2D9FA

Solution structure of ruh-047, an fkbp domain from human cdna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
135
structure length
135
Chain Sequence
GSSGSSGEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDRPDLEMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 8 variant
publication title Solution structure of RUH-047, an FKBP domain from human cDNA
rcsb
source organism Homo sapiens
total genus 14
structure length 135
sequence length 135
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2d9fA01
1Q1CA 1BKFA 5HWBA 3JYJA 1N1AA 3O5EA 2FKEA 3CGMA 4ITZA 2MPHA 4ODQA 3LUOA 4ODMA 5HW7A 1FKBA 5BXJA 1JNSA 4MSPA 4ODOA 3KADA 2F21A 3O5FA 2M1IA 4U85A 4DRMA 4DRPA 2PV3A 1FKFA 2PV2A 1EQ3A 4QT2A 3ODKA 4DRQA 3MDYB 3WH0A 4DRJA 2Y78A 2FAPA 2Q5AA 2ZQUA 4FAPA 1YW5A 2XP9A 4GGQA 1M5YA 2N87A 1QPFA 3O5DA 3VAWA 3TDBA 2LGOA 2KO7A 4JYSA 3O5MA 2PPNA 3O5IA 2KR7A 5DITA 3I6CA 3NI6A 4ODLA 1D7HA 2JZVA 2ZR4A 5HT1A 2MLXA 1JVWA 3RGCA 2ZQTA 2OFNA 4DRKA 4J4NA 1NMWA 3CGNA 2PV1A 1KT1A 2IF4A 3GPKA 4LAVA 4U86A 4W9OA 2F4EA 3OOBA 4DH0A 3TCZA 4GIVA 1Q6UA 2DG4A 2F2DA 3KAIA 5DIVA 1FKGA 1ZK6A 3UF8A 3UI5A 2ZQVA 1Q6HA 3KAHA 2PPPA 1FKKA 5HTGA 1D7JA 2RUCA 3KCEA 1L1PA 1PINA 1J6YA 2XP7A 3UI4A 1TCOC 2MNTA 4LAYA 4ODRA 5GPGA 2MF9A 3RFWA 2M08A 3PA7A 4FN2A 1Y0OA 2MLYA 2RUQA 1F40A 1FKIA 2RSEA 2VN1A 2LKNA 3KABA 3PRBA 4DZ3A 1ROUA 2KFWA 4U84A 4MGVA 4IPXA 1FD9A 2K8IA 2LPVA 1JNTA 2DG3A 2RURA 1J4IA 3PRDA 1T11A 2L2SA 5HW6A 1KT0A 4DRHA 3IKGA 3IKDA 2XP4A 3B7XA 4DIPA 3UQBA 2D9FA 4TYOA 3TC5A 2DG9A 3IK8A 1U79A 2RQSA 3NRKA 4ODKA 4BF8A 2MLZA 4O2TA 1EYMA 4IQ2A 3O5LA 5I98A 2XP3A 3KZ7A 4TW7A 1P5QA 2XP6A 2ZR5A 1FKTA 1NSGA 1FKJA 4N19A 3JYMA 3KAGA 5HW8A 1D7IA 2KE0A 2PBCA 5DIUA 2KGJA 1W26A 4G50A 4ODPA 2ZR6A 1Q6IA 3O5RA 3NTPA 2ZQSA 4DT4A 4TNSA 3KAFA 3FAPA 2LJ4A 1PBKA 3O5OA 3UI6A 4QIBA 3H9RB 1FKLA 3IHZA 4JFMA 1J4HA 2RUDA 4R0XA 3O5QA 1B6CA 4TW8A 1J4RA 1FKHA 1ROTA 5D75A 4TW6A 1ZCNA 3O5JA 4J4OA 1QZ2A 2AWGA 4LAWA 1YATA 1FJDA 2M2AA 3O5GA 2XPBA 4W9QA 4DROA 3EY6A 1QPLA 2VCDA 4QT3A 1R9HA 1FAPA 4DZ2A 5HKGA 4JFKA 1FKSA 1C9HA 5HWCA 3JXVA 2ITKA 1A7XA 3O5KA 4JFJA 1HXVA 2UZ5A 2XP5A 5HUAA 2PPOA 4G2PA 1FKRA 4NNRA 1NMVA 4C02B 3KACA 4DRNA 5B8IC 4TX0A 5J6EA 1BL4A 4W9PA 3UQAA 4JFIA 3O5PA 2XP8A 2KI3A 4IQCA 4DRIA 1FKDA 1F8AB 4ODNA 3UQIA 4JFLA 4LAXA 2XPAA 1D6OA
chains in the Genus database with same CATH superfamily
1O6IA 4PTMA 4WKAA 4WJXA 4Z2KA 2MPHA 5HW7A 1NWUA 5BXJA 2AOSA 4R5EA 3KADA 2WK2A 4DRMA 4XAKA 4S3JA 2PV2A 1EQ3A 1WAWA 2FAPA 3PRAA 4MPKA 1QPFA 2QF8A 4JYSA 2PPNA 2KR7A 3I6CA 4ODLA 2MLXA 3ARWA 2A3EA 4DRKA 2PV1A 4W9OA 3ARUA 1W9UA 1HJVA 4KR0B 3UI5A 3KAIA 1ZK6A 2A3BA 1E9LA 2PPPA 1X6LA 2IUZA 5HTGA 2RUCA 1PINA 4ZPWR 3RM4A 1ZBCA 3UI4A 1TCOC 2B5UB 4LAYA 4FN2A 2A3AA 1KFWA 2O92A 2KFWA 4L72B 2RURA 1J4IA 5HW6A 1HJXA 1KT0A 4DRHA 3IKGA 4S3KA 2RQSA 4ODKA 1NWSA 4BF8A 3CZ8A 4O2TA 5I98A 1GPFA 4MNKA 1OGGA 2ESCA 2O9OA 1P5QA 2KE0A 1W1PA 3H9RB 1OGBA 3W4RA 2RUDA 1GUVA 3ARXA 2FDMA 4ZPTR 1YATA 2XPBA 3B9AA 3EY6A 4QT3A 1FAPA 1C9HA 3WQWA 2DT3A 4G2PA 2OLHA 4NNRA 2A3CA 4MNMA 3ARRA 4DRNA 1BL4A 4NZCA 2F23A 3UQAA 1TFVA 2DSUA 3WKZA 1F8AB 3UQIA 2XPAA 1Q1CA 1VF8A 3JYJA 1N1AA 2FKEA 3CGMA 3FY1A 3B8SA 2YBTA 1JNSA 2P4VA 2B31A 4LGXA 3O5FA 5GQBA 4DRQA 4DRJA 2Q5AA 4FAPA 4GGQA 2G8ZA 3AROA 3VAWA 2LGOA 3B9DA 2WLZA 3NI6A 1D7HA 2JZVA 5HT1A 4ZS6A 2DSWA 4J4NA 2PN0A 1KT1A 5HBFA 2PI6A 4ZPVR 2F4EA 4Q7NA 3AS3A 4DH0A 3TCZA 5DIVA 2DG4A 1FKGA 2ZQVA 1JCHB 1ZU8A 4Q22A 1WB0A 4DWSA 1E44A 2XP7A 2MF9A 2RUQA 1FKIA 2VN1A 2LKNA 3EIPA 3RM9A 4DZ3A 1ROUA 4DWSD 4MGVA 4IPXA 2LPVA 1GRJA 3PRDA 3ARQA 2XP4A 3B9EA 4DIPA 2DG9A 1H0IA 1ZBWA 4ML4A 2WM0A 3O5LA 1ZL1A 3ARYA 1LG1A 2EULA 1NSGA 3ALFA 1D7IA 1W26A 1LQ0A 4DT4A 5GPRA 4DWSB 3GU0A 2LJ4A 3O5OA 1W9PA 4WIWA 3G6MA 1HKKA 4WK9A 1UR9A 1OWQA 3O5QA 4TW8A 4UDMA 3GTYX 4HARA 1ZCNA 3CHFA 3WD1A 4AY1A 1FJDA 1D2KA 1W9VA 1QPLA 4DZ2A 4P8XA 1HXVA 4JFJA 3BMBA 2XP5A 5HUAA 2PPOA 1NMVA 4C02B 1ITXA 1E6NA 4TX0A 4W9PA 4JFIA 3O5PA 4IQCA 4DRIA 1LJYA 1RD6A 1D6OA 4LAXA 5HWBA 1BKFA 3LUOA 1NWRA 1FKBA 1SYTA 4Z2HA 4ODOA 4DRPA 2F21A 4MNLA 1XHGA 1H0GA 2PV3A 3RMEA 1X6NA 1LL6A 3MDYB 3WH0A 2Y78A 4P8WA 1YW5A 1UR8A 5DO2A 3O5DA 2KO7A 3O5MA 3O5IA 4MNJA 1CTNA 1JVWA 4LAVA 3OOBA 1Q6UA 2F2DA 4Z2GA 1LG2A 3UF8A 4MTVA 1Q6HA 4URIA 1FKKA 1D7JA 2DT1A 3AS1A 1LL4A 1J6YA 4ODRA 5GPGA 3RFWA 2M08A 1W1VA 3PA7A 1Y0OA 3ALGA 2MLYA 2G41A 3QOKA 2RSEA 3KABA 1EIBA 1FD9A 1JNTA 5JH8A 4WKFA 4MAVA 1T11A 2L2SA 4P8VA 3FXYA 3CHDA 3IKDA 3WL0A 2DT0A 3WL1A 3UQBA 4TYOA 1E6RA 3AS2A 3TC5A 4IT4A 3NRKA 3RM8A 1EYMA 4IQ2A 2XP3A 3KZ7A 1ZBKA 2ZR5A 3JYMA 2PBCA 2KGJA 4P8UA 3O5RA 1Q6IA 4TNSA 1PBKA 3UI6A 1FKLA 3IHZA 4JFMA 3CHCA 4R0XA 1B6CA 4L3NA 1K9TA 3OA5A 1J4RA 1FKHA 1ZBVA 4TW6A 3O5JA 4IT6A 4J4OA 1QZ2A 2AWGA 3O5GA 4DROA 4JFKA 1FKSA 5HWCA 3JXVA 2ITKA 1A7XA 2DSVA 1FKRA 3KACA 5B8IC 4KQZA 5J6EA 4Z2IA 2KI3A 4ODNA 3ARTA 1E15A 4JFLA 4HBEA 2WLYA 1NWTA 4ITZA 3O5EA 1HKMA 3G6LA 1LL7A 4ODQA 4ODMA 3WD0A 1W1TA 4MSPA 2M1IA 4U85A 4NSBA 1FKFA 4QT2A 3ODKA 1EDQA 2ZQUA 2XP9A 1M5YA 2N87A 1HJWA 2DPEA 4Z2JA 1ZB5A 3TDBA 5DITA 2ZR4A 3RGCA 1HKIA 4W5UA 2ZQTA 2OFNA 3ARVA 3CHEA 4U86A 1NMWA 3CGNA 1JNEA 2IF4A 3GPKA 1HKJA 1XRVA 4GIVA 1FFRA 1WNOA 3KAHA 4DWSC 3WD4A 1E6ZA 3KCEA 1L1PA 2MNTA 1NH6A 1F40A 3PRBA 1SR0A 4U84A 5DF0A 2K8IA 2DG3A 2YBUA 4HBOA 5DEZA 2DSZA 3B7XA 2D9FA 1JNDA 3AS0A 3IK8A 1U79A 2MLZA 4TW7A 2XP6A 3ARPA 1FKTA 4N19A 1FKJA 1W1YA 5HW8A 3KAGA 5DIUA 4ODPA 4G50A 2ZR6A 3NTPA 2ZQSA 1EHNA 3KAFA 3FAPA 4QIBA 3AQUA 1J4HA 1ROTA 5D75A 3BXWA 4LAWA 2M2AA 4W9QA 1GOIA 2VCDA 3ARSA 1R9HA 5HKGA 3WD3A 1IX5A 4QZVB 3O5KA 3WD2A 1FFQA 2UZ5A 3CH9A 3WIJA 2ETNA 1E6PA 3WQVA 4WKHA 2XP8A 2DT2A 3PR9A 4Z2LA 1FKDA 3ARZA
chains in the Genus database with same CATH topology
1O6IA 4PTMA 4WKAA 4WJXA 4Z2KA 2MPHA 5HW7A 1NWUA 5BXJA 2AOSA 4R5EA 3KADA 2WK2A 4DRMA 4XAKA 4S3JA 2PV2A 1EQ3A 1WAWA 2FAPA 3PRAA 4MPKA 1QPFA 2QF8A 4JYSA 2PPNA 2KR7A 3I6CA 4ODLA 2MLXA 3ARWA 2A3EA 4DRKA 2PV1A 4W9OA 3ARUA 1W9UA 1HJVA 4KR0B 3UI5A 3KAIA 1ZK6A 2A3BA 1E9LA 2PPPA 1X6LA 2IUZA 5HTGA 2RUCA 1PINA 4ZPWR 3RM4A 1ZBCA 3UI4A 1TCOC 4LAYA 4FN2A 2A3AA 1KFWA 2O92A 2KFWA 4L72B 2RURA 1J4IA 5HW6A 1HJXA 1KT0A 4DRHA 3IKGA 4S3KA 2RQSA 4ODKA 1NWSA 4BF8A 3CZ8A 4O2TA 5I98A 1GPFA 4MNKA 1OGGA 2ESCA 2O9OA 1P5QA 2KE0A 1W1PA 3H9RB 1OGBA 3W4RA 2RUDA 1GUVA 3ARXA 2FDMA 4ZPTR 1YATA 2XPBA 3B9AA 3EY6A 4QT3A 1FAPA 1C9HA 3WQWA 2DT3A 4G2PA 2OLHA 4NNRA 2A3CA 4MNMA 3ARRA 4DRNA 1BL4A 4NZCA 3UQAA 1TFVA 2DSUA 3WKZA 1F8AB 3UQIA 2XPAA 1Q1CA 1VF8A 3JYJA 1N1AA 2FKEA 3CGMA 3FY1A 3B8SA 2YBTA 1JNSA 2B31A 4LGXA 3O5FA 5GQBA 4DRQA 4DRJA 2Q5AA 4FAPA 4GGQA 2G8ZA 3AROA 3VAWA 2LGOA 3B9DA 2WLZA 3NI6A 1D7HA 2JZVA 5HT1A 4ZS6A 2DSWA 4J4NA 1KT1A 5HBFA 2PI6A 4ZPVR 2F4EA 4Q7NA 3AS3A 4DH0A 3TCZA 5DIVA 2DG4A 1FKGA 2ZQVA 1ZU8A 4Q22A 1WB0A 4DWSA 2XP7A 2MF9A 2RUQA 1FKIA 2VN1A 2LKNA 3RM9A 4DZ3A 1ROUA 4DWSD 4MGVA 4IPXA 2LPVA 3PRDA 3ARQA 2XP4A 3B9EA 4DIPA 2DG9A 1H0IA 1ZBWA 4ML4A 2WM0A 3O5LA 1ZL1A 3ARYA 1LG1A 1NSGA 3ALFA 1D7IA 1W26A 1LQ0A 4DT4A 5GPRA 4DWSB 2LJ4A 3O5OA 1W9PA 4WIWA 3G6MA 1HKKA 4WK9A 1UR9A 1OWQA 3O5QA 4TW8A 4HARA 1ZCNA 3CHFA 3WD1A 4AY1A 1FJDA 1D2KA 1W9VA 1QPLA 4DZ2A 4P8XA 1HXVA 4JFJA 2XP5A 5HUAA 2PPOA 1NMVA 4C02B 1ITXA 1E6NA 4TX0A 4W9PA 4JFIA 3O5PA 4IQCA 4DRIA 1LJYA 1RD6A 1D6OA 4LAXA 5HWBA 1BKFA 3LUOA 1NWRA 1FKBA 1SYTA 4Z2HA 4ODOA 4DRPA 2F21A 4MNLA 1XHGA 1H0GA 2PV3A 3RMEA 1X6NA 1LL6A 3MDYB 3WH0A 2Y78A 4P8WA 1YW5A 1UR8A 5DO2A 3O5DA 2KO7A 3O5MA 3O5IA 4MNJA 1CTNA 1JVWA 4LAVA 3OOBA 1Q6UA 2F2DA 4Z2GA 1LG2A 3UF8A 4MTVA 1Q6HA 4URIA 1FKKA 1D7JA 2DT1A 3AS1A 1LL4A 1J6YA 4ODRA 5GPGA 3RFWA 2M08A 1W1VA 3PA7A 1Y0OA 3ALGA 2MLYA 2G41A 3QOKA 2RSEA 3KABA 1EIBA 1FD9A 1JNTA 5JH8A 4WKFA 4MAVA 1T11A 2L2SA 4P8VA 3FXYA 3CHDA 3IKDA 3WL0A 2DT0A 3WL1A 3UQBA 4TYOA 1E6RA 3AS2A 3TC5A 4IT4A 3NRKA 3RM8A 1EYMA 4IQ2A 2XP3A 3KZ7A 1ZBKA 2ZR5A 3JYMA 2PBCA 2KGJA 4P8UA 3O5RA 1Q6IA 4TNSA 1PBKA 3UI6A 1FKLA 3IHZA 4JFMA 3CHCA 4R0XA 1B6CA 4L3NA 1K9TA 3OA5A 1J4RA 1FKHA 1ZBVA 4TW6A 3O5JA 4IT6A 4J4OA 1QZ2A 2AWGA 3O5GA 4DROA 4JFKA 1FKSA 5HWCA 3JXVA 2ITKA 1A7XA 2DSVA 1FKRA 3KACA 5B8IC 4KQZA 5J6EA 4Z2IA 2KI3A 4ODNA 3ARTA 1E15A 4JFLA 4HBEA 2WLYA 1NWTA 4ITZA 3O5EA 1HKMA 3G6LA 1LL7A 4ODQA 4ODMA 3WD0A 1W1TA 4MSPA 2M1IA 4U85A 4NSBA 1FKFA 4QT2A 3ODKA 1EDQA 2ZQUA 2XP9A 1M5YA 2N87A 1HJWA 2DPEA 4Z2JA 1ZB5A 3TDBA 5DITA 2ZR4A 3RGCA 1HKIA 4W5UA 2ZQTA 2OFNA 3ARVA 3CHEA 4U86A 1NMWA 3CGNA 1JNEA 2IF4A 3GPKA 1HKJA 1XRVA 4GIVA 1FFRA 1WNOA 3KAHA 4DWSC 3WD4A 1E6ZA 3KCEA 1L1PA 2MNTA 1NH6A 1F40A 3PRBA 1SR0A 4U84A 5DF0A 2K8IA 2DG3A 2YBUA 4HBOA 5DEZA 2DSZA 3B7XA 2D9FA 1JNDA 3AS0A 3IK8A 1U79A 2MLZA 4TW7A 2XP6A 3ARPA 1FKTA 4N19A 1FKJA 1W1YA 5HW8A 3KAGA 5DIUA 4ODPA 4G50A 2ZR6A 3NTPA 2ZQSA 1EHNA 3KAFA 3FAPA 4QIBA 3AQUA 1J4HA 1ROTA 5D75A 3BXWA 4LAWA 2M2AA 4W9QA 1GOIA 2VCDA 3ARSA 1R9HA 5HKGA 3WD3A 1IX5A 4QZVB 3O5KA 3WD2A 1FFQA 2UZ5A 3CH9A 3WIJA 1E6PA 3WQVA 4WKHA 2XP8A 2DT2A 3PR9A 4Z2LA 1FKDA 3ARZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q1C A;  1BKF A;  5HWB A;  3JYJ A;  1N1A A;  3O5E A;  2FKE A;  3CGM A;  4ITZ A;  2MPH A;  4ODQ A;  3LUO A;  4ODM A;  5HW7 A;  1FKB A;  5BXJ A;  1JNS A;  4MSP A;  4ODO A;  3KAD A;  2F21 A;  3O5F A;  2M1I A;  4U85 A;  4DRM A;  4DRP A;  2PV3 A;  1FKF A;  2PV2 A;  1EQ3 A;  4QT2 A;  3ODK A;  4DRQ A;  3MDY B;  3WH0 A;  4DRJ A;  2Y78 A;  2FAP A;  2Q5A A;  2ZQU A;  4FAP A;  1YW5 A;  2XP9 A;  4GGQ A;  1M5Y A;  2N87 A;  1QPF A;  3O5D A;  3VAW A;  3TDB A;  2LGO A;  2KO7 A;  4JYS A;  3O5M A;  2PPN A;  3O5I A;  2KR7 A;  5DIT A;  3I6C A;  3NI6 A;  4ODL A;  1D7H A;  2JZV A;  2ZR4 A;  5HT1 A;  2MLX A;  1JVW A;  3RGC A;  2ZQT A;  2OFN A;  4DRK A;  4J4N A;  1NMW A;  3CGN A;  2PV1 A;  1KT1 A;  2IF4 A;  3GPK A;  4LAV A;  4U86 A;  4W9O A;  2F4E A;  3OOB A;  4DH0 A;  3TCZ A;  4GIV A;  1Q6U A;  2DG4 A;  2F2D A;  3KAI A;  5DIV A;  1FKG A;  1ZK6 A;  3UF8 A;  3UI5 A;  2ZQV A;  1Q6H A;  3KAH A;  2PPP A;  1FKK A;  5HTG A;  1D7J A;  2RUC A;  3KCE A;  1L1P A;  1PIN A;  1J6Y A;  2XP7 A;  3UI4 A;  1TCO C;  2MNT A;  4LAY A;  4ODR A;  5GPG A;  2MF9 A;  3RFW A;  2M08 A;  3PA7 A;  4FN2 A;  1Y0O A;  2MLY A;  2RUQ A;  1F40 A;  1FKI A;  2RSE A;  2VN1 A;  2LKN A;  3KAB A;  3PRB A;  4DZ3 A;  1ROU A;  2KFW A;  4U84 A;  4MGV A;  4IPX A;  1FD9 A;  2K8I A;  2LPV A;  1JNT A;  2DG3 A;  2RUR A;  1J4I A;  3PRD A;  1T11 A;  2L2S A;  5HW6 A;  1KT0 A;  4DRH A;  3IKG A;  3IKD A;  2XP4 A;  3B7X A;  4DIP A;  3UQB A;  2D9F A;  4TYO A;  3TC5 A;  2DG9 A;  3IK8 A;  1U79 A;  2RQS A;  3NRK A;  4ODK A;  4BF8 A;  2MLZ A;  4O2T A;  1EYM A;  4IQ2 A;  3O5L A;  5I98 A;  2XP3 A;  3KZ7 A;  4TW7 A;  1P5Q A;  2XP6 A;  2ZR5 A;  1FKT A;  1NSG A;  1FKJ A;  4N19 A;  3JYM A;  3KAG A;  5HW8 A;  1D7I A;  2KE0 A;  2PBC A;  5DIU A;  2KGJ A;  1W26 A;  4G50 A;  4ODP A;  2ZR6 A;  1Q6I A;  3O5R A;  3NTP A;  2ZQS A;  4DT4 A;  4TNS A;  3KAF A;  3FAP A;  2LJ4 A;  1PBK A;  3O5O A;  3UI6 A;  4QIB A;  3H9R B;  1FKL A;  3IHZ A;  4JFM A;  1J4H A;  2RUD A;  4R0X A;  3O5Q A;  1B6C A;  4TW8 A;  1J4R A;  1FKH A;  1ROT A;  5D75 A;  4TW6 A;  1ZCN A;  3O5J A;  4J4O A;  1QZ2 A;  2AWG A;  4LAW A;  1YAT A;  1FJD A;  2M2A A;  3O5G A;  2XPB A;  4W9Q A;  4DRO A;  3EY6 A;  1QPL A;  2VCD A;  4QT3 A;  1R9H A;  1FAP A;  4DZ2 A;  5HKG A;  4JFK A;  1FKS A;  1C9H A;  5HWC A;  3JXV A;  2ITK A;  1A7X A;  3O5K A;  4JFJ A;  1HXV A;  2UZ5 A;  2XP5 A;  5HUA A;  2PPO A;  4G2P A;  1FKR A;  4NNR A;  1NMV A;  4C02 B;  3KAC A;  4DRN A;  5B8I C;  4TX0 A;  5J6E A;  1BL4 A;  4W9P A;  3UQA A;  4JFI A;  3O5P A;  2XP8 A;  2KI3 A;  4IQC A;  4DRI A;  1FKD A;  1F8A B;  4ODN A;  3UQI A;  4JFL A;  4LAX A;  2XPA A;  1D6O A; 
#chains in the Genus database with same CATH topology
 1O6I A;  4PTM A;  4WKA A;  4WJX A;  4Z2K A;  2MPH A;  5HW7 A;  1NWU A;  5BXJ A;  2AOS A;  4R5E A;  3KAD A;  2WK2 A;  4DRM A;  4XAK A;  4S3J A;  2PV2 A;  1EQ3 A;  1WAW A;  2FAP A;  3PRA A;  4MPK A;  1QPF A;  2QF8 A;  4JYS A;  2PPN A;  2KR7 A;  3I6C A;  4ODL A;  2MLX A;  3ARW A;  2A3E A;  4DRK A;  2PV1 A;  4W9O A;  3ARU A;  1W9U A;  1HJV A;  4KR0 B;  3UI5 A;  3KAI A;  1ZK6 A;  2A3B A;  1E9L A;  2PPP A;  1X6L A;  2IUZ A;  5HTG A;  2RUC A;  1PIN A;  4ZPW R;  3RM4 A;  1ZBC A;  3UI4 A;  1TCO C;  2B5U B;  4LAY A;  4FN2 A;  2A3A A;  1KFW A;  2O92 A;  2KFW A;  4L72 B;  2RUR A;  1J4I A;  5HW6 A;  1HJX A;  1KT0 A;  4DRH A;  3IKG A;  4S3K A;  2RQS A;  4ODK A;  1NWS A;  4BF8 A;  3CZ8 A;  4O2T A;  5I98 A;  1GPF A;  4MNK A;  1OGG A;  2ESC A;  2O9O A;  1P5Q A;  2KE0 A;  1W1P A;  3H9R B;  1OGB A;  3W4R A;  2RUD A;  1GUV A;  3ARX A;  2FDM A;  4ZPT R;  1YAT A;  2XPB A;  3B9A A;  3EY6 A;  4QT3 A;  1FAP A;  1C9H A;  3WQW A;  2DT3 A;  4G2P A;  2OLH A;  4NNR A;  2A3C A;  4MNM A;  3ARR A;  4DRN A;  1BL4 A;  4NZC A;  2F23 A;  3UQA A;  1TFV A;  2DSU A;  3WKZ A;  1F8A B;  3UQI A;  2XPA A;  1Q1C A;  1VF8 A;  3JYJ A;  1N1A A;  2FKE A;  3CGM A;  3FY1 A;  3B8S A;  2YBT A;  1JNS A;  2P4V A;  2B31 A;  4LGX A;  3O5F A;  5GQB A;  4DRQ A;  4DRJ A;  2Q5A A;  4FAP A;  4GGQ A;  2G8Z A;  3ARO A;  3VAW A;  2LGO A;  3B9D A;  2WLZ A;  3NI6 A;  1D7H A;  2JZV A;  5HT1 A;  4ZS6 A;  2DSW A;  4J4N A;  2PN0 A;  1KT1 A;  5HBF A;  2PI6 A;  4ZPV R;  2F4E A;  4Q7N A;  3AS3 A;  4DH0 A;  3TCZ A;  5DIV A;  2DG4 A;  1FKG A;  2ZQV A;  1JCH B;  1ZU8 A;  4Q22 A;  1WB0 A;  4DWS A;  1E44 A;  2XP7 A;  2MF9 A;  2RUQ A;  1FKI A;  2VN1 A;  2LKN A;  3EIP A;  3RM9 A;  4DZ3 A;  1ROU A;  4DWS D;  4MGV A;  4IPX A;  2LPV A;  1GRJ A;  3PRD A;  3ARQ A;  2XP4 A;  3B9E A;  4DIP A;  2DG9 A;  1H0I A;  1ZBW A;  4ML4 A;  2WM0 A;  3O5L A;  1ZL1 A;  3ARY A;  1LG1 A;  2EUL A;  1NSG A;  3ALF A;  1D7I A;  1W26 A;  1LQ0 A;  4DT4 A;  5GPR A;  4DWS B;  3GU0 A;  2LJ4 A;  3O5O A;  1W9P A;  4WIW A;  3G6M A;  1HKK A;  4WK9 A;  1UR9 A;  1OWQ A;  3O5Q A;  4TW8 A;  4UDM A;  3GTY X;  4HAR A;  1ZCN A;  3CHF A;  3WD1 A;  4AY1 A;  1FJD A;  1D2K A;  1W9V A;  1QPL A;  4DZ2 A;  4P8X A;  1HXV A;  4JFJ A;  3BMB A;  2XP5 A;  5HUA A;  2PPO A;  1NMV A;  4C02 B;  1ITX A;  1E6N A;  4TX0 A;  4W9P A;  4JFI A;  3O5P A;  4IQC A;  4DRI A;  1LJY A;  1RD6 A;  1D6O A;  4LAX A;  5HWB A;  1BKF A;  3LUO A;  1NWR A;  1FKB A;  1SYT A;  4Z2H A;  4ODO A;  4DRP A;  2F21 A;  4MNL A;  1XHG A;  1H0G A;  2PV3 A;  3RME A;  1X6N A;  1LL6 A;  3MDY B;  3WH0 A;  2Y78 A;  4P8W A;  1YW5 A;  1UR8 A;  5DO2 A;  3O5D A;  2KO7 A;  3O5M A;  3O5I A;  4MNJ A;  1CTN A;  1JVW A;  4LAV A;  3OOB A;  1Q6U A;  2F2D A;  4Z2G A;  1LG2 A;  3UF8 A;  4MTV A;  1Q6H A;  4URI A;  1FKK A;  1D7J A;  2DT1 A;  3AS1 A;  1LL4 A;  1J6Y A;  4ODR A;  5GPG A;  3RFW A;  2M08 A;  1W1V A;  3PA7 A;  1Y0O A;  3ALG A;  2MLY A;  2G41 A;  3QOK A;  2RSE A;  3KAB A;  1EIB A;  1FD9 A;  1JNT A;  5JH8 A;  4WKF A;  4MAV A;  1T11 A;  2L2S A;  4P8V A;  3FXY A;  3CHD A;  3IKD A;  3WL0 A;  2DT0 A;  3WL1 A;  3UQB A;  4TYO A;  1E6R A;  3AS2 A;  3TC5 A;  4IT4 A;  3NRK A;  3RM8 A;  1EYM A;  4IQ2 A;  2XP3 A;  3KZ7 A;  1ZBK A;  2ZR5 A;  3JYM A;  2PBC A;  2KGJ A;  4P8U A;  3O5R A;  1Q6I A;  4TNS A;  1PBK A;  3UI6 A;  1FKL A;  3IHZ A;  4JFM A;  3CHC A;  4R0X A;  1B6C A;  4L3N A;  1K9T A;  3OA5 A;  1J4R A;  1FKH A;  1ZBV A;  4TW6 A;  3O5J A;  4IT6 A;  4J4O A;  1QZ2 A;  2AWG A;  3O5G A;  4DRO A;  4JFK A;  1FKS A;  5HWC A;  3JXV A;  2ITK A;  1A7X A;  2DSV A;  1FKR A;  3KAC A;  5B8I C;  4KQZ A;  5J6E A;  4Z2I A;  2KI3 A;  4ODN A;  3ART A;  1E15 A;  4JFL A;  4HBE A;  2WLY A;  1NWT A;  4ITZ A;  3O5E A;  1HKM A;  3G6L A;  1LL7 A;  4ODQ A;  4ODM A;  3WD0 A;  1W1T A;  4MSP A;  2M1I A;  4U85 A;  4NSB A;  1FKF A;  4QT2 A;  3ODK A;  1EDQ A;  2ZQU A;  2XP9 A;  1M5Y A;  2N87 A;  1HJW A;  2DPE A;  4Z2J A;  1ZB5 A;  3TDB A;  5DIT A;  2ZR4 A;  3RGC A;  1HKI A;  4W5U A;  2ZQT A;  2OFN A;  3ARV A;  3CHE A;  4U86 A;  1NMW A;  3CGN A;  1JNE A;  2IF4 A;  3GPK A;  1HKJ A;  1XRV A;  4GIV A;  1FFR A;  1WNO A;  3KAH A;  4DWS C;  3WD4 A;  1E6Z A;  3KCE A;  1L1P A;  2MNT A;  1NH6 A;  1F40 A;  3PRB A;  1SR0 A;  4U84 A;  5DF0 A;  2K8I A;  2DG3 A;  2YBU A;  4HBO A;  5DEZ A;  2DSZ A;  3B7X A;  2D9F A;  1JND A;  3AS0 A;  3IK8 A;  1U79 A;  2MLZ A;  4TW7 A;  2XP6 A;  3ARP A;  1FKT A;  4N19 A;  1FKJ A;  1W1Y A;  5HW8 A;  3KAG A;  5DIU A;  4ODP A;  4G50 A;  2ZR6 A;  3NTP A;  2ZQS A;  1EHN A;  3KAF A;  3FAP A;  4QIB A;  3AQU A;  1J4H A;  1ROT A;  5D75 A;  3BXW A;  4LAW A;  2M2A A;  4W9Q A;  1GOI A;  2VCD A;  3ARS A;  1R9H A;  5HKG A;  3WD3 A;  1IX5 A;  4QZV B;  3O5K A;  3WD2 A;  1FFQ A;  2UZ5 A;  3CH9 A;  3WIJ A;  2ETN A;  1E6P A;  3WQV A;  4WKH A;  2XP8 A;  2DT2 A;  3PR9 A;  4Z2L A;  1FKD A;  3ARZ A; 
#chains in the Genus database with same CATH homology
 1O6I A;  4PTM A;  4WKA A;  4WJX A;  4Z2K A;  2MPH A;  5HW7 A;  1NWU A;  5BXJ A;  2AOS A;  4R5E A;  3KAD A;  2WK2 A;  4DRM A;  4XAK A;  4S3J A;  2PV2 A;  1EQ3 A;  1WAW A;  2FAP A;  3PRA A;  4MPK A;  1QPF A;  2QF8 A;  4JYS A;  2PPN A;  2KR7 A;  3I6C A;  4ODL A;  2MLX A;  3ARW A;  2A3E A;  4DRK A;  2PV1 A;  4W9O A;  3ARU A;  1W9U A;  1HJV A;  4KR0 B;  3UI5 A;  3KAI A;  1ZK6 A;  2A3B A;  1E9L A;  2PPP A;  1X6L A;  2IUZ A;  5HTG A;  2RUC A;  1PIN A;  4ZPW R;  3RM4 A;  1ZBC A;  3UI4 A;  1TCO C;  4LAY A;  4FN2 A;  2A3A A;  1KFW A;  2O92 A;  2KFW A;  4L72 B;  2RUR A;  1J4I A;  5HW6 A;  1HJX A;  1KT0 A;  4DRH A;  3IKG A;  4S3K A;  2RQS A;  4ODK A;  1NWS A;  4BF8 A;  3CZ8 A;  4O2T A;  5I98 A;  1GPF A;  4MNK A;  1OGG A;  2ESC A;  2O9O A;  1P5Q A;  2KE0 A;  1W1P A;  3H9R B;  1OGB A;  3W4R A;  2RUD A;  1GUV A;  3ARX A;  2FDM A;  4ZPT R;  1YAT A;  2XPB A;  3B9A A;  3EY6 A;  4QT3 A;  1FAP A;  1C9H A;  3WQW A;  2DT3 A;  4G2P A;  2OLH A;  4NNR A;  2A3C A;  4MNM A;  3ARR A;  4DRN A;  1BL4 A;  4NZC A;  3UQA A;  1TFV A;  2DSU A;  3WKZ A;  1F8A B;  3UQI A;  2XPA A;  1Q1C A;  1VF8 A;  3JYJ A;  1N1A A;  2FKE A;  3CGM A;  3FY1 A;  3B8S A;  2YBT A;  1JNS A;  2B31 A;  4LGX A;  3O5F A;  5GQB A;  4DRQ A;  4DRJ A;  2Q5A A;  4FAP A;  4GGQ A;  2G8Z A;  3ARO A;  3VAW A;  2LGO A;  3B9D A;  2WLZ A;  3NI6 A;  1D7H A;  2JZV A;  5HT1 A;  4ZS6 A;  2DSW A;  4J4N A;  1KT1 A;  5HBF A;  2PI6 A;  4ZPV R;  2F4E A;  4Q7N A;  3AS3 A;  4DH0 A;  3TCZ A;  5DIV A;  2DG4 A;  1FKG A;  2ZQV A;  1ZU8 A;  4Q22 A;  1WB0 A;  4DWS A;  2XP7 A;  2MF9 A;  2RUQ A;  1FKI A;  2VN1 A;  2LKN A;  3RM9 A;  4DZ3 A;  1ROU A;  4DWS D;  4MGV A;  4IPX A;  2LPV A;  3PRD A;  3ARQ A;  2XP4 A;  3B9E A;  4DIP A;  2DG9 A;  1H0I A;  1ZBW A;  4ML4 A;  2WM0 A;  3O5L A;  1ZL1 A;  3ARY A;  1LG1 A;  1NSG A;  3ALF A;  1D7I A;  1W26 A;  1LQ0 A;  4DT4 A;  5GPR A;  4DWS B;  2LJ4 A;  3O5O A;  1W9P A;  4WIW A;  3G6M A;  1HKK A;  4WK9 A;  1UR9 A;  1OWQ A;  3O5Q A;  4TW8 A;  4HAR A;  1ZCN A;  3CHF A;  3WD1 A;  4AY1 A;  1FJD A;  1D2K A;  1W9V A;  1QPL A;  4DZ2 A;  4P8X A;  1HXV A;  4JFJ A;  2XP5 A;  5HUA A;  2PPO A;  1NMV A;  4C02 B;  1ITX A;  1E6N A;  4TX0 A;  4W9P A;  4JFI A;  3O5P A;  4IQC A;  4DRI A;  1LJY A;  1RD6 A;  1D6O A;  4LAX A;  5HWB A;  1BKF A;  3LUO A;  1NWR A;  1FKB A;  1SYT A;  4Z2H A;  4ODO A;  4DRP A;  2F21 A;  4MNL A;  1XHG A;  1H0G A;  2PV3 A;  3RME A;  1X6N A;  1LL6 A;  3MDY B;  3WH0 A;  2Y78 A;  4P8W A;  1YW5 A;  1UR8 A;  5DO2 A;  3O5D A;  2KO7 A;  3O5M A;  3O5I A;  4MNJ A;  1CTN A;  1JVW A;  4LAV A;  3OOB A;  1Q6U A;  2F2D A;  4Z2G A;  1LG2 A;  3UF8 A;  4MTV A;  1Q6H A;  4URI A;  1FKK A;  1D7J A;  2DT1 A;  3AS1 A;  1LL4 A;  1J6Y A;  4ODR A;  5GPG A;  3RFW A;  2M08 A;  1W1V A;  3PA7 A;  1Y0O A;  3ALG A;  2MLY A;  2G41 A;  3QOK A;  2RSE A;  3KAB A;  1EIB A;  1FD9 A;  1JNT A;  5JH8 A;  4WKF A;  4MAV A;  1T11 A;  2L2S A;  4P8V A;  3FXY A;  3CHD A;  3IKD A;  3WL0 A;  2DT0 A;  3WL1 A;  3UQB A;  4TYO A;  1E6R A;  3AS2 A;  3TC5 A;  4IT4 A;  3NRK A;  3RM8 A;  1EYM A;  4IQ2 A;  2XP3 A;  3KZ7 A;  1ZBK A;  2ZR5 A;  3JYM A;  2PBC A;  2KGJ A;  4P8U A;  3O5R A;  1Q6I A;  4TNS A;  1PBK A;  3UI6 A;  1FKL A;  3IHZ A;  4JFM A;  3CHC A;  4R0X A;  1B6C A;  4L3N A;  1K9T A;  3OA5 A;  1J4R A;  1FKH A;  1ZBV A;  4TW6 A;  3O5J A;  4IT6 A;  4J4O A;  1QZ2 A;  2AWG A;  3O5G A;  4DRO A;  4JFK A;  1FKS A;  5HWC A;  3JXV A;  2ITK A;  1A7X A;  2DSV A;  1FKR A;  3KAC A;  5B8I C;  4KQZ A;  5J6E A;  4Z2I A;  2KI3 A;  4ODN A;  3ART A;  1E15 A;  4JFL A;  4HBE A;  2WLY A;  1NWT A;  4ITZ A;  3O5E A;  1HKM A;  3G6L A;  1LL7 A;  4ODQ A;  4ODM A;  3WD0 A;  1W1T A;  4MSP A;  2M1I A;  4U85 A;  4NSB A;  1FKF A;  4QT2 A;  3ODK A;  1EDQ A;  2ZQU A;  2XP9 A;  1M5Y A;  2N87 A;  1HJW A;  2DPE A;  4Z2J A;  1ZB5 A;  3TDB A;  5DIT A;  2ZR4 A;  3RGC A;  1HKI A;  4W5U A;  2ZQT A;  2OFN A;  3ARV A;  3CHE A;  4U86 A;  1NMW A;  3CGN A;  1JNE A;  2IF4 A;  3GPK A;  1HKJ A;  1XRV A;  4GIV A;  1FFR A;  1WNO A;  3KAH A;  4DWS C;  3WD4 A;  1E6Z A;  3KCE A;  1L1P A;  2MNT A;  1NH6 A;  1F40 A;  3PRB A;  1SR0 A;  4U84 A;  5DF0 A;  2K8I A;  2DG3 A;  2YBU A;  4HBO A;  5DEZ A;  2DSZ A;  3B7X A;  2D9F A;  1JND A;  3AS0 A;  3IK8 A;  1U79 A;  2MLZ A;  4TW7 A;  2XP6 A;  3ARP A;  1FKT A;  4N19 A;  1FKJ A;  1W1Y A;  5HW8 A;  3KAG A;  5DIU A;  4ODP A;  4G50 A;  2ZR6 A;  3NTP A;  2ZQS A;  1EHN A;  3KAF A;  3FAP A;  4QIB A;  3AQU A;  1J4H A;  1ROT A;  5D75 A;  3BXW A;  4LAW A;  2M2A A;  4W9Q A;  1GOI A;  2VCD A;  3ARS A;  1R9H A;  5HKG A;  3WD3 A;  1IX5 A;  4QZV B;  3O5K A;  3WD2 A;  1FFQ A;  2UZ5 A;  3CH9 A;  3WIJ A;  1E6P A;  3WQV A;  4WKH A;  2XP8 A;  2DT2 A;  3PR9 A;  4Z2L A;  1FKD A;  3ARZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...