2D9FA

Solution structure of ruh-047, an fkbp domain from human cdna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
135
structure length
135
Chain Sequence
GSSGSSGEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDRPDLEMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RUH-047, an FKBP domain from human cDNA
rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506-binding protein 8 variant
total genus 14
structure length 135
sequence length 135
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2d9fA01
2ZQVA 4C02B 1KT1A 2RSEA 4JFIA 2F21A 3O5MA 2KO7A 4LAXA 3O5PA 3H9RB 4JFKA 1A7XA 1T11A 2PV1A 4DRNA 1R9HA 3OOBA 1FKTA 2L2SA 1HXVA 3B7XA 4FAPA 1F40A 2F4EA 4DROA 1Q6HA 4TX0A 2IF4A 5DIVA 1FD9A 3UI4A 4QIBA 5HW6A 2AWGA 1D7IA 4ODPA 2KI3A 2XP6A 2KR7A 4O2TA 2PPOA 2XP5A 1F8AB 2UZ5A 4ODMA 4W9QA 5HT1A 1KT0A 4DRIA 1ROTA 3PRDA 3IKGA 4TW6A 3ODKA 4U85A 1C9HA 5BXJA 1ZCNA 2XP9A 3O5RA 1ROUA 2PV3A 3KACA 4JFMA 2Q5AA 4DRJA 1FKJA 2MLXA 1FKRA 1EQ3A 1FKDA 1FKIA 1J4IA 2ZR6A 3O5LA 4N19A 3KAFA 4QT3A 3IK8A 1NMVA 2XPAA 4J4OA 2ZR4A 5J6EA 1QPLA 3PRBA 1NSGA 4G2PA 1M5YA 2D9FA 2XPBA 4MSPA 2KE0A 3IKDA 3KAGA 3KZ7A 1QPFA 3KAHA 3JYMA 3O5IA 3UQAA 2FKEA 4NNRA 4ODQA 3TC5A 4BF8A 4DT4A 5HKGA 2M2AA 2Y78A 1QZ2A 3PA7A 2K8IA 2XP8A 2XP4A 3EY6A 4ODRA 4ODOA 3IHZA 4W9OA 3MDYB 4JFLA 2ZQUA 3O5EA 3O5KA 3WH0A 3LUOA 1EYMA 2KFWA 4ODLA 2RURA 4W9PA 2XP3A 1JNTA 3FAPA 4ODNA 2DG9A 4TYOA 5D75A 4TW7A 5HWBA 1PINA 2ZR5A 4JFJA 3UF8A 5DITA 2RQSA 3KCEA 1FKSA 2LKNA 4GIVA 4U84A 2PV2A 1J4HA 2PPNA 4LAYA 1FKHA 4MGVA 2XP7A 1FAPA 1FKFA 3TDBA 3RGCA 3VAWA 2VCDA 4DH0A 2M1IA 4DZ2A 5HTGA 1BKFA 2LJ4A 4DRHA 3O5FA 1FKLA 4DRPA 3NTPA 2PBCA 3O5QA 3RFWA 4DZ3A 4QT2A 1J6YA 4JYSA 1Q6UA 4J4NA 1D7HA 5GPGA 4DIPA 4DRQA 2F2DA 1JVWA 1ZK6A 1FJDA 4IQ2A 2MLZA 4IPXA 2LGOA 3JXVA 3CGNA 3O5GA 2KGJA 3CGMA 3JYJA 3TCZA 1N1AA 2FAPA 3O5DA 2OFNA 1Q1CA 1JNSA 5HUAA 4LAVA 4LAWA 1U79A 2JZVA 3KABA 1PBKA 3UI6A 1NMWA 2DG4A 4TW8A 3GPKA 2MNTA 3KADA 2M08A 3UQBA 2LPVA 2PPPA 2ITKA 3I6CA 2MF9A 3NRKA 1FKKA 1YATA 4IQCA 4U86A 5HW7A 1L1PA 2RUCA 3UI5A 2RUQA 3UQIA 1TCOC 4FN2A 1BL4A 4GGQA 5DIUA 2ZQSA 2RUDA 3O5JA 1D6OA 3KAIA 1FKGA 1J4RA 1YW5A 5HWCA 1Y0OA 5I98A 4TNSA 2N87A 2ZQTA 2MPHA 4G50A 1P5QA 1FKBA 3O5OA 4DRKA 5HW8A 1W26A 2VN1A 4ODKA 2DG3A 4DRMA 3NI6A 4ITZA 5B8IC 2MLYA 1D7JA 1Q6IA 4R0XA 1B6CA
chains in the Genus database with same CATH superfamily
2ZQVA 1RD6A 1GRJA 1T11A 1W9VA 4DRNA 4S3KA 3B8SA 3WD2A 2WK2A 4TX0A 1JCHB 1FD9A 4ODPA 2XP6A 4HBOA 4O2TA 2XP5A 2UZ5A 4ODMA 3CHCA 2A3CA 4DRIA 1E6RA 3IKGA 3ODKA 1C9HA 1ZCNA 2XP9A 1ZBVA 1W1VA 3KACA 2Q5AA 1ZB5A 3WKZA 1TFVA 2ZR6A 4N19A 4ML4A 3WD3A 4QT3A 1KFWA 2A3EA 4IT6A 1M5YA 2P4VA 3KAHA 3JYMA 3O5IA 4HARA 4ODQA 5HKGA 1QZ2A 2K8IA 2XP8A 4Z2LA 4W9OA 1OWQA 4P8WA 3MDYB 2OLHA 4IT4A 3LUOA 4W9PA 2XP3A 5D75A 3AS3A 1W1TA 2ZR5A 4JFJA 2RQSA 1FKSA 3TDBA 4MGVA 2WLYA 1FKFA 1BKFA 4AY1A 4DRHA 4Z2GA 4DRPA 1LG1A 1E6ZA 3NTPA 4P8UA 3EIPA 3B9AA 1E15A 4MNMA 1W9UA 3FXYA 1D7HA 4DIPA 3W4RA 4P8XA 2ESCA 4IPXA 3WD4A 3TCZA 1N1AA 2FAPA 1LL6A 4LAVA 1E6NA 3B9EA 2PPPA 2ITKA 4IQCA 1E44A 1GOIA 4MNKA 2RUQA 4DRKA 1BL4A 5DIUA 2RUDA 3KAIA 1HJWA 1J4RA 4WJXA 3G6LA 4QZVB 2ZQTA 3ARZA 3ARTA 5JH8A 1W26A 2VN1A 4DWSA 1X6NA 1XRVA 1D7JA 1FFQA 4R0XA 1B6CA 4C02B 3CH9A 4WKFA 4LAXA 3O5PA 3H9RB 4JFKA 2PV1A 3FY1A 1NWTA 4DROA 2IF4A 4PTMA 4QIBA 5HW6A 1D7IA 3ARUA 4W9QA 5HT1A 1ITXA 1ROTA 1W9PA 4U85A 3AROA 2B31A 4LGXA 4KR0B 2PV3A 3ARYA 4JFMA 3AQUA 1FKJA 1W1PA 2MLXA 1EQ3A 1ZL1A 3O5LA 1X6LA 3KAFA 3IK8A 1NMVA 1QPLA 2YBUA 3PRBA 1E9LA 2XPBA 2KE0A 3KZ7A 1QPFA 4NNRA 3TC5A 3WL0A 4BF8A 4DT4A 2Y78A 3EY6A 3O5KA 4ODLA 3ARQA 4MNJA 4TYOA 4MNLA 1LL7A 1NH6A 1E6PA 4UDMA 3KCEA 2LKNA 4U84A 3G6MA 1WNOA 2PPNA 4FAPA 2XP7A 1ZU8A 2PN0A 2ETNA 4WK9A 3O5FA 1FKLA 4DWSC 1EDQA 3OA5A 4DZ3A 4QT2A 1J6YA 4J4NA 1NWSA 2DSUA 3WL1A 5GPGA 4DRQA 2A3AA 1JVWA 1ZK6A 2LGOA 3JXVA 4DWSB 3RM9A 3O5GA 3CGMA 1Q1CA 1U79A 3UI6A 2DG4A 2MNTA 4ZPTR 4HBEA 2MF9A 1YATA 5HW7A 2RUCA 1TCOC 4FN2A 4Z2HA 1FKGA 1YW5A 5HWCA 1HJXA 3WD1A 5HW8A 4L72B 4MPKA 2EULA 4XAKA 4ITZA 2FDMA 1LL4A 2OFNA 4DRJA 1KT1A 2RSEA 1HKKA 2F21A 2KO7A 1GUVA 4R5EA 1A7XA 2DT3A 1R9HA 3CZ8A 3OOBA 3AS2A 1HXVA 5DO2A 1F40A 5DIVA 3UI4A 4W5UA 1VF8A 2DT1A 3ARRA 1F8AB 1CTNA 1SYTA 3AS1A 3PRDA 5BXJA 3WD0A 3O5RA 1ROUA 3GTYX 3PRAA 3ARVA 3ALFA 1FKDA 4L3NA 4NSBA 1FKIA 2O9OA 4Z2KA 4J4OA 5J6EA 4WIWA 4G2PA 1EIBA 1EHNA 2D9FA 3IKDA 1FFRA 2FKEA 4Q7NA 2M2AA 2DSVA 1H0IA 2XP4A 4ODRA 4ODOA 4Z2IA 1IX5A 4ZPVR 4JFLA 3O5EA 1EYMA 2KFWA 2DG9A 4TW7A 5HWBA 1PINA 2PI6A 5DITA 2F23A 2DT0A 4S3JA 1FKHA 1FAPA 3VAWA 3RGCA 2LJ4A 1HJVA 1XHGA 2PBCA 2IUZA 4JYSA 2AOSA 5DF0A 4MAVA 4DWSD 5HBFA 1W1YA 2DPEA 2G41A 2WM0A 2MLZA 3CGNA 2KGJA 3QOKA 2DT2A 3JYJA 3O5DA 4WKAA 2YBTA 1JNSA 1K9TA 4NZCA 3CHFA 1PBKA 1NWRA 3WIJA 5GPRA 1HKMA 3GPKA 2G8ZA 3KADA 2LPVA 1L1PA 3UI5A 1FJDA 3O5JA 1D6OA 1LG2A 1Y0OA 2B5UB 2N87A 1LQ0A 4G50A 1P5QA 3O5OA 2DG3A 3NI6A 2MLYA 1Q6IA 2DSWA 1UR9A 3BXWA 4JFIA 3O5MA 4ZPWR 4KQZA 3RM4A 1FKTA 2L2SA 3B7XA 3PR9A 2F4EA 1Q6HA 2AWGA 2KI3A 4MTVA 1ZBCA 2KR7A 2PPOA 2WLZA 1KT0A 4ZS6A 4TW6A 1LJYA 3RM8A 3WQVA 3RMEA 1WAWA 3ALGA 1FKRA 1D2KA 1J4IA 1ZBWA 2XPAA 2ZR4A 4WKHA 1NSGA 4MSPA 3KAGA 3UQAA 3PA7A 3BMBA 1JNDA 1GPFA 1ZBKA 3IHZA 2ZQUA 4P8VA 3WH0A 3UQBA 3GU0A 2RURA 3FAPA 1JNTA 4ODNA 3UF8A 4GIVA 3AS0A 2PV2A 1J4HA 4LAYA 1JNEA 4DH0A 2VCDA 2M1IA 4DZ2A 5HTGA 1UR8A 2A3BA 3O5QA 3RFWA 1H0GA 1HKJA 1Q6UA 1SR0A 3CHEA 3B9DA 2F2DA 3WQWA 4IQ2A 2DSZA 3CHDA 1WB0A 3ARWA 5DEZA 5HUAA 4LAWA 3KABA 2JZVA 1O6IA 1NMWA 4TW8A 2M08A 5GQBA 4Q22A 3NRKA 3I6CA 3ARXA 1NWUA 1FKKA 4U86A 4Z2JA 3UQIA 4GGQA 2ZQSA 5I98A 2O92A 1OGBA 4TNSA 3ARSA 2MPHA 1FKBA 1HKIA 4ODKA 4DRMA 5B8IC 1OGGA 2QF8A 4URIA 3ARPA
chains in the Genus database with same CATH topology
2ZQVA 1RD6A 1T11A 1W9VA 4DRNA 4S3KA 3B8SA 3WD2A 2WK2A 4TX0A 1FD9A 4ODPA 2XP6A 4HBOA 4O2TA 2XP5A 2UZ5A 4ODMA 3CHCA 2A3CA 4DRIA 1E6RA 3IKGA 3ODKA 1C9HA 1ZCNA 2XP9A 1ZBVA 1W1VA 3KACA 2Q5AA 1ZB5A 3WKZA 1TFVA 2ZR6A 4N19A 4ML4A 3WD3A 4QT3A 1KFWA 2A3EA 4IT6A 1M5YA 3KAHA 3JYMA 3O5IA 4HARA 4ODQA 5HKGA 1QZ2A 2K8IA 2XP8A 4Z2LA 4W9OA 1OWQA 4P8WA 3MDYB 2OLHA 4IT4A 3LUOA 4W9PA 2XP3A 5D75A 3AS3A 1W1TA 2ZR5A 4JFJA 2RQSA 1FKSA 3TDBA 4MGVA 2WLYA 1FKFA 1BKFA 4AY1A 4DRHA 4Z2GA 4DRPA 1LG1A 1E6ZA 3NTPA 4P8UA 3B9AA 1E15A 4MNMA 1W9UA 3FXYA 1D7HA 4DIPA 3W4RA 4P8XA 2ESCA 4IPXA 3WD4A 3TCZA 1N1AA 2FAPA 1LL6A 4LAVA 1E6NA 3B9EA 2PPPA 2ITKA 4IQCA 1GOIA 4MNKA 2RUQA 4DRKA 1BL4A 5DIUA 2RUDA 3KAIA 1HJWA 1J4RA 4WJXA 3G6LA 4QZVB 2ZQTA 3ARZA 3ARTA 5JH8A 1W26A 2VN1A 4DWSA 1X6NA 1XRVA 1D7JA 1FFQA 4R0XA 1B6CA 4C02B 3CH9A 4WKFA 4LAXA 3O5PA 3H9RB 4JFKA 2PV1A 3FY1A 1NWTA 4DROA 2IF4A 4PTMA 4QIBA 5HW6A 1D7IA 3ARUA 4W9QA 5HT1A 1ITXA 1ROTA 1W9PA 4U85A 3AROA 2B31A 4LGXA 4KR0B 2PV3A 3ARYA 4JFMA 3AQUA 1FKJA 1W1PA 2MLXA 1EQ3A 1ZL1A 3O5LA 1X6LA 3KAFA 3IK8A 1NMVA 1QPLA 2YBUA 3PRBA 1E9LA 2XPBA 2KE0A 3KZ7A 1QPFA 4NNRA 3TC5A 3WL0A 4BF8A 4DT4A 2Y78A 3EY6A 3O5KA 4ODLA 3ARQA 4MNJA 4TYOA 4MNLA 1LL7A 1NH6A 1E6PA 3KCEA 2LKNA 4U84A 3G6MA 1WNOA 2PPNA 4FAPA 2XP7A 1ZU8A 4WK9A 3O5FA 1FKLA 4DWSC 1EDQA 3OA5A 4DZ3A 4QT2A 1J6YA 4J4NA 1NWSA 2DSUA 3WL1A 5GPGA 4DRQA 2A3AA 1JVWA 1ZK6A 2LGOA 3JXVA 4DWSB 3RM9A 3O5GA 3CGMA 1Q1CA 1U79A 3UI6A 2DG4A 2MNTA 4ZPTR 4HBEA 2MF9A 1YATA 5HW7A 2RUCA 1TCOC 4FN2A 4Z2HA 1FKGA 1YW5A 5HWCA 1HJXA 3WD1A 5HW8A 4L72B 4MPKA 4XAKA 4ITZA 2FDMA 1LL4A 2OFNA 4DRJA 1KT1A 2RSEA 1HKKA 2F21A 2KO7A 1GUVA 4R5EA 1A7XA 2DT3A 1R9HA 3CZ8A 3OOBA 3AS2A 1HXVA 5DO2A 1F40A 5DIVA 3UI4A 4W5UA 1VF8A 2DT1A 3ARRA 1F8AB 1CTNA 1SYTA 3AS1A 3PRDA 5BXJA 3WD0A 3O5RA 1ROUA 3PRAA 3ARVA 3ALFA 1FKDA 4L3NA 4NSBA 1FKIA 2O9OA 4Z2KA 4J4OA 5J6EA 4WIWA 4G2PA 1EIBA 1EHNA 2D9FA 3IKDA 1FFRA 2FKEA 4Q7NA 2M2AA 2DSVA 1H0IA 2XP4A 4ODRA 4ODOA 4Z2IA 1IX5A 4ZPVR 4JFLA 3O5EA 1EYMA 2KFWA 2DG9A 4TW7A 5HWBA 1PINA 2PI6A 5DITA 2DT0A 4S3JA 1FKHA 1FAPA 3VAWA 3RGCA 2LJ4A 1HJVA 1XHGA 2PBCA 2IUZA 4JYSA 2AOSA 5DF0A 4MAVA 4DWSD 5HBFA 1W1YA 2DPEA 2G41A 2WM0A 2MLZA 3CGNA 2KGJA 3QOKA 2DT2A 3JYJA 3O5DA 4WKAA 2YBTA 1JNSA 1K9TA 4NZCA 3CHFA 1PBKA 1NWRA 3WIJA 5GPRA 1HKMA 3GPKA 2G8ZA 3KADA 2LPVA 1L1PA 3UI5A 1FJDA 3O5JA 1D6OA 1LG2A 1Y0OA 2N87A 1LQ0A 4G50A 1P5QA 3O5OA 2DG3A 3NI6A 2MLYA 1Q6IA 2DSWA 1UR9A 3BXWA 4JFIA 3O5MA 4ZPWR 4KQZA 3RM4A 1FKTA 2L2SA 3B7XA 3PR9A 2F4EA 1Q6HA 2AWGA 2KI3A 4MTVA 1ZBCA 2KR7A 2PPOA 2WLZA 1KT0A 4ZS6A 4TW6A 1LJYA 3RM8A 3WQVA 3RMEA 1WAWA 3ALGA 1FKRA 1D2KA 1J4IA 1ZBWA 2XPAA 2ZR4A 4WKHA 1NSGA 4MSPA 3KAGA 3UQAA 3PA7A 1JNDA 1GPFA 1ZBKA 3IHZA 2ZQUA 4P8VA 3WH0A 3UQBA 2RURA 3FAPA 1JNTA 4ODNA 3UF8A 4GIVA 3AS0A 2PV2A 1J4HA 4LAYA 1JNEA 4DH0A 2VCDA 2M1IA 4DZ2A 5HTGA 1UR8A 2A3BA 3O5QA 3RFWA 1H0GA 1HKJA 1Q6UA 1SR0A 3CHEA 3B9DA 2F2DA 3WQWA 4IQ2A 2DSZA 3CHDA 1WB0A 3ARWA 5DEZA 5HUAA 4LAWA 3KABA 2JZVA 1O6IA 1NMWA 4TW8A 2M08A 5GQBA 4Q22A 3NRKA 3I6CA 3ARXA 1NWUA 1FKKA 4U86A 4Z2JA 3UQIA 4GGQA 2ZQSA 5I98A 2O92A 1OGBA 4TNSA 3ARSA 2MPHA 1FKBA 1HKIA 4ODKA 4DRMA 5B8IC 1OGGA 2QF8A 4URIA 3ARPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQV A;  4C02 B;  1KT1 A;  2RSE A;  4JFI A;  2F21 A;  3O5M A;  2KO7 A;  4LAX A;  3O5P A;  3H9R B;  4JFK A;  1A7X A;  1T11 A;  2PV1 A;  4DRN A;  1R9H A;  3OOB A;  1FKT A;  2L2S A;  1HXV A;  3B7X A;  4FAP A;  1F40 A;  2F4E A;  4DRO A;  1Q6H A;  4TX0 A;  2IF4 A;  5DIV A;  1FD9 A;  3UI4 A;  4QIB A;  5HW6 A;  2AWG A;  1D7I A;  4ODP A;  2KI3 A;  2XP6 A;  2KR7 A;  4O2T A;  2PPO A;  2XP5 A;  1F8A B;  2UZ5 A;  4ODM A;  4W9Q A;  5HT1 A;  1KT0 A;  4DRI A;  1ROT A;  3PRD A;  3IKG A;  4TW6 A;  3ODK A;  4U85 A;  1C9H A;  5BXJ A;  1ZCN A;  2XP9 A;  3O5R A;  1ROU A;  2PV3 A;  3KAC A;  4JFM A;  2Q5A A;  4DRJ A;  1FKJ A;  2MLX A;  1FKR A;  1EQ3 A;  1FKD A;  1FKI A;  1J4I A;  2ZR6 A;  3O5L A;  4N19 A;  3KAF A;  4QT3 A;  3IK8 A;  1NMV A;  2XPA A;  4J4O A;  2ZR4 A;  5J6E A;  1QPL A;  3PRB A;  1NSG A;  4G2P A;  1M5Y A;  2D9F A;  2XPB A;  4MSP A;  2KE0 A;  3IKD A;  3KAG A;  3KZ7 A;  1QPF A;  3KAH A;  3JYM A;  3O5I A;  3UQA A;  2FKE A;  4NNR A;  4ODQ A;  3TC5 A;  4BF8 A;  4DT4 A;  5HKG A;  2M2A A;  2Y78 A;  1QZ2 A;  3PA7 A;  2K8I A;  2XP8 A;  2XP4 A;  3EY6 A;  4ODR A;  4ODO A;  3IHZ A;  4W9O A;  3MDY B;  4JFL A;  2ZQU A;  3O5E A;  3O5K A;  3WH0 A;  3LUO A;  1EYM A;  2KFW A;  4ODL A;  2RUR A;  4W9P A;  2XP3 A;  1JNT A;  3FAP A;  4ODN A;  2DG9 A;  4TYO A;  5D75 A;  4TW7 A;  5HWB A;  1PIN A;  2ZR5 A;  4JFJ A;  3UF8 A;  5DIT A;  2RQS A;  3KCE A;  1FKS A;  2LKN A;  4GIV A;  4U84 A;  2PV2 A;  1J4H A;  2PPN A;  4LAY A;  1FKH A;  4MGV A;  2XP7 A;  1FAP A;  1FKF A;  3TDB A;  3RGC A;  3VAW A;  2VCD A;  4DH0 A;  2M1I A;  4DZ2 A;  5HTG A;  1BKF A;  2LJ4 A;  4DRH A;  3O5F A;  1FKL A;  4DRP A;  3NTP A;  2PBC A;  3O5Q A;  3RFW A;  4DZ3 A;  4QT2 A;  1J6Y A;  4JYS A;  1Q6U A;  4J4N A;  1D7H A;  5GPG A;  4DIP A;  4DRQ A;  2F2D A;  1JVW A;  1ZK6 A;  1FJD A;  4IQ2 A;  2MLZ A;  4IPX A;  2LGO A;  3JXV A;  3CGN A;  3O5G A;  2KGJ A;  3CGM A;  3JYJ A;  3TCZ A;  1N1A A;  2FAP A;  3O5D A;  2OFN A;  1Q1C A;  1JNS A;  5HUA A;  4LAV A;  4LAW A;  1U79 A;  2JZV A;  3KAB A;  1PBK A;  3UI6 A;  1NMW A;  2DG4 A;  4TW8 A;  3GPK A;  2MNT A;  3KAD A;  2M08 A;  3UQB A;  2LPV A;  2PPP A;  2ITK A;  3I6C A;  2MF9 A;  3NRK A;  1FKK A;  1YAT A;  4IQC A;  4U86 A;  5HW7 A;  1L1P A;  2RUC A;  3UI5 A;  2RUQ A;  3UQI A;  1TCO C;  4FN2 A;  1BL4 A;  4GGQ A;  5DIU A;  2ZQS A;  2RUD A;  3O5J A;  1D6O A;  3KAI A;  1FKG A;  1J4R A;  1YW5 A;  5HWC A;  1Y0O A;  5I98 A;  4TNS A;  2N87 A;  2ZQT A;  2MPH A;  4G50 A;  1P5Q A;  1FKB A;  3O5O A;  4DRK A;  5HW8 A;  1W26 A;  2VN1 A;  4ODK A;  2DG3 A;  4DRM A;  3NI6 A;  4ITZ A;  5B8I C;  2MLY A;  1D7J A;  1Q6I A;  4R0X A;  1B6C A; 
#chains in the Genus database with same CATH topology
 2ZQV A;  1RD6 A;  1GRJ A;  1T11 A;  1W9V A;  4DRN A;  4S3K A;  3B8S A;  3WD2 A;  2WK2 A;  4TX0 A;  1JCH B;  1FD9 A;  4ODP A;  2XP6 A;  4HBO A;  4O2T A;  2XP5 A;  2UZ5 A;  4ODM A;  3CHC A;  2A3C A;  4DRI A;  1E6R A;  3IKG A;  3ODK A;  1C9H A;  1ZCN A;  2XP9 A;  1ZBV A;  1W1V A;  3KAC A;  2Q5A A;  1ZB5 A;  3WKZ A;  1TFV A;  2ZR6 A;  4N19 A;  4ML4 A;  3WD3 A;  4QT3 A;  1KFW A;  2A3E A;  4IT6 A;  1M5Y A;  2P4V A;  3KAH A;  3JYM A;  3O5I A;  4HAR A;  4ODQ A;  5HKG A;  1QZ2 A;  2K8I A;  2XP8 A;  4Z2L A;  4W9O A;  1OWQ A;  4P8W A;  3MDY B;  2OLH A;  4IT4 A;  3LUO A;  4W9P A;  2XP3 A;  5D75 A;  3AS3 A;  1W1T A;  2ZR5 A;  4JFJ A;  2RQS A;  1FKS A;  3TDB A;  4MGV A;  2WLY A;  1FKF A;  1BKF A;  4AY1 A;  4DRH A;  4Z2G A;  4DRP A;  1LG1 A;  1E6Z A;  3NTP A;  4P8U A;  3EIP A;  3B9A A;  1E15 A;  4MNM A;  1W9U A;  3FXY A;  1D7H A;  4DIP A;  3W4R A;  4P8X A;  2ESC A;  4IPX A;  3WD4 A;  3TCZ A;  1N1A A;  2FAP A;  1LL6 A;  4LAV A;  1E6N A;  3B9E A;  2PPP A;  2ITK A;  4IQC A;  1E44 A;  1GOI A;  4MNK A;  2RUQ A;  4DRK A;  1BL4 A;  5DIU A;  2RUD A;  3KAI A;  1HJW A;  1J4R A;  4WJX A;  3G6L A;  4QZV B;  2ZQT A;  3ARZ A;  3ART A;  5JH8 A;  1W26 A;  2VN1 A;  4DWS A;  1X6N A;  1XRV A;  1D7J A;  1FFQ A;  4R0X A;  1B6C A;  4C02 B;  3CH9 A;  4WKF A;  4LAX A;  3O5P A;  3H9R B;  4JFK A;  2PV1 A;  3FY1 A;  1NWT A;  4DRO A;  2IF4 A;  4PTM A;  4QIB A;  5HW6 A;  1D7I A;  3ARU A;  4W9Q A;  5HT1 A;  1ITX A;  1ROT A;  1W9P A;  4U85 A;  3ARO A;  2B31 A;  4LGX A;  4KR0 B;  2PV3 A;  3ARY A;  4JFM A;  3AQU A;  1FKJ A;  1W1P A;  2MLX A;  1EQ3 A;  1ZL1 A;  3O5L A;  1X6L A;  3KAF A;  3IK8 A;  1NMV A;  1QPL A;  2YBU A;  3PRB A;  1E9L A;  2XPB A;  2KE0 A;  3KZ7 A;  1QPF A;  4NNR A;  3TC5 A;  3WL0 A;  4BF8 A;  4DT4 A;  2Y78 A;  3EY6 A;  3O5K A;  4ODL A;  3ARQ A;  4MNJ A;  4TYO A;  4MNL A;  1LL7 A;  1NH6 A;  1E6P A;  4UDM A;  3KCE A;  2LKN A;  4U84 A;  3G6M A;  1WNO A;  2PPN A;  4FAP A;  2XP7 A;  1ZU8 A;  2PN0 A;  2ETN A;  4WK9 A;  3O5F A;  1FKL A;  4DWS C;  1EDQ A;  3OA5 A;  4DZ3 A;  4QT2 A;  1J6Y A;  4J4N A;  1NWS A;  2DSU A;  3WL1 A;  5GPG A;  4DRQ A;  2A3A A;  1JVW A;  1ZK6 A;  2LGO A;  3JXV A;  4DWS B;  3RM9 A;  3O5G A;  3CGM A;  1Q1C A;  1U79 A;  3UI6 A;  2DG4 A;  2MNT A;  4ZPT R;  4HBE A;  2MF9 A;  1YAT A;  5HW7 A;  2RUC A;  1TCO C;  4FN2 A;  4Z2H A;  1FKG A;  1YW5 A;  5HWC A;  1HJX A;  3WD1 A;  5HW8 A;  4L72 B;  4MPK A;  2EUL A;  4XAK A;  4ITZ A;  2FDM A;  1LL4 A;  2OFN A;  4DRJ A;  1KT1 A;  2RSE A;  1HKK A;  2F21 A;  2KO7 A;  1GUV A;  4R5E A;  1A7X A;  2DT3 A;  1R9H A;  3CZ8 A;  3OOB A;  3AS2 A;  1HXV A;  5DO2 A;  1F40 A;  5DIV A;  3UI4 A;  4W5U A;  1VF8 A;  2DT1 A;  3ARR A;  1F8A B;  1CTN A;  1SYT A;  3AS1 A;  3PRD A;  5BXJ A;  3WD0 A;  3O5R A;  1ROU A;  3GTY X;  3PRA A;  3ARV A;  3ALF A;  1FKD A;  4L3N A;  4NSB A;  1FKI A;  2O9O A;  4Z2K A;  4J4O A;  5J6E A;  4WIW A;  4G2P A;  1EIB A;  1EHN A;  2D9F A;  3IKD A;  1FFR A;  2FKE A;  4Q7N A;  2M2A A;  2DSV A;  1H0I A;  2XP4 A;  4ODR A;  4ODO A;  4Z2I A;  1IX5 A;  4ZPV R;  4JFL A;  3O5E A;  1EYM A;  2KFW A;  2DG9 A;  4TW7 A;  5HWB A;  1PIN A;  2PI6 A;  5DIT A;  2F23 A;  2DT0 A;  4S3J A;  1FKH A;  1FAP A;  3VAW A;  3RGC A;  2LJ4 A;  1HJV A;  1XHG A;  2PBC A;  2IUZ A;  4JYS A;  2AOS A;  5DF0 A;  4MAV A;  4DWS D;  5HBF A;  1W1Y A;  2DPE A;  2G41 A;  2WM0 A;  2MLZ A;  3CGN A;  2KGJ A;  3QOK A;  2DT2 A;  3JYJ A;  3O5D A;  4WKA A;  2YBT A;  1JNS A;  1K9T A;  4NZC A;  3CHF A;  1PBK A;  1NWR A;  3WIJ A;  5GPR A;  1HKM A;  3GPK A;  2G8Z A;  3KAD A;  2LPV A;  1L1P A;  3UI5 A;  1FJD A;  3O5J A;  1D6O A;  1LG2 A;  1Y0O A;  2B5U B;  2N87 A;  1LQ0 A;  4G50 A;  1P5Q A;  3O5O A;  2DG3 A;  3NI6 A;  2MLY A;  1Q6I A;  2DSW A;  1UR9 A;  3BXW A;  4JFI A;  3O5M A;  4ZPW R;  4KQZ A;  3RM4 A;  1FKT A;  2L2S A;  3B7X A;  3PR9 A;  2F4E A;  1Q6H A;  2AWG A;  2KI3 A;  4MTV A;  1ZBC A;  2KR7 A;  2PPO A;  2WLZ A;  1KT0 A;  4ZS6 A;  4TW6 A;  1LJY A;  3RM8 A;  3WQV A;  3RME A;  1WAW A;  3ALG A;  1FKR A;  1D2K A;  1J4I A;  1ZBW A;  2XPA A;  2ZR4 A;  4WKH A;  1NSG A;  4MSP A;  3KAG A;  3UQA A;  3PA7 A;  3BMB A;  1JND A;  1GPF A;  1ZBK A;  3IHZ A;  2ZQU A;  4P8V A;  3WH0 A;  3UQB A;  3GU0 A;  2RUR A;  3FAP A;  1JNT A;  4ODN A;  3UF8 A;  4GIV A;  3AS0 A;  2PV2 A;  1J4H A;  4LAY A;  1JNE A;  4DH0 A;  2VCD A;  2M1I A;  4DZ2 A;  5HTG A;  1UR8 A;  2A3B A;  3O5Q A;  3RFW A;  1H0G A;  1HKJ A;  1Q6U A;  1SR0 A;  3CHE A;  3B9D A;  2F2D A;  3WQW A;  4IQ2 A;  2DSZ A;  3CHD A;  1WB0 A;  3ARW A;  5DEZ A;  5HUA A;  4LAW A;  3KAB A;  2JZV A;  1O6I A;  1NMW A;  4TW8 A;  2M08 A;  5GQB A;  4Q22 A;  3NRK A;  3I6C A;  3ARX A;  1NWU A;  1FKK A;  4U86 A;  4Z2J A;  3UQI A;  4GGQ A;  2ZQS A;  5I98 A;  2O92 A;  1OGB A;  4TNS A;  3ARS A;  2MPH A;  1FKB A;  1HKI A;  4ODK A;  4DRM A;  5B8I C;  1OGG A;  2QF8 A;  4URI A;  3ARP A; 
#chains in the Genus database with same CATH homology
 2ZQV A;  1RD6 A;  1T11 A;  1W9V A;  4DRN A;  4S3K A;  3B8S A;  3WD2 A;  2WK2 A;  4TX0 A;  1FD9 A;  4ODP A;  2XP6 A;  4HBO A;  4O2T A;  2XP5 A;  2UZ5 A;  4ODM A;  3CHC A;  2A3C A;  4DRI A;  1E6R A;  3IKG A;  3ODK A;  1C9H A;  1ZCN A;  2XP9 A;  1ZBV A;  1W1V A;  3KAC A;  2Q5A A;  1ZB5 A;  3WKZ A;  1TFV A;  2ZR6 A;  4N19 A;  4ML4 A;  3WD3 A;  4QT3 A;  1KFW A;  2A3E A;  4IT6 A;  1M5Y A;  3KAH A;  3JYM A;  3O5I A;  4HAR A;  4ODQ A;  5HKG A;  1QZ2 A;  2K8I A;  2XP8 A;  4Z2L A;  4W9O A;  1OWQ A;  4P8W A;  3MDY B;  2OLH A;  4IT4 A;  3LUO A;  4W9P A;  2XP3 A;  5D75 A;  3AS3 A;  1W1T A;  2ZR5 A;  4JFJ A;  2RQS A;  1FKS A;  3TDB A;  4MGV A;  2WLY A;  1FKF A;  1BKF A;  4AY1 A;  4DRH A;  4Z2G A;  4DRP A;  1LG1 A;  1E6Z A;  3NTP A;  4P8U A;  3B9A A;  1E15 A;  4MNM A;  1W9U A;  3FXY A;  1D7H A;  4DIP A;  3W4R A;  4P8X A;  2ESC A;  4IPX A;  3WD4 A;  3TCZ A;  1N1A A;  2FAP A;  1LL6 A;  4LAV A;  1E6N A;  3B9E A;  2PPP A;  2ITK A;  4IQC A;  1GOI A;  4MNK A;  2RUQ A;  4DRK A;  1BL4 A;  5DIU A;  2RUD A;  3KAI A;  1HJW A;  1J4R A;  4WJX A;  3G6L A;  4QZV B;  2ZQT A;  3ARZ A;  3ART A;  5JH8 A;  1W26 A;  2VN1 A;  4DWS A;  1X6N A;  1XRV A;  1D7J A;  1FFQ A;  4R0X A;  1B6C A;  4C02 B;  3CH9 A;  4WKF A;  4LAX A;  3O5P A;  3H9R B;  4JFK A;  2PV1 A;  3FY1 A;  1NWT A;  4DRO A;  2IF4 A;  4PTM A;  4QIB A;  5HW6 A;  1D7I A;  3ARU A;  4W9Q A;  5HT1 A;  1ITX A;  1ROT A;  1W9P A;  4U85 A;  3ARO A;  2B31 A;  4LGX A;  4KR0 B;  2PV3 A;  3ARY A;  4JFM A;  3AQU A;  1FKJ A;  1W1P A;  2MLX A;  1EQ3 A;  1ZL1 A;  3O5L A;  1X6L A;  3KAF A;  3IK8 A;  1NMV A;  1QPL A;  2YBU A;  3PRB A;  1E9L A;  2XPB A;  2KE0 A;  3KZ7 A;  1QPF A;  4NNR A;  3TC5 A;  3WL0 A;  4BF8 A;  4DT4 A;  2Y78 A;  3EY6 A;  3O5K A;  4ODL A;  3ARQ A;  4MNJ A;  4TYO A;  4MNL A;  1LL7 A;  1NH6 A;  1E6P A;  3KCE A;  2LKN A;  4U84 A;  3G6M A;  1WNO A;  2PPN A;  4FAP A;  2XP7 A;  1ZU8 A;  4WK9 A;  3O5F A;  1FKL A;  4DWS C;  1EDQ A;  3OA5 A;  4DZ3 A;  4QT2 A;  1J6Y A;  4J4N A;  1NWS A;  2DSU A;  3WL1 A;  5GPG A;  4DRQ A;  2A3A A;  1JVW A;  1ZK6 A;  2LGO A;  3JXV A;  4DWS B;  3RM9 A;  3O5G A;  3CGM A;  1Q1C A;  1U79 A;  3UI6 A;  2DG4 A;  2MNT A;  4ZPT R;  4HBE A;  2MF9 A;  1YAT A;  5HW7 A;  2RUC A;  1TCO C;  4FN2 A;  4Z2H A;  1FKG A;  1YW5 A;  5HWC A;  1HJX A;  3WD1 A;  5HW8 A;  4L72 B;  4MPK A;  4XAK A;  4ITZ A;  2FDM A;  1LL4 A;  2OFN A;  4DRJ A;  1KT1 A;  2RSE A;  1HKK A;  2F21 A;  2KO7 A;  1GUV A;  4R5E A;  1A7X A;  2DT3 A;  1R9H A;  3CZ8 A;  3OOB A;  3AS2 A;  1HXV A;  5DO2 A;  1F40 A;  5DIV A;  3UI4 A;  4W5U A;  1VF8 A;  2DT1 A;  3ARR A;  1F8A B;  1CTN A;  1SYT A;  3AS1 A;  3PRD A;  5BXJ A;  3WD0 A;  3O5R A;  1ROU A;  3PRA A;  3ARV A;  3ALF A;  1FKD A;  4L3N A;  4NSB A;  1FKI A;  2O9O A;  4Z2K A;  4J4O A;  5J6E A;  4WIW A;  4G2P A;  1EIB A;  1EHN A;  2D9F A;  3IKD A;  1FFR A;  2FKE A;  4Q7N A;  2M2A A;  2DSV A;  1H0I A;  2XP4 A;  4ODR A;  4ODO A;  4Z2I A;  1IX5 A;  4ZPV R;  4JFL A;  3O5E A;  1EYM A;  2KFW A;  2DG9 A;  4TW7 A;  5HWB A;  1PIN A;  2PI6 A;  5DIT A;  2DT0 A;  4S3J A;  1FKH A;  1FAP A;  3VAW A;  3RGC A;  2LJ4 A;  1HJV A;  1XHG A;  2PBC A;  2IUZ A;  4JYS A;  2AOS A;  5DF0 A;  4MAV A;  4DWS D;  5HBF A;  1W1Y A;  2DPE A;  2G41 A;  2WM0 A;  2MLZ A;  3CGN A;  2KGJ A;  3QOK A;  2DT2 A;  3JYJ A;  3O5D A;  4WKA A;  2YBT A;  1JNS A;  1K9T A;  4NZC A;  3CHF A;  1PBK A;  1NWR A;  3WIJ A;  5GPR A;  1HKM A;  3GPK A;  2G8Z A;  3KAD A;  2LPV A;  1L1P A;  3UI5 A;  1FJD A;  3O5J A;  1D6O A;  1LG2 A;  1Y0O A;  2N87 A;  1LQ0 A;  4G50 A;  1P5Q A;  3O5O A;  2DG3 A;  3NI6 A;  2MLY A;  1Q6I A;  2DSW A;  1UR9 A;  3BXW A;  4JFI A;  3O5M A;  4ZPW R;  4KQZ A;  3RM4 A;  1FKT A;  2L2S A;  3B7X A;  3PR9 A;  2F4E A;  1Q6H A;  2AWG A;  2KI3 A;  4MTV A;  1ZBC A;  2KR7 A;  2PPO A;  2WLZ A;  1KT0 A;  4ZS6 A;  4TW6 A;  1LJY A;  3RM8 A;  3WQV A;  3RME A;  1WAW A;  3ALG A;  1FKR A;  1D2K A;  1J4I A;  1ZBW A;  2XPA A;  2ZR4 A;  4WKH A;  1NSG A;  4MSP A;  3KAG A;  3UQA A;  3PA7 A;  1JND A;  1GPF A;  1ZBK A;  3IHZ A;  2ZQU A;  4P8V A;  3WH0 A;  3UQB A;  2RUR A;  3FAP A;  1JNT A;  4ODN A;  3UF8 A;  4GIV A;  3AS0 A;  2PV2 A;  1J4H A;  4LAY A;  1JNE A;  4DH0 A;  2VCD A;  2M1I A;  4DZ2 A;  5HTG A;  1UR8 A;  2A3B A;  3O5Q A;  3RFW A;  1H0G A;  1HKJ A;  1Q6U A;  1SR0 A;  3CHE A;  3B9D A;  2F2D A;  3WQW A;  4IQ2 A;  2DSZ A;  3CHD A;  1WB0 A;  3ARW A;  5DEZ A;  5HUA A;  4LAW A;  3KAB A;  2JZV A;  1O6I A;  1NMW A;  4TW8 A;  2M08 A;  5GQB A;  4Q22 A;  3NRK A;  3I6C A;  3ARX A;  1NWU A;  1FKK A;  4U86 A;  4Z2J A;  3UQI A;  4GGQ A;  2ZQS A;  5I98 A;  2O92 A;  1OGB A;  4TNS A;  3ARS A;  2MPH A;  1FKB A;  1HKI A;  4ODK A;  4DRM A;  5B8I C;  1OGG A;  2QF8 A;  4URI A;  3ARP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...