1PBKA

Homologous domain of human fkbp25
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
116
structure length
116
Chain Sequence
PKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP25
publication title Structure of the human 25 kDa FK506 binding protein complexed with rapamycin.
pubmed rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 23
structure length 116
sequence length 116
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1pbkA00
4TW7A 1U79A 3RFWA 1N1AA 4TYOA 2Y78A 4QT2A 4ODKA 4J4NA 4W9PA 1FKBA 1PINA 1FKGA 3H9RB 3PA7A 3OOBA 4MGVA 1PBKA 1J6YA 3UQBA 1QPLA 3O5RA 4U84A 1NSGA 4DIPA 4TNSA 4ODQA 4QIBA 3UQIA 2XP8A 5HKGA 1JNSA 4DH0A 4O2TA 1ROUA 4ITZA 4TW8A 1FKHA 2PPPA 5D75A 2RUCA 5HT1A 4FAPA 4DZ3A 2KI3A 3O5FA 4DRIA 3JYMA 5B8IC 2RQSA 3KAIA 2RSEA 5DIUA 1FKKA 1QZ2A 3TDBA 1D7IA 2XP9A 4DRHA 2VN1A 1ZCNA 1KT1A 2MF9A 2Q5AA 1R9HA 4LAVA 2VCDA 1JNTA 2JZVA 3O5EA 5BXJA 2MLYA 4DT4A 3KAHA 4G2PA 1C9HA 4IQCA 4ODRA 4W9QA 1F40A 4DRQA 4TW6A 4FN2A 1FKJA 5HWBA 1W26A 2XP5A 4JFKA 4C02B 2ZQVA 3O5DA 4LAWA 3IKDA 3VAWA 2ZR5A 2ZQUA 4J4OA 3KZ7A 2XP4A 3O5MA 3UF8A 2DG9A 2MLZA 2ZR6A 1Q6UA 2ZQSA 3JXVA 2ZQTA 2ZR4A 2D9FA 2M08A 2PPOA 4DRMA 4JYSA 2PBCA 5HW7A 4W9OA 3O5LA 1D7JA 3UI6A 2AWGA 1D6OA 2M1IA 1NMVA 1Y0OA 3IHZA 3O5KA 4ODNA 4DRNA 1ROTA 1NMWA 2XP3A 3O5GA 1FAPA 1FKIA 1Q6IA 2PPNA 2MNTA 3LUOA 5HTGA 2LKNA 4DRPA 4LAYA 3B7XA 5HUAA 1KT0A 3FAPA 4IQ2A 1FKSA 5HWCA 1BL4A 2F4EA 3TC5A 4DRJA 3EY6A 3O5PA 1BKFA 3O5OA 3ODKA 5I98A 3WH0A 2OFNA 1TCOC 5DITA 2XP7A 1YW5A 4TX0A 1J4RA 3KABA 4MSPA 4DZ2A 2RUDA 4JFJA 4BF8A 1FD9A 4IPXA 3TCZA 1M5YA 3KCEA 1P5QA 2N87A 3RGCA 3KAFA 2RUQA 1FKRA 2KE0A 2KGJA 3UI4A 5J6EA 3O5IA 4JFLA 1FKDA 1QPFA 5DIVA 2RURA 2ITKA 1FJDA 4ODOA 4N19A 4ODLA 1F8AB 3UI5A 2K8IA 2L2SA 1T11A 2M2AA 2PV1A 2UZ5A 3GPKA 3KACA 4GGQA 2KO7A 1J4IA 1ZK6A 1JVWA 2MLXA 2XPAA 2XP6A 1FKLA 3NI6A 1D7HA 3KAGA 3IK8A 3I6CA 3NTPA 4GIVA 1YATA 4U86A 2MPHA 3CGNA 3PRDA 2LPVA 2LJ4A 4DRKA 5HW8A 1Q1CA 1B6CA 4JFIA 3UQAA 1J4HA 3MDYB 3PRBA 2FAPA 5HW6A 2XPBA 4ODPA 4U85A 2F2DA 2IF4A 2KFWA 3O5JA 2LGOA 4JFMA 1EYMA 2DG3A 3O5QA 3IKGA 4R0XA 4QT3A 4ODMA 2F21A 2PV2A 1A7XA 3JYJA 4LAXA 4NNRA 1EQ3A 1FKTA 2FKEA 1FKFA 5GPGA 3CGMA 3KADA 1HXVA 2DG4A 2KR7A 2PV3A 3NRKA 1Q6HA 4G50A 4DROA 1L1PA
chains in the Genus database with same CATH superfamily
4ZPTR 4TW7A 2DSUA 4TYOA 4ODKA 4J4NA 1FKBA 1PINA 1LL7A 2PN0A 3UQBA 4DIPA 4ODQA 3B9EA 1X6LA 5HKGA 1FFQA 4O2TA 4ITZA 1NH6A 1X6NA 3RMEA 1FKHA 5HT1A 2KI3A 4Z2GA 4DRIA 3JYMA 5DIUA 4WIWA 4S3JA 3TDBA 3AS0A 4DRHA 2VN1A 4ZPVR 4DWSB 4DWSD 1JNTA 1E15A 2JZVA 2MLYA 3AROA 3KAHA 4DRQA 2A3AA 3O5DA 2ZR5A 1OGGA 2DG9A 2ZQSA 2ZQTA 2PPOA 1WNOA 3W4RA 2PBCA 4W9OA 2M1IA 1D6OA 1NMVA 1Y0OA 3IHZA 3O5KA 3ALFA 2XP3A 3O5GA 1FKIA 2PPNA 3LUOA 2MNTA 4Z2KA 4ZS6A 3RM9A 3FAPA 5HWCA 3B9DA 4XAKA 4AY1A 4DRJA 4NSBA 1OWQA 1XHGA 3ODKA 3WH0A 2OFNA 1TCOC 3ARPA 1J4RA 4JFJA 4BF8A 4DWSC 1EHNA 3CHDA 5DF0A 3WL0A 4JFLA 4UDMA 5DIVA 2ITKA 4ODOA 4N19A 1T11A 3KACA 1GOIA 3GPKA 2KO7A 2XP6A 3WD2A 1D7HA 1LJYA 3I6CA 1YATA 3PRDA 4DRKA 4P8WA 2QF8A 4HARA 3WIJA 1Q1CA 2DT0A 1NWUA 5HW6A 2XPBA 3FY1A 3ARZA 4ODPA 4U85A 3CHCA 3WD4A 2KFWA 4L72B 1A7XA 4ML4A 4NNRA 1EQ3A 2ESCA 2DG4A 2KR7A 1E44A 1Q6HA 1RD6A 3ARRA 3RFWA 4PTMA 4WKHA 4Z2IA 1FKGA 2O92A 4MGVA 3WD0A 4Q22A 5GQBA 3ARSA 2A3BA 1W1YA 1GRJA 2XP8A 1JNSA 1ROUA 3ARVA 5D75A 2WLZA 3B8SA 1NWRA 2RSEA 1H0GA 1KFWA 1ZCNA 3GU0A 2MF9A 3B9AA 1H0IA 1W9VA 1ZU8A 1E6PA 4IQCA 4ODRA 2DPEA 1W26A 2XP5A 4QZVB 2ZQUA 2A3CA 3ARXA 2XP4A 2MLZA 3JXVA 2ZR4A 1LQ0A 5HW7A 1NWTA 1W1VA 2B31A 4WK9A 1GUVA 4DRNA 4R5EA 1NMWA 1FAPA 1HJWA 2LKNA 1GPFA 4LAYA 4DRPA 4Z2JA 1WB0A 1ITXA 1FKSA 2F4EA 3O5PA 1E6ZA 3O5OA 4HBEA 4MAVA 5I98A 1OGBA 2XP7A 4TX0A 4MSPA 2RUDA 2FDMA 3TCZA 1M5YA 1P5QA 1E9LA 3KAFA 1XRVA 1FKRA 5DEZA 2KE0A 3UI4A 5JH8A 5J6EA 1FKDA 5DO2A 4IT4A 1FJDA 4ODNA 4IPXA 1JVWA 1HKKA 4MNKA 1EDQA 3IK8A 2MPHA 1ZBKA 1LG2A 1LL4A 5HW8A 3UQAA 4MNJA 2B5UB 1J4HA 2FAPA 4JFMA 2IF4A 3O5JA 2LGOA 1EYMA 3CH9A 3AS1A 2F21A 1UR8A 2PV2A 3JYJA 4MNMA 3CHEA 1HXVA 2ETNA 2PV3A 3NRKA 2DT3A 2YBTA 4G50A 4DROA 1U79A 4KQZA 4W9PA 3H9RB 1J6YA 1PBKA 4U84A 1NSGA 3ARUA 4TNSA 4QIBA 2O9OA 3ARYA 3BMBA 3PRAA 4MNLA 4TW8A 4FAPA 4WKFA 3O5FA 2RQSA 1QZ2A 3AS3A 1D7IA 1R9HA 3O5EA 3OA5A 5BXJA 4DT4A 4G2PA 1F40A 1W9PA 3CHFA 4TW6A 1FKJA 1SYTA 4L3NA 2ZQVA 2AOSA 3O5MA 2ZR6A 1Q6UA 2M08A 4DRMA 1K9TA 2DT1A 4MPKA 3O5LA 2DT2A 3G6MA 3UI6A 2AWGA 1E6NA 1ROTA 1Q6IA 1TFVA 5HTGA 3G6LA 4IQ2A 3WKZA 1BL4A 3TC5A 3PR9A 2IUZA 1BKFA 5DITA 1YW5A 1NWSA 3AQUA 1ZL1A 4LGXA 3KCEA 4KR0B 2N87A 3RGCA 2A3EA 1QPFA 4Q7NA 2RURA 5GPRA 3UI5A 2K8IA 2L2SA 2UZ5A 1JCHB 1E6RA 2M2AA 3AS2A 4GGQA 4P8UA 1J4IA 2XPAA 3NI6A 2MLXA 4W9QA 2LJ4A 3FXYA 3RM8A 3WD1A 4QT2A 3O5QA 3IKGA 4QT3A 4ODMA 2DSZA 4IT6A 4LAXA 1FKTA 3WD3A 1FKFA 3CGMA 3KADA 3ALGA 1D2KA 4DWSA 1O6IA 3ARTA 4P8VA 1N1AA 2Y78A 2YBUA 4Z2HA 3PA7A 3OOBA 1JNEA 1QPLA 3O5RA 3CZ8A 4S3KA 3UQIA 2G41A 3EIPA 1FFRA 3BXWA 4DH0A 4Z2LA 4MTVA 2PPPA 2RUCA 4DZ3A 4URIA 2EULA 2WK2A 3KAIA 5B8IC 1FKKA 2XP9A 1KT1A 2Q5AA 4LAVA 2VCDA 1UR9A 1C9HA 4WKAA 4NZCA 4FN2A 5HWBA 1JNDA 4JFKA 4C02B 1VF8A 4LAWA 3IKDA 4WJXA 4J4OA 3KZ7A 2F23A 4ZPWR 1ZB5A 3UF8A 3QOKA 3WQVA 2D9FA 2OLHA 2PI6A 2P4VA 4JYSA 5HBFA 3WL1A 1D7JA 1EIBA 3GTYX 1IX5A 1ZBVA 3B7XA 5HUAA 1HKJA 1KT0A 1HKIA 1LL6A 1SR0A 3EY6A 2DSWA 3KABA 1W1PA 1FD9A 1HKMA 2RUQA 4HBOA 2KGJA 3O5IA 1CTNA 2WLYA 4ODLA 1F8AB 4DZ2A 1L1PA 1WAWA 2PV1A 1ZK6A 3ARWA 1FKLA 1W9UA 3KAGA 2G8ZA 3NTPA 1ZBCA 4GIVA 4U86A 3CGNA 2LPVA 1B6CA 4JFIA 3WQWA 3MDYB 3PRBA 2WM0A 2F2DA 3VAWA 2DG3A 2DSVA 1HJXA 4R0XA 1HJVA 2FKEA 5GPGA 4W5UA 1LG1A 4P8XA 3RM4A 3ARQA 1ZBWA 1W1TA
chains in the Genus database with same CATH topology
4ZPTR 4TW7A 2DSUA 4TYOA 4ODKA 4J4NA 1FKBA 1PINA 1LL7A 3UQBA 4DIPA 4ODQA 3B9EA 1X6LA 5HKGA 1FFQA 4O2TA 4ITZA 1NH6A 1X6NA 3RMEA 1FKHA 5HT1A 2KI3A 4Z2GA 4DRIA 3JYMA 5DIUA 4WIWA 4S3JA 3TDBA 3AS0A 4DRHA 2VN1A 4ZPVR 4DWSB 4DWSD 1JNTA 1E15A 2JZVA 2MLYA 3AROA 3KAHA 4DRQA 2A3AA 3O5DA 2ZR5A 1OGGA 2DG9A 2ZQSA 2ZQTA 2PPOA 1WNOA 3W4RA 2PBCA 4W9OA 2M1IA 1D6OA 1NMVA 1Y0OA 3IHZA 3O5KA 3ALFA 2XP3A 3O5GA 1FKIA 2PPNA 3LUOA 2MNTA 4Z2KA 4ZS6A 3RM9A 3FAPA 5HWCA 3B9DA 4XAKA 4AY1A 4DRJA 4NSBA 1OWQA 1XHGA 3ODKA 3WH0A 2OFNA 1TCOC 3ARPA 1J4RA 4JFJA 4BF8A 4DWSC 1EHNA 3CHDA 5DF0A 3WL0A 4JFLA 5DIVA 2ITKA 4ODOA 4N19A 1T11A 3KACA 1GOIA 3GPKA 2KO7A 2XP6A 3WD2A 1D7HA 1LJYA 3I6CA 1YATA 3PRDA 4DRKA 4P8WA 2QF8A 4HARA 3WIJA 1Q1CA 2DT0A 1NWUA 5HW6A 2XPBA 3FY1A 3ARZA 4ODPA 4U85A 3CHCA 3WD4A 2KFWA 4L72B 1A7XA 4ML4A 4NNRA 1EQ3A 2ESCA 2DG4A 2KR7A 1Q6HA 1RD6A 3ARRA 3RFWA 4PTMA 4WKHA 4Z2IA 1FKGA 2O92A 4MGVA 3WD0A 4Q22A 5GQBA 3ARSA 2A3BA 1W1YA 2XP8A 1JNSA 1ROUA 3ARVA 5D75A 2WLZA 3B8SA 1NWRA 2RSEA 1H0GA 1KFWA 1ZCNA 2MF9A 3B9AA 1H0IA 1W9VA 1ZU8A 1E6PA 4IQCA 4ODRA 2DPEA 1W26A 2XP5A 4QZVB 2ZQUA 2A3CA 3ARXA 2XP4A 2MLZA 3JXVA 2ZR4A 1LQ0A 5HW7A 1NWTA 1W1VA 2B31A 4WK9A 1GUVA 4DRNA 4R5EA 1NMWA 1FAPA 1HJWA 2LKNA 1GPFA 4LAYA 4DRPA 4Z2JA 1WB0A 1ITXA 1FKSA 2F4EA 3O5PA 1E6ZA 3O5OA 4HBEA 4MAVA 5I98A 1OGBA 2XP7A 4TX0A 4MSPA 2RUDA 2FDMA 3TCZA 1M5YA 1P5QA 1E9LA 3KAFA 1XRVA 1FKRA 5DEZA 2KE0A 3UI4A 5JH8A 5J6EA 1FKDA 5DO2A 4IT4A 1FJDA 4ODNA 4IPXA 1JVWA 1HKKA 4MNKA 1EDQA 3IK8A 2MPHA 1ZBKA 1LG2A 1LL4A 5HW8A 3UQAA 4MNJA 1J4HA 2FAPA 4JFMA 2IF4A 3O5JA 2LGOA 1EYMA 3CH9A 3AS1A 2F21A 1UR8A 2PV2A 3JYJA 4MNMA 3CHEA 1HXVA 2PV3A 3NRKA 2DT3A 2YBTA 4G50A 4DROA 1U79A 4KQZA 4W9PA 3H9RB 1J6YA 1PBKA 4U84A 1NSGA 3ARUA 4TNSA 4QIBA 2O9OA 3ARYA 3PRAA 4MNLA 4TW8A 4FAPA 4WKFA 3O5FA 2RQSA 1QZ2A 3AS3A 1D7IA 1R9HA 3O5EA 3OA5A 5BXJA 4DT4A 4G2PA 1F40A 1W9PA 3CHFA 4TW6A 1FKJA 1SYTA 4L3NA 2ZQVA 2AOSA 3O5MA 2ZR6A 1Q6UA 2M08A 4DRMA 1K9TA 2DT1A 4MPKA 3O5LA 2DT2A 3G6MA 3UI6A 2AWGA 1E6NA 1ROTA 1Q6IA 1TFVA 5HTGA 3G6LA 4IQ2A 3WKZA 1BL4A 3TC5A 3PR9A 2IUZA 1BKFA 5DITA 1YW5A 1NWSA 3AQUA 1ZL1A 4LGXA 3KCEA 4KR0B 2N87A 3RGCA 2A3EA 1QPFA 4Q7NA 2RURA 5GPRA 3UI5A 2K8IA 2L2SA 2UZ5A 2M2AA 1E6RA 3AS2A 4GGQA 4P8UA 4W9QA 1J4IA 2XPAA 3NI6A 2MLXA 2LJ4A 3FXYA 3RM8A 3WD1A 4QT2A 3O5QA 3IKGA 4QT3A 4ODMA 2DSZA 4IT6A 4LAXA 1FKTA 3WD3A 1FKFA 3CGMA 3KADA 3ALGA 1D2KA 4DWSA 1O6IA 3ARTA 4P8VA 1N1AA 2Y78A 2YBUA 4Z2HA 3PA7A 3OOBA 1JNEA 1QPLA 3O5RA 3CZ8A 4S3KA 3UQIA 2G41A 1FFRA 3BXWA 4DH0A 4Z2LA 4MTVA 2PPPA 2RUCA 4DZ3A 4URIA 2WK2A 5B8IC 3KAIA 1FKKA 2XP9A 1KT1A 2Q5AA 4LAVA 2VCDA 1UR9A 1C9HA 4WKAA 4NZCA 4FN2A 5HWBA 1JNDA 4JFKA 4C02B 1VF8A 4LAWA 3IKDA 4WJXA 4J4OA 3KZ7A 4ZPWR 1ZB5A 3UF8A 3QOKA 3WQVA 2D9FA 2OLHA 2PI6A 4JYSA 5HBFA 3WL1A 1D7JA 1EIBA 1IX5A 1ZBVA 3B7XA 5HUAA 1HKJA 1KT0A 1HKIA 1LL6A 1SR0A 3EY6A 2DSWA 3KABA 1W1PA 1FD9A 1HKMA 2RUQA 4HBOA 2KGJA 3O5IA 1CTNA 2WLYA 4ODLA 1F8AB 4DZ2A 1L1PA 1WAWA 2PV1A 1ZK6A 3ARWA 1FKLA 1W9UA 3KAGA 2G8ZA 3NTPA 1ZBCA 4GIVA 4U86A 3CGNA 2LPVA 1B6CA 4JFIA 3WQWA 3MDYB 3PRBA 2WM0A 2F2DA 3VAWA 2DG3A 2DSVA 1HJXA 4R0XA 1HJVA 2FKEA 5GPGA 4W5UA 1LG1A 4P8XA 3RM4A 3ARQA 1ZBWA 1W1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TW7 A;  1U79 A;  3RFW A;  1N1A A;  4TYO A;  2Y78 A;  4QT2 A;  4ODK A;  4J4N A;  4W9P A;  1FKB A;  1PIN A;  1FKG A;  3H9R B;  3PA7 A;  3OOB A;  4MGV A;  1PBK A;  1J6Y A;  3UQB A;  1QPL A;  3O5R A;  4U84 A;  1NSG A;  4DIP A;  4TNS A;  4ODQ A;  4QIB A;  3UQI A;  2XP8 A;  5HKG A;  1JNS A;  4DH0 A;  4O2T A;  1ROU A;  4ITZ A;  4TW8 A;  1FKH A;  2PPP A;  5D75 A;  2RUC A;  5HT1 A;  4FAP A;  4DZ3 A;  2KI3 A;  3O5F A;  4DRI A;  3JYM A;  5B8I C;  2RQS A;  3KAI A;  2RSE A;  5DIU A;  1FKK A;  1QZ2 A;  3TDB A;  1D7I A;  2XP9 A;  4DRH A;  2VN1 A;  1ZCN A;  1KT1 A;  2MF9 A;  2Q5A A;  1R9H A;  4LAV A;  2VCD A;  1JNT A;  2JZV A;  3O5E A;  5BXJ A;  2MLY A;  4DT4 A;  3KAH A;  4G2P A;  1C9H A;  4IQC A;  4ODR A;  4W9Q A;  1F40 A;  4DRQ A;  4TW6 A;  4FN2 A;  1FKJ A;  5HWB A;  1W26 A;  2XP5 A;  4JFK A;  4C02 B;  2ZQV A;  3O5D A;  4LAW A;  3IKD A;  3VAW A;  2ZR5 A;  2ZQU A;  4J4O A;  3KZ7 A;  2XP4 A;  3O5M A;  3UF8 A;  2DG9 A;  2MLZ A;  2ZR6 A;  1Q6U A;  2ZQS A;  3JXV A;  2ZQT A;  2ZR4 A;  2D9F A;  2M08 A;  2PPO A;  4DRM A;  4JYS A;  2PBC A;  5HW7 A;  4W9O A;  3O5L A;  1D7J A;  3UI6 A;  2AWG A;  1D6O A;  2M1I A;  1NMV A;  1Y0O A;  3IHZ A;  3O5K A;  4ODN A;  4DRN A;  1ROT A;  1NMW A;  2XP3 A;  3O5G A;  1FAP A;  1FKI A;  1Q6I A;  2PPN A;  2MNT A;  3LUO A;  5HTG A;  2LKN A;  4DRP A;  4LAY A;  3B7X A;  5HUA A;  1KT0 A;  3FAP A;  4IQ2 A;  1FKS A;  5HWC A;  1BL4 A;  2F4E A;  3TC5 A;  4DRJ A;  3EY6 A;  3O5P A;  1BKF A;  3O5O A;  3ODK A;  5I98 A;  3WH0 A;  2OFN A;  1TCO C;  5DIT A;  2XP7 A;  1YW5 A;  4TX0 A;  1J4R A;  3KAB A;  4MSP A;  4DZ2 A;  2RUD A;  4JFJ A;  4BF8 A;  1FD9 A;  4IPX A;  3TCZ A;  1M5Y A;  3KCE A;  1P5Q A;  2N87 A;  3RGC A;  3KAF A;  2RUQ A;  1FKR A;  2KE0 A;  2KGJ A;  3UI4 A;  5J6E A;  3O5I A;  4JFL A;  1FKD A;  1QPF A;  5DIV A;  2RUR A;  2ITK A;  1FJD A;  4ODO A;  4N19 A;  4ODL A;  1F8A B;  3UI5 A;  2K8I A;  2L2S A;  1T11 A;  2M2A A;  2PV1 A;  2UZ5 A;  3GPK A;  3KAC A;  4GGQ A;  2KO7 A;  1J4I A;  1ZK6 A;  1JVW A;  2MLX A;  2XPA A;  2XP6 A;  1FKL A;  3NI6 A;  1D7H A;  3KAG A;  3IK8 A;  3I6C A;  3NTP A;  4GIV A;  1YAT A;  4U86 A;  2MPH A;  3CGN A;  3PRD A;  2LPV A;  2LJ4 A;  4DRK A;  5HW8 A;  1Q1C A;  1B6C A;  4JFI A;  3UQA A;  1J4H A;  3MDY B;  3PRB A;  2FAP A;  5HW6 A;  2XPB A;  4ODP A;  4U85 A;  2F2D A;  2IF4 A;  2KFW A;  3O5J A;  2LGO A;  4JFM A;  1EYM A;  2DG3 A;  3O5Q A;  3IKG A;  4R0X A;  4QT3 A;  4ODM A;  2F21 A;  2PV2 A;  1A7X A;  3JYJ A;  4LAX A;  4NNR A;  1EQ3 A;  1FKT A;  2FKE A;  1FKF A;  5GPG A;  3CGM A;  3KAD A;  1HXV A;  2DG4 A;  2KR7 A;  2PV3 A;  3NRK A;  1Q6H A;  4G50 A;  4DRO A;  1L1P A; 
#chains in the Genus database with same CATH topology
 4ZPT R;  4TW7 A;  2DSU A;  4TYO A;  4ODK A;  4J4N A;  1FKB A;  1PIN A;  1LL7 A;  2PN0 A;  3UQB A;  4DIP A;  4ODQ A;  3B9E A;  1X6L A;  5HKG A;  1FFQ A;  4O2T A;  4ITZ A;  1NH6 A;  1X6N A;  3RME A;  1FKH A;  5HT1 A;  2KI3 A;  4Z2G A;  4DRI A;  3JYM A;  5DIU A;  4WIW A;  4S3J A;  3TDB A;  3AS0 A;  4DRH A;  2VN1 A;  4ZPV R;  4DWS B;  4DWS D;  1JNT A;  1E15 A;  2JZV A;  2MLY A;  3ARO A;  3KAH A;  4DRQ A;  2A3A A;  3O5D A;  2ZR5 A;  1OGG A;  2DG9 A;  2ZQS A;  2ZQT A;  2PPO A;  1WNO A;  3W4R A;  2PBC A;  4W9O A;  2M1I A;  1D6O A;  1NMV A;  1Y0O A;  3IHZ A;  3O5K A;  3ALF A;  2XP3 A;  3O5G A;  1FKI A;  2PPN A;  3LUO A;  2MNT A;  4Z2K A;  4ZS6 A;  3RM9 A;  3FAP A;  5HWC A;  3B9D A;  4XAK A;  4AY1 A;  4DRJ A;  4NSB A;  1OWQ A;  1XHG A;  3ODK A;  3WH0 A;  2OFN A;  1TCO C;  3ARP A;  1J4R A;  4JFJ A;  4BF8 A;  4DWS C;  1EHN A;  3CHD A;  5DF0 A;  3WL0 A;  4JFL A;  4UDM A;  5DIV A;  2ITK A;  4ODO A;  4N19 A;  1T11 A;  3KAC A;  1GOI A;  3GPK A;  2KO7 A;  2XP6 A;  3WD2 A;  1D7H A;  1LJY A;  3I6C A;  1YAT A;  3PRD A;  4DRK A;  4P8W A;  2QF8 A;  4HAR A;  3WIJ A;  1Q1C A;  2DT0 A;  1NWU A;  5HW6 A;  2XPB A;  3FY1 A;  3ARZ A;  4ODP A;  4U85 A;  3CHC A;  3WD4 A;  2KFW A;  4L72 B;  1A7X A;  4ML4 A;  4NNR A;  1EQ3 A;  2ESC A;  2DG4 A;  2KR7 A;  1E44 A;  1Q6H A;  1RD6 A;  3ARR A;  3RFW A;  4PTM A;  4WKH A;  4Z2I A;  1FKG A;  2O92 A;  4MGV A;  3WD0 A;  4Q22 A;  5GQB A;  3ARS A;  2A3B A;  1W1Y A;  1GRJ A;  2XP8 A;  1JNS A;  1ROU A;  3ARV A;  5D75 A;  2WLZ A;  3B8S A;  1NWR A;  2RSE A;  1H0G A;  1KFW A;  1ZCN A;  3GU0 A;  2MF9 A;  3B9A A;  1H0I A;  1W9V A;  1ZU8 A;  1E6P A;  4IQC A;  4ODR A;  2DPE A;  1W26 A;  2XP5 A;  4QZV B;  2ZQU A;  2A3C A;  3ARX A;  2XP4 A;  2MLZ A;  3JXV A;  2ZR4 A;  1LQ0 A;  5HW7 A;  1NWT A;  1W1V A;  2B31 A;  4WK9 A;  1GUV A;  4DRN A;  4R5E A;  1NMW A;  1FAP A;  1HJW A;  2LKN A;  1GPF A;  4LAY A;  4DRP A;  4Z2J A;  1WB0 A;  1ITX A;  1FKS A;  2F4E A;  3O5P A;  1E6Z A;  3O5O A;  4HBE A;  4MAV A;  5I98 A;  1OGB A;  2XP7 A;  4TX0 A;  4MSP A;  2RUD A;  2FDM A;  3TCZ A;  1M5Y A;  1P5Q A;  1E9L A;  3KAF A;  1XRV A;  1FKR A;  5DEZ A;  2KE0 A;  3UI4 A;  5JH8 A;  5J6E A;  1FKD A;  5DO2 A;  4IT4 A;  1FJD A;  4ODN A;  4IPX A;  1JVW A;  1HKK A;  4MNK A;  1EDQ A;  3IK8 A;  2MPH A;  1ZBK A;  1LG2 A;  1LL4 A;  5HW8 A;  3UQA A;  4MNJ A;  2B5U B;  1J4H A;  2FAP A;  4JFM A;  2IF4 A;  3O5J A;  2LGO A;  1EYM A;  3CH9 A;  3AS1 A;  2F21 A;  1UR8 A;  2PV2 A;  3JYJ A;  4MNM A;  3CHE A;  1HXV A;  2ETN A;  2PV3 A;  3NRK A;  2DT3 A;  2YBT A;  4G50 A;  4DRO A;  1U79 A;  4KQZ A;  4W9P A;  3H9R B;  1J6Y A;  1PBK A;  4U84 A;  1NSG A;  3ARU A;  4TNS A;  4QIB A;  2O9O A;  3ARY A;  3BMB A;  3PRA A;  4MNL A;  4TW8 A;  4FAP A;  4WKF A;  3O5F A;  2RQS A;  1QZ2 A;  3AS3 A;  1D7I A;  1R9H A;  3O5E A;  3OA5 A;  5BXJ A;  4DT4 A;  4G2P A;  1F40 A;  1W9P A;  3CHF A;  4TW6 A;  1FKJ A;  1SYT A;  4L3N A;  2ZQV A;  2AOS A;  3O5M A;  2ZR6 A;  1Q6U A;  2M08 A;  4DRM A;  1K9T A;  2DT1 A;  4MPK A;  3O5L A;  2DT2 A;  3G6M A;  3UI6 A;  2AWG A;  1E6N A;  1ROT A;  1Q6I A;  1TFV A;  5HTG A;  3G6L A;  4IQ2 A;  3WKZ A;  1BL4 A;  3TC5 A;  3PR9 A;  2IUZ A;  1BKF A;  5DIT A;  1YW5 A;  1NWS A;  3AQU A;  1ZL1 A;  4LGX A;  3KCE A;  4KR0 B;  2N87 A;  3RGC A;  2A3E A;  1QPF A;  4Q7N A;  2RUR A;  5GPR A;  3UI5 A;  2K8I A;  2L2S A;  2UZ5 A;  1JCH B;  1E6R A;  2M2A A;  3AS2 A;  4GGQ A;  4P8U A;  1J4I A;  2XPA A;  3NI6 A;  2MLX A;  4W9Q A;  2LJ4 A;  3FXY A;  3RM8 A;  3WD1 A;  4QT2 A;  3O5Q A;  3IKG A;  4QT3 A;  4ODM A;  2DSZ A;  4IT6 A;  4LAX A;  1FKT A;  3WD3 A;  1FKF A;  3CGM A;  3KAD A;  3ALG A;  1D2K A;  4DWS A;  1O6I A;  3ART A;  4P8V A;  1N1A A;  2Y78 A;  2YBU A;  4Z2H A;  3PA7 A;  3OOB A;  1JNE A;  1QPL A;  3O5R A;  3CZ8 A;  4S3K A;  3UQI A;  2G41 A;  3EIP A;  1FFR A;  3BXW A;  4DH0 A;  4Z2L A;  4MTV A;  2PPP A;  2RUC A;  4DZ3 A;  4URI A;  2EUL A;  2WK2 A;  3KAI A;  5B8I C;  1FKK A;  2XP9 A;  1KT1 A;  2Q5A A;  4LAV A;  2VCD A;  1UR9 A;  1C9H A;  4WKA A;  4NZC A;  4FN2 A;  5HWB A;  1JND A;  4JFK A;  4C02 B;  1VF8 A;  4LAW A;  3IKD A;  4WJX A;  4J4O A;  3KZ7 A;  2F23 A;  4ZPW R;  1ZB5 A;  3UF8 A;  3QOK A;  3WQV A;  2D9F A;  2OLH A;  2PI6 A;  2P4V A;  4JYS A;  5HBF A;  3WL1 A;  1D7J A;  1EIB A;  3GTY X;  1IX5 A;  1ZBV A;  3B7X A;  5HUA A;  1HKJ A;  1KT0 A;  1HKI A;  1LL6 A;  1SR0 A;  3EY6 A;  2DSW A;  3KAB A;  1W1P A;  1FD9 A;  1HKM A;  2RUQ A;  4HBO A;  2KGJ A;  3O5I A;  1CTN A;  2WLY A;  4ODL A;  1F8A B;  4DZ2 A;  1L1P A;  1WAW A;  2PV1 A;  1ZK6 A;  3ARW A;  1FKL A;  1W9U A;  3KAG A;  2G8Z A;  3NTP A;  1ZBC A;  4GIV A;  4U86 A;  3CGN A;  2LPV A;  1B6C A;  4JFI A;  3WQW A;  3MDY B;  3PRB A;  2WM0 A;  2F2D A;  3VAW A;  2DG3 A;  2DSV A;  1HJX A;  4R0X A;  1HJV A;  2FKE A;  5GPG A;  4W5U A;  1LG1 A;  4P8X A;  3RM4 A;  3ARQ A;  1ZBW A;  1W1T A; 
#chains in the Genus database with same CATH homology
 4ZPT R;  4TW7 A;  2DSU A;  4TYO A;  4ODK A;  4J4N A;  1FKB A;  1PIN A;  1LL7 A;  3UQB A;  4DIP A;  4ODQ A;  3B9E A;  1X6L A;  5HKG A;  1FFQ A;  4O2T A;  4ITZ A;  1NH6 A;  1X6N A;  3RME A;  1FKH A;  5HT1 A;  2KI3 A;  4Z2G A;  4DRI A;  3JYM A;  5DIU A;  4WIW A;  4S3J A;  3TDB A;  3AS0 A;  4DRH A;  2VN1 A;  4ZPV R;  4DWS B;  4DWS D;  1JNT A;  1E15 A;  2JZV A;  2MLY A;  3ARO A;  3KAH A;  4DRQ A;  2A3A A;  3O5D A;  2ZR5 A;  1OGG A;  2DG9 A;  2ZQS A;  2ZQT A;  2PPO A;  1WNO A;  3W4R A;  2PBC A;  4W9O A;  2M1I A;  1D6O A;  1NMV A;  1Y0O A;  3IHZ A;  3O5K A;  3ALF A;  2XP3 A;  3O5G A;  1FKI A;  2PPN A;  3LUO A;  2MNT A;  4Z2K A;  4ZS6 A;  3RM9 A;  3FAP A;  5HWC A;  3B9D A;  4XAK A;  4AY1 A;  4DRJ A;  4NSB A;  1OWQ A;  1XHG A;  3ODK A;  3WH0 A;  2OFN A;  1TCO C;  3ARP A;  1J4R A;  4JFJ A;  4BF8 A;  4DWS C;  1EHN A;  3CHD A;  5DF0 A;  3WL0 A;  4JFL A;  5DIV A;  2ITK A;  4ODO A;  4N19 A;  1T11 A;  3KAC A;  1GOI A;  3GPK A;  2KO7 A;  2XP6 A;  3WD2 A;  1D7H A;  1LJY A;  3I6C A;  1YAT A;  3PRD A;  4DRK A;  4P8W A;  2QF8 A;  4HAR A;  3WIJ A;  1Q1C A;  2DT0 A;  1NWU A;  5HW6 A;  2XPB A;  3FY1 A;  3ARZ A;  4ODP A;  4U85 A;  3CHC A;  3WD4 A;  2KFW A;  4L72 B;  1A7X A;  4ML4 A;  4NNR A;  1EQ3 A;  2ESC A;  2DG4 A;  2KR7 A;  1Q6H A;  1RD6 A;  3ARR A;  3RFW A;  4PTM A;  4WKH A;  4Z2I A;  1FKG A;  2O92 A;  4MGV A;  3WD0 A;  4Q22 A;  5GQB A;  3ARS A;  2A3B A;  1W1Y A;  2XP8 A;  1JNS A;  1ROU A;  3ARV A;  5D75 A;  2WLZ A;  3B8S A;  1NWR A;  2RSE A;  1H0G A;  1KFW A;  1ZCN A;  2MF9 A;  3B9A A;  1H0I A;  1W9V A;  1ZU8 A;  1E6P A;  4IQC A;  4ODR A;  2DPE A;  1W26 A;  2XP5 A;  4QZV B;  2ZQU A;  2A3C A;  3ARX A;  2XP4 A;  2MLZ A;  3JXV A;  2ZR4 A;  1LQ0 A;  5HW7 A;  1NWT A;  1W1V A;  2B31 A;  4WK9 A;  1GUV A;  4DRN A;  4R5E A;  1NMW A;  1FAP A;  1HJW A;  2LKN A;  1GPF A;  4LAY A;  4DRP A;  4Z2J A;  1WB0 A;  1ITX A;  1FKS A;  2F4E A;  3O5P A;  1E6Z A;  3O5O A;  4HBE A;  4MAV A;  5I98 A;  1OGB A;  2XP7 A;  4TX0 A;  4MSP A;  2RUD A;  2FDM A;  3TCZ A;  1M5Y A;  1P5Q A;  1E9L A;  3KAF A;  1XRV A;  1FKR A;  5DEZ A;  2KE0 A;  3UI4 A;  5JH8 A;  5J6E A;  1FKD A;  5DO2 A;  4IT4 A;  1FJD A;  4ODN A;  4IPX A;  1JVW A;  1HKK A;  4MNK A;  1EDQ A;  3IK8 A;  2MPH A;  1ZBK A;  1LG2 A;  1LL4 A;  5HW8 A;  3UQA A;  4MNJ A;  1J4H A;  2FAP A;  4JFM A;  2IF4 A;  3O5J A;  2LGO A;  1EYM A;  3CH9 A;  3AS1 A;  2F21 A;  1UR8 A;  2PV2 A;  3JYJ A;  4MNM A;  3CHE A;  1HXV A;  2PV3 A;  3NRK A;  2DT3 A;  2YBT A;  4G50 A;  4DRO A;  1U79 A;  4KQZ A;  4W9P A;  3H9R B;  1J6Y A;  1PBK A;  4U84 A;  1NSG A;  3ARU A;  4TNS A;  4QIB A;  2O9O A;  3ARY A;  3PRA A;  4MNL A;  4TW8 A;  4FAP A;  4WKF A;  3O5F A;  2RQS A;  1QZ2 A;  3AS3 A;  1D7I A;  1R9H A;  3O5E A;  3OA5 A;  5BXJ A;  4DT4 A;  4G2P A;  1F40 A;  1W9P A;  3CHF A;  4TW6 A;  1FKJ A;  1SYT A;  4L3N A;  2ZQV A;  2AOS A;  3O5M A;  2ZR6 A;  1Q6U A;  2M08 A;  4DRM A;  1K9T A;  2DT1 A;  4MPK A;  3O5L A;  2DT2 A;  3G6M A;  3UI6 A;  2AWG A;  1E6N A;  1ROT A;  1Q6I A;  1TFV A;  5HTG A;  3G6L A;  4IQ2 A;  3WKZ A;  1BL4 A;  3TC5 A;  3PR9 A;  2IUZ A;  1BKF A;  5DIT A;  1YW5 A;  1NWS A;  3AQU A;  1ZL1 A;  4LGX A;  3KCE A;  4KR0 B;  2N87 A;  3RGC A;  2A3E A;  1QPF A;  4Q7N A;  2RUR A;  5GPR A;  3UI5 A;  2K8I A;  2L2S A;  2UZ5 A;  2M2A A;  1E6R A;  3AS2 A;  4GGQ A;  4P8U A;  4W9Q A;  1J4I A;  2XPA A;  3NI6 A;  2MLX A;  2LJ4 A;  3FXY A;  3RM8 A;  3WD1 A;  4QT2 A;  3O5Q A;  3IKG A;  4QT3 A;  4ODM A;  2DSZ A;  4IT6 A;  4LAX A;  1FKT A;  3WD3 A;  1FKF A;  3CGM A;  3KAD A;  3ALG A;  1D2K A;  4DWS A;  1O6I A;  3ART A;  4P8V A;  1N1A A;  2Y78 A;  2YBU A;  4Z2H A;  3PA7 A;  3OOB A;  1JNE A;  1QPL A;  3O5R A;  3CZ8 A;  4S3K A;  3UQI A;  2G41 A;  1FFR A;  3BXW A;  4DH0 A;  4Z2L A;  4MTV A;  2PPP A;  2RUC A;  4DZ3 A;  4URI A;  2WK2 A;  5B8I C;  3KAI A;  1FKK A;  2XP9 A;  1KT1 A;  2Q5A A;  4LAV A;  2VCD A;  1UR9 A;  1C9H A;  4WKA A;  4NZC A;  4FN2 A;  5HWB A;  1JND A;  4JFK A;  4C02 B;  1VF8 A;  4LAW A;  3IKD A;  4WJX A;  4J4O A;  3KZ7 A;  4ZPW R;  1ZB5 A;  3UF8 A;  3QOK A;  3WQV A;  2D9F A;  2OLH A;  2PI6 A;  4JYS A;  5HBF A;  3WL1 A;  1D7J A;  1EIB A;  1IX5 A;  1ZBV A;  3B7X A;  5HUA A;  1HKJ A;  1KT0 A;  1HKI A;  1LL6 A;  1SR0 A;  3EY6 A;  2DSW A;  3KAB A;  1W1P A;  1FD9 A;  1HKM A;  2RUQ A;  4HBO A;  2KGJ A;  3O5I A;  1CTN A;  2WLY A;  4ODL A;  1F8A B;  4DZ2 A;  1L1P A;  1WAW A;  2PV1 A;  1ZK6 A;  3ARW A;  1FKL A;  1W9U A;  3KAG A;  2G8Z A;  3NTP A;  1ZBC A;  4GIV A;  4U86 A;  3CGN A;  2LPV A;  1B6C A;  4JFI A;  3WQW A;  3MDY B;  3PRB A;  2WM0 A;  2F2D A;  3VAW A;  2DG3 A;  2DSV A;  1HJX A;  4R0X A;  1HJV A;  2FKE A;  5GPG A;  4W5U A;  1LG1 A;  4P8X A;  3RM4 A;  3ARQ A;  1ZBW A;  1W1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...