1PBKA

Homologous domain of human fkbp25
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
116
structure length
116
Chain Sequence
PKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FKBP25
publication title Structure of the human 25 kDa FK506 binding protein complexed with rapamycin.
pubmed rcsb
source organism Homo sapiens
total genus 23
structure length 116
sequence length 116
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1pbkA00
4DRPA 2PV3A 4R0XA 2RSEA 3O5EA 4QIBA 2ZR5A 2F2DA 4NNRA 3O5MA 4W9PA 4ODLA 5HWBA 5I98A 3CGNA 1ZK6A 3CGMA 1D7HA 2KE0A 4DIPA 2FKEA 3UQBA 3MDYB 3O5PA 4FN2A 4G2PA 1BL4A 4JYSA 5HTGA 1HXVA 3NRKA 4TNSA 2Q5AA 4DT4A 1ROTA 2DG4A 2LJ4A 2PV2A 3KZ7A 4GGQA 2OFNA 2MPHA 3GPKA 4DRHA 2AWGA 3NTPA 3LUOA 2DG9A 2M2AA 5HW8A 3UI5A 2Y78A 4ODKA 4ODPA 2PPNA 2MF9A 2XP7A 4FAPA 3O5JA 4DRMA 5HW7A 2UZ5A 1KT0A 4IQCA 5GPGA 1FKKA 1NMWA 2LKNA 1Q6UA 4LAWA 3IK8A 1P5QA 2XPBA 3EY6A 4J4OA 1FJDA 2FAPA 3KAIA 1U79A 1J4IA 1D7IA 3KABA 1FKBA 4ODOA 1QZ2A 2ZQUA 3IKDA 1ROUA 3KAFA 4TYOA 3KADA 5J6EA 2F21A 1FKHA 3TC5A 2ITKA 2PPOA 4ODMA 3B7XA 3RFWA 3VAWA 5B8IC 4TW6A 4W9QA 4DRKA 1D6OA 4JFKA 2DG3A 5D75A 3UQAA 3WH0A 4JFIA 1J4HA 3PRBA 4MGVA 4N19A 2F4EA 1BKFA 3H9RB 3O5GA 4IPXA 4JFMA 3TCZA 5HUAA 2RURA 1FKIA 2ZQSA 4DRQA 1D7JA 2MLXA 3UF8A 2RQSA 2RUCA 3O5IA 2N87A 2KFWA 3JYJA 4TW8A 2MLYA 1FAPA 4DRNA 3KACA 1Q6IA 3O5QA 5DIVA 1FKRA 2M1IA 2XP6A 4DRIA 4U84A 3PA7A 2ZQVA 1F8AB 5HT1A 2MLZA 2ZQTA 3FAPA 4ODNA 1JVWA 1YATA 4GIVA 4QT2A 3UQIA 2XP3A 3KCEA 4DZ2A 1T11A 4MSPA 1ZCNA 3IKGA 3NI6A 4U86A 1J4RA 2JZVA 4W9OA 1PBKA 2XPAA 2VCDA 2K8IA 1KT1A 1N1AA 3UI4A 1FKJA 3O5OA 3TDBA 1J6YA 4C02B 3I6CA 1W26A 4JFJA 4ODQA 3KAHA 5BXJA 1F40A 1PINA 1QPLA 2ZR4A 1EYMA 2D9FA 4JFLA 2XP9A 4G50A 2PV1A 1B6CA 1FKSA 4O2TA 2KI3A 2KO7A 3PRDA 2LPVA 4TW7A 5HW6A 2MNTA 2LGOA 1C9HA 2PBCA 3IHZA 4DRJA 1FKLA 1R9HA 4QT3A 4TX0A 4DH0A 1L1PA 5HKGA 3O5LA 4IQ2A 3RGCA 3O5KA 3JYMA 3O5FA 2KGJA 3KAGA 4DZ3A 1M5YA 1Q6HA 5HWCA 5DIUA 4LAYA 1JNSA 2IF4A 2XP8A 4LAXA 4J4NA 1FKFA 1FKTA 1JNTA 1TCOC 1Y0OA 2VN1A 3O5DA 1QPFA 3ODKA 1A7XA 5DITA 4DROA 2L2SA 4ODRA 1EQ3A 2M08A 1YW5A 3OOBA 4U85A 2KR7A 2RUDA 1FKGA 1NMVA 1NSGA 4LAVA 1FKDA 2XP5A 3JXVA 4ITZA 3O5RA 1FD9A 4BF8A 2PPPA 2ZR6A 2XP4A 2RUQA 1Q1CA 3UI6A
chains in the Genus database with same CATH superfamily
2PV3A 2ZR5A 4MNLA 4ODLA 3CGMA 1LQ0A 2DSWA 3CH9A 2EULA 3UQBA 4IT4A 4DWSC 4IT6A 3NRKA 4DT4A 1ROTA 2B31A 2LJ4A 2PV2A 4AY1A 1CTNA 1D2KA 3ARWA 3UI5A 1OWQA 1UR8A 4ODKA 4ODPA 4W5UA 1W1TA 2PPNA 1NWUA 4FAPA 2UZ5A 4IQCA 1H0IA 1E6NA 4LAWA 4ZPTR 3EY6A 3RM8A 3RM9A 4L3NA 1D7IA 1RD6A 1ROUA 3KAFA 3CHFA 2ITKA 2A3AA 5B8IC 4W9QA 4UDMA 2DG3A 3WH0A 4JFIA 4P8WA 3O5GA 5HUAA 5DF0A 1FFQA 2DT3A 2MLXA 3UF8A 2RUCA 4ML4A 3O5IA 3B8SA 2MLYA 3KACA 3G6LA 1NWTA 2XP6A 1W9UA 2MLZA 3UQIA 1YATA 4QT2A 3ALFA 4MSPA 4MNJA 3IKGA 5GPRA 2XPAA 5HBFA 2K8IA 1W26A 4L72B 1EYMA 3ARPA 4O2TA 3PRDA 5HW6A 2MNTA 4MPKA 2A3EA 4P8UA 2F23A 1L1PA 4IQ2A 3RGCA 3JYMA 3O5FA 5HWCA 2WM0A 1JNSA 2DSZA 4LAXA 5DO2A 1JNTA 1Y0OA 1ITXA 1A7XA 4DROA 2L2SA 2DSUA 3RMEA 1E6ZA 3BMBA 4U85A 1FKGA 1NMVA 3O5RA 2ZR6A 2WK2A 3UI6A 4DRPA 3O5EA 4QIBA 1W1PA 4NNRA 4W9PA 5HWBA 1ZK6A 1D7HA 2IUZA 1LG1A 3ARSA 1GRJA 4XAKA 5HTGA 4FN2A 4MNKA 3WD1A 3AQUA 1HJVA 1XRVA 1ZU8A 2DG4A 3KZ7A 2OFNA 2MPHA 3OA5A 3GPKA 3NTPA 1LL4A 5HW8A 4WKFA 2MF9A 4DRMA 1FKKA 2LKNA 4LGXA 4J4OA 2FAPA 3KAIA 1GOIA 1QZ2A 2FDMA 3KADA 2F21A 1FKHA 3G6MA 2PPOA 4ODMA 3VAWA 2P4VA 3WL0A 3ARXA 3FXYA 1IX5A 4JFMA 3TCZA 4Q7NA 1NWRA 1FKIA 1HKKA 1W9VA 1D7JA 2AOSA 2RQSA 1EIBA 1ZBKA 4S3KA 2KFWA 1XHGA 1FAPA 4PTMA 3O5QA 2B5UB 4KQZA 1ZBVA 4DRIA 1UR9A 4Z2JA 1F8AB 1GUVA 5HT1A 3FAPA 4WKHA 1GPFA 3GTYX 2XP3A 2PN0A 3KCEA 1T11A 4DZ2A 3NI6A 4U86A 3AS3A 2ESCA 3TDBA 3ARTA 4WKAA 1QPLA 4G50A 1B6CA 3EIPA 4Z2IA 2KI3A 1E9LA 1E6RA 1C9HA 2PBCA 3AS2A 1ZL1A 1FKLA 3GU0A 5HKGA 3ARRA 1SYTA 3ARUA 3O5LA 3O5KA 1HKMA 2DSVA 4WIWA 2KGJA 2YBUA 2O92A 1KFWA 1Q6HA 5GQBA 4J4NA 3O5DA 3CZ8A 1TCOC 3QOKA 1QPFA 3ODKA 2ETNA 2O9OA 1YW5A 3B9AA 4LAVA 1NSGA 1E6PA 3WD2A 4ITZA 4BF8A 4HARA 2RUQA 1Q1CA 4R0XA 2RSEA 2F2DA 1HKJA 3O5MA 4DIPA 2DPEA 3O5PA 2DT1A 4G2PA 1BL4A 4JYSA 1HXVA 2Q5AA 3WQWA 4GGQA 3AROA 1EDQA 2AWGA 2M2AA 2Y78A 1LG2A 4Z2GA 3B9DA 1X6LA 1KT0A 5GPGA 4DWSA 1Q6UA 1P5QA 2XPBA 3ARZA 1U79A 1FKBA 4MAVA 3WQVA 2G41A 3IKDA 3AS1A 1E15A 4TYOA 3B7XA 4DRKA 4DWSD 1D6OA 1JNDA 3UQAA 4QZVB 4P8VA 1J4HA 3PRBA 1OGBA 2F4EA 3H9RB 3WL1A 2RURA 3WKZA 4DRQA 2WLZA 3FY1A 4R5EA 2N87A 3JYJA 3ARQA 5DIVA 1FKRA 2M1IA 1LL7A 4U84A 3PA7A 2ZQTA 4ODNA 1JVWA 4GIVA 1HJXA 1ZCNA 1J4RA 2JZVA 4W9OA 1PBKA 2VCDA 3UI4A 1FKJA 2DT0A 3O5OA 1J6YA 2PI6A 3I6CA 4C02B 3KAHA 1F40A 2ZR4A 4JFLA 3PRAA 1K9TA 2KO7A 2LPVA 3CHDA 1WNOA 4WJXA 4QT3A 1TFVA 4Z2LA 3KAGA 1M5YA 4LAYA 1VF8A 2XP8A 1FKFA 1FKTA 1LJYA 1WB0A 3ARYA 3OOBA 2KR7A 2OLHA 2RUDA 1FKDA 2XP5A 4MTVA 1FD9A 2PPPA 3AS0A 2XP4A 1W9PA 1ZB5A 1W1VA 2QF8A 5I98A 3CGNA 2KE0A 1X6NA 2FKEA 3MDYB 1NWSA 1SR0A 4TNSA 3RM4A 4KR0B 4DRHA 1FFRA 3LUOA 3CHCA 2DG9A 3WD3A 4Z2HA 1LL6A 1OGGA 2XP7A 4WK9A 3O5JA 5HW7A 1NMWA 3IK8A 3BXWA 1HKIA 1FJDA 1EHNA 3KABA 1J4IA 4ODOA 2ZQUA 5J6EA 3WD0A 3TC5A 3RFWA 1H0GA 5JH8A 4TW6A 3CHEA 4JFKA 5D75A 1ZBCA 4NSBA 4MGVA 4N19A 1BKFA 1JNEA 3B9EA 1O6IA 4IPXA 5DEZA 1W1YA 2ZQSA 2DT2A 4DWSB 3WD4A 4TW8A 4Z2KA 4DRNA 4P8XA 1Q6IA 4HBEA 4S3JA 1ZBWA 2A3CA 2WLYA 3W4RA 2ZQVA 2YBTA 4URIA 4NZCA 4ZS6A 1HJWA 4ZPWR 1KT1A 1N1AA 3WIJA 4Q22A 4MNMA 4JFJA 4ODQA 5BXJA 1PINA 2D9FA 2XP9A 2PV1A 1FKSA 1WAWA 4TW7A 2A3BA 2LGOA 3IHZA 4DRJA 1R9HA 4TX0A 2G8ZA 4DH0A 4ZPVR 1E44A 1JCHB 4DZ3A 4HBOA 1NH6A 5DIUA 2IF4A 2VN1A 1EQ3A 5DITA 3PR9A 4ODRA 2M08A 3ALGA 3JXVA 3ARVA
chains in the Genus database with same CATH topology
2PV3A 2ZR5A 4MNLA 4ODLA 3CGMA 1LQ0A 2DSWA 3CH9A 3UQBA 4IT4A 4DWSC 4IT6A 3NRKA 4DT4A 1ROTA 2B31A 2LJ4A 2PV2A 4AY1A 1CTNA 1D2KA 3ARWA 3UI5A 1OWQA 1UR8A 4ODKA 4ODPA 4W5UA 1W1TA 2PPNA 1NWUA 4FAPA 2UZ5A 4IQCA 1H0IA 1E6NA 4LAWA 4ZPTR 3EY6A 3RM8A 3RM9A 4L3NA 1D7IA 1RD6A 1ROUA 3KAFA 3CHFA 2ITKA 2A3AA 5B8IC 4W9QA 2DG3A 3WH0A 4JFIA 4P8WA 3O5GA 5HUAA 5DF0A 1FFQA 2DT3A 2MLXA 3UF8A 2RUCA 4ML4A 3O5IA 3B8SA 2MLYA 3KACA 3G6LA 1NWTA 2XP6A 1W9UA 2MLZA 3UQIA 1YATA 4QT2A 3ALFA 4MSPA 4MNJA 3IKGA 5GPRA 2XPAA 5HBFA 2K8IA 1W26A 4L72B 1EYMA 3ARPA 4O2TA 3PRDA 5HW6A 2MNTA 4MPKA 2A3EA 4P8UA 1L1PA 4IQ2A 3RGCA 3JYMA 3O5FA 5HWCA 2WM0A 1JNSA 2DSZA 4LAXA 5DO2A 1JNTA 1Y0OA 1ITXA 1A7XA 4DROA 2L2SA 2DSUA 3RMEA 1E6ZA 4U85A 1FKGA 1NMVA 3O5RA 2ZR6A 2WK2A 3UI6A 4DRPA 3O5EA 4QIBA 1W1PA 4NNRA 4W9PA 5HWBA 1ZK6A 1D7HA 2IUZA 1LG1A 3ARSA 4XAKA 5HTGA 4FN2A 4MNKA 3WD1A 3AQUA 1HJVA 1XRVA 1ZU8A 2DG4A 3KZ7A 2OFNA 2MPHA 3OA5A 3GPKA 3NTPA 1LL4A 5HW8A 4WKFA 2MF9A 4DRMA 1FKKA 2LKNA 4LGXA 4J4OA 2FAPA 3KAIA 1GOIA 1QZ2A 2FDMA 3KADA 2F21A 1FKHA 3G6MA 2PPOA 4ODMA 3VAWA 3WL0A 3ARXA 3FXYA 1IX5A 4JFMA 3TCZA 4Q7NA 1NWRA 1FKIA 1HKKA 1W9VA 1D7JA 2AOSA 2RQSA 1EIBA 1ZBKA 4S3KA 2KFWA 1XHGA 1FAPA 4PTMA 3O5QA 4KQZA 1ZBVA 4DRIA 1UR9A 4Z2JA 1F8AB 1GUVA 5HT1A 3FAPA 4WKHA 1GPFA 2XP3A 3KCEA 4DZ2A 1T11A 3NI6A 4U86A 3AS3A 2ESCA 3TDBA 3ARTA 4WKAA 1QPLA 4G50A 1B6CA 4Z2IA 2KI3A 1E9LA 1E6RA 1C9HA 2PBCA 3AS2A 1ZL1A 1FKLA 5HKGA 3ARRA 1SYTA 3ARUA 3O5LA 3O5KA 1HKMA 2DSVA 4WIWA 2KGJA 2YBUA 2O92A 1KFWA 1Q6HA 5GQBA 4J4NA 3O5DA 3CZ8A 1TCOC 3QOKA 1QPFA 3ODKA 2O9OA 1YW5A 3B9AA 4LAVA 1NSGA 1E6PA 3WD2A 4ITZA 4BF8A 4HARA 2RUQA 1Q1CA 4R0XA 2RSEA 2F2DA 1HKJA 3O5MA 4DIPA 2DPEA 3O5PA 2DT1A 4G2PA 1BL4A 4JYSA 1HXVA 2Q5AA 3WQWA 4GGQA 3AROA 1EDQA 2AWGA 2M2AA 2Y78A 1LG2A 4Z2GA 3B9DA 1X6LA 1KT0A 5GPGA 4DWSA 1Q6UA 1P5QA 2XPBA 3ARZA 1U79A 1FKBA 4MAVA 3WQVA 2G41A 3IKDA 3AS1A 1E15A 4TYOA 3B7XA 4DRKA 4DWSD 1D6OA 1JNDA 3UQAA 4QZVB 4P8VA 1J4HA 3PRBA 1OGBA 2F4EA 3H9RB 3WL1A 2RURA 3WKZA 4DRQA 2WLZA 3FY1A 4R5EA 2N87A 3JYJA 3ARQA 5DIVA 1FKRA 2M1IA 1LL7A 4U84A 3PA7A 2ZQTA 4ODNA 1JVWA 4GIVA 1HJXA 1ZCNA 1J4RA 2JZVA 4W9OA 1PBKA 2VCDA 3UI4A 1FKJA 2DT0A 3O5OA 1J6YA 2PI6A 3I6CA 4C02B 3KAHA 1F40A 2ZR4A 4JFLA 3PRAA 1K9TA 2KO7A 2LPVA 3CHDA 1WNOA 4WJXA 4QT3A 1TFVA 4Z2LA 3KAGA 1M5YA 4LAYA 1VF8A 2XP8A 1FKFA 1FKTA 1LJYA 1WB0A 3ARYA 3OOBA 2KR7A 2OLHA 2RUDA 1FKDA 2XP5A 4MTVA 1FD9A 2PPPA 3AS0A 2XP4A 1W9PA 1ZB5A 1W1VA 2QF8A 5I98A 3CGNA 2KE0A 1X6NA 2FKEA 3MDYB 1NWSA 1SR0A 4TNSA 3RM4A 4KR0B 4DRHA 1FFRA 3LUOA 3CHCA 2DG9A 3WD3A 4Z2HA 1LL6A 1OGGA 2XP7A 4WK9A 3O5JA 5HW7A 1NMWA 3IK8A 3BXWA 1HKIA 1FJDA 1EHNA 3KABA 1J4IA 4ODOA 2ZQUA 5J6EA 3WD0A 3TC5A 3RFWA 1H0GA 5JH8A 4TW6A 3CHEA 4JFKA 5D75A 1ZBCA 4NSBA 4MGVA 4N19A 1BKFA 1JNEA 3B9EA 1O6IA 4IPXA 5DEZA 1W1YA 2ZQSA 2DT2A 4DWSB 3WD4A 4TW8A 4Z2KA 4DRNA 4P8XA 1Q6IA 4HBEA 4S3JA 1ZBWA 2A3CA 2WLYA 3W4RA 2ZQVA 2YBTA 4URIA 4NZCA 4ZS6A 1HJWA 4ZPWR 1KT1A 1N1AA 3WIJA 4Q22A 4MNMA 4JFJA 4ODQA 5BXJA 1PINA 2D9FA 2XP9A 2PV1A 1FKSA 1WAWA 4TW7A 2A3BA 2LGOA 3IHZA 4DRJA 1R9HA 4TX0A 2G8ZA 4DH0A 4ZPVR 4DZ3A 4HBOA 1NH6A 5DIUA 2IF4A 2VN1A 1EQ3A 5DITA 3PR9A 4ODRA 2M08A 3ALGA 3JXVA 3ARVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRP A;  2PV3 A;  4R0X A;  2RSE A;  3O5E A;  4QIB A;  2ZR5 A;  2F2D A;  4NNR A;  3O5M A;  4W9P A;  4ODL A;  5HWB A;  5I98 A;  3CGN A;  1ZK6 A;  3CGM A;  1D7H A;  2KE0 A;  4DIP A;  2FKE A;  3UQB A;  3MDY B;  3O5P A;  4FN2 A;  4G2P A;  1BL4 A;  4JYS A;  5HTG A;  1HXV A;  3NRK A;  4TNS A;  2Q5A A;  4DT4 A;  1ROT A;  2DG4 A;  2LJ4 A;  2PV2 A;  3KZ7 A;  4GGQ A;  2OFN A;  2MPH A;  3GPK A;  4DRH A;  2AWG A;  3NTP A;  3LUO A;  2DG9 A;  2M2A A;  5HW8 A;  3UI5 A;  2Y78 A;  4ODK A;  4ODP A;  2PPN A;  2MF9 A;  2XP7 A;  4FAP A;  3O5J A;  4DRM A;  5HW7 A;  2UZ5 A;  1KT0 A;  4IQC A;  5GPG A;  1FKK A;  1NMW A;  2LKN A;  1Q6U A;  4LAW A;  3IK8 A;  1P5Q A;  2XPB A;  3EY6 A;  4J4O A;  1FJD A;  2FAP A;  3KAI A;  1U79 A;  1J4I A;  1D7I A;  3KAB A;  1FKB A;  4ODO A;  1QZ2 A;  2ZQU A;  3IKD A;  1ROU A;  3KAF A;  4TYO A;  3KAD A;  5J6E A;  2F21 A;  1FKH A;  3TC5 A;  2ITK A;  2PPO A;  4ODM A;  3B7X A;  3RFW A;  3VAW A;  5B8I C;  4TW6 A;  4W9Q A;  4DRK A;  1D6O A;  4JFK A;  2DG3 A;  5D75 A;  3UQA A;  3WH0 A;  4JFI A;  1J4H A;  3PRB A;  4MGV A;  4N19 A;  2F4E A;  1BKF A;  3H9R B;  3O5G A;  4IPX A;  4JFM A;  3TCZ A;  5HUA A;  2RUR A;  1FKI A;  2ZQS A;  4DRQ A;  1D7J A;  2MLX A;  3UF8 A;  2RQS A;  2RUC A;  3O5I A;  2N87 A;  2KFW A;  3JYJ A;  4TW8 A;  2MLY A;  1FAP A;  4DRN A;  3KAC A;  1Q6I A;  3O5Q A;  5DIV A;  1FKR A;  2M1I A;  2XP6 A;  4DRI A;  4U84 A;  3PA7 A;  2ZQV A;  1F8A B;  5HT1 A;  2MLZ A;  2ZQT A;  3FAP A;  4ODN A;  1JVW A;  1YAT A;  4GIV A;  4QT2 A;  3UQI A;  2XP3 A;  3KCE A;  4DZ2 A;  1T11 A;  4MSP A;  1ZCN A;  3IKG A;  3NI6 A;  4U86 A;  1J4R A;  2JZV A;  4W9O A;  1PBK A;  2XPA A;  2VCD A;  2K8I A;  1KT1 A;  1N1A A;  3UI4 A;  1FKJ A;  3O5O A;  3TDB A;  1J6Y A;  4C02 B;  3I6C A;  1W26 A;  4JFJ A;  4ODQ A;  3KAH A;  5BXJ A;  1F40 A;  1PIN A;  1QPL A;  2ZR4 A;  1EYM A;  2D9F A;  4JFL A;  2XP9 A;  4G50 A;  2PV1 A;  1B6C A;  1FKS A;  4O2T A;  2KI3 A;  2KO7 A;  3PRD A;  2LPV A;  4TW7 A;  5HW6 A;  2MNT A;  2LGO A;  1C9H A;  2PBC A;  3IHZ A;  4DRJ A;  1FKL A;  1R9H A;  4QT3 A;  4TX0 A;  4DH0 A;  1L1P A;  5HKG A;  3O5L A;  4IQ2 A;  3RGC A;  3O5K A;  3JYM A;  3O5F A;  2KGJ A;  3KAG A;  4DZ3 A;  1M5Y A;  1Q6H A;  5HWC A;  5DIU A;  4LAY A;  1JNS A;  2IF4 A;  2XP8 A;  4LAX A;  4J4N A;  1FKF A;  1FKT A;  1JNT A;  1TCO C;  1Y0O A;  2VN1 A;  3O5D A;  1QPF A;  3ODK A;  1A7X A;  5DIT A;  4DRO A;  2L2S A;  4ODR A;  1EQ3 A;  2M08 A;  1YW5 A;  3OOB A;  4U85 A;  2KR7 A;  2RUD A;  1FKG A;  1NMV A;  1NSG A;  4LAV A;  1FKD A;  2XP5 A;  3JXV A;  4ITZ A;  3O5R A;  1FD9 A;  4BF8 A;  2PPP A;  2ZR6 A;  2XP4 A;  2RUQ A;  1Q1C A;  3UI6 A; 
#chains in the Genus database with same CATH topology
 2PV3 A;  2ZR5 A;  4MNL A;  4ODL A;  3CGM A;  1LQ0 A;  2DSW A;  3CH9 A;  2EUL A;  3UQB A;  4IT4 A;  4DWS C;  4IT6 A;  3NRK A;  4DT4 A;  1ROT A;  2B31 A;  2LJ4 A;  2PV2 A;  4AY1 A;  1CTN A;  1D2K A;  3ARW A;  3UI5 A;  1OWQ A;  1UR8 A;  4ODK A;  4ODP A;  4W5U A;  1W1T A;  2PPN A;  1NWU A;  4FAP A;  2UZ5 A;  4IQC A;  1H0I A;  1E6N A;  4LAW A;  4ZPT R;  3EY6 A;  3RM8 A;  3RM9 A;  4L3N A;  1D7I A;  1RD6 A;  1ROU A;  3KAF A;  3CHF A;  2ITK A;  2A3A A;  5B8I C;  4W9Q A;  4UDM A;  2DG3 A;  3WH0 A;  4JFI A;  4P8W A;  3O5G A;  5HUA A;  5DF0 A;  1FFQ A;  2DT3 A;  2MLX A;  3UF8 A;  2RUC A;  4ML4 A;  3O5I A;  3B8S A;  2MLY A;  3KAC A;  3G6L A;  1NWT A;  2XP6 A;  1W9U A;  2MLZ A;  3UQI A;  1YAT A;  4QT2 A;  3ALF A;  4MSP A;  4MNJ A;  3IKG A;  5GPR A;  2XPA A;  5HBF A;  2K8I A;  1W26 A;  4L72 B;  1EYM A;  3ARP A;  4O2T A;  3PRD A;  5HW6 A;  2MNT A;  4MPK A;  2A3E A;  4P8U A;  2F23 A;  1L1P A;  4IQ2 A;  3RGC A;  3JYM A;  3O5F A;  5HWC A;  2WM0 A;  1JNS A;  2DSZ A;  4LAX A;  5DO2 A;  1JNT A;  1Y0O A;  1ITX A;  1A7X A;  4DRO A;  2L2S A;  2DSU A;  3RME A;  1E6Z A;  3BMB A;  4U85 A;  1FKG A;  1NMV A;  3O5R A;  2ZR6 A;  2WK2 A;  3UI6 A;  4DRP A;  3O5E A;  4QIB A;  1W1P A;  4NNR A;  4W9P A;  5HWB A;  1ZK6 A;  1D7H A;  2IUZ A;  1LG1 A;  3ARS A;  1GRJ A;  4XAK A;  5HTG A;  4FN2 A;  4MNK A;  3WD1 A;  3AQU A;  1HJV A;  1XRV A;  1ZU8 A;  2DG4 A;  3KZ7 A;  2OFN A;  2MPH A;  3OA5 A;  3GPK A;  3NTP A;  1LL4 A;  5HW8 A;  4WKF A;  2MF9 A;  4DRM A;  1FKK A;  2LKN A;  4LGX A;  4J4O A;  2FAP A;  3KAI A;  1GOI A;  1QZ2 A;  2FDM A;  3KAD A;  2F21 A;  1FKH A;  3G6M A;  2PPO A;  4ODM A;  3VAW A;  2P4V A;  3WL0 A;  3ARX A;  3FXY A;  1IX5 A;  4JFM A;  3TCZ A;  4Q7N A;  1NWR A;  1FKI A;  1HKK A;  1W9V A;  1D7J A;  2AOS A;  2RQS A;  1EIB A;  1ZBK A;  4S3K A;  2KFW A;  1XHG A;  1FAP A;  4PTM A;  3O5Q A;  2B5U B;  4KQZ A;  1ZBV A;  4DRI A;  1UR9 A;  4Z2J A;  1F8A B;  1GUV A;  5HT1 A;  3FAP A;  4WKH A;  1GPF A;  3GTY X;  2XP3 A;  2PN0 A;  3KCE A;  1T11 A;  4DZ2 A;  3NI6 A;  4U86 A;  3AS3 A;  2ESC A;  3TDB A;  3ART A;  4WKA A;  1QPL A;  4G50 A;  1B6C A;  3EIP A;  4Z2I A;  2KI3 A;  1E9L A;  1E6R A;  1C9H A;  2PBC A;  3AS2 A;  1ZL1 A;  1FKL A;  3GU0 A;  5HKG A;  3ARR A;  1SYT A;  3ARU A;  3O5L A;  3O5K A;  1HKM A;  2DSV A;  4WIW A;  2KGJ A;  2YBU A;  2O92 A;  1KFW A;  1Q6H A;  5GQB A;  4J4N A;  3O5D A;  3CZ8 A;  1TCO C;  3QOK A;  1QPF A;  3ODK A;  2ETN A;  2O9O A;  1YW5 A;  3B9A A;  4LAV A;  1NSG A;  1E6P A;  3WD2 A;  4ITZ A;  4BF8 A;  4HAR A;  2RUQ A;  1Q1C A;  4R0X A;  2RSE A;  2F2D A;  1HKJ A;  3O5M A;  4DIP A;  2DPE A;  3O5P A;  2DT1 A;  4G2P A;  1BL4 A;  4JYS A;  1HXV A;  2Q5A A;  3WQW A;  4GGQ A;  3ARO A;  1EDQ A;  2AWG A;  2M2A A;  2Y78 A;  1LG2 A;  4Z2G A;  3B9D A;  1X6L A;  1KT0 A;  5GPG A;  4DWS A;  1Q6U A;  1P5Q A;  2XPB A;  3ARZ A;  1U79 A;  1FKB A;  4MAV A;  3WQV A;  2G41 A;  3IKD A;  3AS1 A;  1E15 A;  4TYO A;  3B7X A;  4DRK A;  4DWS D;  1D6O A;  1JND A;  3UQA A;  4QZV B;  4P8V A;  1J4H A;  3PRB A;  1OGB A;  2F4E A;  3H9R B;  3WL1 A;  2RUR A;  3WKZ A;  4DRQ A;  2WLZ A;  3FY1 A;  4R5E A;  2N87 A;  3JYJ A;  3ARQ A;  5DIV A;  1FKR A;  2M1I A;  1LL7 A;  4U84 A;  3PA7 A;  2ZQT A;  4ODN A;  1JVW A;  4GIV A;  1HJX A;  1ZCN A;  1J4R A;  2JZV A;  4W9O A;  1PBK A;  2VCD A;  3UI4 A;  1FKJ A;  2DT0 A;  3O5O A;  1J6Y A;  2PI6 A;  3I6C A;  4C02 B;  3KAH A;  1F40 A;  2ZR4 A;  4JFL A;  3PRA A;  1K9T A;  2KO7 A;  2LPV A;  3CHD A;  1WNO A;  4WJX A;  4QT3 A;  1TFV A;  4Z2L A;  3KAG A;  1M5Y A;  4LAY A;  1VF8 A;  2XP8 A;  1FKF A;  1FKT A;  1LJY A;  1WB0 A;  3ARY A;  3OOB A;  2KR7 A;  2OLH A;  2RUD A;  1FKD A;  2XP5 A;  4MTV A;  1FD9 A;  2PPP A;  3AS0 A;  2XP4 A;  1W9P A;  1ZB5 A;  1W1V A;  2QF8 A;  5I98 A;  3CGN A;  2KE0 A;  1X6N A;  2FKE A;  3MDY B;  1NWS A;  1SR0 A;  4TNS A;  3RM4 A;  4KR0 B;  4DRH A;  1FFR A;  3LUO A;  3CHC A;  2DG9 A;  3WD3 A;  4Z2H A;  1LL6 A;  1OGG A;  2XP7 A;  4WK9 A;  3O5J A;  5HW7 A;  1NMW A;  3IK8 A;  3BXW A;  1HKI A;  1FJD A;  1EHN A;  3KAB A;  1J4I A;  4ODO A;  2ZQU A;  5J6E A;  3WD0 A;  3TC5 A;  3RFW A;  1H0G A;  5JH8 A;  4TW6 A;  3CHE A;  4JFK A;  5D75 A;  1ZBC A;  4NSB A;  4MGV A;  4N19 A;  1BKF A;  1JNE A;  3B9E A;  1O6I A;  4IPX A;  5DEZ A;  1W1Y A;  2ZQS A;  2DT2 A;  4DWS B;  3WD4 A;  4TW8 A;  4Z2K A;  4DRN A;  4P8X A;  1Q6I A;  4HBE A;  4S3J A;  1ZBW A;  2A3C A;  2WLY A;  3W4R A;  2ZQV A;  2YBT A;  4URI A;  4NZC A;  4ZS6 A;  1HJW A;  4ZPW R;  1KT1 A;  1N1A A;  3WIJ A;  4Q22 A;  4MNM A;  4JFJ A;  4ODQ A;  5BXJ A;  1PIN A;  2D9F A;  2XP9 A;  2PV1 A;  1FKS A;  1WAW A;  4TW7 A;  2A3B A;  2LGO A;  3IHZ A;  4DRJ A;  1R9H A;  4TX0 A;  2G8Z A;  4DH0 A;  4ZPV R;  1E44 A;  1JCH B;  4DZ3 A;  4HBO A;  1NH6 A;  5DIU A;  2IF4 A;  2VN1 A;  1EQ3 A;  5DIT A;  3PR9 A;  4ODR A;  2M08 A;  3ALG A;  3JXV A;  3ARV A; 
#chains in the Genus database with same CATH homology
 2PV3 A;  2ZR5 A;  4MNL A;  4ODL A;  3CGM A;  1LQ0 A;  2DSW A;  3CH9 A;  3UQB A;  4IT4 A;  4DWS C;  4IT6 A;  3NRK A;  4DT4 A;  1ROT A;  2B31 A;  2LJ4 A;  2PV2 A;  4AY1 A;  1CTN A;  1D2K A;  3ARW A;  3UI5 A;  1OWQ A;  1UR8 A;  4ODK A;  4ODP A;  4W5U A;  1W1T A;  2PPN A;  1NWU A;  4FAP A;  2UZ5 A;  4IQC A;  1H0I A;  1E6N A;  4LAW A;  4ZPT R;  3EY6 A;  3RM8 A;  3RM9 A;  4L3N A;  1D7I A;  1RD6 A;  1ROU A;  3KAF A;  3CHF A;  2ITK A;  2A3A A;  5B8I C;  4W9Q A;  2DG3 A;  3WH0 A;  4JFI A;  4P8W A;  3O5G A;  5HUA A;  5DF0 A;  1FFQ A;  2DT3 A;  2MLX A;  3UF8 A;  2RUC A;  4ML4 A;  3O5I A;  3B8S A;  2MLY A;  3KAC A;  3G6L A;  1NWT A;  2XP6 A;  1W9U A;  2MLZ A;  3UQI A;  1YAT A;  4QT2 A;  3ALF A;  4MSP A;  4MNJ A;  3IKG A;  5GPR A;  2XPA A;  5HBF A;  2K8I A;  1W26 A;  4L72 B;  1EYM A;  3ARP A;  4O2T A;  3PRD A;  5HW6 A;  2MNT A;  4MPK A;  2A3E A;  4P8U A;  1L1P A;  4IQ2 A;  3RGC A;  3JYM A;  3O5F A;  5HWC A;  2WM0 A;  1JNS A;  2DSZ A;  4LAX A;  5DO2 A;  1JNT A;  1Y0O A;  1ITX A;  1A7X A;  4DRO A;  2L2S A;  2DSU A;  3RME A;  1E6Z A;  4U85 A;  1FKG A;  1NMV A;  3O5R A;  2ZR6 A;  2WK2 A;  3UI6 A;  4DRP A;  3O5E A;  4QIB A;  1W1P A;  4NNR A;  4W9P A;  5HWB A;  1ZK6 A;  1D7H A;  2IUZ A;  1LG1 A;  3ARS A;  4XAK A;  5HTG A;  4FN2 A;  4MNK A;  3WD1 A;  3AQU A;  1HJV A;  1XRV A;  1ZU8 A;  2DG4 A;  3KZ7 A;  2OFN A;  2MPH A;  3OA5 A;  3GPK A;  3NTP A;  1LL4 A;  5HW8 A;  4WKF A;  2MF9 A;  4DRM A;  1FKK A;  2LKN A;  4LGX A;  4J4O A;  2FAP A;  3KAI A;  1GOI A;  1QZ2 A;  2FDM A;  3KAD A;  2F21 A;  1FKH A;  3G6M A;  2PPO A;  4ODM A;  3VAW A;  3WL0 A;  3ARX A;  3FXY A;  1IX5 A;  4JFM A;  3TCZ A;  4Q7N A;  1NWR A;  1FKI A;  1HKK A;  1W9V A;  1D7J A;  2AOS A;  2RQS A;  1EIB A;  1ZBK A;  4S3K A;  2KFW A;  1XHG A;  1FAP A;  4PTM A;  3O5Q A;  4KQZ A;  1ZBV A;  4DRI A;  1UR9 A;  4Z2J A;  1F8A B;  1GUV A;  5HT1 A;  3FAP A;  4WKH A;  1GPF A;  2XP3 A;  3KCE A;  4DZ2 A;  1T11 A;  3NI6 A;  4U86 A;  3AS3 A;  2ESC A;  3TDB A;  3ART A;  4WKA A;  1QPL A;  4G50 A;  1B6C A;  4Z2I A;  2KI3 A;  1E9L A;  1E6R A;  1C9H A;  2PBC A;  3AS2 A;  1ZL1 A;  1FKL A;  5HKG A;  3ARR A;  1SYT A;  3ARU A;  3O5L A;  3O5K A;  1HKM A;  2DSV A;  4WIW A;  2KGJ A;  2YBU A;  2O92 A;  1KFW A;  1Q6H A;  5GQB A;  4J4N A;  3O5D A;  3CZ8 A;  1TCO C;  3QOK A;  1QPF A;  3ODK A;  2O9O A;  1YW5 A;  3B9A A;  4LAV A;  1NSG A;  1E6P A;  3WD2 A;  4ITZ A;  4BF8 A;  4HAR A;  2RUQ A;  1Q1C A;  4R0X A;  2RSE A;  2F2D A;  1HKJ A;  3O5M A;  4DIP A;  2DPE A;  3O5P A;  2DT1 A;  4G2P A;  1BL4 A;  4JYS A;  1HXV A;  2Q5A A;  3WQW A;  4GGQ A;  3ARO A;  1EDQ A;  2AWG A;  2M2A A;  2Y78 A;  1LG2 A;  4Z2G A;  3B9D A;  1X6L A;  1KT0 A;  5GPG A;  4DWS A;  1Q6U A;  1P5Q A;  2XPB A;  3ARZ A;  1U79 A;  1FKB A;  4MAV A;  3WQV A;  2G41 A;  3IKD A;  3AS1 A;  1E15 A;  4TYO A;  3B7X A;  4DRK A;  4DWS D;  1D6O A;  1JND A;  3UQA A;  4QZV B;  4P8V A;  1J4H A;  3PRB A;  1OGB A;  2F4E A;  3H9R B;  3WL1 A;  2RUR A;  3WKZ A;  4DRQ A;  2WLZ A;  3FY1 A;  4R5E A;  2N87 A;  3JYJ A;  3ARQ A;  5DIV A;  1FKR A;  2M1I A;  1LL7 A;  4U84 A;  3PA7 A;  2ZQT A;  4ODN A;  1JVW A;  4GIV A;  1HJX A;  1ZCN A;  1J4R A;  2JZV A;  4W9O A;  1PBK A;  2VCD A;  3UI4 A;  1FKJ A;  2DT0 A;  3O5O A;  1J6Y A;  2PI6 A;  3I6C A;  4C02 B;  3KAH A;  1F40 A;  2ZR4 A;  4JFL A;  3PRA A;  1K9T A;  2KO7 A;  2LPV A;  3CHD A;  1WNO A;  4WJX A;  4QT3 A;  1TFV A;  4Z2L A;  3KAG A;  1M5Y A;  4LAY A;  1VF8 A;  2XP8 A;  1FKF A;  1FKT A;  1LJY A;  1WB0 A;  3ARY A;  3OOB A;  2KR7 A;  2OLH A;  2RUD A;  1FKD A;  2XP5 A;  4MTV A;  1FD9 A;  2PPP A;  3AS0 A;  2XP4 A;  1W9P A;  1ZB5 A;  1W1V A;  2QF8 A;  5I98 A;  3CGN A;  2KE0 A;  1X6N A;  2FKE A;  3MDY B;  1NWS A;  1SR0 A;  4TNS A;  3RM4 A;  4KR0 B;  4DRH A;  1FFR A;  3LUO A;  3CHC A;  2DG9 A;  3WD3 A;  4Z2H A;  1LL6 A;  1OGG A;  2XP7 A;  4WK9 A;  3O5J A;  5HW7 A;  1NMW A;  3IK8 A;  3BXW A;  1HKI A;  1FJD A;  1EHN A;  3KAB A;  1J4I A;  4ODO A;  2ZQU A;  5J6E A;  3WD0 A;  3TC5 A;  3RFW A;  1H0G A;  5JH8 A;  4TW6 A;  3CHE A;  4JFK A;  5D75 A;  1ZBC A;  4NSB A;  4MGV A;  4N19 A;  1BKF A;  1JNE A;  3B9E A;  1O6I A;  4IPX A;  5DEZ A;  1W1Y A;  2ZQS A;  2DT2 A;  4DWS B;  3WD4 A;  4TW8 A;  4Z2K A;  4DRN A;  4P8X A;  1Q6I A;  4HBE A;  4S3J A;  1ZBW A;  2A3C A;  2WLY A;  3W4R A;  2ZQV A;  2YBT A;  4URI A;  4NZC A;  4ZS6 A;  1HJW A;  4ZPW R;  1KT1 A;  1N1A A;  3WIJ A;  4Q22 A;  4MNM A;  4JFJ A;  4ODQ A;  5BXJ A;  1PIN A;  2D9F A;  2XP9 A;  2PV1 A;  1FKS A;  1WAW A;  4TW7 A;  2A3B A;  2LGO A;  3IHZ A;  4DRJ A;  1R9H A;  4TX0 A;  2G8Z A;  4DH0 A;  4ZPV R;  4DZ3 A;  4HBO A;  1NH6 A;  5DIU A;  2IF4 A;  2VN1 A;  1EQ3 A;  5DIT A;  3PR9 A;  4ODR A;  2M08 A;  3ALG A;  3JXV A;  3ARV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...