1PBKA

Homologous domain of human fkbp25
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
116
structure length
116
Chain Sequence
b'PKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP25
publication title Structure of the human 25 kDa FK506 binding protein complexed with rapamycin.
pubmed rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 23
structure length 116
sequence length 116
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1pbkA00
1FJDA 2ZR5A 2Q5AA 5BXJA 4MGVA 2XPAA 1JVWA 3O5DA 3KABA 4C02B 1JNSA 2ZQTA 2IF4A 4DIPA 1ROTA 3CGNA 4DZ3A 2XP8A 1FKIA 1R9HA 4TYOA 5I98A 1EQ3A 3VAWA 1D6OA 2F21A 3JYMA 2VCDA 1ZK6A 3KAGA 3O5FA 4TNSA 3KCEA 4GGQA 2KI3A 4R0XA 1FKJA 4DRHA 1B6CA 2PPOA 2ZQSA 3ODKA 3UQBA 4JYSA 1EYMA 2ZQVA 3MDYB 1D7JA 4DRNA 1N1AA 4ODOA 4QT3A 4LAVA 1KT0A 1FKHA 2KR7A 2PPNA 2UZ5A 2Y78A 1FKRA 2XP5A 2LKNA 4U85A 2DG9A 2PV3A 2RQSA 1QPFA 4W9OA 5GPGA 4DRQA 3UQAA 1Q1CA 3GPKA 4FAPA 2PBCA 4ODRA 4DT4A 1Q6IA 3JXVA 3KZ7A 2XP9A 3OOBA 4TW6A 5DITA 2PPPA 3O5JA 1FKKA 1PBKA 1W26A 3RGCA 2XP4A 4DZ2A 1FD9A 5DIUA 5HT1A 1FKGA 4DRIA 4JFJA 4MSPA 2M2AA 5HWCA 1L1PA 2MLXA 2AWGA 2RURA 2D9FA 3CGMA 3O5PA 4LAYA 2MLYA 3UI5A 1ROUA 1J4HA 5B8IC 4ODPA 4W9PA 1PINA 4GIVA 2FKEA 2LPVA 3RFWA 3WH0A 2JZVA 1KT1A 1YW5A 1FKDA 2RSEA 4LAWA 3O5RA 1TCOC 3UI4A 4ITZA 4G50A 4ODMA 5HWBA 3O5OA 2M08A 1JNTA 3I6CA 4DRJA 1U79A 3TC5A 3UI6A 2KGJA 4JFIA 3O5QA 3TCZA 2DG4A 1J4RA 5HKGA 5HW8A 5HTGA 4JFKA 4DH0A 1T11A 2LGOA 2PV2A 4W9QA 1HXVA 4DRPA 4BF8A 1NMWA 3KAFA 4ODLA 2XPBA 4FN2A 5HW7A 4IPXA 4JFLA 5DIVA 3UQIA 3KACA 2LJ4A 3NRKA 2F4EA 1FKBA 2KE0A 2RUDA 2XP3A 4IQCA 1QZ2A 3O5IA 3PRDA 3NTPA 4LAXA 2L2SA 3LUOA 3O5KA 4U84A 1BKFA 3O5LA 3O5GA 3NI6A 4DRMA 4ODQA 1Q6UA 3KAHA 4QIBA 1BL4A 4G2PA 4DRKA 5J6EA 2RUQA 1YATA 3IHZA 2N87A 3IKGA 1J4IA 3TDBA 3PA7A 4U86A 2ZR6A 2ITKA 2RUCA 1F40A 1FKLA 2K8IA 1A7XA 2VN1A 4IQ2A 2XP6A 4QT2A 1M5YA 5HW6A 1FKSA 1D7HA 4DROA 1D7IA 1Y0OA 1NSGA 2FAPA 1FKFA 4ODKA 1P5QA 2DG3A 3JYJA 3EY6A 1QPLA 4J4NA 2M1IA 2OFNA 4ODNA 1Q6HA 2MPHA 4JFMA 1F8AB 2ZR4A 4TX0A 3UF8A 3B7XA 3FAPA 3O5EA 1J6YA 2KFWA 2MLZA 2PV1A 3H9RB 3IKDA 2KO7A 3O5MA 1FAPA 1FKTA 2MNTA 4N19A 5HUAA 3KAIA 3PRBA 4J4OA 2XP7A 4NNRA 5D75A 4TW7A 2F2DA 2ZQUA 1ZCNA 4O2TA 3KADA 2MF9A 1NMVA 4TW8A 3IK8A 1C9HA
chains in the Genus database with same CATH superfamily
1FJDA 4R5EA 1GRJA 1JVWA 3O5DA 2B31A 2ZQTA 4DIPA 4DZ3A 4NSBA 5I98A 3WKZA 2F21A 4XAKA 3JYMA 2VCDA 4ZPVR 1B6CA 2ZQSA 1XHGA 1ZBKA 1N1AA 4ODOA 1FKRA 2DT3A 4Z2GA 4U85A 2RQSA 4DRQA 4W9OA 1E6ZA 3UQAA 1Q1CA 1HJVA 2XP9A 3ALGA 3ARSA 2DT2A 3O5JA 1PBKA 1W26A 1E6RA 2XP4A 1EIBA 4JFJA 2M2AA 3ARPA 2RURA 2D9FA 3BMBA 3O5PA 2MLYA 1ROUA 5B8IC 4GIVA 1LG2A 3RFWA 1ZBWA 4WKAA 1E6PA 2RSEA 3UI4A 4G50A 4HBOA 3O5OA 2KGJA 3TCZA 1NMWA 1LG1A 3CH9A 3KACA 4LAXA 2WK2A 1QZ2A 3PRDA 5DEZA 2F23A 5DO2A 3O5KA 4U84A 1D2KA 2DPEA 3KAHA 4G2PA 1YATA 3IKGA 4L3NA 2RUCA 1EHNA 2DT1A 1FKSA 1Y0OA 4DWSD 1NSGA 1E9LA 2FAPA 3JYJA 4AY1A 1WAWA 4NZCA 1HKKA 1NWSA 1LL6A 1JNDA 3GU0A 5GQBA 4WIWA 2MPHA 1FFRA 3B9DA 1F8AB 2ZR4A 1W1PA 3CHEA 3FAPA 1LQ0A 3ARYA 2MLZA 4L72B 2KO7A 2DSVA 3ARQA 2MNTA 4NNRA 5D75A 2XP7A 1HJXA 1ZCNA 4O2TA 3WL0A 3ARRA 2EULA 2ZR5A 1TFVA 3QOKA 1O6IA 4ZPTR 1JNSA 1ROTA 3ARVA 4IT6A 4PTMA 4TYOA 1EQ3A 1EDQA 1ZK6A 4GGQA 5JH8A 4DRNA 1D7JA 1W1YA 1ZU8A 3FY1A 2YBUA 1FFQA 4P8XA 2LKNA 2DG9A 2PV3A 3GPKA 4Q22A 4DT4A 1Q6IA 2PI6A 3FXYA 3JXVA 3KZ7A 5DITA 3CZ8A 1FD9A 4DRIA 5HT1A 4MSPA 1L1PA 2MLXA 4LAYA 3UI5A 4Z2KA 1J4HA 1H0GA 1PINA 2P4VA 4Q7NA 2LPVA 2JZVA 3ALFA 2FDMA 4LAWA 1TCOC 4ITZA 1OGBA 1JNTA 2ESCA 3TC5A 4Z2IA 5HW8A 5HTGA 1H0IA 2PV2A 4DRPA 2G41A 3W4RA 1ZBCA 3OA5A 1JCHB 3B9AA 1HKJA 2F4EA 3O5IA 4LGXA 3NTPA 3O5LA 4DRMA 4ODQA 1Q6UA 4QIBA 1BL4A 2B5UB 2RUQA 3WQWA 3IHZA 3TDBA 1J4IA 4MNJA 2K8IA 1GPFA 4QT2A 1M5YA 1W9VA 1D7HA 4DROA 4P8VA 2A3BA 4ODKA 2DG3A 3EY6A 1QPLA 1E15A 2OFNA 2A3AA 4JFMA 4TX0A 4WKFA 3B7XA 1J6YA 3AQUA 1NWRA 1FAPA 5HUAA 4J4OA 1UR9A 2ETNA 2F2DA 1WNOA 2MF9A 3ODKA 1NWTA 2Q5AA 5BXJA 4MGVA 2XPAA 3B8SA 3KABA 1HKIA 3RM8A 2A3CA 2IF4A 2XP8A 3VAWA 3ARZA 1D6OA 3KAGA 1VF8A 4WJXA 3KCEA 4R0XA 2KI3A 2PPOA 4S3JA 4JYSA 1EYMA 3GTYX 3AS3A 4S3KA 4LAVA 2KR7A 4WKHA 1W9UA 2PPNA 2UZ5A 3WQVA 3WD1A 2XP5A 3B9EA 3WD2A 1K9TA 1QPFA 5GPGA 4ODRA 1W1TA 4UDMA 3ARXA 3OOBA 4DWSA 2WM0A 4MNKA 1FKKA 1RD6A 3RGCA 1X6LA 2DT0A 1FKGA 2WLYA 3RMEA 4KR0B 2QF8A 3ARWA 4W9PA 2FKEA 2DSZA 1XRVA 2DSUA 4IT4A 4ODMA 1U79A 1W9PA 3UI6A 3O5QA 3G6LA 2DG4A 1J4RA 5HKGA 4JFKA 2O92A 4DH0A 1T11A 1ZL1A 2LGOA 1HXVA 4BF8A 5HBFA 4ODLA 2XPBA 4FN2A 5HW7A 4IPXA 4JFLA 3PR9A 5DIVA 2LJ4A 1FKBA 2KE0A 3ARTA 4IQCA 4MNMA 4MPKA 2O9OA 2L2SA 3LUOA 3O5GA 3RM9A 1HJWA 4DWSC 3CHCA 5J6EA 2N87A 4WK9A 2ZR6A 2ITKA 1JNEA 1FKLA 2VN1A 2XP6A 5HW6A 1D7IA 5GPRA 4W5UA 4J4NA 4ODNA 2DSWA 2PN0A 3UF8A 3O5EA 3CHDA 4HARA 3AROA 4MNLA 1GUVA 3H9RB 1FKTA 3KAIA 3PRBA 2ZQUA 3KADA 4TW8A 1GOIA 4Z2JA 1WB0A 1LL7A 3AS1A 4C02B 1E44A 4URIA 4QZVB 3WL1A 3CGNA 1FKIA 1R9HA 4P8UA 4ZS6A 2AOSA 1OGGA 3O5FA 4TNSA 1ZBVA 4DRHA 1FKJA 1LL4A 3UQBA 4ML4A 2ZQVA 3MDYB 4QT3A 1KT0A 1FKHA 1W1VA 2Y78A 4Z2HA 4FAPA 2PBCA 1UR8A 4DWSB 4TW6A 3WD3A 2PPPA 1KFWA 4DZ2A 5DIUA 5DF0A 5HWCA 2AWGA 3CGMA 3PRAA 4Z2LA 3RM4A 4ODPA 3WH0A 1E6NA 1NH6A 1KT1A 1YW5A 1FKDA 3O5RA 4MAVA 1ITXA 5HWBA 2YBTA 2M08A 3I6CA 4P8WA 2OLHA 4DRJA 4JFIA 3CHFA 3WD0A 4MTVA 1OWQA 4W9QA 3KAFA 4HBEA 3UQIA 1SYTA 3G6MA 1HKMA 3NRKA 2RUDA 2XP3A 1BKFA 3NI6A 3BXWA 3AS0A 1ZB5A 2G8ZA 4DRKA 3PA7A 4U86A 1F40A 2WLZA 1A7XA 4IQ2A 1FKFA 1P5QA 1SR0A 2M1IA 1Q6HA 4ZPWR 3WD4A 1X6NA 4KQZA 2KFWA 3IKDA 2PV1A 2IUZA 3O5MA 3ARUA 1IX5A 4N19A 3AS2A 4TW7A 1LJYA 3EIPA 1NWUA 1CTNA 1NMVA 2A3EA 3IK8A 3WIJA 1C9HA
chains in the Genus database with same CATH topology
1FJDA 4R5EA 1JVWA 3O5DA 2B31A 2ZQTA 4DIPA 4DZ3A 4NSBA 5I98A 3WKZA 2F21A 4XAKA 3JYMA 2VCDA 4ZPVR 1B6CA 2ZQSA 1XHGA 1ZBKA 1N1AA 4ODOA 1FKRA 2DT3A 4Z2GA 4U85A 2RQSA 4DRQA 4W9OA 1E6ZA 3UQAA 1Q1CA 1HJVA 2XP9A 3ALGA 3ARSA 2DT2A 3O5JA 1PBKA 1W26A 1E6RA 2XP4A 1EIBA 4JFJA 2M2AA 3ARPA 2RURA 2D9FA 3O5PA 2MLYA 1ROUA 5B8IC 4GIVA 1LG2A 3RFWA 1ZBWA 4WKAA 1E6PA 2RSEA 3UI4A 4G50A 4HBOA 2KGJA 3TCZA 1NMWA 1LG1A 3CH9A 3KACA 4LAXA 2WK2A 1QZ2A 3PRDA 5DEZA 5DO2A 3O5KA 4U84A 1D2KA 2DPEA 3KAHA 4G2PA 1YATA 3IKGA 4L3NA 2RUCA 1EHNA 2DT1A 1FKSA 1Y0OA 4DWSD 1NSGA 1E9LA 2FAPA 3JYJA 4AY1A 1WAWA 4NZCA 1HKKA 1NWSA 1LL6A 1JNDA 5GQBA 4WIWA 2MPHA 1FFRA 3B9DA 1F8AB 2ZR4A 1W1PA 3CHEA 3FAPA 1LQ0A 3ARYA 2MLZA 4L72B 2KO7A 2DSVA 3ARQA 2MNTA 4NNRA 5D75A 2XP7A 1HJXA 1ZCNA 4O2TA 3WL0A 3ARRA 2ZR5A 1TFVA 3QOKA 1O6IA 4ZPTR 1JNSA 1ROTA 3ARVA 4IT6A 4PTMA 4TYOA 1EQ3A 1EDQA 1ZK6A 4GGQA 5JH8A 4DRNA 1D7JA 1W1YA 1ZU8A 3FY1A 2YBUA 1FFQA 4P8XA 2LKNA 2DG9A 2PV3A 3GPKA 4Q22A 4DT4A 1Q6IA 2PI6A 3FXYA 3JXVA 3KZ7A 5DITA 3CZ8A 1FD9A 4DRIA 5HT1A 4MSPA 1L1PA 2MLXA 4LAYA 3UI5A 4Z2KA 1J4HA 1H0GA 1PINA 4Q7NA 2LPVA 2JZVA 3ALFA 2FDMA 4LAWA 1TCOC 4ITZA 1OGBA 1JNTA 2ESCA 3TC5A 4Z2IA 5HW8A 5HTGA 1H0IA 2PV2A 4DRPA 2G41A 3W4RA 1ZBCA 3OA5A 3B9AA 1HKJA 2F4EA 3O5IA 4LGXA 3NTPA 3O5LA 4DRMA 4ODQA 1Q6UA 4QIBA 1BL4A 2RUQA 3WQWA 3IHZA 3TDBA 1J4IA 4MNJA 2K8IA 1GPFA 4QT2A 1M5YA 1W9VA 1D7HA 4DROA 4P8VA 2A3BA 4ODKA 2DG3A 3EY6A 1QPLA 1E15A 2OFNA 2A3AA 4JFMA 4TX0A 4WKFA 3B7XA 1J6YA 3AQUA 1NWRA 1FAPA 5HUAA 4J4OA 1UR9A 2F2DA 1WNOA 2MF9A 1C9HA 3ODKA 1NWTA 2Q5AA 5BXJA 4MGVA 2XPAA 3B8SA 3KABA 1HKIA 3RM8A 2A3CA 2IF4A 2XP8A 3VAWA 3ARZA 1D6OA 3KAGA 1VF8A 4WJXA 3KCEA 4R0XA 2KI3A 2PPOA 4S3JA 4JYSA 1EYMA 3AS3A 4S3KA 4LAVA 2KR7A 4WKHA 1W9UA 2PPNA 2UZ5A 3WQVA 3WD1A 2XP5A 3B9EA 3WD2A 1K9TA 1QPFA 5GPGA 4ODRA 1W1TA 3ARXA 3OOBA 4DWSA 2WM0A 4MNKA 1FKKA 1RD6A 3RGCA 1X6LA 2DT0A 1FKGA 2WLYA 3RMEA 4KR0B 2QF8A 3ARWA 4W9PA 2FKEA 2DSZA 1XRVA 2DSUA 4IT4A 4ODMA 1U79A 1W9PA 3UI6A 3O5QA 3G6LA 2DG4A 1J4RA 5HKGA 4JFKA 2O92A 4DH0A 1T11A 1ZL1A 2LGOA 1HXVA 4BF8A 5HBFA 4ODLA 2XPBA 4FN2A 5HW7A 4IPXA 4JFLA 3PR9A 5DIVA 2LJ4A 1FKBA 2KE0A 3ARTA 4IQCA 4MNMA 4MPKA 2O9OA 2L2SA 3LUOA 3O5GA 3RM9A 1HJWA 4DWSC 3CHCA 5J6EA 2N87A 4WK9A 2ZR6A 2ITKA 1JNEA 1FKLA 2VN1A 2XP6A 5HW6A 1D7IA 5GPRA 4W5UA 4J4NA 4ODNA 2DSWA 3UF8A 3O5EA 3CHDA 4HARA 3AROA 4MNLA 1GUVA 3H9RB 1FKTA 3KAIA 3PRBA 2ZQUA 3KADA 4TW8A 1GOIA 4Z2JA 1WB0A 1LL7A 3AS1A 4C02B 4URIA 4QZVB 3WL1A 3CGNA 1FKIA 1R9HA 4P8UA 4ZS6A 2AOSA 1OGGA 3O5FA 4TNSA 1ZBVA 4DRHA 1FKJA 1LL4A 3UQBA 4ML4A 2ZQVA 3MDYB 4QT3A 1KT0A 1FKHA 1W1VA 2Y78A 4Z2HA 4FAPA 2PBCA 1UR8A 4DWSB 4TW6A 3WD3A 2PPPA 1KFWA 4DZ2A 5DIUA 5DF0A 5HWCA 2AWGA 3CGMA 3PRAA 4Z2LA 3RM4A 4ODPA 3WH0A 1E6NA 1NH6A 1KT1A 1YW5A 1FKDA 3O5RA 4MAVA 1ITXA 5HWBA 2YBTA 2M08A 3I6CA 4P8WA 2OLHA 4DRJA 4JFIA 3CHFA 3WD0A 4MTVA 1OWQA 4W9QA 3KAFA 4HBEA 3UQIA 1SYTA 3G6MA 1HKMA 3NRKA 2RUDA 2XP3A 1BKFA 3NI6A 3BXWA 3AS0A 1ZB5A 2G8ZA 4DRKA 3PA7A 4U86A 1F40A 2WLZA 1A7XA 4IQ2A 1FKFA 1P5QA 1SR0A 2M1IA 1Q6HA 4ZPWR 3WD4A 1X6NA 4KQZA 2KFWA 3IKDA 2PV1A 2IUZA 3O5MA 3ARUA 1IX5A 4N19A 3AS2A 4TW7A 1LJYA 1NWUA 1CTNA 1NMVA 2A3EA 3IK8A 3WIJA 3O5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJD A;  2ZR5 A;  2Q5A A;  5BXJ A;  4MGV A;  2XPA A;  1JVW A;  3O5D A;  3KAB A;  4C02 B;  1JNS A;  2ZQT A;  2IF4 A;  4DIP A;  1ROT A;  3CGN A;  4DZ3 A;  2XP8 A;  1FKI A;  1R9H A;  4TYO A;  5I98 A;  1EQ3 A;  3VAW A;  1D6O A;  2F21 A;  3JYM A;  2VCD A;  1ZK6 A;  3KAG A;  3O5F A;  4TNS A;  3KCE A;  4GGQ A;  2KI3 A;  4R0X A;  1FKJ A;  4DRH A;  1B6C A;  2PPO A;  2ZQS A;  3ODK A;  3UQB A;  4JYS A;  1EYM A;  2ZQV A;  3MDY B;  1D7J A;  4DRN A;  1N1A A;  4ODO A;  4QT3 A;  4LAV A;  1KT0 A;  1FKH A;  2KR7 A;  2PPN A;  2UZ5 A;  2Y78 A;  1FKR A;  2XP5 A;  2LKN A;  4U85 A;  2DG9 A;  2PV3 A;  2RQS A;  1QPF A;  4W9O A;  5GPG A;  4DRQ A;  3UQA A;  1Q1C A;  3GPK A;  4FAP A;  2PBC A;  4ODR A;  4DT4 A;  1Q6I A;  3JXV A;  3KZ7 A;  2XP9 A;  3OOB A;  4TW6 A;  5DIT A;  2PPP A;  3O5J A;  1FKK A;  1PBK A;  1W26 A;  3RGC A;  2XP4 A;  4DZ2 A;  1FD9 A;  5DIU A;  5HT1 A;  1FKG A;  4DRI A;  4JFJ A;  4MSP A;  2M2A A;  5HWC A;  1L1P A;  2MLX A;  2AWG A;  2RUR A;  2D9F A;  3CGM A;  3O5P A;  4LAY A;  2MLY A;  3UI5 A;  1ROU A;  1J4H A;  5B8I C;  4ODP A;  4W9P A;  1PIN A;  4GIV A;  2FKE A;  2LPV A;  3RFW A;  3WH0 A;  2JZV A;  1KT1 A;  1YW5 A;  1FKD A;  2RSE A;  4LAW A;  3O5R A;  1TCO C;  3UI4 A;  4ITZ A;  4G50 A;  4ODM A;  5HWB A;  3O5O A;  2M08 A;  1JNT A;  3I6C A;  4DRJ A;  1U79 A;  3TC5 A;  3UI6 A;  2KGJ A;  4JFI A;  3O5Q A;  3TCZ A;  2DG4 A;  1J4R A;  5HKG A;  5HW8 A;  5HTG A;  4JFK A;  4DH0 A;  1T11 A;  2LGO A;  2PV2 A;  4W9Q A;  1HXV A;  4DRP A;  4BF8 A;  1NMW A;  3KAF A;  4ODL A;  2XPB A;  4FN2 A;  5HW7 A;  4IPX A;  4JFL A;  5DIV A;  3UQI A;  3KAC A;  2LJ4 A;  3NRK A;  2F4E A;  1FKB A;  2KE0 A;  2RUD A;  2XP3 A;  4IQC A;  1QZ2 A;  3O5I A;  3PRD A;  3NTP A;  4LAX A;  2L2S A;  3LUO A;  3O5K A;  4U84 A;  1BKF A;  3O5L A;  3O5G A;  3NI6 A;  4DRM A;  4ODQ A;  1Q6U A;  3KAH A;  4QIB A;  1BL4 A;  4G2P A;  4DRK A;  5J6E A;  2RUQ A;  1YAT A;  3IHZ A;  2N87 A;  3IKG A;  1J4I A;  3TDB A;  3PA7 A;  4U86 A;  2ZR6 A;  2ITK A;  2RUC A;  1F40 A;  1FKL A;  2K8I A;  1A7X A;  2VN1 A;  4IQ2 A;  2XP6 A;  4QT2 A;  1M5Y A;  5HW6 A;  1FKS A;  1D7H A;  4DRO A;  1D7I A;  1Y0O A;  1NSG A;  2FAP A;  1FKF A;  4ODK A;  1P5Q A;  2DG3 A;  3JYJ A;  3EY6 A;  1QPL A;  4J4N A;  2M1I A;  2OFN A;  4ODN A;  1Q6H A;  2MPH A;  4JFM A;  1F8A B;  2ZR4 A;  4TX0 A;  3UF8 A;  3B7X A;  3FAP A;  3O5E A;  1J6Y A;  2KFW A;  2MLZ A;  2PV1 A;  3H9R B;  3IKD A;  2KO7 A;  3O5M A;  1FAP A;  1FKT A;  2MNT A;  4N19 A;  5HUA A;  3KAI A;  3PRB A;  4J4O A;  2XP7 A;  4NNR A;  5D75 A;  4TW7 A;  2F2D A;  2ZQU A;  1ZCN A;  4O2T A;  3KAD A;  2MF9 A;  1NMV A;  4TW8 A;  3IK8 A;  1C9H A; 
#chains in the Genus database with same CATH topology
 1FJD A;  4R5E A;  1GRJ A;  1JVW A;  3O5D A;  2B31 A;  2ZQT A;  4DIP A;  4DZ3 A;  4NSB A;  5I98 A;  3WKZ A;  2F21 A;  4XAK A;  3JYM A;  2VCD A;  4ZPV R;  1B6C A;  2ZQS A;  1XHG A;  1ZBK A;  1N1A A;  4ODO A;  1FKR A;  2DT3 A;  4Z2G A;  4U85 A;  2RQS A;  4DRQ A;  4W9O A;  1E6Z A;  3UQA A;  1Q1C A;  1HJV A;  2XP9 A;  3ALG A;  3ARS A;  2DT2 A;  3O5J A;  1PBK A;  1W26 A;  1E6R A;  2XP4 A;  1EIB A;  4JFJ A;  2M2A A;  3ARP A;  2RUR A;  2D9F A;  3BMB A;  3O5P A;  2MLY A;  1ROU A;  5B8I C;  4GIV A;  1LG2 A;  3RFW A;  1ZBW A;  4WKA A;  1E6P A;  2RSE A;  3UI4 A;  4G50 A;  4HBO A;  3O5O A;  2KGJ A;  3TCZ A;  1NMW A;  1LG1 A;  3CH9 A;  3KAC A;  4LAX A;  2WK2 A;  1QZ2 A;  3PRD A;  5DEZ A;  2F23 A;  5DO2 A;  3O5K A;  4U84 A;  1D2K A;  2DPE A;  3KAH A;  4G2P A;  1YAT A;  3IKG A;  4L3N A;  2RUC A;  1EHN A;  2DT1 A;  1FKS A;  1Y0O A;  4DWS D;  1NSG A;  1E9L A;  2FAP A;  3JYJ A;  4AY1 A;  1WAW A;  4NZC A;  1HKK A;  1NWS A;  1LL6 A;  1JND A;  3GU0 A;  5GQB A;  4WIW A;  2MPH A;  1FFR A;  3B9D A;  1F8A B;  2ZR4 A;  1W1P A;  3CHE A;  3FAP A;  1LQ0 A;  3ARY A;  2MLZ A;  4L72 B;  2KO7 A;  2DSV A;  3ARQ A;  2MNT A;  4NNR A;  5D75 A;  2XP7 A;  1HJX A;  1ZCN A;  4O2T A;  3WL0 A;  3ARR A;  2EUL A;  2ZR5 A;  1TFV A;  3QOK A;  1O6I A;  4ZPT R;  1JNS A;  1ROT A;  3ARV A;  4IT6 A;  4PTM A;  4TYO A;  1EQ3 A;  1EDQ A;  1ZK6 A;  4GGQ A;  5JH8 A;  4DRN A;  1D7J A;  1W1Y A;  1ZU8 A;  3FY1 A;  2YBU A;  1FFQ A;  4P8X A;  2LKN A;  2DG9 A;  2PV3 A;  3GPK A;  4Q22 A;  4DT4 A;  1Q6I A;  2PI6 A;  3FXY A;  3JXV A;  3KZ7 A;  5DIT A;  3CZ8 A;  1FD9 A;  4DRI A;  5HT1 A;  4MSP A;  1L1P A;  2MLX A;  4LAY A;  3UI5 A;  4Z2K A;  1J4H A;  1H0G A;  1PIN A;  2P4V A;  4Q7N A;  2LPV A;  2JZV A;  3ALF A;  2FDM A;  4LAW A;  1TCO C;  4ITZ A;  1OGB A;  1JNT A;  2ESC A;  3TC5 A;  4Z2I A;  5HW8 A;  5HTG A;  1H0I A;  2PV2 A;  4DRP A;  2G41 A;  3W4R A;  1ZBC A;  3OA5 A;  1JCH B;  3B9A A;  1HKJ A;  2F4E A;  3O5I A;  4LGX A;  3NTP A;  3O5L A;  4DRM A;  4ODQ A;  1Q6U A;  4QIB A;  1BL4 A;  2B5U B;  2RUQ A;  3WQW A;  3IHZ A;  3TDB A;  1J4I A;  4MNJ A;  2K8I A;  1GPF A;  4QT2 A;  1M5Y A;  1W9V A;  1D7H A;  4DRO A;  4P8V A;  2A3B A;  4ODK A;  2DG3 A;  3EY6 A;  1QPL A;  1E15 A;  2OFN A;  2A3A A;  4JFM A;  4TX0 A;  4WKF A;  3B7X A;  1J6Y A;  3AQU A;  1NWR A;  1FAP A;  5HUA A;  4J4O A;  1UR9 A;  2ETN A;  2F2D A;  1WNO A;  2MF9 A;  3ODK A;  1NWT A;  2Q5A A;  5BXJ A;  4MGV A;  2XPA A;  3B8S A;  3KAB A;  1HKI A;  3RM8 A;  2A3C A;  2IF4 A;  2XP8 A;  3VAW A;  3ARZ A;  1D6O A;  3KAG A;  1VF8 A;  4WJX A;  3KCE A;  4R0X A;  2KI3 A;  2PPO A;  4S3J A;  4JYS A;  1EYM A;  3GTY X;  3AS3 A;  4S3K A;  4LAV A;  2KR7 A;  4WKH A;  1W9U A;  2PPN A;  2UZ5 A;  3WQV A;  3WD1 A;  2XP5 A;  3B9E A;  3WD2 A;  1K9T A;  1QPF A;  5GPG A;  4ODR A;  1W1T A;  4UDM A;  3ARX A;  3OOB A;  4DWS A;  2WM0 A;  4MNK A;  1FKK A;  1RD6 A;  3RGC A;  1X6L A;  2DT0 A;  1FKG A;  2WLY A;  3RME A;  4KR0 B;  2QF8 A;  3ARW A;  4W9P A;  2FKE A;  2DSZ A;  1XRV A;  2DSU A;  4IT4 A;  4ODM A;  1U79 A;  1W9P A;  3UI6 A;  3O5Q A;  3G6L A;  2DG4 A;  1J4R A;  5HKG A;  4JFK A;  2O92 A;  4DH0 A;  1T11 A;  1ZL1 A;  2LGO A;  1HXV A;  4BF8 A;  5HBF A;  4ODL A;  2XPB A;  4FN2 A;  5HW7 A;  4IPX A;  4JFL A;  3PR9 A;  5DIV A;  2LJ4 A;  1FKB A;  2KE0 A;  3ART A;  4IQC A;  4MNM A;  4MPK A;  2O9O A;  2L2S A;  3LUO A;  3O5G A;  3RM9 A;  1HJW A;  4DWS C;  3CHC A;  5J6E A;  2N87 A;  4WK9 A;  2ZR6 A;  2ITK A;  1JNE A;  1FKL A;  2VN1 A;  2XP6 A;  5HW6 A;  1D7I A;  5GPR A;  4W5U A;  4J4N A;  4ODN A;  2DSW A;  2PN0 A;  3UF8 A;  3O5E A;  3CHD A;  4HAR A;  3ARO A;  4MNL A;  1GUV A;  3H9R B;  1FKT A;  3KAI A;  3PRB A;  2ZQU A;  3KAD A;  4TW8 A;  1GOI A;  4Z2J A;  1WB0 A;  1LL7 A;  3AS1 A;  4C02 B;  1E44 A;  4URI A;  4QZV B;  3WL1 A;  3CGN A;  1FKI A;  1R9H A;  4P8U A;  4ZS6 A;  2AOS A;  1OGG A;  3O5F A;  4TNS A;  1ZBV A;  4DRH A;  1FKJ A;  1LL4 A;  3UQB A;  4ML4 A;  2ZQV A;  3MDY B;  4QT3 A;  1KT0 A;  1FKH A;  1W1V A;  2Y78 A;  4Z2H A;  4FAP A;  2PBC A;  1UR8 A;  4DWS B;  4TW6 A;  3WD3 A;  2PPP A;  1KFW A;  4DZ2 A;  5DIU A;  5DF0 A;  5HWC A;  2AWG A;  3CGM A;  3PRA A;  4Z2L A;  3RM4 A;  4ODP A;  3WH0 A;  1E6N A;  1NH6 A;  1KT1 A;  1YW5 A;  1FKD A;  3O5R A;  4MAV A;  1ITX A;  5HWB A;  2YBT A;  2M08 A;  3I6C A;  4P8W A;  2OLH A;  4DRJ A;  4JFI A;  3CHF A;  3WD0 A;  4MTV A;  1OWQ A;  4W9Q A;  3KAF A;  4HBE A;  3UQI A;  1SYT A;  3G6M A;  1HKM A;  3NRK A;  2RUD A;  2XP3 A;  1BKF A;  3NI6 A;  3BXW A;  3AS0 A;  1ZB5 A;  2G8Z A;  4DRK A;  3PA7 A;  4U86 A;  1F40 A;  2WLZ A;  1A7X A;  4IQ2 A;  1FKF A;  1P5Q A;  1SR0 A;  2M1I A;  1Q6H A;  4ZPW R;  3WD4 A;  1X6N A;  4KQZ A;  2KFW A;  3IKD A;  2PV1 A;  2IUZ A;  3O5M A;  3ARU A;  1IX5 A;  4N19 A;  3AS2 A;  4TW7 A;  1LJY A;  3EIP A;  1NWU A;  1CTN A;  1NMV A;  2A3E A;  3IK8 A;  3WIJ A;  1C9H A; 
#chains in the Genus database with same CATH homology
 1FJD A;  4R5E A;  1JVW A;  3O5D A;  2B31 A;  2ZQT A;  4DIP A;  4DZ3 A;  4NSB A;  5I98 A;  3WKZ A;  2F21 A;  4XAK A;  3JYM A;  2VCD A;  4ZPV R;  1B6C A;  2ZQS A;  1XHG A;  1ZBK A;  1N1A A;  4ODO A;  1FKR A;  2DT3 A;  4Z2G A;  4U85 A;  2RQS A;  4DRQ A;  4W9O A;  1E6Z A;  3UQA A;  1Q1C A;  1HJV A;  2XP9 A;  3ALG A;  3ARS A;  2DT2 A;  3O5J A;  1PBK A;  1W26 A;  1E6R A;  2XP4 A;  1EIB A;  4JFJ A;  2M2A A;  3ARP A;  2RUR A;  2D9F A;  3O5P A;  2MLY A;  1ROU A;  5B8I C;  4GIV A;  1LG2 A;  3RFW A;  1ZBW A;  4WKA A;  1E6P A;  2RSE A;  3UI4 A;  4G50 A;  4HBO A;  2KGJ A;  3TCZ A;  1NMW A;  1LG1 A;  3CH9 A;  3KAC A;  4LAX A;  2WK2 A;  1QZ2 A;  3PRD A;  5DEZ A;  5DO2 A;  3O5K A;  4U84 A;  1D2K A;  2DPE A;  3KAH A;  4G2P A;  1YAT A;  3IKG A;  4L3N A;  2RUC A;  1EHN A;  2DT1 A;  1FKS A;  1Y0O A;  4DWS D;  1NSG A;  1E9L A;  2FAP A;  3JYJ A;  4AY1 A;  1WAW A;  4NZC A;  1HKK A;  1NWS A;  1LL6 A;  1JND A;  5GQB A;  4WIW A;  2MPH A;  1FFR A;  3B9D A;  1F8A B;  2ZR4 A;  1W1P A;  3CHE A;  3FAP A;  1LQ0 A;  3ARY A;  2MLZ A;  4L72 B;  2KO7 A;  2DSV A;  3ARQ A;  2MNT A;  4NNR A;  5D75 A;  2XP7 A;  1HJX A;  1ZCN A;  4O2T A;  3WL0 A;  3ARR A;  2ZR5 A;  1TFV A;  3QOK A;  1O6I A;  4ZPT R;  1JNS A;  1ROT A;  3ARV A;  4IT6 A;  4PTM A;  4TYO A;  1EQ3 A;  1EDQ A;  1ZK6 A;  4GGQ A;  5JH8 A;  4DRN A;  1D7J A;  1W1Y A;  1ZU8 A;  3FY1 A;  2YBU A;  1FFQ A;  4P8X A;  2LKN A;  2DG9 A;  2PV3 A;  3GPK A;  4Q22 A;  4DT4 A;  1Q6I A;  2PI6 A;  3FXY A;  3JXV A;  3KZ7 A;  5DIT A;  3CZ8 A;  1FD9 A;  4DRI A;  5HT1 A;  4MSP A;  1L1P A;  2MLX A;  4LAY A;  3UI5 A;  4Z2K A;  1J4H A;  1H0G A;  1PIN A;  4Q7N A;  2LPV A;  2JZV A;  3ALF A;  2FDM A;  4LAW A;  1TCO C;  4ITZ A;  1OGB A;  1JNT A;  2ESC A;  3TC5 A;  4Z2I A;  5HW8 A;  5HTG A;  1H0I A;  2PV2 A;  4DRP A;  2G41 A;  3W4R A;  1ZBC A;  3OA5 A;  3B9A A;  1HKJ A;  2F4E A;  3O5I A;  4LGX A;  3NTP A;  3O5L A;  4DRM A;  4ODQ A;  1Q6U A;  4QIB A;  1BL4 A;  2RUQ A;  3WQW A;  3IHZ A;  3TDB A;  1J4I A;  4MNJ A;  2K8I A;  1GPF A;  4QT2 A;  1M5Y A;  1W9V A;  1D7H A;  4DRO A;  4P8V A;  2A3B A;  4ODK A;  2DG3 A;  3EY6 A;  1QPL A;  1E15 A;  2OFN A;  2A3A A;  4JFM A;  4TX0 A;  4WKF A;  3B7X A;  1J6Y A;  3AQU A;  1NWR A;  1FAP A;  5HUA A;  4J4O A;  1UR9 A;  2F2D A;  1WNO A;  2MF9 A;  1C9H A;  3ODK A;  1NWT A;  2Q5A A;  5BXJ A;  4MGV A;  2XPA A;  3B8S A;  3KAB A;  1HKI A;  3RM8 A;  2A3C A;  2IF4 A;  2XP8 A;  3VAW A;  3ARZ A;  1D6O A;  3KAG A;  1VF8 A;  4WJX A;  3KCE A;  4R0X A;  2KI3 A;  2PPO A;  4S3J A;  4JYS A;  1EYM A;  3AS3 A;  4S3K A;  4LAV A;  2KR7 A;  4WKH A;  1W9U A;  2PPN A;  2UZ5 A;  3WQV A;  3WD1 A;  2XP5 A;  3B9E A;  3WD2 A;  1K9T A;  1QPF A;  5GPG A;  4ODR A;  1W1T A;  3ARX A;  3OOB A;  4DWS A;  2WM0 A;  4MNK A;  1FKK A;  1RD6 A;  3RGC A;  1X6L A;  2DT0 A;  1FKG A;  2WLY A;  3RME A;  4KR0 B;  2QF8 A;  3ARW A;  4W9P A;  2FKE A;  2DSZ A;  1XRV A;  2DSU A;  4IT4 A;  4ODM A;  1U79 A;  1W9P A;  3UI6 A;  3O5Q A;  3G6L A;  2DG4 A;  1J4R A;  5HKG A;  4JFK A;  2O92 A;  4DH0 A;  1T11 A;  1ZL1 A;  2LGO A;  1HXV A;  4BF8 A;  5HBF A;  4ODL A;  2XPB A;  4FN2 A;  5HW7 A;  4IPX A;  4JFL A;  3PR9 A;  5DIV A;  2LJ4 A;  1FKB A;  2KE0 A;  3ART A;  4IQC A;  4MNM A;  4MPK A;  2O9O A;  2L2S A;  3LUO A;  3O5G A;  3RM9 A;  1HJW A;  4DWS C;  3CHC A;  5J6E A;  2N87 A;  4WK9 A;  2ZR6 A;  2ITK A;  1JNE A;  1FKL A;  2VN1 A;  2XP6 A;  5HW6 A;  1D7I A;  5GPR A;  4W5U A;  4J4N A;  4ODN A;  2DSW A;  3UF8 A;  3O5E A;  3CHD A;  4HAR A;  3ARO A;  4MNL A;  1GUV A;  3H9R B;  1FKT A;  3KAI A;  3PRB A;  2ZQU A;  3KAD A;  4TW8 A;  1GOI A;  4Z2J A;  1WB0 A;  1LL7 A;  3AS1 A;  4C02 B;  4URI A;  4QZV B;  3WL1 A;  3CGN A;  1FKI A;  1R9H A;  4P8U A;  4ZS6 A;  2AOS A;  1OGG A;  3O5F A;  4TNS A;  1ZBV A;  4DRH A;  1FKJ A;  1LL4 A;  3UQB A;  4ML4 A;  2ZQV A;  3MDY B;  4QT3 A;  1KT0 A;  1FKH A;  1W1V A;  2Y78 A;  4Z2H A;  4FAP A;  2PBC A;  1UR8 A;  4DWS B;  4TW6 A;  3WD3 A;  2PPP A;  1KFW A;  4DZ2 A;  5DIU A;  5DF0 A;  5HWC A;  2AWG A;  3CGM A;  3PRA A;  4Z2L A;  3RM4 A;  4ODP A;  3WH0 A;  1E6N A;  1NH6 A;  1KT1 A;  1YW5 A;  1FKD A;  3O5R A;  4MAV A;  1ITX A;  5HWB A;  2YBT A;  2M08 A;  3I6C A;  4P8W A;  2OLH A;  4DRJ A;  4JFI A;  3CHF A;  3WD0 A;  4MTV A;  1OWQ A;  4W9Q A;  3KAF A;  4HBE A;  3UQI A;  1SYT A;  3G6M A;  1HKM A;  3NRK A;  2RUD A;  2XP3 A;  1BKF A;  3NI6 A;  3BXW A;  3AS0 A;  1ZB5 A;  2G8Z A;  4DRK A;  3PA7 A;  4U86 A;  1F40 A;  2WLZ A;  1A7X A;  4IQ2 A;  1FKF A;  1P5Q A;  1SR0 A;  2M1I A;  1Q6H A;  4ZPW R;  3WD4 A;  1X6N A;  4KQZ A;  2KFW A;  3IKD A;  2PV1 A;  2IUZ A;  3O5M A;  3ARU A;  1IX5 A;  4N19 A;  3AS2 A;  4TW7 A;  1LJY A;  1NWU A;  1CTN A;  1NMV A;  2A3E A;  3IK8 A;  3WIJ A;  3O5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...