1PBKA

Homologous domain of human fkbp25
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
116
structure length
116
Chain Sequence
PKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human 25 kDa FK506 binding protein complexed with rapamycin.
pubmed rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FKBP25
total genus 23
structure length 116
sequence length 116
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1pbkA00
4DRPA 3KAIA 3VAWA 1FKIA 2ZR6A 2KGJA 4JFMA 1N1AA 2LPVA 2MLZA 3MDYB 3JYJA 1J4HA 4IQCA 2ZQTA 4TNSA 1D7JA 1PBKA 1W26A 4W9QA 1FAPA 1NMVA 4W9PA 4DRKA 1FKGA 1JVWA 4MGVA 3I6CA 4ODPA 1JNTA 3O5JA 3UF8A 2ZQVA 1Y0OA 2DG3A 4TW6A 2FAPA 4QIBA 3UI5A 4BF8A 3O5GA 1D7HA 4DRMA 2F4EA 2KE0A 1KT0A 4DRNA 3O5KA 3JYMA 2PV1A 1ROUA 2XP3A 3TC5A 1FKJA 2KR7A 4U84A 5HUAA 1Q6UA 2LKNA 4G50A 1B6CA 2ITKA 2XP5A 2DG4A 3UI6A 1J6YA 1FD9A 1T11A 5HW7A 3KACA 1QPFA 3IKDA 4IQ2A 2XP6A 2LJ4A 4JFKA 3TDBA 2VCDA 1C9HA 4U86A 4DRQA 1F40A 3LUOA 2XP4A 4MSPA 1FKFA 3O5PA 4LAWA 3O5DA 5HT1A 1EYMA 2RQSA 2D9FA 2KO7A 2F2DA 4JFLA 2PPOA 1J4RA 4TW7A 5HWCA 2ZQUA 1A7XA 1D7IA 4ODNA 5D75A 2M2AA 2ZR5A 3KAFA 3O5LA 3NRKA 4ODRA 3RGCA 4J4OA 3TCZA 3RFWA 2RUDA 4DRIA 4DROA 2Q5AA 2MLYA 2JZVA 3O5IA 2FKEA 3EY6A 1FKRA 2IF4A 1EQ3A 4TW8A 4DRHA 2XP8A 1FKKA 1YW5A 4G2PA 3PA7A 3KZ7A 3B7XA 4JFJA 4JYSA 5I98A 5HW6A 5HW8A 1FKHA 1ZK6A 5HWBA 2PPNA 1FKBA 5GPGA 5J6EA 2Y78A 1M5YA 4FN2A 2ZQSA 2N87A 3IKGA 3O5FA 4J4NA 4LAVA 1FKSA 4NNRA 1TCOC 4JFIA 2RSEA 2UZ5A 4GGQA 2M08A 4QT2A 2AWGA 4U85A 3IK8A 2DG9A 4DIPA 4R0XA 3NTPA 3PRBA 4O2TA 2XP7A 2MNTA 1FKTA 2LGOA 1BL4A 2M1IA 2ZR4A 1ZCNA 3GPKA 3KAGA 1P5QA 4IPXA 1R9HA 4TYOA 5HTGA 3KADA 2KFWA 4N19A 2MLXA 3UQBA 2MF9A 5DIVA 3H9RB 3O5EA 2PPPA 4TX0A 3JXVA 5BXJA 1YATA 3IHZA 3O5QA 2L2SA 1D6OA 3UQAA 2MPHA 1ROTA 1KT1A 1FKLA 2RUCA 2KI3A 4DT4A 1QZ2A 4ODMA 1HXVA 1Q6IA 1FKDA 3ODKA 3O5OA 3UQIA 1JNSA 2XP9A 4C02B 1BKFA 2XPAA 4DH0A 4GIVA 3FAPA 4ITZA 3NI6A 1F8AB 1NSGA 4W9OA 1NMWA 3CGMA 4ODKA 1L1PA 3CGNA 4LAYA 2VN1A 3OOBA 1Q1CA 2F21A 4DRJA 1FJDA 2PV2A 4LAXA 5DITA 2OFNA 3PRDA 3O5MA 3KABA 3KAHA 5B8IC 4DZ2A 2RURA 5HKGA 4FAPA 1Q6HA 5DIUA 3KCEA 3O5RA 1PINA 1QPLA 1J4IA 4ODOA 2RUQA 4QT3A 3UI4A 2XPBA 4DZ3A 2PBCA 2K8IA 4ODLA 4ODQA 2PV3A 1U79A 3WH0A
chains in the Genus database with same CATH superfamily
4JFMA 3RM9A 1FJDA 1J4HA 4IQCA 1D7JA 1PBKA 1FKGA 1E15A 2DPEA 3ARYA 3UI5A 2ZQVA 4TW6A 1H0IA 3WIJA 1D7HA 4DRMA 2F4EA 2KE0A 3O5KA 3JYMA 2PV1A 1XRVA 2XP3A 3TC5A 2O92A 1HJXA 3PR9A 4KR0B 2YBUA 4KQZA 5HW7A 1GOIA 1RD6A 1NWUA 4NSBA 1D2KA 1W1TA 2RQSA 3WKZA 2F2DA 4URIA 1EDQA 1D7IA 2B31A 4ZPTR 3ARXA 3FXYA 3AROA 2M2AA 2QF8A 4QZVB 4MNKA 4DWSA 3RFWA 4HARA 3WQWA 4XAKA 1ZBVA 3O5IA 2JZVA 5DF0A 2AOSA 2IF4A 1YW5A 4Z2JA 2DSZA 5I98A 5HW8A 2P4VA 3WL1A 5HWBA 4MNLA 5GPGA 2Y78A 1M5YA 3O5FA 1W9PA 2DT3A 1X6NA 4LAVA 1CTNA 3ALFA 1TCOC 1HJWA 2UZ5A 3ARQA 2AWGA 4U85A 2PN0A 4DIPA 2M1IA 1ZCNA 2A3BA 3AQUA 2MLXA 2PPPA 1YATA 2OLHA 2RUCA 2ETNA 1FKDA 3ODKA 3O5OA 1JNSA 2DSUA 4WKFA 2XPAA 1NH6A 3AS1A 4Z2IA 1TFVA 2VN1A 2F21A 4DRJA 5DITA 2OFNA 2RURA 5HKGA 1OGBA 3O5RA 4P8UA 3UI4A 2XPBA 3WL0A 2K8IA 1FFRA 4ODQA 3B9DA 4DRPA 1GUVA 2A3AA 3KAIA 1N1AA 3MDYB 3JYJA 4DRKA 4W9QA 1NMVA 3I6CA 1JNTA 3UF8A 3RMEA 4Q22A 1UR8A 3RM8A 3WD2A 1FKJA 1XHGA 5GQBA 4P8VA 1J6YA 1FD9A 1ZBKA 4IQ2A 2XP6A 4JFKA 1E6NA 1HJVA 3ARTA 4MSPA 1KFWA 3RM4A 3BXWA 3AS0A 1FKFA 2G41A 2DSVA 2PPOA 4ZPWR 2F23A 4TW7A 5HWCA 2A3CA 4J4OA 4DROA 2B5UB 2MLYA 1FKRA 2G8ZA 1EIBA 1EQ3A 2DSWA 4DRHA 1FKKA 4G2PA 3KZ7A 1FKHA 3B8SA 4FN2A 2N87A 1LG1A 3PRBA 2ZR4A 3ARVA 4TYOA 2KFWA 1WAWA 2EULA 3H9RB 3WQVA 3CH9A 3WD3A 3UQAA 4DT4A 4C02B 1BKFA 4P8WA 3FAPA 4ITZA 1F8AB 1NSGA 3CGMA 4ODKA 4LAYA 2WLYA 3OOBA 1Q1CA 4AY1A 2PV2A 1JNEA 2WK2A 4FAPA 5DIUA 3KCEA 1X6LA 4MNJA 1LJYA 4QT3A 3GU0A 2PBCA 1H0GA 3ARPA 4ODLA 1GPFA 1ITXA 3QOKA 3WH0A 3VAWA 2ZR6A 3FY1A 4S3KA 3CHEA 2ZQTA 4TNSA 4WKHA 5GPRA 1JVWA 1W1YA 4MGVA 5JH8A 2DG3A 4W5UA 2FAPA 4BF8A 4LGXA 4DWSC 1W1PA 4L3NA 1ROUA 4WJXA 1ZU8A 2KR7A 4PTMA 5HUAA 1Q6UA 2LKNA 1E6ZA 2XP5A 2ITKA 3UI6A 1ZBWA 3G6LA 3KACA 3IKDA 2WLZA 3TDBA 2VCDA 4U86A 4DRQA 4NZCA 2WM0A 1ZB5A 1ZBCA 5HBFA 3O5PA 3O5DA 1E6PA 2D9FA 4WIWA 1E6RA 3CZ8A 4MTVA 4Z2HA 1J4RA 1OGGA 1A7XA 3AS3A 2DT1A 3KAFA 2ZR5A 1HKMA 2RUDA 3BMBA 4DRIA 3EY6A 2O9OA 2XP8A 4JYSA 4JFJA 3B7XA 1W1VA 1NWSA 1SYTA 4J4NA 1FKSA 1NWRA 4NNRA 4JFIA 2ESCA 2M08A 4QT2A 3WD1A 4L72B 2DG9A 3NTPA 3GTYX 4O2TA 2MNTA 4IPXA 1FKTA 2LGOA 1BL4A 5HTGA 3KAGA 4MNMA 5DEZA 3O5EA 4TX0A 3JXVA 5BXJA 3IHZA 3CHFA 2L2SA 2MPHA 1ROTA 1KT1A 2KI3A 1QZ2A 2DT0A 4ODMA 1E9LA 1JNDA 1Q6IA 3UQIA 2XP9A 4DH0A 3NI6A 4WK9A 3ARWA 4W9OA 1NMWA 3CGNA 5DO2A 4WKAA 4LAXA 1FFQA 3EIPA 4IT4A 3O5MA 4Z2LA 5B8IC 4Q7NA 3WD0A 1PINA 1QPLA 2IUZA 2RUQA 3OA5A 4DWSD 4DZ3A 1O6IA 3ARZA 4N19A 3RGCA 3UQBA 3B9EA 1FKIA 3W4RA 2KGJA 2MLZA 2LPVA 1LG2A 1W26A 1FAPA 2YBTA 4W9PA 4ODPA 3O5JA 1Y0OA 4QIBA 4UDMA 3O5GA 1KT0A 1OWQA 4DRNA 4HBEA 4P8XA 4ML4A 4Z2KA 1LL6A 4U84A 4G50A 1B6CA 1LL4A 2DG4A 1VF8A 1GRJA 3ARSA 1T11A 1QPFA 1UR9A 2LJ4A 1C9HA 4ZPVR 1F40A 3LUOA 1EHNA 2XP4A 4LAWA 5HT1A 1EYMA 1NWTA 2KO7A 4JFLA 2ZQUA 4ODNA 1WB0A 5D75A 3CHCA 4ODRA 3O5LA 3NRKA 1LQ0A 3TCZA 1IX5A 4Z2GA 2Q5AA 1E44A 2FKEA 4TW8A 2A3EA 4HBOA 3PA7A 5HW6A 1ZK6A 4IT6A 4MAVA 2PPNA 1FKBA 5J6EA 1HKJA 2ZQSA 3IKGA 2RSEA 4GGQA 2DT2A 1HKKA 2FDMA 3B9AA 3ARUA 3IK8A 4R0XA 1W9UA 2XP7A 3GPKA 1WNOA 1P5QA 1R9HA 3KADA 2MF9A 4R5EA 5DIVA 4S3JA 2PI6A 3O5QA 1D6OA 1FKLA 3ARRA 4DWSB 3G6MA 3CHDA 1HXVA 1HKIA 3AS2A 1K9TA 4GIVA 1JCHB 3WD4A 1L1PA 1LL7A 3PRAA 4MPKA 4ZS6A 1W9VA 3ALGA 3PRDA 3KABA 3KAHA 4DZ2A 1Q6HA 4ODOA 1J4IA 1ZL1A 1SR0A 2PV3A 1U79A
chains in the Genus database with same CATH topology
4JFMA 3RM9A 1FJDA 1J4HA 4IQCA 1D7JA 1PBKA 1FKGA 1E15A 2DPEA 3ARYA 3UI5A 2ZQVA 4TW6A 1H0IA 3WIJA 1D7HA 4DRMA 2F4EA 2KE0A 3O5KA 3JYMA 2PV1A 1XRVA 2XP3A 3TC5A 2O92A 1HJXA 3PR9A 4KR0B 2YBUA 4KQZA 5HW7A 1GOIA 1RD6A 1NWUA 4NSBA 1D2KA 1W1TA 2RQSA 3WKZA 2F2DA 4URIA 1EDQA 1D7IA 2B31A 4ZPTR 3ARXA 3FXYA 3AROA 2M2AA 2QF8A 4QZVB 4MNKA 4DWSA 3RFWA 4HARA 3WQWA 4XAKA 1ZBVA 3O5IA 2JZVA 5DF0A 2AOSA 2IF4A 1YW5A 4Z2JA 2DSZA 5I98A 5HW8A 3WL1A 5HWBA 4MNLA 5GPGA 2Y78A 1M5YA 3O5FA 1W9PA 2DT3A 1X6NA 4LAVA 1CTNA 3ALFA 1TCOC 1HJWA 2UZ5A 3ARQA 2AWGA 4U85A 4DIPA 2M1IA 1ZCNA 2A3BA 3AQUA 2MLXA 2PPPA 1YATA 2OLHA 2RUCA 1FKDA 3ODKA 3O5OA 1JNSA 2DSUA 4WKFA 2XPAA 1NH6A 3AS1A 4Z2IA 1TFVA 2VN1A 2F21A 4DRJA 5DITA 2OFNA 2RURA 5HKGA 1OGBA 3O5RA 4P8UA 3UI4A 2XPBA 3WL0A 2K8IA 1FFRA 4ODQA 3B9DA 4DRPA 1GUVA 2A3AA 3KAIA 1N1AA 3MDYB 3JYJA 4DRKA 4W9QA 1NMVA 3I6CA 1JNTA 3UF8A 3RMEA 4Q22A 1UR8A 3RM8A 3WD2A 1FKJA 1XHGA 5GQBA 4P8VA 1J6YA 1FD9A 1ZBKA 4IQ2A 2XP6A 4JFKA 1E6NA 1HJVA 3ARTA 4MSPA 1KFWA 3RM4A 3BXWA 3AS0A 1FKFA 2G41A 2DSVA 2PPOA 4ZPWR 4TW7A 5HWCA 2A3CA 4J4OA 4DROA 2MLYA 1FKRA 2G8ZA 1EIBA 1EQ3A 2DSWA 4DRHA 1FKKA 4G2PA 3KZ7A 1FKHA 3B8SA 4FN2A 2N87A 1LG1A 3PRBA 2ZR4A 3ARVA 4TYOA 2KFWA 1WAWA 3H9RB 3WQVA 3CH9A 3WD3A 3UQAA 4DT4A 4C02B 1BKFA 4P8WA 3FAPA 4ITZA 1F8AB 1NSGA 3CGMA 4ODKA 4LAYA 2WLYA 3OOBA 1Q1CA 4AY1A 2PV2A 1JNEA 2WK2A 4FAPA 5DIUA 3KCEA 1X6LA 4MNJA 1LJYA 4QT3A 2PBCA 1H0GA 3ARPA 4ODLA 1GPFA 1ITXA 3QOKA 3WH0A 3VAWA 2ZR6A 3FY1A 4S3KA 3CHEA 2ZQTA 4TNSA 4WKHA 5GPRA 1JVWA 1W1YA 4MGVA 5JH8A 2DG3A 4W5UA 2FAPA 4BF8A 4LGXA 4DWSC 1W1PA 4L3NA 1ROUA 4WJXA 1ZU8A 2KR7A 4PTMA 5HUAA 1Q6UA 2LKNA 1E6ZA 2XP5A 2ITKA 3UI6A 1ZBWA 3G6LA 3KACA 3IKDA 2WLZA 3TDBA 2VCDA 4U86A 4DRQA 4NZCA 2WM0A 1ZB5A 1ZBCA 5HBFA 3O5PA 3O5DA 1E6PA 2D9FA 4WIWA 1E6RA 3CZ8A 4MTVA 4Z2HA 1J4RA 1OGGA 1A7XA 3AS3A 2DT1A 3KAFA 2ZR5A 1HKMA 2RUDA 4DRIA 3EY6A 2O9OA 2XP8A 4JYSA 4JFJA 3B7XA 1W1VA 1NWSA 1SYTA 4J4NA 1FKSA 1NWRA 4NNRA 4JFIA 2ESCA 2M08A 4QT2A 3WD1A 4L72B 2DG9A 3NTPA 4O2TA 2MNTA 4IPXA 1FKTA 2LGOA 1BL4A 5HTGA 3KAGA 4MNMA 5DEZA 3O5EA 4TX0A 3JXVA 5BXJA 3IHZA 3CHFA 2L2SA 2MPHA 1ROTA 1KT1A 2KI3A 1QZ2A 2DT0A 4ODMA 1E9LA 1JNDA 1Q6IA 3UQIA 2XP9A 4DH0A 3NI6A 4WK9A 3ARWA 4W9OA 1NMWA 3CGNA 5DO2A 4WKAA 4LAXA 1FFQA 4IT4A 3O5MA 4Z2LA 5B8IC 4Q7NA 3WD0A 1PINA 1QPLA 2IUZA 2RUQA 3OA5A 4DWSD 4DZ3A 1O6IA 3ARZA 4N19A 3RGCA 3UQBA 3B9EA 1FKIA 3W4RA 2KGJA 2MLZA 2LPVA 1LG2A 1W26A 1FAPA 2YBTA 4W9PA 4ODPA 3O5JA 1Y0OA 4QIBA 3O5GA 1KT0A 1OWQA 4DRNA 4HBEA 4P8XA 4ML4A 4Z2KA 1LL6A 4U84A 4G50A 1B6CA 1LL4A 2DG4A 1VF8A 3ARSA 1T11A 1QPFA 1UR9A 2LJ4A 1C9HA 4ZPVR 1F40A 3LUOA 1EHNA 2XP4A 4LAWA 5HT1A 1EYMA 1NWTA 2KO7A 4JFLA 2ZQUA 4ODNA 1WB0A 5D75A 3CHCA 4ODRA 3O5LA 3NRKA 1LQ0A 3TCZA 1IX5A 4Z2GA 2Q5AA 2FKEA 4TW8A 2A3EA 4HBOA 3PA7A 5HW6A 1ZK6A 4IT6A 4MAVA 2PPNA 1FKBA 5J6EA 1HKJA 2ZQSA 3IKGA 2RSEA 4GGQA 2DT2A 1HKKA 2FDMA 3B9AA 3ARUA 3IK8A 4R0XA 1W9UA 2XP7A 3GPKA 1WNOA 1P5QA 1R9HA 3KADA 2MF9A 4R5EA 5DIVA 4S3JA 2PI6A 3O5QA 1D6OA 1FKLA 3ARRA 4DWSB 3G6MA 3CHDA 1HXVA 1HKIA 3AS2A 1K9TA 4GIVA 3WD4A 1L1PA 1LL7A 3PRAA 4MPKA 4ZS6A 1W9VA 3ALGA 3PRDA 3KABA 3KAHA 4DZ2A 1Q6HA 4ODOA 1J4IA 1ZL1A 1SR0A 2PV3A 1U79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRP A;  3KAI A;  3VAW A;  1FKI A;  2ZR6 A;  2KGJ A;  4JFM A;  1N1A A;  2LPV A;  2MLZ A;  3MDY B;  3JYJ A;  1J4H A;  4IQC A;  2ZQT A;  4TNS A;  1D7J A;  1PBK A;  1W26 A;  4W9Q A;  1FAP A;  1NMV A;  4W9P A;  4DRK A;  1FKG A;  1JVW A;  4MGV A;  3I6C A;  4ODP A;  1JNT A;  3O5J A;  3UF8 A;  2ZQV A;  1Y0O A;  2DG3 A;  4TW6 A;  2FAP A;  4QIB A;  3UI5 A;  4BF8 A;  3O5G A;  1D7H A;  4DRM A;  2F4E A;  2KE0 A;  1KT0 A;  4DRN A;  3O5K A;  3JYM A;  2PV1 A;  1ROU A;  2XP3 A;  3TC5 A;  1FKJ A;  2KR7 A;  4U84 A;  5HUA A;  1Q6U A;  2LKN A;  4G50 A;  1B6C A;  2ITK A;  2XP5 A;  2DG4 A;  3UI6 A;  1J6Y A;  1FD9 A;  1T11 A;  5HW7 A;  3KAC A;  1QPF A;  3IKD A;  4IQ2 A;  2XP6 A;  2LJ4 A;  4JFK A;  3TDB A;  2VCD A;  1C9H A;  4U86 A;  4DRQ A;  1F40 A;  3LUO A;  2XP4 A;  4MSP A;  1FKF A;  3O5P A;  4LAW A;  3O5D A;  5HT1 A;  1EYM A;  2RQS A;  2D9F A;  2KO7 A;  2F2D A;  4JFL A;  2PPO A;  1J4R A;  4TW7 A;  5HWC A;  2ZQU A;  1A7X A;  1D7I A;  4ODN A;  5D75 A;  2M2A A;  2ZR5 A;  3KAF A;  3O5L A;  3NRK A;  4ODR A;  3RGC A;  4J4O A;  3TCZ A;  3RFW A;  2RUD A;  4DRI A;  4DRO A;  2Q5A A;  2MLY A;  2JZV A;  3O5I A;  2FKE A;  3EY6 A;  1FKR A;  2IF4 A;  1EQ3 A;  4TW8 A;  4DRH A;  2XP8 A;  1FKK A;  1YW5 A;  4G2P A;  3PA7 A;  3KZ7 A;  3B7X A;  4JFJ A;  4JYS A;  5I98 A;  5HW6 A;  5HW8 A;  1FKH A;  1ZK6 A;  5HWB A;  2PPN A;  1FKB A;  5GPG A;  5J6E A;  2Y78 A;  1M5Y A;  4FN2 A;  2ZQS A;  2N87 A;  3IKG A;  3O5F A;  4J4N A;  4LAV A;  1FKS A;  4NNR A;  1TCO C;  4JFI A;  2RSE A;  2UZ5 A;  4GGQ A;  2M08 A;  4QT2 A;  2AWG A;  4U85 A;  3IK8 A;  2DG9 A;  4DIP A;  4R0X A;  3NTP A;  3PRB A;  4O2T A;  2XP7 A;  2MNT A;  1FKT A;  2LGO A;  1BL4 A;  2M1I A;  2ZR4 A;  1ZCN A;  3GPK A;  3KAG A;  1P5Q A;  4IPX A;  1R9H A;  4TYO A;  5HTG A;  3KAD A;  2KFW A;  4N19 A;  2MLX A;  3UQB A;  2MF9 A;  5DIV A;  3H9R B;  3O5E A;  2PPP A;  4TX0 A;  3JXV A;  5BXJ A;  1YAT A;  3IHZ A;  3O5Q A;  2L2S A;  1D6O A;  3UQA A;  2MPH A;  1ROT A;  1KT1 A;  1FKL A;  2RUC A;  2KI3 A;  4DT4 A;  1QZ2 A;  4ODM A;  1HXV A;  1Q6I A;  1FKD A;  3ODK A;  3O5O A;  3UQI A;  1JNS A;  2XP9 A;  4C02 B;  1BKF A;  2XPA A;  4DH0 A;  4GIV A;  3FAP A;  4ITZ A;  3NI6 A;  1F8A B;  1NSG A;  4W9O A;  1NMW A;  3CGM A;  4ODK A;  1L1P A;  3CGN A;  4LAY A;  2VN1 A;  3OOB A;  1Q1C A;  2F21 A;  4DRJ A;  1FJD A;  2PV2 A;  4LAX A;  5DIT A;  2OFN A;  3PRD A;  3O5M A;  3KAB A;  3KAH A;  5B8I C;  4DZ2 A;  2RUR A;  5HKG A;  4FAP A;  1Q6H A;  5DIU A;  3KCE A;  3O5R A;  1PIN A;  1QPL A;  1J4I A;  4ODO A;  2RUQ A;  4QT3 A;  3UI4 A;  2XPB A;  4DZ3 A;  2PBC A;  2K8I A;  4ODL A;  4ODQ A;  2PV3 A;  1U79 A;  3WH0 A; 
#chains in the Genus database with same CATH topology
 4JFM A;  3RM9 A;  1FJD A;  1J4H A;  4IQC A;  1D7J A;  1PBK A;  1FKG A;  1E15 A;  2DPE A;  3ARY A;  3UI5 A;  2ZQV A;  4TW6 A;  1H0I A;  3WIJ A;  1D7H A;  4DRM A;  2F4E A;  2KE0 A;  3O5K A;  3JYM A;  2PV1 A;  1XRV A;  2XP3 A;  3TC5 A;  2O92 A;  1HJX A;  3PR9 A;  4KR0 B;  2YBU A;  4KQZ A;  5HW7 A;  1GOI A;  1RD6 A;  1NWU A;  4NSB A;  1D2K A;  1W1T A;  2RQS A;  3WKZ A;  2F2D A;  4URI A;  1EDQ A;  1D7I A;  2B31 A;  4ZPT R;  3ARX A;  3FXY A;  3ARO A;  2M2A A;  2QF8 A;  4QZV B;  4MNK A;  4DWS A;  3RFW A;  4HAR A;  3WQW A;  4XAK A;  1ZBV A;  3O5I A;  2JZV A;  5DF0 A;  2AOS A;  2IF4 A;  1YW5 A;  4Z2J A;  2DSZ A;  5I98 A;  5HW8 A;  2P4V A;  3WL1 A;  5HWB A;  4MNL A;  5GPG A;  2Y78 A;  1M5Y A;  3O5F A;  1W9P A;  2DT3 A;  1X6N A;  4LAV A;  1CTN A;  3ALF A;  1TCO C;  1HJW A;  2UZ5 A;  3ARQ A;  2AWG A;  4U85 A;  2PN0 A;  4DIP A;  2M1I A;  1ZCN A;  2A3B A;  3AQU A;  2MLX A;  2PPP A;  1YAT A;  2OLH A;  2RUC A;  2ETN A;  1FKD A;  3ODK A;  3O5O A;  1JNS A;  2DSU A;  4WKF A;  2XPA A;  1NH6 A;  3AS1 A;  4Z2I A;  1TFV A;  2VN1 A;  2F21 A;  4DRJ A;  5DIT A;  2OFN A;  2RUR A;  5HKG A;  1OGB A;  3O5R A;  4P8U A;  3UI4 A;  2XPB A;  3WL0 A;  2K8I A;  1FFR A;  4ODQ A;  3B9D A;  4DRP A;  1GUV A;  2A3A A;  3KAI A;  1N1A A;  3MDY B;  3JYJ A;  4DRK A;  4W9Q A;  1NMV A;  3I6C A;  1JNT A;  3UF8 A;  3RME A;  4Q22 A;  1UR8 A;  3RM8 A;  3WD2 A;  1FKJ A;  1XHG A;  5GQB A;  4P8V A;  1J6Y A;  1FD9 A;  1ZBK A;  4IQ2 A;  2XP6 A;  4JFK A;  1E6N A;  1HJV A;  3ART A;  4MSP A;  1KFW A;  3RM4 A;  3BXW A;  3AS0 A;  1FKF A;  2G41 A;  2DSV A;  2PPO A;  4ZPW R;  2F23 A;  4TW7 A;  5HWC A;  2A3C A;  4J4O A;  4DRO A;  2B5U B;  2MLY A;  1FKR A;  2G8Z A;  1EIB A;  1EQ3 A;  2DSW A;  4DRH A;  1FKK A;  4G2P A;  3KZ7 A;  1FKH A;  3B8S A;  4FN2 A;  2N87 A;  1LG1 A;  3PRB A;  2ZR4 A;  3ARV A;  4TYO A;  2KFW A;  1WAW A;  2EUL A;  3H9R B;  3WQV A;  3CH9 A;  3WD3 A;  3UQA A;  4DT4 A;  4C02 B;  1BKF A;  4P8W A;  3FAP A;  4ITZ A;  1F8A B;  1NSG A;  3CGM A;  4ODK A;  4LAY A;  2WLY A;  3OOB A;  1Q1C A;  4AY1 A;  2PV2 A;  1JNE A;  2WK2 A;  4FAP A;  5DIU A;  3KCE A;  1X6L A;  4MNJ A;  1LJY A;  4QT3 A;  3GU0 A;  2PBC A;  1H0G A;  3ARP A;  4ODL A;  1GPF A;  1ITX A;  3QOK A;  3WH0 A;  3VAW A;  2ZR6 A;  3FY1 A;  4S3K A;  3CHE A;  2ZQT A;  4TNS A;  4WKH A;  5GPR A;  1JVW A;  1W1Y A;  4MGV A;  5JH8 A;  2DG3 A;  4W5U A;  2FAP A;  4BF8 A;  4LGX A;  4DWS C;  1W1P A;  4L3N A;  1ROU A;  4WJX A;  1ZU8 A;  2KR7 A;  4PTM A;  5HUA A;  1Q6U A;  2LKN A;  1E6Z A;  2XP5 A;  2ITK A;  3UI6 A;  1ZBW A;  3G6L A;  3KAC A;  3IKD A;  2WLZ A;  3TDB A;  2VCD A;  4U86 A;  4DRQ A;  4NZC A;  2WM0 A;  1ZB5 A;  1ZBC A;  5HBF A;  3O5P A;  3O5D A;  1E6P A;  2D9F A;  4WIW A;  1E6R A;  3CZ8 A;  4MTV A;  4Z2H A;  1J4R A;  1OGG A;  1A7X A;  3AS3 A;  2DT1 A;  3KAF A;  2ZR5 A;  1HKM A;  2RUD A;  3BMB A;  4DRI A;  3EY6 A;  2O9O A;  2XP8 A;  4JYS A;  4JFJ A;  3B7X A;  1W1V A;  1NWS A;  1SYT A;  4J4N A;  1FKS A;  1NWR A;  4NNR A;  4JFI A;  2ESC A;  2M08 A;  4QT2 A;  3WD1 A;  4L72 B;  2DG9 A;  3NTP A;  3GTY X;  4O2T A;  2MNT A;  4IPX A;  1FKT A;  2LGO A;  1BL4 A;  5HTG A;  3KAG A;  4MNM A;  5DEZ A;  3O5E A;  4TX0 A;  3JXV A;  5BXJ A;  3IHZ A;  3CHF A;  2L2S A;  2MPH A;  1ROT A;  1KT1 A;  2KI3 A;  1QZ2 A;  2DT0 A;  4ODM A;  1E9L A;  1JND A;  1Q6I A;  3UQI A;  2XP9 A;  4DH0 A;  3NI6 A;  4WK9 A;  3ARW A;  4W9O A;  1NMW A;  3CGN A;  5DO2 A;  4WKA A;  4LAX A;  1FFQ A;  3EIP A;  4IT4 A;  3O5M A;  4Z2L A;  5B8I C;  4Q7N A;  3WD0 A;  1PIN A;  1QPL A;  2IUZ A;  2RUQ A;  3OA5 A;  4DWS D;  4DZ3 A;  1O6I A;  3ARZ A;  4N19 A;  3RGC A;  3UQB A;  3B9E A;  1FKI A;  3W4R A;  2KGJ A;  2MLZ A;  2LPV A;  1LG2 A;  1W26 A;  1FAP A;  2YBT A;  4W9P A;  4ODP A;  3O5J A;  1Y0O A;  4QIB A;  4UDM A;  3O5G A;  1KT0 A;  1OWQ A;  4DRN A;  4HBE A;  4P8X A;  4ML4 A;  4Z2K A;  1LL6 A;  4U84 A;  4G50 A;  1B6C A;  1LL4 A;  2DG4 A;  1VF8 A;  1GRJ A;  3ARS A;  1T11 A;  1QPF A;  1UR9 A;  2LJ4 A;  1C9H A;  4ZPV R;  1F40 A;  3LUO A;  1EHN A;  2XP4 A;  4LAW A;  5HT1 A;  1EYM A;  1NWT A;  2KO7 A;  4JFL A;  2ZQU A;  4ODN A;  1WB0 A;  5D75 A;  3CHC A;  4ODR A;  3O5L A;  3NRK A;  1LQ0 A;  3TCZ A;  1IX5 A;  4Z2G A;  2Q5A A;  1E44 A;  2FKE A;  4TW8 A;  2A3E A;  4HBO A;  3PA7 A;  5HW6 A;  1ZK6 A;  4IT6 A;  4MAV A;  2PPN A;  1FKB A;  5J6E A;  1HKJ A;  2ZQS A;  3IKG A;  2RSE A;  4GGQ A;  2DT2 A;  1HKK A;  2FDM A;  3B9A A;  3ARU A;  3IK8 A;  4R0X A;  1W9U A;  2XP7 A;  3GPK A;  1WNO A;  1P5Q A;  1R9H A;  3KAD A;  2MF9 A;  4R5E A;  5DIV A;  4S3J A;  2PI6 A;  3O5Q A;  1D6O A;  1FKL A;  3ARR A;  4DWS B;  3G6M A;  3CHD A;  1HXV A;  1HKI A;  3AS2 A;  1K9T A;  4GIV A;  1JCH B;  3WD4 A;  1L1P A;  1LL7 A;  3PRA A;  4MPK A;  4ZS6 A;  1W9V A;  3ALG A;  3PRD A;  3KAB A;  3KAH A;  4DZ2 A;  1Q6H A;  4ODO A;  1J4I A;  1ZL1 A;  1SR0 A;  2PV3 A;  1U79 A; 
#chains in the Genus database with same CATH homology
 4JFM A;  3RM9 A;  1FJD A;  1J4H A;  4IQC A;  1D7J A;  1PBK A;  1FKG A;  1E15 A;  2DPE A;  3ARY A;  3UI5 A;  2ZQV A;  4TW6 A;  1H0I A;  3WIJ A;  1D7H A;  4DRM A;  2F4E A;  2KE0 A;  3O5K A;  3JYM A;  2PV1 A;  1XRV A;  2XP3 A;  3TC5 A;  2O92 A;  1HJX A;  3PR9 A;  4KR0 B;  2YBU A;  4KQZ A;  5HW7 A;  1GOI A;  1RD6 A;  1NWU A;  4NSB A;  1D2K A;  1W1T A;  2RQS A;  3WKZ A;  2F2D A;  4URI A;  1EDQ A;  1D7I A;  2B31 A;  4ZPT R;  3ARX A;  3FXY A;  3ARO A;  2M2A A;  2QF8 A;  4QZV B;  4MNK A;  4DWS A;  3RFW A;  4HAR A;  3WQW A;  4XAK A;  1ZBV A;  3O5I A;  2JZV A;  5DF0 A;  2AOS A;  2IF4 A;  1YW5 A;  4Z2J A;  2DSZ A;  5I98 A;  5HW8 A;  3WL1 A;  5HWB A;  4MNL A;  5GPG A;  2Y78 A;  1M5Y A;  3O5F A;  1W9P A;  2DT3 A;  1X6N A;  4LAV A;  1CTN A;  3ALF A;  1TCO C;  1HJW A;  2UZ5 A;  3ARQ A;  2AWG A;  4U85 A;  4DIP A;  2M1I A;  1ZCN A;  2A3B A;  3AQU A;  2MLX A;  2PPP A;  1YAT A;  2OLH A;  2RUC A;  1FKD A;  3ODK A;  3O5O A;  1JNS A;  2DSU A;  4WKF A;  2XPA A;  1NH6 A;  3AS1 A;  4Z2I A;  1TFV A;  2VN1 A;  2F21 A;  4DRJ A;  5DIT A;  2OFN A;  2RUR A;  5HKG A;  1OGB A;  3O5R A;  4P8U A;  3UI4 A;  2XPB A;  3WL0 A;  2K8I A;  1FFR A;  4ODQ A;  3B9D A;  4DRP A;  1GUV A;  2A3A A;  3KAI A;  1N1A A;  3MDY B;  3JYJ A;  4DRK A;  4W9Q A;  1NMV A;  3I6C A;  1JNT A;  3UF8 A;  3RME A;  4Q22 A;  1UR8 A;  3RM8 A;  3WD2 A;  1FKJ A;  1XHG A;  5GQB A;  4P8V A;  1J6Y A;  1FD9 A;  1ZBK A;  4IQ2 A;  2XP6 A;  4JFK A;  1E6N A;  1HJV A;  3ART A;  4MSP A;  1KFW A;  3RM4 A;  3BXW A;  3AS0 A;  1FKF A;  2G41 A;  2DSV A;  2PPO A;  4ZPW R;  4TW7 A;  5HWC A;  2A3C A;  4J4O A;  4DRO A;  2MLY A;  1FKR A;  2G8Z A;  1EIB A;  1EQ3 A;  2DSW A;  4DRH A;  1FKK A;  4G2P A;  3KZ7 A;  1FKH A;  3B8S A;  4FN2 A;  2N87 A;  1LG1 A;  3PRB A;  2ZR4 A;  3ARV A;  4TYO A;  2KFW A;  1WAW A;  3H9R B;  3WQV A;  3CH9 A;  3WD3 A;  3UQA A;  4DT4 A;  4C02 B;  1BKF A;  4P8W A;  3FAP A;  4ITZ A;  1F8A B;  1NSG A;  3CGM A;  4ODK A;  4LAY A;  2WLY A;  3OOB A;  1Q1C A;  4AY1 A;  2PV2 A;  1JNE A;  2WK2 A;  4FAP A;  5DIU A;  3KCE A;  1X6L A;  4MNJ A;  1LJY A;  4QT3 A;  2PBC A;  1H0G A;  3ARP A;  4ODL A;  1GPF A;  1ITX A;  3QOK A;  3WH0 A;  3VAW A;  2ZR6 A;  3FY1 A;  4S3K A;  3CHE A;  2ZQT A;  4TNS A;  4WKH A;  5GPR A;  1JVW A;  1W1Y A;  4MGV A;  5JH8 A;  2DG3 A;  4W5U A;  2FAP A;  4BF8 A;  4LGX A;  4DWS C;  1W1P A;  4L3N A;  1ROU A;  4WJX A;  1ZU8 A;  2KR7 A;  4PTM A;  5HUA A;  1Q6U A;  2LKN A;  1E6Z A;  2XP5 A;  2ITK A;  3UI6 A;  1ZBW A;  3G6L A;  3KAC A;  3IKD A;  2WLZ A;  3TDB A;  2VCD A;  4U86 A;  4DRQ A;  4NZC A;  2WM0 A;  1ZB5 A;  1ZBC A;  5HBF A;  3O5P A;  3O5D A;  1E6P A;  2D9F A;  4WIW A;  1E6R A;  3CZ8 A;  4MTV A;  4Z2H A;  1J4R A;  1OGG A;  1A7X A;  3AS3 A;  2DT1 A;  3KAF A;  2ZR5 A;  1HKM A;  2RUD A;  4DRI A;  3EY6 A;  2O9O A;  2XP8 A;  4JYS A;  4JFJ A;  3B7X A;  1W1V A;  1NWS A;  1SYT A;  4J4N A;  1FKS A;  1NWR A;  4NNR A;  4JFI A;  2ESC A;  2M08 A;  4QT2 A;  3WD1 A;  4L72 B;  2DG9 A;  3NTP A;  4O2T A;  2MNT A;  4IPX A;  1FKT A;  2LGO A;  1BL4 A;  5HTG A;  3KAG A;  4MNM A;  5DEZ A;  3O5E A;  4TX0 A;  3JXV A;  5BXJ A;  3IHZ A;  3CHF A;  2L2S A;  2MPH A;  1ROT A;  1KT1 A;  2KI3 A;  1QZ2 A;  2DT0 A;  4ODM A;  1E9L A;  1JND A;  1Q6I A;  3UQI A;  2XP9 A;  4DH0 A;  3NI6 A;  4WK9 A;  3ARW A;  4W9O A;  1NMW A;  3CGN A;  5DO2 A;  4WKA A;  4LAX A;  1FFQ A;  4IT4 A;  3O5M A;  4Z2L A;  5B8I C;  4Q7N A;  3WD0 A;  1PIN A;  1QPL A;  2IUZ A;  2RUQ A;  3OA5 A;  4DWS D;  4DZ3 A;  1O6I A;  3ARZ A;  4N19 A;  3RGC A;  3UQB A;  3B9E A;  1FKI A;  3W4R A;  2KGJ A;  2MLZ A;  2LPV A;  1LG2 A;  1W26 A;  1FAP A;  2YBT A;  4W9P A;  4ODP A;  3O5J A;  1Y0O A;  4QIB A;  3O5G A;  1KT0 A;  1OWQ A;  4DRN A;  4HBE A;  4P8X A;  4ML4 A;  4Z2K A;  1LL6 A;  4U84 A;  4G50 A;  1B6C A;  1LL4 A;  2DG4 A;  1VF8 A;  3ARS A;  1T11 A;  1QPF A;  1UR9 A;  2LJ4 A;  1C9H A;  4ZPV R;  1F40 A;  3LUO A;  1EHN A;  2XP4 A;  4LAW A;  5HT1 A;  1EYM A;  1NWT A;  2KO7 A;  4JFL A;  2ZQU A;  4ODN A;  1WB0 A;  5D75 A;  3CHC A;  4ODR A;  3O5L A;  3NRK A;  1LQ0 A;  3TCZ A;  1IX5 A;  4Z2G A;  2Q5A A;  2FKE A;  4TW8 A;  2A3E A;  4HBO A;  3PA7 A;  5HW6 A;  1ZK6 A;  4IT6 A;  4MAV A;  2PPN A;  1FKB A;  5J6E A;  1HKJ A;  2ZQS A;  3IKG A;  2RSE A;  4GGQ A;  2DT2 A;  1HKK A;  2FDM A;  3B9A A;  3ARU A;  3IK8 A;  4R0X A;  1W9U A;  2XP7 A;  3GPK A;  1WNO A;  1P5Q A;  1R9H A;  3KAD A;  2MF9 A;  4R5E A;  5DIV A;  4S3J A;  2PI6 A;  3O5Q A;  1D6O A;  1FKL A;  3ARR A;  4DWS B;  3G6M A;  3CHD A;  1HXV A;  1HKI A;  3AS2 A;  1K9T A;  4GIV A;  3WD4 A;  1L1P A;  1LL7 A;  3PRA A;  4MPK A;  4ZS6 A;  1W9V A;  3ALG A;  3PRD A;  3KAB A;  3KAH A;  4DZ2 A;  1Q6H A;  4ODO A;  1J4I A;  1ZL1 A;  1SR0 A;  2PV3 A;  1U79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...