1TFVA

Crystal structure of a buffalo signaling glycoprotein (spb-40) secreted during involution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords mammary gland protein 40
publication title CRYSTAL STRUCTURE OF A BUFFALO SIGNALING GLYCOPROTEIN (SPB-40) SECRETED DURING INVOLUTION
rcsb
total genus 107
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1tfvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tfvA01
1MW1A 1UD6A 4EK7A 1W3JA 4AD0A 3TTSA 3MMDA 2RGMA 3VGDA 4PTVA 1GORA 2CKSA 3BGAA 2AOSA 3SCNA 5A94A 2BV9A 1E6SM 4DM2A 4AD5A 1UD4A 3PZNA 1C8XA 3AROA 4HZ6A 4AD1A 1G5AA 2DT0A 4PTMA 4PUDA 1V6YA 3LPOA 1R8LA 5A6JA 5D9NA 5I24A 1W1TA 1ZBCA 1V02E 2D23A 3TTQA 2CKRA 4MB1A 2CBJA 4BQ4A 2XHYA 5C70A 5FCZA 3FW6A 5HDRA 1Q6GA 1QOXA 3GBEA 5JUVA 1GOMA 5GNXA 1JFHA 1KR0A 4LX4A 1GJWA 4WLCA 2CERA 1BSIA 4OBRA 1HXJA 2GUYA 4UFLA 2QMKA 4CVUA 4D71A 3CUJA 2CHNA 2IUZA 3WQ6A 2EJ1A 4EAMA 1U30A 4X9YA 3HJEA 3B9AA 1UUQA 3VM7A 4Z2JA 3K8LA 2J75A 3SCPA 3BAYA 2PBOA 4PSPA 4NRRA 1CXLA 2D1ZA 3VX1A 5BWFA 3M6DA 3BAXA 4DWSB 4AZIA 1JYXA 1HL8A 5BRQA 4CU7A 3POCA 2WMJA 3WMSA 4BQ2A 2UWFA 4J3WA 3L4XA 1JAKA 3DC0A 2BXZA 3HMCA 4V2XA 2DT1A 4HZ8A 1D2KA 1XYFA 2YA0A 4TX8A 2V3GA 4CD6A 1PX3A 4J3VA 4B15A 2GJXA 3VILA 3N15A 2JEQA 1KR1A 1UH4A 2VX4A 5ABHA 5GPRA 4ACYA 1VAHA 2WBGA 1GVYA 3WDPP 1V0MA 3U5UA 2EQDA 2O92A 1EQCA 1KQYA 2XVPA 3VX0A 1F4HA 1GOIA 1B30A 4A3HA 4OOUA 1UZ1A 2WKGA 1ZBKA 5ABFB 2VNCA 3ARQA 4H8HA 5IFTA 5FD0A 3WDJA 5BYWA 2YL8A 5FOOA 1CGUA 1LL6A 2YA2A 3KL5A 1NWRA 5D9OA 3WD1A 2Y4SA 2E40A 1QI2A 3QHMA 2J7HA 2WKLA 1GJUA 2CBUA 2J7BA 1UQYA 3CZJA 3T0AA 3SEPA 2WW5A 1NQ6A 3OBAA 1E6ZA 2CXGA 4AZCB 2G3NA 1GHRA 2WXDM 2W92A 1QW9A 4PBGA 1UR0A 4MJ2A 1JYVA 1C7TA 2XVKA 4DUVA 3I3EA 1OWQA 4UCFA 4AD2A 5CLWA 3W38A 3AZRA 4AZ6A 1XHGA 3T2PA 3PN8A 4GO8A 5BRPA 3AMCA 4QDMA 2ZUTA 5HOSA 2W62A 2Z1KA 1CZ1A 3VIGA 1E0VA 1WAWA 6TAAA 4JL2A 1H0IA 1ZB5A 4WIWA 2X0YA 3AIRA 3UR8A 8CGTA 4H41A 4WKHA 1HJWA 3A4WA 1BYBA 2ZUNA 4WJXA 2NSXA 3VVGA 5JH8A 4ACZA 4P7RA 3I3DA 1JI1A 3VTRA 4FK9A 2PI6A 2GK1A 2E4TA 5IXEA 3SIMA 3PTQA 2BVTA 4NF7A 4UZUA 3CLWA 2JE8A 4OBSA 2XFYA 1RD6A 3PZMA 3B9EA 2JFEX 1EDQA 3TTYA 3F5KA 4UQDA 3WD4A 3W25A 1QNRA 4JHOA 4DWSD 3NYDA 3T2OA 3VGBA 2ZXAA 1V6XA 4HMDA 2EXOA 4Q22A 5AY7A 4N0RA 4KWUA 3IJ7A 3L2MA 2ZOXA 4P8XA 1Q6CA 4WF7A 2VC9A 1V3LA 4UNIA 4MAVA 4P7NA 1IZJA 1WP6A 4M29A 2ZICA 3WNPA 3U5YA 4BA0A 3WN6A 3M7SA 3W27A 4RL3A 4Q7NA 4Z2KA 1SR0A 2NT1A 2WM0A 1PZ2A 3N13A 1EHNA 5HPOA 4W87A 3AHTA 3VGFA 1W9BM 1GONA 3ARVA 3S6TA 4EE9A 4KRTA 4ZE4A 5EBAA 2W67A 2UY5A 1KWKA 2HVMA 4H8UA 3AIUA 3PZ9A 1ISWA 3DHUA 1R7AA 5LA2A 3AXXA 3VDHA 2YBTA 3J7HA 5I78A 2OSWA 1XCXA 1CGYA 4KGLA 2WZEA 4W8BA 1ZS2A 2F8QA 2DH2A 4M56A 1ODUA 3BLKA 3UESA 3TOPA 2OWCA 4XZWA 2XWDA 3AFBA 3GXFA 5A8MA 1UHVA 2XM2A 3AS0A 1UQZA 2PWEA 2PB1A 4MDPA 3RM4A 3VKKA 1LL7A 5E09A 1E6XM 1PAMA 1JXJA 3UERA 4JFUA 3VIMA 1J12A 3VIKA 4W5ZA 3IJ9A 1P6WA 2BY3A 2ZUVA 1D7FA 1PZ3A 4YHGA 1EIBA 3SUTA 4GI9A 1E3ZA 1Q6DA 2VOTA 4UZSA 3VINA 5HPCA 3HN3A 1QI0A 4W84A 4U31A 5GNZA 1KBKA 2Q8XA 1OINA 3AIVA 1V03A 4PRWA 5AC4A 4EKJA 4W89A 5CPQA 1TVPA 3FN9A 5CLTA 3MUY1 2WCAA 3GH7A 3PTKA 3N18A 4F79A 1KWGA 1UKQA 4GKLA 3AHVA 1W9PA 5I2UA 1UD2A 4ZENA 2ZXDA 4HOZA 3AIEA 1B0IA 1UWRA 3CUFA 1HP5A 1E5JA 2GVYA 1V3MA 4JCMA 4A4AA 3UR7A 3VDCA 1J01A 2GK1B 3AZTA 1NWUA 3W82A 1XSKA 2WSPA 1DWGM 5BXPA 4LYPA 5HXMA 6CGTA 1CDGA 1MFVA 3M46A 5A2BA 3NDZA 2E8ZA 2ZX7A 2QMJA 2V3DA 1S46A 5FKYA 2WANA 1D3CA 2AMGA 1V3IA 4D6DA 3WDQA 3AS1A 2J74A 4CKQA 4AYSA 5HNNA 5IHRA 2WHKA 3RJYA 2XGIA 2XVNA 2V5CA 1QHPA 5EB8A 1BYDA 1JAEA 4BQ5A 3VU2A 2YLAA 4C7DA 1CGTA 2WVUA 3ZJKA 3K8MA 1W1VA 1OGGA 3DYOA 4CN4A 1BVNP 3CBWA 4W7VA 5I0DA 3AHYA 1CGWA 2TAAA 3OG2A 1DWJM 3VMNA 1WO2A 1HJSA 3WDIA 3CZKA 4QFUA 4XV0A 1OM0A 2D3NA 4HZ7A 3SCTA 4HPHA 3CH9A 3WQ4A 4V28A 1B3VA 1W2VA 5TD4A 3T0DA 1E4IA 3CMGA 4AISA 4D6JA 1VEPA 3WBAA 1V6UA 1ESWA 3TTOA 3KEHA 1Z32X 3MO4A 5GNYA 4B16A 1WZAA 4URIA 1V3JA 3IK2A 3BMWA 3VUPA 4PCTA 3OA5A 3IJ8A 3MANA 3ZMRA 4JFVA 2D22A 3AJ7A 4AY1A 1FH9A 1MXGA 4FLQA 2YL9A 5CG0A 1VIWA 1TUXA 3MUAA 3WUFA 3AS3A 1WDRA 4PEEA 4KRUA 1GUVA 1JZ5A 4ML4A 3EDDA 2ZWZA 1QHOA 4P7QA 5A8OA 1KGWA 2YL5A 2A3AA 1PX8A 4P8UA 2VRKA 4MAZA 4UOJA 1CBGA 3MU7A 3ARZA 4AIEA 4AWEA 4QAWA 1AQMA 4DWSA 2WK2A 1KXTA 1H41A 3ZR5A 1M53A 2O9OA 3E1F1 2X8RA 4M24A 1C3FA 3WKZA 4UQCA 2G3IA 4XB3A 3VIHA 5M03A 2D2OA 5KEZA 4W88A 2VL4A 5A6LA 3W6MA 4PMVA 2WSKA 2XGBA 1TE1A 2XYLA 4S3KA 1MW0A 5JBDA 1ZU8A 1JL8A 1EDTA 1B3XA 1KGUA 2VZTA 2EPKX 1BFNA 2YDSA 5BXSA 2VX6A 4RE4A 5I79A 2PWHA 3WNMA 2EPMX 5LYRA 5JBEA 3U57A 2E9LA 4J7RA 1KGXA 3WF4A 1OGSA 2EBNA 2CNCA 3TP4A 5ABFA 4J3UA 1VENA 2FHBA 3VM5A 1DHKA 5A8PA 3GDBA 1BYAA 2UY4A 2QF8A 3AISA 4AZBA 5A6KA 3WNNA 1FH7A 4D72A 1V0NA 3THDA 1MFUA 1UH3A 7CGTA 3QOMA 1E15A 2BVDA 4FMVA 4CD4A 4CU8A 1UOKA 4AZCA 1UKOA 2E3ZA 1XV8A 1W91A 1FA2A 3RDKA 4FLRA 1A47A 1NP2A 1JF6A 3PZGA 1E1FA 4EANA 4U5KA 2VZOA 3VDBA 1UWIA 1X1NA 2ZUUA 3OB8A 1HJVA 2XUCA 1CXHA 3B8SA 4ZE5A 1UR1A 1J18A 1V02A 1E5NA 3T0BA 1B3YA 4TVDA 1WZLA 4W8AA 1H3GA 3OIHA 4U2ZA 4LGXA 3OLEA 4M81A 4X0NA 1B3WA 1O7AA 2VQTA 3WH8A 3W24A 1EA9C 3AIWA 1E3XA 3GXMA 2AAAA 1KXQA 1JF5A 2WCGA 3VPLA 1XSIA 5C71A 1ZJBA 4PTWA 1MQPA 1E72M 4LYQA 1O6IA 2BFGA 1HKIA 4PMNA 4QCFA 2DSWA 3SURA 2CETA 3CGTA 4J3XA 2YA1A 2BY1A 3CHCA 3ZSTA 3F5JA 1JDDA 4GIAA 4AIUA 1MYRA 4UFJA 2D0GA 2WHJA 1H1NA 1M7XA 3VGHA 3K46A 2JIWA 4MB4A 1EDGA 4JFSA 1E70M 3DYPA 4M8UA 1E4MM 1DTUA 1W3HA 1V0LA 4QLLA 3FHQA 5GQBA 3CPUA 1UA7A 4HP5A 1M01A 2XG9A 3F5LA 2ZXBA 2PC8A 2EPNA 3CIVA 3WDHA 3CZLA 3KL0A 2F2HA 4CVWA 2CESA 3AICA 3RJXA 2BVYA 5A6MA 7A3HA 1EOKA 1C7SA 1W1PA 4GI8A 4RE3A 1W9XA 2YIHA 1WKYA 5FL0A 1BVZA 4DWSC 4UQ9A 3WF3A 1C92A 1VRXA 3JUGA 4WKAA 1ISXA 3EMZA 4UR9A 2WNWA 2EPLX 1C8QA 3MUZ1 4PTXA 1UKTA 2UY2A 2OSYA 3IAQA 2CHOA 1CNVA 4TXEA 5D9PA 5DFAA 2VZSA 2XSBA 3BLPX 2ZIDA 2WAGA 1NH6A 4MADA 2ZWYA 1GW1A 1PX4A 4B3LA 3NSNA 2VURA 4YN5A 4KH2A 4PMQA 4J3TA 4PN2A 5JIWA 4F66A 2WZHA 1FFRA 1CLXA 5FIPA 2A3BA 1E55A 1QVBA 3WQ5A 5A6SA 3VNYA 4GINA 1I1WA 2VZUA 3BXWA 5A2AA 1XRVA 1ZJAA 2CBIA 1JNEA 3UG5A 1JNDA 5CJ5A 3GNRA 1NWSA 2DGAA 2VX7A 3O6AA 1CEOA 2C7FA 3GXDA 3ZT7A 3A4AA 1XD0A 4DM1A 1VB9A 4D1IA 1B31A 4U33A 2X2YA 2PWDA 4CN1A 5M17A 4WK9A 4R5EA 1SMAA 1BYCA 4IPLA 2DT2A 4MNLA 4L4PA 1E4NA 3POHA 1WNOA 4LPCA 4C7FA 1PIFA 4OKDA 1GVIA 4C7GA 2FH6A 1V0KA 1KB3A 1CYGA 3MMWA 2HISA 5JBFA 1E40A 1DWIM 3ARRA 1GHSA 1KCKA 3TA9A 2BHZA 1MWOA 1EOMA 3PZUA 3WMBA 3PZQA 4OUEA 2YBUA 3VD3A 1EO5A 1VBUA 3NJ3A 2XSAA 3WL1A 4CD8A 5A69A 5CSYA 3K4AA 3SUSA 4ATLA 4JKKA 3CZEA 1BHGA 1PBGA 3L4WA 2W63A 3AYRA 1EO7A 2DPEA 1OB0A 3PHAA 2A3EA 4W8LA 3L4VA 7TAAA 4IM4A 3SCSA 1ZBWA 3GZAA 4OZOA 1US2A 3FXYA 2XVGA 2VZVA 3EMCA 5DEZA 2OLHA 4D6HA 4AD3A 3ZSSA 3AIQA 1B9ZA 1HJXA 1BG4A 1OGBA 1EH9A 3S2CA 2YDQA 3PZVA 1MW3A 4PMXA 1G0CA 2Z1SA 4TOQA 4DUWA 2VR4A 1TA3B 3CO4A 2GSJA 3MUIA 3QGVA 5A6BD 2IXVA 2ZX8A 1XCWA 2A3HA 4AZHA 2D20A 2DEPA 1K9DA 4U2YA 2W66A 4GI6A 1JZ7A 3WQWA 3KL3A 1I75A 1GQIA 4PMOA 1L0PA 9CGTA 4J28A 3ARXA 2WB5A 1JZ3A 1M04A 5KZ6A 2JALA 1QPKA 2WC7A 3ZJ8A 3CUIA 3WBEA 1TMQA 3GXIA 4HOWA 1JZ6A 4GQRA 3HU7A 3AMDA 3SCUA 1J10A 3CHFA 2FHCA 5BXTA 2XPKA 1V6VA 2XFRA 1JYWA 3AYSA 4B9YA 1TR1A 1VEMA 4ATDA 4UFMA 4Z2IA 4JFTA 3WL0A 4F9DA 2PF0A 1U2YA 3N12A 4PYSA 5E6ZA 4F9JA 4W86A 1CXEA 5DT5A 3GYCA 3ARWA 1LL4A 3AMLA 3ZJ7A 3NCOA 4WSJA 4PMYA 4IUGA 5M3WA 1J9YA 3WIJA 2VUYA 2MANA 3WUBA 2DT3A 3QHOA 2FGLA 1MXDA 1RP8A 1QI5A 1OT1A 5LA1A 2O9TA 2WVVB 1QNQA 2BS9A 4UFKA 1BG9A 2XM1A 2VO5A 2GDVA 4H8VA 4AW7A 1CECA 4WKFA 1C93A 1K9EA 1HX0A 1JYNA 1FP8A 2CPUA 5I77A 3FAWA 3VD7A 2WVSA 1VFUA 3AMKA 3NUKA 1ZL1A 5I6SA 3RM8A 1CPUA 3D5HA 5CPSA 1Q6FA 4UFIA 4UFHA 1A3HA 1SFSA 5DT7A 1FH8A 1R87A 1UR4A 4ZFMA 4A3YA 1KFWA 1WDQA 3PBGA 1J0IA 2VI0A 3NSXA 2W4XA 3WH6A 4MNMA 2VCBA 1PIGA 1OCQA 3WNKA 3L4TA 1J0YA 2G3JA 3MV11 2J8FA 3WD3A 1OIMA 5C8BB 1BAGA 1LWHA 1QI3A 3AZSA 3GNPA 4GZJA 3RCNA 1LQ0A 3N17A 1RP9A 5JIPA 4F8XA 2ZX6A 1FOBA 2WBKA 4YHEA 2E9MA 5E70A 1DP0A 2ZX9A 3N11A 3II1A 1E9LA 3FNDA 3CUGA 2J62A 4LQ1A 1RPKA 3AOFA 4WSKA 1X6LA 5BROA 2DH3A 2W61A 5ABGA 4JKMA 3G6LA 1R7OA 4HMEA 1DWFM 1RH9A 3EDFA 2XTKA 1B90A 1K9FA 1QBAA 5E9AA 1GCYA 2G8ZA 4FLSA 3LPFA 1E73M 4BCEA 4E2OA 3VD5A 5A3HA 1AMYA 2DQXA 3W81A 4MTVA 1JZ4A 1JXKA 1VJZA 2PWFA 5EFFA 3OGVA 1J0JA 4CCEA 2QV4A 2EEXA 4ZXOA 5IHSA 4H04A 2WMFA 3WQ8A 3PTMA 4XX6A 1UR2A 1GOKA 1VBRA 5CGTA 3UCQA 3VIPA 4JHZA 1V08A 3K8KA 1TFVA 3U7BA 4V27A 4HU8A 1ISYA 4TUFA 4P7LA 3KE0A 2J7GA 2WMIB 3L4UA 1C90A 1HF6A 2G41A 1V3HA 2G3MA 3DECA 3WDRA 1GQKA 2DIJA 2BHYA 1WB0A 4AEEA 2B31A 2E9BA 1MQQA 2JF7A 3AS2A 2W5FA 1M03A 4AEFA 1KXVA 2VCCA 1G01A 4J3SA 3L4YA 4QCEA 4OIFA 2J78A 3U7VA 3ARSA 4U3CA 1QNPA 5EFDA 2FDMA 3A4XA 1DWAM 2Y5EA 4PCSA 4PMRA 3SCOA 1HKKA 2WHLA 1NARA 1HKJA 1W9UA 1XGZA 3EMQA 2NT0A 3M07A 6A3HA 1E6PA 1HJQA 3AMGA 1UD3A 3L2LA 3VIOA 1UYQA 5BCAA 3ZM8A 5A6AA 3WD2A 4ZXLA 2CEQA 3SUUA 2YDRA 3MS8A 2YKKA 2WMGA 1CXIA 4BZYA 4IISA 5AYBA 3I3BA 4B3KA 2Y2WA 1G1YA 2VRJA 4KGJA 3RIKA 3CMJA 1E56A 1GZJA 1L8NA 3AHZA 1XSJA 3WF2A 2DSKA 2CIPA 1NP0A 1X6NA 1H0GA 3CHDA 2CITA 3ARUA 3AI0A 3W37A 4TVUA 4CD5A 5A1AA 2DSUA 3BAKA 1E1EA 1UWSA 4W7UA 4P7OA 2O9RA 3MSGA 3ZQ9A 3WNOA 5DMYA 1G94A 4UOQA 2VT0A 2WWCA 4UQBA 1WZMA 1XC6A 4W93A 3ARYA 4XUYA 1CGXA 1IZKA 3O9NA 4ATWA 3G6MA 2W91A 1R86A 1BGGA 3W29A 3VNZA 1OSEA 4PSRA 2GJRA 3OLGA 3QHNA 4DUXA 4PUEA 2ZUWA 2DSZA 1JZ2A 4MJ4A 4AMCA 4HU0A 1PEZA 3GTNA 5E0FA 1OD8A 4UOZA 3FY1A 1YHTA 4MPKA 2Y8VA 2YJQA 4HA4A 4JZ5A 1LJYA 4TX6A 4B9ZA 1KBBA 1I1XA 1PPIA 2VCAA 2NW0A 3ZJ6A 4AZ5A 2QPSA 3UG3A 5A2CA 2J7CA 2WWDA 1CIUA 1QI4A 3K1DA 4E8CA 1SYTA 4HA1A 1GQLA 1KCLA 2VVSA 2JIEA 4W7WA 2VVNA 1ITCA 5AYIA 4AD4A 3GNOA 5A95A 3WFLA 4H7VA 1VFOA 1LG2A 2XIIA 1W2PA 1US3A 3UG4A 2WLYA 1ITXA 3W0KA 4U3AA 1TCMA 5I3DA 1EGZA 3GH4A 4OOZA 4CD7A 3QOKA 3WUEA 4GXPA 3W6LA 4TTGA 4D6EA 1TA3A 4QP0A 3BC9A 1YQ2A 4AZ7A 1VJSA 4Z2HA 3T09A 3A6OA 1CXFA 1UD5A 1E43A 3CHEA 1HVQA 1KXHA 3OLDA 3WEMA 2C0HA 3L4ZA 4QLKA 2ZE0A 1CTNA 3W4RA 4UTFA 2CYGA 3WSUA 2X05A 2FHFA 2QHAA 3PZOA 2X0HA 2X09A 3BAIA 3OGSA 2WZIA 1VFMA 4KMQA 1IV8A 4H2CA 1UH2A 2WYSA 1ODZA 3LPGA 1JFXA 4FLOA 4S3JA 1JG9A 4Z2LA 3WD0A 4RE2A 2OYLA 1LWJA 3PZTA 3B9DA 1VF8A 5I23A 3EYPA 5DO8A 1UKSA 1UWUA 2J8GA 5D8ZA 1PJ9A 3ZT6A 4HMCA 1ISZA 3F4VA 4CGTA 1OD0A 4MDOA 4Y7EA 1W9VA 1NOWA 4BF7A 5M5DA 1JZ8A 1XH0A 8A3HA 4CCDA 3VD9A 1Y7VA 2FH8A 3RM9A 5CPTA 2WVVA 1JD7A 1OIFA 3WH7A 1E6QM 1B1YA 3OZOA 3OGRA 1UD8A 1HT6A 4GO9A 3VGEA 2VJXA 2WVTA 1W9DM 2J4GA 3WEOA 1CXKA 4PMZA 5A8NA 5E0CA 3WMCA 1XH2A 1JIBA 3GH5A 3RMEA 4HTYA 1AVAA 3ZIZA 4P8VA 1JGIA 1LF1A 4LXFA 5D9MA 3AXIA 4BQ3A 1E0XA 3GM8A 2J77A 1UA3A 2VTFA 5EMYA 4NRSA 4CUCA 4QLJA 1J0ZA 3CUHA 1UZ4A 1VEOA 1H11A 3CTTA 1EHAA 3SCQA 2DDXA 4GPNA 3ZO9A 2V3FA 3BSGA 4AZGA 3K4DA 2XWEA 1GOOA 1U33A 3UEQA 1JDCA 1GNXA 3WEZA 1K9TA 1W3LA 3MMUA 5FL1A 1LG1A 1OBAA 1BPLB 4J27A 2GJXB 5I5RA 1H2JA 3KZSA 1NWTA 3EBVA 5CSUA 3RO8A 1QNOA 2QLYA 1R85A 4HPGA 1BLIA 1W32A 4PMUA 3WUGA 4D6FA 5IDIA 2XJ7A 3BCFA 1EXPA 2VMFA 4L4OA 3AQUA 1ISVA 3WY1A 3IANA 3IAPA 3MSDA 3BMVA 1AQ0A 2QPUA 2YOCA 3ARPA 4P8WA 2YLLA 2V38A 1UKPA 3WENA 3WELA 4GQQA 5E6YA 4TTUA 3W26A 4W85A 1HKMA 2WCSA 3SCWA 4Z2GA 3MV01 4TVCA 3THCA 3EDKA 4UQAA 2YL6A 1K6AA 1MQRA 1TG7A 3VIFA 3AHXA 4OJYA 2GFTA 4JFWA 3WF0A 2ZXQA 2WMIA 2D0FA 2Y8KA 3WH5A 2J47A 1V3KA 1HNYA 1W3KA 4X0VA 2CCRA 2X1IA 2GJPA 3RPMA 1FFQA 4D1JA 1C8YA 4UQEA 1FHDA 4XZBA 1XH1A 3T2QA 1WZKA 2EPOA 2FGZA 2D0HA 4D6CA 4R27A 3RILA 3QR3A 5CXPA 4JCLA 5BXRA 1J11A 3OLIA 4E8DA 2DIEA 1HP4A 1GPFA 3ALFA 4ACZB 2F61A 1XYZA 3N9KA 1JI2A 3BCDA 1NOFA 1HJUA 2WMKA 2D3LA 1E0WA 4JKLA 3AXHA 4NZCA 1WE5A 2V5DA 1SMDA 2J7EA 1BF2A 3EDEA 4ZEPA 3CZGA 5LA0A 2VR5A 1NM9A 3UETA 1MW2A 2XVLA 2ZX5A 1JD9A 3BSHA 4N42A 1H5VA 1LLOA 1KQZA 1Q4NX 3NIYA 3W28A 3GBDA 1UWQA 1C91A 3SCVA 3VMPA 3VIJA 4JIEA 2OWWA 2O9PA 3N04A 1GOWA 2D24A 4FF5A 2BY0A 5AC5A 1OT2A 1WDPA 3LPPA 4JL1A 2E0PA 1F4AA 4AC1X 2IXUA 3VIIA 2XFFA 3A3HA 4U5IA 4K68A 3ARTA 2J7DA 4CCCA 2ZUMA 4MNJA 2PWGA 2XIBA 4AIOA 3PZIA 2ESCA 5F7UA 1E6RA 1MVYA 2WC4A 1Q6EA 2OWXA 1QNSA 2BNJA 2C8NA 2WLZA 1CGVA 5CQ1A 1HIZA 2E8YA 2RGLA 2V3EA 3WNLA 4MB3A 4BS0A 2J79A 2BXYA 4HA3A 4CU6A 4HOXA 3SUWA 1HL9A 3KWXA 1CLVA 3FHAA 2ZUSA 3TONA 4MNKA 3W53A 1NOUA 1UR9A 1E6NA 1WPCA 2OYMA 1DWHM 3VGGA 1HVXA 2VX5A 4NI3A 3OZPA 4CN6A 3VO0A 1UG6A 3AIBA 3VD4A 4W5UA 4GZIA 4PMDA 4NSBA 1TZ7A 2BHUA 1HN1A 1H49A 1TVNA 1B3ZA 4JAWA 1WCGA 1GQJA 1E4LA 2G4FA 3ZT5A 3SUVA 3FAXA 3ZOAA 1V6WA 1AQHA 2J7FA 4D6GA 5HBFA 2OYKA 1J0KA 1W1YA 4E4PA 5ECUA 3VDAA 3ALGA 2EO7A 2WPGA 1VFFA 2JF6A 1IT0A 2UY3A 1CWYA 2A3CA 1B2YA 2Y24A 5DF0A 2JEPA 2WHMA 3ECQA 5D4YA 3SCRA 3BAJA 3WF1A 3ZR6A 1H4PA 5CZKA 1H09A 4IPNB 3WFZA 3BAWA 2WMHA 3N1AA 2DSVA 2PBGA 3WH9A 3APGA 1UR8A 1N82A 1FHLA 3DYMA 2VRQA 2OSXA 3VOCA 2BY2A 5IFPA 1UWTA 5A8QA 1QBBA 1GOQA 4M80A 1QHZA 1ECEA 3BH4A 1DEDA 3WQVA 5A6BA 2J25A 3D3AA 1WDSA 3LMYA 1XD1A 1BQCA 3CZ8A 1E71M 3NDYA 5ABEA 3NSMA 3A47A 3DHPA 1FP9A 1ZBVA 1JDAA 2WC3A 4MB5A 1J0HA 1CENA 2VQUA 1G9HA 3EDJA 4GZEA 3MKKA 3O2LA 4M82A 5D8WA 1BTCA 4M1RA 5CGMA 3T08A 4D6IA 1QW8A 4YPJA 1EQPA 2CBVA 1BGAA 4LYRA 2GDUA 4AXNA 3VMOA
chains in the Genus database with same CATH superfamily
5E5CA 4AD0A 4C6DA 5I3FA 3GVGA 3VNKA 3W7NA 2AOSA 5A94A 4DM2A 1SO4A 5ENLA 4IPPA 4AD5A 1UD4A 4ZO9A 1FCUA 1UB3A 3KVKA 4I5XA 3WK2A 3W71A 3LLFA 2DT0A 3S5SA 4WXYA 3LPOA 3S6OA 4EX4A 1V02E 3OHIA 2OLAA 1IR2A 4XBSA 3S4TA 5C70A 3FW6A 4UTWC 3GBEA 2D69A 3RXZA 1KR0A 4O0ZA 1BSIA 4WD0A 4NX5A 4OBRA 1HQTA 4AF0B 1W26A 3NGFA 2ABAA 3NG3A 2QMKA 3CUJA 3GDLA 4U4MA 4C60A 1E9IA 3B8IA 4EAYA 4ICCX 2PF8A 2EJ1A 2C1HA 3ABXA 2P8CA 4JIHA 1LOLA 3EWCA 4JTGA 5AC6A 5A8GA 3K8LA 3FA3A 2PBOA 1NIUA 1RCXB 4NRRA 4YTRA 2D1ZA 2ETNA 2IPFA 2Y8UA 3CJPA 3O07A 3RU6A 1XXXA 3M6DA 1RV8A 3QH2A 3OZYA 3D3FA 3BZJA 2QUVA 2WMJA 4O4VA 1DXIA 2V67A 3L4XA 5HWBA 3DC0A 3ORWA 1ITUA 4KFNA 1D2KA 1XYFA 2YA0A 3VKAA 1PX3A 3VILA 3N15A 3S6DA 2JEQA 1KR1A 4Y9PA 3O3RA 5GPRA 4JTCA 4IOTA 1VAHA 2GVJA 5HUOA 3U6WA 3WLJA 1V0MA 3U5UA 1I2RA 1EQCA 1KQYA 3CV7A 3E6EA 1OX6A 4DY1A 1LZOA 1GOIA 1MEWA 2PGEA 1AW2A 2WKGA 1CX9A 3NPXA 4EVZA 2YL8A 3P8JA 5B80A 5KZDA 3N2XA 6PTDA 2YA2A 4DF0A 3P80A 4O50A 1LOQA 3AYTA 5LIYX 1GWJA 4O11A 3WD1A 1QI2A 4FAMA 4Q8UA 3LQLA 2XU2A 2CBUA 4HBKA 3I6RA 2KGJA 4NNCA 3CZJA 3T0AA 3SEPA 2WW5A 1E6ZA 2I5GA 4I5RA 3QV9A 2XVKA 1IIGA 5HINA 3DG3A 2XDFA 1IIHA 2ZQ0A 3CB8A 4AXKA 5BRPA 5FEPA 2ZUTA 5HOSA 1XICA 2Z1KA 3DBNA 4DO6A 1R47A 5KINA 3NA8A 1R3VA 4F2BA 4J1OA 1ZB5A 3WCZA 4J40A 3AIRA 3A4WA 3MDYB 1RQBA 1D7IA 4P7RA 4FK9A 3EA3A 3EWXA 3AU2A 2AGKA 1XIDA 3H4WA 3INPA 5AHMA 4U84A 2BVTA 3LENA 2CZEA 1MNSA 3C5QA 3S2LA 4V33A 1RD6A 1Q65A 3NQ8A 4CQAA 1EDQA 4Y9NA 3F5KA 3WD4A 1GPWA 2PLCA 4IX0A 3L67A 4DWSD 4GIEA 3NYDA 2O56A 4HN4A 4K7YA 2ZXAA 7ENLA 3BQ6A 1QPRA 1XIJA 4Q22A 1FKLA 4N0RA 3IJ7A 2ZOXA 5MF5A 4AY8A 1QO2A 4O54A 1GYLA 2ACQA 4LAMA 2FPVA 1IZJA 1WP6A 3U5YA 1HUVA 2X1SA 3CXOA 4RL3A 3VOIA 4DEFA 3CQIA 4O52A 4ZOEA 4UIOA 2G37A 3GWQA 1W9BM 3I65A 1GONA 3HGOA 2DVTA 4ZE4A 1XFCA 2ZFAA 4WSHA 2UY5A 2Z28A 2UV8G 3W1RA 3AIUA 3E3HA 4DJFD 2ZZ4A 3C8FA 3AXXA 2YCIX 1H60A 3QC0A 5FF2A 2OSWA 1CGYA 5CC6A 4JDBA 3IIVA 2F8QA 3VI2A 1ODUA 3UESA 3TOPA 3PANA 3TVAA 2R94A 3STCA 3VE7A 5A8MA 2OLSA 4JQ2A 1XYBA 3R2GA 2PB1A 3RM4A 1LL7A 3STPA 1PAMA 1JXJA 1XW8A 3HZ3A 2FAPA 3H26A 5HMEA 1LRQA 4HN8A 3W7KA 1L6GA 3GLCA 4XUGA 3UZJA 2QDDA 1LRNA 3V35A 1TPEA 3PBUA 1BXNA 4LAWA 4ZFCA 1UROA 1QI0A 2FZMA 1KBKA 2Q8XA 1OINA 2OO6A 5AC4A 4EKJA 3E0IA 3TE9A 1E44A 3N18A 4F79A 4LEQA 5BW6A 5DY3A 1B3OA 2YCLB 1W9PA 3C3UA 1EZWA 3QW3A 2KI3A 4HOZA 3QEZA 2R6OA 1MZRA 1UWRA 3IUDA 1V3MA 5LXEA 1KFKA 1TZZA 3W7OA 3UQIA 1XLFA 1EFZA 3WK1A 3LYEA 1WQ5A 3NGJA 3W6YA 3UA3A 3WJYA 3IV8A 2Z2AA 1DHPA 5BXPA 4G6CA 5AC7A 3K13A 6CGTA 3M46A 4E5TA 5FKYA 1Z8AA 2WANA 1OVDA 1FCQA 3DFNA 1NU5A 3G3DA 5DBUA 2XP6A 2WPBA 4QJ4B 3EPMA 5DMLA 1D6OA 3B0VC 3OOBA 4GIRA 1BYDA 4EPDC 3FKKA 5MKGA 4ZTXA 2OG9A 2WVUA 3CL6A 1KM3A 1DJZA 1PBKA 3B40A 4B2DA 4AVOA 1BWVA 3AHYA 1CGWA 1TTPA 2TAAA 3LHWA 1DWJM 5M2FX 3R94A 3VMNA 1J96A 4N7QA 2D3NA 2DW7A 4PEKA 1EJ7L 2DZSA 1OHLA 3CS2A 3CH9A 1O1ZA 3S9YA 3W86A 1VHNA 3T0DA 4S3GA 1XBYA 4D6JA 4Q4OA 2VD9A 4J35A 4A2RA 2CLKA 3KEHA 5GNYA 1EF2A 4F0LA 3ZXWA 3KRUA 2LGOA 4URIA 1A5KC 2O55A 1XRSA 3IK2A 2ZRWA 2X42A 1R9YA 3OA5A 4MOZA 5T9BG 2VUNA 3MANA 3ZMRA 2WQPA 1MXGA 2YL9A 5CG0A 1TUXA 1KTNA 3LGEA 3FGCB 3WLHA 2CLFA 5FJIA 4LAUA 1V77A 4Q4MA 1QHOA 1WXZA 2A3AA 2HK1A 1PX8A 2OU4A 2VRKA 1RALA 3AU6A 2FZDA 4X3ZA 4HNVA 4QAWA 1MZHA 3BK0A 1AQMA 1KXTA 4FALA 1H41A 1W3IA 3QN3A 3S5YA 2X8RA 4M24A 2B0MA 4UQCA 3VIHA 2WJZA 2D2OA 1GZGA 4GQ0A 5KEZA 4HYRA 4PMVA 4EWND 4ZSUA 1EQ3A 2QJNA 1ZCCA 1MW0A 4AY7A 3O05A 1FCBA 5LNSA 4OU1A 3PAJA 1EDTA 3F2DA 1K8YA 5DITA 3W7IA 2EPKX 2YDSA 3GW3A 2VX6A 4LSBA 4RE4A 2Q71A 5I79A 1ZGDA 3VYLA 1F6KA 4BF9A 4JTEA 2I9UA 5BMWA 4LBUA 1KRCC 3U57A 1KGXA 3B97A 5A6TC 2GJNA 4KWWA 1OGSA 2EBNA 2CNCA 1YXYA 2VYOA 3W2UA 2ANUA 3L65A 1YDVA 1XLCA 2FHBA 3N6QA 2GLKA 3M7WA 2UY4A 1IE7C 1TJ1A 1YBQA 3PS7A 3VNLA 4O19A 2ON3A 1GVEA 1EC8A 4D72A 1M5YA 4ZGYA 1NFBA 1MFUA 1UH3A 3WQFA 7CGTA 3O0FA 1F6YA 1REQB 2QGYA 1J6OA 4HT3A 4F0KA 4FLRA 4M6QA 5HT1A 1A47A 4E2DA 1JF6A 5AZ0A 4YWIA 3UR2A 1UOZA 4IIEA 4DPQA 1HJVA 3TYAA 5BMXA 2XUCA 3SN0A 1XDJA 1J18A 1KTCA 3V5CA 1E9ZB 4DAIA 5KSWA 1IEQA 1WZLA 1AJ0A 1FBAA 3O5EA 4U2ZA 4LGXA 2OZ8A 1J93A 4X0NA 1UP0A 3WH8A 1EKOA 2VQTA 1ZHAA 1EA9C 1E3XA 1TJPA 4JIQA 1JF5A 1VRDA 2CWXA 1ZJBA 5D33A 1MQPA 2PGRA 4LYQA 2BFGA 4QCFA 4H9TA 3OP2A 4GY7A 3LXBA 1R0MA 1IWAA 1TX0A 2MPHA 1TRDA 4GIAA 3LCXA 1YX1A 2I57A 2PURA 2WHJA 3UNTA 1RD5A 2ZBTA 2VGBA 3K46A 3FJ6A 2XH2A 1VZWA 1DJHA 1AW5A 1E70M 3SJ3A 4DJDC 3ONCA 3JYMA 4M8UA 2NV9A 3QJAA 4HP5A 3I6CA 4QG8A 2XG9A 3F5LA 2ZXBA 2PC8A 4OE7A 1QCWA 1T0OA 1J2BA 4FZIA 1YTKA 3W00A 1LQ2A 1FTXA 3LI1A 3O5RA 2J24A 2F2HA 2QIWA 6TIMA 4PBFA 4YS1A 4CVWA 1XGDA 2DQWA 2XIOA 4PUNA 4RE3A 1W9XA 2YIHA 3CL7A 1C92A 4KF1A 1VRXA 2A6NA 4WKAA 3A21A 3SY5A 1EC7A 4ZA0A 5G2HA 2YZRA 1P0BA 3IPWA 3NQ2A 1YTDA 4PTXA 2UY2A 2CHOA 3M0LA 4PC8A 3C3NA 2PS2A 3PRAA 1TREA 1EUAA 3GYEA 3U0HA 4IJBA 2WAGA 1EGVA 4DZ5A 2O4MA 4H7CA 2ZWYA 5JMUA 3SADA 3RK8A 3PNUA 4KH2A 4PMQA 3O7UA 1MEHA 1QVBA 5EA9A 5I03A 3L66A 2M1IA 2VZUA 3BXWA 1DJNA 1JEZA 4GJJA 3IIOA 3S3GA 3UG5A 3GNRA 1ENUA 3C56A 4KERA 4ZL1A 3KM8A 3ZT7A 4J4NA 1GKRA 3A4AA 2QIIA 4DM1A 1X1OA 1JUBA 4D1IA 4HIBA 2BOEX 1UC5A 2B5UB 3CQ0A 1CW2A 2PWDA 1YKWA 4Q8NA 4XSLA 4WK9A 3GVVA 4IPLA 1E4NA 3LTPA 3KVJA 3POHA 1VLIA 4IJRA 4OKDA 3CLMA 1O95A 4ZOCA 2PFHA 1JNSA 3MMWA 2HISA 4ERIA 4LV9A 1NY1A 1KCKA 3TA9A 1OX4B 4TQTA 1UMLA 4RK8A 3D0CA 3GTIA 3P5ZA 1UBPC 2GQ9A 1EO5A 3GVRA 2XSAA 4QT2A 5EMKA 4UTUA 4NNBA 5KZEA 1KW1A 4GGHA 4NHVA 4QRNA 4Y2WA 2NVDA 3TCZA 3PBYA 2FKEA 2AQOA 3AYRA 1FKIA 2DPEA 3HV9A 7TAAA 4IM4A 1ZBWA 3UVAA 1K8XA 1KM1A 3GR8A 4GGBA 3W1QA 3RN6A 2XVGA 2Y6ZA 4P61A 2VZVA 1S2WA 1WA3A 4D6HA 5DY2A 1BG4A 2WJFA 1T7LA 4LRTA 3FAPA 1G0CA 2Z1SA 4DUWA 2VR4A 4AG0A 2GSJA 4QSHA 3CH0A 4JR5A 1W31A 2FPYA 2A3HA 3Q67A 4KQNA 3E96A 4DVOA 3MWAA 2PLMA 2W66A 3PRBA 3FSTA 3WQWA 4UCGA 2D73A 4PMOA 1FHVA 3QYSA 3ARXA 3UGRA 1M5WA 2POZA 2O4QA 3HJZA 2FJKA 1ZRQA 3CUIA 2VKZG 4IQEA 1B4KA 2C79A 4JTJA 3TLLA 3URQA 4I3GA 1JYWA 3AYSA 5E93A 3KACA 4B9YA 1VEMA 4I9JA 4NIRA 2NWRA 1EJRC 4Z2IA 1NEYA 1FKKA 1LBLA 1U2YA 4GJIA 4PYSA 1M9HA 2NQJA 3GYCA 3AMLA 1PCWA 4PL1A 4POCA 5D2TA 5ECVA 4PMYA 5IM51 2MANA 4PUWA 2BASA 1XR2A 4FAPA 5FF4A 4JEQA 1FWRA 1A5CA 4HARA 1J2WA 1GG0A 4GIYA 5I3IA 4JQAA 2WVVB 4ZVJA 2VO5A 4AW7A 1CECA 1LOSA 3NQBA 5G4WA 1JYNA 4LBSA 3TC5A 2QUTA 4QX4A 3UPWA 5AZ1A 2WVSA 4PBEA 3NUKA 1ZL1A 3RM8A 3H2EA 2BDQA 3NQ7A 5CPSA 2XP7A 4F40A 2XP8A 3MSYA 3S2NA 4UFIA 1ZCNA 5H8PA 1YEYA 4ZFMA 5DQPA 1WDQA 1SSDA 4GOAA 3M0MA 2YX0A 4E4FA 3NTPA 4XTDA 4ROPA 4MNMA 3VOJA 4DB7A 1OCQA 3L4TA 1J0YA 2G3JA 4AWTA 2Z25A 7REQA 2WZTA 1P1MA 4PUUA 3SFWA 1LWHA 1YADA 3KBNA 1XLBA 4GZJA 2PODA 1LQ0A 4DZAA 2OB3A 2P0IA 4F8XA 2E9MA 4QJ5B 1LUCA 3UXIA 3AO0A 4A21A 5C2GA 4ZO7A 5DRCA 4IPJA 4C6QA 4KKXA 1B5TA 3L0NA 3AUJA 5KITA 3G6LA 1J5SA 2DIKA 1YPIA 2HK0A 3DH7A 1RH9A 3MQTA 2XTKA 1B90A 3O5IA 2Y61A 3DOPA 3CAWA 3KZ7A 5E9AA 4IP7A 1GCYA 4FLSA 4JOMA 3UPBA 2PAJA 4E2OA 3VD5A 4JN7A 5A3HA 2DQXA 1ONRA 3BL3A 2PDUA 1E1CA 3COTA 3WK0A 1RBAA 1JCJA 3W1PA 2PWFA 1P0NA 5HTGA 2YB4A 4GC4A 3T07A 2WNNA 3UF8A 1O5QA 8RUCA 3EEGA 4ZTYA 3KAIA 4H04A 2BP1A 1I2QA 3PTMA 2WSQA 1W1IE 2OVLA 3PULA 5CGTA 2ZRYA 3W1MA 5H91A 3UR5A 2DJLA 2NZLA 2E25A 3FEMA 1TMHA 1JVNA 1C90A 1TV7A 2YFNA 1LM1A 2G3MA 1GQKA 3Q2DA 4ILSA 3KP0A 3TROA 5F4SA 1PXGA 2W5FA 5ABTA 1M03A 3NVTA 4AEFA 1G01A 1UIPA 3GXNA 3P7YA 4YTUA 2C91A 3L4YA 4ODNA 3BOLA 5GJNA 4K1GA 2FDMA 3A4XA 2Z4GA 1AD4A 2WHLA 3R12A 2XIQA 3M07A 1FKSA 3H2AA 3I7QA 1UD3A 3WLIA 3L2LA 4UBPC 1UYQA 2PDFA 4ES4A 4UMCA 3SO7A 3WD2A 4ZXLA 4RNHA 2PRMA 3PJXA 1W1A1 1YXDA 3DFTA 1WAUA 3I3BA 4PA8A 4I9AA 4YTQA 2Y2WA 2VRJA 3RIKA 3CMJA 1TR9A 2VEFA 1KCXA 3AHZA 1XSJA 3WF2A 3RMJA 1U5VA 4CQCA 3ARUA 4ZPWR 2KZHA 1FWEC 1R9HA 3TAOA 3SSJA 1EPVA 1QR7A 4TVUA 4CD5A 4JTAA 2QCDA 1GZ1A 3BAKA 1I60A 3W7LA 1E1EA 1PZ0A 2O9RA 3MSGA 5G1TA 3AWNA 2FIQA 3OZMA 4NJHA 2QCNA 1V93A 2E1WA 2YR1A 1O12A 3M0IA 1FWIC 1XC6A 3KTSA 1CGXA 4FX7A 3O9NA 3G6MA 2W91A 2Y7DA 3ZWTA 3TJ4A 4R7WA 3MUXA 3UI5A 4LAKA 3QHNA 4OT7A 4ZR8A 2ZUWA 2DSZA 5C2XA 4JTUA 1BRLA 4AMCA 3IJIA 1F2JA 3O0KA 3WK3A 2GJLA 3CWNA 3O5GA 1PEZA 3LK6A 1Z48A 3QPEA 3FOKA 4KEMA 1KFBA 1LJYA 4UNKA 4QGCA 3DFPA 1I1XA 1VS1A 4IT1A 2QJMA 1PPIA 2VCAA 4AZ5A 2QPSA 2J7CA 2WWDA 4WX2A 5HQEA 3LCHA 4FN2A 3K1DA 2QR6A 4E8CA 5EMUA 1SYTA 1GQLA 3OO2A 3B8DA 3IVTA 3G1SA 4W7WA 5LGZA 5J5DA 2G5WA 5TF0A 1S5MA 3WFLA 3LSBA 1LG2A 2XIIA 3TDBA 3UY8A 3H7RA 1ITXA 4Q4RA 3W0KA 5BNKA 1TCMA 3W7QA 2V63A 5I3DA 3N3MA 1EGZA 1TJ2A 1GJPA 2ZADA 3O5LA 1JCHB 2ISFA 3TXVA 4HU3A 3TW9A 1YQ2A 2OTDA 2VP8A 1B9BA 4F0SA 2Z2UA 4Z2HA 4LUIA 3MHGA 1CXFA 1E43A 3W23A 1XG3A 3FIGA 3UY7A 2C0HA 3FDGA 2PA6A 1XL9A 2CYGA 2XIMA 2FHFA 4WDWA 2RUSA 2X0HA 3B8TA 3BAIA 1VFTA 3W7EA 1VFMA 1ITQA 3N2OA 1UH2A 1ODZA 4C6EA 3MZ2A 1JFXA 4BK9A 1JG9A 4US6A 2OYLA 1A0DA 3PZTA 4YVVA 4HBOA 1UWUA 3TH6A 3TSBA 5D8ZA 1PJ9A 4LCSA 1L2QA 3H2MA 1ISZA 4HMCA 2XGZA 1F3EA 3BG9A 1OD0A 5KZMA 2X30A 1XLMA 1N55A 1WDDA 1OQFA 3G0SA 4TR9A 1W9VA 1FWSA 1ONXA 3A3XA 4CCDA 4KEUA 4C6MA 2B7OA 4XAGA 4GO9A 2YZ5A 2UZ9A 3JYJA 2WVTA 4NILA 1EP1A 5KETA 2A7RA 3MCMA 1IT7A 3M64A 4LS0A 1BXCA 2ZYFA 5A8NA 3WLMA 4M0XA 5E0CA 1XH2A 4GQBA 5LIXX 4J5NA 3RMEA 1AVAA 5BOEA 4ZS6A 4MYAA 4JS3A 1LP6A 3DFQA 5EMYA 4MGVA 4H6KA 5XIAA 5GJMA 2Y63A 1VEOA 4DLMA 4BI6A 2DDXA 4XAZA 1NTHA 2OEJA 4GPNA 1UPMB 3G8RA 3MYPA 3L21A 2E5BA 1EX1A 4MZYA 3UEQA 3B8UA 3SY8A 3QPZA 4J2MA 2Z00A 2ZRVA 3UCDA 2OELA 2PWVA 6XIAA 5EL1A 5I5RA 3KTXA 4JFIA 3NM1A 1DJXA 1QNOA 2E6YA 1W32A 2ZTKA 4HNTA 2H3DA 3RU8X 3T0TA 1QW7A 1OFQA 3DIPA 2VMFA 1ISVA 1AJZA 1O94A 3PBVA 2YLLA 3DGRA 2ITKA 1JCLA 3WENA 3WELA 4Q8WA 4J3ZA 1HKMA 4TU1A 1EYMA 3GTXA 2QDHA 3MV01 4L9ZA 3VFCA 1UASA 3W2JA 4TVCA 3EDKA 1U5JA 3ITGA 4UQAA 2ZA3A 4GY1A 3KLLA 4OV9A 5G1MA 3VIFA 2FZNA 5FAJA 2CLMA 2GFTA 3DI0A 3WF0A 3M44A 2D0FA 2Y8KA 5CPOA 3WH5A 2J47A 4L64A 4IMEA 3P0WA 1L6FA 1FRBA 1W3KA 4MGGA 1AL8A 3UA4A 4CQBA 1JUKA 8XIAA 2EPOA 3CWOX 4R27A 3QR3A 2GQ8A 3S1UA 1S2AA 5LNVA 4H9MA 1A4MA 5BU6A 4GFIA 4E8DA 3ATYA 1GQNA 3BVJA 4NG3A 3KXQA 4IGNA 1GRJA 1WXJA 2WMKA 3E9AA 1T40A 3WX7A 4G9PA 4JKLA 4NZCA 3LDVA 4UWMA 1ZLPA 2C14A 3C2VA 2XVLA 5BZAA 3VNMA 3VK5A 3VFLA 2M08A 2RJHA 1IGWA 3NIYA 5L9FA 2PV1A 4PCNA 3VMPA 3ZVHB 1YE4A 2OWWA 3TTEA 1GOWA 1G6CA 4HTBA 2B7NA 5AC5A 3ITXA 1YTEA 2YCKX 2RQSA 1H5YA 3UJFA 1KNWA 2IXUA 3E5PA 1TZ9A 3VIIA 1X96A 1VHCA 4HKPA 1FXQA 2VHLA 4JIIX 4U5IA 4K68A 4KIRA 1UPPA 2Z2BA 2PWGA 2XIBA 4AIOA 1MVYA 3LXCA 3VNDA 4ENLA 4UTWA 3SGZA 3HA1A 4REQA 4ADSA 3KDNA 1TB3A 3V0TA 5AECA 3S46A 3QMSA 4QSFA 1SJDA 5REQA 4JGDA 1KBLA 2YB1A 3FHAA 1SZNA 5F1VA 1IT8A 1DWHM 1HVXA 1RVKA 1RBLA 2J13A 2IQTA 4Y6GA 3VD4A 3HM7A 3UWZA 4GMEA 1TPUA 1TZ7A 3W2KA 2QUMA 5CPNA 3HO8A 1B3ZA 5JVLA 4CNTA 1WCGA 1E4LA 4FIQA 2OQHA 3ZT5A 4FB7A 3SECA 1V6WA 3JZEA 1F74A 2AL2B 1US0A 2XH7A 1J0KA 2OYKA 1F76A 3H2OA 3ALGA 1R9ZA 1VFFA 2JF6A 1IT0A 2UY3A 2A3CA 3KAFA 2Q8ZA 2PRHA 3B8WA 3ECQA 4UUIA 3EGJA 2H8XA 3W9ZA 1OC6A 1FXPA 1H09A 1GVRA 3BAWA 2WMHA 5HK4A 2DSVA 3G3MA 3ATZA 2PBGA 2DZBA 3APGA 4IFKA 3CV1A 2E28A 4FI4A 3P61A 2JGYA 5IFPA 3G1YA 4AC7C 1UWTA 1JCMP 3NAVA 4IMGA 1QBBA 1QHZA 3M0XA 2YCJA 5A6BA 2Z27A 3VZYA 4Q8QA 1BQCA 2DZVA 3FVDA 2Z29A 1AMKA 1DPMA 3TZFA 3A47A 2ATMA 3S42A 2FVKA 1W17A 4ASTA 3I6TA 2VQUA 1G9HA 3B9NA 1A5BA 4JTIA 2M2AA 4CNSA 1S2CA 3T08A 4IG2B 4ZODA 3BSMA 1QW8A 1BGAA 2GDUA 3B05A 1E9YB 3TC6A 3VMOA 2DY3A 1MW1A 1UD6A 1XPGA 4DZHA 3TTSA 3MMDA 5DXYA 2RGMA 4RR4A 1QOPA 3VGDA 1IWPA 1FWCC 1CI1A 1RK6A 2BV9A 2FB2A 5CEWA 2JQXA 2PBCA 1UW9A 3PZNA 2CZVA 4HZ6A 3CQKA 2R24A 4AD1A 3WQDA 3BE7A 3EOLA 5D32A 4PTMA 1V6YA 1R8LA 3ODKA 3O5KA 5A6JA 3EWZA 2CKRA 4MB1A 4ODRA 1UIOA 3UFYA 3FYYA 2XHYA 3TNBA 2RJGA 1G67A 5FCZA 1QOXA 4M6UA 3C2FA 5GNXA 2P1FA 5LKYA 1YXCA 3RX4A 1ROTA 1GJWA 4L3NA 1FWJC 2QAFA 1OG0A 3Q65A 3HG4A 2REQA 5HUPA 4EIVA 4UFLA 2PDJA 4Y9OA 4DBSA 2A5HA 2OGYA 2RSEA 3IUHA 3ABQA 1AQFA 3C0LA 2LKNA 4X9YA 4GVFA 2ZA2A 3GHUA 1EGMA 1HGWA 1GOXA 4PSPA 2FLIA 2HNHA 3N2MA 3LHYA 3P81A 1WOAA 2HVOA 3VX1A 2X1RA 1JYXA 4XISA 3NDOA 1P48A 4CU7A 4PUMA 5EU9A 1WKFA 3JXVA 5C0QA 1JPHA 3LUOA 2PLKA 3C2RA 3NQDA 4ZO6A 2PSNA 4CCZA 3M0VA 4HZ8A 3E0FA 1Z44A 1R30A 4CD6A 2Y88A 2ISVA 3QQ0A 5AHFA 2PCEA 1XRTA 2LJ4A 2D9FA 1W56A 2Y89A 3AAMA 3SRHA 5HR6A 3G0XA 3UYCA 1G4TA 4IT6A 2D2HA 3FJLA 2EQDA 5CZTA 4LUTA 4MJZA 1GK8A 1P0EA 3PUOA 1ADOA 1UZ1A 1EP2A 1KT1A 3LRMA 4TW6A 6REQA 5FD0A 5BYWA 1TIWA 1CGUA 1Q6HA 4C1NB 1NWRA 5D2VA 1TCDA 2Y4SA 1DKWA 2V5BA 2J7HA 4UTTA 1GJUA 2J7BA 5LHEA 1V6TA 1WUFA 1UQYA 2CXGA 4AZCB 4KW2A 2G3NA 1GHRA 1FKXA 2WXDM 1QW9A 1UR0A 4MJ2A 3ABZA 3USZA 4GE8A 3KBJA 1OWQA 1PZ1A 3RAOA 2YFOA 5HJXA 3FA5A 2KFWA 4AZ6A 4RNIA 2XH0A 1IXPA 3T2PA 1O66A 4GO8A 4QIBA 3WJXA 4QDMA 3U2ZA 4WJEA 3VIGA 1WAWA 4JL2A 1FKRA 3S1XA 5C7HA 2X0YA 3UR8A 3WLLA 1HJWA 2MLXA 4NZFA 4EF9A 2NSXA 5HWCA 5JH8A 2PRLA 4DLFA 5D2XA 2GK1A 2E4TA 5IXEA 4C02B 1VCGA 5F4XA 2F23A 1NSJA 3CLWA 4YVPA 2JE8A 3W70A 4A29A 1C8VA 4US5D 3B9EA 1W8SA 3QZEA 3BGJA 5G2IA 4D2JA 3EPNA 4DELA 1UUMA 3NO3A 3W87A 3VGBA 4HMDA 2EXOA 3UD6A 5TAOA 4KWUA 4NASA 4P8XA 1Q6CA 4WF7A 2VC9A 4DRQA 1POJA 1F7BA 2ZICA 3WNPA 4BA0A 1SZFA 3WN6A 2J9ZA 4PULA 4Z2KA 1RPXA 4YU1A 1P5BA 4Q7IA 2R14A 1EHNA 1OZMA 5HPOA 3LUTA 3VGFA 2ZA1A 5DCEA 3HF3A 3ARVA 4EE9A 2XN2A 4GYPA 2VEKA 1IEVA 3F03K 2HVMA 4H8UA 3LI0A 3PZ9A 1ISWA 5AYYA 1R7AA 5LA2A 1OFAA 3LCIA 2YBTA 4ERAA 3LHZA 1XCXA 1XINA 2BWGA 5A5WA 1K77A 3BLKA 4XZWA 2XWDA 3GXFA 3AS0A 3M5ZA 1UQZA 4S3DA 4MDPA 3VKKA 5E09A 2ASHA 3Q94A 1E6XM 4BHYA 4Q8PA 4JFUA 1PL9A 2C18A 3JU2A 1OYCA 4JBRA 3IJ9A 1P6WA 4J9JA 1R3SA 4EOUA 3SUTA 1KBJA 4GI9A 4UZSA 1XX1A 3PTDA 3NZ1A 4LTSA 4W84A 2V2CA 4O1EA 4U31A 4GWEA 4GIVA 5GNZA 1YRRA 1OF8A 1OYBA 4W89A 5CPQA 1UMYA 2AMXA 3MUY1 3GH7A 1KWGA 1UKQA 4A8RA 3CWHA 3S9IA 3GR7A 3W7GA 1B0IA 3RGCA 1E5JA 4H2HA 5I7GA 4JCMA 3UR7A 1W5PA 3FK4A 1DV7A 3C2EA 1NWUA 1Q63A 1HFBA 1L2UA 3E74A 4V1XA 4K39A 4GY0A 4IP4A 1CDGA 3NDZA 4UR8A 4FNUA 3TU9A 4IQDA 3ICJA 2AMGA 4D6DA 3RITA 4EWJA 2VFHA 1Q2RA 4AYSA 1FQ0A 4LEFA 5HNNA 5AB3A 5IHRA 2XGIA 4Z08A 5EB8A 1LROA 3N73A 4NL1A 1JAEA 3O5JA 4NJJA 1TPDA 3N4EA 3VU2A 4ZQNA 3DXIA 2XSXA 4GH3A 2TYSA 3BW3A 1A5SA 3EA2A 3QY7A 4AWSA 1J4HA 1LCOA 3DYOA 4R9OA 3T9PA 4W7VA 2R1NA 3OG2A 4BR1A 1A5NC 3W72A 3KZPA 2DG9A 1SPQA 3ITOA 4DXKA 3TWAA 1IXNA 2ZC8A 1PDZA 5DCBA 4HZ7A 4K37A 4LANA 4HPHA 3K30A 2VENA 1VFSA 3PSWA 4DBDA 4ML9A 1B3VA 5TD4A 2DW6A 1E4IA 3CMGA 4Q4SA 2AKZA 4AISA 7TIMA 3GTYX 3HGRA 3T4CA 3WBAA 3TTOA 4O12A 4U28A 2GOKA 4DYKA 1Z32X 1JJKA 5HUAA 1LLZA 3GAKA 4A8LA 1V3JA 1EXBA 1XUUA 3VUPA 5HQLA 3NRKA 5PTDA 2OEMA 3FSUA 4AF0A 3IJ8A 2PDHA 4FXSA 4JFVA 3CUZA 4FNSA 5CPMA 2VCDA 4AY1A 3WBWA 1VIWA 1VFLA 4I6VA 4MHBA 1JZ5A 1FUYA 4AYGA 3AYVA 2VGFA 5E0KA 1YE6A 1ZFJA 2Y1HA 4MAZA 4UOJA 2NQHA 3ARZA 3BW2A 1DIKA 3WG6A 2A2IA 5CAKA 4W9OA 1ZJHA 1M53A 2O9OA 2UBPC 4XB3A 4GUGA 4W88A 2VL4A 4C90A 3NQVA 4H6EA 3H8AA 3MJMA 5KMYA 4KT2A 3SGUA 1VFHA 4S3KA 4CLMA 4GBUA 4DRHA 1KGUA 2VZTA 1K7XA 2QCGA 1PIIA 1BFNA 1Q1CA 1TPC1 3WO8A 2V5JA 2OQYA 3WNMA 4O18A 4Q3MA 2Y85A 3UWUA 1M6JA 4JFKA 5HULA 3GR4A 4K2SA 3WF4A 5LHFA 1K02A 3BURA 1B6CA 3NL3A 4J3UA 5HNUA 4JNYA 4D8AA 2AL1A 2JBMA 3O6CA 2G3FA 4HK5A 2HPMA 2QF8A 5RUBA 2O7QA 3HTWA 3THUA 3NYZA 1S2UA 5J6EA 3QSTA 3A5VA 5T8GA 4B4HA 3QY6A 2F21A 3MVIA 2FVMA 3N19B 5B8IC 1UOKA 3N34A 2HSAA 4QHRA 1UKOA 4G7EB 1A5LC 1XV8A 2ZR5A 4DIPA 1FA2A 3FS2A 4R9XA 1SSGA 3RDKA 1E1FA 4GA8A 1W5MA 3QXBA 4HBEA 1RJRA 1UWIA 1JPMA 3TSDA 4H9VA 3OB8A 1GVFA 3LN3A 3B8SA 3RPTA 4ZE5A 1UR1A 5IDZA 3SFKA 1E5NA 3T0BA 1W6TA 1B3YA 3KFTA 4F4RA 4RDZA 3S1VA 2ALDA 3K4WA 3OIHA 3OLEA 4L1WA 4UMBA 3AIWA 4H8NA 3GXMA 1IQ8A 2BZNA 2AAAA 3VPLA 1N7KA 2WM1A 3W85A 2G0WA 1DIOA 1E72M 4DPPA 4PH6A 1IGSA 3ME3A 2DSWA 4QDPA 3CGTA 4J3XA 2BY1A 3CHCA 3GZ3A 3ZSTA 1JDDA 4JN8A 3M4HA 2P88A 4TX0A 2BVWA 2JIWA 4JTDA 5AN7A 2FB3A 1EDGA 1X97A 2V2DA 3DYPA 2XP3A 2JGQA 1V0LA 3FHQA 4AMAA 2EPNA 2O7SA 2C0AA 1Q13A 4RNJA 3GTFA 5H8UA 4JFJA 3GHTA 4DRSA 4WDXA 2ZE3A 1NMWA 2CESA 3RJXA 2BVYA 4FOUA 1C7SA 4GI8A 3V5OA 2RKXA 1BVZA 3GIPA 1DJIA 3WF3A 4LWWA 3TC3A 1ISXA 3EWWA 1HTIA 4UR9A 4ODMA 3LCGA 1OEPA 4XZIA 3IAQA 4BEUA 4TXEA 5D9PA 4RZ5A 3MO7A 4MM1A 4OGZA 5DFAA 4Q8OA 4FX8A 1O68A 1VQTA 4GC3A 4WR3A 4N9CA 2VGGA 3VAVA 3W2MA 1GW1A 3YPIA 4XKMA 1PX4A 5H2ZA 4A8IA 4LNCA 2VURA 3QSRA 4J3TA 4PN2A 2Y70A 3L7RA 4JX6A 3QZAA 3OW1A 3VOGA 1FFRA 1Q8AA 1SO6A 1WKEA 3ITYA 1JPIA 4JPGA 4CNPA 3R0UA 5HATA 4S3AA 3MBDA 3N9RA 4PTNA 4LF1A 4Z1CA 5A2AA 4O13A 3I4KA 2VM8A 1JNDA 3G1HA 2C7FA 3GU9A 4EXQA 1N8FA 1XLLA 1J4EA 1VJIA 1H50A 4HCHA 3FFSA 1B31A 5AHIA 4CN1A 2XH4A 2YCLA 3W73A 2FGBA 1WNOA 1A49A 4C7FA 1GVIA 5I07A 3LZ5A 2FH6A 3MC5A 4TO8A 1XBXA 1TWZA 5FEWA 4RV3A 1K3UA 4JTQA 3P2VA 1JCNA 5JBFA 4HHLA 3H7VA 3B04A 3ARRA 5I00A 1MWOA 1EOMA 1AFSA 4NNRA 4G7FA 1R3WA 4QE4A 4ITZA 2TRSA 1EIXA 4HSHA 2PGFA 3NM3A 3WL1A 3IJLA 4XIAA 4QXIA 3SUSA 4O0KA 3QR1A 4JKKA 5GVJA 3FVMA 1BHGA 3DAQA 1UP3A 1TV4A 3L4WA 4J2PA 4WY0A 1EO7A 4CQ9A 3PHAA 2A3EA 4IL0A 1J79A 2ZR4A 4NZJA 2DG4A 3PPGA 5C9RA 1SZRA 3EMCA 1VPXA 5DEZA 1EYWA 4OBTA 4AD3A 1J4RA 1RLDA 5JH1A 1KM0A 3WQOA 1HJXA 4DRKA 4ZCWA 1R3QA 1OGBA 2F6XA 1WBHA 3S2CA 1A53A 4IGSA 1Q6RA 2YDQA 2OPJA 4JXCA 1OF6A 4TOQA 2QGHA 2GQAA 3T7VA 1XBZA 1X6UA 1TA3B 3CO4A 4HPJA 1RAKA 3MUIA 1JGMA 3LHTA 3CGNA 4QM1A 2CZDA 4GI6A 4GCAA 1JZ7A 3KL3A 1EEPA 4IICA 3EXTA 3H12A 1YATA 4J28A 1NDVA 5D05A 4F0RA 2WB5A 1XLAA 4G2DA 5HR7A 2JALA 2WC7A 4TYOA 1MUMA 4GQRA 4H9XA 3FGCA 3SCUA 4XO7A 1KRMA 2ZQVA 2XPKA 2OJPA 4Z0SA 1KT0A 4ATDA 4C91A 1A5MC 1P7TB 5E6ZA 1UWAA 2TODA 3E2SA 2Z26A 1CXEA 3ARWA 1GTHA 3I68A 2R82A 1JDFA 4MUPA 2VUYA 1LBMA 3W1XA 2DT3A 1NMVA 2W6RA 3RR1A 4YYFA 4LVDA 3O5QA 3UI4A 4FIRA 1FWHC 1OT1A 2QULA 5LA1A 2NXHA 3O16A 4NY2A 4NVTA 2OXNA 4A6GA 1SUXA 1ONWA 3URAA 4S3FA 3V7PA 4LB3A 1R6WA 3LU2A 2CPUA 5I77A 4GRSA 3FAWA 1UR3M 2HV5A 3R1ZA 4TX9A 3HGSA 3CC1A 1Q6FA 3NQMA 4UFHA 4E4UA 1AH0A 4NZ5A 1Y8BA 3WMLA 4A3YA 2GGEA 1S2VA 2E6FA 3PBGA 3TAKA 1J0IA 2F6KA 2VI0A 3SY1A 2NV2A 2W4XA 1Q3NA 1DJWA 4XD5A 4GD0A 2VCBA 1OIMA 3PFRA 1JQVA 1BAGA 4AEOA 4R3UA 4RZ4A 1REQA 1QI3A 3AZSA 3RCNA 3P3BA 3N17A 1RP9A 5JIPA 3CQHA 3KHDA 4YHEA 1ME8A 1DP0A 3N11A 4P2VA 2E7FA 4GNJA 3CUGA 2NX1A 1X8CA 4LUSA 3AOFA 4WSKA 4FX6M 2CZ5A 3DKJA 5BROA 1FVPA 1QU4A 3PF3A 1DXEA 3W88A 4W9QA 2WQDA 3PVFA 3W1TA 1ROUA 2I16A 5I02A 2G8ZA 2E6AA 3LPFA 4BCEA 3B0XA 4EPKA 2HTMA 5FJTA 1ICQA 1JZ4A 5AVNA 2OT0A 5EFFA 4HPXA 1J0JA 3RFAA 4JIPA 1TIMA 1TQJA 1VCVA 4C6LA 2H3BA 1X7IA 3QTPA 1OC7A 1XIEA 4ZXOA 5HWJA 5BRBA 1YW5A 3WQ8A 4ODKA 4XX6A 3H24A 1UR2A 3STEA 1VBRA 3H53A 3EWDA 4JHZA 4QS6A 3OIXA 1QT1A 1NDWA 1V7YA 3USBA 2J7GA 2WMIB 3W2LA 3H2NA 2RDXA 3PNZA 1V3HA 3NQ6A 3DECA 3WDRA 2OX4A 3HPAA 5F2IA 2VEIA 2DIJA 3KUMA 1WB0A 1RY0A 2B31A 2P50A 4MZ8A 4CNOA 2JF7A 3AS2A 1AODA 4LALA 3BGGA 5AVHA 3QRHA 1TV8A 1YMYA 4OIFA 1A5OC 1QNPA 1YPXA 5EFDA 5F2LA 4PMRA 4TW7A 1HKKA 4C5YA 1OFRA 1W9UA 1XGZA 1ICSA 3BW4A 2NQLA 6A3HA 1E6PA 3R79A 4Q4QA 4H6RA 1RQEA 4UTKA 1M3UA 4L80A 5DLCA 2V2HA 2HBXA 2CEQA 2YDRA 3CO8A 3MS8A 3R5EA 4FXJA 4O4WA 3SQLA 2INEA 1WXYA 4HA0A 4IISA 4NT0A 4K7VA 2EF9A 4B3KA 1E0TA 4KGJA 1E56A 3NL6A 3R11A 4MZ1A 1SO3A 7REQB 3MJYA 2CIPA 3UW6A 2QDGA 1JPKA 1H0GA 1GVOA 1XLEA 3AI0A 3W37A 3DX5A 3G1VA 3NO5A 3G18A 4C6BA 1OFBA 2BMBA 1XDMA 3DDMA 4MF4A 5A1AA 1B54A 1LUCB 4GKTA 1UWSA 1TSIA 2BOFX 4P7OA 3ZQ9A 3H70A 2CZFA 1G94A 2A7NA 4H00A 3H7UA 4UOQA 3S5NA 1XIGA 4UQBA 2R1PA 1Q4WA 4K6AA 4W93A 5F4WA 1XG4A 3HPZA 4HNLA 5HA7A 3UWVA 2RH9A 4O1AA 3KOWA 4ATWA 1B57A 1TELA 3KRSA 3GQYA 3VNZA 3R0DA 2GJRA 3RHGA 2VFDA 5F2GA 1TWIA 1WOBA 1AH3A 1JZ2A 3VDGA 4TMCA 4MJ4A 1FWDC 3UZ5A 3GTNA 5E0FA 1A0EA 1OD8A 4FSAA 3BARA 4OVXA 5FF7A 2XP9A 4JYFA 5FSDC 1KA9F 3IK8A 1TMLA 2GSHA 1JRBA 2QCFA 3VCCA 4HHHA 4NYYA 1QI4A 4HA1A 1SU5A 2RDWA 2P76A 2VVNA 3IHZA 4WDTA 5AYIA 3GNOA 5CG7A 1R3RA 2D2JA 2OOGA 3C8NA 1QJWA 1US3A 2GGIA 2WLYA 4NJGA 5HMDA 3VABA 1F3XA 1KM2A 4ZZ9A 3ENLA 4CD7A 1NDZA 3L0KA 3QOKA 1U79A 1V51A 4GXPA 4D6EA 2N87A 3EXRA 2QCLA 4AX6A 4L65A 4KRZA 1S39A 4HVXA 2QQ6A 3N2TA 5DO2A 3OLDA 3FJNA 4QLKA 1U83A 1BXBA 1NF0A 4DROA 4HCDA 5I3KA 8XIMA 3WSUA 1PWMA 4FR6A 4V1YA 4C6OA 3CT2A 3EY6A 5JU6A 3PZOA 4ZQPA 3KHJA 4JTSA 1DQUA 2WYSA 2QCDB 1QPLA 6ALDA 4KIEA 3GD6A 1LWJA 2HDJA 3T1GA 4XKYA 3EYPA 1SVDA 5DO8A 1TO3A 2IW0A 4IQLA 3GY1A 1L1PA 4RDYA 1AK5A 3BO9A 2V9DA 1PHQA 4NZ4A 3R7MA 4MDOA 2IPJA 4X2PA 1Q6IA 4BF7A 2MLYA 2XFWA 3WLQA 4LV4A 1Y7VA 4Z42C 5I09A 5FJJA 2DG3A 2WVVA 3EX3A 1OIFA 1N8WA 1E6QM 3CIXA 3BJTA 5DANA 1M68A 5XINA 1MO0A 3OGRA 1HT6A 3DC8A 1S5VA 2VJXA 2VC6A 2J4GA 3WEOA 3EB2A 4JFMA 1CXKA 1A0CA 2GVLA 3P60A 3KAGA 1JIBA 3R8HA 4LRSA 3M5YA 4DQWA 4W9PA 3B0YA 4G56A 3ZIZA 1YNQA 4P8VA 3OQ8A 3EB3A 1LF1A 2K8IA 3NFUA 3AXIA 3NZRA 1E0XA 5DXXA 5C2CA 2VFEA 1BTMA 4NJIA 1RBOB 2VTFA 4CUCA 3TKFA 3QTGA 1J0ZA 1QPQA 1R2SA 3JVAA 1ADSA 3XISA 2ZKMX 4LC6A 3CL8A 3G1AA 3SCQA 1SW3A 1UJQA 4XO6A 2IS7A 1TJRA 4IH3A 4MYXA 4FS9A 3QV6A 1JDCA 3WEZA 1K9TA 1W3LA 2ODOA 1ZSXA 3MMUA 3VZXA 2PDNA 4J27A 2GJXB 3TN6A 4IJCA 4IMCA 1NWTA 5CSUA 3RO8A 4HPGA 3M0ZA 1BLIA 3BV7A 4D6FA 1F07A 4MWAE 3GDKA 2VD8A 1EA0A 1EXPA 4BF5A 1V79A 3IAPA 4JQ4A 2IPGA 3MSDA 2L5HA 4LC8A 1AQ0A 4A3UA 3ARPA 1GW9A 1KRBC 2V69A 4IIFA 4E38A 2XN0A 4AVFA 1OCNA 4MKSA 2NUWA 3SCWA 2GWGA 2CFFA 4GUIA 3P6LA 3THCA 3CPGA 2F9RA 3GE7A 2YL6A 3IJ6A 3M16A 3CASA 1TG7A 5CPLA 4OJYA 2ACUA 3PWAA 2P53A 2R1KA 3FX4A 1QOQA 4N2YA 1C9WA 2ZXQA 4K8GA 5C9UA 5EKYA 4X0VA 1LT7A 2X1IA 4UB9A 5D04C 4UTTC 2P3EA 3ITLA 4D1JA 4IHCA 3PRDA 3OEXA 3GXPA 2VXNA 3W3OA 1XCFA 1XH1A 3QBUA 4OFCA 4D6CA 2YCEA 2ZZ6A 3RILA 1F73A 1SFTA 1XGEA 3H23A 4NQ1A 4WRHA 4XAYA 1GPFA 3OVGA 3ALFA 4ACZB 3LTSA 5FEZA 3O1NA 3BCDA 2C1IA 1EJTC 4LOCA 2D3LA 1E0WA 3AXHA 1SMDA 2BSLA 1BF2A 3EDEA 3P82A 9XIAA 1PYFA 3CZGA 5LA0A 3G22A 5EGRA 1VR6A 3LNPA 4YTSA 2ZX5A 4B5XA 4C6CA 2ZR6A 1R5YA 1D7JA 3ZZ1A 4Z1YA 1Q4NX 1QATA 2ADAA 3W28A 4AHPA 4KS0A 1UWQA 4M6PA 4UDMA 3SCVA 1QAPA 4EP8C 1I8JA 1W37A 3VIJA 3N04A 3LZ3A 2D24A 2ISSA 1WDPA 3O5FA 3PB2A 3TNOA 3T4WA 2PP3A 2VOMA 2VFIA 3KS5A 2ZZ3A 1DOSA 4H7ZA 2A21A 2ZUMA 1F5ZA 5E9XA 4MNJA 2ATSA 4C6KA 3WZ0E 4GYKA 1Q6EA 3KS6A 5CAHA 2WKJA 1QNSA 1XLHA 2BNJA 2C8NA 1CGVA 5CQ1A 1HIZA 2E8YA 3WNLA 3QMTA 4JY9A 8TIMA 4HA3A 3IRDA 2PV2A 3SUWA 3LRLA 1CLVA 4GUHA 3W53A 4U10A 1NOUA 1E6NA 4PL2A 4BWLA 4NI3A 1UG6A 4GYPC 5FEXA 3M6YA 2E5DA 4E3TA 3RR4A 1H49A 1K8ZA 1TVNA 1PE1A 3LA4A 4RZ6A 4BY3A 4YNGA 4JAWA 4HNNA 4O2TA 2AKMA 1UC4A 2CC0A 1YLVA 4QE1A 4GXMA 1AQHA 4D6GA 5HBFA 3NTYA 1W1YA 4N9DA 3VDAA 3TSMA 1CWYA 3CV6A 3NR0A 5DF0A 3BAJA 1O5RA 4I8YA 3KAHA 4JYEA 4LVGA 2CLPA 3WF1A 3N4AA 4GCXA 1WKDA 2V30A 3BPWA 3WFZA 3TW7A 2GWNA 3UJEA 3CAQA 4MLRA 1UUOA 1UR8A 1N82A 3CEPA 1FHLA 3DYMA 2OSXA 4O57A 3VOCA 2V5LA 3OHMB 3KLKA 3GU1A 4A3RA 1GOQA 2Z0IA 5T26A 1RJPA 3NOEA 2J25A 2W0UA 3DFSA 4N6FA 1WDSA 3LMYA 4IIDA 1XLGA 1W54A 3XIMA 1AZ1A 2QCMA 4Z17A 3P74A 3XINA 3VZZA 3WH0A 1WDWA 3PFMA 1V7AA 1JDAA 1XUZA 4MB5A 2HE8A 1BVWA 5FJPA 3S8HA 1CENA 1DJQA 3EDJA 4YCPA 3MKKA 3O2LA 3GFXA 4M82A 1VBJA 4M1RA 2Y78A 4DI8A 3MP4A 1EQPA 3IVUA 4LYRA 3TN4A 3UWWA 1VIZA 4ONVA 4Q33A 4EK7A 1KTBA 1SR9A 1W3JA 2KR7A 2I9EA 3ANYA 4PTVA 1GORA 2CKSA 3BGAA 3M41A 2NQZA 3SCNA 4MWAD 3N3TA 3MP5A 3CEUA 2BLEA 3DENA 5D2WA 5DRIA 1K1DA 2PDCA 2E5CA 1C8XA 2AGTA 3M5VA 2XP4A 1G5AA 3OU8A 1WX0A 3CIWA 3W75A 2VEGA 5REQB 5D9NA 2FZ9A 1ZBCA 2D23A 5C5YA 3LB0A 3IVSA 1ME7A 2CBJA 4BQ4A 4DYJA 4DO7A 3GNXA 5HDRA 1EBHA 5JUVA 1GOMA 2PCQA 1SZEA 2LLEA 1I2NA 1RY8A 4X22A 5MHBA 4FF7A 2GUYA 1VD6A 2ZRZA 4D71A 1P4CA 4PZVA 4QG6A 2IUZA 3WQ6A 2YYUA 1PKYA 1TPH1 3G1XA 3HJEA 3B9AA 2Z1BA 5AYZA 3VM7A 4Z2JA 2PDWA 4MSSA 1AA1B 4U85A 3RLVA 2EULA 3UG8A 1TWSA 4GVGA 4CNUA 2NX3A 1H63A 1I4NA 1G4EA 4DWSB 4AZIA 2HZGA 3H55A 4AU0A 5U7SA 3LERA 1W1ZA 4DNHA 4J3WA 4N4PA 4GG9A 5FI8A 3HMCA 2DT1A 3QPYA 4TX8A 4J3VA 2BX7A 1AL7A 4RE0A 4ZPTR 2Y7GA 4O16A 4ACYA 3QR0A 4XG1A 3PG9A 2O0TA 3WDPP 1EZ2A 1G69A 1GT8A 4YTTA 5JH2A 2VR2A 3JR2A 2XVPA 3H4XA 3TC7A 1F4HA 4A3HA 1B30A 3G1FA 3A9IA 1ZBKA 4MVAA 5ABFB 2VNCA 3WLOA 4RPPA 3WDJA 1SFLA 2WSYA 1LL6A 3PBMA 5D9OA 4C6JA 2OGJA 2E1DA 2WKLA 5BXJA 3DI1A 2PDMA 1NQ6A 1X38A 3WLKX 3LHUA 5B7YA 4H19A 2J27A 4LCRA 4PBGA 4L4LA 4WZHA 3APYA 4MLJA 3I3EA 4IX2A 4AIBA 4NXSA 3BG3A 1VPQA 4AD2A 3KBWA 3SW6A 5H1WA 2V5KA 1XHGA 1A50A 3PN8A 4RLIA 5FA5A 1RHCA 2W62A 1M7PA 1CZ1A 1QZ2A 1E0VA 1T8XA 6TAAA 4H9YA 1H0IA 2PDYA 4WIWA 1KD0A 1U1HA 4H41A 4WKHA 3PK7A 4GX9A 4DBEA 1FWBC 3UWQA 5HJLA 1Y0EA 3I3DA 4RUBA 1JI1A 1S38A 4HQVA 4UR7A 2PI6A 4DJDD 1W3NA 3W7RA 4TMBA 2I7GA 2F2DA 1FWTA 3L68A 3SIMA 1DJYA 4PFHA 3F2BA 3PTQA 4LS2A 2RUQA 4NF7A 1C9HA 4JDYA 1TQXA 2GGJA 4OBSA 4Q8TA 2XFYA 2JFEX 3TTYA 3NPVA 4UQDA 4PRRA 3ZLGA 1B4EA 4E0CA 1QNRA 3TFCA 3L5AA 5BWAA 4IGHA 4JHOA 3GG0A 3WLTA 4BEQA 3LCFA 3NQEA 1V6XA 2FTYA 4DH0A 4GZ7A 3GRIA 3ZVHA 3CM4A 4YVXA 3H22A 3L2MA 1V3LA 3LQGA 3GB6A 4KWOA 2HBVA 4P7NA 2OR2A 2JKPA 2IF4A 5DN1A 4M29A 2OFJA 1OK6A 4IZGA 3W02A 3IJDA 4LAZA 4Q7NA 3EOOA 3H54A 3K2GA 4A8NA 3UXLA 2WM0A 3O6DA 2PD9A 3BICA 2QT3A 1TPFA 1PCKA 2CLOA 3S6TA 4KRTA 5EBAA 2W67A 4LUTB 4L6HA 2GGHA 4S1FA 3ZVIA 1KWKA 3UQBA 3UJ2A 4FR1A 4QAIA 3VDHA 5AHEA 3EKZA 4XK2A 1Q6OA 1J4IA 1F6PA 5AKQA 4W8BA 4M56A 4LAVA 2DH2A 3KCOA 1T99A 5DX7A 2OWCA 4LT9A 5D09A 2R91A 3DERA 4RV8A 1I2OA 1UHVA 1YIXA 2QYGA 2PWEA 3T6CA 4HYWA 4IMAA 2ACRA 3ES8A 1EB3A 3UERA 4QJ1A 4ZBCA 1TTIA 3OYXA 3VIMA 4GQGA 5AHNA 1J12A 4JTRA 2BY3A 2ZUVA 1PZ3A 4YHGA 2BGNE 4M5PA 1LRTA 3F4DA 1V4YA 2VOTA 3W74A 3KABA 3VINA 4TIMA 5HPCA 2VEPA 1NFPA 1Q45A 1JCXA 4N9EA 4WDUA 3MPGA 1ALDA 3AIVA 3K1GA 4PRWA 1TVPA 3FN9A 5CLTA 2WCAA 4HB7A 4DBWA 1QUMA 2NQ9A 3RX2A 4GKLA 4WOQA 5I2UA 1UD2A 4ZENA 2EJAA 1RK5A 5HQMA 1IHIA 3CAVA 2GVYA 4A4AA 2JKEA 4Y90A 3VDCA 1Y5XA 1J01A 2GK1B 4RPQA 3AZTA 3UZZA 3W82A 4ERGA 2WSPA 3O63A 5CCZA 1DWGM 3O5PA 4UNLA 4A22A 4TV6A 5HXMA 3PB0A 7ODCA 1MFVA 5A2BA 1AZ2A 2ZX7A 4WQ6A 2QMJA 1S46A 4QEEA 2EAWA 2B7PA 1D3CA 1V3IA 3WDQA 2E6DA 2Z6IA 3FKRA 2V5CA 5IOBA 1QHPA 4GJ1A 3ID7A 1XP3A 2QJJA 2OOFA 2A1YA 3EAUA 3GC4A 4IG2A 3ITCA 1CGTA 1KCZA 3RCYA 4NAEB 4BFAA 4UTJA 5HW6A 3KRZA 3ZJKA 1W1VA 1PTGA 1OGGA 4ADTA 1MRAA 1BVNP 3EKGA 3HQNA 2MLZA 3MP3A 1TUFA 3GC2A 4Y9MA 1VYSX 1HJSA 3A23A 1TX2A 3CZKA 3APTA 1QWGA 4NAFB 1OM0A 2PWUA 5EYWA 3T05A 1VCFA 4MWAB 4HK6A 1P5QA 3Q37A 4AH7A 3JRKA 3PBWA 2A7PA 4L9YA 4OECA 3MI2A 2E77A 1F61A 1ESWA 4PGLA 1ZAJA 1RUSA 3MO4A 4B16A 4XAFA 2Z7GA 1XIMA 1WZAA 1SZGA 3BMWA 3RLHA 4PCTA 1VYPX 1O5XA 4M19A 3AJ7A 1FH9A 4ORMA 7XIMA 3MUAA 1YDYA 4PEEA 4KRUA 2NVAA 3EDDA 3W7PA 4R0XA 5A8OA 4C6NA 2YL5A 4XD6A 3CNYA 4LYKA 1CBGA 4AIEA 3W7MA 3GKAA 4DJED 3IWPA 3EPOA 1ZNNA 3ZR5A 2WK2A 1W8GA 3EX4A 3NI6A 1FKHA 1PS9A 1YNPA 3WKZA 5M03A 2CLHA 5A6LA 5FSEC 2QJIA 2WSKA 2XGBA 1TE1A 3DZ1A 4L6DA 2XYLA 4L1GA 4KETA 5C9WA 1EJWC 3KOXA 4QROA 1D8WA 4XZLX 2QPXA 2C1GA 3NEVA 1DQWA 4E8GA 2PWHA 1H7XA 2OFNA 1XPYA 1QASA 2PPGA 1TWDA 3HG3A 2YGYA 3EB4A 2E9LA 3PR2A 4J7RA 5TBOA 4PB3A 1K03A 1IYXA 2Q01A 5IRPA 3AC0A 3VM5A 1DHKA 4C1NA 5A8PA 1JR1A 5D2YA 4S39A 4IL2A 3ELFA 3TZNA 3C0SA 4XZMX 4AZBA 3WNNA 5A6KA 3EOEA 3ONBA 1FH7A 1RA5A 4XD3A 1V0NA 1J5TA 3THDA 1DVJA 4CD4A 1E15A 2BVDA 4CU8A 4DZIA 4DZ3A 1TTQA 4AZCA 3WLNA 2YYTA 1YYAA 3OA3A 3MBFA 1W91A 3U2CA 4DF2A 4QNEA 3PZGA 3KWSA 2VZOA 2F6UA 2QNEA 3UT0A 5D75A 2ZTJA 3W01A 3WLPA 1EJXC 3PPFA 1RR2A 1RCOB 2FFCA 4LY4A 4M81A 1B3WA 3V16A 2DUZA 3W24A 2RHGA 1YPFA 1QMLA 1KXQA 3S1WA 2WCGA 2I5QA 1XSIA 5C71A 2EKGA 4PTWA 1K4HA 4MKVA 1HKVA 5DELA 1L8PA 3WJWA 1HW6A 3TYUA 3GTHA 3SURA 5CKSA 3F5JA 4QEHA 4AIUA 2PGWA 4TNSA 1TWWA 1MSSA 3VGHA 4UC5A 4F2TA 4JFSA 2CLIA 2CHRA 1E4MM 2VC7A 1W3HA 4QLLA 4HNOA 1JULA 3CZLA 3MDUA 1EL3A 4RJEA 1IWBA 3KL0A 4FXRA 4NXKA 5A6MA 1EOKA 1W1PA 2Y5JA 5FL0A 4DWSC 4UQ9A 1DL3A 2ALRA 3JUGA 2PP0A 1UCWA 2P0OA 1OABA 2EPLX 2WNWA 3BCJA 1IZCA 2OSYA 4KQZA 1CNVA 4Y8FA 2XSBA 1NAL1 3BLPX 2ZIDA 2IQ0A 4B3LA 3NSNA 3MMTA 3TCEA 4F66A 3GSMA 3MHUA 3A24A 2ISDA 3TYCA 4JQ3A 3UJSA 2A3BA 2NSOA 3SN1A 1ZCOA 4DJFC 3VNYA 4GINA 2PLJA 1XRVA 1TPVA 2FVLA 2CBIA 3M0JA 3QZ6A 3A3WA 2DVUA 5CJ5A