1TFVA

Crystal structure of a buffalo signaling glycoprotein (spb-40) secreted during involution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mammary gland protein 40
publication title CRYSTAL STRUCTURE OF A BUFFALO SIGNALING GLYCOPROTEIN (SPB-40) SECRETED DURING INVOLUTION
rcsb
molecule tags Signaling protein
total genus 107
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1tfvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tfvA01
2XVNA 5CGTA 3AXIA 4PMZA 2ZXDA 1CGWA 2GJXA 2CIPA 2YLLA 4J27A 3WEZA 2QF8A 3PTMA 2WAGA 1ISXA 4PBGA 3IANA 4HTYA 1EOKA 4ZENA 4S3JA 3POCA 3WF3A 1C92A 5I23A 5CZKA 2EO7A 4H7VA 5IHSA 2D1ZA 1EDQA 5E6ZA 3VD4A 1W3JA 1BYCA 3VGGA 1V6YA 3WDHA 3ZR5A 1NM9A 3UR7A 3NIYA 3WNPA 1W1PA 3N18A 2WZIA 4C7GA 2ZUSA 2BHUA 2G3JA 4MB3A 4UQAA 3WD4A 4NI3A 4MB1A 4ZXLA 5A2CA 1BVNP 4OJYA 2D0FA 1K9DA 2BXYA 3W26A 3OZPA 1C3FA 4GKLA 3AIEA 2E0PA 2VX4A 4CGTA 1TA3B 2E8YA 4AIEA 1RP9A 4UQBA 1EGZA 1NOFA 1KBBA 1JD9A 1H09A 4C7DA 1UG6A 2J7FA 2ZWYA 2J4GA 1Q6GA 1B9ZA 1XD1A 2D0GA 4MB4A 3GTNA 1WKYA 1U30A 3NSXA 1ZJBA 1D3CA 4FF5A 2OWWA 3PZOA 1UD4A 3U5UA 1VEOA 2DEPA 5BXTA 1QW9A 4UQ9A 4W5ZA 4A3YA 1UR9A 1NWRA 1LL4A 2FHCA 2XPKA 1MXGA 3HMCA 5GNZA 3SCVA 1HJUA 4IISA 3WDIA 3MO4A 1H11A 4UCFA 2BHYA 1VJZA 2D2OA 4J3SA 1CWYA 2J79A 3ARXA 3BMWA 2W66A 2XYLA 1UZ4A 1TG7A 3ZSSA 2PC8A 7A3HA 1YHTA 1HL9A 2YDQA 3BAYA 4M81A 1KR0A 3I3EA 2BFGA 3GYCA 3VILA 1K6AA 5HBFA 4ATWA 3THCA 1CTNA 4WKFA 1J9YA 3OLGA 3W6MA 4AZIA 3ZT7A 3BCFA 3VIOA 4QDMA 2FHFA 1HJQA 3WH8A 4LGXA 2ZUTA 1Q6CA 4V2XA 3SURA 3K8MA 4V27A 1UQZA 3AYRA 1X1NA 3VO0A 4F79A 2ZX5A 1GOWA 2DDXA 1J0IA 2PWHA 2OYLA 1UR1A 4Z2IA 2ZX9A 3BH4A 3WELA 5I2UA 1J10A 1GONA 3VIMA 1EDTA 3CMJA 3N11A 3ZR6A 2DSUA 2YA1A 3RJYA 1LG2A 3FN9A 3MS8A 1B3YA 1JL8A 4M56A 2EPKX 1UHVA 5A3HA 1GOMA 3W29A 3WUGA 2PWFA 1W9UA 4PTXA 1UWQA 2JFEX 2D24A 1QI3A 1OB0A 1TVNA 3BC9A 4Y7EA 2WCAA 1KXTA 3K46A 4J28A 1K9FA 5I5RA 4HZ7A 3ALFA 2HVMA 1V6VA 1O7AA 1K9EA 3VDAA 4YN5A 3L4TA 2DT0A 1P6WA 3VKKA 1C8QA 1CXHA 4K68A 3CZEA 3GXMA 4V28A 5BCAA 1NWSA 4R5EA 3AYSA 4QP0A 2DT1A 3W38A 5A8QA 5D9OA 4Z2GA 4W7VA 3W81A 2Y2WA 4EE9A 1AQMA 1VFOA 1EA9C 4ML4A 4CN6A 1UWRA 3MMWA 3WEOA 4MNJA 4M1RA 1LLOA 3WDPP 1NP0A 2CYGA 3L4XA 2VZTA 1AMYA 3CBWA 1E6ZA 3BXWA 4CU8A 4B9YA 3PZMA 3T2PA 4W87A 2GUYA 1KXVA 2YKKA 1R7AA 1EIBA 4Q7NA 1QI4A 2VRJA 5M3WA 3CZGA 3OB8A 5DFAA 3AFBA 3RDKA 3VINA 4PMOA 4PMQA 2DGAA 2GJXB 2OYMA 3VUPA 1QNRA 1U2YA 5A2AA 3IJ9A 1LWJA 2BXZA 2YL5A 1UZ1A 1DWAM 1GQKA 2DH2A 2OSYA 2XSAA 1SR0A 1US2A 3EMQA 2WVTA 2YDSA 3CMGA 3W24A 1UUQA 2CITA 2ZXBA 5M03A 5C70A 4UFHA 3PZVA 1UH3A 1OINA 4JKMA 2TAAA 4E8CA 5A94A 4AD1A 1J01A 1CLVA 4WIWA 1E43A 3EMZA 3SCSA 2QV4A 3VIIA 1JYWA 3BSGA 7TAAA 1JAKA 4AW7A 1G5AA 3SUUA 4GXPA 3UR8A 5D9MA 2BHZA 5CPTA 2A3EA 5IXEA 2YBUA 3OLEA 4KWUA 1MW3A 4LPCA 3A4WA 2DSWA 3WQ6A 2DSVA 1OGSA 2ZX7A 3SCUA 3N12A 3VIPA 3VDBA 4CCCA 1FOBA 1HKIA 2VRQA 1ZBCA 2X05A 3KL0A 2CKSA 2NT0A 1HVXA 2WYSA 1JZ3A 3FY1A 1TR1A 2VR4A 5F7UA 3BGAA 1GZJA 2D0HA 2VR5A 2IXVA 1Q6FA 1JZ2A 3QOKA 4EAMA 4DUXA 4AMCA 5JBFA 1BQCA 2HISA 2WMIA 1CXKA 3FAXA 1ZU8A 1WAWA 2WCGA 1JZ7A 1BGAA 3F5JA 1C8XA 1KCLA 5CJ5A 3AIBA 1D2KA 5JIWA 2VOTA 4LQ1A 3FHQA 1FFQA 1CPUA 3VTRA 2W62A 3GXFA 1BTCA 1E6RA 3RO8A 2WC3A 1I1WA 4AEEA 5CLTA 4M82A 3CZJA 2GJPA 4PTWA 1ODUA 3DECA 2W91A 3KWXA 5CPSA 3N1AA 3AI0A 1C7SA 4PTMA 3WD1A 2GDVA 4P7QA 1EQPA 3APGA 1OWQA 2WVUA 3U7BA 4CUCA 4UZSA 3NDYA 1DWGM 4PSRA 5FL1A 3EDJA 3DHPA 2V5DA 3PZIA 1GCYA 3ZJKA 2O9TA 2G3MA 1V02E 1R87A 1EO5A 1H41A 2A3AA 2BY2A 1IZJA 4CCEA 5EMYA 2XFRA 4LYRA 1TUXA 3EBVA 3L4ZA 1OM0A 1V6UA 2D22A 2J7EA 2XVKA 1UH2A 4MJ4A 1WO2A 4RE2A 1JAEA 2E9MA 3TTQA 3WH6A 1Y7VA 2JEQA 1KGXA 4ZE5A 2CCRA 1WZKA 2PBOA 4S3KA 1JI1A 1E40A 4JZ5A 2CBVA 3T2QA 3W27A 3ARPA 4OBRA 3G6LA 2WMGA 4ATDA 4JL1A 2XVPA 3VGFA 2F2HA 4D1JA 2DPEA 3AZRA 1BSIA 2Y24A 3GDBA 3MUZ1 3ZMRA 1V0KA 4OKDA 2ZUUA 3CUGA 1HJSA 1UD8A 2VX6A 4Z2LA 4MTVA 4W8AA 3UG3A 3BAKA 5IHRA 6TAAA 2CKRA 4D6IA 2WBKA 5JIPA 4MAZA 4GQRA 4BQ2A 2BY1A 4NRSA 3MUAA 1CGYA 3VM5A 3KE0A 4IPLA 3NYDA 4H8UA 4AZGA 1WDSA 2WZHA 1TCMA 1XRVA 4J3VA 1FFRA 5A69A 3F5LA 5HPCA 3VD7A 5CPQA 1W2PA 4QLKA 1EH9A 1H4PA 3SCOA 3GH7A 1V6XA 3A4AA 3VU2A 3I3DA 3ALGA 3SCWA 2C0HA 4DWSC 1JDCA 4TXEA 4NZCA 3ARYA 1QHPA 3K4AA 5HNNA 2IUZA 4HMDA 3PZUA 1MVYA 1TE1A 3OGSA 1V08A 4PTVA 1KWGA 3WNNA 2VO5A 3CUFA 3AS0A 1QNPA 1B31A 2Z1KA 6CGTA 3L4WA 2VVNA 3ZT5A 1M04A 4UQCA 1H3GA 2GDUA 1GHSA 3W37A 1V3IA 4W7WA 3FNDA 4JCMA 2DQXA 4FLQA 1R85A 4B3KA 3WEMA 1MWOA 4W8BA 4GZIA 3ARUA 1VAHA 1XV8A 1GHRA 1NOWA 1WCGA 1JZ5A 1EOMA 4N42A 3VX1A 5A2BA 3M7SA 5LA2A 5BWFA 1KFWA 3VX0A 1QHZA 2WVSA 2VZUA 3L2MA 1NWUA 3OIHA 1B3XA 3UCQA 1VF8A 4D72A 3W82A 4JFWA 4BZYA 2XWEA 1IT0A 3ZM8A 4UTFA 1CDGA 2FH6A 4U2YA 1CBGA 4EANA 2VJXA 1JYXA 1LJYA 1UD2A 1ZBKA 3VMOA 1V3MA 2WNWA 2CBUA 2GVYA 3WQ4A 3PBGA 4TTUA 4CD8A 3ARVA 1E6NA 1CIUA 2VVSA 3AHZA 3WFLA 5FCZA 2WMIB 4W93A 4GPNA 1E6PA 1QBAA 4PCSA 1QOXA 3M07A 4ACYA 2W61A 1C90A 4JHZA 1B3WA 3MSGA 2JF6A 1GPFA 3T08A 1Q4NX 3BCDA 1HP5A 4KGJA 3EDEA 4YPJA 2D3NA 3N17A 3WQVA 5A1AA 2VCAA 2C8NA 4TVUA 4ACZA 4DUWA 3BAJA 1FH8A 4DWSD 1E1FA 4NSBA 3AJ7A 1E15A 3RPMA 4GI8A 4NF7A 1BHGA 1MW1A 4P8VA 4XB3A 3WH5A 3BAIA 3NDZA 2UWFA 4OIFA 2RGMA 2FDMA 2J47A 2DT2A 1W3LA 2XM2A 4H2CA 3UERA 1HNYA 4IM4A 4ATLA 2WMJA 3AMDA 3AHYA 1W1YA 2QPSA 2VUYA 2O92A 2D20A 3ZT6A 4D71A 1XSKA 2J7GA 5JBEA 3II1A 2E9LA 2XUCA 1CXIA 3L4VA 2VZOA 3KEHA 3WY1A 1ECEA 3SCTA 1VB9A 2PWDA 1HL8A 2X09A 4XUYA 2YLAA 3RCNA 5JH8A 1JD7A 4FLSA 1VFUA 1LL7A 1JZ4A 1W1TA 2OYKA 3CPUA 4U31A 2CBIA 3ZSTA 4H41A 3MU7A 4UFLA 1E71M 4JFSA 3VD5A 1VBUA 3SCRA 3PN8A 4P8WA 3TTSA 2YA2A 3AMKA 2PWGA 4UFJA 4HA1A 3WENA 1BVZA 5D8WA 2OSWA 1MFVA 2O9OA 3A47A 1JYNA 2J7DA 3L4YA 1LWHA 4HOWA 2Y4SA 4KGLA 1RPKA 1QI0A 3BLKA 1FHDA 3ECQA 1V3KA 3AIUA 4HZ6A 3RM4A 4AXNA 4IPNB 3WBAA 2BV9A 4M80A 1BYDA 2EBNA 1ZBWA 2ZWZA 1E6XM 3QHNA 2EPLX 1CGTA 1GQIA 1LL6A 1Z32X 1UD3A 4PYSA 5ABEA 5EFDA 2BVYA 1JI2A 3IAQA 1UR4A 2JEPA 3CHEA 1V0LA 3A3HA 1GJWA 4HPHA 1JFHA 1M03A 6A3HA 2BY0A 2O9PA 1HVQA 1XC6A 1AQ0A 1M53A 2W67A 5A8MA 1XSIA 3CGTA 3K4DA 5ABFA 4FLRA 1M7XA 4F8XA 5DT5A 1BYBA 2J7BA 1R7OA 4XX6A 2V38A 1HKMA 1GOOA 5BRQA 3SCNA 3AICA 2YL8A 2WW5A 1J0KA 5DEZA 1R8LA 3AIRA 1GOKA 3LPFA 3VOCA 2CXGA 3OA5A 1K9TA 1Q6EA 3L4UA 2OWXA 1V3HA 4U3AA 2QMJA 4EK7A 2E3ZA 3ZOAA 4CN4A 1BG4A 5CSUA 3PHAA 1UR0A 4BF7A 4CU7A 2V3DA 1HN1A 3ARWA 2VZVA 4PN2A 4AZ5A 2D3LA 5DMYA 2G41A 1W9VA 1LF1A 4MAVA 3WH7A 3HJEA 3VVGA 1RP8A 2JIEA 3NJ3A 3T09A 1ITXA 4M8UA 2DIJA 2XFYA 3CHCA 1WPCA 1H1NA 2NSXA 4JIEA 5IFPA 3B8SA 1HKJA 4QFUA 4F9JA 4TOQA 3LPOA 3CIVA 4JKLA 4CD4A 1GW1A 3WQ8A 4X9YA 5A6AA 5DT7A 4GZEA 3IK2A 1J0HA 1PX8A 4FLOA 2AAAA 1FH9A 4ZFMA 5A6BA 4P8XA 1E4IA 1R86A 3ZO9A 3S6TA 3K8LA 4AY1A 1J11A 1J18A 3WBEA 2GJRA 4MADA 3SEPA 3LMYA 1WZMA 1C8YA 3OGRA 2DH3A 1CGVA 2W4XA 3VNZA 1UKSA 2JIWA 5A6KA 1VEPA 4PMXA 5LA0A 3CHFA 1OBAA 4FK9A 1UWUA 4ACZB 1UWSA 1J0ZA 3UEQA 4XZWA 1FP8A 2Y8KA 4D1IA 1B3ZA 3VPLA 5CSYA 1MW0A 3EMCA 3CUIA 4P7OA 5GNYA 4W86A 1E1EA 5M5DA 1US3A 3AXHA 2VZSA 3VD3A 3AZTA 4UNIA 2OSXA 1OT1A 3PZQA 3AIWA 3RILA 2VX5A 1JF6A 1RH9A 4AWEA 5AC5A 4N0RA 3WUEA 5A6MA 4W8LA 3W0KA 1AQHA 2XTKA 2Y8VA 3VDHA 4AZHA 4HMCA 3GXIA 2WVVB 3DYPA 3VGEA 4DWSA 2WHJA 2EXOA 1H2JA 3WL1A 1V3JA 2BNJA 3FXYA 1H0GA 1EQCA 1F4AA 4HU0A 4W7UA 4AD4A 3W6LA 1CEOA 2XM1A 5GQBA 2XVLA 3AHTA 1AVAA 1BPLB 3CZKA 3UG4A 3WF1A 2WXDM 3U57A 1PZ2A 2C7FA 3L2LA 1NH6A 1KXQA 3CTTA 2J8GA 4OUEA 4WKHA 2GK1A 1E0WA 3QR3A 3DYOA 3AS3A 4P8UA 1J0JA 1JXKA 5AYBA 1HT6A 2VQTA 4J7RA 4DUVA 1XHGA 3ZJ7A 4PMDA 3CHDA 4AZCA 1QNQA 4HA3A 4WK9A 3QHMA 1FA2A 3VDCA 2WK2A 1EDGA 2YJQA 1WB0A 4RE3A 5BYWA 1MYRA 2BVTA 1C7TA 2J77A 3VM7A 4U5IA 2YL6A 3GNOA 1SMAA 4GO8A 1FHLA 3CUHA 3UETA 2UY5A 5A6JA 1MW2A 3EDFA 1HKKA 1N82A 1UD6A 1ZBVA 4OZOA 5ABFB 1XD0A 3PTQA 4PMYA 3ARTA 1D7FA 2WPGA 1G0CA 1DWJM 3MSDA 1JIBA 1PZ3A 1PPIA 3WNKA 5A6SA 3KL5A 1EHNA 3J7HA 3MANA 1EXPA 2EEXA 1E3ZA 5FD0A 3WDQA 3SUSA 5CGMA 2V3GA 1G94A 2J25A 2VRKA 1E4NA 3VIGA 3CZLA 4GI9A 4U2ZA 1KQZA 1KWKA 1QW8A 5E9AA 2A3BA 4AIOA 1CECA 5IFTA 1XYZA 4D6EA 5HDRA 3WL0A 1W91A 4UOZA 3U5YA 3VIHA 3WIJA 2VC9A 1XH0A 4KRTA 5EB8A 4HZ8A 9CGTA 5D8ZA 2YIHA 4WKAA 1KGUA 3SUVA 1OIMA 1KGWA 4WJXA 1WDPA 3MMUA 4F66A 2G4FA 1XSJA 4PMVA 1CYGA 2J75A 4AZ6A 2WMFA 1GUVA 4RE4A 1HIZA 2PWEA 4H04A 1JDAA 1UQYA 2WLZA 3GZAA 1KR1A 2A3HA 2F8QA 1O6IA 1QNOA 3ARSA 2CBJA 5C71A 1QVBA 1FP9A 4J3TA 3OG2A 1C93A 3THDA 5ABHA 2YL9A 3GXDA 3PZ9A 4JL2A 1UKOA 3B9EA 4CD6A 1OGGA 2QMKA 3TONA 2VNCA 4Z2JA 1UA7A 4HPGA 4QLLA 3CH9A 2J78A 2ZXAA 2PF0A 4UZUA 4TX8A 5HOSA 2A3CA 1GOIA 3WQWA 5BXRA 3EYPA 1ISWA 4AC1X 1V03A 3WSUA 2YBTA 1L0PA 1UKPA 1UOKA 2V3FA 3KZSA 5AY7A 2WMKA 4UOJA 3TP4A 1VENA 2WHKA 3SUTA 3K8KA 3SIMA 4E2OA 2CESA 1G01A 5FOOA 1HF6A 5AC4A 3BLPX 3CUJA 3RJXA 4PSPA 1VIWA 3TTYA 5A8PA 3AXXA 1HX0A 2EJ1A 5CG0A 1PIGA 3T0BA 1E0VA 5IDIA 3WH9A 5BXSA 4W88A 4MNKA 4PMNA 5FIPA 1F4HA 3IJ8A 3IJ7A 5I3DA 2G8ZA 1TVPA 2CETA 3RM9A 2WMHA 2WKGA 2X2YA 1QI2A 4CKQA 4URIA 1ESWA 4DWSB 5CXPA 3E1F1 1CXFA 1CXLA 1V3LA 3PZNA 4DM2A 2W63A 1V6WA 4BCEA 1KQYA 3AQUA 2JE8A 1TZ7A 3ZJ6A 3EDKA 1VBRA 2ZOXA 1PIFA 1OD0A 4UQDA 1BAGA 5DO8A 3EDDA 1JZ8A 5I79A 2J7CA 2GK1B 5D4YA 3SCQA 1ZB5A 4CN1A 1PAMA 3F5KA 4D6GA 5CLWA 8CGTA 4IUGA 3VGBA 1HJXA 4F9DA 1B30A 4TUFA 2BVDA 1CENA 2J74A 5GPRA 4AZCB 1E6QM 2XG9A 1LQ0A 3PZGA 4CVWA 2VCBA 1XH1A 1GVIA 4MJ2A 3CO4A 1I1XA 3AHXA 2UY4A 4AISA 1W2VA 5A8NA 3K1DA 4Z2KA 8A3HA 1E3XA 1CLXA 1W9PA 3WUFA 5A6BD 3G6MA 2WVVA 4HOXA 1B90A 1B3VA 1WZLA 5E09A 2UY3A 1E0XA 1GVYA 3JUGA 1UYQA 2ZXQA 4U5KA 2VL4A 1UKTA 5HXMA 3OBAA 1OT2A 1SYTA 4BQ4A 1E4LA 3VMNA 4U3CA 2PBGA 2X8RA 5E0CA 1J0YA 3GBDA 1OSEA 3O9NA 1E73M 4AD2A 2DSKA 3LPPA 2PB1A 3WNLA 3ZJ8A 2QLYA 3AISA 5E0FA 4Q22A 4PUEA 4BS0A 5A8OA 3QHOA 4MB5A 4QAWA 3WMSA 1E6SM 4ZEPA 4GI6A 4AD5A 2WANA 3AHVA 1E55A 1W3KA 2EPMX 2DIEA 5D9NA 3WFZA 4PMUA 1GORA 1OD8A 1C91A 1OIFA 1XCXA 3T2OA 2WC4A 2D23A 4W84A 3WMBA 4OOZA 4M29A 1JNEA 1G9HA 2W92A 1EO7A 2XJ7A 2WZEA 2NW0A 3DC0A 3GNRA 1B2YA 3BMVA 3WUBA 5E70A 3WNOA 1GOQA 3NCOA 2XVGA 1QNSA 4AIUA 4LX4A 3MUIA 3B9DA 4EKJA 4J3WA 2XGIA 1LG1A 3N9KA 3TTOA 1IV8A 1BFNA 2DSZA 1GNXA 4XZBA 4OBSA 4UFKA 2J8FA 2GSJA 4TVCA 4QCFA 2X1IA 4D6DA 1VRXA 3F4VA 5M17A 3ZQ9A 2Z1SA 2MANA 1ZJAA 5GNXA 5ABGA 4ZE4A 4J3XA 4BA0A 1HJWA 2FHBA 4AZBA 2YA0A 3ARZA 1W3HA 1BGGA 2ESCA 3SCPA 1QPKA 4JKKA 4B9ZA 3BAXA 5E6YA 3AOFA 3TOPA 2FGLA 2EQDA 5DF0A 2CPUA 5A6LA 2CEQA 3FAWA 4JHOA 1ODZA 5I78A 1DWFM 3WKZA 1BLIA 5EFFA 3D5HA 4MNMA 3N15A 3DYMA 1G1YA 4JFVA 3VMPA 5HPOA 4LXFA 4MNLA 2XIBA 4DM1A 2W5FA 3CLWA 4AYSA 2WC7A 3NSNA 1CGUA 2ZUNA 3MV11 5BROA 1XH2A 4UR9A 1VFMA 5AYIA 4TTGA 3RMEA 2EPNA 2WLYA 1BYAA 1E5NA 3U7VA 5I6SA 1UR8A 4HA4A 2WHLA 3M6DA 3WDJA 3IAPA 4UFIA 3WF2A 1BF2A 3VIJA 1MQQA 2E9BA 2VQUA 4UQEA 1I75A 4YHGA 3W28A 1OCQA 1JG9A 5LA1A 3TA9A 4AZ7A 1EHAA 1PJ9A 2WKLA 1ISVA 4MPKA 3AMCA 1GQJA 1MXDA 1PEZA 3OLDA 2CERA 4X0NA 3I3BA 1MQRA 4P7NA 3WN6A 5A95A 4ZXOA 1XYFA 1E5JA 4E8DA 3AROA 2G3IA 4A4AA 1KBKA 1J12A 4AD3A 1DWIM 1W1VA 2FH8A 3HN3A 2WSPA 1SMDA 2XHYA 2VX7A 1E72M 3O6AA 4WSKA 4GZJA 2CHOA 3BSHA 3AMGA 2VI0A 4TX6A 3UG5A 5KZ6A 1XGZA 4BQ5A 4YHEA 4B3LA 1ISYA 4JFTA 4M24A 4CCDA 2YDRA 3NUKA 3PZTA 2DT3A 1DEDA 1W32A 1OGBA 2VT0A 3GNPA 1VFFA 2E8ZA 1NOUA 1E4MM 1DHKA 3HU7A 1YQ2A 4CD5A 3GH4A 4P7RA 4W89A 2OLHA 2WM0A 1CZ1A 1UD5A 3OGVA 1U33A 3WNMA 1S46A 3D3AA 3UESA 2IXUA 2FGZA 3CZ8A 1GQLA 3VGDA 3VNYA 5C8BB 3AS2A 1CNVA 4RL3A 4J3UA 5I0DA 2XFFA 2X0YA 3W25A 4BQ3A 5BRPA 3RIKA 1KB3A 4GQQA 1E70M 4AEFA 4KRUA 2Y5EA 1JZ6A 1ZL1A 3VD9A 5LYRA 3B9AA 2ZICA 1WZAA 3OZOA 1E9LA 4PRWA 2WWCA 3W53A 3SUWA 2G3NA 4D6JA 2AMGA 2CNCA 1UWTA 1W9DM 2E4TA 2ZIDA 3WQ5A 1MQPA 4U33A 3ZIZA 1NP2A 4JAWA 2XGBA 3A4XA 3W4RA 4B15A 2VMFA 4HMEA 3GBEA 1H49A 4HU8A 3S2CA 3DHUA 2RGLA 5KEZA 4AD0A 4W5UA 3RM8A 1NWTA 1JFXA 3WDRA 2J7HA 1WDRA 1Q6DA 2AOSA 3AIVA 1WDQA 3AS1A 1WE5A 1GJUA 4L4PA 1V02A 1ITCA 2WCSA 3A6OA 4GINA 4P7LA 5JUVA 4LYQA 1DTUA 2GFTA 1ZS2A 2X0HA 5ECUA 4JCLA 4A3HA 1TA3A 2V5CA 3OLIA 1UWIA 1WP6A 2CHNA 5BXPA 1QBBA 5FL0A 1KCKA 2WHMA 3AMLA 4W85A 2JF7A 1V0MA 1JNDA 1A3HA 3VIKA 1RD6A 4WLCA 2JALA 3WD2A 4UOQA 1VJSA 5CQ1A 4WF7A 3NSMA 5TD4A 1DP0A 5I24A 1HXJA 3WD0A 1QI5A 4GO9A 2XIIA 3LPGA 1SFSA 1X6LA 4E4PA 4XV0A 4H8VA 3FW6A 1X6NA 2BS9A 3KL3A 2XWDA 1CGXA 2O9RA 4PMRA 4NRRA 1VEMA 4R27A 1JGIA 1TMQA 2E40A 3N04A 3AZSA 3POHA 4OOUA 4PEEA 2ZUVA 2OWCA 3ARRA 3MV01 4UFMA 1ISZA 1QHOA 5I77A 3N13A 2WSKA 1W9XA 2XSBA 1NARA 1JDDA 2QHAA 4MDPA 1MFUA 2Q8XA 4Z2HA 5FKYA 4KMQA 1E56A 5EBAA 4JFUA 1V0NA 4CVUA 2NT1A 1KXHA 1HP4A 3VIFA 4L4OA 2J62A 2ZUWA 4CU6A 1HJVA 1H5VA 1JXJA 2VTFA 1UH4A 3O2LA 4PUDA 2VCCA 1L8NA 3WD3A 2VURA 2F61A 1PX3A 1JYVA 1CXEA 4PCTA 2ZUMA 1IZKA 2UY2A 4D6HA 1A47A 2PI6A 3GH5A 4X0VA 2ZX8A 7CGTA 3MKKA 4QCEA 5JBDA 1BG9A 4B16A 3ARQA 2QPUA 4QLJA 3BAWA 1B0IA 3T0DA 3GM8A 1W9BM 3PTKA 2WBGA 2B31A 1PX4A 5D9PA 4D6FA 4TVDA 1FH7A 4FMVA 1PBGA 3M46A 1H0IA 4WSJA 1TFVA 3WF4A 2EPOA 4D6CA 3WMCA 4H8HA 2YOCA 3QOMA 3T0AA 4CD7A 4MDOA 4GIAA 1M01A 3MUY1 1B1YA 1NQ6A 3AIQA 3QGVA 3VGHA 2WWDA 1XCWA 2ZE0A 4C7FA 2WB5A 4HOZA 1UR2A 1UA3A 3FHAA 1UKQA 1WNOA 4KH2A 3WF0A 1DWHM 2BY3A 2V3EA 1JF5A 3MMDA 4HP5A 4LYPA 2ZX6A
chains in the Genus database with same CATH superfamily
2XVNA 3I7QA 2NX3A 2Z26A 1MNSA 5HWBA 2ZXDA 1U22A 3TTEA 3HV8A 4JQ2A 2INFA 4ZFCA 4GHRA 4JFJA 3IANA 4HTYA 1ZK6A 4ZENA 4S3JA 3G1HA 3POCA 3V35A 3O5QA 1C92A 3LCIA 4K3ZA 4QR6A 1Z42A 1EEXA 5IHSA 1SO4A 2D1ZA 1R46A 1QDSA 1W3JA 4ZPVR 3KHJA 4AEOA 4FALA 1BYCA 3VGGA 1TRIA 3BGGA 2P10A 3W23A 2BGQA 3P93A 1LYXA 3N2BA 1ELSA 4ZXLA 4Y9OA 2D0FA 1K9DA 3VFLA 4GKLA 1RAKA 3AIEA 4HJFA 1VS1A 4CGTA 4B5VA 1WAUA 4C7DA 2J7FA 4ICNA 2J4GA 4K7VA 4BK9A 1B9ZA 4JICA 1SR9A 1WKYA 1U30A 3NG3A 1T0OA 3MP3A 1ZJBA 2ZDRA 1DQWA 1D3CA 3T6CA 3OODA 1UD4A 1TX0A 3BV7A 1BXNA 4UQ9A 4W5ZA 3UWQA 1VRDA 1UR9A 4QS5A 4ENLA 3HMCA 5GNZA 3JYMA 1EFZA 3BL3A 3MO4A 4MY1A 3S46A 2RDTA 4K1WA 4J3SA 1CWYA 1XX1A 3BMWA 2XYLA 3HPSA 1UZ4A 4FX6M 1R5YA 3PBMA 2PC8A 3W1LA 3W2UA 3BAYA 1KR0A 3IGHX 3GPKA 3H24A 4S3GA 5HBFA 4C6CA 3VAVA 4WKFA 3IJIA 1M3UA 4AU0A 2VELA 2OZ3A 3BCFA 4NAFB 4LGXA 1JCNA 3HO8A 3EB2A 1MZHA 2PDCA 1KFLA 3K4WA 3CQ0A 4V27A 3W72A 3CUXA 4KFPA 3AYRA 3QH2A 3L65A 3T42A 3H26A 4QITA 4IP7A 3BH4A 1YW1A 4GC3A 5DXYA 4MZYA 3W6YA 3A12A 4LJ3A 2XP6A 2R1PA 1RY0A 3RJYA 2WKJA 5HQLA 4FNSA 3FN9A 5DRIA 1B3YA 2Q3OA 2EPHA 1JL8A 4S3BA 2E68A 2R94A 4GYPC 4E2DA 3DG3A 3Q58A 4JIHA 3PTDA 4XZIA 1TVNA 3BC9A 2JBMA 1KXTA 3W7MA 3EWYA 4R7JA 2GVEA 2Q5AA 1O7AA 1YPFA 4GBDA 3V4BA 2C13A 4LCSA 1FWSA 1CXHA 3DG7A 5BOEA 3XIMA 3GXMA 5G1MA 3VXGA 4ZO6A 1NWSA 4IXXA 2QS8A 5LIKX 4UTWC 5LHFA 2L2SA 2DT1A 1V7AA 4QRNA 2ZZ2A 3THAA 4C6IA 3W81A 3CPGA 4JY9A 2ACSA 2OO6A 2Y2WA 3ENLA 2Q71A 2D9FA 2ZRWA 3WEOA 4MNJA 4M1RA 1LLOA 3GZ3A 1UP0A 3OW1A 2TSYA 5TIMA 3F2CA 1WYIA 5FSDC 4AC7C 2NXIA 4GUHA 2CZFA 4O12A 4IJCA 1R2TA 4B9YA 3WLMA 3STPA 1KFJA 2OEKA 3W00A 3H7UA 1X1OA 2YKKA 3W7GA 4A05A 2MF9A 2PGRA 5M3WA 5DFAA 3WK3A 3AFBA 3RDKA 3MI3A 4B4FA 2DGAA 2GJXB 4IJBA 1QNRA 3USBA 1U2YA 4UMCA 4UTMA 4I9JA 3DI0A 3IJ9A 4M51A 3RCYA 2F38A 3OZMA 2YL5A 5DMMA 1AFSA 1YIXA 1UUOA 3W7OA 2DH2A 1F76A 5LNVA 4TQTA 2XSAA 1NFBA 1XIIA 3LI1A 1TCDA 1HW6A 1Q2SA 1DJNA 2WO5A 2YDSA 2CITA 3KOZA 1OQFA 1F3TA 4UFHA 2PP1A 2FZ8A 1QMLA 3V75A 5M2FX 1J01A 1FWFC 3GFZA 1JVNA 2B7OA 3KP0A 3GDMA 4WIWA 5CAHA 3BSGA 4QISA 4PCFA 4GXPA 5H91A 2FMNA 3NQAA 3UNTA 1XPGA 3S1XA 2MLYA 4LPCA 2VD9A 1FCVA 3UPBA 3VKDA 3TW9A 1DIOA 3EX6A 2BB0A 3VIPA 4X61A 1K8YA 1OCNA 1RV8A 1AL7A 4CCCA 3KHDA 2GZXA 3MCOA 1HKIA 2SFPA 3AUOA 1OCJA 1ZBCA 2OU4A 2WYSA 3TDBA 1HUVA 2Y5SA 4OGZA 4AF0A 2G95A 4JNZA 4C5YA 1MZRA 1F05A 1XIFA 3H54A 2RKXA 1BQCA 2WMIA 2RUCA 3FAXA 4GBUA 2HWGA 2PV1A 1QPRA 4M19A 5CKSA 2BODX 3EEGA 1CX9A 3B9NA 4EVZA 1C8XA 2O7QA 1SJDA 2HVOA 1W6TA 5JIWA 1D6OA 2VC5A 1AW1A 1EGVA 4DXVA 4NAEA 3MZ2A 3FYYA 2Z6IA 3AAMA 1I1WA 1AD1A 5HW8A 2ETNA 3NQ8A 4M82A 2PDGA 3FSUA 3UP8A 3PJTA 4NY2A 5CPSA 3KWXA 3AI0A 4JOMA 4O50A 7XIMA 3QSRA 3CC1A 4Q8NA 1IGSA 4UNKA 2GDVA 1SU5A 4P7QA 3GFXA 1X8CA 2V81A 2GWGA 1OWQA 5AHIA 4CUCA 3M47A 3DHPA 4Q4MA 2V5DA 3M64A 3ZJKA 1ZENA 3PR9A 3B8WA 1F74A 3O63A 5A6TC 2GVJA 2LKNA 2XVKA 4MJ4A 3V16A 1SFLA 3BW4A 4LS1A 5D2XA 4LANA 3TTQA 4L9XA 2K8IA 1EBHA 3O5JA 1UW9A 2INZA 2JEQA 4PEKA 3NL3A 2Y7EA 4W9OA 1XLJA 1JI1A 5DITA 4F0HA 4N4QA 2CBVA 4MJMA 4OBRA 2YX0A 2X1RA 4JL1A 1R3QA 2F2HA 4QE1A 2Y24A 4DO5A 1XPYA 3W3OA 4DIPA 3R58A 4IQEA 2C91A 5A8GA 3QMSA 1G4SA 3RG6A 1I45A 4W8AA 3QYSA 3BAKA 1X8FA 2CKRA 2WBKA 5JIPA 3MBDA 1XG3A 4H19A 3C0JA 5EGRA 3VM5A 2WJFA 3KE0A 1S5MA 3NYDA 4H8UA 4AZGA 4Q33A 3W2KA 3PSWA 2BOFX 3U9IA 1DJYA 1R9YA 2VGFA 3GTYX 4LVGA 2ACQA 3V18A 3LDVA 2R1KA 3CK5A 3TWBA 3VU2A 1WOBA 2NV2A 1W3IA 3SCWA 4DWSC 3VUSA 3QY7A 1JDCA 1F8AB 3N3TA 5H8MA 4NZCA 3ARYA 3K4AA 4J2PA 4HPXA 3OGSA 2R1MA 1V08A 3KBSA 1Y65A 1HL2A 1YXCA 4MKNA 4S3FA 4NJGA 4Y2WA 3BE7A 2VVNA 1TJ2A 1H3GA 4B5SA 1V3IA 1EJTC 5FEZA 1I2QA 3FNDA 4LAMA 4ODQA 4FLQA 5F2MA 1R85A 3SGUA 1SPQA 3S2NA 4GI4A 1VAHA 3JYJA 4D8ZA 1GHRA 1WCGA 3N25A 3VX1A 5LA2A 2DZXA 3VX0A 1MNZA 1QHZA 3BANA 3L2MA 4O28A 3UCQA 4MSSA 4D72A 3W82A 3HPXA 1IT0A 5ABTA 1CDGA 3PJUA 5FA5A 4JX6A 4Z42C 4ROQA 4EANA 4NNBA 1A80A 3WQPA 3VMOA 4GXWA 2CBUA 4HSHA 5B7YA 1FTXA 4TTUA 4CD8A 3C6CA 3ARVA 1ENUA 3WFLA 4W93A 2REQB 3G3MA 1KKOA 4NASA 3T0CA 5BZAA 3M07A 4L56A 4JHZA 3MSGA 3LCLA 2WZTA 1GVRA 3IHZA 1GVSA 2W3ZA 4AH7A 2ALDA 3N17A 4X3ZA 4PB4A 1OFRA 1KM4A 4DUWA 1FH8A 3HIJA 2QVNA 1E15A 3NGJA 3H6OA 1BHGA 2HCVA 2DT2A 3E9AA 2XM2A 1GEHA 2VGGA 4Q8PA 3IACA 1POKA 2WMJA 4XTDA 2PTDA 2D20A 3AALA 3VKJA 2I14A 5JBEA 2XUCA 1CXIA 4B4HA 3SCTA 1VB9A 4LUTB 4JHMA 4Z1DA 3CAWA 4JEJA 5IBXA 4GVIA 1VFUA 3NFUA 1LL7A 3E2QA 3M0HA 3TC6A 3ZSTA 3DFOA 1EJXC 4XZLX 4UC5A 3MYPA 4UFLA 1GRJA 2Q8ZA 1REQB 3VD5A 1VBUA 2VWSA 5HAOA 3O0KA 1M5YA 3TTSA 5HQMA 3M0LA 4UFJA 3WENA 3N4EA 3ATYA 2Z25A 3FA3A 3F2BA 1JYNA 2ADAA 5GVJA 1O5QA 2QCEA 3TNBA 5EMKA 4JNYA 2PEVA 2VKZG 2BV9A 4M80A 3CGMA 1LWIA 1QNVA 2ZWZA 3QHNA 1U5HA 1GQIA 4DZ2A 4ZBCA 1Z32X 1UD3A 4PYSA 5ABEA 5EFDA 2E1WA 2OMAA 4JTJA 3TXZA 5BNKA 5DBTA 3AYTA 3IAQA 1V0LA 1GJWA 1JFHA 1XINA 1KW1A 1ONWA 1Q6OA 2BY0A 2O9PA 4CNUA 4GISA 5A8MA 1XSIA 3GC2A 4JGDA 1VGAA 3MA8A 3IJQA 4F8XA 1Y8BA 3QMTA 5AC8A 1ADDA 4DZ5A 4GUJA 1R7OA 1Q65A 4XX6A 3SCNA 2XN1A 2YL8A 4BEUA 3WH0A 1UBSA 3TZFA 3AIRA 4NL1A 3ONBA 3LPFA 3BVJA 4KT2A 3QVQA 3VOCA 2CZ5A 3S47A 3LX9A 2ZTJA 2OQHA 5HKGA 3CQHA 4EK7A 2CWNA 5CSUA 1PDZA 3PHAA 3NQMA 1TV8A 4NZFA 4QSHA 2QKFA 2VZVA 2D3LA 2A7NA 4Q4PA 2WJDA 3TZNA 4ODPA 4H9YA 1F3EA 4I8DA 3CWHA 3SR7A 3UU0A 5D2VA 3T09A 3NR0A 3T4CA 4BF9A 3CHCA 2F2DA 1BF6A 1ZAIA 5EMLA 3H23A 1JVWA 1PHQA 1VBGA 3W1RA 5IFPA 1W5NA 4NZJA 3UJFA 1JULA 3IS4A 2PURA 1EWDA 4MUPA 4TOQA 1W1A1 3DERA 4CD4A 1GW1A 3WQ8A 5DT7A 3CGNA 5A6BA 4A8LA 3W1XA 4FX7A 1R86A 3ZO9A 4V1XA 2QDGA 3L12A 3S6TA 1J11A 1J18A 1PZ1A 4YTRA 4HARA 3OZYA 2VEGA 5LNUA 3VOFA 4WDWA 3AWOA 3LMYA 1YXDA 2QXWA 1WZMA 3LS9A 3O5KA 1E9IA 3JVAA 2VEFA 1CGVA 2W4XA 3BW3A 3UW6A 1UKSA 2QJNA 3CHVA 3CHFA 4FK9A 4B2DD 2V68A 4XZWA 2Y8KA 4X9SA 3N14A 4PB3A 4WRHA 2WV8A 1ZAJA 3VPLA 3OIXA 4L7ZA 1JQVA 4YTTA 4O15A 1FWNA 2BX7A 1ZPTA 2GQ3A 5ECVA 2OQLA 2BG5A 3AIWA 2VX5A 4Q4QA 1RH9A 4O53A 4N0RA 3WUEA 1IEXA 1W8SA 3ANYA 4LUSA 5A6MA 2Y8VA 3VDHA 3GXIA 2WVVB 4E8GA 3LD5A 2DVXA 4YTSA 3WL1A 5I3GA 4C6PA 2BNJA 2HE5A 3CQJA 2RDUA 2J13A 4UIOA 4HU0A 4W7UA 1NTHA 2IS7A 4MFEA 3W6LA 4QEEA 3UG4A 3WF1A 2PDWA 4UDMA 2WXDM 4O0QA 3U57A 4KWOA 3WQDA 2XIOA 4KFOA 2J8GA 4WKHA 3LV5A 2GK1A 1WXYA 3DYOA 3Q37A 4WDXA 1JPDX 3V1HA 3O6DA 2JQXA 3UG8A 1J0JA 3SJ3A 1OG6A 5AYBA 2Z24A 4PUMA 1TIMA 5FJJA 2OEMA 4J7RA 5HQEA 4PMDA 3CHDA 4ZOBA 1QNQA 4AZCA 2A7RA 1TO3A 3QHMA 5CBJA 1J2WA 2E09A 1IEWA 2WK2A 3QKZA 1P48A 4GNVA 4FR1A 1FWDC 2ZZ5A 3C52A 4U5IA 4QHRA 2Y78A 3GNOA 2DORA 2ON3A 3UETA 4US5D 1ONEA 2EKGA 3BMXA 4S1FA 4JTQA 4HMNA 1N82A 1SZRA 5I03A 4JN6A 1IQ8A 4OZOA 4CQDA 5ABFB 2PFHA 1EPXA 1PS9A 2FJKA 2Z2AA 3CMFA 2C6QA 1DWJM 1GEQA 4EOUA 2YFNA 3J7HA 1F7BA 3WDQA 1NDZA 4KKXA 2EG8A 3ABXA 1G94A 4GVHA 3RX4A 5BU9A 4YIWA 3VIGA 3CZLA 4U2ZA 2ZVIA 2YB1A 5E9AA 3WBWA 5IFTA 4XAGA 3EOUA 3RMJA 4D6EA 3B8VA 1T96A 1JCXA 4XBKA 4PCNA 3GU1A 4PUUA 1NDYA 2VC9A 1UZHA 2X1UA 1XQLA 1J4RA 4HZ8A 3V5OA 2YIHA 1LOQA 3TOYA 4GY1A 1S5TA 2NLYA 4JR5A 2R1NA 2WMFA 2IQTA 3M7WA 3NL6A 3SGZA 1IIHA 2XZ9A 2YCJA 2V8ZA 2WLZA 3IARA 3GZAA 2A3HA 1M65A 5CJNA 3C2VA 5C71A 3L5AA 3DHDA 3L21A 3CIWA 1FP9A 1K7XA 3OG2A 3GXDA 3CPRA 3PZ9A 4JL2A 3B9EA 3SDOA 2B7QA 3PF3A 4Z2JA 1UA7A 4WJ8A 1EP3A 5KETA 2XP9A 1J4IA 5BXRA 3UCCA 3BWWA 1V03A 2PRHA 4BI7A 3GK0A 2XPBA 1UKPA 1TKKA 3ID7A 3NOYA 3K8KA 5B8IC 1UC5A 3SIMA 2CESA 5FOOA 1HF6A 2WJZA 3N9RA 1DORA 3ERPA 3LRLA 4L1XA 4A3RA 2CHRA 3UJSA 1IEIA 3O0FA 4C6LA 5D30A 3KWSA 2EJ1A 1TJPA 3D47A 3M0IA 1AW5A 4I3GA 3WQCA 4HBOA 4ADSA 3REQB 3IJ8A 2CLMA 5I3DA 2CETA 1DVJA 2X2YA 3QPEA 4EWND 2QJJA 4S2CA 1XDMA 3CL7A 2ODOA 5K9DA 5FAJA 3GDTA 4LC6A 2JKPA 4FR6A 4GGBA 1YXYA 3OHIA 3PZNA 5F2IA 2CZVA 1KQYA 3O5MA 3RRAA 3AQUA 4XK2A 5XIMA 1TZ7A 3EWUA 4AFYA 2ZYFA 5HANA 1A4MA 1OX4B 4IGMA 3IIZA 1RK6A 1NF0A 2ZCGA 1JZ8A 2FB3A 3G24A 1OK6A 5CPOA 1EL3A 3EWXA 5D4YA 4LCRA 3JXVA 3UYCA 1PAMA 2VDHA 3F5KA 3OO2A 4D6GA 1W5PA 5CLWA 2NQ9A 4IUGA 4GJ1A 4GVFA 3LGEA 4F9DA 1B30A 4CNTA 1CENA 3LGGA 3QSTA 5GPRA 3G1VA 3IUIA 4CVWA 3RLUA 2OB3A 2VCBA 4XG1A 1EWEA 2OT0A 3SADA 1IWAA 2Y7FA 4JTDA 1LTDA 4EPKA 4JTEA 4K8EA 1TX2A 3L68A 3G6MA 4HPJA 1WZLA 4EX4A 1BRLB 2EGZA 4MUZA 1UKTA 1AH3A 2Z2BA 5HXMA 3S9IA 1OT2A 1LUCA 3OBKA 4CQ9A 3VMNA 4U3CA 1T8QA 1TPDA 3CEPA 2PBGA 2X8RA 5E0CA 1J0YA 5A5WA 4Y90A 1JNTA 2ITKA 4AD2A 1W37A 2X42A 3ZJ8A 2XIMA 2RHGA 3KVKA 3AISA 3W1NA 4PUEA 4BS0A 4QT3A 3N3MA 2V67A 4MB5A 3UBPC 3WMSA 1E6SM 4ZEPA 4AD5A 4NJJA 1NF7A 3G5EA 3KBMA 4ERIA 4Q7IA 3P0WA 3WFZA 1GORA 5B7ZA 1JCTA 4JIPA 4GACA 3LYEA 1C91A 3IRDA 1OIFA 4W84A 3B40A 1ADOA 1G9HA 4HHPA 5C2CA 2D69A 2XJ7A 3PC0A 4JTCA 3GTXA 2ZZ3A 3DC0A 1PB0A 2W79A 3PM6A 3KAOA 1GOQA 1LP6A 3NCOA 4AWTA 2XVGA 1QNSA 3L5MA 4LX4A 4ZSUA 3O7UA 4XIMA 1XIEA 1DOSA 4LS2A 1Q66A 3KXQA 4LAUA 3MI6A 4UFKA 4A8RA 2J8FA 2GSJA 1NAL1 4YTUA 3KRBA 1PE1A 1VRXA 1IXPA 2Z1SA 2MANA 3UA3A 1FQ0A 1HJWA 1DJHA 4FNPA 3HG4A 2ESCA 2Z27A 5E6YA 1UP3A 3AOFA 1VKFA 2PE4A 4ZQNA 1VFLA 1L6SA 3L66A 2P76A 5A6LA 2YCLA 5U4NA 4K36A 1W17A 4JHOA 5DIVA 3IWPA 3GW3A 4GG9A 1BLIA 3UT0A 3IKGA 3D5HA 4TV5A 4JFVA 3RU8X 1N8IA 3R2GA 3PB0A 1GKPA 5I98A 4AYSA 3GLCA 2VDGA 2VCDA 2X7VA 3A9BA 4OQVA 5BROA 4HNUA 4GGHA 2O56A 3PJWA 5AYIA 4TTGA 3WQFA 2WLYA 2PP3A 4LW7A 2NVCA 4G9PA 5I6SA 4UUIA 2WHLA 2ZQUA 1KRMA 1WX0A 1XLDA 3E0LA 1WKDA 3WF2A 2VFEA 4ZQPA 3VIJA 2PDUA 1QATA 1I75A 4H9ZA 4YHGA 1C9WA 3W28A 5LA1A 1D8CA 5EBUA 2HRWA 1PJ9A 4MPKA 2YW4A 4CEUC 2CERA 3WN6A 3RRXA 3PPFA 5A95A 1EF2A 1E5JA 3W9ZA 4A4AA 1J12A 4DPQA 1DWIM 4NU7A 2GOKA 2WSPA 2PCQA 3TJXA 1E72M 4KCVA 5KZ6A 1XGZA 4BQ5A 4YHEA 4B3LA 5IBXC 2NV1A 4CCDA 2YDRA 3NUKA 1RK5A 3T78A 1OGBA 3GNPA 1EP1A 1NOUA 1DHKA 1YQ2A 4CD5A 4G6CA 1PIIA 1YKWA 2WM0A 1UD5A 4G56A 1EF3A 1XM3A 3UESA 3WNMA 2IXUA 3TU9A 2FGZA 3CZ8A 5DANA 1XRSA 4J3UA 4RL3A 1V51A 3WZ0E 4W4QA 4GNJA 3D3FA 4GQQA 3BJSA 4KRUA 2ZKMX 3LUOA 4IFOA 4RW5A 1Q1CA 1F5ZA 1S38A 1WZAA 2XP8A 4D6JA 1V4YA 2NUXA 1W9DM 1UMLA 3P14A 3ZIZA 4JAWA 5LGXA 5AOUA 4B15A 2DG3A 2P0IA 1H49A 3M0XA 5KEZA 1XIDA 1XKYA 1NWTA 5AYYA 3KS6A 2YYUA 4IOTA 1OC5A 3KVMA 3AIVA 1FKHA 3VOIA 3AS1A 1GJUA 1JRBA 4REQB 1ITCA 2WCSA 3A6OA 4QQ3A 4GINA 1DTUA 3EXSA 3URAA 1TWWA 1UWIA 1WP6A 4H6EA 1QBBA 3F4NA 1DYSA 1EX1A 2WHMA 1Y0OA 3BLEA 4HSNA 4W85A 1KFBA 1A3HA 3HF3A 3VIKA 2XH4A 5AHFA 3TQVA 2VEPA 2NQLA 4WF7A 3NSMA 2VDIA 2DIKA 3W22A 5BU6A 1QOPA 4GO9A 1TMHA 1X6LA 3B8IA 2PTYA 5RUBA 4JTIA 5HWNA 1CGXA 1X98A 5AKQA 4PMRA 3N73A 5K4XA 5BMXA 4DH0A 4R27A 1JGIA 4GX8A 3N34A 4IQJA 3IV8A 4OOUA 4PEEA 4LAKA 2ZUVA 4C6MA 4Q8WA 2OWCA 3FDKA 3ARRA 4HTBA 2RDXA 4DYKA 3WLKX 3BLOA 3U2EA 4QG8A 1B4EA 1XIHA 4KRZA 4U84A 4ZO8A 5J04A 1EX5A 3MHFA 4RR4A 2DUAA 1MFUA 1VC4A 3Q94A 3E0WA 3QLDA 4M5PA 1WBJA 2QDEA 3GAYA 1VBHA 3W1QA 1ZHAA 4RNFA 1VCGA 4WDUA 2PZ0A 4L4OA 4CU6A 5G4EA 5D04C 4AUBA 4ZOEA 2MPHA 4H1ZA 4UWMA 3SN0A 3A9IA 1E44A 2VURA 2F61A 3E96A 1Q5MA 4I7UA 2RJHA 2PI6A 4WVXA 4B92A 2ZX8A 3HA1A 4DX3A 1EC8A 4O4WA 5G1YA 3APYA 1BG9A 4AWUA 1LRNA 2DUXA 3PPCA 4C5ZA 3BAWA 3K5XA 4A6GA 2MLXA 1TPEA 3VK5A 4DVOA 4GUFA 1WQ5A 3LBOA 2I5IA 3M46A 4H8HA 3T0AA 4PRTA 5D2YA 2ZZ4A 2PTWA 5HUOA 3VGHA 1XCWA 2ZE0A 4ECLA 4HOZA 3A5FA 1UR2A 3I6TA 4G1KA 1UA3A 1GPWA 1F6YA 4KH2A 2ISDA 4E6MA 2BY3A 4RX0A 1H1YA 2V3EA 4PMZA 1LCOA 2A6LA 2VN1A 3LHVA 3R4IA 5FSEC 4IX2A 1M1BA 2YLLA 4J27A 1YNYA 4C6KA 5LIYX 1GKRA 4TO8A 4PBFA 4PA8A 4XZ9A 2EO7A 1O68A 3OEXA 3ELFA 2KAUC 1ZCCA 1EDQA 4IXHA 1V6YA 2NWSA 4O18A 4LRTA 3UR7A 1V8EA 3NIYA 3TFCA 3WNPA 1FKTA 4Q4KA 1W1PA 3N18A 4MM1A 3WQEA 4C7GA 1E1CB 2VGBA 1DJWA 4NI3A 5DELA 4MB1A 3WBXA 3YPIA 1BVNP 2PV2A 2OLSA 1TTQA 1Q4WA 3CASA 3OZPA 4XAYA 1C3FA 1F3XA 3CAQA 2A0NA 3CYJA 4GFSA 2VX4A 4C1NA 4AIEA 1B54A 1NOFA 3ISIX 1JD9A 2OO0A 1RVKA 3V3WA 1Q6GA 3LSBA 4MB4A 4C1KA 3H9RB 4A3UA 3QPYA 4FF5A 3PZOA 1H60A 4LVAA 4GIRA 4IUOA 3NTYA 2OZTA 3QLLA 4IX0A 1LL4A 2FHCA 2XPKA 3TQPA 3AU6A 1NMWA 3FKRA 4M6VA 4IISA 2FAPA 3PANA 1H11A 3H22A 1FWJC 3PRBA 2HBXA 2BHYA 1R2RA 4MY8A 1J6PA 3O8AA 2W66A 1XLAA 2Z1BA 5F1UA 7A3HA 3TFXA 3I3EA 4KCWA 4NYUA 1YRRA 1DPMA 1K6AA 3S5SA 4KBXA 4UB9A 3W1UA 2YBVA 4ZOCA 3W6MA 4N9EA 4QDMA 2FHFA 1Q6CA 1POJA 3KOFA 1P43A 3DG6A 3K8MA 1UQZA 1X1NA 4US6A 4Y9PA 2PWHA 2OYLA 4JBRA 4JX5A 1FY6A 2E5DA 1J10A 4PTDA 4DO6A 1OJXA 1GONA 3QZ6A 2CXEA 2UZ9A 4QJ5B 1KFKA 3CS2A 4R88A 2G96A 3W74A 2YA1A 3MJYA 1E51A 2V2DA 3BQ6A 5A3HA 2ABAA 1GOMA 4AVNA 4LAWA 4F2TA 5LXXA 4XZHA 3UZXA 4PTXA 2JFEX 1QI3A 4NP7A 4G2PA 3HGRA 3XISA 3LOTA 2HVMA 1V6VA 2DG9A 4DZIA 1K9EA 3CLMA 2QCMA 2G50A 3L4TA 1VBJA 4AVOA 1P6WA 5MHBA 3JZUA 3MW7A 3OPSA 2ZZ7A 2LPVA 2PC4A 3AYSA 2PA6A 2I9UA 3GHUA 3NXLA 3W38A 5D9OA 3O5LA 1JEZA 4W7VA 1KNWA 4FIQA 3QGKC 1I0BA 3AXMA 3TSDA 4QGCA 3K13A 5GJNA 1L2QA 1NP0A 1TPC1 1R47A 3L4XA 4RZBA 3T05A 2VZTA 1AMYA 3CBWA 3ZWTA 1W1ZA 4GK8A 4DI9A 4CU8A 3RR4A 1ZTVA 3PZMA 2PDMA 3T2PA 4W87A 1ZAHA 1EIBA 4Q7NA 4LBUA 2OELA 4QE5A 3CZGA 3M0JA 3VINA 4PMQA 2OYMA 3HPFA 1RQHA 3DIPA 2CLKA 2BXZA 5E1QA 1XDLA 3UI4A 3UXKA 3BG9A 5FF3A 1DWAM 4UTJA 1OC6A 3JRKA 2O7SA 3CMGA 1UUQA 2R91A 3QR1A 3PZVA 1UH3A 4JKMA 3N9SA 2TAAA 4E8CA 1TQJA 4N7QA 4DAIA 2G5WA 3LBMA 2PZNA 1CLVA 1WDWA 1E43A 3EMZA 3HJZA 4IGNA 4DXXA 5L6UA 4DAFA 4H7CA 3GU0A 1X97A 1FCBA 3SUUA 2XINA 4IT1A 5FEPA 3KABA 3GC5A 2BHZA 5CPTA 1A4LA 2TODA 3LHUA 1YTEA 1G7UA 1PSCA 5IXEA 1MW3A 4ZB5A 4MJZA 1G4EA 2WQDA 5CCZA 1KLYA 3RX2A 1PZ0A 1YDYA 4I7WA 3SCUA 3G1SA 3PUDA 4IJRA 3VDBA 4ITZA 3HQ1A 2YCIX 4DN1A 3Q65A 2UV8G 2CKSA 5DLCA 4UNLA 3TQKA 3NO3A 1S2UA 1JPMA 5TQLA 1JZ3A 3UZ5A 1ZALA 2VR4A 3BGAA 1R9XA 3TK7A 2FQIA 1JZ2A 4Q3MA 4Q8UA 4DUXA 5CPMA 1C9DA 2HISA 1GJPA 2PRLA 1ZU8A 3WJWA 3UQAA 1SW0A 1XLKA 2WCGA 1OFPA 3DFTA 1OK4A 2KO7A 4F0MA 3IUHA 2C71A 1R9ZA 2X2GA 2ZFAA 3AIBA 1D2KA 3LRMA 2VOTA 1F07A 1FFQA 3VTRA 3UVAA 1EYMA 1BTCA 3SRKA 1RLDA 4Q8QA 4JFKA 2V2HA 3M1ZA 5DX7A 5LNRA 4LY8A 1D3GA 2GJPA 1OFDA 3OP2A 4PTWA 1ODUA 4ZCWA 2RSEA 1N55A 2Y85A 1NFGA 1EJUC 1LLZA 4DXKA 4RE0A 4R9XA 2PDHA 2WVUA 5FL1A 4Y96A 5DRCA 2GUUA 1GCYA 4B5NA 2G3MA 4ODNA 1R87A 2A3AA 2BY2A 3KBVA 4IIFA 5EMYA 4LYRA 1TUXA 3L4ZA 1S5NA 4I7VA 2BXVA 1D7HA 3SN1A 2C16A 1UC4A 3W71A 1WO2A 1KTCA 4RE2A 2E9MA 4F0KA 1DXFA 3WH6A 4JFIA 1Y7VA 1KGXA 4ZE5A 4N2YA 2CCRA 4UBPC 1WZKA 4S3KA 5FEWA 4JZ5A 1G4PA 3MT1A 4JN8A 2A4AA 1F8IA 5J6EA 3O3RA 2XVPA 2Z2UA 4KR0B 4DYJA 1TPUA 1BSIA 1R9HA 2ZRXA 4L1WA 4OKDA 2ZUUA 2Z00A 3CUGA 4UTKA 4U28A 1QO5A 1XISA 5BXJA 1TR9A 2CLOA 4WHBA 1UD8A 3CM4A 2VX6A 4Z2LA 1XBXA 4MTVA 1TPH1 5IHRA 2CC0A 4MLRA 3VZZA 1BXCA 3VNKA 1FCUA 4BQ2A 4EPDC 2BY1A 2F6KA 3AUJA 4FP1A 4PUNA 4WXYA 1SSGA 4ODRA 2WZHA 1TCMA 1O94A 1XRVA 4AWSA 2KI3A 3F5LA 3K30A 4HCHA 2FLIA 1EH9A 5IDZA 1IX5A 1BQGA 3GH7A 1V6XA 3A4AA 3ALGA 1JRCA 1QHPA 3HGSA 4RNHA 5HNNA 2IUZA 4UTHA 3B97A 3KAHA 3QTPA 1SJAA 3PZUA 2AL2B 2Q3RA 1MVYA 2OOFA 2QCDA 3AS0A 3EX4A 4OWGA 2Z1KA 6CGTA 2E25A 3PWIA 3WX7A 3L4WA 4UQCA 2OKTA 2XSXA 3V36A 5HATA 3NQCA 2FKEA 4AG0A 4MZ8A 4W8BA 4FX8A 2I56A 3ARUA 1SZFA 2GDQA 3R0DA 1XV8A 3HM7A 1NOWA 3BO9A 4NNAA 3U6WA 3QV6A 4GYPA 4ZL1A 1WOAA 1XBVA 1KFWA 2J6VA 2VENA 2VFIA 2VZUA 4L4MA 3OIHA 1B3XA 1VF8A 4BZYA 1J6YA 2XWEA 4MGGA 2FH6A 3G0XA 3R8HA 3N6HA 1EEPA 3MSYA 4FZIA 3CT2A 1JYXA 3WG6A 1LJYA 4MYXA 1YDVA 3VC6A 1GYNA 5JVLA 2WNWA 4AF0B 4O0ZA 1VYRA 3PBGA 4ZGYA 4UTWA 1CIUA 1PTAA 4DZHA 1RALA 2WMIB 2C1IA 4CNSA 1PKYA 2DUZA 2AAMA 1L9WA 1PBKA 1QOXA 3M0YA 2W61A 4IIBA 3DDMA 1Q4NX 2INEA 1W54A 4YU1A 3BCDA 4K37A 4KGJA 4NYYA 2OQYA 1XG4A 3KOYA 4RPPA 4GMEA 5HULA 3WQVA 1ONXA 4NAEB 3DFYA 4LVBA 4ACZA 2AGKA 3BAJA 3T1GA 1SSDA 1OZMA 3VAWA 4LALA 1YDNA 3TC7A 4J3ZA 3AJ7A 1XLEA 3DFHA 3RPMA 1MW1A 1RUSA 3TMQA 4P8VA 3BAIA 2YB4A 1TRDA 4ILSA 4DRMA 1W3LA 4H2CA 3G8RA 3U2ZA 3UERA 3TYEA 3QF0A 1HNYA 1QAPA 1Q85A 3IIVA 3AMDA 1KBIA 2QPSA 3ZT6A 3OJGA 4D71A 1XSKA 2J7GA 4XD5A 3II1A 3NEHA 5C7VA 3QBUA 2BMBA 4W9QA 3Q2DA 3GW0A 2PWDA 3SI9A 2AL1A 3M4HA 1XICA 3AWNA 1YW5A 1JCLA 2TMDA 3P3BA 5JH8A 1JD7A 2GLKA 4PUWA 2C79A 5LIUX 3BDKA 2A3LA 1JZ4A 2OYKA 3GYEA 3GKAA 3CPUA 2PODA 4U31A 1ZSXA 1VYPX 4RNJA 5HJLA 3IK4A 5JU6A 4G2DA 2ZE3A 2H8XA 1H5YA 3ITLA 3R8GA 4IH3A 1X96A 2NX1A 3MU7A 2X7WA 3SCRA 3ODKA 3PN8A 1ZY9A 2XN0A 2PWGA 2ZA1A 1BVZA 3SZ8A 3WJXA 5D8WA 3N6QA 4YYFA 5DY2A 1WBHA 3DAQA 2V82A 1QR7A 1VR6A 3EWCA 3A47A 4H01A 4LTSA 3PNZA 2J7DA 3BICA 1U83A 4MKSA 2CZEA 4R34A 1X38A 4HZ6A 3UYIA 4AXNA 7ODCA 3SGGA 1ZBWA 1DKWA 3A4JA 3L0NA 1O1HA 1E6XM 2EPLX 4LY4A 4F0LA 4F48A 1VPXA 2RFGA 5LIWX 3GDLA 3URNA 3LNPA 2HDJA 2JEPA 4XAKA 3NURA 4HPHA 2ATSA 1A5OC 1HVQA 1AQ0A 4MHBA 3OA3A 3K4DA 4V33A 4CQCA 4BF8A 2VGIA 3M41A 1BYBA 1GT8A 2A6NA 1GOOA 5BRQA 2WW5A 4JN7A 1Q6QA 1GOKA 1RBAA 4ERGA 4J4KA 3TQ0A 1AG1O 4YCPA 3R6IA 1I0DA 3DX5A 3OA5A 3QW4B 2IMRA 1S5WA 2CZDA 3C2EA 3UI5A 1T41A 1OF6A 2E3ZA 3CAVA 4DEFA 3H7RA 2PUZA 4CU7A 1LRQA 2N87A 3ARWA 4PN2A 4AZ5A 1OX6A 4JTLA 1W9VA 2IKIA 4MAVA 3WH7A 2VC6A 1LBLA 4MVAA 1I9CB 2BWGA 3NJ3A 4L6HA 3OVQA 4AHPA 4M8UA 4YNGA 3EZ4A 3O5PA 3IEBA 4BFAA 3NPXA 4DJEA 1JCMP 1HKJA 4F9JA 1XGDA 3GG1A 1V77A 3QY8A 5A6AA 3E2SA 1PXGA 4Z1CA 3IK2A 3TYAA 4Y8EA 4RCXA 2XP7A 1FH9A 5KMYA 2IF4A 3EOEA 1Z8AA 2YXGA 1KTNA 4CQ8A 1PKMA 1YMYA 2DZVA 4MADA 1XI3A 3AXKA 1U1JA 3RLGA 3OGRA 3O6CA 3NEVA 1EKOA 3T44A 1RBOB 1TPFA 3FJNA 3KDNA 1VEPA 3KADA 1OBAA 2OX1A 1ML1A 4KEZA 3AYVA 2DZPA 3RLVA 3UEQA 4RXFA 2D2JA 4D1IA 1B3ZA 1DJZA 3WLTA 5JQ9A 2YGYA 1MW0A 3EMCA 2IPJA 5JMUA 5GNYA 1E1EA 5M5DA 4A2SA 3AXHA 3PSVA 2MNTA 3VD3A 3AZTA 3KLKA 2J27A 4EIVA 2ZVRA 3I4EA 1JF6A 2PTXA 5F2LA 4MYAA 3C0LA 4LOCA 3DYPA 3VGEA 4DWSA 3GG0A 3GR7A 1IYXA 4TW6A 3R43A 3BLDA 2X16A 2XM1A 2DVUA 3P0XA 3AHTA 1AVAA 1BPLB 5JXQA 1VYSX 1I2OA 1PZ2A 2C7FA 1NH6A 1KXQA 3QM3A 3CTTA 5LZLA 4OUEA 1PVNA 1Z6KA 1E0WA 1A0EA 1J96A 3NWRA 1UPMB 4P8UA 1IWPA 5J5DA 5BRBA 2VQTA 3TN4A 1EJ7L 4DF2A 4HA3A 2QIWA 4B91A 1EJVC 2BLEA 4S3CA 1EDGA 3O05A 2YJQA 3U4AA 4RE3A 4DB7A 1MYRA 3TYBA 3UXAA 4XD6A 6TIMA 3VM7A 1VZWA 2YL6A 1QT1A 1SMAA 4GO8A 2D2GA 1ONRA 4YS1A 2XN2A 1KM0A 4HU3A 8TIMA 1MW2A 2QUUA 3VOJA 1R0MA 2FZMA 1WA3A 1L1PA 3ZVIA 1SUXA 1VPQA 5H6HA 3LEPA 3ARTA 1D7FA 4DROA 4IZGA 2WPGA 2PDYA 1PYFA 1G0CA 4FS9A 3MSDA 1JIBA 3B0PA 1GTHA 1P7TA 1PPIA 3G0SA 2PLJA 4DY1A 2EEXA 1HGYA 5FD0A 2ACUA 2ISWA 1TV3A 2J25A 2VRKA 2PPOA 1I2NA 1RA0A 3VOGA 4GI9A 1KWKA 3GG7A 3E2VA 4S38A 3CXOA 4M0XA 4UTLA 1CECA 4QSFA 3U5YA 3VIHA 3SRHA 1XH0A 4KRTA 1KM6A 9CGTA 5D8ZA 1A5AA 4WKAA 1KGUA 3SUVA 4QNEA 3C2FA 4WJXA 4XQ6A 3NTPA 3MMUA 4MWAC 3Q4DA 1BL4A 2G4FA 1CYGA 4AZ6A 4F0SA 1HIZA 4H04A 1D3HA 3KW3A 4NJHA 4S2BA 1TCOC 3MWAA 2F8QA 1QNOA 2X1SA 3BMBA 1DJGA 3ARSA 3CQKA 5BOFA 3THDA 3MZNA 4KEUA 4OECA 3B0XA 3GU2A 3W7IA 2Y5JA 2QCHA 4HPGA 4QLLA 4GYKA 3SFKA 1ZNNA 4DLFA 3I7RA 3BOFA 2A3CA 1GOIA 3RFWA 3H2CA 3EYPA 1ISWA 1FWIC 3FA5A 3TIMA 4WZHA 1DIDA 1UOKA 5CJMA 3GAKA 3SUTA 2QCLA 4E2OA 1G01A 4PGLA 5AC4A 3HFYA 4ASTA 3GFYA 2Z6JA 3GKFA 2HJPA 4FHAA 1HX0A 3VABA 3DN5A 5CG0A 3TV8A 2PN0A 4KESA 6REQA 3T0BA 8XIAA 3EPMA 5ENLA 3WH9A 4W88A 4WDTA 3TLLA 4MNKA 1NQKA 4JQAA 3IJ7A 5JH2A 3V1PA 8XIMA 4KEVA 3RM9A 4LUSB 1QZ2A 2WMHA 3GDRA 3VKBA 5DCBA 4Q4RA 1QI2A 3UZZA 4AX7A 4JXCA 1TSIA 4RK8A 3ZWSA 1J79A 1XYCA 1V3LA 1XJBA 2Y63A 5C54A 1X1ZA 3LU2A 3H12A 1KV8A 1V6WA 4N9CA 5I3KA 3ZJ6A 4KIEA 1QU4A 3EDKA 2ZOXA 1KA9F 1PIFA 2YZRA 1OD0A 2AMXA 2XU2A 1BAGA 3VNIA 3EDDA 4IMFA 5AC6A 2BASA 4TMCA 2J7CA 3QQ1A 1XYAA 2GK1B 3GHTA 2P0OA 1UPPA 1TMLA 2F6UA 8CGTA 2FKPA 3VGBA 4GC4A 2HNHA 4TUFA 3A64A 3BG5A 4HVXA 3URBA 2BVDA 2IPFA 5F2GA 5BW6A 1W3TA 4AZCB 2GQAA 2XG9A 3QJAA 1IGWA 1YNQA 3LZ5A 7REQA 4U85A 5CG7A 3SSZA 3EX2A 3CO4A 1I1XA 3MKCA 1XL9A 2X30A 3EOSA 1W2VA 3TYUA 3M5YA 2Q02A 4OV9A 4DBWA 1E3XA 1CLXA 5KZMA 4MIMA 1W9PA 2WVVA 3S1GA 3C5QA 3P67A 5E09A 2D2HA 2UY3A 1E0XA 1GVYA 3LK6A 3W7CA 3TX9A 4JX4A 4Y9AA 2GUBA 1ZFJA 4GA8A 4BQ4A 1BD0A 1L6WA 1OC7A 1LBMA 4ORMA 1D7IA 3W7NA 2GGHA 1VLWA 4L61A 2NUWA 2KX9A 2PU1A 2DSKA 3LPPA 1IEQA 2RUQA 4I6KA 3GR8A 2FTWA 1P0DA 1QCWA 4YJ5A 4DRIA 3UQNA 3EA2A 5U7SA 4QAWA 2WNNA 4X2RA 3JU2A 4GI6A 4Z0JA 2TYSA 3ZFHA 1D8WA 3AHVA 3HFTA 4QE4A 2EPMX 4H00A 2DIEA 1H7NA 1RY8A 4PMUA 5EKYA 2Z29A 3QMRA 4HQVA 3MHGA 1XCXA 3FS2A 1VLIA 4OOZA 4M29A 1JNEA 4GJJA 3GO2A 3ITGA 3MCNA 4WUIA 5T91A 5K7JA 1B2YA 1WDDA 3PR2A 2PDPA 4GNKB 1T40A 3EEZA 4LT9A 3B9DA 3W7EA 3RX3A 3U2CA 3TTOA 1IV8A 3QFWA 1MEHA 1BFNA 4XVEA 2DSZA 1PUDA 4L80A 4H4IA 2HPMA 4QCFA 2X1IA 2J8TA 4R9OA 4D6DA 2FZ9A 1J2BA 3F4VA 4IIEA 5M17A 3ZQ9A 3W7RA 1BKFA 4ADUA 2X41A 3PAOA 4BA0A 2FHBA 4NXKA 1W3HA 1IZCA 4BHYA 3SCPA 1Q8AA 5D2TA 3I65A 3L7RA 2O55A 1BKHA 4YMZA 3GY1A 3TOPA 2C1HA 4A2RA 4AMAA 2EQDA 5DF0A 3C0SA 2Z28A 1O5XA 1XP3A 3DESA 4RZ6A 2ACRA 5T8GA 5EFFA 3MMTA 3VMPA 3UZYA 1FWBC 1MO0A 4LXFA 2I5QA 4W9PA 3ABOA 4DJFD 1P0BA 3NSNA 4I5RA 4JIRA 1CGUA 2ZUNA 1XH2A 5HWJA 3BLLA 3GX9A 1M7PA 2EPNA 4XISA 5KSWA 4FNQA 2VYOA 4S39A 4XSMA 1TPVA 3U7VA 1UR8A 2PWUA 3VNLA 2HEJA 2FMOA 4UFIA 3LY0A 2FZNA 1IR2A 2E9BA 2VQUA 1PCKA 1OCQA 1M7JA 1JG9A 4AZ7A 4DRPA 1JCJA 3LNMA 5HINA 4NX5A 1GQJA 1FDZA 2DZSA 4FAPA 1AD4A 1PEZA 3OLDA 4X0NA 3I3BA 3KACA 1RJRA 1MQRA 3R10A 1J5SA 1XYFA 4LUIA 1Z69A 1Q3NA 4RDWA 1W1VA 4WD0A 2YPIA 5CZ0A 4GZJA 2CHOA 2VI0A 3T40A 4ZQMA 1XYBA 3UG5A 2GVLA 3KM8A 4JFTA 2B4GA 4LBRA 4GQGA 4GRSA 1K8XA 1OEPA 2YXXA 3NM1A 1XUUA 1W32A 5CPNA 1DQXA 3B8UA 2VT0A 1VFFA 2E8ZA 3O06A 3GH4A 2OLHA 3WQOA 3W1AA 3W7LA 1EJWC 2V9DA 4OTKA 2C3ZA 1U33A 3W7KA 3H4WA 1VHNA 3D3AA 2G3FA 4OV4A 4RPQA 4YWSA 3KBJA 1W31A 2A7PA 2KZHA 2CU0A 2GGIA 5HW7A 1BTMA 1GQLA 3VGDA 3VNYA 5C8BB 7PTDA 3ATZA 5I0DA 2DU2A 2X0YA 3NQBA 3A23A 3W25A 3CT7A 3EX3A 3PUEA 3DFSA 2Y5EA 4G8TA 4Z08A 5AC7A 1JZ6A 4O8RA 3SQLA 1ZL1A 4KETA 3VD9A 3NGFA 4LUJA 3B9AA 3FX4A 2BOEX 3NPVA 4JYEA 3GUGA 4PRWA 1XR2A 3TE9A 4IFKB 2DZAA 1LUCB 1Y0EA 2AMGA 1FWEC 1UWTA 2E4TA 2MNRA 2ZIDA 3IGXA 4QNWA 2WNQA 3JR2A 1NP2A 4B5TA 3W4RA 3A4XA 3LN3A 2VMFA 1AJ2A 3S9YA 2DP3A 5H2ZA 2POZA 1QPOA 5CC5A 3NPWA 3E38A 3PVFA 3R79A 3CV2A 1KV5A 3DFPA 4W5UA 1JFXA 1WDRA 4LVDA 1Q6DA 4O8AA 5CPLA 2AOSA 5C7HA 1T5AA 1WE5A 2J9XA 2YW3A 3WO8A 4C02B 3UJ2A 4NXSA 4LYQA 5JUVA 1UZDA 4D8AA 3N6JA 1ZS2A 2Q01A 4A3HA 3O5EA 3IPWA 1TA3A 1MMFA 1QK0A 3GB6A 2XP3A 4ZMGA 1SQ7A 4UTIA 3A24A 2G37A 3AJXA 1RD6A 4WLCA 3WD2A 1PO9A 1XIGA 1XF0A 3OQ8A 3VE9A 2QULA 1PL9A 1DP0A 3H2OA 3RFAA 3FK4A 4BY3A 3UQIA 3N2TA 1QI5A 2XIIA 1Z9AA 4E4PA 4H8VA 2RUDA 1BXBA 5CZJA 3HGJA 3KL3A 4WOZA 3NQ2A 2XWDA 2HV5A 2O9RA 3KS5A 3NZRA 3W1MA 1GGOA 4NRRA 4DBDA 1VEMA 3KP1A 2DY3A 2E40A 4DJEC 3BJFA 3ANVA 3POHA 4IFRA 4ODKA 4C6BA 5D02A 1XLFA 1VD6A 1AL8A 1LBFA 4XBSA 1KFCA 4UFMA 1AH4A 3ZLHA 1ISZA 4O0KA 3N13A 2YCLB 3EWBX 2V0TA 2WSKA 3MDYB 2DJXA 4GXMA 1NARA 2HS6A 2QCFA 3N2CA 3SAZA 3TAKA 3IIOA 2P3ZA 1UMYA 1VFSA 4D2JA 4Z2HA 5FKYA 4H7ZA 1K8ZA 1E56A 2E28A 3C56A 1KKRA 1YTKA 1V0NA 1X39A 1VCFA 3OVPA 1HP4A 3VIFA 3UR5A 1SGJA 1H5VA 5GJPA 1Q6IA 1JXJA 1VFTA 3O2LA 2DW6A 4HN8A 1JQXA 2VCCA 3SQMA 4IG2B 2Z1VA 5AYXA 3MC5A 3WD3A 3N4AA 1KBJA 2QCCA 3P8JA 5CC7A 1JYVA 4PCTA 3KBWA 1IZKA 2AWGA 2MUCA 4D6HA 1A47A 4HD5A 1UOZA 4X0VA 3LQLA 7CGTA 1TWZA 4QCEA 1US0A 4FNTA 2Z7KA 2YR1A 3T0DA 3GM8A 2CLEA 2C14A 2RDWA 1W9BM 3PTKA 1BKSA 2WBGA 1B5TA 3MUCA 1AJZA 2B31A 1PX4A 5CSRA 4FMVA 1NJJA 1WKEA 1JJKA 3WF4A 2EPOA 4D6CA 4CD7A 4MDOA 3W2MA 2ZQVA 2XFWA 1TELA 1DV7A 3P2VA 1HO1A 1WXZA 4WOQA 5I06A 2WJEA 3A13A 1A49A 1XLGA 4H8NA 5FJTA 3MMDA 4LYPA 4QM1A 4GABA 4B2DA 4HNTA 4FB7A 4QDPA 5CGTA 3AXIA 3MDUA 3VC5A 1ROUA 2A5HA 3WEZA 4NILA 3GU9A 3PTMA 1XLHA 2WAGA 4LVFA 3UR2A 1ISXA 1EOKA 1W3NA 3WLPA 1AJ0A 3WF3A 4EP8C 5CZKA 5MKGA 4H7VA 1LT8A 5FJUA 4C90A 2DZBA 1EBGA 5E6ZA 5FF4A 4QAIA 3UPMA 2HMCA 4GOAA 1ICPA 3MVTA 1BWKA 2HBVA 3S9ZA 2WZIA 4C6DA 2BHUA 3F7JA 2G3JA 1YTDA 4MB3A 3GIPA 3SM0A 3CV6A 4UQAA 3WD4A 4GLEA 1H63A 3FVDA 3L0GA 1XS2A 3NA8A 2BXYA 3W26A 4X2PA 2BDQA 1PKNA 3PFRA 4HNOA 4NG3A 1ZJHA 3W87A 2E8YA 4UQBA 1KBBA 1M68A 1UG6A 2ZWYA 4ZZ9A 2ZR6A 1XD1A 4N19A 2D0GA 2Y89A 4EPBC 2EHHA 1N7KA 2JKEA 3GTNA 2E6YA 2OWWA 3APTA 1H51A 3W2LA 3U5UA 1VEOA 4GE8A 1QW9A 4HJWA 1MUMA 3UGVA 2OOGA 1XYLA 1DXEA 1XW8A 2FIQA 1AW2A 1I2RA 4F40A 3TXVA 1HJUA 4WGHA 3TDFA 3WDIA 4C6QA 4U4MA 1VJZA 1DE6A 4FA3A 1P1MA 3ZSSA 2QQ6A 1K1DA 4TV6A 3UWYA 1YHTA 1C8VA 3I6EA 2V6AA 1HZYA 3K1GA 3GYCA 4HNNA 2H9AA 3ZLGA 3VILA 4N02A 4FOJA 3THCA 1Z48A 4NZ4A 3ZT7A 3VIOA 2ZUTA 3HQPA 5G2IA 4QIBA 1S3TC 3BSMA 4O13A 3I68A 2ZX5A 2DDXA 2G97A 4AQLA 4Z2IA 2PDLA 2ZX9A 3WELA 2YXOA 5F4XA 3VIMA 4S3AA 4Z1BA 4ZSTA 1NSGA 1LG2A 3PPHA 3KRZA 4DRQA 4M56A 1UHVA 3RK8A 2PWFA 3O1NA 1W9UA 1NIUA 3TYZA 2DG4A 2D24A 1OB0A 3K46A 2YCEA 4HZ7A 3ALFA 2CLLA 3VDAA 2FTYA 4YN5A 1H50A 1C8QA 2HXTA 1S2WA 4K68A 5BCAA 3QZEA 5G4WA 4R5EA 1NDWA 3DENA 5A8QA 2ABBA 3ITTA 4Z2GA 2Z7GA 1FKRA 1AQMA 1VFOA 3WLSA 1H7XA 1Z89A 1EA9C 2FVKA 4QJ3B 4YTQA 1UWRA 3MMWA 3KCLA 3WDPP 1R3TA 1QWKA 2VR2A 3KFTA 2CYGA 4CLMA 2Y61A 2PDXA 1FX6A 2J9ZA 2OEJA 1VQTA 3LCHA 3BXWA 3EWWA 1AUSL 3Q67A 3R12A 2XISA 1NVMA 5M1TA 3N2MA 3PRAA 3OBEA 3S83A 1R7AA 4QQUA 4HNLA 3ITXA 3DBNA 1FAPA 3OB8A 3E5PA 2HPIA 3VUPA 2ZQSA 3QQWA 4EF8A 3R8RA 1LWJA 2IQDA 2PS2A 1P4CA 1Y5WA 3NQGA 1UZ1A 1GQKA 4HN4A 3M0MA 2OSYA 4ZA0A 3XINA 3O16A 2O4QA 3I6RA 4LH8A 1US2A 2WVTA 3W24A 4O1FA 2ZXBA 5M03A 2QJMA 1AMKA 1OINA 4FXFA 1S2AA 5AHMA 1OX5A 3CU2A 3SCSA 2QV4A 1JYWA 2E5CA 1XDJA 1JAKA 2AQWA 5FEXA 5D9MA 3LG3A 1PHWA 2HVNA 2A3EA 3OLEA 5I3IA 4AVFA 4C1NB 4GIEA 5EPDA 2HK0A 3O15A 3NZ1A 4M3PA 1Z41A 3PNUA 2DSVA 1OGSA 4K6AA 3N12A 4XO6A 2QZRA 1SW3A 1FXPA 4MKVA 4Q8MA 4MLJA 1FOBA 3U4FA 2VRQA 3KLLA 5H8PA 4HK5A 2X05A 3STFA 3KL0A 2NT0A 1UB3A 2ZR5A 4NHVA 3KX6A 2KGJA 1SW7A 5FF2A 1UP2A 3FY1A 1IIGA 5F7UA 4G1NA 1GZJA 4HSOA 3C8NA 2VR5A 3GIYA 2IXVA 3QOKA 4EAMA 1I8JA 1IXOA 1VJIA 1E0TA 1CXKA 2I9EA 1TQXA 1JZ7A 3F5JA 2PP0A 1SZGA 2PDNA 3NO5A 4IGHA 3M0VA 4GCXA 3CIXA 4FSAA 2J9YA 4GH1A 5LKYA 2HE8A 3U0HA 3M6YA 3ZS4A 3U3HA 3BTNA 1O12A 4AY8A 1AZ1A 2W91A 4Q7BA 4LFYA 1C7SA 4KQNA 1PWMA 4KQZA 3F4DA 4PTMA 2MLZA 2FPTA 4DYEA 1EQPA 2AGTA 3APGA 3CL6A 1FKSA 5CGQA 3U7BA 3UWWA 3ZVHA 3NDYA 1DWGM 1M7OA 1SM9A 3EDJA 3EOOA 3COTA 2O9TA 2Z4GA 2QAFA 1V02E 1K3UA 1EO5A 5KINA 1H41A 4I9MA 1ZP4A 2GQ9A 1Q6UA 1V6UA 2D22A 2GL5A 4LAYA 1UH2A 3T07A 1JAEA 1YE6A 2FJUB 3ITCA 1GW9A 3EKLA 4H9VA 4WY0A 2E6DA 3KAFA 4J40A 3GS6A 3AC0A 3G1RA 1E40A 3A3XA 3T2QA 2WZMA 4I8YA 3G6LA 4ATDA 3PBWA 3VGFA 4QTGA 2E6AA 4JPGA 3GDBA 4DRHA 4QROA 3MUZ1 3E0FA 4O10A 3R7MA 3IK8A 2PGEA 1OCBA 2JGYA 3KUMA 1HQTA 3N4FA 1A7XA 2VFDA 2VC7A 3NZQA 6TAAA 3BPWA 4D6IA 2BOGX 1CB2A 2PLCA 4G7EA 4KWVA 4NRSA 1OYBA 3ZR4A 2I5GA 3MUAA 3LLFA 1WDSA 1SJCA 4N4PA 4J3VA 2OXNA 4JTHA 1FFRA 3NNTA 1OVDA 3H4GA 1MXSA 5I09A 3VD7A 2OTDA 1W2PA 3JW7A 4QLKA 3SCOA 1G6CA 1T11A 5TF0A 4IT4A 4QXIA 3I3DA 2G0WA 2C0HA 3FEQA 2FDSA 4BI5A 4XZMX 3EA1A 1A5BA 1VCVA 2ANUA 3RHGA 5I00A 3S4TA 4HMDA 3PJXA 4ES4A 5E93A 5HMFA 3WLRA 3HMJG 2PGFA 2NXHA 2FGBA 4GGQA 1KWGA 2VO5A 2PPNA 3CUFA 1QNPA 4F0RA 3MY9A 1M04A 3MDWA 4W7WA 1XWYA 4NNCA 1Q7ZA 1MWOA 1LQ2A 3B03A 4GZIA 4LC8A 2NQ5A 1EOMA 2F84A 4BF5A 3PPGA 4AX6A 5A2BA 3RN6A 5BWFA 1IWBA 2WVSA 1K7EA 2LLEA 1NWUA 3IJLA 3ITOA 6ALDA 1J8VA 3ME3A 4L6OA 4UTFA 3ZM8A 2PDBA 2VJXA 2QPXA 5EMJA 1VPYA 3BLFA 4Q8TA 1XQKA 3TCZA 1V3MA 1YBQA 3WQ4A 3NM3A 4YYCA 2RUSA 4IQLA 1E6NA 1GKQA 2VVSA 3AHZA 1VP5A 5EMMA 3FLUA 2E7FA 3LCXA 4GPNA 1HTIA 1DIEA 1E6PA 1QBAA 4PCSA 1H62A 4BI6A 3H2FA 4ACYA 4EAYA 2IKJA 3LV6A 2JF6A 3B0VC 1GPFA 1TB3A 5J8LA 3B04A 3QZAA 3EDEA 2PLMA 4YPJA 2D3NA 2B7PA 1R3SA 3LCGA 4TVUA 3KTSA 4L64A 1S2TA 2FPYA 4DWSD 1E1FA 4Q6XA 2V2CA 4JQ3A 1KC7A 4BKNA 4NSBA 4H3DA 3LI0A 4H6RA 1V93A 4GI8A 1EJSC 3F2DA 4XB3A 3WH5A 2Z0IA 3NDZA 1R3WA 4OIFA 3O5DA 2J47A 1QTWA 1DJXA 3GVGA 3A3WA 4CCZA 4A21A 1W1YA 4GYFA 1PTDA 1EYWA 2O92A 4R33A 5I02A 1ECEA 1SZNA 3UNDA 1HL8A 2ZA3A 4J5NA 2X09A 4XUYA 4MSPA 3RGTA 2YLAA 3RCNA 2RAGA 1TWSA 4GY7A 5DCDA 4FLSA 3TWAA 2IQ0A 1QJWA 3M0KA 1W1TA 3M44A 2QJIA 2ICSA 1Q8JA 2B7NA 2Y70A 1QOQA 3TKFA 3KDOA 4GQ0A 4FXSA 4ONVA 4C91A 4H41A 1N1AA 2FB2A 4DJDD 1J4EA 1FKWA 2VOMA 1GYMA 3DGBA 4H6KA 2OSWA 1MFVA 3VFCA 2DZUA 1ZRQA 3T8QA 1LWHA 2Y4SA 1W0MA 1RPKA 1QI0A 1O66A 3DUGA 1V3KA 5HWMA 5EU9A 4FNRA 3IUDA 4IPNB 2XH7A 5CSSA 2GJNA 3QTGA 3WBAA 2F4EA 1AQFA 3FJLA 3DHFA 1CGTA