1PBKA

Homologous domain of human fkbp25
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
116
structure length
116
Chain Sequence
PKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP25
publication title Structure of the human 25 kDa FK506 binding protein complexed with rapamycin.
pubmed rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 23
structure length 116
sequence length 116
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1pbkA00
1FKSA 3TDBA 4ODOA 4J4NA 1KT1A 1Y0OA 2ZQTA 1D7IA 1ZK6A 4LAXA 2XPAA 5DITA 1FD9A 3UI5A 4DRHA 1HXVA 2MLXA 4QT3A 2PPNA 5HT1A 2KO7A 2PBCA 4DRQA 1N1AA 3CGNA 2M2AA 4W9QA 3KAFA 3TCZA 4DRIA 5GPGA 2FKEA 1F8AB 2Q5AA 4DRMA 2DG9A 3ODKA 4R0XA 1FKLA 1NSGA 1Q6HA 5HW7A 3NI6A 1FKRA 2XP8A 4JFIA 4TX0A 4ODPA 5DIUA 2F2DA 2ZR6A 4FAPA 2KGJA 2RSEA 4ODQA 1ROTA 2XP5A 3KZ7A 3WH0A 4LAWA 1FKBA 4TW6A 5HUAA 4ODLA 1FKTA 3KAGA 1EQ3A 4DT4A 3PRDA 1D6OA 2KR7A 2RURA 4ODNA 1NMWA 3B7XA 3KCEA 2MF9A 4ITZA 2XP4A 1YATA 3NRKA 4TW7A 2PV2A 2N87A 2F21A 4GIVA 4DROA 3KAHA 4NNRA 3UQBA 1F40A 2LGOA 2UZ5A 2ZQVA 2ITKA 2F4EA 3NTPA 1ZCNA 1BL4A 5B8IC 1JNSA 1BKFA 3IHZA 4ODKA 1FAPA 4MGVA 3KACA 4MSPA 3I6CA 4ODMA 3FAPA 2RQSA 2VCDA 3EY6A 3O5PA 3O5EA 1C9HA 3MDYB 2RUCA 1FKKA 3O5KA 1FKGA 2AWGA 5D75A 2M1IA 3RFWA 3UI6A 1FKIA 1Q1CA 3H9RB 2VN1A 4JFLA 5DIVA 3CGMA 3PA7A 1FJDA 2PV3A 5BXJA 4DRKA 3O5GA 4U86A 2LJ4A 4W9PA 4IQCA 2PPPA 2ZR5A 4N19A 5HTGA 3LUOA 1PBKA 3UF8A 2DG3A 2FAPA 4JFJA 4TNSA 1QZ2A 3TC5A 5HWBA 5HWCA 2OFNA 1YW5A 4JFMA 4DIPA 4DRPA 3UQAA 1QPLA 2RUDA 4DRJA 1JNTA 3KABA 4IQ2A 3RGCA 3KAIA 4IPXA 1NMVA 2XP3A 4TW8A 2D9FA 2XPBA 4QT2A 4FN2A 3O5RA 1B6CA 1R9HA 2RUQA 3O5MA 2Y78A 4G2PA 1P5QA 2LKNA 4W9OA 4U85A 1D7HA 2K8IA 2MLYA 2IF4A 1EYMA 2KI3A 2MPHA 3O5QA 3O5FA 3OOBA 4J4OA 4LAYA 3UI4A 4O2TA 1L1PA 2PV1A 4DRNA 3UQIA 1J4HA 1Q6IA 1Q6UA 1J6YA 1JVWA 1U79A 2ZQSA 2ZQUA 4BF8A 4DZ3A 4LAVA 2XP9A 1FKFA 1KT0A 2MNTA 3O5LA 4JFKA 2DG4A 1J4RA 2KFWA 2M08A 1ROUA 2PPOA 4TYOA 3IKGA 4C02B 4DZ2A 5J6EA 1D7JA 2JZVA 1A7XA 3O5DA 4ODRA 3O5JA 3GPKA 4GGQA 2MLZA 2XP7A 1M5YA 1TCOC 5HW8A 1W26A 2XP6A 1T11A 4DH0A 1FKDA 5HW6A 4JYSA 4QIBA 4U84A 3VAWA 5HKGA 2KE0A 4G50A 2L2SA 3O5OA 5I98A 2LPVA 3IKDA 3JXVA 3JYMA 3PRBA 1J4IA 3IK8A 2ZR4A 3O5IA 1FKHA 1QPFA 3JYJA 1FKJA 1PINA 3KADA
chains in the Genus database with same CATH superfamily
2O92A 4J4NA 1ITXA 1D7IA 2IUZA 4LAXA 3ARZA 4DRHA 3ALGA 1N1AA 3WQWA 5JH8A 1E9LA 3KAFA 1RD6A 3TCZA 1NWTA 3ARUA 3ODKA 3AQUA 4R0XA 1H0GA 1GPFA 5HW7A 4KQZA 1K9TA 4NSBA 2EULA 4FAPA 2DT3A 3FY1A 4LAWA 4TW6A 2DT1A 4DT4A 3PRDA 2KR7A 1NMWA 3KCEA 2XP4A 2A3AA 4GIVA 4DWSA 2F21A 5GQBA 4DROA 1F40A 4NZCA 2ZQVA 3NTPA 1ZCNA 1BL4A 3WL1A 3IHZA 2P4VA 3AS0A 4Q22A 4Z2IA 1E6RA 3ARTA 4ODMA 3ARPA 2RQSA 2VCDA 2YBUA 3O5PA 1C9HA 4Z2GA 5D75A 4P8UA 1ZBWA 4JFLA 2VN1A 5DIVA 4ZS6A 1W9PA 2PV3A 3B8SA 3CHCA 4DRKA 3AS1A 5HTGA 3UF8A 1VF8A 5HWBA 2OFNA 4ZPTR 1QPLA 1ZL1A 1H0IA 4IQ2A 3KAIA 3O5RA 1B6CA 4L3NA 4W9OA 3ARSA 3OOBA 1EYMA 2KI3A 2MPHA 3O5QA 1WNOA 1IX5A 2PV1A 2ZQSA 2ZQUA 4P8XA 4BF8A 4LAVA 2DG4A 2KFWA 1HJVA 2PPOA 4L72B 4R5EA 4S3JA 5J6EA 4P8VA 3PRAA 4DH0A 1FKDA 4Q7NA 4WKHA 1EHNA 3WIJA 4G50A 2DSVA 2LPVA 4DWSB 5DO2A 2G41A 2B31A 3CHFA 2QF8A 1ZU8A 3KADA 4HARA 1KT1A 1Y0OA 2ZQTA 1ZK6A 3WD4A 3RMEA 2MLXA 4QT3A 5HT1A 4QZVB 4DRQA 4W9QA 1ZBVA 5GPGA 1F8AB 1E44A 1EDQA 2DG9A 1Q6HA 3ARQA 2F2DA 2ZR6A 2RSEA 1WAWA 1FKBA 3CH9A 5HUAA 4ODLA 3KAGA 1EQ3A 4ODNA 1YATA 2OLHA 1LL6A 2PV2A 3NRKA 4TW7A 4WJXA 4W5UA 1E6PA 3KAHA 2UZ5A 1WB0A 5HBFA 5GPRA 2F4EA 1JNSA 4WIWA 1BKFA 1UR9A 3AS2A 4LGXA 3FAPA 3EY6A 4MTVA 4WKAA 3O5EA 4XAKA 2RUCA 1GRJA 2AWGA 3UI6A 1Q1CA 2ETNA 3H9RB 3B9DA 3FXYA 4W9PA 2PPPA 2ZR5A 3WQVA 2DT0A 3WD1A 1NWUA 1OGBA 2A3EA 3CHEA 3CZ8A 3TC5A 3B9EA 4DRPA 2DPEA 1HJWA 1W1TA 2RUDA 3RGCA 1XRVA 4MNKA 1W1YA 1HKIA 2XPBA 1R9HA 4IT6A 4G2PA 4J4OA 3G6MA 1L1PA 4LAYA 4O2TA 4DRNA 1W9VA 1W1VA 1X6NA 1Q6IA 1Q6UA 1HKMA 3ALFA 2MNTA 3ARXA 3IKGA 3G6LA 3WD0A 4C02B 4S3KA 3GU0A 1A7XA 1JNEA 1CTNA 3O5DA 3B9AA 4MAVA 3GPKA 4GGQA 4Z2KA 3RM9A 1M5YA 1TCOC 1T11A 2WLZA 1LJYA 4U84A 5HKGA 3IKDA 3JXVA 1J4IA 3IK8A 2PN0A 3O5IA 5DF0A 3ARRA 4DWSC 1FKSA 3TDBA 4ODOA 3BXWA 4IT4A 1LG2A 2XPAA 1FD9A 1LQ0A 1HXVA 2PPNA 2ESCA 2PBCA 1SYTA 1W9UA 1LG1A 2DSWA 2FKEA 4DRIA 4DRMA 1FFRA 1FKLA 2XP8A 2G8ZA 2KGJA 1ROTA 1TFVA 2XP5A 3ARVA 3KZ7A 1FKTA 4Z2JA 3AROA 2RURA 3B7XA 2N87A 4HBEA 4NNRA 3UQBA 1GUVA 3KACA 3I6CA 3ARWA 1E6NA 2PI6A 3MDYB 1KFWA 3CGMA 3GTYX 4WKFA 3O5GA 1NWSA 3OA5A 4N19A 3LUOA 2FAPA 4JFJA 1HJXA 4DWSD 3CHDA 1ZB5A 1OGGA 4DRJA 1JNTA 3KABA 2XP3A 4TW8A 2D9FA 4PTMA 4FN2A 3O5MA 1P5QA 2LKNA 4U85A 3WKZA 2FDMA 2K8IA 2MLYA 2IF4A 3O5FA 4MPKA 3ARYA 1J4HA 1JVWA 4KR0B 4DZ3A 2XP9A 3O5LA 1KT0A 4TYOA 1ROUA 4P8WA 1D7JA 2YBTA 4ODRA 3O5JA 4MNLA 1LL7A 1NH6A 4Z2HA 2MLZA 1NWRA 2XP7A 4HBOA 5HW8A 2XP6A 5HW6A 3EIPA 4JYSA 3BMBA 3O5OA 5I98A 3PRBA 1UR8A 1W1PA 1HKJA 1QPFA 3JYJA 1FKJA 1PINA 1JNDA 1XHGA 1O6IA 5DITA 3UI5A 2WLYA 2KO7A 3CGNA 2M2AA 3RM8A 2Q5AA 5DEZA 1NSGA 1FKRA 3NI6A 4JFIA 4TX0A 1JCHB 4ODPA 5DIUA 3AS3A 1OWQA 4ODQA 2A3BA 3WH0A 3WL0A 4AY1A 1D6OA 2MF9A 4ITZA 2DSZA 1ZBCA 2LGOA 2ITKA 5B8IC 4ODKA 2B5UB 1FAPA 4MGVA 1D2KA 3W4RA 4MSPA 3PR9A 1X6LA 3WD3A 4Z2LA 1FKKA 3O5KA 1FKGA 1LL4A 2M1IA 3RFWA 2WM0A 1FKIA 4MNJA 1FJDA 3PA7A 1FFQA 5BXJA 4U86A 2LJ4A 4IQCA 1E6ZA 1ZBKA 1PBKA 2DG3A 4TNSA 1QZ2A 5HWCA 1YW5A 4JFMA 4DIPA 2DSUA 4ZPVR 3UQAA 1HKKA 2F23A 4IPXA 1NMVA 4QT2A 2RUQA 2Y78A 1D7HA 4ZPWR 3UI4A 3UQIA 3QOKA 3WD2A 1J6YA 1U79A 1FKFA 4JFKA 4MNMA 4WK9A 1J4RA 2M08A 4DZ2A 2AOSA 2JZVA 4URIA 2WK2A 1E15A 3RM4A 4ML4A 1W26A 1EIBA 2DT2A 4QIBA 1GOIA 2A3CA 3VAWA 1SR0A 2KE0A 2L2SA 3JYMA 2ZR4A 4UDMA 1FKHA 2O9OA
chains in the Genus database with same CATH topology
2O92A 4J4NA 1ITXA 1D7IA 2IUZA 4LAXA 3ARZA 4DRHA 3ALGA 1N1AA 3WQWA 5JH8A 1E9LA 3KAFA 1RD6A 3TCZA 1NWTA 3ARUA 3ODKA 3AQUA 4R0XA 1H0GA 1GPFA 5HW7A 4KQZA 1K9TA 4NSBA 4FAPA 2DT3A 3FY1A 4LAWA 4TW6A 2DT1A 4DT4A 3PRDA 2KR7A 1NMWA 3KCEA 2XP4A 2A3AA 4GIVA 4DWSA 2F21A 5GQBA 4DROA 1F40A 4NZCA 2ZQVA 3NTPA 1ZCNA 1BL4A 3WL1A 3IHZA 3AS0A 4Q22A 4Z2IA 1E6RA 3ARTA 4ODMA 3ARPA 2RQSA 2VCDA 2YBUA 3O5PA 1C9HA 4Z2GA 5D75A 4P8UA 1ZBWA 4JFLA 2VN1A 5DIVA 4ZS6A 1W9PA 2PV3A 3B8SA 3CHCA 4DRKA 3AS1A 5HTGA 3UF8A 1VF8A 5HWBA 2OFNA 4ZPTR 1QPLA 1ZL1A 1H0IA 4IQ2A 3KAIA 3O5RA 1B6CA 4L3NA 4W9OA 3ARSA 3OOBA 1EYMA 2KI3A 2MPHA 3O5QA 1WNOA 1IX5A 2PV1A 2ZQSA 2ZQUA 4P8XA 4BF8A 4LAVA 2DG4A 2KFWA 1HJVA 2PPOA 4L72B 4R5EA 4S3JA 5J6EA 4P8VA 3PRAA 4DH0A 1FKDA 4Q7NA 4WKHA 1EHNA 3WIJA 4G50A 2DSVA 2LPVA 4DWSB 5DO2A 2G41A 2B31A 3CHFA 2QF8A 1ZU8A 3KADA 4HARA 1KT1A 1Y0OA 2ZQTA 1ZK6A 3WD4A 3RMEA 2MLXA 4QT3A 5HT1A 4QZVB 4DRQA 4W9QA 1ZBVA 5GPGA 1F8AB 1EDQA 2DG9A 1Q6HA 3ARQA 2F2DA 2ZR6A 2RSEA 1WAWA 1FKBA 3CH9A 5HUAA 4ODLA 3KAGA 1EQ3A 4ODNA 1YATA 2OLHA 1LL6A 2PV2A 3NRKA 4TW7A 4WJXA 4W5UA 1E6PA 3KAHA 2UZ5A 1WB0A 5HBFA 5GPRA 2F4EA 1JNSA 4WIWA 1BKFA 1UR9A 3AS2A 4LGXA 3FAPA 3EY6A 4MTVA 4WKAA 3O5EA 4XAKA 2RUCA 2AWGA 3UI6A 1Q1CA 3H9RB 3B9DA 3FXYA 4W9PA 2PPPA 2ZR5A 3WQVA 2DT0A 3WD1A 1NWUA 1OGBA 2A3EA 3CHEA 3CZ8A 3TC5A 3B9EA 4DRPA 2DPEA 1HJWA 1W1TA 2RUDA 3RGCA 1XRVA 4MNKA 1W1YA 1HKIA 2XPBA 1R9HA 4IT6A 4G2PA 4J4OA 3G6MA 1L1PA 4LAYA 4O2TA 4DRNA 1W9VA 1W1VA 1X6NA 1Q6IA 1Q6UA 1HKMA 3ALFA 2MNTA 3ARXA 3IKGA 3G6LA 3WD0A 4C02B 4S3KA 1A7XA 1JNEA 1CTNA 3O5DA 3B9AA 4MAVA 3GPKA 4GGQA 4Z2KA 3RM9A 1M5YA 1TCOC 1T11A 2WLZA 1LJYA 4U84A 5HKGA 3IKDA 3JXVA 1J4IA 3IK8A 3O5IA 5DF0A 3ARRA 4DWSC 1FKSA 3TDBA 4ODOA 3BXWA 4IT4A 1LG2A 2XPAA 1FD9A 1LQ0A 1HXVA 2PPNA 2ESCA 2PBCA 1SYTA 1W9UA 1LG1A 2DSWA 2FKEA 4DRIA 4DRMA 1FFRA 1FKLA 2XP8A 2G8ZA 2KGJA 1ROTA 1TFVA 2XP5A 3ARVA 3KZ7A 1FKTA 4Z2JA 3AROA 2RURA 3B7XA 2N87A 4HBEA 4NNRA 3UQBA 1GUVA 3KACA 3I6CA 3ARWA 1E6NA 2PI6A 3MDYB 1KFWA 3CGMA 4WKFA 3O5GA 1NWSA 3OA5A 4N19A 3LUOA 2FAPA 4JFJA 1HJXA 4DWSD 3CHDA 1ZB5A 1OGGA 4DRJA 1JNTA 3KABA 2XP3A 4TW8A 2D9FA 4PTMA 4FN2A 3O5MA 1P5QA 2LKNA 4U85A 3WKZA 2FDMA 2K8IA 2MLYA 2IF4A 3O5FA 4MPKA 3ARYA 1J4HA 1JVWA 4KR0B 4DZ3A 2XP9A 3O5LA 1KT0A 4TYOA 1ROUA 4P8WA 1D7JA 2YBTA 4ODRA 3O5JA 4MNLA 1LL7A 1NH6A 4Z2HA 2MLZA 1NWRA 2XP7A 4HBOA 5HW8A 2XP6A 5HW6A 4JYSA 3O5OA 5I98A 3PRBA 1UR8A 1W1PA 1HKJA 1QPFA 3JYJA 1FKJA 1PINA 1JNDA 1XHGA 1O6IA 5DITA 3UI5A 2WLYA 2KO7A 3CGNA 2M2AA 3RM8A 2Q5AA 5DEZA 1NSGA 1FKRA 3NI6A 4JFIA 4TX0A 4ODPA 5DIUA 3AS3A 1OWQA 4ODQA 2A3BA 3WH0A 3WL0A 4AY1A 1D6OA 2MF9A 4ITZA 2DSZA 1ZBCA 2LGOA 2ITKA 5B8IC 4ODKA 1FAPA 4MGVA 1D2KA 3W4RA 4MSPA 3PR9A 1X6LA 3WD3A 4Z2LA 1FKKA 3O5KA 1FKGA 1LL4A 2M1IA 3RFWA 2WM0A 1FKIA 4MNJA 1FJDA 3PA7A 1FFQA 5BXJA 4U86A 2LJ4A 4IQCA 1E6ZA 1ZBKA 1PBKA 2DG3A 4TNSA 1QZ2A 5HWCA 1YW5A 4JFMA 4DIPA 2DSUA 4ZPVR 3UQAA 1HKKA 4IPXA 1NMVA 4QT2A 2RUQA 2Y78A 1D7HA 4ZPWR 3UI4A 3UQIA 3QOKA 3WD2A 1J6YA 1U79A 1FKFA 4JFKA 4MNMA 4WK9A 1J4RA 2M08A 4DZ2A 2AOSA 2JZVA 4URIA 2WK2A 1E15A 3RM4A 4ML4A 1W26A 1EIBA 2DT2A 4QIBA 1GOIA 2A3CA 3VAWA 1SR0A 2KE0A 2L2SA 3JYMA 2ZR4A 1FKHA 2O9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKS A;  3TDB A;  4ODO A;  4J4N A;  1KT1 A;  1Y0O A;  2ZQT A;  1D7I A;  1ZK6 A;  4LAX A;  2XPA A;  5DIT A;  1FD9 A;  3UI5 A;  4DRH A;  1HXV A;  2MLX A;  4QT3 A;  2PPN A;  5HT1 A;  2KO7 A;  2PBC A;  4DRQ A;  1N1A A;  3CGN A;  2M2A A;  4W9Q A;  3KAF A;  3TCZ A;  4DRI A;  5GPG A;  2FKE A;  1F8A B;  2Q5A A;  4DRM A;  2DG9 A;  3ODK A;  4R0X A;  1FKL A;  1NSG A;  1Q6H A;  5HW7 A;  3NI6 A;  1FKR A;  2XP8 A;  4JFI A;  4TX0 A;  4ODP A;  5DIU A;  2F2D A;  2ZR6 A;  4FAP A;  2KGJ A;  2RSE A;  4ODQ A;  1ROT A;  2XP5 A;  3KZ7 A;  3WH0 A;  4LAW A;  1FKB A;  4TW6 A;  5HUA A;  4ODL A;  1FKT A;  3KAG A;  1EQ3 A;  4DT4 A;  3PRD A;  1D6O A;  2KR7 A;  2RUR A;  4ODN A;  1NMW A;  3B7X A;  3KCE A;  2MF9 A;  4ITZ A;  2XP4 A;  1YAT A;  3NRK A;  4TW7 A;  2PV2 A;  2N87 A;  2F21 A;  4GIV A;  4DRO A;  3KAH A;  4NNR A;  3UQB A;  1F40 A;  2LGO A;  2UZ5 A;  2ZQV A;  2ITK A;  2F4E A;  3NTP A;  1ZCN A;  1BL4 A;  5B8I C;  1JNS A;  1BKF A;  3IHZ A;  4ODK A;  1FAP A;  4MGV A;  3KAC A;  4MSP A;  3I6C A;  4ODM A;  3FAP A;  2RQS A;  2VCD A;  3EY6 A;  3O5P A;  3O5E A;  1C9H A;  3MDY B;  2RUC A;  1FKK A;  3O5K A;  1FKG A;  2AWG A;  5D75 A;  2M1I A;  3RFW A;  3UI6 A;  1FKI A;  1Q1C A;  3H9R B;  2VN1 A;  4JFL A;  5DIV A;  3CGM A;  3PA7 A;  1FJD A;  2PV3 A;  5BXJ A;  4DRK A;  3O5G A;  4U86 A;  2LJ4 A;  4W9P A;  4IQC A;  2PPP A;  2ZR5 A;  4N19 A;  5HTG A;  3LUO A;  1PBK A;  3UF8 A;  2DG3 A;  2FAP A;  4JFJ A;  4TNS A;  1QZ2 A;  3TC5 A;  5HWB A;  5HWC A;  2OFN A;  1YW5 A;  4JFM A;  4DIP A;  4DRP A;  3UQA A;  1QPL A;  2RUD A;  4DRJ A;  1JNT A;  3KAB A;  4IQ2 A;  3RGC A;  3KAI A;  4IPX A;  1NMV A;  2XP3 A;  4TW8 A;  2D9F A;  2XPB A;  4QT2 A;  4FN2 A;  3O5R A;  1B6C A;  1R9H A;  2RUQ A;  3O5M A;  2Y78 A;  4G2P A;  1P5Q A;  2LKN A;  4W9O A;  4U85 A;  1D7H A;  2K8I A;  2MLY A;  2IF4 A;  1EYM A;  2KI3 A;  2MPH A;  3O5Q A;  3O5F A;  3OOB A;  4J4O A;  4LAY A;  3UI4 A;  4O2T A;  1L1P A;  2PV1 A;  4DRN A;  3UQI A;  1J4H A;  1Q6I A;  1Q6U A;  1J6Y A;  1JVW A;  1U79 A;  2ZQS A;  2ZQU A;  4BF8 A;  4DZ3 A;  4LAV A;  2XP9 A;  1FKF A;  1KT0 A;  2MNT A;  3O5L A;  4JFK A;  2DG4 A;  1J4R A;  2KFW A;  2M08 A;  1ROU A;  2PPO A;  4TYO A;  3IKG A;  4C02 B;  4DZ2 A;  5J6E A;  1D7J A;  2JZV A;  1A7X A;  3O5D A;  4ODR A;  3O5J A;  3GPK A;  4GGQ A;  2MLZ A;  2XP7 A;  1M5Y A;  1TCO C;  5HW8 A;  1W26 A;  2XP6 A;  1T11 A;  4DH0 A;  1FKD A;  5HW6 A;  4JYS A;  4QIB A;  4U84 A;  3VAW A;  5HKG A;  2KE0 A;  4G50 A;  2L2S A;  3O5O A;  5I98 A;  2LPV A;  3IKD A;  3JXV A;  3JYM A;  3PRB A;  1J4I A;  3IK8 A;  2ZR4 A;  3O5I A;  1FKH A;  1QPF A;  3JYJ A;  1FKJ A;  1PIN A;  3KAD A; 
#chains in the Genus database with same CATH topology
 2O92 A;  4J4N A;  1ITX A;  1D7I A;  2IUZ A;  4LAX A;  3ARZ A;  4DRH A;  3ALG A;  1N1A A;  3WQW A;  5JH8 A;  1E9L A;  3KAF A;  1RD6 A;  3TCZ A;  1NWT A;  3ARU A;  3ODK A;  3AQU A;  4R0X A;  1H0G A;  1GPF A;  5HW7 A;  4KQZ A;  1K9T A;  4NSB A;  2EUL A;  4FAP A;  2DT3 A;  3FY1 A;  4LAW A;  4TW6 A;  2DT1 A;  4DT4 A;  3PRD A;  2KR7 A;  1NMW A;  3KCE A;  2XP4 A;  2A3A A;  4GIV A;  4DWS A;  2F21 A;  5GQB A;  4DRO A;  1F40 A;  4NZC A;  2ZQV A;  3NTP A;  1ZCN A;  1BL4 A;  3WL1 A;  3IHZ A;  2P4V A;  3AS0 A;  4Q22 A;  4Z2I A;  1E6R A;  3ART A;  4ODM A;  3ARP A;  2RQS A;  2VCD A;  2YBU A;  3O5P A;  1C9H A;  4Z2G A;  5D75 A;  4P8U A;  1ZBW A;  4JFL A;  2VN1 A;  5DIV A;  4ZS6 A;  1W9P A;  2PV3 A;  3B8S A;  3CHC A;  4DRK A;  3AS1 A;  5HTG A;  3UF8 A;  1VF8 A;  5HWB A;  2OFN A;  4ZPT R;  1QPL A;  1ZL1 A;  1H0I A;  4IQ2 A;  3KAI A;  3O5R A;  1B6C A;  4L3N A;  4W9O A;  3ARS A;  3OOB A;  1EYM A;  2KI3 A;  2MPH A;  3O5Q A;  1WNO A;  1IX5 A;  2PV1 A;  2ZQS A;  2ZQU A;  4P8X A;  4BF8 A;  4LAV A;  2DG4 A;  2KFW A;  1HJV A;  2PPO A;  4L72 B;  4R5E A;  4S3J A;  5J6E A;  4P8V A;  3PRA A;  4DH0 A;  1FKD A;  4Q7N A;  4WKH A;  1EHN A;  3WIJ A;  4G50 A;  2DSV A;  2LPV A;  4DWS B;  5DO2 A;  2G41 A;  2B31 A;  3CHF A;  2QF8 A;  1ZU8 A;  3KAD A;  4HAR A;  1KT1 A;  1Y0O A;  2ZQT A;  1ZK6 A;  3WD4 A;  3RME A;  2MLX A;  4QT3 A;  5HT1 A;  4QZV B;  4DRQ A;  4W9Q A;  1ZBV A;  5GPG A;  1F8A B;  1E44 A;  1EDQ A;  2DG9 A;  1Q6H A;  3ARQ A;  2F2D A;  2ZR6 A;  2RSE A;  1WAW A;  1FKB A;  3CH9 A;  5HUA A;  4ODL A;  3KAG A;  1EQ3 A;  4ODN A;  1YAT A;  2OLH A;  1LL6 A;  2PV2 A;  3NRK A;  4TW7 A;  4WJX A;  4W5U A;  1E6P A;  3KAH A;  2UZ5 A;  1WB0 A;  5HBF A;  5GPR A;  2F4E A;  1JNS A;  4WIW A;  1BKF A;  1UR9 A;  3AS2 A;  4LGX A;  3FAP A;  3EY6 A;  4MTV A;  4WKA A;  3O5E A;  4XAK A;  2RUC A;  1GRJ A;  2AWG A;  3UI6 A;  1Q1C A;  2ETN A;  3H9R B;  3B9D A;  3FXY A;  4W9P A;  2PPP A;  2ZR5 A;  3WQV A;  2DT0 A;  3WD1 A;  1NWU A;  1OGB A;  2A3E A;  3CHE A;  3CZ8 A;  3TC5 A;  3B9E A;  4DRP A;  2DPE A;  1HJW A;  1W1T A;  2RUD A;  3RGC A;  1XRV A;  4MNK A;  1W1Y A;  1HKI A;  2XPB A;  1R9H A;  4IT6 A;  4G2P A;  4J4O A;  3G6M A;  1L1P A;  4LAY A;  4O2T A;  4DRN A;  1W9V A;  1W1V A;  1X6N A;  1Q6I A;  1Q6U A;  1HKM A;  3ALF A;  2MNT A;  3ARX A;  3IKG A;  3G6L A;  3WD0 A;  4C02 B;  4S3K A;  3GU0 A;  1A7X A;  1JNE A;  1CTN A;  3O5D A;  3B9A A;  4MAV A;  3GPK A;  4GGQ A;  4Z2K A;  3RM9 A;  1M5Y A;  1TCO C;  1T11 A;  2WLZ A;  1LJY A;  4U84 A;  5HKG A;  3IKD A;  3JXV A;  1J4I A;  3IK8 A;  2PN0 A;  3O5I A;  5DF0 A;  3ARR A;  4DWS C;  1FKS A;  3TDB A;  4ODO A;  3BXW A;  4IT4 A;  1LG2 A;  2XPA A;  1FD9 A;  1LQ0 A;  1HXV A;  2PPN A;  2ESC A;  2PBC A;  1SYT A;  1W9U A;  1LG1 A;  2DSW A;  2FKE A;  4DRI A;  4DRM A;  1FFR A;  1FKL A;  2XP8 A;  2G8Z A;  2KGJ A;  1ROT A;  1TFV A;  2XP5 A;  3ARV A;  3KZ7 A;  1FKT A;  4Z2J A;  3ARO A;  2RUR A;  3B7X A;  2N87 A;  4HBE A;  4NNR A;  3UQB A;  1GUV A;  3KAC A;  3I6C A;  3ARW A;  1E6N A;  2PI6 A;  3MDY B;  1KFW A;  3CGM A;  3GTY X;  4WKF A;  3O5G A;  1NWS A;  3OA5 A;  4N19 A;  3LUO A;  2FAP A;  4JFJ A;  1HJX A;  4DWS D;  3CHD A;  1ZB5 A;  1OGG A;  4DRJ A;  1JNT A;  3KAB A;  2XP3 A;  4TW8 A;  2D9F A;  4PTM A;  4FN2 A;  3O5M A;  1P5Q A;  2LKN A;  4U85 A;  3WKZ A;  2FDM A;  2K8I A;  2MLY A;  2IF4 A;  3O5F A;  4MPK A;  3ARY A;  1J4H A;  1JVW A;  4KR0 B;  4DZ3 A;  2XP9 A;  3O5L A;  1KT0 A;  4TYO A;  1ROU A;  4P8W A;  1D7J A;  2YBT A;  4ODR A;  3O5J A;  4MNL A;  1LL7 A;  1NH6 A;  4Z2H A;  2MLZ A;  1NWR A;  2XP7 A;  4HBO A;  5HW8 A;  2XP6 A;  5HW6 A;  3EIP A;  4JYS A;  3BMB A;  3O5O A;  5I98 A;  3PRB A;  1UR8 A;  1W1P A;  1HKJ A;  1QPF A;  3JYJ A;  1FKJ A;  1PIN A;  1JND A;  1XHG A;  1O6I A;  5DIT A;  3UI5 A;  2WLY A;  2KO7 A;  3CGN A;  2M2A A;  3RM8 A;  2Q5A A;  5DEZ A;  1NSG A;  1FKR A;  3NI6 A;  4JFI A;  4TX0 A;  1JCH B;  4ODP A;  5DIU A;  3AS3 A;  1OWQ A;  4ODQ A;  2A3B A;  3WH0 A;  3WL0 A;  4AY1 A;  1D6O A;  2MF9 A;  4ITZ A;  2DSZ A;  1ZBC A;  2LGO A;  2ITK A;  5B8I C;  4ODK A;  2B5U B;  1FAP A;  4MGV A;  1D2K A;  3W4R A;  4MSP A;  3PR9 A;  1X6L A;  3WD3 A;  4Z2L A;  1FKK A;  3O5K A;  1FKG A;  1LL4 A;  2M1I A;  3RFW A;  2WM0 A;  1FKI A;  4MNJ A;  1FJD A;  3PA7 A;  1FFQ A;  5BXJ A;  4U86 A;  2LJ4 A;  4IQC A;  1E6Z A;  1ZBK A;  1PBK A;  2DG3 A;  4TNS A;  1QZ2 A;  5HWC A;  1YW5 A;  4JFM A;  4DIP A;  2DSU A;  4ZPV R;  3UQA A;  1HKK A;  2F23 A;  4IPX A;  1NMV A;  4QT2 A;  2RUQ A;  2Y78 A;  1D7H A;  4ZPW R;  3UI4 A;  3UQI A;  3QOK A;  3WD2 A;  1J6Y A;  1U79 A;  1FKF A;  4JFK A;  4MNM A;  4WK9 A;  1J4R A;  2M08 A;  4DZ2 A;  2AOS A;  2JZV A;  4URI A;  2WK2 A;  1E15 A;  3RM4 A;  4ML4 A;  1W26 A;  1EIB A;  2DT2 A;  4QIB A;  1GOI A;  2A3C A;  3VAW A;  1SR0 A;  2KE0 A;  2L2S A;  3JYM A;  2ZR4 A;  4UDM A;  1FKH A;  2O9O A; 
#chains in the Genus database with same CATH homology
 2O92 A;  4J4N A;  1ITX A;  1D7I A;  2IUZ A;  4LAX A;  3ARZ A;  4DRH A;  3ALG A;  1N1A A;  3WQW A;  5JH8 A;  1E9L A;  3KAF A;  1RD6 A;  3TCZ A;  1NWT A;  3ARU A;  3ODK A;  3AQU A;  4R0X A;  1H0G A;  1GPF A;  5HW7 A;  4KQZ A;  1K9T A;  4NSB A;  4FAP A;  2DT3 A;  3FY1 A;  4LAW A;  4TW6 A;  2DT1 A;  4DT4 A;  3PRD A;  2KR7 A;  1NMW A;  3KCE A;  2XP4 A;  2A3A A;  4GIV A;  4DWS A;  2F21 A;  5GQB A;  4DRO A;  1F40 A;  4NZC A;  2ZQV A;  3NTP A;  1ZCN A;  1BL4 A;  3WL1 A;  3IHZ A;  3AS0 A;  4Q22 A;  4Z2I A;  1E6R A;  3ART A;  4ODM A;  3ARP A;  2RQS A;  2VCD A;  2YBU A;  3O5P A;  1C9H A;  4Z2G A;  5D75 A;  4P8U A;  1ZBW A;  4JFL A;  2VN1 A;  5DIV A;  4ZS6 A;  1W9P A;  2PV3 A;  3B8S A;  3CHC A;  4DRK A;  3AS1 A;  5HTG A;  3UF8 A;  1VF8 A;  5HWB A;  2OFN A;  4ZPT R;  1QPL A;  1ZL1 A;  1H0I A;  4IQ2 A;  3KAI A;  3O5R A;  1B6C A;  4L3N A;  4W9O A;  3ARS A;  3OOB A;  1EYM A;  2KI3 A;  2MPH A;  3O5Q A;  1WNO A;  1IX5 A;  2PV1 A;  2ZQS A;  2ZQU A;  4P8X A;  4BF8 A;  4LAV A;  2DG4 A;  2KFW A;  1HJV A;  2PPO A;  4L72 B;  4R5E A;  4S3J A;  5J6E A;  4P8V A;  3PRA A;  4DH0 A;  1FKD A;  4Q7N A;  4WKH A;  1EHN A;  3WIJ A;  4G50 A;  2DSV A;  2LPV A;  4DWS B;  5DO2 A;  2G41 A;  2B31 A;  3CHF A;  2QF8 A;  1ZU8 A;  3KAD A;  4HAR A;  1KT1 A;  1Y0O A;  2ZQT A;  1ZK6 A;  3WD4 A;  3RME A;  2MLX A;  4QT3 A;  5HT1 A;  4QZV B;  4DRQ A;  4W9Q A;  1ZBV A;  5GPG A;  1F8A B;  1EDQ A;  2DG9 A;  1Q6H A;  3ARQ A;  2F2D A;  2ZR6 A;  2RSE A;  1WAW A;  1FKB A;  3CH9 A;  5HUA A;  4ODL A;  3KAG A;  1EQ3 A;  4ODN A;  1YAT A;  2OLH A;  1LL6 A;  2PV2 A;  3NRK A;  4TW7 A;  4WJX A;  4W5U A;  1E6P A;  3KAH A;  2UZ5 A;  1WB0 A;  5HBF A;  5GPR A;  2F4E A;  1JNS A;  4WIW A;  1BKF A;  1UR9 A;  3AS2 A;  4LGX A;  3FAP A;  3EY6 A;  4MTV A;  4WKA A;  3O5E A;  4XAK A;  2RUC A;  2AWG A;  3UI6 A;  1Q1C A;  3H9R B;  3B9D A;  3FXY A;  4W9P A;  2PPP A;  2ZR5 A;  3WQV A;  2DT0 A;  3WD1 A;  1NWU A;  1OGB A;  2A3E A;  3CHE A;  3CZ8 A;  3TC5 A;  3B9E A;  4DRP A;  2DPE A;  1HJW A;  1W1T A;  2RUD A;  3RGC A;  1XRV A;  4MNK A;  1W1Y A;  1HKI A;  2XPB A;  1R9H A;  4IT6 A;  4G2P A;  4J4O A;  3G6M A;  1L1P A;  4LAY A;  4O2T A;  4DRN A;  1W9V A;  1W1V A;  1X6N A;  1Q6I A;  1Q6U A;  1HKM A;  3ALF A;  2MNT A;  3ARX A;  3IKG A;  3G6L A;  3WD0 A;  4C02 B;  4S3K A;  1A7X A;  1JNE A;  1CTN A;  3O5D A;  3B9A A;  4MAV A;  3GPK A;  4GGQ A;  4Z2K A;  3RM9 A;  1M5Y A;  1TCO C;  1T11 A;  2WLZ A;  1LJY A;  4U84 A;  5HKG A;  3IKD A;  3JXV A;  1J4I A;  3IK8 A;  3O5I A;  5DF0 A;  3ARR A;  4DWS C;  1FKS A;  3TDB A;  4ODO A;  3BXW A;  4IT4 A;  1LG2 A;  2XPA A;  1FD9 A;  1LQ0 A;  1HXV A;  2PPN A;  2ESC A;  2PBC A;  1SYT A;  1W9U A;  1LG1 A;  2DSW A;  2FKE A;  4DRI A;  4DRM A;  1FFR A;  1FKL A;  2XP8 A;  2G8Z A;  2KGJ A;  1ROT A;  1TFV A;  2XP5 A;  3ARV A;  3KZ7 A;  1FKT A;  4Z2J A;  3ARO A;  2RUR A;  3B7X A;  2N87 A;  4HBE A;  4NNR A;  3UQB A;  1GUV A;  3KAC A;  3I6C A;  3ARW A;  1E6N A;  2PI6 A;  3MDY B;  1KFW A;  3CGM A;  4WKF A;  3O5G A;  1NWS A;  3OA5 A;  4N19 A;  3LUO A;  2FAP A;  4JFJ A;  1HJX A;  4DWS D;  3CHD A;  1ZB5 A;  1OGG A;  4DRJ A;  1JNT A;  3KAB A;  2XP3 A;  4TW8 A;  2D9F A;  4PTM A;  4FN2 A;  3O5M A;  1P5Q A;  2LKN A;  4U85 A;  3WKZ A;  2FDM A;  2K8I A;  2MLY A;  2IF4 A;  3O5F A;  4MPK A;  3ARY A;  1J4H A;  1JVW A;  4KR0 B;  4DZ3 A;  2XP9 A;  3O5L A;  1KT0 A;  4TYO A;  1ROU A;  4P8W A;  1D7J A;  2YBT A;  4ODR A;  3O5J A;  4MNL A;  1LL7 A;  1NH6 A;  4Z2H A;  2MLZ A;  1NWR A;  2XP7 A;  4HBO A;  5HW8 A;  2XP6 A;  5HW6 A;  4JYS A;  3O5O A;  5I98 A;  3PRB A;  1UR8 A;  1W1P A;  1HKJ A;  1QPF A;  3JYJ A;  1FKJ A;  1PIN A;  1JND A;  1XHG A;  1O6I A;  5DIT A;  3UI5 A;  2WLY A;  2KO7 A;  3CGN A;  2M2A A;  3RM8 A;  2Q5A A;  5DEZ A;  1NSG A;  1FKR A;  3NI6 A;  4JFI A;  4TX0 A;  4ODP A;  5DIU A;  3AS3 A;  1OWQ A;  4ODQ A;  2A3B A;  3WH0 A;  3WL0 A;  4AY1 A;  1D6O A;  2MF9 A;  4ITZ A;  2DSZ A;  1ZBC A;  2LGO A;  2ITK A;  5B8I C;  4ODK A;  1FAP A;  4MGV A;  1D2K A;  3W4R A;  4MSP A;  3PR9 A;  1X6L A;  3WD3 A;  4Z2L A;  1FKK A;  3O5K A;  1FKG A;  1LL4 A;  2M1I A;  3RFW A;  2WM0 A;  1FKI A;  4MNJ A;  1FJD A;  3PA7 A;  1FFQ A;  5BXJ A;  4U86 A;  2LJ4 A;  4IQC A;  1E6Z A;  1ZBK A;  1PBK A;  2DG3 A;  4TNS A;  1QZ2 A;  5HWC A;  1YW5 A;  4JFM A;  4DIP A;  2DSU A;  4ZPV R;  3UQA A;  1HKK A;  4IPX A;  1NMV A;  4QT2 A;  2RUQ A;  2Y78 A;  1D7H A;  4ZPW R;  3UI4 A;  3UQI A;  3QOK A;  3WD2 A;  1J6Y A;  1U79 A;  1FKF A;  4JFK A;  4MNM A;  4WK9 A;  1J4R A;  2M08 A;  4DZ2 A;  2AOS A;  2JZV A;  4URI A;  2WK2 A;  1E15 A;  3RM4 A;  4ML4 A;  1W26 A;  1EIB A;  2DT2 A;  4QIB A;  1GOI A;  2A3C A;  3VAW A;  1SR0 A;  2KE0 A;  2L2S A;  3JYM A;  2ZR4 A;  1FKH A;  2O9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...