2D9FA

Solution structure of ruh-047, an fkbp domain from human cdna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
135
structure length
135
Chain Sequence
GSSGSSGEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDRPDLEMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 8 variant
publication title Solution structure of RUH-047, an FKBP domain from human cDNA
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 14
structure length 135
sequence length 135
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2d9fA01
2MLYA 1FKFA 2Y78A 5DIVA 2MF9A 1D7IA 2LGOA 2XP9A 3VAWA 5HKGA 3O5GA 2MLZA 2KFWA 5HWCA 1B6CA 1P5QA 4ODKA 4TW8A 5DIUA 3KADA 4TX0A 2VCDA 4FAPA 1T11A 3EY6A 3NTPA 2PV3A 4QIBA 1FKGA 3RGCA 4DT4A 4G2PA 2XP5A 3IKDA 2RUDA 5HUAA 1ROTA 2ITKA 4LAWA 4MGVA 4DIPA 4DRJA 2RURA 1D6OA 2KGJA 3TCZA 2PV2A 3O5LA 4QT2A 1ZCNA 3PA7A 1D7HA 3KAIA 1FKSA 2K8IA 2KR7A 4G50A 3TC5A 4DRPA 1R9HA 3O5EA 2XP8A 2N87A 4BF8A 2XP3A 4ODLA 1U79A 4W9OA 5HTGA 2F2DA 2PBCA 2ZQTA 1L1PA 3IKGA 1W26A 3LUOA 4TW7A 5B8IC 4NNRA 2RUCA 3O5PA 1D7JA 2RUQA 1QPLA 2M08A 2FKEA 3GPKA 4JFJA 4DROA 3UQBA 4DRHA 2ZR4A 1J4HA 5HT1A 2DG9A 3PRDA 5HWBA 1QZ2A 2XP4A 3O5OA 5HW8A 3MDYB 4GGQA 4W9PA 4C02B 1JVWA 1BL4A 2XP7A 3IK8A 4FN2A 3O5DA 1A7XA 3KACA 1J4IA 3JYJA 4TW6A 1Q6IA 2M1IA 2FAPA 1BKFA 2XPBA 3I6CA 3JYMA 1J4RA 4DRMA 1ZK6A 3UQAA 4JFIA 2D9FA 4ITZA 3FAPA 1EQ3A 1YW5A 5HW6A 5BXJA 1FD9A 1N1AA 3CGMA 2DG3A 4JYSA 1FAPA 4R0XA 1FKLA 2IF4A 1FKRA 2PPOA 4LAVA 1Q6UA 2RQSA 4DRIA 2PPPA 2PV1A 2ZR5A 4ODPA 4DH0A 4JFKA 4DRNA 1FKBA 3O5QA 3WH0A 2LPVA 3NRKA 3O5MA 4LAYA 3UI4A 1F40A 2VN1A 3JXVA 1YATA 4N19A 4ODNA 2AWGA 2PPNA 1PINA 3KZ7A 4JFMA 3O5RA 1J6YA 4U86A 2UZ5A 2ZR6A 5J6EA 1KT1A 2KI3A 3CGNA 1QPFA 3KAFA 2XP6A 4JFLA 2KE0A 4U85A 2LJ4A 2OFNA 3UI6A 1KT0A 5I98A 2LKNA 4ODMA 4IQ2A 3O5KA 1Q6HA 1Y0OA 1NMVA 2JZVA 2RSEA 3UI5A 4DZ2A 4TYOA 1FJDA 1FKJA 4J4NA 4O2TA 4J4OA 1M5YA 3TDBA 4ODOA 4IQCA 4IPXA 2MPHA 1HXVA 2M2AA 1PBKA 4ODRA 4GIVA 1FKHA 4U84A 1EYMA 1F8AB 5DITA 2KO7A 4DRQA 4W9QA 1TCOC 2F4EA 1JNTA 2XPAA 3RFWA 2MNTA 3O5IA 4ODQA 2DG4A 2ZQUA 1FKIA 1ROUA 2L2SA 2Q5AA 1FKKA 2ZQVA 3KABA 3O5JA 3ODKA 4LAXA 5HW7A 1JNSA 2ZQSA 3PRBA 3H9RB 3KCEA 4TNSA 3UQIA 1Q1CA 5GPGA 3B7XA 2F21A 3IHZA 3KAGA 4DRKA 3O5FA 4DZ3A 3KAHA 4QT3A 3UF8A 1FKDA 3OOBA 4MSPA 1NMWA 1C9HA 2MLXA 5D75A 3NI6A 1FKTA 1NSGA
chains in the Genus database with same CATH superfamily
1GRJA 4WKAA 2G41A 2MF9A 4MAVA 1H0GA 2MLZA 2KFWA 5HWCA 2B31A 4DWSA 4ODKA 4TX0A 4FAPA 3CHFA 2PV3A 3ARRA 3FXYA 2PN0A 1H0IA 2ITKA 4MGVA 3O5LA 3WD1A 4DRPA 1X6NA 2XP8A 1HJVA 2XP3A 1ITXA 2F2DA 1OWQA 4NNRA 2OLHA 1QPLA 2FKEA 1J4HA 1O6IA 1QZ2A 2XP4A 3O5OA 1BL4A 2XP7A 3G6LA 3O5DA 1A7XA 1ZL1A 2M1IA 3I6CA 2D9FA 1EQ3A 4R5EA 1YW5A 1HKKA 2WK2A 1Q6UA 4DRIA 2A3CA 1FKBA 4LAYA 1J6YA 3ARSA 4U86A 4Z2IA 2KI3A 1LG2A 3OA5A 1UR9A 1ZB5A 3UI6A 2OFNA 5I98A 1UR8A 4Q22A 1ZBWA 1Y0OA 3AS0A 4IT6A 1NH6A 1M5YA 4ODOA 4S3JA 4IPXA 3BMBA 3WL1A 2DSZA 1ZBCA 1SR0A 2KO7A 1LL7A 4Z2KA 2XPAA 2G8ZA 3O5IA 1XHGA 3WIJA 1FKKA 3KABA 1EHNA 4P8XA 3WD2A 2EULA 3RM4A 4S3KA 1TFVA 3ARUA 3KAGA 3UF8A 2P4VA 3B9EA 2MLXA 1C9HA 2DT3A 1FKTA 1J4IA 2MLYA 2Y78A 1D7IA 1NWSA 1ZBKA 2AOSA 3B8SA 3VAWA 1B6CA 3B9DA 2DT0A 3IKDA 1HKJA 4QZVB 4DRJA 3CHDA 3AROA 3QOKA 4ZPVR 1E15A 3O5EA 4HBOA 4ODLA 1U79A 5HTGA 2PBCA 1L1PA 1WNOA 3W4RA 1D7JA 3GPKA 4JFJA 4DRHA 5HT1A 5HWBA 3WL0A 5HW8A 1GOIA 5DEZA 5GPRA 2DSUA 4MNKA 3KACA 1SYTA 4WKFA 1Q6IA 2FAPA 3AS2A 2XPBA 1J4RA 1FFRA 3WD0A 3EIPA 1OGBA 5HBFA 2A3EA 4ITZA 3FAPA 1FD9A 1GPFA 4AY1A 3ARVA 2DG3A 4JYSA 1FKRA 2PPOA 4DWSB 2DSWA 4ODPA 4DH0A 4JFKA 2B5UB 3O5QA 4L72B 3O5MA 4ODNA 4N19A 1PINA 1CTNA 4Z2GA 3CGNA 3WQVA 2WLYA 4JFLA 1JNEA 4U85A 1E6RA 1KT0A 2LKNA 2YBUA 3O5KA 1ZU8A 2DSVA 1FFQA 1Q6HA 4DZ2A 3ALGA 3ARXA 1FKJA 3RM8A 4J4OA 3TDBA 3AS1A 4IQCA 2M2AA 4GIVA 1FKHA 3CH9A 3GTYX 1TCOC 3RFWA 2MNTA 5J6EA 2ZQUA 1FKIA 2L2SA 2ZQVA 2Q5AA 4LAXA 3ODKA 3H9RB 3ARQA 4P8WA 1GUVA 1LQ0A 1Q1CA 2F21A 4DRKA 4IT4A 1FKDA 3OOBA 4ZPTR 5D75A 3KCEA 5DIVA 4ML4A 4ZS6A 2LGOA 2XP9A 5HKGA 1W9PA 4LGXA 2FDMA 4DWSD 4TW8A 3CHEA 5DIUA 2VCDA 3EY6A 3NTPA 1FKGA 4PTMA 4DT4A 4G2PA 2XP5A 1W1VA 2RUDA 1ROTA 2RURA 1D6OA 1WAWA 2KGJA 3TCZA 2PV2A 2A3BA 4QT2A 3PA7A 4G50A 2KR7A 1R9HA 3WD3A 2N87A 1E9LA 4BF8A 1LJYA 1W26A 3IKGA 3LUOA 4TW7A 5B8IC 2RUCA 3WD4A 3PRAA 2RUQA 2M08A 2A3AA 2ZR4A 2DG9A 3PRDA 1W1TA 4GGQA 1OGGA 3ALFA 4C02B 1JVWA 2QF8A 4FN2A 3JYJA 4WKHA 3UQAA 4JFIA 1EIBA 3RMEA 2WLZA 2F23A 2IUZA 4HBEA 5BXJA 1N1AA 3CGMA 1JCHB 4HARA 1EDQA 4LAVA 2RQSA 2PPPA 3ARTA 2PV1A 2ZR5A 4DRNA 5DF0A 3ARPA 2LPVA 4NSBA 3JXVA 1YATA 2PPNA 5JH8A 1HJWA 3O5RA 4DWSC 2ZR6A 1QPFA 2YBTA 3CHCA 3ARZA 4ODMA 1W1PA 1HKMA 1NMVA 2JZVA 1FJDA 4J4NA 1HJXA 1NWRA 5DO2A 1WB0A 1HXVA 1PBKA 4Q7NA 1F8AB 4WJXA 5DITA 4DRQA 4MPKA 4W9QA 2F4EA 1JNTA 2O92A 4ODQA 5HW6A 1ROUA 3WQWA 3O5JA 5HW7A 2ZQSA 4TNSA 3UQIA 5GPGA 3B7XA 3IHZA 4Z2JA 2DT1A 3KAHA 4Z2HA 4MSPA 3AQUA 4WK9A 2ESCA 1X6LA 1NSGA 1FKFA 3WKZA 4MTVA 3O5GA 1P5QA 2O9OA 3KADA 1T11A 3RGCA 4QIBA 3GU0A 5HUAA 4DIPA 4LAWA 3B9AA 4NZCA 4ZPWR 1ZCNA 1D7HA 3KAIA 1FKSA 2K8IA 3TC5A 1IX5A 1K9TA 4P8VA 4W9OA 2ZQTA 1ZBVA 2WM0A 4MNLA 3O5PA 3UQBA 4DROA 1E6ZA 3AS3A 4XAKA 1LG1A 1D2KA 3RM9A 3MDYB 4W9PA 1NWUA 1LL4A 1HKIA 3IK8A 1W9UA 4TW6A 1W9VA 1BKFA 4MNJA 3JYMA 1JNDA 4DRMA 3ARYA 1ZK6A 4MNMA 1FAPA 4R0XA 1FKLA 3PR9A 2IF4A 1RD6A 4W5UA 3WH0A 1KFWA 3NRKA 1F40A 3UI4A 2VN1A 2AWGA 3KZ7A 4JFMA 4URIA 2UZ5A 2DT2A 4P8UA 1KT1A 1LL6A 3KAFA 2PI6A 2XP6A 2ETNA 2KE0A 1W1YA 2LJ4A 4L3NA 4IQ2A 3FY1A 2DPEA 2RSEA 3UI5A 1VF8A 4TYOA 4O2TA 1E6PA 4UDMA 2MPHA 3ARWA 4ODRA 4U84A 1EYMA 1XRVA 4KR0B 4KQZA 1NWTA 1E6NA 1E44A 2DG4A 5GQBA 1JNSA 3PRBA 4Z2LA 3BXWA 4DZ3A 3O5FA 4WIWA 4QT3A 3CZ8A 1NMWA 3NI6A 3G6MA
chains in the Genus database with same CATH topology
4WKAA 2G41A 2MF9A 4MAVA 1H0GA 2MLZA 2KFWA 5HWCA 2B31A 4DWSA 4ODKA 4TX0A 4FAPA 3CHFA 2PV3A 3ARRA 3FXYA 1H0IA 2ITKA 4MGVA 3O5LA 3WD1A 4DRPA 1X6NA 2XP8A 1HJVA 2XP3A 1ITXA 2F2DA 1OWQA 4NNRA 2OLHA 1QPLA 2FKEA 1J4HA 1O6IA 1QZ2A 2XP4A 3O5OA 1BL4A 2XP7A 3G6LA 3O5DA 1A7XA 1ZL1A 2M1IA 3I6CA 2D9FA 1EQ3A 4R5EA 1YW5A 1HKKA 2WK2A 1Q6UA 4DRIA 2A3CA 1FKBA 4LAYA 1J6YA 3ARSA 4U86A 4Z2IA 2KI3A 1LG2A 3OA5A 1UR9A 1ZB5A 3UI6A 2OFNA 5I98A 1UR8A 4Q22A 1ZBWA 1Y0OA 3AS0A 4IT6A 1NH6A 1M5YA 4ODOA 4S3JA 4IPXA 3WL1A 2DSZA 1ZBCA 1SR0A 2KO7A 1LL7A 4Z2KA 2XPAA 2G8ZA 3O5IA 1XHGA 3WIJA 1FKKA 3KABA 1EHNA 4P8XA 3WD2A 3RM4A 4S3KA 1TFVA 3ARUA 3KAGA 3UF8A 3B9EA 2MLXA 1C9HA 2DT3A 1FKTA 1J4IA 2MLYA 2Y78A 1D7IA 1NWSA 1ZBKA 2AOSA 3B8SA 3VAWA 1B6CA 3B9DA 2DT0A 3IKDA 1HKJA 4QZVB 4DRJA 3CHDA 3AROA 3QOKA 4ZPVR 1E15A 3O5EA 4HBOA 4ODLA 1U79A 5HTGA 2PBCA 1L1PA 1WNOA 3W4RA 1D7JA 3GPKA 4JFJA 4DRHA 5HT1A 5HWBA 3WL0A 5HW8A 1GOIA 5DEZA 5GPRA 2DSUA 4MNKA 3KACA 1SYTA 4WKFA 1Q6IA 2FAPA 3AS2A 2XPBA 1J4RA 1FFRA 3WD0A 1OGBA 5HBFA 2A3EA 4ITZA 3FAPA 1FD9A 1GPFA 4AY1A 3ARVA 2DG3A 4JYSA 1FKRA 2PPOA 4DWSB 2DSWA 4ODPA 4DH0A 4JFKA 3O5QA 4L72B 3O5MA 4ODNA 4N19A 1PINA 1CTNA 4Z2GA 3CGNA 3WQVA 2WLYA 4JFLA 1JNEA 4U85A 1E6RA 1KT0A 2LKNA 2YBUA 3O5KA 1ZU8A 2DSVA 1FFQA 1Q6HA 4DZ2A 3ALGA 3ARXA 1FKJA 3RM8A 4J4OA 3TDBA 3AS1A 4IQCA 2M2AA 4GIVA 1FKHA 3CH9A 1TCOC 3RFWA 2MNTA 5J6EA 2ZQUA 1FKIA 2L2SA 2ZQVA 2Q5AA 4LAXA 3ODKA 3H9RB 3ARQA 4P8WA 1GUVA 1LQ0A 1Q1CA 2F21A 4DRKA 4IT4A 1FKDA 3OOBA 4ZPTR 5D75A 3KCEA 5DIVA 4ML4A 4ZS6A 2LGOA 2XP9A 5HKGA 1W9PA 4LGXA 2FDMA 4DWSD 4TW8A 3CHEA 5DIUA 2VCDA 3EY6A 3NTPA 1FKGA 4PTMA 4DT4A 4G2PA 2XP5A 1W1VA 2RUDA 1ROTA 2RURA 1D6OA 1WAWA 2KGJA 3TCZA 2PV2A 2A3BA 4QT2A 3PA7A 4G50A 2KR7A 1R9HA 3WD3A 2N87A 1E9LA 4BF8A 1LJYA 1W26A 3IKGA 3LUOA 4TW7A 5B8IC 2RUCA 3WD4A 3PRAA 2RUQA 2M08A 2A3AA 2ZR4A 2DG9A 3PRDA 1W1TA 4GGQA 1OGGA 3ALFA 4C02B 1JVWA 2QF8A 4FN2A 3JYJA 4WKHA 3UQAA 4JFIA 1EIBA 3RMEA 2WLZA 2IUZA 4HBEA 5BXJA 1N1AA 3CGMA 4HARA 1EDQA 4LAVA 2RQSA 2PPPA 3ARTA 2PV1A 2ZR5A 4DRNA 5DF0A 3ARPA 2LPVA 4NSBA 3JXVA 1YATA 2PPNA 5JH8A 1HJWA 3O5RA 4DWSC 2ZR6A 1QPFA 2YBTA 3CHCA 3ARZA 4ODMA 1W1PA 1HKMA 1NMVA 2JZVA 1FJDA 4J4NA 1HJXA 1NWRA 5DO2A 1WB0A 1HXVA 1PBKA 4Q7NA 1F8AB 4WJXA 5DITA 4DRQA 4MPKA 4W9QA 2F4EA 1JNTA 2O92A 4ODQA 5HW6A 1ROUA 3WQWA 3O5JA 5HW7A 2ZQSA 4TNSA 3UQIA 5GPGA 3B7XA 3IHZA 4Z2JA 2DT1A 3KAHA 4Z2HA 4MSPA 3AQUA 4WK9A 2ESCA 1X6LA 1NSGA 1FKFA 3WKZA 4MTVA 3O5GA 1P5QA 2O9OA 3KADA 1T11A 3RGCA 4QIBA 5HUAA 4DIPA 4LAWA 3B9AA 4NZCA 4ZPWR 1ZCNA 1D7HA 3KAIA 1FKSA 2K8IA 3TC5A 1IX5A 1K9TA 4P8VA 4W9OA 2ZQTA 1ZBVA 2WM0A 4MNLA 3O5PA 3UQBA 4DROA 1E6ZA 3AS3A 4XAKA 1LG1A 1D2KA 3RM9A 3MDYB 4W9PA 1NWUA 1LL4A 1HKIA 3IK8A 1W9UA 4TW6A 1W9VA 1BKFA 4MNJA 3JYMA 1JNDA 4DRMA 3ARYA 1ZK6A 4MNMA 1FAPA 4R0XA 1FKLA 3PR9A 2IF4A 1RD6A 4W5UA 3WH0A 1KFWA 3NRKA 1F40A 3UI4A 2VN1A 2AWGA 3KZ7A 4JFMA 4URIA 2UZ5A 2DT2A 4P8UA 1KT1A 1LL6A 3KAFA 2PI6A 2XP6A 2KE0A 1W1YA 2LJ4A 4L3NA 4IQ2A 3FY1A 2DPEA 2RSEA 3UI5A 1VF8A 4TYOA 4O2TA 1E6PA 2MPHA 3ARWA 4ODRA 4U84A 1EYMA 1XRVA 4KR0B 4KQZA 1NWTA 1E6NA 2DG4A 5GQBA 1JNSA 3PRBA 4Z2LA 3BXWA 4DZ3A 3O5FA 4WIWA 4QT3A 3CZ8A 1NMWA 3NI6A 3G6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLY A;  1FKF A;  2Y78 A;  5DIV A;  2MF9 A;  1D7I A;  2LGO A;  2XP9 A;  3VAW A;  5HKG A;  3O5G A;  2MLZ A;  2KFW A;  5HWC A;  1B6C A;  1P5Q A;  4ODK A;  4TW8 A;  5DIU A;  3KAD A;  4TX0 A;  2VCD A;  4FAP A;  1T11 A;  3EY6 A;  3NTP A;  2PV3 A;  4QIB A;  1FKG A;  3RGC A;  4DT4 A;  4G2P A;  2XP5 A;  3IKD A;  2RUD A;  5HUA A;  1ROT A;  2ITK A;  4LAW A;  4MGV A;  4DIP A;  4DRJ A;  2RUR A;  1D6O A;  2KGJ A;  3TCZ A;  2PV2 A;  3O5L A;  4QT2 A;  1ZCN A;  3PA7 A;  1D7H A;  3KAI A;  1FKS A;  2K8I A;  2KR7 A;  4G50 A;  3TC5 A;  4DRP A;  1R9H A;  3O5E A;  2XP8 A;  2N87 A;  4BF8 A;  2XP3 A;  4ODL A;  1U79 A;  4W9O A;  5HTG A;  2F2D A;  2PBC A;  2ZQT A;  1L1P A;  3IKG A;  1W26 A;  3LUO A;  4TW7 A;  5B8I C;  4NNR A;  2RUC A;  3O5P A;  1D7J A;  2RUQ A;  1QPL A;  2M08 A;  2FKE A;  3GPK A;  4JFJ A;  4DRO A;  3UQB A;  4DRH A;  2ZR4 A;  1J4H A;  5HT1 A;  2DG9 A;  3PRD A;  5HWB A;  1QZ2 A;  2XP4 A;  3O5O A;  5HW8 A;  3MDY B;  4GGQ A;  4W9P A;  4C02 B;  1JVW A;  1BL4 A;  2XP7 A;  3IK8 A;  4FN2 A;  3O5D A;  1A7X A;  3KAC A;  1J4I A;  3JYJ A;  4TW6 A;  1Q6I A;  2M1I A;  2FAP A;  1BKF A;  2XPB A;  3I6C A;  3JYM A;  1J4R A;  4DRM A;  1ZK6 A;  3UQA A;  4JFI A;  2D9F A;  4ITZ A;  3FAP A;  1EQ3 A;  1YW5 A;  5HW6 A;  5BXJ A;  1FD9 A;  1N1A A;  3CGM A;  2DG3 A;  4JYS A;  1FAP A;  4R0X A;  1FKL A;  2IF4 A;  1FKR A;  2PPO A;  4LAV A;  1Q6U A;  2RQS A;  4DRI A;  2PPP A;  2PV1 A;  2ZR5 A;  4ODP A;  4DH0 A;  4JFK A;  4DRN A;  1FKB A;  3O5Q A;  3WH0 A;  2LPV A;  3NRK A;  3O5M A;  4LAY A;  3UI4 A;  1F40 A;  2VN1 A;  3JXV A;  1YAT A;  4N19 A;  4ODN A;  2AWG A;  2PPN A;  1PIN A;  3KZ7 A;  4JFM A;  3O5R A;  1J6Y A;  4U86 A;  2UZ5 A;  2ZR6 A;  5J6E A;  1KT1 A;  2KI3 A;  3CGN A;  1QPF A;  3KAF A;  2XP6 A;  4JFL A;  2KE0 A;  4U85 A;  2LJ4 A;  2OFN A;  3UI6 A;  1KT0 A;  5I98 A;  2LKN A;  4ODM A;  4IQ2 A;  3O5K A;  1Q6H A;  1Y0O A;  1NMV A;  2JZV A;  2RSE A;  3UI5 A;  4DZ2 A;  4TYO A;  1FJD A;  1FKJ A;  4J4N A;  4O2T A;  4J4O A;  1M5Y A;  3TDB A;  4ODO A;  4IQC A;  4IPX A;  2MPH A;  1HXV A;  2M2A A;  1PBK A;  4ODR A;  4GIV A;  1FKH A;  4U84 A;  1EYM A;  1F8A B;  5DIT A;  2KO7 A;  4DRQ A;  4W9Q A;  1TCO C;  2F4E A;  1JNT A;  2XPA A;  3RFW A;  2MNT A;  3O5I A;  4ODQ A;  2DG4 A;  2ZQU A;  1FKI A;  1ROU A;  2L2S A;  2Q5A A;  1FKK A;  2ZQV A;  3KAB A;  3O5J A;  3ODK A;  4LAX A;  5HW7 A;  1JNS A;  2ZQS A;  3PRB A;  3H9R B;  3KCE A;  4TNS A;  3UQI A;  1Q1C A;  5GPG A;  3B7X A;  2F21 A;  3IHZ A;  3KAG A;  4DRK A;  3O5F A;  4DZ3 A;  3KAH A;  4QT3 A;  3UF8 A;  1FKD A;  3OOB A;  4MSP A;  1NMW A;  1C9H A;  2MLX A;  5D75 A;  3NI6 A;  1FKT A;  1NSG A; 
#chains in the Genus database with same CATH topology
 1GRJ A;  4WKA A;  2G41 A;  2MF9 A;  4MAV A;  1H0G A;  2MLZ A;  2KFW A;  5HWC A;  2B31 A;  4DWS A;  4ODK A;  4TX0 A;  4FAP A;  3CHF A;  2PV3 A;  3ARR A;  3FXY A;  2PN0 A;  1H0I A;  2ITK A;  4MGV A;  3O5L A;  3WD1 A;  4DRP A;  1X6N A;  2XP8 A;  1HJV A;  2XP3 A;  1ITX A;  2F2D A;  1OWQ A;  4NNR A;  2OLH A;  1QPL A;  2FKE A;  1J4H A;  1O6I A;  1QZ2 A;  2XP4 A;  3O5O A;  1BL4 A;  2XP7 A;  3G6L A;  3O5D A;  1A7X A;  1ZL1 A;  2M1I A;  3I6C A;  2D9F A;  1EQ3 A;  4R5E A;  1YW5 A;  1HKK A;  2WK2 A;  1Q6U A;  4DRI A;  2A3C A;  1FKB A;  4LAY A;  1J6Y A;  3ARS A;  4U86 A;  4Z2I A;  2KI3 A;  1LG2 A;  3OA5 A;  1UR9 A;  1ZB5 A;  3UI6 A;  2OFN A;  5I98 A;  1UR8 A;  4Q22 A;  1ZBW A;  1Y0O A;  3AS0 A;  4IT6 A;  1NH6 A;  1M5Y A;  4ODO A;  4S3J A;  4IPX A;  3BMB A;  3WL1 A;  2DSZ A;  1ZBC A;  1SR0 A;  2KO7 A;  1LL7 A;  4Z2K A;  2XPA A;  2G8Z A;  3O5I A;  1XHG A;  3WIJ A;  1FKK A;  3KAB A;  1EHN A;  4P8X A;  3WD2 A;  2EUL A;  3RM4 A;  4S3K A;  1TFV A;  3ARU A;  3KAG A;  3UF8 A;  2P4V A;  3B9E A;  2MLX A;  1C9H A;  2DT3 A;  1FKT A;  1J4I A;  2MLY A;  2Y78 A;  1D7I A;  1NWS A;  1ZBK A;  2AOS A;  3B8S A;  3VAW A;  1B6C A;  3B9D A;  2DT0 A;  3IKD A;  1HKJ A;  4QZV B;  4DRJ A;  3CHD A;  3ARO A;  3QOK A;  4ZPV R;  1E15 A;  3O5E A;  4HBO A;  4ODL A;  1U79 A;  5HTG A;  2PBC A;  1L1P A;  1WNO A;  3W4R A;  1D7J A;  3GPK A;  4JFJ A;  4DRH A;  5HT1 A;  5HWB A;  3WL0 A;  5HW8 A;  1GOI A;  5DEZ A;  5GPR A;  2DSU A;  4MNK A;  3KAC A;  1SYT A;  4WKF A;  1Q6I A;  2FAP A;  3AS2 A;  2XPB A;  1J4R A;  1FFR A;  3WD0 A;  3EIP A;  1OGB A;  5HBF A;  2A3E A;  4ITZ A;  3FAP A;  1FD9 A;  1GPF A;  4AY1 A;  3ARV A;  2DG3 A;  4JYS A;  1FKR A;  2PPO A;  4DWS B;  2DSW A;  4ODP A;  4DH0 A;  4JFK A;  2B5U B;  3O5Q A;  4L72 B;  3O5M A;  4ODN A;  4N19 A;  1PIN A;  1CTN A;  4Z2G A;  3CGN A;  3WQV A;  2WLY A;  4JFL A;  1JNE A;  4U85 A;  1E6R A;  1KT0 A;  2LKN A;  2YBU A;  3O5K A;  1ZU8 A;  2DSV A;  1FFQ A;  1Q6H A;  4DZ2 A;  3ALG A;  3ARX A;  1FKJ A;  3RM8 A;  4J4O A;  3TDB A;  3AS1 A;  4IQC A;  2M2A A;  4GIV A;  1FKH A;  3CH9 A;  3GTY X;  1TCO C;  3RFW A;  2MNT A;  5J6E A;  2ZQU A;  1FKI A;  2L2S A;  2ZQV A;  2Q5A A;  4LAX A;  3ODK A;  3H9R B;  3ARQ A;  4P8W A;  1GUV A;  1LQ0 A;  1Q1C A;  2F21 A;  4DRK A;  4IT4 A;  1FKD A;  3OOB A;  4ZPT R;  5D75 A;  3KCE A;  5DIV A;  4ML4 A;  4ZS6 A;  2LGO A;  2XP9 A;  5HKG A;  1W9P A;  4LGX A;  2FDM A;  4DWS D;  4TW8 A;  3CHE A;  5DIU A;  2VCD A;  3EY6 A;  3NTP A;  1FKG A;  4PTM A;  4DT4 A;  4G2P A;  2XP5 A;  1W1V A;  2RUD A;  1ROT A;  2RUR A;  1D6O A;  1WAW A;  2KGJ A;  3TCZ A;  2PV2 A;  2A3B A;  4QT2 A;  3PA7 A;  4G50 A;  2KR7 A;  1R9H A;  3WD3 A;  2N87 A;  1E9L A;  4BF8 A;  1LJY A;  1W26 A;  3IKG A;  3LUO A;  4TW7 A;  5B8I C;  2RUC A;  3WD4 A;  3PRA A;  2RUQ A;  2M08 A;  2A3A A;  2ZR4 A;  2DG9 A;  3PRD A;  1W1T A;  4GGQ A;  1OGG A;  3ALF A;  4C02 B;  1JVW A;  2QF8 A;  4FN2 A;  3JYJ A;  4WKH A;  3UQA A;  4JFI A;  1EIB A;  3RME A;  2WLZ A;  2F23 A;  2IUZ A;  4HBE A;  5BXJ A;  1N1A A;  3CGM A;  1JCH B;  4HAR A;  1EDQ A;  4LAV A;  2RQS A;  2PPP A;  3ART A;  2PV1 A;  2ZR5 A;  4DRN A;  5DF0 A;  3ARP A;  2LPV A;  4NSB A;  3JXV A;  1YAT A;  2PPN A;  5JH8 A;  1HJW A;  3O5R A;  4DWS C;  2ZR6 A;  1QPF A;  2YBT A;  3CHC A;  3ARZ A;  4ODM A;  1W1P A;  1HKM A;  1NMV A;  2JZV A;  1FJD A;  4J4N A;  1HJX A;  1NWR A;  5DO2 A;  1WB0 A;  1HXV A;  1PBK A;  4Q7N A;  1F8A B;  4WJX A;  5DIT A;  4DRQ A;  4MPK A;  4W9Q A;  2F4E A;  1JNT A;  2O92 A;  4ODQ A;  5HW6 A;  1ROU A;  3WQW A;  3O5J A;  5HW7 A;  2ZQS A;  4TNS A;  3UQI A;  5GPG A;  3B7X A;  3IHZ A;  4Z2J A;  2DT1 A;  3KAH A;  4Z2H A;  4MSP A;  3AQU A;  4WK9 A;  2ESC A;  1X6L A;  1NSG A;  1FKF A;  3WKZ A;  4MTV A;  3O5G A;  1P5Q A;  2O9O A;  3KAD A;  1T11 A;  3RGC A;  4QIB A;  3GU0 A;  5HUA A;  4DIP A;  4LAW A;  3B9A A;  4NZC A;  4ZPW R;  1ZCN A;  1D7H A;  3KAI A;  1FKS A;  2K8I A;  3TC5 A;  1IX5 A;  1K9T A;  4P8V A;  4W9O A;  2ZQT A;  1ZBV A;  2WM0 A;  4MNL A;  3O5P A;  3UQB A;  4DRO A;  1E6Z A;  3AS3 A;  4XAK A;  1LG1 A;  1D2K A;  3RM9 A;  3MDY B;  4W9P A;  1NWU A;  1LL4 A;  1HKI A;  3IK8 A;  1W9U A;  4TW6 A;  1W9V A;  1BKF A;  4MNJ A;  3JYM A;  1JND A;  4DRM A;  3ARY A;  1ZK6 A;  4MNM A;  1FAP A;  4R0X A;  1FKL A;  3PR9 A;  2IF4 A;  1RD6 A;  4W5U A;  3WH0 A;  1KFW A;  3NRK A;  1F40 A;  3UI4 A;  2VN1 A;  2AWG A;  3KZ7 A;  4JFM A;  4URI A;  2UZ5 A;  2DT2 A;  4P8U A;  1KT1 A;  1LL6 A;  3KAF A;  2PI6 A;  2XP6 A;  2ETN A;  2KE0 A;  1W1Y A;  2LJ4 A;  4L3N A;  4IQ2 A;  3FY1 A;  2DPE A;  2RSE A;  3UI5 A;  1VF8 A;  4TYO A;  4O2T A;  1E6P A;  4UDM A;  2MPH A;  3ARW A;  4ODR A;  4U84 A;  1EYM A;  1XRV A;  4KR0 B;  4KQZ A;  1NWT A;  1E6N A;  1E44 A;  2DG4 A;  5GQB A;  1JNS A;  3PRB A;  4Z2L A;  3BXW A;  4DZ3 A;  3O5F A;  4WIW A;  4QT3 A;  3CZ8 A;  1NMW A;  3NI6 A;  3G6M A; 
#chains in the Genus database with same CATH homology
 4WKA A;  2G41 A;  2MF9 A;  4MAV A;  1H0G A;  2MLZ A;  2KFW A;  5HWC A;  2B31 A;  4DWS A;  4ODK A;  4TX0 A;  4FAP A;  3CHF A;  2PV3 A;  3ARR A;  3FXY A;  1H0I A;  2ITK A;  4MGV A;  3O5L A;  3WD1 A;  4DRP A;  1X6N A;  2XP8 A;  1HJV A;  2XP3 A;  1ITX A;  2F2D A;  1OWQ A;  4NNR A;  2OLH A;  1QPL A;  2FKE A;  1J4H A;  1O6I A;  1QZ2 A;  2XP4 A;  3O5O A;  1BL4 A;  2XP7 A;  3G6L A;  3O5D A;  1A7X A;  1ZL1 A;  2M1I A;  3I6C A;  2D9F A;  1EQ3 A;  4R5E A;  1YW5 A;  1HKK A;  2WK2 A;  1Q6U A;  4DRI A;  2A3C A;  1FKB A;  4LAY A;  1J6Y A;  3ARS A;  4U86 A;  4Z2I A;  2KI3 A;  1LG2 A;  3OA5 A;  1UR9 A;  1ZB5 A;  3UI6 A;  2OFN A;  5I98 A;  1UR8 A;  4Q22 A;  1ZBW A;  1Y0O A;  3AS0 A;  4IT6 A;  1NH6 A;  1M5Y A;  4ODO A;  4S3J A;  4IPX A;  3WL1 A;  2DSZ A;  1ZBC A;  1SR0 A;  2KO7 A;  1LL7 A;  4Z2K A;  2XPA A;  2G8Z A;  3O5I A;  1XHG A;  3WIJ A;  1FKK A;  3KAB A;  1EHN A;  4P8X A;  3WD2 A;  3RM4 A;  4S3K A;  1TFV A;  3ARU A;  3KAG A;  3UF8 A;  3B9E A;  2MLX A;  1C9H A;  2DT3 A;  1FKT A;  1J4I A;  2MLY A;  2Y78 A;  1D7I A;  1NWS A;  1ZBK A;  2AOS A;  3B8S A;  3VAW A;  1B6C A;  3B9D A;  2DT0 A;  3IKD A;  1HKJ A;  4QZV B;  4DRJ A;  3CHD A;  3ARO A;  3QOK A;  4ZPV R;  1E15 A;  3O5E A;  4HBO A;  4ODL A;  1U79 A;  5HTG A;  2PBC A;  1L1P A;  1WNO A;  3W4R A;  1D7J A;  3GPK A;  4JFJ A;  4DRH A;  5HT1 A;  5HWB A;  3WL0 A;  5HW8 A;  1GOI A;  5DEZ A;  5GPR A;  2DSU A;  4MNK A;  3KAC A;  1SYT A;  4WKF A;  1Q6I A;  2FAP A;  3AS2 A;  2XPB A;  1J4R A;  1FFR A;  3WD0 A;  1OGB A;  5HBF A;  2A3E A;  4ITZ A;  3FAP A;  1FD9 A;  1GPF A;  4AY1 A;  3ARV A;  2DG3 A;  4JYS A;  1FKR A;  2PPO A;  4DWS B;  2DSW A;  4ODP A;  4DH0 A;  4JFK A;  3O5Q A;  4L72 B;  3O5M A;  4ODN A;  4N19 A;  1PIN A;  1CTN A;  4Z2G A;  3CGN A;  3WQV A;  2WLY A;  4JFL A;  1JNE A;  4U85 A;  1E6R A;  1KT0 A;  2LKN A;  2YBU A;  3O5K A;  1ZU8 A;  2DSV A;  1FFQ A;  1Q6H A;  4DZ2 A;  3ALG A;  3ARX A;  1FKJ A;  3RM8 A;  4J4O A;  3TDB A;  3AS1 A;  4IQC A;  2M2A A;  4GIV A;  1FKH A;  3CH9 A;  1TCO C;  3RFW A;  2MNT A;  5J6E A;  2ZQU A;  1FKI A;  2L2S A;  2ZQV A;  2Q5A A;  4LAX A;  3ODK A;  3H9R B;  3ARQ A;  4P8W A;  1GUV A;  1LQ0 A;  1Q1C A;  2F21 A;  4DRK A;  4IT4 A;  1FKD A;  3OOB A;  4ZPT R;  5D75 A;  3KCE A;  5DIV A;  4ML4 A;  4ZS6 A;  2LGO A;  2XP9 A;  5HKG A;  1W9P A;  4LGX A;  2FDM A;  4DWS D;  4TW8 A;  3CHE A;  5DIU A;  2VCD A;  3EY6 A;  3NTP A;  1FKG A;  4PTM A;  4DT4 A;  4G2P A;  2XP5 A;  1W1V A;  2RUD A;  1ROT A;  2RUR A;  1D6O A;  1WAW A;  2KGJ A;  3TCZ A;  2PV2 A;  2A3B A;  4QT2 A;  3PA7 A;  4G50 A;  2KR7 A;  1R9H A;  3WD3 A;  2N87 A;  1E9L A;  4BF8 A;  1LJY A;  1W26 A;  3IKG A;  3LUO A;  4TW7 A;  5B8I C;  2RUC A;  3WD4 A;  3PRA A;  2RUQ A;  2M08 A;  2A3A A;  2ZR4 A;  2DG9 A;  3PRD A;  1W1T A;  4GGQ A;  1OGG A;  3ALF A;  4C02 B;  1JVW A;  2QF8 A;  4FN2 A;  3JYJ A;  4WKH A;  3UQA A;  4JFI A;  1EIB A;  3RME A;  2WLZ A;  2IUZ A;  4HBE A;  5BXJ A;  1N1A A;  3CGM A;  4HAR A;  1EDQ A;  4LAV A;  2RQS A;  2PPP A;  3ART A;  2PV1 A;  2ZR5 A;  4DRN A;  5DF0 A;  3ARP A;  2LPV A;  4NSB A;  3JXV A;  1YAT A;  2PPN A;  5JH8 A;  1HJW A;  3O5R A;  4DWS C;  2ZR6 A;  1QPF A;  2YBT A;  3CHC A;  3ARZ A;  4ODM A;  1W1P A;  1HKM A;  1NMV A;  2JZV A;  1FJD A;  4J4N A;  1HJX A;  1NWR A;  5DO2 A;  1WB0 A;  1HXV A;  1PBK A;  4Q7N A;  1F8A B;  4WJX A;  5DIT A;  4DRQ A;  4MPK A;  4W9Q A;  2F4E A;  1JNT A;  2O92 A;  4ODQ A;  5HW6 A;  1ROU A;  3WQW A;  3O5J A;  5HW7 A;  2ZQS A;  4TNS A;  3UQI A;  5GPG A;  3B7X A;  3IHZ A;  4Z2J A;  2DT1 A;  3KAH A;  4Z2H A;  4MSP A;  3AQU A;  4WK9 A;  2ESC A;  1X6L A;  1NSG A;  1FKF A;  3WKZ A;  4MTV A;  3O5G A;  1P5Q A;  2O9O A;  3KAD A;  1T11 A;  3RGC A;  4QIB A;  5HUA A;  4DIP A;  4LAW A;  3B9A A;  4NZC A;  4ZPW R;  1ZCN A;  1D7H A;  3KAI A;  1FKS A;  2K8I A;  3TC5 A;  1IX5 A;  1K9T A;  4P8V A;  4W9O A;  2ZQT A;  1ZBV A;  2WM0 A;  4MNL A;  3O5P A;  3UQB A;  4DRO A;  1E6Z A;  3AS3 A;  4XAK A;  1LG1 A;  1D2K A;  3RM9 A;  3MDY B;  4W9P A;  1NWU A;  1LL4 A;  1HKI A;  3IK8 A;  1W9U A;  4TW6 A;  1W9V A;  1BKF A;  4MNJ A;  3JYM A;  1JND A;  4DRM A;  3ARY A;  1ZK6 A;  4MNM A;  1FAP A;  4R0X A;  1FKL A;  3PR9 A;  2IF4 A;  1RD6 A;  4W5U A;  3WH0 A;  1KFW A;  3NRK A;  1F40 A;  3UI4 A;  2VN1 A;  2AWG A;  3KZ7 A;  4JFM A;  4URI A;  2UZ5 A;  2DT2 A;  4P8U A;  1KT1 A;  1LL6 A;  3KAF A;  2PI6 A;  2XP6 A;  2KE0 A;  1W1Y A;  2LJ4 A;  4L3N A;  4IQ2 A;  3FY1 A;  2DPE A;  2RSE A;  3UI5 A;  1VF8 A;  4TYO A;  4O2T A;  1E6P A;  2MPH A;  3ARW A;  4ODR A;  4U84 A;  1EYM A;  1XRV A;  4KR0 B;  4KQZ A;  1NWT A;  1E6N A;  2DG4 A;  5GQB A;  1JNS A;  3PRB A;  4Z2L A;  3BXW A;  4DZ3 A;  3O5F A;  4WIW A;  4QT3 A;  3CZ8 A;  1NMW A;  3NI6 A;  3G6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...