1TFVA

Crystal structure of a buffalo signaling glycoprotein (spb-40) secreted during involution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mammary gland protein 40
molecule tags Signaling protein
publication title CRYSTAL STRUCTURE OF A BUFFALO SIGNALING GLYCOPROTEIN (SPB-40) SECRETED DURING INVOLUTION
rcsb
total genus 107
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1tfvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tfvA01
4IISA 3W53A 3VVGA 5DF0A 3L4UA 3KL5A 1E15A 3CZJA 3EMCA 2WBKA 1UWQA 5A2CA 1V02A 1B9ZA 1NOWA 1Q4NX 3RM9A 2DDXA 2D0HA 1UWTA 4IUGA 4QLLA 3BGAA 5E70A 1KFWA 1SMDA 3WH5A 1WDPA 1UG6A 4NF7A 2YIHA 4U3AA 4B16A 3VDCA 3WDJA 4LGXA 1DP0A 1LQ0A 5A8PA 2BHUA 1BLIA 3CLWA 2PF0A 4U5KA 1V3KA 3GXMA 4AIUA 3KE0A 1PIGA 1GONA 2FGZA 2YOCA 3HN3A 3T08A 1J01A 3VIJA 3WD4A 1DWAM 2WCGA 3DHUA 3DYMA 5BXSA 1C92A 2F8QA 3OLGA 1ZB5A 4UQEA 4D6JA 1B3YA 1GQKA 5LA0A 4JFSA 3TA9A 3VUPA 2J7BA 1LJYA 4W8LA 4URIA 3ZSSA 2EO7A 2VL4A 1GCYA 1W9PA 1BSIA 5CLTA 4AIOA 1PAMA 3W4RA 3SEPA 4AEFA 3QHOA 3VPLA 1JL8A 3AIWA 5JIPA 1J9YA 4W84A 1E3XA 5CSUA 1V6XA 3I3DA 3CHFA 1CGVA 1CLVA 1TR1A 3AQUA 5HDRA 1E0XA 1KGWA 1G5AA 4HA3A 5BROA 1VJZA 4Z2IA 5BCAA 1AQ0A 4PCSA 4TTGA 1EDQA 3O6AA 2XJ7A 2GDVA 5M17A 3A3HA 1Q6FA 4X9YA 2VRJA 1XC6A 2FHBA 3KEHA 3AFBA 1GQLA 3GTNA 3DECA 1WKYA 1E4NA 5FCZA 5AYBA 3T2QA 3AI0A 4HP5A 4AZIA 3CZ8A 3OGVA 4D71A 1JGIA 4HOXA 2WCAA 2CXGA 1BYCA 2PWGA 2J8GA 1V3MA 2EPKX 1CXIA 2Y2WA 4M56A 4ACYA 2DH2A 1UHVA 3NSMA 2CITA 3WD2A 1E4LA 2BFGA 1OSEA 5D4YA 3N17A 1SMAA 5CLWA 2XYLA 4BQ2A 2W67A 3I3BA 4GIAA 1CXEA 1TUXA 1BYDA 2GK1A 3WELA 4AZGA 1EOKA 3BSHA 3UETA 1K9EA 4QLKA 5ABFB 4A3HA 1GPFA 1GHRA 1XCXA 2A3EA 4E8CA 2C0HA 5FD0A 2TAAA 4ACZB 3WL0A 5AY7A 1IZJA 1E6ZA 1XSIA 1X6LA 2BV9A 1B90A 2D22A 4IM4A 3AS1A 4Q22A 4S3KA 4HPHA 2CHOA 1OT1A 2QHAA 2NT1A 1VFUA 5AYIA 1DWHM 4Y7EA 1K6AA 1XD1A 3W6MA 3WQ8A 2CIPA 2RGMA 5A2AA 2WAGA 2PC8A 3MO4A 3ZQ9A 3QHMA 4ZENA 1MW0A 1JAKA 1J10A 5DO8A 3N13A 2YA2A 3EDJA 2EPOA 1W3LA 1OGSA 1EXPA 1TG7A 1TZ7A 2QPUA 1UWUA 1ZJBA 3F4VA 5EBAA 4BS0A 1G0CA 1V0MA 5AC4A 1CGTA 2HVMA 3BAKA 4BQ5A 2QV4A 2J7HA 4Z2KA 4GKLA 4KGJA 1OCQA 4WSJA 2DT3A 4JKMA 2Y4SA 1J0ZA 1VBUA 1HXJA 1CEOA 3AXIA 2D1ZA 2DSUA 3THCA 1U2YA 3EDKA 3GM8A 3U7BA 2J4GA 3NSXA 3RJXA 2C7FA 2CKRA 1TE1A 1CNVA 4AD3A 3CUHA 1WP6A 3QHNA 3WH8A 4P7OA 1FOBA 3PTKA 4W8AA 2OYMA 1W3KA 3B8SA 2BVYA 3OA5A 1H2JA 1WO2A 4AZ7A 1HIZA 2XVKA 1ECEA 2JFEX 1UKQA 4WLCA 9CGTA 1W1PA 4L4OA 4PMZA 4LYRA 3WEMA 2ZUSA 2G3JA 2CBJA 1UYQA 3OB8A 3VMNA 1QVBA 1PX4A 3UEQA 4D6FA 4AD2A 1QI3A 1UA3A 2FHFA 2VVNA 4J27A 5IDIA 1CIUA 4M81A 1JD7A 2BXYA 3AIBA 1HKKA 3BSGA 2XFFA 3GH5A 4MB4A 5KZ6A 3KL0A 2WB5A 6CGTA 4MB5A 3TONA 3FAWA 1V0KA 3ARVA 2RGLA 3VIGA 4AEEA 5BXPA 2X0YA 1VEMA 3RDKA 1Z32X 2W66A 5FKYA 1LWJA 4LYQA 5LYRA 4PUDA 2ZICA 4B9YA 2XWEA 2WZHA 2WLYA 2XPKA 1UH4A 3PTQA 4U31A 4CN6A 2OSWA 1CXHA 3PZGA 1VJSA 4RE3A 1C8YA 3PZQA 4P8WA 2XFYA 1WE5A 2GFTA 2PWDA 1EHNA 3GNPA 1UQYA 4AWEA 4DUVA 2V3FA 3B9AA 1H0GA 1MQRA 4BQ3A 1W9VA 1QOXA 2A3CA 1BYAA 4GPNA 1N82A 1HJXA 3AS2A 3A47A 3AIEA 4UFHA 3RPMA 1QI4A 3L4VA 1UR4A 4LPCA 3BXWA 3RO8A 3SCQA 4CU8A 2WVVA 1D2KA 3ARRA 1I1WA 3SCWA 3GNRA 4TUFA 5IXEA 3OGSA 1FH8A 1ISYA 1A47A 3SURA 2WMGA 1H5VA 1XHGA 1C90A 3ZJ8A 2ZXDA 3TOPA 3PZUA 4HMEA 3HMCA 2DSZA 1P6WA 1CENA 1PZ3A 1W3HA 5IHSA 2DH3A 2JF7A 4GQRA 3AMKA 3WD3A 1O7AA 3M6DA 1HNYA 1JYVA 4D1IA 3WQ4A 1W9BM 1R7AA 4M24A 3BC9A 4GZIA 2OWWA 1RP9A 2QMJA 4U2ZA 5JBEA 1JAEA 2F61A 1BGAA 2E0PA 4OIFA 2UY2A 3WDPP 1C91A 5D9MA 2OLHA 4GI8A 1Y7VA 2J7FA 2GDUA 2Y5EA 3CMJA 4UTFA 3B9DA 1QW9A 5I3DA 4W7VA 5JUVA 1HJUA 2VUYA 1CYGA 4KMQA 3VDBA 1OD0A 1E6RA 1AQHA 2A3HA 3AZRA 1EO5A 3IJ9A 3VGHA 4H04A 1UKOA 1UOKA 3HJEA 3K46A 3T09A 4E8DA 4HOZA 3EMZA 4JCMA 3VIHA 1NWSA 1OB0A 2PB1A 4WK9A 1NWUA 2GVYA 1VB9A 4UQCA 4Z2LA 3GYCA 3BMWA 4M80A 5HXMA 3N15A 5BRQA 4M8UA 5I24A 1UQZA 1V02E 1JZ2A 5LA1A 5GPRA 3QOMA 3PTMA 3PZ9A 1M7XA 1BAGA 3VD7A 3OG2A 1E43A 1DWIM 4B3KA 2VT0A 1MFVA 4PMYA 1R87A 1W1YA 4LQ1A 3W37A 5A1AA 3G6MA 1WAWA 1JI1A 3VX0A 1M04A 3WNLA 1XH1A 1ISWA 1UWSA 4UOZA 5A6BD 2JIEA 1E1FA 1R8LA 3NSNA 1CECA 4AD5A 2IUZA 1E0VA 4PMUA 4HU8A 4J3XA 5HOSA 3FHQA 1A3HA 2VZTA 2XVGA 1HJVA 1ITXA 5A95A 3BCFA 2YBUA 4QP0A 2D2OA 1QBAA 2VC9A 3LMYA 2GSJA 4B15A 1E5NA 3CO4A 1F4AA 3ZR6A 4CU7A 4PSPA 2YL6A 4MNMA 3AZTA 5I0DA 1J0YA 1OWQA 7TAAA 3SUUA 4UOJA 1EQPA 1KR0A 1MYRA 5ABGA 4DWSB 3K8MA 3UR7A 2BS9A 2CBUA 4TX8A 3VKKA 1ISZA 2X1IA 3OLEA 3SUSA 2J7EA 1LF1A 2WHLA 2WWCA 4PTWA 1K9TA 4M82A 1J0IA 1UR2A 2VZVA 3MMUA 3N9KA 1MVYA 1VFMA 3T0BA 2VI0A 3WNNA 1QHPA 4UZUA 4P7RA 5CJ5A 3TTSA 2D3NA 3WQWA 2WC3A 4HZ7A 4UNIA 2VZSA 1BGGA 1CLXA 4W7UA 2DPEA 1NWTA 3VGEA 4R5EA 5I77A 2X2YA 1AMYA 2DT0A 4CD7A 4GQQA 3CZLA 1HP5A 1WDQA 1E6NA 1WDRA 3CMGA 3TP4A 4JHOA 5D8ZA 1ZS2A 1MXGA 3APGA 3PZVA 3ZT7A 4XX6A 4CN1A 2XVLA 3VINA 5BXTA 1HJWA 4KRTA 4MNJA 3J7HA 5FL1A 3U57A 2GJXB 1E4IA 3HU7A 3GBDA 1R86A 2WLZA 2WMFA 3AHVA 4YHGA 2YJQA 4V28A 4ATLA 2WBGA 1BFNA 2YLLA 3U5YA 2QPSA 4CD4A 1MW1A 3S6TA 3BCDA 3AOFA 1UD6A 1JI2A 1H3GA 1CXLA 3MUY1 3OZPA 5GNZA 3OBAA 4U3CA 3CZKA 5DT5A 3II1A 3POCA 1VAHA 4X0VA 1DWJM 6A3HA 3UESA 2E8YA 4W88A 3CBWA 1J0JA 1L0PA 1R85A 2Z1KA 1HN1A 2XFRA 4W87A 2WSKA 3WDQA 5A2BA 3ZO9A 2G3MA 3WQVA 1VFOA 2J79A 3SCNA 1JDCA 3UERA 5CPTA 1GZJA 4WKFA 4QDMA 3ZMRA 3VO0A 4DUXA 4UFIA 2ZUMA 4JFTA 1QI2A 2O9TA 2VCAA 2WKGA 1QW8A 3WNPA 3CHDA 2W91A 5JBDA 1E72M 1B3WA 3W6LA 4TTUA 4HZ8A 1S46A 2WVUA 2E9MA 4WF7A 1Q6CA 1OM0A 1JZ6A 4AZ6A 4F9JA 2BNJA 1TVPA 4ZE5A 3T2OA 2DIJA 1WZKA 4EANA 2VCCA 3K1DA 2Y8VA 4H7VA 3VD3A 1KWGA 4NRSA 4PYSA 1V3LA 4DWSD 2JIWA 1QBBA 4TVCA 2WVVB 1V6VA 4Q7NA 1EGZA 3WBEA 1XSJA 4P7NA 4MNLA 3AIQA 1EH9A 1HP4A 3ALFA 3CPUA 1ZL1A 2EEXA 2CPUA 2AOSA 2XHYA 4PMQA 1C3FA 1CXKA 2WHMA 1Q6DA 4UZSA 1GOKA 4MNKA 1JD9A 1MXDA 4PTVA 2FDMA 3D5HA 1B3XA 2XM1A 1V6YA 2CBIA 4XUYA 4FK9A 3WF1A 1LLOA 1X1NA 3L4ZA 4U5IA 4OUEA 3QOKA 2VQTA 2YDRA 1E1EA 3WF4A 3DYOA 1HKJA 4DWSC 2XUCA 3L2MA 2GUYA 4AIEA 1O6IA 1FFRA 3VM5A 1W3JA 3FAXA 5D8WA 2BHYA 1FP9A 3FNDA 4PMDA 1ZBCA 2DSVA 3VIFA 2DT1A 3MS8A 1TCMA 4EK7A 2YL5A 1JNDA 1UH2A 5E9AA 1QNRA 3MV01 4PCTA 2J47A 3BAXA 4HA4A 4YHEA 2A3AA 3CTTA 1LWHA 5CGMA 1DWFM 3POHA 3VMPA 1BPLB 1OIMA 3NJ3A 1CGUA 3WQ5A 2CESA 1W9DM 2VURA 2CETA 1HVQA 2O9PA 3F5KA 1E70M 3RILA 4MDOA 4D6DA 3W38A 2WM0A 4H2CA 1TFVA 1TA3A 1E6QM 4W7WA 4AC1X 2OYLA 5BYWA 3CHCA 5D9NA 3SCTA 4MAZA 1XYZA 2VQUA 2UY5A 4ZEPA 1SFSA 3AHZA 3WFLA 2BY3A 4E4PA 4A3YA 4CVWA 1E6PA 3A6OA 5D9OA 4AD0A 3PBGA 3PZMA 3WQ6A 1UR9A 1CGWA 5M5DA 2WW5A 3SUWA 3N12A 1W2PA 2J75A 1QNSA 5CZKA 1US3A 1UKSA 3K4DA 5A6SA 1I75A 2ZX9A 4MADA 1ODZA 2W92A 2WKLA 4P8UA 1F4HA 1Q6GA 1BG4A 3AIRA 4PMRA 2O92A 1KB3A 1BF2A 1H1NA 1JIBA 1PZ2A 5JH8A 3SIMA 3WN6A 3SUVA 4K68A 4EE9A 3AIVA 2WC4A 4UR9A 4JFWA 3VMOA 7A3HA 5E0CA 1J12A 5BRPA 4BF7A 1CTNA 1G94A 2X0HA 3AIUA 3E1F1 5CPQA 1XGZA 5JBFA 3L4YA 3AMGA 2V5DA 4J3VA 4Z2HA 1VBRA 2D20A 1VEPA 3WEZA 3MUAA 1K9DA 5A94A 3U7VA 4B3LA 2V38A 5HNNA 3EDFA 2ZWZA 3EYPA 1JFHA 4UQ9A 2BHZA 5JIWA 1CDGA 3IAQA 2OWXA 2YDSA 2G3NA 1W32A 1CZ1A 3JUGA 1K9FA 4GI6A 4UFMA 5A6MA 4JIEA 4CCDA 5CXPA 3DHPA 4AISA 1KBKA 5FOOA 4WKHA 3ALGA 1FHLA 4H8VA 3WSUA 3B9EA 4LYPA 1M01A 4CUCA 4H8UA 5I78A 3ZJ7A 2YA0A 3GZAA 5E6ZA 2VRQA 4ZXOA 2W63A 3W24A 3AICA 5DT7A 4YPJA 2VZOA 2UY3A 1JYWA 4LX4A 4TOQA 2E4TA 4GO8A 1V6UA 1JZ4A 1LG1A 3WH6A 1XSKA 4C7FA 1VEOA 2E9BA 2VX7A 1GJWA 3ZT5A 1WNOA 2QF8A 4PMVA 5GQBA 1QNPA 1FH7A 1PBGA 1E0WA 5A6AA 4OZOA 4UQBA 1UZ1A 2C8NA 4PMXA 2XWDA 3QR3A 1PEZA 3ZSTA 1HL8A 1CBGA 2DEPA 3F5JA 1E6XM 2ZUUA 3RIKA 1WB0A 2BXZA 1VF8A 1QHOA 2WNWA 4JL2A 4D6IA 2WZEA 4J28A 5HPCA 3EMQA 1V6WA 5DFAA 2J7CA 3M46A 1JXJA 4KGLA 3T2PA 2ZXBA 2GK1B 5TD4A 4HPGA 2NW0A 1JYXA 1JDDA 1W1TA 1I1XA 1NOUA 3AHXA 2ZX7A 3W26A 5EB8A 1V03A 1CGYA 3ARUA 3GH7A 1WDSA 2V5CA 1JDAA 4PMNA 3WUFA 4JFVA 4KRUA 2ZWYA 2BY2A 1V3IA 1YHTA 2XGBA 2Z1SA 3F5LA 4JKLA 4RE4A 1J0KA 3CUGA 2FGLA 3OLIA 5M03A 3VNYA 2YKKA 1KXHA 2EPMX 4QFUA 1B2YA 1VFFA 1ISVA 1GOIA 1QNOA 3IK2A 1GVYA 2UY4A 4JHZA 1UUQA 1GW1A 3W82A 2PBGA 5A6KA 3LPOA 2W61A 4E2OA 2BVDA 3UG3A 2J7DA 5E6YA 5A8OA 1Q6EA 1C93A 2ZUNA 1CWYA 4LXFA 3WUEA 3VGBA 2WC7A 1E56A 2VX6A 4KH2A 3CHEA 1ZJAA 1LL6A 3NCOA 2J78A 1AQMA 3AHTA 4GXPA 3AS0A 1GQJA 2J62A 1G01A 1DEDA 2MANA 1HX0A 1ZBWA 2E9LA 3D3AA 3VM7A 3VIIA 2PWEA 5A8QA 1H11A 1LG2A 4XZBA 4BCEA 3ZJKA 4QCFA 4MJ4A 3RCNA 2VMFA 2A3BA 2V3EA 2CBVA 3VGFA 1X6NA 4FLSA 4B9ZA 1E55A 3N04A 2YA1A 1NP0A 1G1YA 1GUVA 5ABHA 3SCRA 7CGTA 3ZOAA 3GBEA 1E5JA 1NM9A 2G8ZA 1J11A 1M53A 3RM4A 2FH8A 5ECUA 4C7DA 4GO9A 1M03A 2XM2A 3QGVA 1XH0A 2X09A 5BWFA 3MSDA 2XVNA 4M29A 2VR4A 1EO7A 2ZXAA 3U5UA 4PTXA 3AROA 8A3HA 2DT2A 4TVDA 5A6JA 3WDRA 1RPKA 1NP2A 3WL1A 4OBRA 1UD4A 4OBSA 2WMJA 1UD2A 3LPFA 2ZXQA 3MSGA 3WEOA 2DSWA 4PTMA 3WF0A 1FA2A 1LL4A 3TTOA 5CG0A 4HOWA 1W1VA 4FLOA 1NWRA 3VIPA 4UCFA 3ZT6A 5CPSA 1U30A 2WMIA 4UFKA 2B31A 3WH9A 4UFLA 1HJQA 1UWRA 4Z2JA 2D23A 3ZJ6A 3VILA 2QMKA 3MANA 3AZSA 4CD8A 4FLQA 2GJRA 4OOUA 2OYKA 1V0NA 1KGUA 2Y24A 1BQCA 5BXRA 1FHDA 5EMYA 4KWUA 1BVZA 4J3TA 5IFTA 4GZJA 2VVSA 2QLYA 1B1YA 4FF5A 2WXDM 1XCWA 1UA7A 3BLPX 1RH9A 3AMLA 1XH2A 4D6HA 3GNOA 1SYTA 2WK2A 4F79A 5I79A 4J7RA 5I2UA 2OSYA 2E8ZA 1MQPA 5EFDA 1L8NA 4AYSA 4TXEA 3DYPA 4BQ4A 3N11A 2F2HA 2YLAA 3UCQA 4ZFMA 4NSBA 3WDHA 3VDAA 2AAAA 3AMDA 4UFJA 2JF6A 3L4XA 1R7OA 1PIFA 1IZKA 3EDDA 1IV8A 4OKDA 4D1JA 2O9RA 2EJ1A 2CCRA 3WMBA 3MMWA 1ESWA 2D0GA 4GI9A 4ZXLA 1V3HA 4F8XA 1CPUA 2WVTA 1C7SA 3WUBA 2E40A 1OT2A 4W86A 4PEEA 1W9UA 2YBTA 3VX1A 4ML4A 3CZGA 5A69A 4PUEA 4CKQA 4XV0A 1E6SM 5IHRA 3MUZ1 3OZOA 2YL8A 3WNMA 4D72A 3G6LA 2GJXA 4YN5A 1HKMA 2DGAA 3GDBA 3FHAA 3WKZA 2WMKA 3PZTA 3M7SA 2V3GA 1KXTA 1YQ2A 1E4MM 4CCCA 2XSAA 4IPNB 2ZIDA 1FH9A 1ITCA 3T0AA 3S2CA 4TX6A 2G41A 4J3UA 1JZ5A 2D0FA 1KGXA 3OLDA 4NRRA 4WSKA 2WWDA 3ARZA 4ATWA 3GXFA 4AXNA 2OSXA 2BVTA 3AISA 3RM8A 2FHCA 1JZ8A 2NSXA 3AJ7A 4AD1A 4NZCA 1WZLA 4MAVA 3KZSA 3K4AA 4C7GA 2BY1A 3MV11 5A8MA 2IXUA 4GINA 1VRXA 4RL3A 1UH3A 5DMYA 1H0IA 1BVNP 4JAWA 2JALA 3N18A 4W5UA 3NYDA 1H41A 4P8VA 2JEQA 2VOTA 4CN4A 2VX4A 1BYBA 4XB3A 2XG9A 3I3EA 3W81A 1KXQA 3UR8A 2YL9A 2E3ZA 2VRKA 4HU0A 2XSBA 3ARXA 3CUIA 2VR5A 4BA0A 1KCKA 4U33A 4F9DA 5C8BB 3UG4A 4H8HA 2ZX8A 4XZWA 2DIEA 2CHNA 4ATDA 4P8XA 2VNCA 4AY1A 1GHSA 5A6BA 3OGRA 3O9NA 3L4WA 3WF3A 3VIKA 3SUTA 1HJSA 4GZEA 3CGTA 4A4AA 1OGGA 1H4PA 3IJ7A 1GVIA 2XGIA 4IPLA 4PBGA 2Y8KA 1B30A 5IFPA 2WPGA 1XYFA 4Z2GA 1UWIA 1JYNA 1NH6A 3TTYA 1JZ7A 2PI6A 4U2YA 4OOZA 1NOFA 3ARYA 2CEQA 5EFFA 4D6EA 3SCUA 4OJYA 3MU7A 3BH4A 3AHYA 3NDYA 3WUGA 3BAYA 1PJ9A 2CYGA 4JCLA 4TVUA 4ZE4A 1CGXA 1GJUA 2NT0A 1MFUA 5E0FA 2D24A 1HVXA 3T0DA 1B3VA 2OWCA 4HA1A 4NI3A 4WIWA 3BAWA 4P7QA 4QCEA 1UKTA 2CNCA 2VCBA 3MUIA 4AZHA 1KR1A 4DUWA 1MQQA 1UR1A 2W5FA 3ARQA 5FL0A 2ZUTA 4V27A 3AYSA 3UG5A 1UR8A 1WPCA 3BAJA 4DWSA 4JKKA 3VD9A 1GQIA 3M07A 1EIBA 3WD1A 1TVNA 2XTKA 3SCSA 1UZ4A 3WH7A 1EDGA 4QAWA 4UQDA 2WHJA 3CUFA 5FIPA 1TA3B 4FMVA 3DC0A 4R27A 3A4WA 3PN8A 3VGGA 5E09A 3ARWA 3CUJA 4D6CA 4PRWA 3KL3A 1C8XA 1GORA 2PWFA 4JZ5A 1GOWA 4MB3A 2PWHA 1UR0A 3WY1A 3ZR5A 3AYRA 1MW3A 3AXXA 5C70A 1OD8A 3W27A 4M1RA 3W29A 4AZCB 4CCEA 3RJYA 3RMEA 3GH4A 2VX5A 1RD6A 1KBBA 2WZIA 4HTYA 2HISA 3WMCA 1BG9A 3VDHA 2J7GA 4PMOA 3W0KA 3AS3A 3W25A 3EBVA 1ODUA 1JNEA 3NIYA 3WNKA 1E3ZA 2G3IA 1JZ3A 4N42A 5F7UA 1XRVA 1OIFA 1E71M 4MJ2A 2EQDA 3K8KA 5HBFA 4AZBA 3TTQA 3ZM8A 1EDTA 1QHZA 4W85A 4CD5A 2WANA 1OGBA 3FXYA 3O2LA 1V0LA 1B3ZA 4N0RA 1GNXA 3LPPA 5GNXA 3ARPA 4PN2A 3VGDA 2ZOXA 2X8RA 2EPNA 1QNQA 3VIOA 1FP8A 2DQXA 1KQYA 1QPKA 5LA2A 1B0IA 1UD5A 4AMCA 1V08A 3ARTA 5KEZA 2W4XA 4UOQA 1FFQA 5ABFA 1CXFA 1KWKA 4AW7A 1HF6A 3CH9A 1J18A 4RE2A 3THDA 1UD3A 4JFUA 1WCGA 1JFXA 3FW6A 4X0NA 4EAMA 2ZUVA 4UQAA 4DM2A 3WNOA 1EOMA 3WFZA 5AC5A 2YDQA 2EPLX 4AZ5A 2XIBA 4CD6A 1AVAA 1G9HA 2J8FA 3PZIA 3PZNA 4CGTA 4W93A 1HL9A 4J3SA 3WMSA 1V3JA 2D3LA 2DSKA 2WMHA 1KQZA 5I23A 3VTRA 2XIIA 2CKSA 5DEZA 3VU2A 2J77A 3MMDA 1QI0A 2VTFA 5C71A 4F66A 1LL7A 3CZEA 1EHAA 1TMQA 2J25A 4QLJA 1GOMA 2FH6A 1KCLA 1W9XA 4CVUA 1EQCA 5CGTA 4V2XA 3SCPA 3MKKA 4J3WA 2JEPA 2W62A 4HZ6A 3VD4A 3ZIZA 1MW2A 1UD8A 2J74A 3BAIA 1UKPA 3LPGA 1DWGM 1PX3A 3WIJA 1H49A 1EA9C 2ESCA 6TAAA 3VIMA 1JG9A 2WSPA 3IANA 4D6GA 2WYSA 2AMGA 2XVPA 1U33A 4HMCA 2X05A 4MB1A 3K8LA 4MPKA 1OINA 2ZUWA 3ECQA 4H41A 5A3HA 3A4AA 5I6SA 3L4TA 5ABEA 1QI5A 1ISXA 3WD0A 2BY0A 1OBAA 1HKIA 3CIVA 4EKJA 3SCOA 3PHAA 4FLRA 1WZMA 1RP8A 2IXVA 2WCSA 1D7FA 3W28A 1MWOA 3WBAA 5D9PA 1E9LA 4P7LA 2VO5A 2VJXA 2G4FA 4BZYA 4W8BA 1KXVA 5M3WA 8CGTA 2EXOA 5A8NA 4JL1A 2UWFA 2VZUA 2EBNA 1JF5A 3VOCA 5HPOA 1W91A 3WENA 4ACZA 3NDZA 2O9OA 3BMVA 3SCVA 5A6LA 4WKAA 2ZE0A 1BHGA 2PBOA 1DTUA 4W89A 2ZX5A 1WZAA 4DM1A 1ZU8A 4MTVA 5GNYA 1W2VA 3KWXA 3EDEA 3WF2A 4S3JA 1PPIA 1B31A 3GXIA 3PZOA 1C8QA 1XV8A 1HT6A 1JXKA 2WHKA 4MDPA 4HMDA 4AD4A 1GOOA 4CU6A 1H09A 3A4XA 3VNZA 3AXHA 1ZBVA 1US2A 1VENA 1E73M 1D3CA 3BLKA 5CQ1A 4W5ZA 1SR0A 3ARSA 1XD0A 2WMIB 2GJPA 4L4PA 2JE8A 3FN9A 3VD5A 3AMCA 1J0HA 2ZX6A 2WVSA 3L2LA 2V3DA 3GXDA 3NUKA 4WJXA 3OIHA 1IT0A 1E40A 2CERA 1DHKA 3IAPA 1C7TA 1GOQA 1JF6A 1VIWA 3FY1A 1NARA 1ZBKA 3N1AA 5I5RA 3WDIA 4AZCA 1BTCA 2Q8XA 5CSYA 4PSRA 1NQ6A 1PX8A 3IJ8A
chains in the Genus database with same CATH superfamily
5D05A 1YE4A 4LW7A 1WUFA 6ENLA 1ZAHA 1UWQA 5A2CA 5FESA 2DZBA 4K37A 2VGBA 2DDXA 4O15A 4JTRA 1RCQA 4ICCX 4RV3A 1PUDA 4Q8WA 4RDYA 5HUPA 1CB7B 3C3UA 3WH5A 1WDPA 4DN1A 3SADA 3PUOA 3AUJA 4PB5A 1W6TA 4CQ9A 2Q09A 2PF0A 3UR2A 4KW2A 1V3KA 3GXMA 4ODNA 3SQMA 4RK8A 4XD3A 5F4XA 3LTPA 3QPZA 3NWRA 4ZOEA 1PIGA 5LNSA 1GONA 1DBTA 2YOCA 4WXZA 3VIJA 4GH1A 2N87A 2WCGA 2Z2AA 4FXFA 2V82A 1C92A 2F8QA 3P5ZA 3JYJA 4UQEA 4D6JA 3MJYA 1GQKA 4JFSA 4FXRA 3T0CA 2J7BA 3DFTA 4URIA 1JVWA 2ODOA 1B5TA 3LV5A 3TE9A 5DITA 3W4RA 4PCFA 3CXOA 3HOJA 1F6YA 3QHOA 2ZTJA 2X40A 3VPLA 3SM0A 4Q4MA 2RUSA 3VI2A 3CHFA 3FSUA 5JXQA 1BQGA 2R1MA 3DFNA 1CLVA 1TR1A 5H6HA 2V5KA 5K9XA 1L6WA 2ZZ7A 1ZNNA 1Q7QA 3O6AA 2XJ7A 4XSMA 4WVXA 2GDVA 4WGXA 1XC6A 3C2EA 5FCZA 3T2QA 1KO0A 4DIAA 4I8YA 3GTFA 5HWBA 1X98A 1E0UA 4ODQA 1UC4A 4DZIA 2PWGA 4G1NA 2X1RA 4IT4A 3A3WA 2Y2WA 2PGWA 1UHVA 3QF0A 1TREA 3UI4A 4XSLA 4R9XA 4BY3A 4C02B 5D4YA 3MBFA 1SMAA 4V1YA 2W67A 2ZZ6A 3UY7A 1SGJA 1TUXA 4Z1YA 5CAKA 4AZGA 2MF9A 2WSYA 4AB4A 3BSHA 5MF5A 1TWSA 1Q65A 1X97A 4KCUA 3NL2A 2HBVA 1WOAA 4REQA 4DYJA 1XCXA 4ZZ9A 3DHDA 1XUUA 4QE5A 5CH9A 4DLMA 4ACZB 3U2ZA 3CYVA 3P7YA 3EEZA 2ZA2A 1E6ZA 1AH4A 2DG4A 4KQZA 1LLWA 4IM4A 1SZEA 3ABRA 1OY0A 2IPWA 2DZPA 1XYCA 2G95A 2CHOA 2QHAA 5F1VA 5T9CE 1VFUA 3RPDA 2KAUC 1PL9A 1XD1A 3UVIA 5FF0A 1VRDA 3WQ8A 3R58A 3QKEA 5A2AA 1RUSA 3R43A 3MO4A 4S3GA 3BQ6A 4ZENA 5DQPA 1JAKA 4UMAA 4Z0JA 1AMKA 3VYLA 3I4KA 4TR9A 1JEZA 4U85A 1GW9A 1OGSA 4HHHA 3SECA 2ZA1A 1W8GA 1E9YB 3VKJA 3TYDA 3PBVA 2QPUA 3GG8A 3E2RA 5AC4A 2EF9A 4WRHA 4RX0A 1YDVA 1NDWA 3KP0A 1SVDA 3KUMA 4XVEA 3NO1A 1OCQA 2DT3A 2Y4SA 3F2CA 1J0ZA 4B91A 4QTGA 4Q4PA 1CEOA 3AXIA 2OEKA 1PBKA 2X7VA 2D1ZA 2FB3A 1U2YA 1Y5VA 3ABXA 3GM8A 4IQEA 2J4GA 3NSXA 3OW1A 3BLDA 1JUEA 3LCXA 4AVOA 1WP6A 4H01A 1IWAA 2VCDA 4FIRA 2O55A 2BVYA 5K9CA 1XLEA 2JFEX 3G18A 3MA8A 9CGTA 1A4MA 4LYRA 3WEMA 4AWTA 4AD2A 1QI3A 3TU9A 3WK0A 3E0LA 1OABA 4R33A 2VVNA 1BWVA 5IDIA 2JQXA 1REQB 4M81A 3U48A 1JD7A 3AIBA 3W1NA 1OCJA 3RAOA 3H2EA 3ONCA 5KZ6A 1LT7A 2QS8A 3KL0A 3C2FA 3GS6A 3FAWA 1V0KA 3R4IA 2RGLA 4NP7A 4YL2A 4DXXA 1L6YA 1RJQA 5I3IA 5SWUA 1VEMA 3N34A 3RDKA 4DELA 1XI3A 4I5XA 4NT0A 4KESA 4EXAA 4MG4A 3EOEA 2PN0A 1KM1A 3PTQA 1TZZA 2I14A 4YVXA 3BANA 4FOKA 3PZGA 4LUYA 1VHCA 3PZQA 2QJGA 1T7LA 1NVMA 5CBIA 2PWDA 5FSEC 4R7OA 4IIEA 3B9AA 2QIWA 2WNZA 4NZ3A 1W9VA 2RJHA 4ZB0A 2Z1BA 2A3CA 1BYAA 1N82A 5CC7A 5LSMA 3TR2A 2OR2A 1ALDA 1UJQA 4FN2A 3U8GA 1DIEA 3O5LA 3RLVA 3GNNA 2C14A 1EYEA 4DY1A 4F48A 4DIPA 2R6OA 1OCNA 4YTQA 1D9EA 1FH8A 3RCYA 1H5VA 1C90A 3ZJ8A 1J93A 1QK0A 3CAWA 4HPJA 3UF8A 3MYOA 4MFEA 2ACRA 2DSZA 1P6WA 3MSRA 1PZ3A 1W3HA 4O54A 3WZ0E 5IHSA 1LQAA 1EJ7L 3W7MA 3AMKA 3M6DA 1JYVA 3UJEA 1F61A 1TQXA 2I17A 3K1GA 3GU9A 1W9BM 3RUBL 4TQTA 1QU4A 4M24A 4Y6GA 3CM4A 2YBVA 4OIFA 1BGAA 2R91A 2UY2A 4ROQA 3WDPP 1KBLA 4RV8A 1VFSA 1P0NA 1C91A 2VOMA 4GI8A 1Y7VA 5DBUA 2TODA 4TV6A 3W1TA 5I3DA 4W7VA 1OF8A 4LT9A 5DBTA 1D3GA 3VDBA 4GNVA 2PSNA 3NPXA 1E6RA 2YCKX 1UOKA 1UASA 2NWSA 3OVPA 3K46A 4CQCA 1C9DA 4FNTA 3QFWA 3EMZA 4JCMA 3VIHA 1NWSA 1OB0A 2PB1A 3BZJA 1L6GA 6TIMA 1NWUA 4UQCA 2NVCA 4Z2LA 1S39A 3N25A 3THQA 5HWJA 3OQEA 3BMWA 3QR1A 4EWND 2OKTA 4KS0A 2W79A 4M8UA 1UQZA 1EEXA 4GUIA 1XRSA 4XAKA 1GKRA 3V16A 3R7MA 3TC7A 3N6JA 3VD7A 3OG2A 1D8WA 1L2UA 2PDKA 1VC4A 2KR7A 4XBJA 2OFJA 1W31A 1JI1A 2D73A 3VX0A 5C9RA 2XIOA 1Q7ZA 4ZOAA 3GHSA 2ZDRA 3CJPA 4N7QA 4PUKA 1E0VA 4J3XA 4QJ5B 2Y1HA 3QVQA 4RKAA 1A3HA 3U2CA 1HJVA 4ALDA 2QKFA 2E1WA 3M0IA 5LNUA 2ZBTA 4A3UA 2VC9A 3OVRA 4M6PA 4B15A 1ROTA 1F4AA 3LMZA 4GH3A 5I0DA 5T91A 4LV4A 1KR0A 1MYRA 1LBFA 3H55A 3V36A 3SO7A 1JCLA 3UR7A 1D7JA 2HV5A 1PV8A 2X1IA 2WHLA 3KOWA 4FNSA 2ZA3A 4M82A 1J0IA 4G8TA 1UR2A 2REQB 3MMUA 4C60A 3C8NA 3IIVA 4PMJA 2D2GA 5CJ5A 1MUWA 4HZ7A 1JQXA 5IOBA 1GVFA 1CLXA 3KW3A 4GBDA 5F4WA 5I77A 2ALRA 2DT0A 3T6CA 4QNEA 1A5UA 2HNEA 5BU9A 1DORA 4JQ2A 3S5OA 1V51A 3ZT7A 1XGDA 2XVLA 3VINA 5BXTA 4MNJA 4DF2A 4GWEA 4YHGA 2WLZA 2YJQA 4V28A 1BRLB 3FGCA 3B40A 1V4YA 4OT7A 2QPSA 3S6TA 2E77A 1AODA 3P82A 7ODCA 3FIGA 1JI2A 3NR0A 2O7QA 3IVUA 1CXLA 3ZZ1A 1G7UA 2IW0A 1TTPA 2Q02A 2XU2A 3OQ8A 3CU2A 2XN2A 3QTPA 4CNUA 4RDWA 1VAHA 4GVHA 1DWJM 4HJFA 3RGTA 3UESA 2OCZA 2Y70A 1J0JA 1L0PA 4MLRA 3QBUA 3WDQA 1GVOA 4L7ZA 1LUCA 3VKBA 4QHRA 4M51A 1QNVA 4JQ1A 3SCNA 1JPKA 3MCOA 5CPTA 1GZJA 2A21A 1R3RA 4OE7A 4UFIA 4GQBA 1QI2A 1RBOB 2H3DA 3PPGA 4JTKA 3V1PA 2ANUA 1E72M 4TTUA 1S46A 1YPFA 2E9MA 4WF7A 1JZ6A 2YZRA 2JKPA 3OPSA 5CZ0A 3T81A 4AZ6A 2GVGA 1Q6QA 3BW2A 2RAGA 1H7RA 3Q58A 3K1DA 1GZ1A 3VD3A 5K4XA 1QO2A 4DWSD 4C6NA 3GDKA 4Q7NA 3WBEA 1XM3A 3AIQA 1XIEA 4KWWA 3A12A 2YGYA 1KW1A 3APTA 1W5MA 3MHUA 4GYKA 1W1IE 2XP6A 2HPIA 2XHYA 1K6WA 1Z6KA 1Q6DA 2O4MA 2WHMA 4UTIA 1OG6A 4MNKA 3JU2A 2QJJA 2XDFA 4A3RA 1N8IA 2CLPA 3D5HA 1NSJA 4XUYA 4NL1A 1AK5A 4Q7BA 1LLOA 2DU2A 5I3JA 2WZMA 2Q8ZA 4ADUA 4RNIA 3P14A 3HMJG 3IJQA 3PAOA 3GNDA 3SY5A 3EX3A 3CYJA 3KRUA 4GC4A 4AIEA 2Z2BA 3HV8A 1S3TC 1GEQA 3LHZA 5D8WA 3DC8A 4FSAA 3BLEA 3RYSA 2DSVA 4Q8PA 3TYBA 4DO4A 2D9FA 2IMRA 2YL5A 5E9AA 4O1EA 3OTRA 4PCTA 1UJPA 1R6WA 2ACQA 3LCFA 3POHA 4Q7IA 1BPLB 3NJ3A 1CGUA 1K7XA 2CESA 3IVSA 1HVQA 4JDYA 4EXQA 3RILA 4MDOA 5CAHA 1GT8A 4W7WA 4ZO7A 3NI6A 3M6YA 3UI5A 3LEPA 4HK7A 3SCTA 5D9NA 2PUZA 5I07A 1NF0A 1XLFA 4ZEPA 5CC6A 1TPDA 4A3YA 2ZRVA 4ZMGA 3QC0A 3DESA 1A5OC 3USZA 5CZJA 3E0FA 1J6YA 3RR1A 5BMWA 2ETNA 3TOYA 2UV8G 2PRHA 4H7ZA 2QUMA 3TW7A 1I75A 3EWWA 3HA1A 1X38A 1F4HA 1OZQA 1BG4A 4PMRA 3BE7A 2TSYA 4S3AA 3NEHA 1H1NA 1PZ2A 4G1KA 3GC5A 3SIMA 4EE9A 3CT7A 5HWMA 4UTWA 1OFDA 4MSSA 3VMOA 1J12A 5BRPA 5G1YA 1SJAA 5HWNA 3SR7A 2NV2A 3TIMA 5HA7A 4MJZA 1SW7A 3PTDA 1J8VA 1K70A 3WEZA 1Z44A 5HNNA 4CCZA 4LAOA 4GCAA 1TSIA 4WOQA 2OWXA 1W32A 1CZ1A 4GI6A 1T99A 4CCDA 3DHPA 1KC7A 3MVTA 4AISA 3OO2A 4UNLA 4QG8A 5D75A 1FHLA 3M5VA 1W56A 4K36A 4UTLA 5KZEA 2YA0A 4B5SA 3W24A 2QDDA 3KHJA 2VZOA 2UY3A 2E4TA 1V6UA 2CFFA 3W7QA 1WV2A 1QOQA 2XGZA 4FALA 1XIMA 2J88A 2I5IA 1S3HA 1H7XA 3EX1A 3MC5A 5A6AA 4UNKA 3O5MA 4IPXA 1U1JA 3K2GA 2XWDA 3QR3A 4RPPA 3HG5A 3M0MA 3F5JA 2ZUUA 1G6CA 3RIKA 2WNWA 4R88A 4XZMX 2ALDA 2P5NA 5HPCA 2E6DA 2NXIA 3G22A 3M5ZA 4X3ZA 1KFBA 2HQAA 2G3FA 4AXKA 3T2PA 2BMBA 5TD4A 3QC3A 5TIMA 3LDVA 4UTJA 5H2ZA 2PZNA 3AHXA 2IPJA 5H8PA 3QZEA 3UGVA 1K4HA 2G96A 2NX3A 3GTIA 3ARUA 3GH7A 1XYBA 2V5CA 3O5FA 4L65A 3LXCA 3S3GA 3P60A 2ZC1A 2B5UB 3NG3A 4FAMA 4TO8A 4HARA 2FGLA 4JOMA 5M03A 1HG3A 1KXHA 5AYYA 1VFFA 3IK2A 1GVYA 2PBGA 2ZQUA 4YMZA 4NHVA 1AA1B 4EF8A 3UG3A 1NQKA 2FB2A 1Q6EA 1C93A 2ZUNA 3M0JA 4K3ZA 1SU5A 4KH2A 3WQCA 4LUSB 4AF0A 1LL6A 3NCOA 3D47A 4WDXA 2E28A 2OOGA 4XO6A 1XLGA 1XLAA 3D3AA 1FTXA 3RF9A 3QLLA 2RSEA 4PFMA 4DVOA 4RZ5A 3VIIA 2PWEA 1EYMA 2PD9A 2A6LA 1E51A 1YIXA 3THUA 1HO1A 3L0NA 3RCNA 4UTKA 2A3BA 4KFOA 2HEJA 1LZOA 1DJIA 1ONRA 5T8GA 4KIRA 2YA1A 1NP0A 2EAWA 5C2XA 4QDWA 1RVGA 1AJZA 4S1FA 4HMNA 3ZOAA 5XIAA 3B0YA 1J11A 1M53A 2V9DA 3GC2A 4MPQA 4IPPA 3WMLA 3N2BA 4C7DA 1Y65A 1M03A 3ITXA 1VHNA 2P10A 2X09A 5BWFA 2RKXA 2VEGA 3SZ8A 4MGGA 3AROA 4TVDA 5A6JA 1RPKA 3GK0A 2QCMA 2R82A 1NP2A 4LVGA 2PDNA 5HWCA 2X2GA 1UD4A 4L3NA 4JY8A 2DSWA 3LX9A 2DUZA 3OEXA 4PTMA 2HBXA 4EPBC 4PUJA 1QMLA 1W1VA 2X7WA 4HOWA 3KLKA 5I06A 2HTMA 3TWBA 2WMIA 5HANA 1BTMA 5BNKA 3VDGA 4DZHA 1UWRA 1PS9A 3ZJ6A 3MANA 3AZSA 4FLQA 4QT2A 4S3DA 2GJRA 2A4AA 4JFKA 1V0NA 5EMYA 1QAPA 4J3TA 5IBXC 1TJRA 4EF9A 2VVSA 1DXFA 2GJNA 3PUEA 3TJ4A 2WXDM 1RH9A 3AMLA 1M1BA 4WSHA 3T0TA 2QCFA 2V6AA 1NEYA 3NQ2A 2BOEX 1VCFA 4F79A 3A5VA 3QMTA 3MVIA 3VOIA 3PVFA 2HE5A 1L8NA 4XZNX 4DRMA 1BXCA 2YB4A 2YW3A 1NF7A 1W3TA 4GIYA 4CQBA 3M0LA 3KVJA 3KVMA 2ZZ3A 4NSBA 4W9QA 4PUWA 2AAAA 3AMDA 4UFJA 1ZRQA 2JF6A 3VNKA 3TAKA 3DBNA 4DBSA 3DAQA 3OA3A 1FWAC 5D37A 2VC5A 3E0WA 2F2DA 3WMBA 3W7HA 5FI8A 1YRRA 5CPLA 1V3HA 1CPUA 2HS8A 3W22A 1AQFA 1LQ2A 2OO0A 2A7PA 3TTEA 4RLIA 3RK8A 2YBTA 4J2PA 4ML4A 1H63A 3CZGA 1V79A 4HNLA 4CKQA 3RMJA 1PINA 4C1NB 3KZPA 4EX4A 1XYAA 3BICA 4A2SA 1ADOA 3IARA 4D72A 2GJXA 2XN1A 3M7SA 1VH7A 2QT3A 1E4MM 4CCCA 4S39A 5FA5A 1N55A 3MKVA 1U83A 2FKEA 3L66A 3AALA 3S2CA 4L1XA 4TX6A 5I00A 4IT6A 3V1HA 2NV9A 2WWDA 3URQA 1VKFA 2BVTA 3AISA 3RM8A 2FHCA 2FVMA 4AD1A 1DJXA 3K4AA 1SO5A 5A8MA 2PLCA 4GINA 5DMYA 1Z42A 4DF0A 1BVNP 3O5QA 1LUCB 1TV8A 4XB3A 4DLFA 3W81A 3I3EA 2NQ5A 2E3ZA 5HATA 2PTXA 3WBWA 1PDYA 4BA0A 2X30A 2Q6ZA 5DY2A 4H6EA 3GR7A 1A0DA 4JTDA 5BXJA 3KOXA 3USBA 1HW6A 3VIKA 1QPFA 1THFD 4I7VA 1PO9A 3IJ7A 2MUCA 4PBGA 3VE7A 2Y8KA 3MZNA 3NO5A 2OLAA 2PE4A 3TWAA 2GVLA 3TTYA 3TN6A 4H6KA 4RDVA 3MU7A 1ZSXA 2V5JA 3NM1A 1IIGA 1D3HA 3BAYA 2CYGA 2GOUA 3W7OA 4H9MA 3CIWA 2ZZ2A 3CV7A 3PPHA 3EIPA 4F0MA 3O5OA 2DVXA 3SDOA 3T0DA 4PUUA 3EWUA 3OVQA 2D69A 2X1TA 1FWCC 3MUIA 1EPXA 4AZHA 3EA2A 5E5CA 1UR1A 4QJ4B 1X8CA 3ARQA 5FL0A 2ZUTA 4V27A 3AYSA 4XZ9A 4U84A 1TWWA 4JKKA 4US5A 1EIBA 3WD1A 3G1SA 3F1QA 3SCSA 4QAWA 2WHJA 5FIPA 4YTTA 3OBKA 1ZAIA 2BODX 2G97A 3NTYA 4C6PA 2YZ5A 2V5LA 3B4YA 1L6SA 3UFYA 3KAOA 4PRWA 2PWFA 1JGMA 2PWHA 3WY1A 1MW3A 1TV5A 3AXXA 1LCOA 1H7WA 5C70A 4AZCB 4CCEA 3PG9A 1T5AA 3H2AA 3E74A 4XKMA 4MWAB 1FWDC 4GK8A 4HHPA 4JX6A 1GYLA 1PWLA 2RUQA 2BG5A 4ZPTR 4NJHA 5C2CA 3AS3A 1ODUA 3KFTA 1FWSA 2KX9A 4N42A 5C7HA 1K02A 2OEMA 3IIPA 1E71M 2EQDA 3LM7A 5HBFA 4AZBA 1D6OA 1Q6UA 4QT3A 1LROA 1OGBA 3O2LA 3C3NA 2IQTA 2G37A 1XPYA 2AGKA 4N0RA 5GNXA 5FJTA 3PA7A 3ARPA 3BMXA 5JQ9A 3SRHA 1QW7A 5DCEA 2EPNA 2OU4A 5LIWX 2PV1A 1VIZA 3B0XA 5LA2A 5BU6A 4IF2A 4ICNA 3ARTA 5KEZA 4UOQA 1FFQA 3N3MA 5ABFA 3KRBA 3TCEA 3EA3A 1GWJA 3FOKA 1POJA 1B9BA 4LUTA 3GVGA 1Y0EA 3KHDA 3THDA 3W2MA 1JFXA 2ZUVA 1VLIA 1JPMA 3ANVA 3TX9A 3NPVA 3VXGA 1R3YA 4M6UA 2VUNA 1RY8A 1WOBA 1T6MA 1HL9A 2OGJA 1V3JA 2D3LA 1OYAA 2DSKA 2P8BA 5I23A 1VBHA 5HINA 1AZ1A 1JRCA 2CU0A 1Q6IA 4ZS6A 5FAGA 2P8CA 4F66A 3CZEA 3FFSA 3LI0A 3P74A 1TMQA 1KCLA 5U7SA 4MLJA 1W9XA 2GQ8A 3WLHA 4V2XA 3SCPA 4DRPA 3GB6A 3QY8A 5HNRA 3VD4A 2W27A 3N2OA 4ZA0A 2PDMA 1UD8A 4XAZA 2MLXA 2J74A 3BAIA 2ESCA 2BXVA 1XFBA 4JN7A 3V5FA 3VIMA 2OB3A 4D6GA 2WYSA 2POZA 3MJMA 2AMGA 3E9AA 2HXTA 2H3BA 1U33A 5EMMA 2X05A 4Q4KA 2VD8A 2C13A 3ECQA 2ZUWA 5A3HA 3G1VA 1L2QA 3SB0A 1YBQB 5H8MA 1QI5A 1VPXA 1ISXA 3KM8A 2BY0A 1OBAA 2XP7A 5I3GA 3MO7A 1HKIA 4LH8A 1QDSA 1N7KA 1E44A 1LWIA 3CIVA 4EKJA 4QBXA 4B2DD 1L1PA 1RP8A 4J2MA 2F38A 3W1XA 3ZR4A 1QATA 1IWBA 4P7LA 3CTLA 2VJXA 4JBRA 1RQEA 3LBCA 3VZXA 2EXOA 2DW6A 4X63A 3RLHA 1GVEA 2EBNA 1GTHA 3VOCA 3WENA 4ACZA 3NDZA 3BMVA 5FSDC 4WKAA 2PBOA 1FBAA 4XAPA 4NYYA 1WZAA 1ZU8A 3KCJA 1F8MA 1P0BA 1W2VA 3EDEA 4S3EA 3GU1A 4TIMA 3GXIA 2XH0A 3ATZA 4QSHA 1IXPA 4HMDA 1GOOA 1R3WA 3A4XA 3W7DA 3DKLA 4A6GA 2VGFA 3QY6A 5CQ1A 3LYEA 3BUVA 4B5VA 1LYXA 1W1B1 1KBIA 1XD0A 2FZMA 3V0SA 3QLDA 4Y9MA 1Y5XA 3WQEA 3GO2A 3FN9A 1FKWA 4A8NA 4ROPA 3EOSA 3IS4A 2ZX6A 1XLMA 2WVSA 4G6CA 1BD0A 1EJWC 4WJXA 1E40A 3GVRA 3UU0A 3C0LA 3WBYA 2F9RA 3IAPA 1UPMB 3ANYA 3O1NA 1A0CA 5D32A 1WDWA 3ENLA 4LV9A 3VAVA 1NARA 1EJXC 1ZBKA 3BW3A 5I5RA 2OX1A 3R0KA 3HG2A 1BTCA 1GEHA 2XPBA 2OOFA 3IJ8A 5IDZA 4JQAA 1Z69A 3W53A 1SM9A 5DF0A 3GQYA 3L4UA 1F07A 1P0EA 3W1QA 3W1PA 1G4TA 2BP1A 1OFQA 1NOWA 3RM9A 2D0HA 3C2RA 3QM3A 1XLCA 3U3HA 4QLLA 3BGAA 1KFWA 2OODA 3W00A 1W8SA 1UG6A 4NF7A 1R9ZA 2AL2B 3WDJA 1DP0A 3OJGA 2CLFA 3FAPA 2BHUA 1UOZA 3KCOA 1LTDA 3QQ0A 4U5KA 1GJPA 4AIUA 1XLJA 5JH2A 1SJBA 2BB0A 2GL5A 4XTIA 3N19B 4ZQOA 2FGZA 3O8AA 3WD4A 4DRQA 3DN5A 2FQIA 3FCPA 3FS2A 4Y9OA 2C91A 1ZB5A 1TJ0A 1B3YA 3EX4A 4LF1A 5LA0A 3VUPA 5LNRA 3WLTA 4GCXA 3CS2A 3MUXA 5BZAA 3H70A 2PCQA 3ZSSA 5FF7A 1GCYA 1KFKA 3WK3A 3CB8A 3UGRA 4AEFA 1OX5A 1MUMA 3W2LA 3ODKA 3AIWA 4Q6JA 2Y7GA 1AL8A 1DJWA 3I3DA 4YIWA 1FKFA 3PK7A 5HDRA 2L2SA 1E0XA 2QCCA 1JCNA 1KGWA 4ASTA 1NJJA 4WGHA 5FJOA 4CQ8A 5BROA 3GVQA 2C1GA 3O07A 3W07A 1AQ0A 5J6EA 1EDQA 1MRQA 4GD0A 3A3HA 1FX6A 1KLYA 1Q6FA 4ZBCA 4X9YA 4XIAA 1JNSA 4ERIA 2BLEA 1NAL1 1SJDA 4L6OA 3GTNA 4OFCA 1WKYA 5HT1A 3A4JA 2XZ9A 4AZIA 1JGIA 4PODA 2ZRZA 4E4FA 1V3MA 4LEQA 2EPKX 1CXIA 3DFQA 4IQCA 3NSMA 1WBHA 2CITA 1E4LA 3BV7A 1OSEA 4KR0B 4PTNA 3LA4A 5EGRA 4BQ2A 2V2HA 3VE9A 1CXEA 4M7SA 2GK1A 1DE6A 3UPMA 2YDAA 1VFHA 2NQZA 2WSQA 4Q8MA 5KINA 4JIIX 3EGJA 5I03A 2B7OA 4O11A 4HIBA 2OFNA 1VCGA 2XIQA 4AVFA 3WL0A 3IPWA 4DJFA 2Y85A 2QJHA 1PTGA 1XSIA 1SO4A 3E02A 3QKZA 3BQ5A 1BXBA 3FX4A 1B90A 3EB4A 3GUGA 4Z0SA 3AS1A 7PTDA 4Q22A 4IQJA 4LAXA 4IPJA 2AL1A 1DWHM 2E5CA 2AQVA 4JN8A 4KCTA 3DG7A 2RGMA 1YATA 1N8FA 3RX4A 2HJPA 2WAGA 3V5CA 2OO6A 3ZQ9A 4GFSA 1ME8A 1TVLA 4IGMA 4A8IA 4ODOA 1MW0A 1KFEA 5DO8A 7TIMA 3S5ZA 2EPOA 3H12A 5ENLA 4C6EA 4JYSA 1TZ7A 2IF4A 1UWUA 2J66A 1VR6A 4BS0A 1G0CA 4H6RA 4L1WA 3R0DA 2TYSA 3BAKA 2PTZA 1M5YA 3KACA 1XIIA 1VGAA 1VBUA 1HXJA 1XF0A 1T8QA 1VZWA 2KO7A 1FKXA 4OV4A 3RJXA 4MYAA 4QE4A 3BLOA 2RDXA 2C7FA 2LKNA 4IJRA 4QG6A 1RCOB 4AD3A 5MKGB 1Q66A 4BR1A 3WH8A 4W9TA 4P7OA 2FJUB 3TQPA 2PMQA 3NZGA 1W3KA 3CEUA 3OA5A 1H2JA 2CW6A 4AZ7A 4MKSA 1P5BA 1UKQA 4WLCA 4J4OA 1JPDX 3EWCA 9RUBA 3GG7A 4DXVA 2ZUSA 4C65A 3LB0A 1ME9A 1C8VA 5DRIA 2CBJA 3OB8A 1Q63A 4NZFA 4IT1A 1QVBA 1PX4A 5J04A 4ODLA 1IEVA 4V33A 3ITTA 1YW1A 3LS9A 1UA3A 4IPIA 5E1QA 1E9IA 2VR2A 3NDOA 4J27A 1YXCA 3EWXA 5LIXX 3BSGA 4J3ZA 3W6YA 3GH5A 5CBBA 4MB4A 4XAYA 3PJTA 2HROA 4US5D 3IRDA 3PBUA 4MB5A 3TONA 3ARVA 4QIUA 4B5WA 2K8IA 2KI3A 3BVJA 5BXPA 4WDUA 2X0YA 4MZYA 2Z7GA 1Z32X 4I9MA 3RFWA 5FKYA 3W87A 4PUDA 1WXZA 4N9BA 3DDMA 4B9YA 4HN4A 3KBJA 1KA9F 4Z42C 3LUTA 3L2IA 2WLYA 2XPKA 5DXXA 1TIMA 1VJSA 1X1OA 1C8YA 5L9FA 1S2AA 4P8WA 2GFTA 1D7KA 2M1IA 1EHNA 1IF2A 3GNPA 4QEEA 4AWEA 4DUVA 2IKIA 1P6CA 3N73A 3BG3A 4BQ3A 1MQRA 4ODRA 1OCBA 3SRKA 5EA9A 1KLZA 2ZKMX 3TQKA 1SFLA 7ENLA 4IUOA 1KD0A 2EPHA 2Z1VA 3A47A 1GVSA 3BXWA 4F4RA 4CU8A 4B4HA 1A5MC 1EP2A 3GNRA 1XRFA 3IIXA 1K4GA 4O0ZA 5EU9A 1C9WA 1W26A 1ISYA 4O12A 3HFTA 1B3OA 4IMAA 3M64A 3TYUA 1MSSA 1IWPA 3KAFA 4HMEA 5CG7A 2PD5A 2UZ5A 4PRTA 2DH3A 1M3UA 2JF7A 2DZXA 4GACA 4GQRA 4UDMA 2DJXA 1O7AA 1HNYA 1G4SA 4D1IA 3O5EA 2WJZA 4IIFA 3WLIA 2OWWA 5JBEA 1RP9A 2QMJA 3IUDA 2PF8A 5HQEA 3SJNA 3ITOA 4WHBA 2XINA 1AD1A 2Y5EA 3L9CA 4GOAA 3B9DA 1HJUA 4EVZA 1B4EA 4US6A 1CYGA 5MHBA 3MWAA 2XP8A 3W1RA 1AQHA 2A3HA 3O06A 4BWLA 3MWCA 3HJEA 3LQLA 1F6PA 5HUAA 4E8DA 3Q37A 2VP8A 4W4QA 4TMCA 2R1PA 2O7SA 1BL4A 3BOLA 4KWOA 3I6CA 5AZ1A 4M80A 1POKA 3DERA 5HXMA 4P2VA 5BRQA 5I24A 4MHBA 1MEHA 1OYBA 5LA1A 3NL5A 3QOMA 4HJWA 1EWEA 2R24A 4ZL1A 3CPRA 3PTMA 4GC3A 5AHFA 1BAGA 1H7PA 4R9OA 4A05A 4B3KA 1MFVA 2OQYA 5GVJA 3RFAA 1FWBC 1R87A 4C6CA 3CQJA 1W1YA 4LQ1A 3W37A 1MNSA 1WAWA 2XP5A 3TEVA 1XH1A 2HSAA 4GVGA 3A24A 5REQA 4C90A 1CECA 4PMUA 3CO8A 1FCBA 2VYOA 5HOSA 4RJEA 1R2TA 2I5GA 5AC7A 3VAWA 2C15A 1ITXA 1PVNA 3MCNA 5T9BG 6REQA 1J2WA 5EY5A 3LMYA 4TNSA 4EPKA 1OX6A 1MI3A 3WK2A 3ZR6A 4CU7A 1YNYA 4PSPA 4A35A 1W5QA 4HVXA 1EF2A 3SUUA 3L5AA 5G2IA 4DEFA 2DORA 2XISA 3L21A 3UZXA 3L0GA 3I6EA 5HAOA 3VKKA 5TBOA 3SUSA 2QEZA 4DYEA 3UXAA 1B6CA 1I6NA 4PTWA 3G77A 1R3TA 3UR5A 4NAFA 1V6TA 3N9KA 3T0BA 2QVNA 2LJ4A 4FR1A 3KBSA 3WQWA 2WC3A 2VZSA 1NWTA 4ICMA 1AMYA 1S5NA 1MNZA 1W3IA 3E2VA 1H51A 4BFAA 1GZGA 1LOSA 1WDRA 3TP4A 5D8ZA 2NUWA 1ZS2A 2OX4A 3PZVA 2J8TA 3S47A 4GUHA 3EX2A 1HJWA 2DUAA 1UBSA 5FL1A 4J9JA 2NLYA 5K4ZA 3GBDA 1R86A 4ZQCA 2Y7DA 5F2IA 4RDZA 1IXNA 1RXOB 4AYGA 2VFFA 1MW1A 3WLSA 2VEFA 3BCDA 1TJ1A 2F6KA 3QV6A 1UD6A 1SZRA 4GXWA 3MUY1 3OZPA 3VZYA 3R8RA 1ZLPA 3TMLA 3OBAA 5JMUA 3O5PA 3LCWA 3II1A 2FIQA 1I2OA 2CZ5A 2ZDSA 5EMLA 4X0VA 1BWKA 4FOUA 6A3HA 1KM2A 3I6TA 3EXSA 4W88A 5C6MA 1Q6RA 1TPC1 2XFRA 3RXZA 4DXKA 2HZGA 3ITYA 4WCJA 1FWFC 2CZDA 2FZ8A 3MDUA 3WLKX 1FAPA 1JDCA 4FNQA 2HVOA 2Y8UA 3N2TA 4WKFA 3ZMRA 3VO0A 4YCOA 5IRPA 4P61A 2CZFA 3W88A 4GY0A 1QW8A 4KIEA 2WQDA 3CQKA 5DO2A 2UZ9A 4AF0B 4G2PA 2WVUA 2DZWA 3U4AA 1JCHB 3T4CA 4MSPA 3O16A 1UPPA 2BNJA 2XIMA 1WZKA 3HBLA 2VCCA 3H4XA 3T78A 4N9CA 3F4NA 1XX1A 1F3WA 2QAFA 2PDUA 4NRSA 2VGIA 1V3LA 2JIWA 2NV1A 1XSJA 4PGLA 4MNLA 5A6TC 1EH9A 4IX0A 3STGA 2Q8LA 3LSBA 3ALFA 3D3FA 4YJ5A 8XIAA 1SSDA 4E3VA 1JCTA 1GYNA 5D2YA 4HNVA 3JRKA 2RH9A 2AOSA 5B8IC 3GZ3A 3MP5A 3B8WA 3RPTA 1EKOA 3CASA 3NQGA 2FDMA 2P1FA 4FK9A 2HE8A 1X1NA 4JTTA 2BGSA 3L4ZA 4OUEA 3QOKA 2VQTA 2YDRA 2PWVA 1RLDA 3DYOA 3FJ4A 4Q33A 2XUCA 3L2MA 2FZBA 4IL2A 1SO3A 1TQJA 1FFRA 1W3JA 1CT5A 3LG3A 2BHYA 1S2WA 3THAA 3FNDA 3MDYB 4NVTA 3AYVA 3QY7A 4B4FA 5HNTA 3ERPA 3FYPA 4PL2A 5D2TA 1FKIA 1QNRA 2J47A 4HA4A 5DRCA 2V5BA 4AY7A 4HPNA 5CGMA 3VMPA 4GXMA 1W9DM 2O9PA 1E70M 4WD0A 3STEA 3ZWTA 3GIPA 3TA6A 3W38A 3NQEA 2WM0A 1FWJC 1TFVA 1FVPA 1XICA 2F4EA 2BSLA 3KBNA 5LGXA 1IIHA 1Z48A 1XYZA 2ZZ1A 3AHZA 1K77A 2BY3A 4E4PA 3L65A 4CVWA 3R13A 3TJLA 4HHMA 3PBGA 3PZMA 4LBSA 3KVKA 3PSVA 2WW5A 3HO8A 3DEQA 4JEJA 3N14A 4Q8OA 1X8FA 5MKGA 1QNSA 3EWBX 9XIMA 4Q6XA 4B2DA 1UKSA 2O0TA 3QSTA 2BVWA 2ZX9A 2YX0A 1ODZA 2WKLA 1Q6GA 2BZNA 1FKLA 1KV5A 1YLVA 3AWOA 1KB3A 1BF2A 3MZ2A 4J4KA 3IJLA 3WN6A 3ITCA 4WJEA 4LBRA 3ES7A 3NQFA 3U4FA 1DJYA 4BF7A 4AAJA 4IMEA 1G94A 3FDGA 3C0QA 1RQBA 5HNUA 3T42A 1SPQA 1XGZA 5JBFA 2YFNA 3ICJA 3BLLA 3M5YA 5FEXA 4J3VA 3E6EA 2D20A 1K9DA 5A94A 2V63A 4L6DA 1TPH1 3H4GA 1Y8BA 2Y5SA 2ZWZA 4UQ9A 2BHZA 3BLIA 1TV3A 1EX1A 4DRIA 3WH0A 3S1GA 1K9FA 1AH0A 4NZ5A 5HW7A 3H7VA 2V2DA 2VENA 4H8VA 2QV5A 5DN1A 1M01A 2CLKA 3ZJ7A 3GZAA 4QITA 5E6ZA 3S83A 2V8ZA 3AICA 1RALA 4YPJA 4M6QA 2FDSA 4ZTXA 1JNTA 4F2BA 2SFPA 4LCRA 3MCMA 4NY2A 4AX6A 2QCDA 2QUNA 1ZHAA 1XSKA 1PWMA 1VEOA 2E9BA 2VX7A 3TYEA 3G1FA 3UZ5A 1ZFJA 3ZT5A 2QF8A 2P3EA 5GQBA 1FH7A 2H8ZA 5D30A 3A9BA 4TW7A 1HKVA 3NQ8A 2C8NA 1P48A 1PEZA 1XLKA 3EXTA 3CK5A 1HL8A 3CH0A 1CBGA 2DEPA 3B8UA 1E6XM 4JTAA 2BXZA 1VF8A 4JL2A 1TB3A 1S2UA 5TQLA 4PTDA 3EMQA 5DFAA 3UQBA 3ZFHA 1Q8AA 3M46A 1JXJA 4KGLA 4UXDA 1HFBA 1SZFA 2NW0A 1JYXA 1JDDA 1I1XA 4XBSA 3W26A 4A3QA 1V03A 4GGQA 1J6PA 3NZPA 1WDSA 3MI2A 1IZCA 2VEKA 2X1SA 2FPTA 3NO3A 2E1DA 4KBXA 1V3IA 1YHTA 5DANA 3E3HA 2Z1SA 4KFNA 1QWKA 3GAYA 3OLIA 3TJXA 3QMRA 4QFUA 4PBEA 2HRWA 3NPWA 5F2LA 4JTSA 3PR9A 5KITA 1YNPA 1YPIA 2C1HA 2VFHA 3KAHA 1XUZA 2QW5A 5A8OA 3TLLA 4IMFA 4LXFA 3WUEA 3VGBA 2WC7A 1DQUA 2ZADA 4L80A 2VKZG 3STPA 3CHEA 5M2FX 3IV8A 1H1YA 1AQMA 1W54A 5HULA 3AHTA 3SJ3A 1P0KA 4R7JA 1H1ZA 3COTA 1G01A 1HX0A 1QPQA 2PCEA 5AKQA 2Z1XA 3V4BA 2GZXA 4ODMA 3H24A 1OADA 1IX5A 1QK2A 4QCFA 1AG1O 2CBVA 1OQFA 2I9UA 4MY8A 3GLCA 2NX9A 1NDVA 2QQ6A 2RDTA 2QULA 1NELA 3N04A 4YTSA 3VK5A 3OHMB 1G1YA 1V77A 1KCXA 2PRMA 5ABHA 3IWPA 3W7PA 1TPWA 1E5JA 4I5UA 3RM4A 2FH8A 2CWNA 2VFDA 2YW4A 1FKHA 1CCWB 4O57A 3P67A 4GO9A 1U5VA 3N6HA 3GX9A 4WY0F 1G67A 1XH0A 1DJHA 3ZVHB 5CBJA 4M29A 2VR4A 3TQ0A 3LHVA 1EF3A 3U5UA 1V93A 2P4VA 3M0VA 1Q6LA 3V75A 3WL1A 1YDNA 4OBSA 2WMJA 2ZXQA 3S1VA 4H9ZA 4LY4A 4NX5A 2QXWA 3WF0A 5KTLA 3VIPA 1L8PA 3ZT6A 2ZZ5A 1U30A 3EB3A 4N6EA 3WH9A 5EYWA 4Z2JA 3FV9A 1XBXA 4I7UA 3VILA 4CD8A 3W72A 5C0QA 2PRLA 2ZRXA 2BDQA 1KGUA 1BQCA 1IXQA 4L61A 1FHDA 1V7AA 3REQA 5IFTA 2A85A 2A6NA 3B0VC 3TYCA 1B1YA 2E6AA 5E9XA 4EIVA 5KZMA 1ZP4A 2DY3A 2INFA 2E68A 1XH2A 1SYTA 4Q8NA 2WK2A 5I79A 3URAA 5HMFA 3I6RA 3S4TA 3GG0A 3GDLA 2E8ZA 1MQPA 2E5DA 4AYSA 3DYPA 3MTWA 3BJFA 2Z0IA 3R94A 4BQ4A 1KV8A 3PS7A 3U6WA 2YLAA 1SQ7A 3S5SA 3Q2DA 3W7GA 4DRKA 3VDAA 2TMDA 4X60A 4E6MA 5D2VA 4E2BA 4H3DA 2V68A 1W5OA 3L4XA 4EP8C 2FTWA 2XH4A 1IE7C 3LQGA 4BEQA 1IZKA 4OKDA 4D1JA 2F6XA 2INEA 3MMWA 4GI9A 4DNMA 3GFZA 1C7SA 4XZLX 4A8RA 3TQVA 4XKYA 4UTMA 1XQKA 5A69A 3QZAA 4PUEA 4TU1A 4XV0A 3E38A 3RX3A 3PAJA 3WLNA 3OZOA 3STCA 3G6LA 2WJEA 2GQ9A 3GDBA 1IEXA 3FHAA 4YYCA 3M41A 3WKZA 3PZTA 3S2LA 3ONBA 1M65A 2BX7A 2PURA 1VYRA 1O95A 4JPGA 1MMFA 1XIHA 2ZIDA 3S1WA 1PDZA 1OX4A 3HZ3A 4E8GA 3MP3A 2G41A 3ZS4A 1REQA 1JZ5A 1KGXA 3N2CA 3OLDA 4LAMA 4WSKA 4CNNA 4ATWA 5CKSA 4JD4A 4N6FA 4UCGA 5HJXA 4P5UA 2VFGA 2Y78A 1J96A 4JTHA 3F4DA 2NSXA 1FDZA 1WZLA 6XIMA 2IXUA 1H0IA 3WQGA 3UXKA 2R8WA 1ZENA 2VOTA 1YMYA 5AYXA 1BYBA 4YLWA 2YL9A 2PTYA 3UR8A 3CUIA 5FF3A 3T7VA 3NOEA 3GPKA 4F9DA 2GVEA 4Q4OA 3UG4A 1CI1A 2ZRUA 1ITUA 1V5XA 1EUNA 1TV7A 2DIEA 4MY1A 4P8XA 1W3NA 5BRBA 4L5ZA 5HK4A 3W7EA 2IKHA 3OGRA 1FQ0A 2B0MA 3L4WA 1O60A 4LF2A 3WQDA 1OC5A 3SUTA 4DJFC 3CPGA 3AC0A 3GUWA 4A4AA 1OGGA 2PLJA 4WX2A 3LNPA 4QS5A 3TSBA 5AN7A 5IFPA 4FZIA 1O94A 3BURA 2WPGA 4K1WA 3CEPA 1XYFA 4Z2GA 4JIRA 1NH6A 1XISA 3R1ZA 4DO5A 1XQLA 3N9SA 3K4WA 1JZ7A 2PI6A 4OOZA 1JRBA 1TE6A 4D6EA 3SCUA 4OJYA 3TSMA 3KTXA 3BH4A 3NDYA 4E0CA 3WUGA 1ZZMA 1PJ9A 4JCLA 3LK6A 3EPMA 2FZ9A 5I02A 1CGXA 3LENA 1GJUA 3UNDA 2NT0A 3OZMA 3MI3A 2OWCA 4HA1A 5C7VA 3PRAA 3JS3A 3IK4A 3U9IA 4P7QA 3JZEA 3G8RA 3Q45A 1MQQA 4JTIA 2W5FA 3FLUA 1JUKA 3URBA 3B4UA 1WPCA 1VFLA 1ME7A 1VP5A 5HW6A 1I60A 4IZGA 3M07A 3L67A 1SW0A 3WH7A 1EDGA 1XLBA 4YVPA 3CUFA 4F40A 3UWEA 3MHGA 4C1KA 3A4WA 3VGGA 4F0SA 2HVNA 4D6CA 2NWRA 1F73A 3UWYA 3WCZA 1GORA 2ZQVA 4MB3A 1UR0A 3ZR5A 3RRAA 3AYRA 4UR8A 4M1RA 3RJYA 4D8ZA 3RMEA 3GH4A 2VX5A 1MUCA 4Y96A 4XUGA 3DUGA 1QPLA 4NAEA 4C6BA 1JQVA 1Q8JA 3T9PA 3GKFA 1BRLA 5LZLA 3VDHA 5LGZA 1IQ8A 2HDJA 3WO8A 2ZR6A 4PMOA 3U0HA 1MRAA 3EBVA 3TK7A 4R3UA 2FFCA 3NIYA 3UXLA 1E3ZA 3WNKA 4YCPA 2WKJA 4JNZA 2I1OA 4JTJA 5D02A 1O5RA 1EDTA 1QHZA 4CD5A 2WANA 4IP4A 3FXYA 3MW7A 1SJCA 2FKPA 2ZVRA 4PN2A 4NJJA 3XIMA 3FYOA 1KRBC 1O68A 1QNQA 3VIOA 2GUUA 1QPKA 1Q1CA 4WUIA 5E93A 1UD5A 1V08A 2OKOA 2W4XA 1UR3M 1CXFA 5H8UA 2Q71A 3CH9A 1XXXA 3L23A 2P3ZA 5LNWA 3CIXA 1WCGA 3R10A 3IKGA 4X0NA 1EUAA 1FD9A 3WNOA 1EOMA 4ZVJA 2CLHA 5AC5A 1ZALA 2DQWA 3HGRA 4XAGA 3ZWSA 1M68A 1UB3A 3PZNA 4CGTA 2V2CA 4W93A 4LS2A 3IJDA 2FMOA 3CMFA 1KQZA 3VTRA 1F8AB 1S5VA 2J6XA 3LD5A 1PYMA 3E49A 4C6DA 3W7KA 4MWAE 2J77A 1PHWA 4JQ4A 2VTFA 1OEPA 5C71A 4REQB 5F2MA 1O66A 1RK6A 3KOFA 3NGJA 4A21A 2CHRA 4QLJA 1SZGA 3UWVA 4PZVA 4LTSA 1EGMA 1QXLA 1FKKA 1EQCA 3S9ZA 3RNDA 2CLMA 5FACA 4JTQA 3MKKA 2W62A 4HZ6A 5REQB 1XG3A 4AHQA 1MW2A 4HYVA 2ATSA 1XKJA 3LPGA 3B06A 1PX3A 3WIJA 1EA9C 5K2ZA 2PLMA 4OU1A 3G3MA 4Q4QA 3D6NA 1JG9A 2WSPA 2TRSA 4HPXA 1UP0A 2A3LA 3KWSA 4MB1A 3K8LA 5HMDA 3DG3A 4MPKA 5E0KA 5CSSA 1P1MA 3A4AA 5I6SA 5ABEA 4HNOA 3P2VA 1K8XA 4IQLA 4X22A 3TMQA 2WCSA 3O6YX 3RHGA 2J9XA 3W28A 1MWOA 2HNHA 5D9PA 1E9LA 1HL2A 2AKZA 4Q8VA 4NNAA 4W8BA 4ZQNA 1LLZA 5A8NA 3W74A 1XLHA 5HPOA 1E1CB 3RITA 1F3EA 3D46A 2ZE0A 2ZE3A 1BHGA 4MY9A 1DTUA 2ZX5A 3DGRA 5K7JA 4NILA 2P0OA 1RR2A 4G7EB 1DIOA 4S3JA 1PPIA 3C0SA 3PZOA 4ZOCA 1HT6A 3W2NA 3PUGA 3SQSA 1O5XA 4QJ1A 2PDQA 1VENA 1D3CA 4IG2A 1LT8A 1QO5A 3DFSA 3WLOA 2J9ZA 4MYXA 1H60A 2WMIB 2GJPA 2FYMA 4QSFA 1PE1A 2INZA 3CHVA 3VD5A 4GY1A 1W1ZA 3AMCA 4QROA 1KTNA 1J0HA 4H4IA 3L2LA 4GUFA 3GXDA 1K8ZA 3W7LA 3MP4A 1J6OA 2CERA 1XRTA 5D03A 3A3XA 2QIIA 3AYTA 1U1UA 1C7TA 2QJMA 2BGQA 7REQA 1EJVC 1XIJA 4PC8A 3ANUA 3FY1A 1XPGA 3N1AA 1WUEA 4NXSA 1Q6HA 5CSYA 1VYPX 1PX8A 4KETA 4HB7A 4UUIA 4C6OA 3SY8A 4WZHA 2DG9A 1LBMA 4I6KA 1E15A 1YE6A 2V67A 1J79A 2WBKA 2GOKA 4GIVA 4H19A 1V02A 4Y2WA 3B9OA 4ERGA 3GFXA 2V0TA 4XG1A 4O4WA 3KBMA 4IH3A 4IUGA 2ISWA 1SMDA 2GWGA 3TR9A 3OG3A 1UUMA 4B16A 3A64A 4LGXA 4FX8A 1EP1A 1LQ0A 5A8PA 1BLIA 4DZ2A 3P0XA 3S0CA 5EMKA 1N1AA 4K1GA 2RJGA 3KE0A 3GIQA 1XLDA 1DWAM 3DHUA 3HQOA 4IHCA 5BXSA 2H8XA 1QT1A 3T1GA 3OLGA 4GA8A 3TXZA 5BW6A 3TA9A 2KFWA 2NQ9A 4W8LA 2C19A 5C2GA 1VPQA 1GYMA 4QAIA 3RR4A 1BSIA 5CLTA 1O5KA 1OC6A 1PAMA 3S2JA 4AIOA 1Z7AA 3SEPA 3O5GA 4XVDA 3CUZA 4R0XA 1JL8A 3F2DA 4W84A 1F74A 1V6XA 5K9DA 5BOEA 4FI4A 1X1ZA 5CC3A 2VDGA 3IGXA 1G5AA 3BJSA 1OFPA 4RZ4A 1DJZA 5DELA 4DT4A 5DY3A 2YXOA 4F2UA 5BOOA 2FHBA 3KEHA 3AFBA 1GQLA 3PWIA 3G1YA 5AYBA 3WQOA 2AKMA 4HP5A 2P76A 4CNPA 3GTXA 4D71A 4HOXA 2CXGA 2YB1A 1FWHC 1BYCA 1DVJA 1S5TA 4M56A 2DH2A 3C5QA 2B4GA 2BFGA 4H9UA 1I45A 1P7TB 1FXPA 2YPIA 4WDWA 4LB3A 2XYLA 4S2CA 2PP1A 3BWWA 3B03A 1LRTA 3I3BA 4GIAA 2QUVA 1BYDA 4AIBA 3WELA 4C5YA 1EOKA 3M0YA 2PA6A 5C55A 1ZTVA 3CGMA 3UVAA 1X6UA 4QLKA 5ABFB 4A3HA 1GPFA 2A3EA 3SY1A 4ITZA 3P62A 4PBFA 2C0HA 5LHFA 2ACSA 5FD0A 3HPZA 2TAAA 3QZ6A 5AY7A 4K6AA 2LGOA 4PE8A 3AU6A 3A9IA 1X6LA 2BV9A 4ILSA 1TPB1 3RO6A 2D22A 5DMNA 3FVMA 4JTEA 3L5MA 4C6FA 4HPHA 1TPEA 1SFTA 1EC9A 4ODPA 2NT1A 1NFGA 5AYIA 4Y7EA 4DAIA 1K6AA 4BF5A 2PDHA 1G7VA 2CIPA 2NZLA 1QCWA 4KPLA 3KVLA 3TW9A 4IJBA 1J10A 2YA2A 2EULA 2CWXA 1W3LA 4XD6A 2O56A 4O10A 1IXOA 3EB2A 3TNOA 1EIXA 3MHFA 1ZJBA 3GIYA 3M44A 1V0MA 3C61A 2WJFA 2HVMA 4DRJA 4BQ5A 1DTNA 2QV4A 4Z2KA 4ZB2A 4WSJA 3TCZA 4JYDA 4K39A 2XH7A 1EC8A 2DSUA 1GGOA 3EDKA 1WYIA 4XTDA 3KDNA 3U7BA 2PWUA 3TC6A 5I3FA 2CKRA 3H9RB 1WX0A 1CNVA 3CUHA 3QHNA 3CWHA 4H9XA 4UTTC 1FOBA 2OYMA 1ZAJA 1WO2A 2XVKA 1ECEA 1BKSA 3D0CA 3CAVA 3KBWA 1W1PA 4L4OA 2EG8A 1SW3A 1JPHA 3S9IA 4TYOA 3MMTA 3VMNA 3ABOA 5B7ZA 2C79A 4QIBA 2Y0FA 2Z00A 1ITQA 3S2NA 5C5YA 2R1KA 2FHFA 3CQHA 4YU1A 4LC6A 3GC4A 2QZRA 1AW2A 4AC7C 2XFFA 4B3ZA 3F03K 3G1AA 3WX7A 1HGWA 1NFBA 6CGTA 4GUGA 4G56A 2QF7A 4QM1A 1IGSA 4NX0A 4LVBA 2A2IA 3VIGA 3PJWA 4JTGA 4AEEA 2VN1A 2W66A 1CLKA 4NYUA 5AHLA 1LWJA 5LYRA 3NXFA 2AL2A 2Y5JA 2PDJA 2XWEA 1N2VA 3ITGA 3N4AA 1EC7A 1SUXA 2Z1WA 2WZHA 4U31A 4E4UA 4LCSA 3C56A 3UCDA 4CN6A 1CXHA 4MIMA 4RE3A 1DIDA 2F7FA 1A4LA 2XFYA 1WE5A 3W23A 1LRNA 1JCJA 2V3FA 3NVDA 3UWQA 3TYAA 4GPNA 3HB9A 4RR4A 2AWGA 3R0UA 3RLUA 1ROUA 1QI4A 2NUYA 1UR4A 3H22A 1K8CA 2QCEA 4LPCA 3RO8A 3SCQA 1D2KA 3DFYA 5B80A 8TIMA 3SCWA 3B8TA 3I7SA 3N2XA 5H1WA 4C6IA 1K03A 1UIOA 3FGCB 4ECLA 4DROA 4ZO6A 1PTAA 3BOFA 1A47A 5JVLA 1S5WA 4FIQA 2WMGA 3UZJA 3F7JA 3NVTA 2F21A 2ZXDA 4U4MA 3IKDA 3P5YA 3M0ZA 3O15A 4IMCA 1CENA 3CC1A 2PPGA 3NAVA 2PS2A 4GYJA 4KQNA 1X96A 1J4RA 4LANA 3WQ4A 1I2PA 2OT0A 4GZIA 4AWSA 2RFGA 5G2HA 2E0PA 1XDMA 4NUWA 4S3FA 1I0BA 5D9MA 2OLHA 5DX7A 2J7FA 3LGGA 2GDUA 1Q45A 2W0UA 2Z4GA 3CMJA 2W6RA 4UTFA 2D2HA 5T26A 1YX1A 2CZEA 1FKTA 1FKJA 5M1TA 2BOFX 1EO5A 4PH6A 1Z8AA 3HGSA 3VGHA 4H04A 3FA3A 3PANA 3T09A 3KRSA 1Q2SA 1R0MA 3RLGA 3LBOA 1DXEA 4IIHA 4QE1A 1HZYA 3QW4B 3GYCA 3TKFA 2OQLA 3LV6A 3N15A 1V02E 4CQAA 5KZDA 5HJYA 4S23A 1OFRA 3AJXA 5GPRA 1TJPA 4IFKB 1M7XA 4KWSA 2VWTA 1E43A 1B54A 2VT0A 3HURA 5K3VA 4Q8UA 4PMYA 4U28A 5A1AA 1YKWA 1Q13A 3G6MA 3GG1A 1DKWA 3V5OA 1ISWA 4UOZA 5A6BD 1G69A 4CNTA 5DCBA 1WXJA 4HU8A 1XWYA 4FNUA 3FHQA 3QEZA 2XVGA 2PFHA 1H61A 5A95A 2FTPA 3BCFA 2YBUA 1K1DA 1QBAA 3EKLA 2B7PA 2GSJA 2F84A 1A3WA 4MNMA 3AZTA 3GW0A 4QQUA 1UP2A 7TAAA 1HO4A 1EQPA 5EMJA 3H6OA 1ONEA 4DWSB 4XK2A 1OHLA 1OZMA 2I56A 2CBUA 4TX8A 3CAQA 2QUTA 2J7EA 1RD5A 4OUIA 3GNXA 1K9TA 3YPIA 1QZ2A 3K13A 1MVYA 4DHGA 1VFMA 2YXGA 4HNCA 2VI0A 3WNNA 1QHPA 4P7RA 1ZK6A 1GTEA 2Z6IA 1UMYA 4X2RA 1NFPA 3BG9A 1ICPA 2AQWA 2DPEA 1WXYA 5CZSA 2X2YA 3U2EA 1RLCL 3TAOA 3LN3A 1WDQA 1VQTA 1E6NA 3CMGA 2GDQA 3APGA 1GOXA 4XX6A 1TKKA 4CN1A 2OZ8A 3EEGA 3F2BA 1XG4A 3J7HA 4IGHA 2OGYA 2WMFA 4HKPA 2IKGA 3M4HA 3SGGA 2WBGA 4U86A 2YLLA 3U5YA 2GSEA 3LHUA 3UPBA 5EKYA 3R5EA 3AOFA 2QCLA 1K3UA 3BDKA 1H3GA 4EOUA 1BVWA 2BBFA 4IOTA 5CJMA 3IK8A 5GNZA 4U3CA 1GPWA 3CZKA 4B90A 2VM8A 1PKNA 1YNQA 2DFAA 2WPBA 3POCA 5DT5A 2H9AB 3TCSA 1XW8A 4DI9A 5ABTA 1RPXA 2E8YA 2XIJA 3DOPA 3CBWA 1OC7A 1R85A 2FPYA 2Z1KA 4LNYA 2WSKA 5A2BA 2DG3A 2G3MA 1VFOA 3VCRA 3TC5A 1JCMP 1FDJA 4HD5A 4HGXA 3W84A 4QDMA 4DUXA 1WKDA 1OX4B 1EQ3A 3GU0A 4LUIA 1EWDA 3W6LA 3O5DA 4GQGA 1ZCCA 1P0DA 4F9JA 1TVPA 4AVNA 4BWLC 4UTUA 3T2OA 2DIJA 3M5XA 4EANA 3OOBA 2OEJA 1Z9AA 4MWAC 1Q6OA 4OHQA 2XP4A 4PYSA 3WLRA 1I9CB 1QBBA 2ON3A 1FKGA 2WVVB 1V6VA 4CLMA 1EGZA 4O0KA 4P7NA 3C4UA 1AW5A 2EG6A 2PGFA 1Z41A 3O5JA 1JCYA 1HP4A 1Q2RA 1VBGA 4Y90A 5J5DA 3KP1A 1ZL1A 3LM3A 2QPXA 1F40A 1EA0A 5DIUA 4PMQA 1C3FA 3M9YA 5AYZA 1JCXA 1J4IA 4QX4A 4UZSA 3IHZA 1GOKA 5CC5A 1EBHA 1JD9A 4PTVA 3L0KA 1B3XA 1W37A 2XM1A 2YFOA 1V6YA 1ZQ5A 3WF1A 3NQDA 4ZGYA 2PEVA 2Y7FA 2P53A 4U5IA 4LYKA 3W02A 2A79A 1E1EA 3NEVA 4AHOA 3WF4A 1HKJA 4LAYA 4DWSC 2DUXA 2GUYA 2PC4A 3GTHA 4LRSA 1O6IA 1KT0A 3P93A 1ZBCA 3VIFA 3SFWA 2DT1A 5GJNA 1TCMA 4KCVA 3R25A 4EK7A 3VNJA 1JNDA 4GYPC 4M3PA 1MZRA 1ZP3A 3MV01 3OP2A 3RU6A 5LIKX 5I98A 3P81A 4I9JA 4BKNA 3BAXA 4UWMA 1W0MA 4N4QA 2A3AA 3UYCA 1TZ9A 2XZ7A 4A8LA 1LWHA 1RA5A 3UWUA 4AX7A 5FJRA 4ADTA 4BJHA 4UR7A 4JNMA 3KLLA 3F5KA 3IACA 5HQMA 2Y7EA 4IIGA 4H2CA 1TA3A 1QTWA 4GRSA 5FEZA 4AC1X 3TFCA 2PTDA 4AUBA