1PBKA

Homologous domain of human fkbp25
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
116
structure length
116
Chain Sequence
PKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human 25 kDa FK506 binding protein complexed with rapamycin.
pubmed rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FKBP25
total genus 23
structure length 116
sequence length 116
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1pbkA00
1FKBA 1F8AB 3O5IA 4BF8A 2PV2A 2MLXA 4QT2A 4QIBA 3ODKA 1ZCNA 4IQ2A 3UF8A 5HW6A 3B7XA 4ODNA 3UI5A 4TW6A 4TYOA 2ITKA 1Q6IA 4DRKA 4DRHA 5B8IC 2XP7A 4U84A 1FKGA 2L2SA 3JYJA 2KO7A 4ODQA 5BXJA 2PPNA 3KAGA 1YW5A 5HTGA 4DRJA 2KE0A 3KZ7A 2MPHA 2ZR6A 1Q6HA 4QT3A 4ODKA 1PBKA 2RUQA 2MLYA 2RSEA 2ZQTA 2ZQUA 3O5MA 2ZR4A 4TNSA 1J4HA 1D6OA 2XP8A 2KI3A 1QZ2A 3NRKA 2IF4A 2DG9A 4LAYA 1A7XA 3UQAA 1P5QA 3KACA 3RGCA 1Q6UA 4DRQA 3UQBA 3WH0A 4G50A 4NNRA 3O5OA 3KAIA 2LGOA 1TCOC 2MF9A 1FKIA 2XP6A 3O5FA 2JZVA 3O5KA 2FAPA 3I6CA 4TW8A 1FKLA 1J4IA 2M08A 3FAPA 2XP9A 5GPGA 1QPFA 1FKRA 4J4NA 4W9OA 1KT0A 1QPLA 2XP3A 3KABA 3KAHA 2PBCA 2K8IA 3PRDA 4FN2A 1D7IA 3OOBA 5I98A 3O5RA 3H9RB 1D7JA 2RUCA 1FKHA 4O2TA 2F2DA 5HWCA 3MDYB 1PINA 2LPVA 2PPPA 4R0XA 4IPXA 2KR7A 4JFIA 4JFMA 4LAWA 4DRNA 2RURA 3CGNA 2MNTA 1JVWA 2PV1A 3JXVA 4N19A 4U85A 5HT1A 4GIVA 1FKFA 2N87A 1C9HA 3TDBA 2ZQSA 4MGVA 1J4RA 2XP4A 1D7HA 3PA7A 4G2PA 4LAVA 4GGQA 3O5EA 4JFKA 2XPAA 4DZ2A 1ROUA 1W26A 3LUOA 1KT1A 1NMWA 2DG4A 2LKNA 1F40A 4FAPA 2LJ4A 1L1PA 1FKJA 1NMVA 5HW7A 3VAWA 2D9FA 1EYMA 1T11A 1FKSA 3IKDA 2DG3A 3KCEA 5HUAA 5DIUA 4IQCA 1FKKA 1Y0OA 4JFJA 1FJDA 5HW8A 2FKEA 2UZ5A 3KAFA 3UI4A 2XPBA 3NTPA 4JYSA 4ODLA 3GPKA 4DRPA 2XP5A 5D75A 4DZ3A 4C02B 1J6YA 1HXVA 2KGJA 1NSGA 2PPOA 5HKGA 1YATA 2PV3A 4DRIA 2M2AA 2Q5AA 3IHZA 4JFLA 1FAPA 5DIVA 3O5GA 1ZK6A 3KADA 3IK8A 3O5QA 4TW7A 4LAXA 2OFNA 4DT4A 4DROA 1FD9A 1JNTA 3NI6A 2F21A 3O5DA 4W9QA 4DH0A 1Q1CA 3O5JA 4ODOA 4U86A 3IKGA 4J4OA 2MLZA 2RQSA 3UI6A 4DRMA 5HWBA 2VCDA 4ODRA 1U79A 4ITZA 3RFWA 1EQ3A 1FKDA 1BL4A 3TC5A 1R9HA 2F4EA 1ROTA 3JYMA 3PRBA 4TX0A 5DITA 2M1IA 4W9PA 3TCZA 3EY6A 3CGMA 5J6EA 3O5LA 1N1AA 3O5PA 2AWGA 4ODMA 2KFWA 1M5YA 2Y78A 3UQIA 1FKTA 4ODPA 2VN1A 1BKFA 4MSPA 4DIPA 1JNSA 2RUDA 2ZR5A 2ZQVA 1B6CA
chains in the Genus database with same CATH superfamily
3O5IA 2O92A 2P4VA 3AS3A 4ODNA 3UI5A 1ZBVA 2ITKA 5DO2A 1H0GA 1IX5A 4QZVB 3KAGA 1UR8A 2WM0A 2MPHA 3CZ8A 1Q6HA 2RUQA 1J4HA 1D6OA 3OA5A 2DT0A 1QZ2A 3NRKA 3WD2A 1A7XA 3UQAA 4DRQA 3WH0A 4G50A 4ML4A 1TCOC 1WB0A 1FKIA 2DPEA 1FKLA 1J4IA 1QPLA 4IT6A 4ZPTR 3O5RA 5HWBA 2LPVA 2PPPA 4R0XA 4JFMA 4DRNA 1JNEA 4WKFA 3CGNA 3G6LA 4U85A 2O9OA 1J4RA 2DT2A 3PA7A 4G2PA 4LAVA 4MNMA 2WK2A 3B9AA 1H0IA 1ROUA 3ARRA 3CHFA 3W4RA 2FDMA 2DG4A 1CTNA 1TFVA 1F40A 1FKJA 3CHCA 5HW7A 1EYMA 4MPKA 3ARUA 3WL1A 1Y0OA 3ARTA 2UZ5A 1NWUA 1GOIA 2DSWA 2F23A 5HKGA 2PPOA 2Q5AA 3IHZA 4JFLA 1FAPA 5DIVA 1VF8A 3CH9A 3O5QA 3IK8A 4Z2IA 1X6LA 1JNTA 3NI6A 3O5DA 4W9QA 3RMEA 3RM9A 2MLZA 2RQSA 1E44A 2VCDA 4IT4A 4URIA 1E6NA 3TC5A 1W9UA 4P8XA 4AY1A 3EY6A 5J6EA 1E6PA 1GUVA 2AWGA 1JNSA 1HXVA 3PRAA 3ARQA 1EDQA 1WAWA 1FFQA 3B9DA 4QT2A 4WIWA 3ARVA 4IQ2A 5HW6A 1LJYA 1WNOA 3B7XA 1E9LA 1LL7A 1Q6IA 4WKHA 4DRKA 2QF8A 1FKGA 3JYJA 2KO7A 4Q7NA 2B5UB 4ODQA 1NWSA 4DRJA 1W9PA 3KZ7A 4HARA 3AS0A 2ZR4A 4TNSA 3UQBA 1GRJA 4NNRA 2AOSA 3O5FA 4DWSC 3GU0A 3ARXA 4ZS6A 1EHNA 4DWSB 3FAPA 4Z2GA 5GPGA 4XAKA 3AQUA 1FKRA 4J4NA 1GPFA 3WD1A 3KAHA 3PR9A 2B31A 4FN2A 1HJXA 2RUCA 1FKHA 3ALGA 5HBFA 3MDYB 4L3NA 4IPXA 4DWSD 1W1YA 2MNTA 3JXVA 4GIVA 1HJVA 1FKFA 1SR0A 1C9HA 3TDBA 2XP4A 4S3JA 3LUOA 1L1PA 2LJ4A 3VAWA 4P8WA 2D9FA 1T11A 1FKSA 4P8UA 3IKDA 2DG3A 5HUAA 5DIUA 4MTVA 4JFJA 2A3CA 3KAFA 4ZPVR 3QOKA 1RD6A 4MNLA 4UDMA 4DZ3A 1J6YA 2KGJA 1SYTA 3ARWA 2M2AA 4DRIA 4WK9A 4WJXA 4HBEA 2F21A 1Q1CA 1O6IA 3IKGA 2DSUA 4Z2HA 4DRMA 3RFWA 1EQ3A 1BL4A 3CHDA 5DITA 1ZBKA 2ETNA 2M1IA 4Q22A 4ODMA 2KFWA 2A3EA 3WD3A 2Y78A 1FKTA 4ODPA 2VN1A 1BKFA 4MSPA 2RUDA 2ZR5A 2ZQVA 2DT1A 5GPRA 1NWRA 1FFRA 2PV2A 2YBTA 3AS2A 2ESCA 4TW6A 4P8VA 3WD0A 4LGXA 1LG1A 4U84A 2L2SA 2DSVA 2PPNA 3ARPA 3ARYA 2KE0A 1W1TA 4QT3A 2ZQTA 1XRVA 2XP8A 2KI3A 4LAYA 1OWQA 3FXYA 3KAIA 2FAPA 3I6CA 1HKMA 2M08A 4Z2JA 2XP9A 5JH8A 1ZU8A 4W9OA 1KT0A 2PBCA 4KR0B 1D7IA 1W1VA 3OOBA 5I98A 2YBUA 1D7JA 4O2TA 4L72B 5HWCA 2DT3A 1PINA 1HKIA 2KR7A 4LAWA 1JVWA 4N19A 5HT1A 2ZQSA 4MAVA 1D7HA 2A3BA 3O5EA 4GGQA 4JFKA 1NMWA 3RM4A 1NMVA 2G41A 4IQCA 1X6NA 1KFWA 3UI4A 3AS1A 2XPBA 4ODLA 4DRPA 2XP5A 1B6CA 1LQ0A 1NSGA 1YATA 5DF0A 3O5GA 1ZB5A 1ZK6A 3KADA 3WQWA 1LL4A 4LAXA 2OFNA 1FD9A 4DH0A 4ODOA 4MNJA 4WKAA 3UI6A 4HBOA 5GQBA 1FKDA 1K9TA 3PRBA 4NZCA 4W9PA 3CGMA 3O5LA 1N1AA 3O5PA 1NH6A 1E6ZA 3UQIA 4DIPA 1FKBA 1F8AB 2PI6A 4BF8A 1LL6A 1OGBA 1ZL1A 2MLXA 4NSBA 4PTMA 4QIBA 3ODKA 2G8ZA 1ZCNA 3UF8A 4Z2LA 1NWTA 4TYOA 4R5EA 4DRHA 5B8IC 2XP7A 1E15A 3GTYX 1HJWA 3WL0A 5BXJA 3BXWA 4S3KA 1YW5A 5HTGA 1UR9A 4ODKA 1PBKA 2ZQUA 2MLYA 2RSEA 3O5MA 2WLZA 2DG9A 2IF4A 2WLYA 3B9EA 1P5QA 1ZBWA 3KACA 1Q6UA 3RGCA 3EIPA 3O5OA 2LGOA 2MF9A 2DSZA 2XP6A 1E6RA 2JZVA 3O5KA 2A3AA 3WQVA 2EULA 4TW8A 1HKJA 1QPFA 2XP3A 3KABA 2K8IA 3PRDA 3WD4A 2OLHA 1EIBA 3H9RB 2F2DA 3ARSA 3ALFA 3CHEA 4JFIA 3FY1A 2RURA 5DEZA 1ZBCA 2PV1A 2N87A 4MGVA 3G6MA 3WIJA 2XPAA 4DZ2A 1W26A 1W9VA 1KT1A 2LKNA 4FAPA 2IUZA 1HKKA 3KCEA 1JCHB 1FKKA 1FJDA 5HW8A 2FKEA 4KQZA 3NTPA 4JYSA 3GPKA 5D75A 4C02B 4W5UA 2PV3A 3ARZA 4MNKA 4TW7A 1ITXA 1LG2A 4DT4A 3AROA 4DROA 1W1PA 4U86A 3O5JA 1XHGA 4J4OA 1OGGA 1D2KA 4ODRA 1U79A 4ITZA 4DWSA 3RM8A 1R9HA 2F4EA 1ROTA 3JYMA 4TX0A 2PN0A 3TCZA 3WKZA 4ZPWR 1JNDA 3B8SA 3BMBA 1M5YA 4Z2KA 2ZR6A
chains in the Genus database with same CATH topology
3O5IA 2O92A 3AS3A 4ODNA 3UI5A 1ZBVA 2ITKA 5DO2A 1H0GA 1IX5A 4QZVB 3KAGA 1UR8A 2WM0A 2MPHA 3CZ8A 1Q6HA 2RUQA 1J4HA 1D6OA 3OA5A 2DT0A 1QZ2A 3NRKA 3WD2A 1A7XA 3UQAA 4DRQA 3WH0A 4G50A 4ML4A 1TCOC 1WB0A 1FKIA 2DPEA 1FKLA 1J4IA 1QPLA 4IT6A 4ZPTR 3O5RA 5HWBA 2LPVA 2PPPA 4R0XA 4JFMA 4DRNA 1JNEA 4WKFA 3CGNA 3G6LA 4U85A 2O9OA 1J4RA 2DT2A 3PA7A 4G2PA 4LAVA 4MNMA 2WK2A 3B9AA 1H0IA 1ROUA 3ARRA 3CHFA 3W4RA 2FDMA 2DG4A 1CTNA 1TFVA 1F40A 1FKJA 3CHCA 5HW7A 1EYMA 4MPKA 3ARUA 3WL1A 1Y0OA 3ARTA 2UZ5A 1NWUA 1GOIA 2DSWA 5HKGA 2PPOA 2Q5AA 3IHZA 4JFLA 1FAPA 5DIVA 1VF8A 3CH9A 3O5QA 3IK8A 4Z2IA 1X6LA 1JNTA 3NI6A 3O5DA 4W9QA 3RMEA 3RM9A 2MLZA 2RQSA 2VCDA 4IT4A 4URIA 1E6NA 3TC5A 1W9UA 4P8XA 4AY1A 3EY6A 5J6EA 1E6PA 1GUVA 2AWGA 1JNSA 1HXVA 3PRAA 3ARQA 1EDQA 1WAWA 1FFQA 3B9DA 4QT2A 4WIWA 3ARVA 4IQ2A 5HW6A 1LJYA 1WNOA 3B7XA 1E9LA 1LL7A 1Q6IA 4WKHA 4DRKA 2QF8A 1FKGA 3JYJA 2KO7A 4Q7NA 4ODQA 1NWSA 4DRJA 1W9PA 3KZ7A 4HARA 3AS0A 2ZR4A 4TNSA 3UQBA 4NNRA 2AOSA 3O5FA 4DWSC 3ARXA 4ZS6A 1EHNA 4DWSB 3FAPA 4Z2GA 5GPGA 4XAKA 3AQUA 1FKRA 4J4NA 1GPFA 3WD1A 3KAHA 3PR9A 2B31A 4FN2A 1HJXA 2RUCA 1FKHA 3ALGA 5HBFA 3MDYB 4L3NA 4IPXA 4DWSD 1W1YA 2MNTA 3JXVA 4GIVA 1HJVA 1FKFA 1SR0A 1C9HA 3TDBA 2XP4A 4S3JA 3LUOA 1L1PA 2LJ4A 3VAWA 4P8WA 2D9FA 1T11A 1FKSA 4P8UA 3IKDA 2DG3A 5HUAA 5DIUA 4MTVA 4JFJA 2A3CA 3KAFA 4ZPVR 3QOKA 1RD6A 4MNLA 4DZ3A 1J6YA 2KGJA 1SYTA 3ARWA 2M2AA 4DRIA 4WK9A 4WJXA 4HBEA 2F21A 1Q1CA 1O6IA 3IKGA 2DSUA 4Z2HA 4DRMA 3RFWA 1EQ3A 1BL4A 3CHDA 5DITA 1ZBKA 2M1IA 4Q22A 4ODMA 2KFWA 2A3EA 3WD3A 2Y78A 1FKTA 4ODPA 2VN1A 1BKFA 4MSPA 2RUDA 2ZR5A 2ZQVA 2DT1A 5GPRA 1NWRA 1FFRA 2PV2A 2YBTA 3AS2A 2ESCA 4TW6A 4P8VA 3WD0A 4LGXA 1LG1A 4U84A 2L2SA 2DSVA 2PPNA 3ARPA 3ARYA 2KE0A 1W1TA 4QT3A 2ZQTA 1XRVA 2XP8A 2KI3A 4LAYA 1OWQA 3FXYA 3KAIA 2FAPA 3I6CA 1HKMA 2M08A 4Z2JA 2XP9A 5JH8A 1ZU8A 4W9OA 1KT0A 2PBCA 4KR0B 1D7IA 1W1VA 3OOBA 5I98A 2YBUA 1D7JA 4O2TA 4L72B 5HWCA 2DT3A 1PINA 1HKIA 2KR7A 4LAWA 1JVWA 4N19A 5HT1A 2ZQSA 4MAVA 1D7HA 2A3BA 3O5EA 4GGQA 4JFKA 1NMWA 3RM4A 1NMVA 2G41A 4IQCA 1X6NA 1KFWA 3UI4A 3AS1A 2XPBA 4ODLA 4DRPA 2XP5A 1B6CA 1LQ0A 1NSGA 1YATA 5DF0A 3O5GA 1ZB5A 1ZK6A 3KADA 3WQWA 1LL4A 4LAXA 2OFNA 1FD9A 4DH0A 4ODOA 4MNJA 4WKAA 3UI6A 4HBOA 5GQBA 1FKDA 1K9TA 3PRBA 4NZCA 4W9PA 3CGMA 3O5LA 1N1AA 3O5PA 1NH6A 1E6ZA 3UQIA 4DIPA 1FKBA 1F8AB 2PI6A 4BF8A 1LL6A 1OGBA 1ZL1A 2MLXA 4NSBA 4PTMA 4QIBA 3ODKA 2G8ZA 1ZCNA 3UF8A 4Z2LA 1NWTA 4TYOA 4R5EA 4DRHA 5B8IC 2XP7A 1E15A 1HJWA 3WL0A 5BXJA 3BXWA 4S3KA 1YW5A 5HTGA 1UR9A 4ODKA 1PBKA 2ZQUA 2MLYA 2RSEA 3O5MA 2WLZA 2DG9A 2IF4A 2WLYA 3B9EA 1P5QA 1ZBWA 3KACA 1Q6UA 3RGCA 3O5OA 2LGOA 2MF9A 2DSZA 2XP6A 1E6RA 2JZVA 3O5KA 2A3AA 3WQVA 4TW8A 1HKJA 1QPFA 2XP3A 3KABA 2K8IA 3PRDA 3WD4A 2OLHA 1EIBA 3H9RB 2F2DA 3ARSA 3ALFA 3CHEA 4JFIA 3FY1A 2RURA 5DEZA 1ZBCA 2PV1A 2N87A 4MGVA 3G6MA 3WIJA 2XPAA 4DZ2A 1W26A 1W9VA 1KT1A 2LKNA 4FAPA 2IUZA 1HKKA 3KCEA 1FKKA 1FJDA 5HW8A 2FKEA 4KQZA 3NTPA 4JYSA 3GPKA 5D75A 4C02B 4W5UA 2PV3A 3ARZA 4MNKA 4TW7A 1ITXA 1LG2A 4DT4A 3AROA 4DROA 1W1PA 4U86A 3O5JA 1XHGA 4J4OA 1OGGA 1D2KA 4ODRA 1U79A 4ITZA 4DWSA 3RM8A 1R9HA 2F4EA 1ROTA 3JYMA 4TX0A 3TCZA 3WKZA 4ZPWR 1JNDA 3B8SA 1M5YA 4Z2KA 2ZR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKB A;  1F8A B;  3O5I A;  4BF8 A;  2PV2 A;  2MLX A;  4QT2 A;  4QIB A;  3ODK A;  1ZCN A;  4IQ2 A;  3UF8 A;  5HW6 A;  3B7X A;  4ODN A;  3UI5 A;  4TW6 A;  4TYO A;  2ITK A;  1Q6I A;  4DRK A;  4DRH A;  5B8I C;  2XP7 A;  4U84 A;  1FKG A;  2L2S A;  3JYJ A;  2KO7 A;  4ODQ A;  5BXJ A;  2PPN A;  3KAG A;  1YW5 A;  5HTG A;  4DRJ A;  2KE0 A;  3KZ7 A;  2MPH A;  2ZR6 A;  1Q6H A;  4QT3 A;  4ODK A;  1PBK A;  2RUQ A;  2MLY A;  2RSE A;  2ZQT A;  2ZQU A;  3O5M A;  2ZR4 A;  4TNS A;  1J4H A;  1D6O A;  2XP8 A;  2KI3 A;  1QZ2 A;  3NRK A;  2IF4 A;  2DG9 A;  4LAY A;  1A7X A;  3UQA A;  1P5Q A;  3KAC A;  3RGC A;  1Q6U A;  4DRQ A;  3UQB A;  3WH0 A;  4G50 A;  4NNR A;  3O5O A;  3KAI A;  2LGO A;  1TCO C;  2MF9 A;  1FKI A;  2XP6 A;  3O5F A;  2JZV A;  3O5K A;  2FAP A;  3I6C A;  4TW8 A;  1FKL A;  1J4I A;  2M08 A;  3FAP A;  2XP9 A;  5GPG A;  1QPF A;  1FKR A;  4J4N A;  4W9O A;  1KT0 A;  1QPL A;  2XP3 A;  3KAB A;  3KAH A;  2PBC A;  2K8I A;  3PRD A;  4FN2 A;  1D7I A;  3OOB A;  5I98 A;  3O5R A;  3H9R B;  1D7J A;  2RUC A;  1FKH A;  4O2T A;  2F2D A;  5HWC A;  3MDY B;  1PIN A;  2LPV A;  2PPP A;  4R0X A;  4IPX A;  2KR7 A;  4JFI A;  4JFM A;  4LAW A;  4DRN A;  2RUR A;  3CGN A;  2MNT A;  1JVW A;  2PV1 A;  3JXV A;  4N19 A;  4U85 A;  5HT1 A;  4GIV A;  1FKF A;  2N87 A;  1C9H A;  3TDB A;  2ZQS A;  4MGV A;  1J4R A;  2XP4 A;  1D7H A;  3PA7 A;  4G2P A;  4LAV A;  4GGQ A;  3O5E A;  4JFK A;  2XPA A;  4DZ2 A;  1ROU A;  1W26 A;  3LUO A;  1KT1 A;  1NMW A;  2DG4 A;  2LKN A;  1F40 A;  4FAP A;  2LJ4 A;  1L1P A;  1FKJ A;  1NMV A;  5HW7 A;  3VAW A;  2D9F A;  1EYM A;  1T11 A;  1FKS A;  3IKD A;  2DG3 A;  3KCE A;  5HUA A;  5DIU A;  4IQC A;  1FKK A;  1Y0O A;  4JFJ A;  1FJD A;  5HW8 A;  2FKE A;  2UZ5 A;  3KAF A;  3UI4 A;  2XPB A;  3NTP A;  4JYS A;  4ODL A;  3GPK A;  4DRP A;  2XP5 A;  5D75 A;  4DZ3 A;  4C02 B;  1J6Y A;  1HXV A;  2KGJ A;  1NSG A;  2PPO A;  5HKG A;  1YAT A;  2PV3 A;  4DRI A;  2M2A A;  2Q5A A;  3IHZ A;  4JFL A;  1FAP A;  5DIV A;  3O5G A;  1ZK6 A;  3KAD A;  3IK8 A;  3O5Q A;  4TW7 A;  4LAX A;  2OFN A;  4DT4 A;  4DRO A;  1FD9 A;  1JNT A;  3NI6 A;  2F21 A;  3O5D A;  4W9Q A;  4DH0 A;  1Q1C A;  3O5J A;  4ODO A;  4U86 A;  3IKG A;  4J4O A;  2MLZ A;  2RQS A;  3UI6 A;  4DRM A;  5HWB A;  2VCD A;  4ODR A;  1U79 A;  4ITZ A;  3RFW A;  1EQ3 A;  1FKD A;  1BL4 A;  3TC5 A;  1R9H A;  2F4E A;  1ROT A;  3JYM A;  3PRB A;  4TX0 A;  5DIT A;  2M1I A;  4W9P A;  3TCZ A;  3EY6 A;  3CGM A;  5J6E A;  3O5L A;  1N1A A;  3O5P A;  2AWG A;  4ODM A;  2KFW A;  1M5Y A;  2Y78 A;  3UQI A;  1FKT A;  4ODP A;  2VN1 A;  1BKF A;  4MSP A;  4DIP A;  1JNS A;  2RUD A;  2ZR5 A;  2ZQV A;  1B6C A; 
#chains in the Genus database with same CATH topology
 3O5I A;  2O92 A;  2P4V A;  3AS3 A;  4ODN A;  3UI5 A;  1ZBV A;  2ITK A;  5DO2 A;  1H0G A;  1IX5 A;  4QZV B;  3KAG A;  1UR8 A;  2WM0 A;  2MPH A;  3CZ8 A;  1Q6H A;  2RUQ A;  1J4H A;  1D6O A;  3OA5 A;  2DT0 A;  1QZ2 A;  3NRK A;  3WD2 A;  1A7X A;  3UQA A;  4DRQ A;  3WH0 A;  4G50 A;  4ML4 A;  1TCO C;  1WB0 A;  1FKI A;  2DPE A;  1FKL A;  1J4I A;  1QPL A;  4IT6 A;  4ZPT R;  3O5R A;  5HWB A;  2LPV A;  2PPP A;  4R0X A;  4JFM A;  4DRN A;  1JNE A;  4WKF A;  3CGN A;  3G6L A;  4U85 A;  2O9O A;  1J4R A;  2DT2 A;  3PA7 A;  4G2P A;  4LAV A;  4MNM A;  2WK2 A;  3B9A A;  1H0I A;  1ROU A;  3ARR A;  3CHF A;  3W4R A;  2FDM A;  2DG4 A;  1CTN A;  1TFV A;  1F40 A;  1FKJ A;  3CHC A;  5HW7 A;  1EYM A;  4MPK A;  3ARU A;  3WL1 A;  1Y0O A;  3ART A;  2UZ5 A;  1NWU A;  1GOI A;  2DSW A;  2F23 A;  5HKG A;  2PPO A;  2Q5A A;  3IHZ A;  4JFL A;  1FAP A;  5DIV A;  1VF8 A;  3CH9 A;  3O5Q A;  3IK8 A;  4Z2I A;  1X6L A;  1JNT A;  3NI6 A;  3O5D A;  4W9Q A;  3RME A;  3RM9 A;  2MLZ A;  2RQS A;  1E44 A;  2VCD A;  4IT4 A;  4URI A;  1E6N A;  3TC5 A;  1W9U A;  4P8X A;  4AY1 A;  3EY6 A;  5J6E A;  1E6P A;  1GUV A;  2AWG A;  1JNS A;  1HXV A;  3PRA A;  3ARQ A;  1EDQ A;  1WAW A;  1FFQ A;  3B9D A;  4QT2 A;  4WIW A;  3ARV A;  4IQ2 A;  5HW6 A;  1LJY A;  1WNO A;  3B7X A;  1E9L A;  1LL7 A;  1Q6I A;  4WKH A;  4DRK A;  2QF8 A;  1FKG A;  3JYJ A;  2KO7 A;  4Q7N A;  2B5U B;  4ODQ A;  1NWS A;  4DRJ A;  1W9P A;  3KZ7 A;  4HAR A;  3AS0 A;  2ZR4 A;  4TNS A;  3UQB A;  1GRJ A;  4NNR A;  2AOS A;  3O5F A;  4DWS C;  3GU0 A;  3ARX A;  4ZS6 A;  1EHN A;  4DWS B;  3FAP A;  4Z2G A;  5GPG A;  4XAK A;  3AQU A;  1FKR A;  4J4N A;  1GPF A;  3WD1 A;  3KAH A;  3PR9 A;  2B31 A;  4FN2 A;  1HJX A;  2RUC A;  1FKH A;  3ALG A;  5HBF A;  3MDY B;  4L3N A;  4IPX A;  4DWS D;  1W1Y A;  2MNT A;  3JXV A;  4GIV A;  1HJV A;  1FKF A;  1SR0 A;  1C9H A;  3TDB A;  2XP4 A;  4S3J A;  3LUO A;  1L1P A;  2LJ4 A;  3VAW A;  4P8W A;  2D9F A;  1T11 A;  1FKS A;  4P8U A;  3IKD A;  2DG3 A;  5HUA A;  5DIU A;  4MTV A;  4JFJ A;  2A3C A;  3KAF A;  4ZPV R;  3QOK A;  1RD6 A;  4MNL A;  4UDM A;  4DZ3 A;  1J6Y A;  2KGJ A;  1SYT A;  3ARW A;  2M2A A;  4DRI A;  4WK9 A;  4WJX A;  4HBE A;  2F21 A;  1Q1C A;  1O6I A;  3IKG A;  2DSU A;  4Z2H A;  4DRM A;  3RFW A;  1EQ3 A;  1BL4 A;  3CHD A;  5DIT A;  1ZBK A;  2ETN A;  2M1I A;  4Q22 A;  4ODM A;  2KFW A;  2A3E A;  3WD3 A;  2Y78 A;  1FKT A;  4ODP A;  2VN1 A;  1BKF A;  4MSP A;  2RUD A;  2ZR5 A;  2ZQV A;  2DT1 A;  5GPR A;  1NWR A;  1FFR A;  2PV2 A;  2YBT A;  3AS2 A;  2ESC A;  4TW6 A;  4P8V A;  3WD0 A;  4LGX A;  1LG1 A;  4U84 A;  2L2S A;  2DSV A;  2PPN A;  3ARP A;  3ARY A;  2KE0 A;  1W1T A;  4QT3 A;  2ZQT A;  1XRV A;  2XP8 A;  2KI3 A;  4LAY A;  1OWQ A;  3FXY A;  3KAI A;  2FAP A;  3I6C A;  1HKM A;  2M08 A;  4Z2J A;  2XP9 A;  5JH8 A;  1ZU8 A;  4W9O A;  1KT0 A;  2PBC A;  4KR0 B;  1D7I A;  1W1V A;  3OOB A;  5I98 A;  2YBU A;  1D7J A;  4O2T A;  4L72 B;  5HWC A;  2DT3 A;  1PIN A;  1HKI A;  2KR7 A;  4LAW A;  1JVW A;  4N19 A;  5HT1 A;  2ZQS A;  4MAV A;  1D7H A;  2A3B A;  3O5E A;  4GGQ A;  4JFK A;  1NMW A;  3RM4 A;  1NMV A;  2G41 A;  4IQC A;  1X6N A;  1KFW A;  3UI4 A;  3AS1 A;  2XPB A;  4ODL A;  4DRP A;  2XP5 A;  1B6C A;  1LQ0 A;  1NSG A;  1YAT A;  5DF0 A;  3O5G A;  1ZB5 A;  1ZK6 A;  3KAD A;  3WQW A;  1LL4 A;  4LAX A;  2OFN A;  1FD9 A;  4DH0 A;  4ODO A;  4MNJ A;  4WKA A;  3UI6 A;  4HBO A;  5GQB A;  1FKD A;  1K9T A;  3PRB A;  4NZC A;  4W9P A;  3CGM A;  3O5L A;  1N1A A;  3O5P A;  1NH6 A;  1E6Z A;  3UQI A;  4DIP A;  1FKB A;  1F8A B;  2PI6 A;  4BF8 A;  1LL6 A;  1OGB A;  1ZL1 A;  2MLX A;  4NSB A;  4PTM A;  4QIB A;  3ODK A;  2G8Z A;  1ZCN A;  3UF8 A;  4Z2L A;  1NWT A;  4TYO A;  4R5E A;  4DRH A;  5B8I C;  2XP7 A;  1E15 A;  3GTY X;  1HJW A;  3WL0 A;  5BXJ A;  3BXW A;  4S3K A;  1YW5 A;  5HTG A;  1UR9 A;  4ODK A;  1PBK A;  2ZQU A;  2MLY A;  2RSE A;  3O5M A;  2WLZ A;  2DG9 A;  2IF4 A;  2WLY A;  3B9E A;  1P5Q A;  1ZBW A;  3KAC A;  1Q6U A;  3RGC A;  3EIP A;  3O5O A;  2LGO A;  2MF9 A;  2DSZ A;  2XP6 A;  1E6R A;  2JZV A;  3O5K A;  2A3A A;  3WQV A;  2EUL A;  4TW8 A;  1HKJ A;  1QPF A;  2XP3 A;  3KAB A;  2K8I A;  3PRD A;  3WD4 A;  2OLH A;  1EIB A;  3H9R B;  2F2D A;  3ARS A;  3ALF A;  3CHE A;  4JFI A;  3FY1 A;  2RUR A;  5DEZ A;  1ZBC A;  2PV1 A;  2N87 A;  4MGV A;  3G6M A;  3WIJ A;  2XPA A;  4DZ2 A;  1W26 A;  1W9V A;  1KT1 A;  2LKN A;  4FAP A;  2IUZ A;  1HKK A;  3KCE A;  1JCH B;  1FKK A;  1FJD A;  5HW8 A;  2FKE A;  4KQZ A;  3NTP A;  4JYS A;  3GPK A;  5D75 A;  4C02 B;  4W5U A;  2PV3 A;  3ARZ A;  4MNK A;  4TW7 A;  1ITX A;  1LG2 A;  4DT4 A;  3ARO A;  4DRO A;  1W1P A;  4U86 A;  3O5J A;  1XHG A;  4J4O A;  1OGG A;  1D2K A;  4ODR A;  1U79 A;  4ITZ A;  4DWS A;  3RM8 A;  1R9H A;  2F4E A;  1ROT A;  3JYM A;  4TX0 A;  2PN0 A;  3TCZ A;  3WKZ A;  4ZPW R;  1JND A;  3B8S A;  3BMB A;  1M5Y A;  4Z2K A;  2ZR6 A; 
#chains in the Genus database with same CATH homology
 3O5I A;  2O92 A;  3AS3 A;  4ODN A;  3UI5 A;  1ZBV A;  2ITK A;  5DO2 A;  1H0G A;  1IX5 A;  4QZV B;  3KAG A;  1UR8 A;  2WM0 A;  2MPH A;  3CZ8 A;  1Q6H A;  2RUQ A;  1J4H A;  1D6O A;  3OA5 A;  2DT0 A;  1QZ2 A;  3NRK A;  3WD2 A;  1A7X A;  3UQA A;  4DRQ A;  3WH0 A;  4G50 A;  4ML4 A;  1TCO C;  1WB0 A;  1FKI A;  2DPE A;  1FKL A;  1J4I A;  1QPL A;  4IT6 A;  4ZPT R;  3O5R A;  5HWB A;  2LPV A;  2PPP A;  4R0X A;  4JFM A;  4DRN A;  1JNE A;  4WKF A;  3CGN A;  3G6L A;  4U85 A;  2O9O A;  1J4R A;  2DT2 A;  3PA7 A;  4G2P A;  4LAV A;  4MNM A;  2WK2 A;  3B9A A;  1H0I A;  1ROU A;  3ARR A;  3CHF A;  3W4R A;  2FDM A;  2DG4 A;  1CTN A;  1TFV A;  1F40 A;  1FKJ A;  3CHC A;  5HW7 A;  1EYM A;  4MPK A;  3ARU A;  3WL1 A;  1Y0O A;  3ART A;  2UZ5 A;  1NWU A;  1GOI A;  2DSW A;  5HKG A;  2PPO A;  2Q5A A;  3IHZ A;  4JFL A;  1FAP A;  5DIV A;  1VF8 A;  3CH9 A;  3O5Q A;  3IK8 A;  4Z2I A;  1X6L A;  1JNT A;  3NI6 A;  3O5D A;  4W9Q A;  3RME A;  3RM9 A;  2MLZ A;  2RQS A;  2VCD A;  4IT4 A;  4URI A;  1E6N A;  3TC5 A;  1W9U A;  4P8X A;  4AY1 A;  3EY6 A;  5J6E A;  1E6P A;  1GUV A;  2AWG A;  1JNS A;  1HXV A;  3PRA A;  3ARQ A;  1EDQ A;  1WAW A;  1FFQ A;  3B9D A;  4QT2 A;  4WIW A;  3ARV A;  4IQ2 A;  5HW6 A;  1LJY A;  1WNO A;  3B7X A;  1E9L A;  1LL7 A;  1Q6I A;  4WKH A;  4DRK A;  2QF8 A;  1FKG A;  3JYJ A;  2KO7 A;  4Q7N A;  4ODQ A;  1NWS A;  4DRJ A;  1W9P A;  3KZ7 A;  4HAR A;  3AS0 A;  2ZR4 A;  4TNS A;  3UQB A;  4NNR A;  2AOS A;  3O5F A;  4DWS C;  3ARX A;  4ZS6 A;  1EHN A;  4DWS B;  3FAP A;  4Z2G A;  5GPG A;  4XAK A;  3AQU A;  1FKR A;  4J4N A;  1GPF A;  3WD1 A;  3KAH A;  3PR9 A;  2B31 A;  4FN2 A;  1HJX A;  2RUC A;  1FKH A;  3ALG A;  5HBF A;  3MDY B;  4L3N A;  4IPX A;  4DWS D;  1W1Y A;  2MNT A;  3JXV A;  4GIV A;  1HJV A;  1FKF A;  1SR0 A;  1C9H A;  3TDB A;  2XP4 A;  4S3J A;  3LUO A;  1L1P A;  2LJ4 A;  3VAW A;  4P8W A;  2D9F A;  1T11 A;  1FKS A;  4P8U A;  3IKD A;  2DG3 A;  5HUA A;  5DIU A;  4MTV A;  4JFJ A;  2A3C A;  3KAF A;  4ZPV R;  3QOK A;  1RD6 A;  4MNL A;  4DZ3 A;  1J6Y A;  2KGJ A;  1SYT A;  3ARW A;  2M2A A;  4DRI A;  4WK9 A;  4WJX A;  4HBE A;  2F21 A;  1Q1C A;  1O6I A;  3IKG A;  2DSU A;  4Z2H A;  4DRM A;  3RFW A;  1EQ3 A;  1BL4 A;  3CHD A;  5DIT A;  1ZBK A;  2M1I A;  4Q22 A;  4ODM A;  2KFW A;  2A3E A;  3WD3 A;  2Y78 A;  1FKT A;  4ODP A;  2VN1 A;  1BKF A;  4MSP A;  2RUD A;  2ZR5 A;  2ZQV A;  2DT1 A;  5GPR A;  1NWR A;  1FFR A;  2PV2 A;  2YBT A;  3AS2 A;  2ESC A;  4TW6 A;  4P8V A;  3WD0 A;  4LGX A;  1LG1 A;  4U84 A;  2L2S A;  2DSV A;  2PPN A;  3ARP A;  3ARY A;  2KE0 A;  1W1T A;  4QT3 A;  2ZQT A;  1XRV A;  2XP8 A;  2KI3 A;  4LAY A;  1OWQ A;  3FXY A;  3KAI A;  2FAP A;  3I6C A;  1HKM A;  2M08 A;  4Z2J A;  2XP9 A;  5JH8 A;  1ZU8 A;  4W9O A;  1KT0 A;  2PBC A;  4KR0 B;  1D7I A;  1W1V A;  3OOB A;  5I98 A;  2YBU A;  1D7J A;  4O2T A;  4L72 B;  5HWC A;  2DT3 A;  1PIN A;  1HKI A;  2KR7 A;  4LAW A;  1JVW A;  4N19 A;  5HT1 A;  2ZQS A;  4MAV A;  1D7H A;  2A3B A;  3O5E A;  4GGQ A;  4JFK A;  1NMW A;  3RM4 A;  1NMV A;  2G41 A;  4IQC A;  1X6N A;  1KFW A;  3UI4 A;  3AS1 A;  2XPB A;  4ODL A;  4DRP A;  2XP5 A;  1B6C A;  1LQ0 A;  1NSG A;  1YAT A;  5DF0 A;  3O5G A;  1ZB5 A;  1ZK6 A;  3KAD A;  3WQW A;  1LL4 A;  4LAX A;  2OFN A;  1FD9 A;  4DH0 A;  4ODO A;  4MNJ A;  4WKA A;  3UI6 A;  4HBO A;  5GQB A;  1FKD A;  1K9T A;  3PRB A;  4NZC A;  4W9P A;  3CGM A;  3O5L A;  1N1A A;  3O5P A;  1NH6 A;  1E6Z A;  3UQI A;  4DIP A;  1FKB A;  1F8A B;  2PI6 A;  4BF8 A;  1LL6 A;  1OGB A;  1ZL1 A;  2MLX A;  4NSB A;  4PTM A;  4QIB A;  3ODK A;  2G8Z A;  1ZCN A;  3UF8 A;  4Z2L A;  1NWT A;  4TYO A;  4R5E A;  4DRH A;  5B8I C;  2XP7 A;  1E15 A;  1HJW A;  3WL0 A;  5BXJ A;  3BXW A;  4S3K A;  1YW5 A;  5HTG A;  1UR9 A;  4ODK A;  1PBK A;  2ZQU A;  2MLY A;  2RSE A;  3O5M A;  2WLZ A;  2DG9 A;  2IF4 A;  2WLY A;  3B9E A;  1P5Q A;  1ZBW A;  3KAC A;  1Q6U A;  3RGC A;  3O5O A;  2LGO A;  2MF9 A;  2DSZ A;  2XP6 A;  1E6R A;  2JZV A;  3O5K A;  2A3A A;  3WQV A;  4TW8 A;  1HKJ A;  1QPF A;  2XP3 A;  3KAB A;  2K8I A;  3PRD A;  3WD4 A;  2OLH A;  1EIB A;  3H9R B;  2F2D A;  3ARS A;  3ALF A;  3CHE A;  4JFI A;  3FY1 A;  2RUR A;  5DEZ A;  1ZBC A;  2PV1 A;  2N87 A;  4MGV A;  3G6M A;  3WIJ A;  2XPA A;  4DZ2 A;  1W26 A;  1W9V A;  1KT1 A;  2LKN A;  4FAP A;  2IUZ A;  1HKK A;  3KCE A;  1FKK A;  1FJD A;  5HW8 A;  2FKE A;  4KQZ A;  3NTP A;  4JYS A;  3GPK A;  5D75 A;  4C02 B;  4W5U A;  2PV3 A;  3ARZ A;  4MNK A;  4TW7 A;  1ITX A;  1LG2 A;  4DT4 A;  3ARO A;  4DRO A;  1W1P A;  4U86 A;  3O5J A;  1XHG A;  4J4O A;  1OGG A;  1D2K A;  4ODR A;  1U79 A;  4ITZ A;  4DWS A;  3RM8 A;  1R9H A;  2F4E A;  1ROT A;  3JYM A;  4TX0 A;  3TCZ A;  3WKZ A;  4ZPW R;  1JND A;  3B8S A;  1M5Y A;  4Z2K A;  2ZR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...