1TFVA

Crystal structure of a buffalo signaling glycoprotein (spb-40) secreted during involution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF A BUFFALO SIGNALING GLYCOPROTEIN (SPB-40) SECRETED DURING INVOLUTION
rcsb
molecule tags Signaling protein
molecule keywords mammary gland protein 40
total genus 107
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1tfvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tfvA01
2VTFA 4W86A 1FP8A 4JFWA 9CGTA 3SUUA 1PZ2A 2J7DA 2EPKX 1UQYA 3ZSSA 4KH2A 4W93A 4PMUA 4CD7A 1C7SA 3WDPP 1HKIA 4F8XA 4PMNA 3WD0A 1HP5A 3II1A 5A6LA 4UQ9A 1VJSA 3SCSA 4V28A 3WD4A 4PMQA 3BAYA 2FHFA 1OB0A 3BMWA 4AZCA 2VO5A 1JZ2A 1KCKA 3U57A 4JFUA 3L2MA 2E4TA 3WNKA 2FDMA 4GI8A 1WPCA 1HIZA 1MWOA 2J8GA 2V5DA 3WIJA 5A8MA 3VDHA 1WKYA 1B3WA 1VEOA 4D6HA 3CPUA 4TX8A 1CLVA 7TAAA 4OJYA 4TTGA 2J79A 1W3JA 3VMPA 2ZUTA 2ZUUA 1E40A 4NI3A 1ECEA 5HXMA 1HJQA 3CTTA 1OGSA 1GJWA 3WQ8A 1V3LA 3BAJA 5LA0A 4H2CA 4R27A 1MXDA 1QI3A 3SCVA 1KGXA 4W8AA 3MMUA 3WQVA 1SR0A 4IUGA 3OLGA 5BXTA 4HA4A 1UR1A 4PMDA 1KXTA 2OLHA 1F4AA 4RE4A 1HJWA 1CXLA 3TTOA 1QOXA 1QVBA 4CD4A 2VRJA 1QHOA 4AIEA 3FNDA 1NWUA 2WVVA 3PZIA 2PB1A 3GH7A 1D7FA 1SFSA 2D23A 2J7CA 3ARZA 1B3VA 2WVTA 4PUDA 2CETA 3AHYA 1QNQA 5I24A 1E3ZA 8A3HA 3SUSA 1W1PA 1TUXA 3ZOAA 2C8NA 1QI4A 4D6FA 3K46A 1XSKA 5CPSA 2E40A 3L4UA 4TOQA 1E56A 1R7OA 2WMHA 2J7BA 3O9NA 3VIMA 2JEQA 1UWUA 2DH2A 1UKTA 2CITA 2YL9A 3O6AA 3S2CA 5BXSA 4AY1A 3EDEA 1GHSA 4CGTA 3GBEA 2YDQA 4AZ5A 1J0YA 1VEMA 2YDRA 3J7HA 3QR3A 1KXQA 4U3AA 3U7BA 1G9HA 4IPNB 5JUVA 2BY0A 1KBBA 5ECUA 1E4NA 1DTUA 3MS8A 1UWSA 4PMXA 3KEHA 3UESA 5I78A 1QHZA 1EIBA 5GNZA 5EMYA 2BV9A 3RILA 1J18A 1E73M 5D9MA 4AZ7A 4V27A 4CD5A 1UR0A 2WC4A 2W92A 4B3LA 1EGZA 5A8OA 5DEZA 5CLWA 1FHDA 2UWFA 1R87A 5A3HA 1UYQA 1NOFA 3GXFA 1ISYA 1E4IA 1JF5A 5DMYA 2XIBA 1LWJA 2GJRA 4WKFA 3AMCA 1P6WA 3ZT5A 2NT1A 4YN5A 4Q7NA 5A6KA 2Y8VA 3MU7A 5A8QA 1KWKA 5BCAA 3BGAA 2J75A 2DIEA 1PEZA 1KQYA 2DGAA 4PN2A 1CXFA 4D6IA 3SCPA 4BA0A 3SCRA 2BXYA 4M56A 4MAVA 3PZVA 3PZMA 2X8RA 1LG1A 2WMIB 1BYDA 3MANA 1VBUA 5BYWA 4A4AA 1AQMA 2BY2A 1JNEA 5FL0A 2NW0A 3OLEA 3T2QA 1OIFA 1BAGA 3AROA 3PZUA 1HJVA 1WZKA 3TP4A 4AZGA 3UR8A 2XTKA 3CZ8A 4JFTA 4MJ2A 4YHEA 2G3IA 1TFVA 1CIUA 2GJXB 4PMOA 4UQBA 1VEPA 3EDFA 1M03A 1PPIA 3PZQA 5CJ5A 1AQ0A 3F4VA 2VQUA 3WD3A 2WANA 4JCMA 1W32A 2XYLA 2V3EA 5M17A 1GOKA 4HU0A 1JXKA 1GJUA 3AHTA 3AZTA 5DFAA 4EANA 3VIGA 3W26A 1MQPA 4XZWA 1KGUA 4MB3A 3L2LA 3NDZA 3M46A 1CTNA 5ABEA 1B3YA 2O9TA 2EQDA 1BVNP 3VX0A 4P7OA 3F5KA 1V3JA 2VQTA 1B90A 4F9JA 2RGMA 1G0CA 3VNZA 5M03A 1UOKA 2OWXA 2WHKA 3KE0A 1R7AA 4MNLA 2DT1A 3GM8A 1XC6A 3CMJA 2O9PA 1K9TA 3RJXA 4AZ6A 3OZOA 4B15A 1C8YA 2CYGA 3WDJA 5CZKA 1PJ9A 3UG5A 4H7VA 1ISZA 1B1YA 5LYRA 5ABGA 2B31A 1BYAA 2PWFA 1CBGA 4JKMA 3AOFA 2BY1A 4M1RA 1E71M 2VURA 4AD0A 4HP5A 1MW0A 1PIGA 1XCXA 1GQKA 1DWHM 3T2OA 2EO7A 2O9RA 4OKDA 2WAGA 4UFLA 1E55A 1VB9A 2GK1A 3D3AA 2D24A 1XH0A 3CZGA 3NSNA 1OGGA 1J0JA 3I3BA 1UG6A 4C7FA 4MDPA 3N9KA 2X0HA 1XD0A 4YHGA 1V3KA 1UQZA 4BQ5A 4BF7A 5I77A 1ZJAA 2WNWA 3WUFA 1EA9C 5I2UA 2DSKA 5ABFB 2DSVA 2OSXA 4AYSA 4CU6A 2AMGA 3VIPA 4MJ4A 1ZBKA 1UWTA 3W53A 5A1AA 3LPOA 1GW1A 3AXHA 4J27A 2YLLA 2VCBA 4QFUA 1V0KA 5CPTA 4M8UA 1R86A 3K8KA 1C92A 2ZXAA 2ZXBA 2OSWA 5AC5A 1M01A 3G6MA 5A8NA 3DHUA 1NP2A 1GONA 3VX1A 1BLIA 3M7SA 2WVSA 1OBAA 4DWSB 3WEZA 3W29A 1MQQA 3WMCA 4ZENA 4Z2GA 3FHAA 1GVIA 2QV4A 1GOOA 4HZ7A 4X0VA 4C7GA 4HOWA 5GPRA 4PBGA 4GZJA 2J25A 2XUCA 3PZNA 3N18A 3EMCA 1D2KA 4DUVA 2VZTA 3AYRA 2VC9A 2VMFA 3DHPA 3AIBA 5D4YA 4WF7A 2ZOXA 4D1JA 1XD1A 3GXDA 3PZOA 5DT5A 1DEDA 3ZJKA 1ISWA 4KRTA 4FMVA 1PIFA 3W6LA 4AZHA 1V6UA 1H41A 3MV01 1BGGA 4JCLA 4MPKA 5CG0A 3A4AA 3APGA 4F9DA 2OWCA 1GPFA 2WPGA 3WFLA 3FHQA 1UH3A 1JYNA 3WQ6A 2EPNA 1KQZA 4QP0A 3THDA 4AW7A 4ATDA 2ZX7A 4UFMA 2WBGA 2WVVB 4PRWA 2ZX5A 3ZR6A 1PZ3A 4J3WA 3U5UA 1WNOA 3KL5A 2XM1A 5HPOA 1W9PA 1ZBWA 1GOWA 3VM5A 1NWRA 1XYFA 1L0PA 2ZWZA 1JD9A 3ZJ6A 1WDRA 1XCWA 4LYQA 4CCCA 1G01A 1Q6CA 5A94A 3SCNA 1HKJA 1EDQA 2W66A 4P8XA 4M29A 2FH6A 2DSUA 1IZKA 3CHEA 4PCTA 2WSKA 1KWGA 3VIKA 2ZXDA 5IXEA 1EQCA 1JNDA 2YBTA 3TTYA 4CCEA 3TOPA 2A3AA 3ARSA 2VX4A 4GQRA 2VVSA 4WJXA 2GVYA 4ZFMA 1O7AA 2XFRA 4W7WA 3RM9A 3W24A 2YA1A 3W4RA 5I3DA 5E6YA 2EBNA 3ZM8A 5JIPA 4D6EA 4PUEA 1B30A 3QHOA 3N11A 2WLZA 3WDIA 4B3KA 3UR7A 1DWAM 1WP6A 1E6NA 3SURA 1W1VA 1CGTA 2BHYA 2JF7A 4QCEA 5C8BB 2ZE0A 2VT0A 1BGAA 2VI0A 3WF0A 1V3HA 2A3CA 3AXIA 2PWGA 3IK2A 3WUBA 3WEMA 4J3VA 1ISVA 1HJSA 3AHXA 3DECA 3DC0A 1UA7A 5F7UA 5EB8A 4W8LA 1E6RA 5A6JA 4BQ2A 2CBJA 1ESWA 1V02E 1MW1A 2E0PA 3WFZA 5M3WA 4W7UA 4MDOA 1V0MA 2J62A 1VF8A 3O2LA 3CUJA 4LXFA 2WM0A 1HF6A 3K8MA 5IHSA 1US2A 5I23A 2GFTA 4W84A 5EFDA 3EYPA 3FN9A 3D5HA 1TG7A 4ATLA 4J3TA 3GXIA 2DT3A 1G5AA 4LPCA 3WUEA 1UHVA 3AXXA 1CGUA 1C7TA 3WH5A 1MQRA 4CN1A 4U3CA 2DDXA 2JEPA 2XVLA 4TX6A 2A3BA 1CGYA 2GK1B 2XPKA 5LA1A 4MTVA 5FKYA 2BY3A 2VOTA 1MFUA 1PX3A 1H4PA 2BFGA 5DT7A 1BTCA 4AD1A 4ZE4A 5JBEA 3VD9A 2YOCA 3AMKA 2Y24A 4JL2A 5BXPA 1OWQA 4KGJA 1W9XA 3BAWA 4J3UA 1B9ZA 3W81A 2XFFA 1TVNA 2WC7A 3WD2A 3OLIA 1Y7VA 3IJ7A 3DYPA 3BXWA 2DPEA 2DEPA 3MMWA 3PTMA 2F61A 2DSWA 2CCRA 2WZHA 1BG4A 2A3HA 1JDDA 4JL1A 5FIPA 2WMKA 4OOZA 3N13A 1J0IA 1ZBCA 5AYBA 4FLRA 1GVYA 2DQXA 2QF8A 3K8LA 3B9DA 3WNMA 2WWDA 3BLPX 4DM2A 1G94A 3ZMRA 1H0GA 4S3JA 3MO4A 3DYOA 2VZVA 3A47A 4HOZA 4A3HA 4PTWA 2D0HA 3VGGA 3CMGA 4UOZA 1JZ8A 1WDSA 2J77A 1TMQA 5TD4A 4BS0A 2UY2A 1TZ7A 4PTMA 3BAIA 4Q22A 2XM2A 4WSJA 1H11A 3T09A 2W63A 3VIOA 4QDMA 1E70M 2D0GA 3EBVA 1XRVA 4UFIA 5EFFA 1WZMA 3AZRA 3IAQA 3KWXA 2FHCA 2XJ7A 1E0VA 1PAMA 2J8FA 2OSYA 3WY1A 1WDPA 2XWDA 3L4VA 3VDBA 3VIHA 1JYWA 1W9VA 1QPKA 1W2PA 1R8LA 3LPGA 1K9DA 4JZ5A 4TVCA 2VCCA 1XH1A 1BG9A 1CPUA 4NF7A 4X0NA 1PX8A 3IANA 1CYGA 3ZO9A 1B31A 1E0XA 4QLLA 4NRRA 1UH2A 4AEFA 5GNYA 2TAAA 3K4AA 2J47A 3CLWA 2WCSA 1ISXA 1BYCA 2WSPA 3VDCA 1JAEA 1V6VA 2E9BA 1SMDA 2V3FA 2ZXQA 1UWRA 2D3NA 1E9LA 4CVWA 1BFNA 3WQ4A 5CGMA 2F2HA 4C7DA 3I3DA 1UD6A 3PTKA 5D9NA 1WO2A 4M81A 4W85A 4ACYA 1OSEA 3TTSA 1NP0A 2DT2A 4FLQA 3ARRA 1DHKA 4UR9A 1XSIA 3B9EA 1KB3A 5A2AA 3PTQA 2YA0A 3WDHA 5HNNA 5BXRA 1BQCA 1HJUA 3HN3A 3ZQ9A 2OYKA 1GOMA 1M53A 4UZUA 3MMDA 4YPJA 4ML4A 4OUEA 3AJ7A 1CGVA 1H5VA 3OA5A 1UR4A 3AISA 3L4TA 4HOXA 7A3HA 3GNPA 4KMQA 2J7GA 3RO8A 1PX4A 3VINA 2JFEX 1O6IA 4FLOA 4LGXA 3WNNA 5A95A 1OD0A 4PMVA 5CXPA 3RPMA 1GQIA 3SUWA 1VFOA 3FW6A 1KBKA 1V02A 4TVDA 1AQHA 2WC3A 1HKMA 2EXOA 3RCNA 1E1EA 1JDCA 2DSZA 4GI9A 4ZXLA 4HMDA 3E1F1 1UR9A 2OYMA 2D20A 5CQ1A 1EQPA 2W5FA 4BCEA 1UH4A 1L8NA 3AS2A 5KEZA 1S46A 1VENA 1UA3A 1LL6A 2BS9A 2W62A 2ZX9A 3WF1A 1W9UA 1E6SM 1UUQA 1K6AA 1C91A 2MANA 2QLYA 3MSDA 3CHFA 5HBFA 1B2YA 3NYDA 1QI0A 4IISA 2ZUVA 5GNXA 1HVQA 1EDGA 4B9ZA 2DT0A 2XGBA 3PN8A 3MV11 3L4YA 3HU7A 4EE9A 4HA3A 1KFWA 1HVXA 2E9MA 4U2ZA 2EPMX 1GOQA 3KL0A 3UERA 1F4HA 3ZT7A 1V0NA 1GHRA 4NRSA 4IM4A 2JE8A 2VRQA 4IPLA 4UQEA 4GINA 1WZLA 4NSBA 3RDKA 1ITCA 3T0AA 4J3SA 1UKQA 4NZCA 4CU8A 1GNXA 2ZX8A 4CU7A 2CERA 2VL4A 6TAAA 4DWSD 3IJ8A 4JAWA 3ARTA 3N17A 1BSIA 4HMCA 1FHLA 1OCQA 5A69A 1OGBA 1W91A 2VR4A 2VUYA 2VZUA 3CUIA 4GXPA 3AI0A 4GO9A 1ITXA 1UKOA 4WLCA 3VGHA 1VAHA 1W3HA 3WH6A 4HZ8A 2JALA 1V6YA 1LL7A 4ACZB 1X1NA 1R85A 1QI2A 4DUWA 2EPLX 1DWJM 4LQ1A 1I75A 5D9OA 3GTNA 2D22A 2EEXA 3VM7A 2WB5A 5IFPA 1NARA 1A47A 5IFTA 5D8WA 1NM9A 4EKJA 5LA2A 3IAPA 4PSPA 1CDGA 1XH2A 3CZKA 3F5LA 3TONA 4ACZA 2WYSA 5E9AA 4XUYA 1LF1A 1KXVA 1U2YA 4M80A 1JI2A 3VD5A 1NOUA 4B16A 2G4FA 2WMJA 1W2VA 4AISA 1RPKA 1U30A 1QNOA 1QNPA 1IZJA 1C8XA 4DWSC 5HPCA 2ZWYA 4N0RA 1H2JA 4P7QA 4QCFA 2WMIA 3VGBA 3ALGA 4GIAA 1EHAA 1HL9A 5JIWA 3VO0A 1C90A 2VR5A 2V38A 4XB3A 3CZLA 4TUFA 5A6MA 2UY5A 1LJYA 2BNJA 2YKKA 3IJ9A 1ODZA 1XV8A 3UG4A 1CLXA 5HDRA 3VUPA 1US3A 2PWHA 1CXIA 1ZS2A 1J0ZA 3GDBA 1Z32X 4AD3A 1CENA 4AC1X 3A6OA 4H04A 1EO5A 2CNCA 4Z2JA 3POCA 3ZR5A 1KR1A 1V03A 3U7VA 1TA3B 4RL3A 1OT1A 2D1ZA 3OGSA 4P8VA 3A3HA 2GSJA 3SCWA 1FFRA 1TVPA 4J7RA 1V6WA 1LG2A 4GQQA 3VILA 1RH9A 4CD6A 1YHTA 3PZGA 4PEEA 4XV0A 1W1TA 4AEEA 3M6DA 3U5YA 5IHRA 4WSKA 4EK7A 4A3YA 2VNCA 1C8QA 3GYCA 3EDJA 4M24A 1KCLA 3EMQA 1UR2A 2YL6A 2VCAA 4Y7EA 4D1IA 2ESCA 4PTXA 4HMEA 1HXJA 2WCGA 5ABFA 1EH9A 1V6XA 1FP9A 1E72M 4AD2A 1UD4A 2PC8A 2XVNA 3PZ9A 2CESA 3TA9A 1DP0A 4L4PA 4OOUA 2W67A 3GNRA 2WHLA 3W27A 1H49A 2ZX6A 1AVAA 4GZIA 4E8DA 3AIUA 1HX0A 1Q6FA 2UY3A 3W82A 1JFXA 2J78A 2CHNA 2Y8KA 1ZBVA 4GKLA 2W61A 1Q6GA 4WK9A 4JIEA 4D71A 3K1DA 2PWDA 3ARPA 1GZJA 3BSHA 2X05A 1JG9A 3N12A 3WBAA 1IT0A 3BAKA 3S6TA 5I6SA 1ZL1A 1XYZA 2ZICA 4N42A 4UTFA 3WH9A 4FK9A 5FL1A 1OM0A 2F8QA 3F5JA 4PTVA 6A3HA 5E09A 1W9BM 2VRKA 4ZEPA 2BHZA 2V3GA 4W5UA 2QPUA 2W4XA 3WQ5A 1NOWA 1J12A 3AIWA 1QBBA 5D9PA 2CEQA 3VGFA 2WLYA 3QHNA 3W6MA 1CNVA 5E0FA 4UOQA 2IUZA 3BSGA 1FH8A 3CHDA 2ZUWA 4Z2HA 4D6GA 2WXDM 2CIPA 3A4WA 3FAXA 1E15A 2GDUA 4D72A 2VJXA 1XGZA 3LMYA 3WL0A 1E6PA 2GUYA 3VMNA 4AZBA 3WL1A 3AQUA 3ARWA 2GDVA 2CPUA 2ZUMA 2XFYA 3LPPA 1JYVA 4OBSA 2ZUSA 4OZOA 4W88A 3AS3A 1UR8A 2WVUA 4XX6A 4FLSA 3L4WA 3ARQA 4URIA 2OYLA 1WDQA 2A3EA 1E6QM 3N1AA 3AS0A 4QLJA 2Z1SA 2VX5A 5DO8A 2PI6A 1CZ1A 3CH9A 5ABHA 1D3CA 4JHZA 1VIWA 4AZCB 5I79A 4XZBA 1J0KA 2X09A 1W9DM 3WDQA 3VPLA 1XHGA 3AIEA 1CGXA 4MNMA 1E3XA 3SIMA 4CUCA 2NSXA 1OINA 3PZTA 5A6BD 2XGIA 2OWWA 1VBRA 1ZU8A 3WSUA 1KXHA 3HJEA 3AICA 2JIWA 4CN4A 3AMLA 3WELA 1UZ4A 1G1YA 3THCA 4OIFA 1M04A 1JFHA 2WMFA 1CXHA 4F66A 1WB0A 5AYIA 1GORA 1W1YA 3WNOA 1E4MM 1NQ6A 2VX6A 2E8ZA 2CBUA 4P7LA 4E8CA 5C71A 4PMZA 4ATWA 4J3XA 1FH7A 4CCDA 5CSYA 3ZSTA 4FF5A 4DWSA 3SCQA 3AIVA 3OGVA 5E0CA 1W3LA 3JUGA 3MUAA 2Y4SA 4JFVA 1AMYA 4Z2KA 3GBDA 1WCGA 1B3XA 5BROA 3CHCA 3MUY1 3OG2A 4DM1A 5CLTA 1OIMA 1X6LA 5A6AA 3VVGA 2WHJA 1K9FA 3CO4A 3SUVA 3EDDA 3GZAA 3CUGA 3UEQA 2WZIA 4UOJA 2O9OA 5A6BA 4TTUA 1DWGM 3UCQA 4GO8A 2J7FA 3NDYA 4BQ4A 2VX7A 1E4LA 4ZXOA 1E5NA 2YDSA 1MVYA 3CUFA 2FGZA 4AIUA 3CZEA 3OLDA 1Q6EA 5DF0A 3VKKA 2WK2A 3GH4A 5A2CA 3OBAA 3VOCA 3VMOA 1LL4A 2E8YA 1JGIA 2X0YA 4ZE5A 1VJZA 3ZT6A 1QHPA 3RJYA 3WNLA 4KRUA 1I1WA 4R5EA 3NSMA 4UCFA 2E3ZA 1JIBA 2AAAA 3GXMA 3BH4A 2E9LA 4LX4A 3VU2A 1E6ZA 2G3MA 1H0IA 1HL8A 1UD3A 2J4GA 4W5ZA 2YL8A 1KGWA 3FY1A 4LYRA 4QLKA 5JBDA 3I3EA 3A4XA 2VVNA 2XIIA 4GI6A 1W3KA 5E70A 4MB5A 4W7VA 1HT6A 1OD8A 2XVGA 3ARXA 3NIYA 4UFHA 3B9AA 4AD4A 5HOSA 1ZJBA 1M7XA 5BWFA 2C7FA 3SCOA 3EDKA 3BMVA 3WKZA 3FXYA 2PWEA 5I0DA 4U31A 1UD2A 3GH5A 2IXVA 3WN6A 1VFUA 1CXKA 4WKAA 3TTQA 3T08A 2XSAA 1DWFM 4EAMA 4MAZA 3AMGA 1LWHA 1UWQA 8CGTA 4OBRA 3ARVA 1U33A 4WIWA 6CGTA 3VGEA 3VNYA 4Z2LA 1HN1A 4MNKA 1J11A 1LQ0A 5D8ZA 2G3JA 1EXPA 3AHVA 5CPQA 1B0IA 3MUZ1 4H41A 3B8SA 3VD3A 2DH3A 1J9YA 1RP9A 3AZSA 4UQCA 1CWYA 3OB8A 1NWSA 2Y5EA 2FHBA 1BF2A 2J7EA 3LPFA 1WAWA 1EHNA 5FD0A 1GQLA 2D2OA 1V08A 3BLKA 2XWEA 2IXUA 1MW2A 4RE2A 1VFFA 1FA2A 3PHAA 4H8VA 4MNJA 4S3KA 2YJQA 2X2YA 5A8PA 2UY4A 3WMBA 1EO7A 4UZSA 3MUIA 1Q6DA 1QNSA 4F79A 1J0HA 4HPGA 4D6DA 4U2YA 3RMEA 1JF6A 3N04A 1XSJA 4D6JA 3AYSA 4Z2IA 1SMAA 2O92A 3WF4A 5EBAA 2V5CA 5CSUA 4P7RA 3KZSA 5BRPA 4K68A 1HNYA 3L4XA 1LLOA 5IDIA 3WF2A 2FH8A 2CBVA 1JZ3A 3L4ZA 3OZPA 1E1FA 3WQWA 2J74A 1MYRA 5I5RA 3KL3A 1SYTA 3SEPA 2YA2A 1QW8A 2YBUA 3VIIA 1V3IA 3UETA 3POHA 3CGTA 4CN6A 4MB1A 3VD4A 1QI5A 1UKPA 2C0HA 5FOOA 1MFVA 1FFQA 1MXGA 1UD8A 3T2PA 4AZIA 1UD5A 1Q4NX 4HTYA 2PF0A 2X1IA 3NJ3A 3W28A 1RP8A 5AY7A 4CD8A 5JH8A 2WKLA 1JYXA 1WZAA 4W89A 4PYSA 1HJXA 2BHUA 2EJ1A 4D6CA 4CVUA 1N82A 3W0KA 4JHOA 4AXNA 2BVDA 4X9YA 2G3NA 4L4OA 4PCSA 4UQAA 3M07A 4U5IA 1HKKA 4MB4A 4P8WA 1KR0A 1TCMA 5M5DA 2WHMA 5CGTA 1TR1A 3QHMA 3ALFA 1CXEA 3DYMA 2D3LA 3WDRA 4MADA 2QPSA 4UNIA 4H8UA 1UZ1A 3WH7A 1A3HA 2WZEA 1UWIA 4W8BA 4CKQA 3BCFA 3CIVA 1UKSA 3NSXA 1JZ7A 1E43A 3WH8A 1JZ5A 2J7HA 2CBIA 3QOKA 3SUTA 3MSGA 4TVUA 1EOKA 2EPOA 1EOMA 2CKSA 2RGLA 3MKKA 4PMRA 4HZ6A 1GCYA 2DIJA 4PSRA 1BPLB 1E0WA 4U5KA 4HA1A 1JI1A 1V0LA 2D0FA 2HVMA 3AFBA 4W87A 4AWEA 4AD5A 5BRQA 1NWTA 1BYBA 1X6NA 2YLAA 4DUXA 1CECA 3CUHA 2PBOA 3VD7A 1H09A 2QMKA 3FAWA 3NUKA 1EDTA 3WBEA 2XG9A 2QMJA 1ZB5A 2W91A 3PBGA 5E6ZA 3SCUA 2G41A 3WF3A 1B3ZA 1IV8A 4JKLA 2WCAA 5FCZA 3ARUA 4JKKA 4BQ3A 4V2XA 1NH6A 3RM8A 2FGLA 2WW5A 3EMZA 2XVKA 1V3MA 4UFKA 2NT0A 3BC9A 1JXJA 3AMDA 2Q8XA 1TE1A 1VFMA 1J10A 2VZSA 1BHGA 1CEOA 1TA3A 3ARYA 1VRXA 1PBGA 4KWUA 2XHYA 3CZJA 3BCDA 3VIFA 3SCTA 5KZ6A 1C93A 2CXGA 3HMCA 3W38A 4UFJA 3RM4A 3WNPA 4GPNA 2BXZA 4U33A 3AS1A 3VIJA 3T0BA 1RD6A 3QOMA 4WKHA 2YIHA 2GJPA 3G6LA 4AIOA 1I1XA 3BAXA 5A6SA 3WENA 1E5JA 2Y2WA 1YQ2A 2AOSA 1GUVA 3VDAA 3AIQA 1FH9A 4LYPA 2BVYA 3OGRA 4P8UA 4H8HA 4J28A 4HU8A 3AHZA 4RE3A 3WUGA 1JAKA 2CHOA 2QHAA 3UG3A 7CGTA 2WKGA 1HP4A 1CGWA 2VZOA 5GQBA 3ECQA 4BZYA 1OT2A 2CKRA 1JDAA 4UQDA 2JF6A 3VTRA 5C70A 4PMYA 2XSBA 1MW3A 4JFSA 5AC4A 2ZUNA 3WD1A 3OIHA 1JZ6A 4E4PA 4P7NA 3WEOA 1H1NA 1JD7A 3CBWA 1E6XM 3ZJ7A 2BVTA 2XVPA 3W25A 2V3DA 2PBGA 1J01A 4KGLA 3K4DA 4B9YA 1K9EA 2G8ZA 1H3GA 4TXEA 3AIRA 1JL8A 2WBKA 3GNOA 1QW9A 3T0DA 2HISA 1DWIM 1JZ4A 1C3FA 2ZIDA 2JIEA 4E2OA 4AMCA 4HPHA 3VGDA 3NCOA 3RIKA 2Z1KA 4M82A 1WE5A 1GQJA 1FOBA 2YL5A 3ZIZA 4QAWA 3W37A 2WWCA 1QNRA 3ZJ8A 5JBFA 1ODUA 4GZEA 1BVZA 3N15A 2GJXA 1GOIA 3WMSA 3QGVA 1QBAA 2WMGA 5A2BA
chains in the Genus database with same CATH superfamily
2Y85A 2NV1A 1D7IA 1FP8A 2C91A 4JFWA 1KC7A 4B2DD 2GWNA 2EPKX 4PMUA 4Y8FA 1S2CA 1C7SA 1UUMA 3O3RA 4Q8WA 3II1A 5A6LA 1VJSA 1BD0A 1G67A 4V28A 4EWND 4H00A 5H8PA 3O5JA 1M7JA 4RZ4A 3U57A 2E4TA 1ROUA 1J96A 1XIFA 1J4IA 1MWOA 1K8ZA 1WKYA 1WXYA 1GG1A 1M68A 3W00A 1WKFA 1B3WA 3NL6A 2KR7A 1JGMA 3E5BA 1VFTA 2JZVA 4TX8A 5HWJA 4C6LA 2ATMA 1ZRQA 3W74A 1CLVA 1PWLA 4OT7A 5G4HC 4TTGA 2J79A 4M6PA 4WOZA 3VMPA 2ZUTA 4NI3A 3VAWA 1WOAA 2VC6A 1A53A 1HJQA 1K1DA 3QBUA 3WQ8A 1EPXA 4S3FA 1XLGA 2OLAA 3BAJA 4H2CA 1QI3A 4UTHA 3KP1A 4W8AA 2ZR6A 4OQVA 3WQVA 3OLGA 5LZLA 5BXTA 3NO5A 1XLDA 1KXTA 2GVEA 3ITOA 4NNCA 1QPRA 2BGSA 1RQHA 1CXLA 1YPFA 4B3ZA 5J5DA 1TPB1 1QHOA 1FKLA 3SY8A 2PB1A 4XK2A 1IEWA 4QNEA 4AC7C 2XSXA 4CQCA 3DN5A 3BE7A 4TV5A 3TQ0A 2G0WA 4PUDA 1MUCA 2CETA 3AHYA 3UJ2A 3EWXA 4DJDC 3QZAA 1EBHA 2VFFA 3BOXA 4YU1A 3ZOAA 2RURA 2CXEA 3OVQA 4LC8A 3IIXA 4BHYA 3O5GA 1EBGA 4TOQA 3ABRA 3TMLA 2J7BA 3O9NA 2OX1A 6XIAA 2JEQA 2FZMA 1UKTA 2CITA 2YL9A 1NSGA 4DT4A 5G2WA 1GHSA 4GVGA 4ZPTR 4CGTA 4ZS6A 3KAGA 2YDQA 1Q1CA 3J7HA 3QPZA 4FB7A 4JTEA 3QQ0A 3KP0A 4U3AA 2A4AA 3RCYA 2WOQA 5JXQA 3UF8A 2ZVIA 2OGYA 1OFRA 1KBBA 1E4NA 1X1OA 3MS8A 1EJVC 3CPRA 5HULA 4A8NA 3KEHA 3MYPA 3UESA 3NQGA 2GOKA 1EIBA 4KWOA 4V27A 4IICA 3LY0A 2WC4A 4IG2B 3GKAA 1EGZA 5DEZA 2J27A 1J2BA 3IV8A 2VKZG 3MW7A 4FNTA 5DLCA 2GWGA 1E4IA 5DMYA 2V5JA 2QVHA 4ZQMA 1AA1B 1B3OA 3AMCA 4JYSA 5A6KA 2Y8VA 5A8QA 3BGAA 1XUZA 2J75A 2DVXA 5JQ9A 6ENLA 2DVUA 3SCPA 4KFNA 2PODA 4MAVA 1QOQA 2FZNA 2GLKA 5CG7A 3QSRA 1LG1A 3DGRA 1H62A 3MANA 1HW6A 4A4AA 3NGFA 2BY2A 1JNEA 3ZFHA 4O4WA 1SJCA 2OG9A 1OIFA 4FAPA 5HQLA 2XTKA 3CZ8A 4MJ2A 2GJXB 1TFVA 1VEPA 3EDFA 2ZTKA 3G77A 5CJ5A 3S3GA 1D3HA 4O1CA 3WD3A 1PVNA 1SO6A 5M17A 1GVQA 2IPWA 4HU0A 3AZTA 3ABOA 3HB9A 3IGXA 3L2LA 1RHCA 1B3YA 2B7PA 3FIGA 2O9TA 1H7PA 1BVNP 1KLZA 3VX0A 4P7OA 3SB0A 3UF9A 2D2HA 2HBVA 1G0CA 1PE1A 4LNYA 2H8XA 2OWXA 2CZEA 3A5VA 3KE0A 2DT1A 5JVLA 3GM8A 3P0XA 4C6PA 1KW1A 1Q5MA 2FZ8A 4GIVA 3CMJA 2QDHA 5AZ0A 2O9PA 2QIIA 4KQZA 4KFOA 4ZB2A 4AZ6A 2V67A 1C8YA 4DF1A 2HROA 1PJ9A 2OKOA 4L64A 3UG5A 2ITKA 4HSHA 1W5NA 3E96A 3HPAA 1BYAA 2PWFA 3AOFA 2BY1A 2VURA 3FXGA 1EJRC 1KKOA 1H60A 1I4NA 1H63A 1PIGA 1REQA 2YB4A 1X8FA 4XBJA 4IIGA 1VH7A 1GQKA 3VDGA 4KEMA 2GGHA 2O9RA 4OKDA 2F4EA 3H4XA 1ZFJA 1VB9A 2GK1A 3WK2A 3S6DA 4ONVA 2J66A 1OGGA 2BG5A 3H4GA 1J0JA 4B5UA 1UG6A 4C7FA 4BFAA 4XD6A 3CO8A 4QE5A 1KCZA 3LU2A 4BQ5A 4F2TA 4BF7A 1DE6A 5H8MA 4QBXA 2NQLA 3HMJG 2DZTA 1KFBA 1VBGA 1M41A 3TKFA 3LUOA 1EA9C 5I2UA 4HA0A 3LERA 4TW6A 3MKCA 3VOFA 4CU6A 2AMGA 1PTGA 2P8BA 1T8QA 4J5NA 3ABQA 1UWTA 1GW1A 1HXVA 2Y6ZA 3WK1A 4WX2A 2Z1WA 2YLLA 5HK4A 1EUNA 1VYPX 4H83A 5I7GA 1R86A 3M0KA 2ZXBA 5FJTA 1M01A 3G6MA 1OZQA 3L12A 2INEA 2FAPA 1NP2A 3CWNA 5CZJA 2QYGA 1BLIA 4B90A 1LROA 1MQQA 3WMCA 1WAUA 1GOOA 1XBYA 4HOWA 2J25A 2P0OA 1Z69A 2XUCA 4D9PA 1VZWA 2ZRYA 1S2UA 4DUVA 4LCRA 4DNHA 1HKWA 3R8HA 3WLNA 4D1JA 1XD1A 3PULA 1YTEA 1DEDA 3ZJKA 4MYXA 3H21A 4AZHA 3L0NA 3CWOX 1H41A 4DRKA 3F4CA 3MV01 1BGGA 4JCLA 2OVLA 3APGA 4J4KA 2DIKA 1UH3A 2C18A 2Z28A 1PKMA 3UWUA 3W88A 1KQZA 4QP0A 1IXPA 4AW7A 1XLMA 1OCBA 4DRMA 4MWAE 5EMLA 1XIBA 1LM1A 3B05A 3EXTA 2VDGA 4F0SA 3HIJA 1UCWA 3SR7A 2DG4A 5HPOA 1ZBWA 3VM5A 1XYFA 3P67A 3R0KA 3CT7A 1F74A 1W1ZA 2ZWZA 5CC5A 1JD9A 4C6JA 1XCWA 2P8CA 4A8IA 1L2UA 3CAWA 4DQWA 3LI1A 4I9MA 2DW6A 4CCEA 3W6YA 3DKJA 1LP6A 3TOPA 2A3AA 2BXVA 1QXLA 3N9SA 3WK0A 2NZLA 1XFCA 2GVYA 4WOQA 2DZPA 3W24A 4A29A 2P10A 3LXCA 3RNDA 2B4GA 4L4LA 3TMQA 5HNRA 1YE4A 2GQ9A 2P50A 3R25A 3R43A 3T0CA 4PUEA 2WLZA 2XN0A 1DWAM 5C2CA 1W1VA 1CGTA 2VC7A 1KRBC 1QOPA 5C8BB 2ZE0A 2HEJA 4RUBA 3HA1A 2VI0A 3IARA 1V3HA 2XN1A 3LMZA 4PUJA 2PWGA 1GVEA 2PDFA 1AZ2A 4Y6GA 2BB0A 3W7NA 3STCA 1W37A 2CWXA 1QPNA 3GAKA 3VFCA 5F7UA 5EB8A 3V7PA 5A6TC 3MVTA 4TU1A 4H8NA 1MW1A 5TAOA 2Y7DA 5AOUA 3UJRA 3KOWA 1V0MA 2F6KA 3IIZA 3N29A 2IPFA 4W84A 4ECLA 5EFDA 5LNWA 3EYPA 1EC8A 3PJUA 2VWSA 3D5HA 5C9XA 4J3TA 1G5AA 3DENA 1UHVA 2ZZ1A 1MQRA 4CN1A 1EFZA 3U2EA 3KOFA 4HNTA 2BY3A 2VOTA 1RAKA 4M7TA 1CW2A 3N34A 1DXFA 4NZJA 5JBEA 1R9ZA 1EWDA 4JL2A 5BXPA 3W7LA 5EMJA 4S23A 3Q2DA 3PY2A 1TTPA 3TYCA 3BAWA 4J3UA 3W81A 2WC7A 3QMTA 3DYPA 2YB1A 2DEPA 5EU9A 2Q5AA 3PTMA 2F61A 3UYIA 2PD9A 4B5WA 1BG4A 4XO7A 2RJHA 4TQTA 5F4SA 3CV6A 1ZBCA 2DQXA 1QW7A 3G3MA 3K8LA 4K6AA 3B9DA 3L0KA 4R7OA 3U0HA 1G94A 4CEXC 3NQFA 1D7HA 2ZE3A 3W02A 3PRBA 1VHNA 2D0HA 3W71A 2MUCA 2FKPA 4XZNX 2HNHA 3IEBA 4FA3A 1TZ7A 5M2FX 4Q22A 2XM2A 3TDFA 1SW3A 3NZQA 4GYKA 3T09A 3VIOA 4QDMA 5AHEA 1E70M 4DZHA 2D0GA 2VD8A 1WZMA 2OEKA 3IAQA 2XJ7A 1PAMA 5I03A 3FA5A 3STGA 4JDBA 4X63A 3A9BA 1W9VA 4JZ5A 1FKIA 1TPVA 2GGEA 4L1WA 4O52A 1BF6A 2ASHA 4BEQA 1CPUA 2PDMA 1PX8A 4IX2A 4WHBA 3M4HA 1KFKA 4GUFA 1UH2A 4Q8UA 4DI8A 4JOMA 4NYYA 2TAAA 2QW5A 2QULA 3UZZA 4F48A 8TIMA 4B5TA 3N4AA 3R0DA 3VDCA 5DX7A 1SMDA 3NZ1A 3TXZA 4PUMA 2D3NA 4C5ZA 1DJXA 1OYBA 1RJPA 1BFNA 5CGMA 1NELA 1EEXA 4I5XA 3G1AA 4IXXA 3UVAA 3L5AA 3TTSA 1W54A 3LXAA 2R82A 1TMHA 1YW1A 1UUOA 3GZ3A 1S3HA 4TNSA 2YCIX 2YGYA 3LEPA 1M53A 4U86A 3SIZA 4GYJA 2XIMA 2PGRA 3W7EA 4DLFA 5TBOA 3W85A 4HD5A 3RO8A 1PX4A 3VINA 4LGXA 5CXPA 3RPMA 3C86A 4GX8A 2BVWA 1KA9F 4TVDA 2QJNA 2VP8A 5E93A 1YDNA 3L66A 3H2EA 1YATA 4HARA 4GBUA 3HQ1A 5FF3A 2QCLA 4LAUA 3W75A 3C4UA 3E1F1 1UR9A 2OYMA 4AAJA 1RLCL 1GKPA 2W5FA 3SQMA 3NL3A 2X40A 4NU7A 4K1GA 1S46A 4NX5A 2V30A 1GVRA 2BS9A 2W62A 1W9UA 4AY7A 2O7QA 4RE0A 4CQ9A 2QLYA 1GYMA 5I3FA 5MF5A 5D38A 1KM6A 1I2RA 4ZA0A 1QI0A 4IISA 5KINA 2FDSA 5GNXA 2JKPA 1CB2A 2QUTA 2XGBA 3MV11 4EE9A 1QT1A 3KOZA 2E9MA 4HA3A 4HZMA 4U2ZA 1GOQA 1KFLA 2XZ7A 3B8IA 4C6DA 1V0NA 1GHRA 4IM4A 4Q33A 3GG1A 1WZLA 3UI6A 3BV4A 3GDLA 4JTAA 3GVQA 3BK0A 2D2GA 3BLFA 3ENLA 2G5WA 3R8GA 1D8WA 4NZCA 1XBVA 2HPIA 3C6CA 4CU7A 2CERA 3C56A 4DWSD 4JN6A 4JAWA 1BSIA 5T9BG 4HMCA 5A69A 4ZGYA 5H1WA 5FACA 2VUYA 4GXPA 3AI0A 1EIXA 4GO9A 1UKOA 3NOEA 2VGFA 4ADTA 4ASTA 2KFWA 1FKBA 1LL7A 2NX3A 4ACZB 1X98A 1Y0OA 1QI2A 4DUWA 1I2QA 1DWJM 1T5AA 1OFDA 2EEXA 4PCPA 2WB5A 5IFPA 1A47A 2BOEX 4EKJA 3BJSA 3H8AA 3PK7A 2OELA 2WYSA 3VD5A 4M80A 4B16A 3LBCA 2WMJA 3KAIA 3M9YA 1RPKA 2PDQA 1QNOA 1QNPA 2QUMA 3M0LA 4QR6A 2ZWYA 4M51A 4QCFA 2WMIA 2PU1A 3VGBA 3ALGA 1NSJA 4JTUA 3LGDA 4S39A 1ZJHA 2V38A 4XB3A 4AH7A 1OG6A 3JZEA 4ROQA 3Q37A 3NWRA 1S2AA 2WJFA 5C2GA 1BL4A 3LHWA 3IJ9A 1FKJA 1ODZA 2OMAA 4EPEC 3IUDA 3UG4A 5HDRA 1JCNA 5F4XA 4LV4A 2TSYA 3M0ZA 2IKIA 1NF0A 4AC1X 3A6OA 3MI6A 4JFIA 4C91A 2E5BA 1XIHA 4JICA 4GRSA 3ZR5A 2X7VA 4IXHA 1KR1A 3UQAA 2V68A 4GGBA 1XPGA 4AX6A 2NQZA 3A3HA 2GSJA 3SCWA 1FFRA 3A64A 3FJ6A 1XWYA 4GQQA 3VILA 3RFWA 2VC5A 4PEEA 4TW8A 2ZRWA 1W1TA 3M6DA 4Q4RA 3U5YA 5IHRA 1FUYA 3EDJA 4M24A 4NAFB 4Q4KA 3MZNA 3EMQA 3O07A 1UR2A 3KXQA 4G8TA 4Y7EA 3TR9A 3W7GA 2ESCA 2P53A 1HXJA 2Q71A 1EH9A 1V6XA 2DW7A 3SRHA 4LS2A 3GWQA 3ANYA 4NZ5A 3JYJA 3PZ9A 2CESA 1DP0A 3O5PA 2BBFA 4OOUA 3PAJA 4H6QA 4XD4A 4C6KA 3K2GA 1TV2A 1AMKA 1H49A 1DQUA 1CCWB 1S5VA 1HX0A 1Q6FA 2UY3A 3LGGA 3REQB 1X38A 3LA4A 2J78A 3AXKA 4GKLA 1Q6GA 3N6HA 2PWDA 4QEEA 2WNQA 3R12A 1GZJA 1XIIA 2MNTA 2X05A 1JG9A 4HN8A 3N12A 3P81A 2HVOA 3F4NA 5FESA 4FK9A 3F5JA 2GGIA 5E09A 4ZEPA 1NOWA 3UA4A 5HJLA 5D9PA 4KCTA 4IMFA 1FKDA 2MLZA 2ZQUA 3RLHA 3EWDA 3WLKX 4C02B 4UOQA 1EP1A 3SBFA 1FH8A 3CHDA 1BSLA 5HQEA 4D6GA 4J2PA 1A5LC 5F4WA 1KRCC 3ZWTA 3WL0A 1BEUA 3IV3A 4KESA 2XIOA 1B5TA 2AL2B 3ARWA 1IEVA 2CPUA 2ZUMA 4OBSA 4OZOA 2XP9A 2WVUA 1S39A 3UWZA 2OGJA 2ZKMX 1DJYA 2FFCA 4URIA 2OYLA 4DIPA 4HNCA 1F07A 3AS0A 3KS5A 5DO8A 3G1YA 4QZVB 4ZL1A 1V8EA 4XZBA 5BMWA 1W9DM 3WDQA 4CCZA 5EYWA 1V51A 1ZP3A 3AIEA 1CGXA 3O5FA 4O10A 1VLIA 2QKFA 3PZTA 3D3FA 5A6BD 2XGIA 3FJLA 3G8RA 3F2BA 5G4EA 3UU0A 2ZRUA 5CZ0A 3AICA 2JIWA 2P76A 1DIKA 4WDWA 3HOJA 3MT1A 1NFPA 4ODPA 4QJ4B 1JFHA 1A0DA 2BP1A 1CXHA 4ZPVR 4YTQA 1Q6HA 4DO7A 3EX1A 4JTDA 5DIVA 2RUQA 2E8ZA 4GH3A 4E8CA 2BOGX 2G50A 4PA8A 5C71A 4E6MA 3VABA 3CLMA 1FH7A 1AH0A 1ZALA 1FXQA 5CSYA 3ZSTA 4NILA 3B97A 5CJMA 3AIVA 4Z0JA 3MUAA 4IGNA 2YXXA 1XLAA 3B8UA 5LSMA 1K8XA 4A21A 1U5JA 1B3XA 3GC5A 3SO7A 3MWCA 4KW2A 5CLTA 1OIMA 3S1WA 3VVGA 1XG4A 4L9ZA 4NNBA 1EZWA 5KMYA 3GZAA 4C1NA 3CV7A 5A6BA 4UOJA 4NYUA 3APYA 2RDWA 4IIDA 2VX7A 5F1VA 3QR0A 4XZLX 1MVYA 2PLMA 4ZSTA 4C6OA 4NAEA 2Y5JA 1AH4A 3B3DA 3OLDA 4G5DA 1TWSA 2REQA 3G1VA 5FEXA 4ZBCA 1E1CA 3KUMA 3VOCA 4DZ2A 4L61A 5KITA 3O05A 4Y9OA 4ZO7A 2Z25A 3KTSA 3SRFA 2RSEA 3DESA 1PS9A 4UCFA 3S83A 2JK2A 3GXMA 4LX4A 4L6HA 4ZQCA 3H4WA 3T40A 4ORMA 4D8ZA 2E25A 2QJMA 1L6GA 1DORA 1UD3A 2J4GA 4LAVA 1KGWA 3B03A 5XINA 4N9DA 3V5OA 4QLKA 3CH0A 2D2JA 3N4EA 4I8YA 2XIIA 4QDWA 4W7VA 1OC5A 2XIJA 4F0LA 4QG8A 1E0TA 4AQLA 1AJZA 3NIYA 4CQAA 4AD4A 4YXGA 3M7WA 1ZJBA 1M7XA 4JTJA 3SCOA 3E2QA 5G1MA 3BMVA 5DXYA 2P1FA 3FXYA 2GYIA 4JQ4A 4IF2A 1UD2A 3GH5A 5IBXC 5MKGA 5SWUA 3W1RA 3T08A 1DV7A 2XSAA 3VAVA 2ZZ4A 3VNIA 4V33A 4YLWA 1S5MA 2CZVA 3OVPA 1XIMA 4U10A 1HN1A 4GOAA 1LQ0A 2YYUA 1B0IA 3MUZ1 5G1YA 3SW6A 4ERGA 3AZSA 4HK7A 3WQPA 1B57A 2JGYA 1CWYA 5HNUA 1Q13A 5DXXA 2G4JA 4HHMA 3LPFA 4IT4A 3USBA 5G5IA 4GKTA 2G97A 1GQLA 1F3EA 4LS0A 1XLHA 2IXUA 1MW2A 4JTIA 3ONBA 3UQIA 1QK2A 2YCKX 2XH2A 2X2YA 5FF0A 3W7KA 4IZGA 4K3ZA 3KVMA 2H9AB 4ICMA 3NVDA 3W2MA 4U2YA 1NFGA 1ZPTA 3N04A 3BARA 1S2WA 3OU8A 1L9WA 3KZPA 2O92A 4LWWA 5CSUA 1JVNA 1DXEA 3KZSA 4E3TA 3WO8A 5BRPA 1HNYA 3C2YA 1LLOA 4RW3A 1REQB 2NXGA 3L4ZA 1RZMA 2HXTA 5HMFA 2FB3A 3BVJA 1MMFA 4X3ZA 1EJUC 3S42A 2YBUA 1D9EA 4FXFA 3CXOA 5M1TA 1K7EA 3NL5A 3IIPA 1UKPA 5FJRA 1J93A 4N6EA 1H7OA 1YDVA 4GD0A 1F5ZA 4GYPC 3UP8A 4HTYA 2PF0A 2X1IA 1RP8A 5AY7A 3VE7A 1QPLA 1RR2A 3VZYA 4GIYA 1ICPA 3N2XA 3EB3A 3FS2A 2W3ZA 4DXXA 4H9ZA 4HBEA 1OFPA 4JY8A 3BLOA 3WBWA 4CVUA 1EGMA 3LBMA 2GUUA 1KNWA 4JHOA 4AXNA 4X9YA 3PJTA 2G3NA 3RYSA 1IHIA 3STEA 4UQAA 4HK6A 1YDYA 1BXCA 3GB6A 4MB4A 1KR0A 1XLFA 3RPTA 3VFLA 1TCMA 4EPDC 5CGTA 2D3LA 3DYMA 2PDWA 4UC5A 2CLMA 4BF9A 4MADA 2QPSA 4H8UA 2WZEA 1A0CA 4R88A 3BCFA 1UKSA 2KO7A 1E43A 4F4RA 2HDJA 2Q3RA 3MSGA 4TVUA 2EPOA 3LB0A 1U5HA 3MKKA 3TCEA 1R6WA 1GCYA 4WJ8A 4PSRA 4CNNA 4U5KA 1JI1A 3NM1A 4QGCA 3KVKA 5BOOA 2N87A 1OQFA 5BRQA 3RRAA 3CUHA 3HPZA 2PBOA 2YCJA 4X60A 4FZIA 3KBVA 2DY3A 3UZXA 2MNRA 3W9ZA 3N3MA 1AUSL 5CGQA 2E5DA 2QMJA 2VEFA 4QNWA 1RALA 3PBGA 5CAKA 1ZZMA 1W26A 4F0KA 4RKAA 3MI2A 4GE8A 4Y8EA 4IT6A 4OHQA 1NH6A 4FS9A 1O12A 1PYFA 5FEWA 3KHDA 2WW5A 3EMZA 1XL9A 2XVKA 4HBOA 1I8JA 4UFKA 2R14A 1TMLA 3OHMB 4FXSA 2Q8XA 4HYVA 4C6FA 2QXWA 3BQ6A 1W0MA 3EOSA 4LUYA 5DN1A 2PPPA 1TA3A 1U79A 1M65A 2ACUA 4KWUA 4XSMA 3VIFA 2NUXA 3VYLA 1C93A 2CXGA 4JQAA 4JQ3A 3RM4A 5BWAA 3DFPA 2ZZ3A 3S2LA 3MJMA 3V4BA 1QTWA 4LOCA 3VIJA 1O5XA 3QH2A 4PL1A 3QOMA 3S9ZA 2YIHA 2GJPA 1PKYA 3NA8A 3G6LA 1VFLA 3WENA 4NP7A 1F6YA 2POTA 1I60A 3NZPA 4A8RA 5J5RA 5HWBA 1TSIA 1R47A 3BOLA 2WJDA 2AOSA 2YR1A 3VDAA 3KADA 4LYPA 2H6RA 2BVYA 1DKWA 1FKXA 4YWIA 4RE3A 3UGVA 3V1HA 4H7CA 3CYVA 2QHAA 1TPFA 1HP4A 2V0TA 2PPGA 3ISIX 1OT2A 3LHUA 1JDAA 5C70A 3DFQA 1JZ6A 1FKFA 5HAOA 3WEOA 1H1NA 1JD7A 3CBWA 3I6TA 3ZJ7A 2BVTA 2XVPA 1P0EA 2V3DA 2H8ZA 1K9EA 1TV8A 1FKSA 1J79A 3WLLA 3PUOA 4B91A 3GNOA 3T0DA 3AYVA 1C3FA 3UBPC 3SRDA 2JIEA 2OOFA 5FJJA 4HPHA 3VGDA 3NCOA 3FOKA 2Z1KA 1FHUA 3M64A 3QV8A 2YL5A 1FOBA 4LVFA 3W7RA 3BG9A 5LIKX 2WWCA 3W37A 1Q66A 1QNRA 4V1XA 3B4YA 2EKGA 5JBFA 4GZEA 1BVZA 3RU8X 1QDSA 5AB3A 3N4FA 2W6RA 1QBAA 5DMMA 2VTFA 2ZCGA 3L23A 1FCBA 2Z0IA 2PZNA 4KH2A 4W93A 4CD7A 1IWPA 3WDPP 3RGCA 4EXBA 1CLKA 3IGHX 3EIPA 4PMNA 3SCSA 2VXNA 3BAYA 3CNYA 1Q6UA 2FHFA 1OB0A 1K7FA 3UNDA 4AZCA 2PA6A 1BWLA 4JFUA 3L2MA 4L5ZA 1PDZA 1TV4A 4YVVA 3KACA 1UPPA 4S3AA 3RFAA 1SVDA 1JCMP 4S2CA 1TQJA 1Q7MA 4ZOEA 2DUAA 3N2CA 4HIBA 4WVXA 3TW6A 3HG2A 3FEQA 3UXDA 4MZYA 4M19A 2YSWA 4OJYA 1RBLA 3UVIA 4G2PA 3O8AA 1W3JA 1E40A 1UW9A 1ECEA 3R13A 1V3LA 4HK5A 1IZCA 2RH9A 1TIMA 2Y7FA 3MPGA 1LT8A 2KAUC 1KGXA 1FWCC 1X39A 3MMUA 3T0TA 1SR0A 4L1XA 5A5WA 1ZJIA 5I3IA 4HPXA 3CGNA 2I7GA 4Z1DA 1HJWA 4H7ZA 4ZFCA 4CD4A 2V2CA 2VRJA 1O5KA 5E1QA 3H2CA 3M1ZA 3PZIA 3WJZA 3GH7A 2RDXA 3LENA 4FP1A 1ZCNA 1PKNA 1QPQA 2HRWA 3KTCA 1B3VA 3LCHA 1CX9A 3ABXA 1K3UA 1QJWA 3KBJA 1E3ZA 8A3HA 5DITA 4A3UA 3SUSA 1W1PA 4D6FA 3T05A 3TEVA 1ZCOA 1LCOA 3LHVA 1SO4A 1UWUA 1Y65A 5BXSA 5FSDC 3S2CA 3O5RA 4AY1A 3TOYA 3TYUA 3EZ4A 1VEMA 1DJQA 5DBTA 4ROPA 1RQEA 3WYZA 3C0LA 3MUXA 3JS3A 3DX5A 3P84A 4IPNB 3KBNA 3COTA 3CU2A 4US6A 1DTUA 4O2TA 1JPKA 1QHZA 5GNZA 2BV9A 3MDWA 1J18A 1FWHC 1UZDA 4NNAA 3P7YA 2Q09A 3I68A 4PUKA 5CSSA 5A8OA 5HWMA 4YL2A 1T6MA 4BY3A 3TVAA 5A3HA 4LCQA 4LAYA 1NOFA 1UYQA 2A3LA 2NXHA 3GXFA 1ISYA 3S5YA 3K4WA 3ORWA 3W7HA 2GJRA 4XBSA 3GU9A 3MU7A 1KWKA 1JEZA 4FOKA 3NDOA 3UYCA 1CXFA 4KIRA 4D6IA 1M6JA 4AB4A 3R4IA 4JQ2A 4J3ZA 4BA0A 2XP6A 3PZVA 3PBUA 2CLIA 3W86A 2Y63A 3OVGA 4O12A 3DFNA 1VBUA 5BYWA 4WXZA 3WLIA 3LM3A 3FCPA 3DXIA 1WBHA 1A5NC 1QO5A 3AROA 1A5BA 1HJVA 1WZKA 3PZUA 3T4CA 3TP4A 3UR8A 2VDHA 3RN6A 2G3IA 1CIUA 4UQBA 3PPGA 2LJ4A 1M03A 1R3QA 3S5SA 4WCJA 3GTYX 1MDRA 3OPSA 4KWVA 4C65A 3WLSA 1KCXA 1J4EA 2QF7A 1W32A 2XYLA 2V3EA 2DU2A 1GOKA 2OT0A 2HQAA 3TK7A 3KDOA 3AHTA 5DFAA 3CK5A 4MM1A 2ZYFA 5FA5A 1KGUA 4XBKA 3W70A 5AYZA 3PR2A 1TUFA 5ABEA 4IWWA 1BKFA 2ZR5A 3P2VA 1QMLA 2REQB 3F5KA 1V3JA 2VQTA 4DIAA 4O16A 5M03A 1UOKA 3OVRA 2WHKA 2X1SA 1EYEA 4QIUA 3VKCA 1R7AA 4QJ5B 3FSUA 3GW3A 1TPEA 1KO0A 3KAHA 3PTDA 2JBMA 1F6PA 3N14A 4DY1A 3WLOA 5KZMA 2PDCA 5LNRA 1NAL1 3LX9A 2GL5A 3RR4A 2CLLA 3MQTA 3LBOA 1CBGA 5HMSA 1SZFA 4HP5A 1MW0A 4NI8A 3IIVA 3RG6A 4DJFC 3OYXA 5I02A 2WSQA 3T2OA 4JFKA 1DBTA 3M41A 4UFLA 1TRIA 3C2OA 3GNNA 4GWEA 1E55A 2VM8A 2D24A 1XH0A 2QCGA 1EF3A 4WQ6A 3I3BA 2G95A 5JH1A 4MDPA 2OO6A 2W0UA 3TIMA 2ZQTA 4YHGA 4HU4A 4QT2A 4H6RA 4NQ1A 4DVOA 4KFPA 1YDOA 4XIAA 2X7WA 2PV3A 2HSAA 1RV8A 2EHHA 4UMBA 1H50A 4JD4A 1ZJAA 2WNWA 3WUFA 3URNA 2DSKA 3GG8A 4J4NA 4FALA 1M3UA 1DHPA 3SFWA 1FDJA 2FVLA 3MP5A 3VIPA 4MJ4A 3E2RA 1ZBKA 1PTAA 3TYAA 5BZAA 1TJ0A 3PFMA 3OIXA 3AXHA 1XIEA 4IQCA 1AFSA 1KT0A 4QFUA 1XG3A 3EEZA 1RCXB 5HW8A 3OOBA 1VRDA 2OSWA 2EULA 3E0IA 1T8XA 5A8NA 1Y8BA 2ZQSA 3S5ZA 1EA0A 3VKJA 3JZUA 1TJ1A 4W9OA 2QR6A 5EA9A 3JU2A 3G0SA 3B0XA 3RAOA 4QIBA 3FHAA 3BV7A 2QV4A 2I5GA 2PDPA 2O55A 3AWNA 5DBUA 2HV5A 4BI6A 4PBGA 1TIWA 4HYWA 1FKTA 3PZNA 3N18A 2OO0A 3EMCA 1D2KA 2VZTA 3AYRA 3EKLA 3DHPA 5H2ZA 1PTDA 3GXDA 3PZOA 4DRIA 4FNSA 4WZHA 1ADSA 1D6OA 2QUUA 1KTNA 4Z1AA 3AYTA 1IWAA 1BXNA 1FCQA 1GPFA 2WPGA 1XBXA 4IFRA 4KQNA 3SGGA 1JYNA 2AKMA 1PINA 1XDMA 4X9SA 1ZP4A 3SQLA 4PRWA 1XS2A 4IP7A 2ZX5A 1J5SA 3A4JA 1OABA 3E2VA 4FOUA 2P3EA 3M5YA 4GI4A 4LTSA 3MO7A 1SFLA 1JPIA 1W9PA 1GOWA 3ZLHA 4I8DA 4C6IA 4A35A 2BX7A 2HNEA 3DFTA 3OO2A 4B5SA 4FAMA 3AC0A 3OYZA 1ZGDA 1WDRA 1Q8AA 3BURA 3CT2A 2PLCA 1Q6OA 3B9NA 4CCCA 1G01A 2OB3A 5F2MA 4IIHA 2W66A 4DJDA 2DSUA 1IZKA 1VIZA 3GE7A 1F76A 3NQAA 4PCTA 2WSKA 1WUEA 2WZTA 1FX6A 3VIKA 3WLJA 4O50A 1EQCA 5HW7A 3QYQA 3TTYA 1V5XA 4GUJA 1G4PA 3W2JA 3ARSA 1BVWA 3D6NA 3MB9A 4GQRA 2VVSA 3SGUA 1O7AA 2XFRA 5JMUA 3CAQA 3PPHA 4QTGA 1TZZA 3ZM8A 4EVZA 4RZ5A 4Q4OA 4D6EA 4KBXA 3L2IA 4LCSA 3G1FA 2NVAA 1E6NA 1U83A 2FZ9A 2R24A 4E38A 5B7YA 3WUBA 3IK2A 4J3VA 1ISVA 1HJSA 2DUXA 3RRXA 4MJMA 3QV9A 3NOYA 3S2NA 1TWWA 5AHFA 4EXQA 4BQ2A 3UR2A 1ESWA 1V02E 1GT8A 5M3WA 1VF8A 4LXFA 1LT7A 5HJYA 3K8MA 1US2A 5I23A 1P5QA 2K8IA 3CC1A 4LBUA 1XQKA 2PC4A 2QEZA 3TR2A 3FN9A 2Z2AA 3EX2A 3GXIA 2DT3A 3QR1A 4LPCA 3WUEA 5AVHA 1CGUA 4PFHA 2XVLA 2A3BA 5C9RA 2XPKA 5LA1A 8XIMA 1MFUA 1PX3A 4HBKA 3TN3A 3W84A 4AD1A 1OFOA 4DWDA 2Q6ZA 5EGRA 4ZOAA 3MC5A 2Y24A 3H23A 1VFHA 5AFDA 1ADDA 3LSCA 1A50A 1TWZA 4N7QA 4ZTYA 1Y7VA 3QLLA 4W9PA 3BXWA 2DPEA 3EPOA 3MMWA 3UA3A 3RX3A 4WSHA 1XBZA 4JX6A 1LOLA 2CCRA 1MNZA 2WZHA 1JDDA 2PP3A 4Q8VA 4DBUA 4OOZA 1TPWA 3N13A 3U6WA 4V1YA 3UWVA 2I9EA 5AYBA 1R38A 3CV2A 4O17A 3GLCA 3WNMA 2NQJA 3S8HA 3HFYA 1DJGA 3KRUA 3NPWA 2RQSA 1MRQA 1UJPA 3O5LA 1TPC1 3TNBA 4UOZA 1IIGA 1WDSA 4D8AA 2NV2A 4FHAA 3DBPA 5TD4A 1R3SA 2I5QA 4PTMA 3BAIA 3KAOA 2ON3A 3CB8A 1XRVA 4HNUA 3DCPA 4PBFA 4LBRA 2OSYA 2GQ8A 3VDBA 1JYWA 5LNVA 1AL8A 3LPGA 3FFSA 3MDUA 1XH1A 1BG9A 3IIOA 1GEQA 1CYGA 1B31A 1EF2A 3K1GA 4I9JA 4NRRA 1DIEA 1JCYA 1GZ1A 1MUWA 3ITGA 3K4AA 1ME8A 1VCFA 3R79A 3S1VA 4QDPA 2WSPA 4XUGA 1YMYA 2E9BA 4RDZA 1WV2A 3GIYA 1UWRA 5HTGA 4CVWA 4GH1A 4O8RA 5KTLA 3WQ4A 2R1MA 5D9NA 3CJPA 4UMAA 3G1RA 1Z42A 2Z6JA 3T81A 3IUIA 1AG1O 4Q8NA 1LQAA 2DT2A 1Q7ZA 4ORIA 5FF4A 4F0MA 4FLQA 3MHUA 3SM0A 2QVNA 1DHKA 1XSIA 4TX9A 5LIXX 2D9FA 9RUBA 4NHVA 3PTQA 2IPGA 3QEZA 4K1WA 1HJUA 2E09A 4LT9A 2OYKA 1GOMA 1UP2A 3MMDA 3O1NA 1P6BA 3W7DA 4C1KA 5CBBA 1H5VA 1TR9A 3AISA 4HOXA 3GDMA 3A5FA 4NAFA 3WNNA 1P6CA 3SUWA 1VFOA 2ZZ2A 1FDYA 1AQHA 2PWUA 3VNKA 2WC3A 3EPNA 2EXOA 4W9QA 2AL2A 4GI9A 4BI7A 3BTNA 1AW1A 1JR1A 4NX0A 4BCEA 4TO8A 2OJPA 4S38A 3MSDA 4ILSA 4O54A 3CHFA 3W7JA 1WQ5A 4M7SA 1XYLA 4CNTA 2ZUVA 1VS1A 2DT0A 3EWYA 1J6YA 3L4YA 3KVLA 1KFWA 2EPMX 4DJFD 3ZT7A 1Z7AA 2JE8A 4UQEA 4GLEA 3W73A 3HZ3A 4CNSA 1EZ2A 3T0AA 3O5DA 1H7WA 3LCFA 3MCNA 5CSRA 1GNXA 1UMYA 4S3DA 3NNTA 5FF7A 3XINA 4C6QA 3ARTA 1XLEA 1HUVA 1FHLA 1OCQA 2VELA 1OGBA 4R34A 3CQHA 2VZUA 4IIEA 2QJHA 3CASA 3VGHA 3TCZA 2YFOA 1VAHA 1W3HA 4F0RA 1N8IA 3CQKA 1RBAA 1R85A 3HV9A 2EPLX 3CGMA 2VCDA 2UBPC 1E9YB 3CL6A 3GPKA 3HBLA 3N9RA 4X2PA 4Q8OA 2OLSA 1US0A 2X42A 4PSPA 3TJLA 1CDGA 3ZWSA 1XH2A 3LCXA 3WLQA 4ACZA 2RDTA 2ZRVA 1FTXA 4XUYA 1LF1A 1KXVA 3OW1A 1NOUA 3SSZA 3B0UX 4LEQA 4GNVA 5CPLA 1I0BA 3LK6A 4Q4PA 1H2JA 2PFHA 1HG3A 1J6OA 2OZTA 1YNPA 1EGVA 5D33A 4QQ3A 3VO0A 1HO1A 1JCTA 1P4CA 1ROTA 1SZGA 5XIAA 4X22A 4IGMA 3KCLA 2VEMA 4ZCWA 4ODKA 3REQA 3LCLA 1IEIA 4NUWA 2M08A 2PP0A 2IKHA 2XP5A 5A6MA 1N55A 1LJYA 4D8LA 2YXOA 1A4LA 4DJED 1TKKA 1CLXA 1OC6A 3C8FA 2PWHA 1CXIA 1ZS2A 3E74A 3LRKA 4AD3A 4PTDA 2JKEA 3TC3A 1EO5A 3VNDA 2CNCA 1BRLB 5EMKA 1JCJA 1QPOA 3A9IA 1TA3B 3TJXA 4U84A 5K4XA 4L72B 5GPGA 2D1ZA 1M7OA 2CU0A 4H19A 5CCZA 3NEHA 1RH9A 3IWPA 4CD6A 4E3VA 3UPWA 1YHTA 3PZGA 2F84A 2JQXA 4XV0A 1J6PA 4AHQA 4WSKA 4EK7A 3NQDA 2EGZA 3NR0A 5AHIA 3FDGA 4QX4A 1AL7A 1ZK6A 3TX9A 2POZA 3C2EA 4GQGA 3LTSA 4LEFA 4PTXA 3GQYA 3PB0A 3ONCA 2CC0A 1UD4A 2PC8A 2VEGA 1XI3A 4GC3A 4IJBA 2W67A 3GNRA 4JGDA 3UXKA 3BPWA 1TZ9A 2WHLA 3UQBA 1F8IA 4E8DA 4JIRA 2VGBA 4HHPA 3RXZA 4MSPA 3KBSA 2Y8KA 4I7VA 4WK9A 4JIEA 4FX6M 2XH4A 5DIUA 4UTWA 3VUSA 3BSHA 3R11A 1F3TA 3RLUA 3O0KA 5FEPA 3WBAA 2W79A 3VNJA 1LRQA 3OEXA 4IPXA 3RITA 3OQ8A 3LQGA 4O28A 4PTVA 2W27A 2V3GA 2QPUA 3WQ5A 1VLWA 1F2JA 1YADA 2ZBTA 3KCJA 3E9AA 2FJUB 3VGFA 3BOFA 2WLYA 1SJAA 1YTDA 2PDNA 3W6MA 4HSOA 1CNVA 3LCGA 2IUZA 1NMVA 2WZMA 2ZUWA 3TYEA 1HFBA 3A4WA 1E15A 3GHUA 3H2AA 2VJXA 1XGZA 1Q6RA 3LCWA 4HJFA 3W1UA 4EP8C 3AQUA 2V2DA 2E7FA 2GDVA 1P0BA 3FVDA 2GGJA 4PEKA 5AN7A 1WXJA 3LPPA 1X96A 4NZ1A 4XX6A 2Z1BA 4U28A 4DN1A 3L4WA 1FBAA 2FQIA 3WJXA 4EAYA 4K8EA 5FAGA 2NX9A 2Z1SA 1XC4A 1OX5A 1D3CA 4BKNA 1VIWA 4AZCB 1PSCA 1SSDA 1ZQ5A 1E51A 1ZTVA 1OF6A 4A2RA 4BF5A 4XZMX 4H6KA 2RJGA 3PUEA 1Q6LA 3WMLA 4AG0A 1KV8A 3B8WA 4Y9AA 1ZU8A 4OECA 3WSUA 2C1GA 1JUEA 3R2GA 1G4EA 3AMLA 1G1YA 3IGSA 1K8CA 4CQ8A 3THCA 3QQ1A 3KTXA 1M04A 2DZAA 2PDHA 5C54A 1WB0A 3DFHA 3NQ7A 4GX9A 3SQSA 3WNOA 1E4MM 2DP3A 3CEPA 3PPFA 1JCXA 2J6XA 4ATWA 2Y62A 1K4GA 4DWSA 2WM1A 1VC4A 1TB3A 5E0CA 4HCLA 4DX3A 4ZO9A 2ATSA 2Y4SA 1LOSA 4IJCA 3F1QA 1WCGA 1QU4A 1X7FA 5REQA 4DM1A 1XDLA 1H7XA 2FIQA 3CO4A 3SUVA 4DO5A 7TIMA 3UEQA 1DWGM 1IXQA 2J7FA 3M6YA 5C7VA 3NDYA 4BQ4A 4ZXOA 1H61A 3CUFA 2HK1A 4L3NA 5DF0A 1IXOA 3VKKA 3S9YA 2QNEA 1S5WA 4AX7A 1LL4A 3JXVA 4H9YA 1JGIA 4BJHA 3STPA 1VJZA 2SFPA 3ZT6A 1QHPA 1A5OC 3V36A 3S2MA 1TQXA 3ATZA 2ZZ7A 4IT1A 4O57A 3EB4A 3GC2A 3S46A 4LY4A 4PGLA 5B8IC 1P48A 1YE6A 4QG9A 3KOYA 1H0IA 4DRSA 5A2BA 1HL8A 3R1ZA 5J8LA 1C29A 1RK5A 1IYXA 2Y61A 3CB3A 3FY1A 2A7NA 4MY1A 1MEHA 3I3EA 3A4XA 4A05A 4JNMA 3LNPA 1W3KA 5E70A 4MB5A 1HT6A 3DDMA 3DG3A 1Q2SA 1OD8A 3PSVA 3ARXA 3TW9A 1X1ZA 1F05A 1WDWA 4MY8A 2FVKA 2C7FA 2BDQA 1P43A 4A2SA 4LAOA 1TV5A 3SJ3A 3EDKA 3PNZA 3DG7A 5I0DA 2ADAA 2IXVA 4O4VA 3W23A 3P8IA 3ABZA 3WN6A 2PV1A 4MVAA 2QCDB 3Q58A 3TTQA 4XAKA 3N19B 1DWFM 4MAZA 1LWHA 1JUKA 1L1PA 3I10A 4ERAA 6CGTA 3VNYA 4RZBA 1Z48A 3QVQA 5D8ZA 2G3JA 1POKA 3VC5A 3VD3A 1B9BA 1NDVA 4K2SA 1AJ2A 2HXUA 1Y0EA 1ONWA 1AW2A 4UQCA 4LAWA 4LVGA 1NY1A 1O94A 2FHBA 2QAPA 3NVTA 2V5LA 2J7EA 3NQ2A 1WAWA 1EHNA 4BWLA 4GMEA 2J24A 1HO4A 5FD0A 1YIXA 1V08A 1VBHA 5DY2A 1X7IA 3M5VA 1AJ0A 3IPWA 4RE2A 2X16A 2BLEA 1FA2A 4H8VA 4CEUC 3ITYA 3MCMA 4PBEA 4PB3A 3HM7A 2PZ0A 3G3DA 3MUIA 1Q6DA 3CYJA 4GIRA 5LGZA 3IKDA 3RX2A 1J0HA 4D6DA 4AYGA 5GJNA 3P6LA 2HE8A 4MFDA 3C2FA 3HGRA 1LOQA 1SMAA 5FI8A 3WF4A 2F2KA 4K68A 5MHBA 1U22A 3L4XA 3F4WA 5IDIA 3WF2A 2FH8A 2CBVA 1UWAA 2LGOA 1A5UA 3HGSA 5CPOA 3CHVA 5BW6A 1S38A 3KL3A 1FKGA 1SYTA 4W4QA 1QW8A 1FWBC 4DJEA 3UETA 5G2HA 1YLVA 3Q65A 1XCFA 1XRSA 1VGAA 1TPUA 1RA0A 2XP7A 2QCEA 1MFVA 2Z2UA 1FFQA 1KM1A 1UD8A 1C8VA 1LDCA 1OX6A 1XR2A 3U4AA 3LDVA 1Q4NX 3NJ3A 1QFEA 2FJKA 4CD8A 3EA3A 3G1DA 4AY8A 4UTMA 4PYSA 2BHUA 3W0KA 4ZQOA 5LIYX 4IL0A 4C60A 3PG8A 1LORA 4L4OA 4PCSA 4P8WA 5M5DA 1POJA 2WHMA 3KOXA 3GTXA 3VI2A 4W9TA 1L6WA 1A3HA 3BGGA 2FYMA 4W8BA 2PE4A 4XTDA 3CIVA 2X1TA 1DIOA 3NSXA 2Y0FA 3WH8A 1KD0A 2P3ZA 2J7HA 2CBIA 2A5HA 1NFBA 3QOKA 3P14A 1CI1A 3QN3A 3W76A 4Q8QA 1EOKA 4H9XA 2CKSA 2RDUA 2O4QA 3H26A 3IJ6A 4PMRA 2XGZA 2QUNA 4PFMA 2Q01A 2DIJA 5CKSA 2BTMA 3KLKA 4P2VA 1V0LA 2D0FA 4W87A 3UXLA 5F2GA 4JPGA 4O0QA 1X6NA 3DHDA 1CECA 1JCLA 4HJWA 1O1ZA 4MGGA 1H09A 4A6GA 2Y7EA 4DRHA 3NUKA 5CZSA 4GQBA 3KRZA 1W5MA 2CLPA 2ISFA 4HPJA 5GJPA 3PBYA 2W91A 4PC8A 1AH3A 2F6XA 3VK5A 1B3ZA 3VOGA 4JKLA 1TV7A 2WCAA 3ARUA 4JKKA 3ANVA 2C79A 4V2XA 5J04A 4H9VA 4XAZA 3O6CA 4FXRA 4HNLA 2FGLA 3SDOA 4QT3A 3BC9A 1LQ2A 3CUXA 1JXJA 1IGSA 1OG0A 4JIQA 4MUPA 9XIMA 5G4WA 5D02A 3G1HA 2XHYA 2Y5SA 1GWJA 2YXGA 4LBSA 3O5MA 3OHIA 1FWNA 1Z89A 2VFHA 3RGTA 4GPNA 3GU2A 2WSYA 4G1KA 1HGYA 3C5QA 4FF7A 2HJPA 3DIPA 4DROA 3TWAA 4E2VA 2C19A 1XRFA 2ZFAA 3IJIA 4WJEA 1OVDA 4AF0A 5F2IA 1LUCA 3MVIA 3GK0A 3VXGA 2C3ZA 5TNVA 1GUVA 4ZVJA 2H90A 4MKSA 3GYEA 1FH9A 3P5YA 3GUGA 2ZDRA 4GNJA 4DB7A 2PTXA 3TV8A 4H8HA 2UZ5A 4J28A 4XD5A 3LZ5A 3M5XA 5EKYA 7CGTA 2VZOA 1CGWA 5GQBA 1IR2A 2ONEA 4BZYA 3GIPA 3VTRA 3QW4B 4LJ3A 3NQCA 3OIHA 4NASA 1WYIA 1QRQA 3LD5A 1L8PA 3URBA 1K03A 2OQHA 4P7NA 1E6XM 3IJLA 4V15A 2FFIA 4UBPC 4KGLA 3PWAA 1TJRA 4GUHA 4BF8A 2H9AA 3AIRA 1EX1A 1QW9A 3TDBA 4H9UA 1KFEA 2OXNA 4EPBC 1H7RA 2QQ6A 3MP3A 4AVOA 4MIMA 4IQJA 3DI1A 4GGHA 1RSCA 3AUOA 4QEHA 3GTFA 1A7XA 4M82A 4MWAB 1GQJA 4PUNA 4QAWA 1O68A 4L9YA 4DYKA 3NO3A 4A3RA 3QGVA 2CLKA 1A5MC 3QYSA 9CGTA 3SUUA 1PZ2A 2J7DA 3ZSSA 2PD5A 1ADOA 4C6NA 4F8XA 3WD0A 1VJIA 5T9CE 4BEUA 3M43A 2ISDA 3WD4A 4PMQA 3BMWA 3UJFA 4ODRA 1KCKA 1F40A 3A22A 3S2JA 5AYYA 2FLIA 5LXEA 2FDMA 4GC4A 3WLTA 4GI8A 4PR4A 4HSNA 1HIZA 3MDYB 1UJQA 1GVSA 4UR8A 5A8MA 4NXKA 1MEWA 4KEVA 2X1RA 3W07A 3CPUA 1MZRA 5L9FA 4AMAA 5C55A 1DXIA 1RY0A 2ZUUA 5HXMA 4N4QA 1OGSA 1GJWA 2YFNA 3XISA 5LA0A 1MXDA 3SCVA 1YKWA 2D73A 1YPXA 4XSLA 2AL1A 4HA4A 4PMDA 3TH6A 3CPGA 4UTWC 3T78A 3KCEA 4ZB5A 4RE4A 3P80A 3NO1A 4QS6A 3TTOA 1I2PA 2FTWA 1PZ0A 2E77A 2HS8A 4AIEA 1C9HA 1FWDC 3FNDA 3L0GA 1D7FA 4GGQA 2D23A 2J7CA 3IACA 3ARZA 4IMGA 2WVTA 3VA8A 3QQWA 1Q8JA 1QNQA 5I24A 3HO8A 3LRMA 4IQ2A 1RVGA 3KCOA 4E5TA 5I3GA 1IEQA 4ICNA 5CPSA 3T1GA 2E40A 3L4UA 1R7OA 3UI4A 3O6AA 2QCNA 2GJLA 2GQAA 3EDEA 4FX7A 4E4FA 1XYCA 4WDXA 3GBEA 4AZ5A 2DJXA 3GKFA 1J0YA 4GXWA 1R5YA 3EGJA 3QR3A 4HMNA 1KXQA 1VPXA 1I9CB 3TFCA 1G9HA 4Y2WA 1FWAC 4NKCA 3NI6A 1VP5A 1ZNNA 5ECUA 1WDDA 4PMXA 1WKEA 1EUAA 5I78A 1XLLA 3RK8A 3RILA 1E1CB 1E73M 3W22A 4CD5A 2W92A 3E6EA 3QTPA 3H2FA 7PTDA 1LBLA 1GQNA 2X0SA 3P0WA 1B6CA 5CLWA 1FHDA 2UWFA 4QJ3B 1JDEA 2O56A 3GR8A 2WQPA 1MUMA 4KEZA 1TO3A 2PDBA 3TU9A 1AD1A 2XIBA 1LWJA 4QE1A 4YJ5A 2NT1A 4NJIA 4B5NA 4TIMA 3A13A 4TW7A 6ALDA 2Z1VA 2B0MA 2DIEA 1PEZA 7ENLA 1KQYA 4EF8A 2DGAA 4PN2A 1KM4A 3H70A 2P0IA 1N7KA 1AW5A 4M6UA 2BXYA 1DIDA 1GGOA 1ALDA 2OZ3A 3PZMA 3RMJA 1IGWA 3QMRA 4HCHA 4OBTA 2KZHA 2WMIB 2ABBA 1BYDA 3EKGA 3I6EA 3VKBA 4C6BA 2QCDA 1AQMA 2DQWA 5D04C 3T2QA 5FL0A 3OLEA 1WOBA 3KZ7A 1A5KC 4MWAA 1VBJA 4JYDA 1VHCA 3Q94A 4JFTA 4YHEA 5DMLA 1UP3A 2DZSA 3TYBA 2XZ9A 3PZQA 5D2XA 2VQUA 1D3GA 3GR7A 2WANA 1EEPA 3TQPA 3NQVA 4EANA 3VIGA 5BMXA 3W26A 2ISWA 1IQ8A 1MQPA 4XZWA 4XD3A 1XIDA 3NDZA 3M46A 1CTNA 3N2TA 3NZGA 3THAA 2Q3OA 3WQDA 4NG3A 1B90A 3LLXA 4F9JA 2OT1A 5D37A 1FWRA 3LTYA 4O1DA 4DXVA 4LUIA 3H12A 4MNLA 3SN4A 4DPQA 2E68A 2Z1XA 3W1NA 1DVJA 3LSBA 4JTCA 1ONEA 4MYAA 2CYGA 5IBXA 2P4VA 1DTNA 3LUTA 1WKDA 4H7VA 4RNIA 1W5OA 1ISZA 2KX9A 1B1YA 1XPYA 5LYRA 5ABGA 3HGJA 4PUWA 3H55A 4LY8A 4UTUA 3OG3A 3MBFA 4JKMA 4M1RA 1E71M 3HG5A 3FA4A 3G0UA 3CL7A 3QC3A 4AHPA 4G7EB 3RU6A 4IPJA 3BSMA 3R0UA 2P5NA 4DF2A 1SZNA 4DF0A 1N2VA 2NWRA 2WAGA 2GSHA 2Y78A 3Q45A 3PB2A 1QCWA 3D3AA 2O4MA 3CZGA 3GHRA 3D0CA 4INFA 4HHLA 3FGCA 2J9ZA 3FX4A 1V3KA 1UQZA 1A5SA 4JYEA 1IXNA 1PXGA 3PAOA 5XIMA 1FKHA 1NU5A 2BWGA 3BZJA 2HS6A 3WJYA 4XAFA 2V63A 4S3BA 3GG7A 2VEIA 2DSVA 2ODOA 4AYSA 3EOUA 4NT0A 3DFOA 1D8CA 3NFUA 2R91A 5A1AA 4DO6A 2F6UA 4YYFA 2V69A 4J27A 4UTIA 2VCBA 3LM7A 1V0KA 5CPTA 3W2UA 4M8UA 4AXKA 5HT1A 3FYPA 1LLWA 4M3PA 4Z0SA 3K8KA 2ZXAA 1TV3A 5B7ZA 3N2BA 2DORA 3VX1A 3TLQA 3UQNA 3V0UA 4Q6JA 4DHGA 1OBAA 4AVFA 4DWSB 3WEZA 3W29A 4QJ1A 4L6OA 4ZENA 4K8HA 1GVIA 2VD9A 4LB3A 4HZ7A 1TCOC 5GPRA 1OFQA 4WF7A 1XFBA 2VC9A 2VMFA 4LUTA 3AIBA 3IVTA 2TMDA 2ZOXA 3S5NA 3I4KA 5DT5A 4ODLA 4MGVA 1ISWA 3W6LA 1V6UA 2LPVA 3V5CA 3W72A 1O4UA 4OU1A 5CG0A 3AUJA 3KDNA 5E0KA 3A4AA 2ZA1A 4GHRA 1FHVA 1W17A 4F9DA 2OWCA 4Z1BA 3WFLA 1IT7A 3FHQA 5D2TA 1W3IA 5IDZA 1N8WA 3BUVA 3THDA 3B8TA 1NDZA 3YPIA 2ZX7A 4UFMA 5D03A 3BL3A 1E9ZB 3ABSA 1VCVA 3CQIA 3L9CA 4UMCA 1EJ7L 3ZR6A 2R8WA 1PZ3A 4J3WA 3U5UA 4UCGA 4PE8A 4S3CA 1RJQA 2VFIA 1W8SA 2XM1A 3GRIA 5HUAA 3W7CA 1YNYA 3H54A 2PWVA 4UWMA 3MSYA 4PCNA 3ZLGA 1F73A 3G18A 4LYQA 1Q6CA 4C6MA 2IKJA 1HKJA 1EDQA 3CUZA 2FH6A 4H3DA 3DI0A 5JH2A 3A24A 3CHEA 1I6NA 1KWGA 5IXEA 1TPH1 1JNDA 1Q45A 2YBTA 3WK3A 2E5CA 2PRLA 4IMAA 4GG9A 3EAUA 5B80A 2AMXA 3QKZA 3OBKA 2VX4A 2E67A 4DEFA 4WJXA 4DRPA 4S2BA 4ZFMA 1GVFA 2PPOA 2RUDA 5E6YA 2Y7GA 1XDJA 3T8LA 3HURA 4LUTB 5C2XA 4PTNA 3BMBA 3PBMA 4Q7IA 1B30A 3QHOA 1E0UA 4JQ1A 5AHMA 3WDIA 4O53A 2V6AA 4IX0A 1WP6A 4G7EA 2Z26A 3SURA 4IMCA 3T7VA 3NQBA 2NVDA 3WF0A 5E5CA 2A3CA 2C71A 3N2MA 4IP5A 2Z00A 1X97A 3M0XA 2Z2BA 4Q3MA 1GZGA 3AHXA 3DECA 3LV5A 1ML1A 1H1YA 1FWTA 1E6RA 5A6JA 3LRLA 1YEYA 2CBJA 4MOZA 2E0PA 4W7UA 2OQYA 4MDOA 4ZR8A 2J62A 1UPMB 1FDZA 3B40A 3U4FA 2I17A 4D2JA 2RUSA 4GIEA 3WQFA 1NQKA 5IHSA 2GFTA 4PULA 3TA6A 4GVFA 4C5YA 1HL2A 3GVWA 4I7WA 3FEMA 4LC6A 1TG7A 1SSGA 2VUNA 3V3WA 4DZIA 1BKHA 3SJNA 3UT0A 2JEPA 4CNPA 4TX6A 1WBJA 1CGYA 2GK1B 4MTVA 5FKYA 1KTBA 2CZ5A 3MUCA 2BFGA 3GHSA 5DT7A 2AWGA 3ZVIA 4GYFA 1BTCA 4HNOA 3VD9A 1GVOA 1FRBA 2YOCA 4UNKA 1DJIA 4KGJA 3FLUA 4LAXA 2XH0A 1XLKA 5TIMA 3OLIA 4XTIA 1JVWA 4FNQA 1FWWA 5DRIA 1L2QA 2DSWA 1XLCA 2WMKA 2OTDA 2YCLB 3DHFA 3QM3A 4RDVA 1PWMA 1J0IA 2QV5A 3PVFA 3ES8A 3V18A 2WWDA 1H0GA 4S3JA 3IS4A 3NTYA 5DCBA 3DYOA 2VZVA 1S1RA 3A47A 4M0XA 1HGWA 4HOZA 4A3HA 3GU0A 2BOFX 3VGGA 1JZ8A 2WPBA 1EP2A 5I3JA 1EC9A 2J77A 3QZ6A 3W1LA 3NG3A 4BS0A 2UY2A 5EBUA 2R1PA 4N9EA 3EBVA 2R1NA 2FHCA 3H2OA 3HV8A 3ZLFA 4FX8A 2XWDA 3PG9A 1QPKA 3GFZA 4PRTA 2PLKA 4FIRA 4TVCA 2WKJA 4H4IA 3W1QA 1LTDA 3IANA 3ZO9A 4GUIA 1E0XA 4QLLA 3VZZA 4AEFA 2VFGA 2V9DA 2J47A 3QY6A 2WCSA 1ISXA 4AFYA 1BYCA 1PL9A 3WQEA 1JAEA 3U3HA 5DMNA 1SJDA 3TSBA 2V3FA 1IR1A 1Q2RA 3G24A 4E2DA 2F2HA 2Z29A 3I3DA 1UD6A 3PTKA 1J2WA 3CV1A 3DEQA 4HTBA 4W85A 4ACYA 1OSEA 3OP2A 1S5TA 2J9XA 5TF0A 1NP0A 2NLYA 2PU0A 4UR9A 3O5IA 2J8TA 4XQ6A 2I9UA 1FD9A 1ZY9A 3NM3A 3QC0A 5D75A 4HGXA 3VZXA 2R6OA 5A2AA 5HNNA 3HN3A 1SPQA 1GEHA 4YPJA 1RJRA 4ML4A 4RV8A 4G9PA 4HU3A 2E1WA 3GNPA 3DERA 3KHJA 4JTTA 3RLGA 1O6IA 4GY1A 5A95A 1UROA 3P5ZA 4PMVA 3LS9A 2PTZA 2R1KA 3FW6A 3P8JA 1OEPA 3TNOA 3GDRA 2YZRA 1HKMA 1EP3A 3TC6A 3RCNA 4LF1A 3EKZA 1E1EA 1JDCA 2DSZA 3SN0A 4ZXLA 1M1BA 1V7YA 2IW0A 2NQ5A 1KRAC