA 1WDDA 4GY7A 2FH8A 3TR9A 3TH6A 3W83A 4D6DA 3CQJA 1C29A 3VOIA 5BW6A 2MF9A 4XG1A 3NURA 2J74A 2EPOA 2XFRA 3LENA 2YYTA 3P67A 2QUUA 2VWTA 3KEHA 3EKLA 4NU7A 3QSRA 2Z2UA 1LRQA 1WX0A 1XCXA 4UOJA 2OQHA 1IEVA 4KRUA 3TDFA 4GYPC 4C6FA 4Q8NA 4DLFA 3E6EA 1EEXA 2WVVA 5D2WA 1Q6DA 3H2AA 4IG2A 4WX2A 2ISFA 3WJXA 4I8YA 3O7UA 3ZLGA 5ECVA 1DV7A 3HF3A 2ZRZA 5E9XA 3UF8A 3SY1A 3UXLA 4IM4A 3CL8A 4I9MA 5DF0A 5I98A 1P4CA 3D3FA 4IMDA 3FYPA 3WJZA 3UZZA 2B7PA 3XIMA 1EHAA 4BA0A 1DXFA 1MUMA 2GQ9A 5KZ6A 4A2SA 3V75A 4KGJA 3PFRA 3DI0A 2VXNA 4AD2A 4S3CA 1E5NA 1K7XA 1Z41A 4RE3A 2ZUNA 5I03A 3PY2A 2W0UA 1XIIA 4ZO9A 3N17A 5F2IA 3VKBA 3QC0A 1ZBVA 1DWAM 1Q6GA 3L9CA 1XH1A 3C6CA 2WW5A 4HCDA 4R27A 5BNKA 2PDPA 3ZXWA 1X6LA 1L8PA 2GQAA 4MMWA 1ZSXA 3CHFA 4DX3A 4C6BA 1OJXA 4S3FA 2PRLA 3XINA 4A21A 1L6WA 3TAOA 5A8QA 3PRAA 2M08A 2PDLA 3HV9A 4AISA 2PLKA 4JBRA 2ZZ4A 4L4LA 2BGQA 4JY8A 3STEA 3UWYA 3BUVA 1TR1A 2PDYA 2V5BA 5M1TA 3M5VA 3L5AA 2PDQA 4L9XA 3TQVA 4OWGA 2QDHA 3GC4A 5AHNA 4P8VA 4IT6A 4FLSA 1UKQA 3AI0A 3LYEA 3LCLA 2AAMA 4JN7A 1U5VA 3L0NA 1W9PA 3WK1A 4QXIA 1KGUA 3RAOA 5FEWA 5C9ZA 4H6RA 2D0GA 1J0KA 1UWIA 3IK4A 3NQFA 1V0KA 3G24A 2DZWA 4HU0A 2ACSA 3TWBA 1BTMA 4E3TA 4YTRA 3HGOA 3CGTA 4MDOA 4GI4A 1HO4A 3NL6A 2ATMA 1QATA 4BEUA 5M2FX 1H09A 3CPGA 2R14A 1KFLA 1GOMA 2ZICA 3DI1A 1OT2A 3CEPA 4BF7A 4CCCA 4IIFA 1V93A 5EPDA 1F8MA 3DGBA 4JFSA 1JZ5A 3FEQA 5DITA 3IVTA 8A3HA 2OB3A 2BG5A 1EJ7L 3K8MA 4UR8A 2I17A 2P10A 2B7NA 2DSZA 1KCKA 3LB0A 3PB0A 4DY1A 1FKFA 1GOWA 1YW1A 4R88A 1M5YA 4DRQA 3L0GA 4UUIA 1CLXA 1NAL1 1A0DA 4EPEC 1ELSA 4DAIA 2VR4A 4FMVA 3ZR5A 5BXPA 2JKEA 1UKTA 3LBOA 3SR7A 1BRLA 3O5QA 4F8XA 1EZ2A 2Z4GA 1VF8A 3D47A 3LUTA 3Q94A 4H04A 4UQCA 3EYPA 1OFRA 1ZP3A 3O6DA 1VIWA 1R38A 1WPCA 5BZAA 3AFBA 3C3NA 3W3OA 1UBPC 1ECEA 2JIEA 3SUUA 5AHIA 1MVYA 2OTDA 3TW9A 4AXNA 2ADAA 3R0UA 3A3HA 3OQEA 1WQ5A 4ZBCA 4R3UA 1A4MA 4L80A 3B0PA 2BVWA 3GHTA 3NPUA 3PHAA 3GYCA 3NSMA 3R13A 4PFHA 2FHBA 2ZWYA 1EJVC 5K9DA 1TZ9A 2EF9A 3W7LA 1HVXA 5DMLA 3MO7A 4H9MA 1OK6A 2C14A 4AHPA 2BY1A 5D75A 5LXEA 2DH3A 1GJWA 3GUWA 3PNUA 3RM9A 3ITLA 1US0A 1I1WA 4KEMA 4IQDA 4LAXA 3AIEA 1H7PA 2IMRA 3OEXA 1TIMA 1U79A 5A6BA 2I14A 1PB0A 1VLIA 4J3TA 1RPKA 3FFSA 1QJWA 4IIGA 3TZNA 4DBWA 3CWHA 3TR2A 4YVPA 1L6SA 4L1XA 1UP0A 3ZS4A 1W3LA 1BWLA 3PBYA 4W7WA 1VHNA 1SPQA 4JS3A 4C6QA 3N13A 1IGSA 3CUXA 3MY9A 1UZ1A 3GXFA 2PDBA 4YCPA 2Y8KA 2JF7A 4MJ4A 4FR1A 1ITXA 4R5EA 1ZQ5A 3MKKA 2P8CA 3BAWA 4CD5A 4TW7A 3ZYZA 3ITTA 3NUKA 5BOOA 1IEIA 3FGCB 1XH0A 3W2UA 2WLZA 2VHLA 3TMLA 1JJKA 7ENLA 5I6SA 1QASA 3EEZA 3MUIA 1JNEA 4O54A 2FVLA 5HW8A 4D8ZA 3GXIA 1JYNA 4TW8A 3UI5A 5IOBA 4PUNA 4GCAA 5CC5A 4LT9A 1MDRA 1XYBA 3LU2A 2PB1A 2BASA 3AU2A 4O28A 1FQ0A 2CC0A 1N55A 1XQKA 2CEQA 2ZIDA 2ISDA 3R58A 2CZDA 1FFRA 1UIPA 4P7QA 1TJRA 3Q4DA 1K02A 2BBFA 4PC8A 3SSZA 2PCQA 1DXEA 3LXBA 3WFLA 3GAKA 3QQ0A 4UFHA 4Z2GA 4I8DA 1VHCA 3KADA 4NAFA 4AZ5A 1B6CA 3HG3A 3LRLA 5FEPA 2XJ7A 2BGNE 1ODZA 4A35A 1WKEA 2VCBA 3O5FA 3UQNA 3S83A 2NSXA 4WGXA 2XFFA 1K6AA 3OVRA 4FB7A 4KPLA 2KX9A 2QJGA 1S1RA 5LA2A 3EDFA 3O3RA 5C55A 4AIOA 5BWFA 1CXKA 4YTTA 3B3DA 3G6LA 3AICA 4Q22A 4FEZA 1B1YA 3N2CA 2YA1A 3BE7A 3AZSA 5EY5A 2BOEX 3BMXA 2FMNA 5I79A 3Q58A 1R3QA 1FWCC 1GVOA 1M65A 4QQ3A 2QYGA 1EC9A 3H2MA 3SQSA 1C9DA 1J12A 1NMWA 3MHGA 1NMVA 1VC4A 4OOZA 4QRNA 5I02A 2HBXA 3F5LA 3WF4A 5I5RA 3SCWA 3E0FA 3W7DA 3EB2A 3H12A 2VGIA 3WLHA 1BAGA 3K30A 2J6XA 5FACA 4MYXA 3UEQA 4GX9A 2NLIA 1YNPA 4XBSA 2FDMA 4JFJA 3C0JA 4P61A 4NASA 5I23A 3AC0A 2YXXA 1XS2A 1JVWA 4MWAA 3W88A 3K4AA 1KR1A 3CQIA 4PTWA 4HMEA 3P2VA 4DM1A 3RGTA 1EF2A 2EO7A 1VCFA 4RXFA 1JAEA 5BOFA 1Y8BA 1WOAA 2YCJA 1E5JA 3KDNA 4KS0A 5A95A 3O5IA 1W3NA 4LUSA 1TPFA 2ZVIA 4HBKA 4U5KA 4ZTYA 2PV1A 4FNSA 4CNUA 1H61A 3JZUA 4GYJA 4AEEA 1BFNA 4YTUA 5FSDC 2YJQA 3JU2A 2RHGA 3QQ1A 4LTSA 1AW1A 1YDNA 1QHPA 4IPPA 3RYSA 2A7NA 1X96A 5DXXA 1G7VA 3IUHA 4DYJA 3KTXA 2PDWA 3ZT5A 4DB7A 3QZAA 5EFDA 1FKWA 2VO5A 3H55A 3ARRA 4YHGA 4PL2A 1UA3A 1LROA 2Z1WA 1CGYA 1JQXA 3QW3A 5AZ1A 3F4DA 1KRAC 3KL3A 1EIBA 3GXMA 1R9YA 3BLEA 4DIAA 2PDIA 2HSAA 2V0TA 3QY6A 1F05A 4N9CA 3QC3A 1OGGA 2XIQA 3S2CA 1C8XA 3M16A 2C91A 4JX6A 3E2VA 1QW9A 4B5NA 3LA4A 3F2BA 3M47A 6XIMA 5AHFA 1TCMA 5HTGA 1JGMA 1TG7A 3KP1A 4A22A 5LHFA 3U0HA 3EWBX 1KM2A 4JYSA 2CU0A 4TW6A 4K39A 3CO4A 2E5CA 2BB0A 2OZ8A 4O52A 2Z28A 4B4HA 1FVPA 5DMNA 1XG3A 2VQTA 3SIZA 5HPCA 4INFA 1PX8A 2BOFX 4IZGA 2HJPA 2JEPA 1KWGA 3WJSA 3P93A 5EL1A 4M24A 3LG3A 4ODMA 7A3HA 3S6OA 3TYUA 3ONCA 5HMDA 3NSNA 2GQ8A 2OCZA 2Z1SA 4JFUA 3EGJA 4QE4A 4HZMA 2H8XA 1L8NA 3GC2A 3AHTA 3WDRA 4WQ6A 1ZK6A 1MDLA 4BY3A 4O19A 4Z2LA 3GH4A 2F6UA 1HTIA 1IIHA 5D2YA 2E8YA 2ABAA 4L4MA 4HZ7A 3ES7A 2WSYA 4GUFA 4CNNA 3OZMA 3W23A 4E0CA 3GNPA 4MFEA 1IZJA 1NM9A 2A21A 4OOUA 2IQDA 3W29A 2V38A 5JQ9A 1AW2A 4HPNA 1V77A 1TVLA 4FIQA 1PAMA 2QCGA 4C7FA 3TWAA 4K68A 2PWEA 3C2YA 3PTMA 4KIRA 3CB8A 4UTWC 2G0WA 4QIBA 5D05A 3VX1A 4EWND 2CKSA 3DC8A 3ID7A 3RJXA 2ASHA 3IJ8A 1K8YA 2XGZA 2Q8XA 3N14A 2HS8A 4GXWA 2AWGA 4DJDA 2QT3A 3GHUA 2QZRA 1SW7A 3WLNA 4DUWA 3V0UA 3N18A 3L4UA 3H53A 3VIKA 3TJLA 3WD0A 1EBGA 1AH3A 3IACA 1A5UA 2GYIA 3R8GA 3BW3A 4O2TA 4JTCA 3II1A 4JYFA 4C6MA 4F0HA 3UPWA 3HFYA 3KOFA 1A3XA 4RK8A 3PM6A 3I7RA 2OWWA 2FH6A 2CESA 4JTLA 4MHBA 1DWIM 4KESA 4FK9A 2IPJA 5REQA 3LHUA 4AZCB 2OZ3A 3LBCA 3WF3A 1P5QA 4Q8MA 3A4WA 3A4AA 3SY5A 4ZFCA 3NVDA 1FCQA 4AC1X 3WD3A 1YNYA 4ODOA 3ARPA 2OELA 1BYDA 3FGCA 4US5D 3LLDA 1V7AA 3H9RB 3G1DA 4K7VA 4RL3A 2WMFA 4FXFA 2ZR5A 3BICA 2EJAA 3GVWA