4WKFA

Crystal structure of human chitotriosidase-1 catalytic domain in complex with chitobiose (2.5mm) at 1.10 a resolution
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
368
structure length
368
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Chitotriosidase-1
total genus 128
structure length 368
sequence length 368
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wkfA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wkfA01
4BQ3A 3VDCA 4HPGA 4UOJA 1HKIA 3WL1A 3AMKA 2CKRA 3W29A 5HPCA 2OSWA 4YHGA 2CERA 4GIAA 2GJRA 2YJQA 1JXKA 2UY5A 2WMIA 5BRQA 3EDFA 1TCMA 4AZ5A 3B9AA 1BG4A 1GORA 2DT3A 1WZKA 3BAKA 1GUVA 1IT0A 2VQUA 3RCNA 3W6MA 3QR3A 5I0DA 4P7QA 1LL7A 4NSBA 4MNKA 4HA1A 1ZBCA 3UESA 4MB1A 3DYMA 1JF6A 3SCSA 3EMCA 2G41A 2J62A 1GW1A 1EH9A 1E5NA 2JF6A 4FMVA 4N0RA 4RE4A 2WMFA 2O92A 1E40A 5A3HA 3OLDA 2QV4A 2XM1A 1P6WA 1QVBA 3MUZ1 3VOCA 1E56A 1VIWA 1UH4A 1M01A 1E6NA 5LYRA 3M07A 2Y8VA 3AYRA 7CGTA 3SIMA 1UH3A 3OB8A 2C0HA 3QHMA 4HOXA 4P8WA 1JXJA 3VDBA 3MUY1 3CTTA 2CHOA 5EBAA 4H2CA 4UQ9A 1M7XA 3ZT7A 1DHKA 5DO8A 1HKMA 1JI1A 1SYTA 4AC1X 2PB1A 3UG4A 1A47A 1OWQA 1EIBA 1VBRA 3SCWA 1CBGA 1E70M 1AVAA 2YLAA 2WVVB 4W7WA 3QHNA 1RPKA 2ZOXA 2A3AA 4WKHA 2W66A 4J3UA 3QGVA 4RL3A 1NWRA 4S3KA 2XUCA 3NDYA 3MV01 2VZTA 2YA0A 1UWUA 5BXRA 3GBEA 1AQ0A 1NOFA 2CBUA 4OIFA 2BFGA 5IDIA 2DSWA 2J74A 1MW0A 5M17A 2VRKA 2E0PA 4M29A 3SCTA 1KXVA 2JF7A 2VZSA 4W5UA 1ESWA 3NUKA 4BS0A 4FK9A 2VL4A 1GVIA 1VEMA 2XSBA 3U57A 4GZEA 5D8WA 3WF3A 5IFTA 4JFWA 1UQZA 4UTFA 2O9OA 3VIGA 1E15A 2CHNA 2E9LA 4B15A 1W1PA 1B30A 1OM0A 1QI4A 4MB5A 1V6VA 2J7DA 4W8LA 6CGTA 1MW1A 4W5ZA 1Q6GA 1UWSA 1EDQA 1O7AA 2WCAA 2OWCA 1L0PA 3VO0A 1VBUA 2WHLA 1KXTA 3PZUA 2FHBA 3ARVA 2DPEA 3S6TA 1H4PA 7A3HA 2X05A 5KEZA 5M03A 1PEZA 1L8NA 1UD8A 3ARPA 1FOBA 3IAPA 1JZ6A 3BMVA 1PJ9A 2J75A 1H41A 2WPGA 4GZIA 4CD8A 3SCOA 2X09A 4B9ZA 4YPJA 1W9VA 3DYPA 3AHVA 1R85A 4XZBA 4PCSA 4Z2JA 1BVZA 1GOKA 2DIEA 3D3AA 1ZJBA 1WCGA 1BLIA 1US2A 2VZOA 3GXDA 4QLJA 2J8GA 4U5IA 1UWRA 1HJWA 1C90A 4JFVA 5JIWA 3AMGA 2ZICA 2VMFA 3PHAA 3IANA 2VZUA 2VX7A 2WSPA 3PZNA 1OIFA 4ZXOA 1U2YA 1I75A 1UD2A 1SMDA 2O9TA 2CXGA 3K46A 4HOWA 4DM1A 1WAWA 1CXEA 3WD0A 1E55A 5FOOA 1J0KA 1E43A 4UFKA 3I3DA 1C8QA 4AMCA 1HKKA 4H41A 5DT7A 3ZOAA 1OGSA 4M56A 2VX5A 4J3VA 4UFHA 2WK2A 1HVXA 3L4VA 2BXYA 3N12A 3THDA 2DSZA 5E9AA 2VRJA 3ZO9A 1B3XA 4IM4A 3BAJA 2FH8A 3BCFA 4CU7A 2D24A 4YN5A 4LX4A 3N04A 1FP9A 3N15A 2AAAA 4P7RA 1E3XA 2HISA 1FH8A 2UY2A 3OIHA 3GZAA 4EANA 4JHOA 2WKGA 2E9BA 1B1YA 1XSKA 4H8UA 3WD1A 4QDMA 3VPLA 3VIKA 1QHPA 1HJUA 1ODZA 1V3MA 2GDUA 1PX8A 1Z32X 1VEOA 3WQVA 3AMLA 2JALA 5TD4A 5F7UA 1WDRA 3TOPA 3VX0A 2E8ZA 3DC0A 2WLYA 5I23A 4AEEA 4D6EA 5HPOA 2VO5A 2XVNA 4ATDA 3QHOA 4GKLA 1NWSA 5AYIA 2B31A 1K9TA 2UWFA 4ACYA 3BLKA 3MSGA 1JZ5A 2PBGA 4AD0A 1UWQA 2D3LA 2ZX5A 1HJQA 5E6YA 5ABHA 1TG7A 3N18A 3OLEA 4OZOA 2CITA 3VVGA 2W4XA 1H5VA 2VQTA 2WSKA 3NDZA 3ARSA 1JD9A 2YKKA 2FHFA 1Y7VA 3AS0A 1LL4A 3M7SA 4A4AA 3VMNA 4CD5A 2WMHA 3DYOA 1K6AA 3VM5A 1GQJA 4HA3A 5CGMA 2RGLA 1NOUA 3WNLA 3RM8A 2WKLA 2G4FA 2YDSA 4QAWA 1M53A 1ISWA 5CZKA 2Y4SA 1R8LA 4AD4A 3BH4A 4PMRA 3A4WA 5IHRA 1JAEA 5D9NA 2ZUSA 2PWDA 5EFDA 4CUCA 3A3HA 3BAWA 3IJ8A 1KB3A 2OYMA 3O2LA 1EOMA 2ZUWA 1ZS2A 1ZB5A 1GQLA 1DWAM 5AC4A 3MSDA 1SFSA 3T2PA 1J0IA 2FH6A 3U7VA 5DT5A 1MQQA 1WDQA 2G3NA 4QCFA 1UWIA 2XPKA 3LMYA 4MNLA 1BPLB 1E71M 3EMZA 3POHA 1V3JA 2D23A 3AXHA 4JKMA 1EA9C 5I5RA 3BAXA 3AZTA 5EFFA 4UCFA 1HX0A 4PEEA 2W5FA 4R5EA 3MMWA 3AFBA 1E3ZA 2ZX7A 1JAKA 3O6AA 1W3HA 3MV11 2CPUA 2BXZA 4OOZA 2XHYA 5CLTA 4LPCA 3VX1A 2EPMX 2W62A 2J79A 3UR7A 2FHCA 3VD7A 1E4MM 1MQRA 4IPNB 3VD5A 1UKTA 2PWGA 2WWCA 2YL6A 3PZOA 4BQ2A 3PZQA 1AQHA 4KGLA 4X0NA 2G8ZA 2CKSA 2WZEA 5E09A 3L4YA 4NF7A 3VIOA 4MB3A 2YIHA 2D22A 4GXPA 4WJXA 2WAGA 3CIVA 5D9PA 2O9PA 3WF1A 4V27A 3GTNA 2WVTA 5E6ZA 1PX4A 3BLPX 3F5LA 2PC8A 4UZSA 3GH4A 2XVLA 4W89A 2WNWA 1WZAA 2GJPA 4CN4A 3WQ8A 1HNYA 4ACZB 3RIKA 1E9LA 3F5JA 1CEOA 2D2OA 3U7BA 4D6CA 2AOSA 3WL0A 4PTXA 3WNOA 1BYDA 2BVTA 4GQRA 3W6LA 4TVCA 5DFAA 3IAQA 2J7CA 3GYCA 2DH2A 1JFXA 3VIJA 1OT1A 3B8SA 4TUFA 2CEQA 4W88A 2WMIB 3WDRA 1XH0A 4JHZA 3K8MA 2FDMA 4OBSA 3RJYA 4Z2KA 1W3KA 1VFFA 4M8UA 1IZJA 2V5CA 1ZU8A 1F4HA 4FLQA 1B0IA 1J01A 3THCA 3ALGA 3VDAA 5GQBA 4TVDA 1QNRA 3CPUA 4AISA 4D1IA 2ZWZA 4V2XA 1CXIA 4U2YA 5CXPA 5AY7A 3NYDA 3LPGA 4ZE4A 4HZ7A 4WKFA 1HP5A 1XCXA 2BHYA 3CUFA 2DEPA 2VT0A 3RM9A 1WNOA 3PTKA 5I78A 1PX3A 2G3JA 1KGUA 1ZBKA 3OLIA 5HDRA 1XD0A 5BXTA 1UA3A 4B3LA 4M1RA 2WHJA 3ARXA 1V0KA 5A8MA 3WQWA 3AS3A 1UA7A 5GNYA 3SUSA 2VOTA 5A2CA 1TVPA 3PBGA 4J28A 1QNPA 3W24A 3EDJA 5JUVA 1VRXA 1B90A 4PN2A 2G3IA 5LA2A 1UR8A 4IPLA 3WELA 1OIMA 1R86A 4MJ4A 3W82A 3TTQA 3AIRA 4TX8A 4UQCA 1CXHA 4NRRA 1EQCA 4A3YA 3CO4A 1UZ1A 2VC9A 3OGSA 2XGIA 1BGGA 2VCBA 2IUZA 4JL1A 3WBEA 1ODUA 1UR0A 2F61A 3RILA 4X9YA 3PZIA 1CPUA 1JG9A 3AHXA 1RD6A 2V38A 1X6NA 1E0XA 5FIPA 1BGAA 3AIWA 1C3FA 2CIPA 2YLLA 3AXXA 3M6DA 1MW2A 4EK7A 2W61A 3VIMA 1G01A 3B9DA 5CJ5A 3BCDA 1FHDA 2J47A 1I1WA 1Q6CA 2PWFA 1JYWA 1H1NA 2CESA 1KBKA 4WIWA 3EDDA 3FN9A 4MNJA 4XX6A 1R7OA 4K68A 1E6ZA 1VAHA 3WQ4A 1EHAA 3SUUA 2BY1A 1ZBWA 2YL9A 2NW0A 1BQCA 5FL1A 1EOKA 2ZXQA 3RDKA 1TA3A 1OD0A 4CCDA 1DEDA 1QHZA 1WB0A 1EXPA 5CGTA 1ISVA 4U33A 2BNJA 1CTNA 2PF0A 5ABGA 2WC7A 3BSGA 3HN3A 3K8KA 3L2LA 4M80A 3AIUA 5ECUA 4E8DA 1B31A 3WD2A 2YDRA 1W9DM 3CZKA 2BY0A 3ZMRA 2D0FA 2WZHA 4CD6A 4F9DA 1MFUA 1UHVA 5D9OA 5A95A 3AXIA 5JBDA 4E4PA 3UG5A 3VGBA 2VJXA 1KCLA 2YBTA 2J7BA 1NARA 3BC9A 3CUIA 4OOUA 1MWOA 3ZJ8A 1VFMA 2EJ1A 3AICA 3VGHA 4C7DA 3G6LA 4IISA 4UFJA 5GNXA 4WK9A 2E8YA 1NQ6A 1WPCA 3BMWA 4EAMA 3A4XA 3BSHA 5LA1A 1W91A 4Z2HA 1V3LA 3UR8A 4MNMA 3ECQA 1KXQA 2WANA 2VZVA 4HU0A 1GOQA 3TTSA 1JYVA 3VILA 3TA9A 1KQZA 1W9BM 1Q6FA 3KWXA 1A3HA 2WCGA 3PTMA 4PMUA 1CWYA 2ZUVA 3WENA 1HXJA 4DWSB 1QNSA 3AS1A 1CZ1A 3WDPP 4XUYA 2X2YA 5BRPA 3KL3A 1B2YA 1E0VA 3SUTA 1V6WA 5A94A 1GOMA 1G9HA 2GVYA 4QP0A 1EO7A 4HMCA 4MDPA 2DDXA 9CGTA 2WYSA 1LQ0A 3CZ8A 1VB9A 5AC5A 3WF4A 3GNOA 2YDQA 4CD4A 5I24A 4JKLA 1V0MA 4GO9A 1JNDA 2DQXA 2ZIDA 8CGTA 3N13A 4M81A 2XFFA 1WZLA 4JL2A 1DWJM 3TTOA 4W85A 1CENA 1V08A 4PCTA 1OT2A 1OGBA 4J3WA 3SUWA 3OG2A 3SCUA 1W32A 3WEMA 2VR4A 3APGA 2IXUA 4MTVA 1QHOA 2CBIA 4W7UA 2NSXA 3WFZA 1J10A 3AIQA 3L4UA 4HMEA 3LPFA 1QOXA 2OSYA 3SCRA 1V6YA 1LG2A 2EQDA 1B3WA 2WC3A 5JH8A 1CGYA 3VMPA 4C7GA 1FH9A 2QMKA 5ABFB 4AD3A 1I1XA 3L2MA 4IUGA 3W4RA 1UQYA 1E4NA 2DT0A 2ZUNA 1U30A 1V0LA 5HNNA 1E0WA 4B3KA 3KL0A 4HU8A 4OJYA 3WBAA 2XVPA 2OYKA 1NWTA 5E0CA 1UKOA 1NP2A 2W91A 2QPSA 4AZGA 3SCNA 2WVVA 4GO8A 1OD8A 4W84A 3UERA 4PSPA 1TUXA 2Z1KA 3VIIA 4HP5A 5HBFA 3MS8A 3CUJA 5GNZA 5A8OA 4YHEA 4ML4A 1TR1A 1MW3A 3FNDA 2ZX9A 4AZCB 1CLVA 3N1AA 2GK1A 3RJXA 3WUEA 2VTFA 2A3HA 4GI9A 1NH6A 1JD7A 6A3HA 1OCQA 1U33A 1KFWA 2D20A 3U5UA 1XH1A 1W9XA 2ZX6A 2ZXAA 1UUQA 1PIFA 1F4AA 4TVUA 3UG3A 3SCQA 1JGIA 3WQ6A 3FAXA 5BYWA 1GVYA 3ZT6A 4W87A 2X1IA 3WNKA 3MKKA 1J0JA 3PN8A 3RMEA 2OSXA 4HA4A 1MVYA 3M46A 4ACZA 3AMDA 1KGWA 3LPOA 1MXGA 4GPNA 3ZJKA 3W81A 2YL5A 3K8LA 4XZWA 5D8ZA 1X6LA 3WF0A 1WP6A 4MB4A 1QI0A 2CYGA 3ZR5A 3T2OA 3AJ7A 3VM7A 4JKKA 3FHQA 3WH7A 3W27A 1XH2A 4U31A 4TTGA 3FHAA 1LL6A 4GZJA 6TAAA 3WDHA 2PBOA 4QCEA 3T0BA 4PMZA 3IJ7A 1CYGA 3W28A 3AIBA 3WMBA 2WBGA 5JIPA 1YQ2A 1LG1A 3W38A 1OGGA 1DWGM 4MJ2A 3T2QA 1XCWA 2BHUA 1RP8A 1JZ4A 1JZ8A 3ARWA 4HZ6A 3WNNA 1W1YA 2CETA 1ECEA 4HZ8A 4UQAA 3VD9A 2JEQA 3PZTA 1VF8A 3VGFA 1Q6DA 2CNCA 1W3LA 2BV9A 3T09A 4M82A 3AIVA 4JCMA 1LJYA 2GJXB 1WDSA 3AHYA 2EO7A 3CGTA 2BVYA 5IFPA 3WDQA 2NT0A 4AIEA 1HJXA 2QLYA 1J0ZA 2PI6A 5M5DA 3EMQA 1JFHA 2VNCA 1AMYA 3ARRA 1ISZA 3VIPA 1CGVA 2QF8A 1TA3B 1V03A 3PZGA 1KBBA 1M03A 4BA0A 1E72M 4AZIA 5I2UA 4L4PA 3OBAA 4PSRA 2BY3A 1BHGA 1E1FA 5A8NA 3CHEA 5BCAA 1W3JA 1XC6A 2QPUA 2VVNA 2XYLA 3MU7A 3LPPA 4FLRA 2X8RA 1W1TA 3OA5A 2NT1A 2E3ZA 1JDCA 4CU8A 4A3HA 5CSYA 2O9RA 3KZSA 2ZUTA 1NM9A 3E1F1 1J12A 3WNPA 2DGAA 4V28A 4U2ZA 3DHPA 3N11A 4GINA 1XGZA 5C71A 3PZVA 1XSIA 1TMQA 1LLOA 5CSUA 3CLWA 4UOQA 4UNIA 3WSUA 3G6MA 4W8BA 3T0AA 3MUAA 1QNQA 4AXNA 4P8UA 5A1AA 1WE5A 4KH2A 4EKJA 1K9EA 4Z2LA 2GDVA 1KGXA 3NSNA 5E70A 1V0NA 4JFTA 4JCLA 1H2JA 4Z2IA 1LWHA 3KEHA 1K9DA 3CMGA 3NJ3A 2WVSA 3NIYA 2C8NA 5BWFA 1LF1A 3KL5A 1SMAA 3IJ9A 1W9UA 1NWUA 3J7HA 1WKYA 4WSKA 5A8PA 2F8QA 1QNOA 1OB0A 4E2OA 2XIIA 4J3XA 1E73M 2EXOA 2V3DA 2GFTA 4C7FA 5JBFA 4CD7A 3VTRA 3L4WA 3WH6A 4AZBA 3VD4A 2Y2WA 1JI2A 1E5JA 3WUFA 3AZRA 2WMKA 2TAAA 5A6MA 2A3CA 4P7NA 3VDHA 1C92A 3GM8A 3WFLA 4CKQA 4GQQA 2OYLA 2ZWYA 2BY2A 5FKYA 5I77A 1HJVA 1CNVA 3W37A 2J7GA 2W63A 2DSUA 1V6XA 3MO4A 3ARZA 3WDIA 3RPMA 4DM2A 4D6JA 1QI5A 1N82A 2XFRA 3OZPA 1CGUA 3JUGA 2HVMA 2JIWA 3PZMA 3AOFA 2AMGA 5A2BA 5HXMA 3CHDA 1XRVA 1GNXA 1J18A 5CPQA 1PPIA 1H0GA 1E6SM 2D0HA 3VIFA 4TTUA 2VI0A 4Z2GA 1QI3A 4WKAA 4R27A 2OLHA 1AQMA 1UG6A 1XYFA 2XIBA 1BAGA 2Z1SA 3MUIA 5A8QA 3WEOA 4AD2A 4EE9A 4MPKA 2V3GA 4KMQA 2XVKA 3TP4A 2VVSA 3W25A 3VGDA 1TFVA 1KWKA 3WF2A 1C8XA 1BYAA 3NSMA 2WXDM 2XJ7A 3TONA 2DT2A 1ISXA 3GXIA 4U3AA 1TVNA 4S3JA 2E40A 1GONA 4CVWA 4DUWA 1KCKA 4OBRA 3ZR6A 4WF7A 4NZCA 1G0CA 3W26A 2ZE0A 3VINA 4D72A 4NRSA 3VGGA 4Y7EA 2G3MA 3EDKA 2EPLX 2ZUUA 3N17A 1KXHA 1R7AA 2A3EA 2WC4A 1LWJA 4LYRA 2EPNA 3SURA 1ITCA 2BS9A 4AY1A 1VFUA 1UKPA 3D5HA 1KWGA 2WB5A 2A3BA 1BSIA 2WVUA 3MANA 3BAIA 1RH9A 1QBBA 3CZLA 3ZQ9A 1HJSA 1CGWA 2Y24A 1VENA 4AIOA 4AZCA 4UFLA 4DUVA 3DECA 4LYPA 1BYCA 1HIZA 3BGAA 3WNMA 3FAWA 1NOWA 1W2PA 1CGXA 1QW8A 1TE1A 3SCPA 1UYQA 1E4LA 4AZ7A 3AQUA 5M3WA 5FCZA 1V3KA 4ATLA 4E8CA 2XG9A 3FXYA 2V3FA 1J9YA 4D6GA 4U5KA 2J8FA 1CXKA 2OWWA 4PMXA 4PMDA 3ZM8A 4UR9A 2XVGA 1JYNA 1VFOA 1ZJAA 4PTWA 4W86A 2JE8A 3K4AA 1CXFA 4H04A 5DEZA 3ZJ6A 1HT6A 5C8BB 1E6QM 1GCYA 1BFNA 4M24A 1BTCA 1BYBA 4DWSA 3ARUA 1W2VA 1XHGA 3NSXA 4JFSA 1D2KA 2F2HA 5A2AA 1C7TA 4UQEA 3WH9A 1YHTA 1GJUA 2ESCA 4PBGA 1B3ZA 1C7SA 2J77A 1HN1A 2XWEA 4H8VA 2WHMA 4AEFA 1UD6A 2E9MA 2VRQA 2D0GA 1C8YA 4AWEA 4CGTA 3VMOA 3OZOA 1JYXA 2WLZA 3CBWA 1MFVA 3GBDA 1JF5A 3UETA 4GI6A 2V3EA 2WMJA 1DP0A 5BXPA 1M04A 4URIA 1PIGA 3ZT5A 4P7OA 4ZEPA 2J4GA 5I6SA 2WHKA 4CCCA 3WN6A 3UEQA 2VX4A 3POCA 3EDEA 2YOCA 5I79A 3CMJA 2DSKA 2XGBA 3WD3A 1EGZA 4DWSD 4KRTA 3ARYA 3RM4A 3CUHA 1UKQA 3MMDA 2DIJA 1J11A 5A6AA 3U5YA 5BROA 5JBEA 2WMGA 3GDBA 1HL9A 2RGMA 1JZ2A 3WY1A 3B9EA 2VCCA 4AIUA 1WDPA 2J25A 2DH3A 4JIEA 2BHZA 3CHCA 4UQDA 4LXFA 3HMCA 5EMYA 3HU7A 4P7LA 1CLXA 2VURA 5CPSA 1V02A 2J7EA 4ATWA 1C91A 2XWDA 3AISA 3CUGA 3NCOA 5FL0A 2J7HA 1RP9A 3IK2A 5A6KA 4TOQA 1XV8A 3W53A 1B3VA 4GI8A 3WMCA 3ALFA 1QBAA 4ZFMA 3ARQA 2CBVA 1UWTA 5ABEA 2QMJA 5A6BA 1V6UA 3CH9A 5I3DA 3VGEA 1K9FA 5A69A 1EDTA 2YA1A 1Q6EA 4UQBA 1H49A 2WCSA 3EBVA 4WSJA 3BXWA 3QOMA 2WBKA 1WO2A 1PAMA 1B9ZA 1V3IA 1XD1A 3O9NA 3WDJA 4UFMA 7TAAA 4AD1A 1V02E 2E4TA 2PWEA 1HVQA 3PTQA 3S2CA 1HL8A 3HJEA 1UH2A 1JL8A 2GJXA 3DHUA 4CU6A 5D4YA 1VJZA 1KR1A 5D9MA 1XSJA 1JIBA 3AYSA 4H7VA 4PMQA 1PZ2A 4RE2A 3FY1A 4N42A 1JZ7A 1H0IA 2Y8KA 3GXMA 4D6DA 3GNRA 1FP8A 3AROA 4PRWA 3W0KA 1PZ3A 3OLGA 2XTKA 3K4DA 4U3CA 2YBUA 2JEPA 4B16A 3AZSA 2D3NA 2Q8XA 1US3A 2EEXA 1FFRA 1OSEA 1HP4A 1BVNP 3N9KA 1EQPA 1QW9A 2ZXBA 5EB8A 4MDOA 4BCEA 1FH7A 2OWXA 2W92A 5GPRA 3WEZA 3VD3A 2CBJA 5CG0A 3GNPA 4AD5A 4BZYA 3OGRA 3VIHA 4LYQA 3ARTA 3OGVA 1GQKA 2UY3A 1UD5A 1MQPA 2YA2A 2V5DA 4ZE5A 1KR0A 3CZJA 4RE3A 3WUGA 2X0HA 4H8HA 4HPHA 5CLWA 1IV8A 1H11A 4FLOA 2WM0A 3CZGA 1TZ7A 1EO5A 1GJWA 4PMYA 5A6LA 4OUEA 2J7FA 1UD3A 1BG9A 4UOZA 3SUVA 1E4IA 2XSAA 1ZL1A 4D1JA 4Q22A 3AHTA 4D6IA 3A47A 3GH5A 2DT1A 2WWDA 1D3CA 1R87A 1GPFA 1UKSA 1HF6A 4XB3A 4P8VA 2WW5A 4WLCA 4AYSA 4HOZA 1W9PA 1VEPA 2DSVA 2GSJA 4L4OA 3T0DA 1MXDA 3EYPA 1KQYA 3WIJA 2EPOA 4NI3A 1CECA 3KE0A 4JZ5A 1BF2A 4D71A 3BAYA 4BF7A 1G1YA 1H09A 4TX6A 1E6RA 5IHSA 4W93A 1ITXA 3ZJ7A 2C7FA 4FLSA 1IZKA 1CDGA 4LQ1A 1CGTA 1GOWA 3K1DA 1GOIA 1EDGA 4HMDA 4XV0A 4TXEA 2VCAA 1GOOA 3GH7A 3MMUA 5LA0A 2FGZA 1S46A 1PBGA 3VNYA 2J78A 5HOSA 4PMOA 2PWHA 2CCRA 2ZUMA 5KZ6A 1Q4NX 3I3BA 4KRUA 3T08A 1E1EA 1XYZA 3VKKA 1DTUA 5ABFA 4PUDA 2QHAA 4OKDA 2ZX8A 3SEPA 1CIUA 2XM2A 5FD0A 2JIEA 3QOKA 4AZ6A 3ZSSA 1QI2A 1V3HA 3TTYA 1MYRA 4F79A 2Y5EA 3PZ9A 3SCVA 4X0VA 3VNZA 2WZIA 1UR1A 4JAWA 4J7RA 1J0YA 1QPKA 4QLKA 4PYSA 5A6SA 1EHNA 5DMYA 2ZXDA 4QLLA 1DWFM 4D6HA 1J0HA 1FFQA 4LGXA 4CN6A 4MAVA 1JDDA 5AYBA 3WKZA 5E0FA 2VX6A 3WH5A 5IXEA 3AHZA 5A6JA 4F9JA 1UZ4A 4PMNA 2EPKX 8A3HA 1D7FA 2GUYA 2XFYA 3AS2A 3L4TA 1JNEA 3A6OA 2JFEX 4HTYA 1B3YA 1E6XM 2GK1B 3WQ5A 4PTVA 4W8AA 4ZXLA 2EBNA 1FA2A 2BVDA 3AMCA 4MADA 4F66A 1HKJA 2IXVA 4BQ4A 3WMSA 1DWIM 2FGLA 4AZHA 1C93A 1ISYA 2X0YA 1WZMA 1G94A 1UR4A 3L4XA 4J3SA 1DWHM 1OINA 1E6PA 1G5AA 3WUBA 3WH8A 3WD4A 1SR0A 1JZ3A 4PUEA 5A6BD 1GHRA 5BXSA 4PMVA 4B9YA 1GQIA 1W1VA 4Q7NA 3F5KA 1NP0A 3AIEA 4KWUA 4BQ5A 4F8XA 2D1ZA 4MAZA 4KGJA 1FHLA 4FF5A 4ZENA 2VUYA 4D6FA 1O6IA 3GXFA 1GHSA 4W7VA 3VUPA 1OBAA 1H3GA 1ZBVA 4UFIA 1JDAA 2W67A 4AW7A 4PTMA 5CQ1A 4CN1A 4JFUA 3II1A 1UR2A 1VJSA 1UOKA 4P8XA 2VR5A 3F4VA 4CCEA 4QFUA 4CVUA 4DWSC 4J3TA 3A4AA 3UCQA 5DF0A 1CXLA 1UR9A 3CHFA 3AI0A 4DUXA 2YL8A 5CPTA 3RO8A 4J27A 3CZEA 1X1NA 3ZSTA 3ZIZA 1UD4A 3I3EA 2UY4A 5C70A 2MANA 4UZUA 3VU2A 3L4ZA 3FW6A 1GZJA
chains in the Genus database with same CATH superfamily
2WJFA 3E9AA 4HPGA 3WL1A 3NOYA 2RUSA 2V69A 1C9DA 1XG3A 3M43A 2VD9A 2GJRA 3S2JA 1JXKA 2WMIA 2C91A 3TC6A 1TCMA 4AZ5A 1OC7A 3H54A 3HG2A 2VQUA 3W6MA 3BDKA 1XIBA 5L9FA 2OLSA 1EUNA 1LL7A 3VFCA 3EEZA 3O05A 4NSBA 1RCXB 4MNKA 3T42A 5TF0A 2IF4A 4MB1A 1M68A 2IQ0A 1Q85A 3UWQA 2BZNA 1GW1A 1EH9A 5LGZA 1GWJA 1AQFA 2JF6A 4FMVA 4A29A 3QJAA 1E40A 5A3HA 3G0SA 3ITXA 2XM1A 1PHWA 1QVBA 3KTCA 1M01A 2PPGA 5DY2A 5LYRA 4IQEA 2Y8VA 1A5UA 1MZHA 1JR1A 4C6EA 3FVDA 2QGHA 4HOXA 1JXJA 3CTTA 3KW3A 5BOFA 3VFLA 1A3WA 4KFOA 1ZP4A 1HKMA 4O4VA 1SZFA 3DUGA 4Y9PA 1EIBA 3SCWA 4HK5A 4UMCA 3JU2A 1K4HA 1E70M 5AHMA 3H2EA 2QPXA 2V8ZA 1AVAA 4HPJA 5FJPA 4W7WA 4LRSA 4U10A 4PA8A 4KCUA 4L4MA 3BWWA 2PDBA 4PB3A 3ORWA 4G7EA 3LGDA 3MV01 3RF9A 5KITA 1AK5A 5TNVA 4OIFA 5IDIA 2ZRVA 3QTPA 4A6GA 2M08A 1SPQA 4V1XA 2G97A 4LC8A 4O0ZA 4EAYA 2HMCA 1EF2A 2YXXA 1KXVA 2PDYA 3B0VC 4HVXA 4W5UA 1NTHA 4D2JA 5E9XA 3W2NA 1V8EA 4B2DA 1EUAA 1GVIA 1TRDA 5D2TA 4H9ZA 4TX0A 4PB4A 3TKFA 3GXTA 4GISA 3WF3A 4JFWA 1UQZA 3DFTA 1VH7A 3VIGA 3TDFA 1EPXA 1WDDA 5HJXA 1OM0A 3IIOA 2QJHA 3EKLA 4CQCA 3QV7A 4FR1A 4DJFC 4MF4A 1ZZMA 2PURA 2TYSA 3FKKA 2GDQA 1A5LC 1O7AA 3EIPA 4WX2A 3QVQA 2OWCA 2CZVA 4EF9A 3C2EA 5EL1A 3OZMA 5IDZA 2X1RA 4KEUA 3NZRA 1KXTA 3CAVA 2YW3A 3S6TA 2OXNA 7A3HA 3IJIA 1T40A 1J4EA 1UD8A 3ARPA 2HV5A 1IXQA 3TE9A 2D69A 3CUZA 4JTQA 4B9ZA 4YPJA 1US0A 3BLOA 5FAGA 3AHVA 1R85A 4XZBA 3LUOA 1ZJBA 1GEQA 3GU2A 3MHGA 3NL3A 1BLIA 1US2A 4C6OA 3EOLA 2J8GA 4U5IA 1HJWA 1U5HA 1T7LA 3IANA 3E5BA 4K8GA 1GRJA 2VX7A 1ECQA 5RUBA 3W76A 2PLJA 2VEPA 4GUFA 1I75A 3FDKA 4DQWA 1MZRA 5DLCA 3K46A 3WLRA 2ZZ2A 4IMFA 2QS8A 1E55A 4B5VA 3KLKA 5FOOA 1E43A 3GTIA 4UFKA 2Z24A 1HKKA 1XL9A 1PYMA 1VCVA 4M56A 1YPXA 4J3VA 4UFHA 3NEVA 2WK2A 3L4VA 3THDA 4FXJA 2DSZA 1SVDA 4IM4A 3BAJA 2FH8A 4CU7A 2HXTA 1HZYA 5EMLA 1O1HA 2AAAA 1AH4A 4NZ3A 3GZAA 1Q8JA 4JHOA 2WKGA 4ZTXA 3N2OA 1XSKA 4R7JA 3WD1A 5J8LA 4DLMA 3VIKA 1QHPA 2HE5A 2ZRXA 1Z32X 2VCDA 3AMLA 4GUJA 5I3FA 4JTGA 5F7UA 5I23A 3UNTA 2GUBA 1AZ1A 5HPOA 2VO5A 4L9YA 4FZIA 3NL5A 4LVDA 1NWSA 5ENLA 5AYIA 1LBFA 5J04A 4K8EA 2XP9A 1XUUA 2PBGA 1HJQA 5ABHA 3H4WA 3NO5A 4XAFA 3KBSA 2ATMA 1VP5A 2XSXA 1KKRA 1VBGA 2QJNA 1SQ7A 2Z1WA 4LEQA 2YKKA 2FHFA 1Y7VA 3S46A 3RRXA 4A4AA 1RK6A 4AQLA 1XIEA 1R9ZA 2OT1A 5CZ0A 3M5VA 2XIOA 3VKBA 1A5OC 2Q8ZA 2ALDA 3LBMA 4B2DD 5AECA 4C1KA 3W87A 2YDSA 3OQ8A 4ZOBA 5BOOA 2Y4SA 1HQTA 1R8LA 4AD4A 4PMRA 4HPXA 5IHRA 2ZKMX 3LZ5A 5HUPA 4A3UA 3DFYA 4Q8TA 4NY2A 3IRDA 5K4XA 3EXSA 2ZZ7A 4JPGA 2PDMA 3O2LA 1UB3A 1EOMA 2ZUWA 3N9RA 4BWLC 3HPZA 4NUWA 4Q4SA 3ZR4A 4FX7A 5EMUA 3PRBA 4IGHA 1SFSA 1UZHA 3GVVA 3T2PA 2FH6A 1NQKA 2PSNA 5F2GA 1TQXA 4NJIA 3KAFA 1VR6A 3LMYA 2H3DA 1GKPA 1BPLB 4C65A 3UQAA 4XAGA 3AXHA 5HATA 5I5RA 4GIYA 5EFFA 4UCFA 4PEEA 4JS3A 3O5KA 3MMWA 5HINA 1LUCA 3B8VA 1EJWC 2VFEA 4PCNA 4CQ9A 4F2BA 1NFGA 3N2TA 3L5MA 1X98A 3O6DA 1JNSA 2MLXA 3OVGA 1ELSA 2C18A 2FHCA 3VD7A 4Q3MA 2BG5A 1LBMA 5DX7A 2YL6A 3R1ZA 3TX9A 1K8XA 1EEXA 4CEUC 1AQHA 4MMWA 5D02A 4KGLA 1VFTA 5AYZA 1Q6LA 3L4YA 1EYWA 1A5MC 2ZE3A 1XRFA 2P8BA 4DPQA 3GTNA 4F0SA 5E6ZA 4B5TA 3IGHX 3F5LA 1NELA 1IE7C 2CHRA 4Y6GA 2ONEA 2PDQA 3OVPA 2WNWA 3T6CA 2GJPA 3NO3A 4CN4A 3WQ8A 1HNYA 1BF6A 3P2VA 1XYCA 3O5DA 3QPZA 5AC6A 4D6CA 2DG3A 4G56A 3TQKA 3EWCA 5DFAA 3IAQA 3W86A 3GYCA 4BF9A 1DQUA 5K7JA 2CEQA 2WMIB 2AQWA 1R9XA 3K8MA 4OBSA 1XWYA 3CH0A 4Z2KA 4OQVA 1W3KA 3BJSA 4U85A 4OV9A 4J35A 4M8UA 4C6IA 1QASA 3THCA 5FEPA 1Z41A 4A3QA 2H9AA 3LDVA 5REQA 1XC4A 2ZZ4A 4TVDA 2HNHA 2Y61A 4P2VA 3EX4A 2ZWZA 4V2XA 4Y8FA 3NYDA 1M5YA 2QCHA 4V33A 4I9JA 4HZ7A 4NILA 1KTBA 8XIAA 2J9ZA 1R3SA 4GXWA 1LM1A 3TYDA 4Q33A 3CUFA 3QR0A 1NJJA 3FFSA 4IQCA 1WNOA 3TYUA 1G67A 1ZBKA 5HDRA 1XD0A 3NPWA 2H3BA 4ODPA 5BNKA 1HKWA 3CYVA 3IKDA 3WQWA 4UR7A 1UA7A 4FXFA 5GNYA 1TVPA 4DYEA 4IGSA 2AKMA 3QH2A 4PN2A 1QU4A 2INFA 5JH1A 1UR8A 2E6FA 3G0XA 4TX8A 1FKTA 1CXHA 2R24A 3H12A 4A3YA 1UZ1A 1SW0A 3BG9A 2XGIA 4U84A 3DKJA 3LXBA 5XINA 1YTEA 3REQB 2IUZA 5G5IA 3PZIA 3A21A 1CPUA 5C9UA 4HJWA 3LM7A 1O1ZA 3AIWA 3GVQA 4RPPA 3AXXA 2FZMA 3CS2A 1Q6CA 2QV5A 3O5QA 1JYWA 4DJFA 3BLDA 4WIWA 2IQTA 1V4YA 1E6ZA 1VAHA 3WQ4A 1EHAA 2BY1A 1I45A 4GLEA 2NX9A 2NW0A 1BQCA 3ONCA 4HSOA 2ZXQA 1W54A 3N6JA 3TQ0A 1ISVA 3QXBA 2NQLA 1CTNA 5ABGA 5I3HA 3HN3A 4QIBA 4QT3A 5ECUA 3N2MA 1DJWA 2BY0A 2DZUA 1TCDA 3G1SA 3PNUA 1QDSA 1UHVA 4MGGA 1F73A 5D9OA 1I6NA 2HK1A 1OZMA 2PPPA 3QW4B 5MF5A 2YBTA 4WRHA 3W7HA 1LORA 1S2VA 4OOUA 1MWOA 3QLLA 4QQUA 1TO3A 5MHBA 2BGNE 2EJ1A 3FYYA 3FLUA 3G6LA 2PMQA 4IISA 2R1PA 1I2NA 3GR8A 4X63A 2E8YA 1NQ6A 4GH3A 3BMWA 3A4XA 2YYUA 3BSHA 1ZUAX 3RNDA 1VHCA 4XK2A 3UR8A 4MNMA 3LXCA 1ADDA 3NM1A 2WANA 3KP0A 2C1GA 4KKXA 2Y7FA 3ID7A 2OR2A 1FHVA 4OUIA 1FX6A 3EOOA 1W9BM 3BW2A 5T91A 4PBEA 3LM3A 3SRFA 4FOJA 4H1ZA 4H9UA 2VGBA 1DBTA 2NX3A 2F2DA 3TVAA 5K2ZA 2C15A 3W1XA 1IEIA 3RN6A 5I09A 1PKYA 3MT1A 3EOUA 1B2YA 3SUTA 4A2SA 2J6VA 3DDMA 4IJRA 1GOMA 3RHGA 5A94A 4WD0A 2P4VA 1EO7A 2DDXA 3D47A 9CGTA 3R94A 4IIEA 3HJZA 3LCIA 1VBJA 4NQ1A 3WBWA 1TELA 4PR4A 2R94A 5C54A 3WF4A 1ITUA 3GNOA 2YB1A 2RUCA 1L6GA 2R1KA 3W23A 4CD4A 3EB2A 1P1XA 4JKLA 4HU3A 3KTSA 3DI0A 1UBSA 4GO9A 4L3NA 1QRQA 2GL5A 2DQXA 8CGTA 4M81A 1J6YA 4H4IA 1WZLA 4JL2A 4M51A 1OFDA 3R58A 2L5HA 2V5BA 4W85A 3CV7A 1GVRA 4DRSA 1OGBA 2DJXA 4MPQA 1W32A 3H2AA 4S3CA 3MP5A 4Y2WA 3MCNA 2RJHA 3APGA 2PDCA 3TMQA 3STFA 4W7UA 5A6TC 3AIQA 3GDLA 3H4GA 2RDXA 1QOXA 3SCRA 1V6YA 1B3WA 4NJJA 2IPJA 5JH8A 3W85A 3HGSA 4PRTA 1S2UA 4M7TA 4C6DA 3PC0A 4C7GA 1FH9A 2QMKA 3UJFA 1I1XA 1GW9A 3GAYA 1AMKA 3OU8A 4XVEA 1Y65A 1W1B1 1E4NA 3O0KA 2ZQUA 2DT0A 3W72A 2ZUNA 3F4NA 4B3ZA 1V0LA 2PU0A 1R9YA 5LZLA 1E0WA 3M7WA 4OJYA 2NQ9A 3S1UA 2XVPA 2OJPA 1ADOA 3OIXA 2W91A 1W3TA 4HA0A 3T8QA 4NIRA 4GO8A 1OD8A 4DXKA 3PBYA 3UERA 4PSPA 3UCDA 3VOHA 1EA0A 4S3GA 3S4TA 1D8WA 3MS8A 3CNYA 3CUJA 1W8SA 3C3UA 5CGQA 2PDXA 3FNDA 3PK7A 3CQHA 3OHIA 3O5EA 2ZX9A 1QPRA 3N1AA 3CWNA 1ZSXA 1WXYA 3LHVA 3RJXA 2A3HA 4WY0B 1NH6A 1JD7A 3R43A 4OECA 2C71A 4BKNA 3NVDA 2VGFA 4EVZA 3N6QA 2YCLA 3IWPA 4GVIA 1XH1A 2ZX6A 3MKVA 1TPVA 1YKWA 2ZXAA 1UUQA 1UJPA 1GT8A 2YCEA 3ZT6A 6ALDA 4QNEA 4W87A 1LRQA 1XG4A 3HG3A 1QPLA 4HA4A 3M46A 4W9OA 3E0LA 2GVGA 1KGWA 4Q8NA 1EP1A 3O15A 4XZWA 3NZ1A 4O53A 2CW6A 4MSPA 2PF8A 1F8MA 4MB4A 1QI0A 4PBFA 4PUNA 3AJ7A 2GZXA 3W7OA 5I3GA 4PL1A 3FHQA 5I7GA 1QFEA 3PTDA 3WH7A 3W27A 3GFYA 3B8IA 5FJRA 3PULA 4GZJA 3WDHA 5FSEC 4IICA 3T0BA 1CYGA 5K4ZA 3W28A 4GUIA 3WMBA 3TA6A 3VCCA 3W1PA 5JIPA 3URNA 1LG1A 1OGGA 4C5ZA 5KZMA 3T2QA 1WQ5A 4GX8A 2Z29A 2INZA 1MDRA 3ARWA 3T81A 2FAPA 3U8GA 2QVNA 3WNNA 4WOQA 4YTUA 5J5RA 2CETA 1DJZA 5L6UA 3CAKA 3DESA 5E93A 3VD9A 1YE6A 3VGFA 4DBWA 1M7JA 1JVNA 1W3LA 2BV9A 4AVFA 4UTMA 1H7NA 4K2SA 1WDSA 3AHYA 3VOFA 2BVYA 5LHEA 4MWAC 4ZMGA 3BLEA 3NPUA 4DBSA 5M5DA 4R88A 4KCWA 1JFHA 4MJZA 3BMXA 2VNCA 3V1HA 1SZRA 1AMYA 3UD6A 5HJYA 4PC8A 3MY9A 5I2UA 4H19A 4BA0A 4AZIA 3LTYA 4IP5A 4NZ5A 4A22A 3THQA 2BY3A 4AH7A 3DG6A 5A8NA 3CHEA 4RDVA 3IPWA 2Z6JA 1TJ0A 4O1AA 1NIUA 3DC8A 3ZVHA 1XC6A 4Y9NA 4RZ4A 2HXUA 2VVNA 2EG7A 2XYLA 4XO6A 3M0HA 1J4HA 2V81A 4E8GA 5DRIA 3E1F1 4ZGYA 1NF0A 2DGAA 2F21A 1PS9A 1PO9A 1JRBA 3HV8A 3DHPA 3N11A 4LVGA 3T44A 4GOAA 1XGZA 4XD5A 1OJXA 3RX2A 1XSIA 4CQDA 2DZTA 5CSUA 1N2VA 2O0TA 4Z08A 4H7ZA 4G9PA 2FJUB 5HNUA 4EOUA 3IV8A 4Q32A 1DJHA 3SJNA 1YBQA 2WNZA 4JN6A 1OX4A 1Y5XA 1FWDC 1TQJA 3WCZA 2WVSA 4J2MA 4EF8A 1TWDA 1LF1A 3SFKA 3RG6A 1W9UA 3QTGA 1I4NA 4WSKA 3J7HA 5A8PA 2F8QA 4HNOA 1QNOA 1OB0A 1TSIA 4RKAA 4C7FA 3VTRA 4AZBA 3VD4A 2Y2WA 2TAAA 5A6MA 1IXOA 4C1LA 2WO5A 3GM8A 1XKYA 3PVFA 4GQQA 2ZWYA 3MDYB 2BY2A 1YNQA 5I77A 1CNVA 1EJRC 2ZRYA 2XGZA 2XDFA 2W63A 2DSUA 1BWVA 2B7QA 4QS6A 3WDIA 3KZ7A 1QTWA 2PTXA 4XG1A 3M1ZA 2PWUA 3T4WA 2Y85A 4IXHA 1N82A 4MWAD 4JDYA 2HVMA 5CBJA 3W7EA 4ZQMA 1JPIA 1KO0A 3LHYA 1H0GA 4B5UA 3VIFA 4LY8A 3GR4A 1QI3A 5FEXA 5HANA 1JRCA 4EE9A 2VVSA 4XWUA 2P10A 4JYFA 3GXIA 2ZA1A 1G7VA 1TVNA 3AU6A 1B54A 4S3JA 2OEKA 3OBKA 1GONA 1U79A 3E0FA 1KCKA 3ZR6A 5BU6A 4NZCA 4V15A 4NRSA 4HHMA 4IX0A 5CBBA 3TJXA 5LSMA 3EDKA 3N17A 4DO4A 3W1UA 1LWJA 4LY4A 1ITCA 1IT8A 1E1CA 3SB0A 1KWGA 2WB5A 4QJ3B 4ZOCA 4UTIA 1M1BA 2F9RA 3AXMA 2Q02A 1VENA 1TYGA 4H7CA 3DECA 4C60A 4RNFA 2XH2A 2WSQA 2ISSA 1QW8A 1TE1A 2ISFA 4D9PA 3SQLA 2GGEA 1YX1A 1OYCA 2DV0A 5FCZA 4TX9A 4D8ZA 4ATLA 3CL8A 3CEPA 3ELFA 1IT7A 4HU4A 3FXYA 1KBIA 3C5QA 4S3DA 1BKFA 1J9YA 1TV5A 3H22A 2OWWA 5K9CA 4GK8A 4PTWA 2JE8A 3CTLA 1CXFA 3HF3A 3M64A 3M0YA 3RCMA 1GCYA 2DG4A 1BTCA 2I5IA 3GDRA 3MSYA 2HDJA 4DWSA 4KPLA 1W2VA 5IBXC 1D2KA 4I90A 5HW6A 3ES8A 3PWIA 3UZ5A 3SGZA 2G5WA 4NT0A 3WH9A 4DI9A 4PBGA 3GG0A 4AEOA 3UQBA 1KM6A 1JCNA 3K1GA 1UD6A 2VRQA 2Y8UA 2DW6A 4CGTA 2RKXA 3ITTA 5DQPA 3VMOA 5I3JA 5U7SA 3LD5A 1XLBA 2WLZA 4NNCA 1JF5A 4JTAA 3KVMA 3PSWA 2Z1BA 3JRKA 4ZTYA 2QIIA 2GLKA 1N8WA 3LQGA 2C1HA 2E5BA 2WHKA 3AUJA 1V5XA 3HGOA 4CCCA 3UEQA 2VX4A 5SWUA 4E38A 3KRZA 1VLIA 2XGBA 1Q7ZA 4DWSD 3OVQA 1SFTA 3RM4A 5T9BG 2C79A 4KIEA 3M6YA 3MMDA 5HQEA 1K8YA 3EKZA 3H6OA 5AHLA 4G8TA 3U5YA 1XISA 3WJZA 2IS7A 4A8LA 1HL9A 2RGMA 2CFFA 2Q5AA 3L65A 4FNRA 4FALA 4UQDA 3CHCA 3UYCA 4U28A 1DE6A 3HU7A 3LGEA 4P7LA 2J7EA 4UXDA 2XWDA 1FXQA 4WVXA 3CUGA 3NCOA 3R13A 5HQLA 3NQVA 5FL0A 2J7HA 4S38A 3GXNA 2H90A 4HSHA 5A6KA 1XV8A 1TZZA 1QK2A 3PP7A 1TPEA 1WX0A 2F6XA 4YJ5A 3AO0A 2QMJA 4JTKA 3UJRA 3CH9A 2X1TA 3VGEA 4Q8PA 3NL2A 4CNNA 4HARA 1MRQA 5GJPA 1FVPA 3W71A 2FPTA 3B04A 2GQAA 2WCSA 3EBVA 2C19A 4WSJA 4LFYA 5CJMA 1WO2A 1H7PA 3W7IA 1WKFA 4Q8OA 3B8WA 3S2CA 1V6TA 2W79A 3SY1A 2PAJA 4IPXA 4C5YA 4C1NB 4DX3A 1UH2A 3N14A 2VEFA 4Q4KA 1LRNA 3AU2A 4CNPA 3JR2A 2XIJA 3N3TA 5G2IA 1SZEA 1JIBA 3AYSA 4IQDA 5CAKA 4XSMA 1PZ2A 4JFJA 3STPA 3EB3A 4NZ1A 4N42A 4Z1CA 1FP8A 3AROA 3G1FA 2I5GA 4PZVA 3WLKX 3NWRA 5CJNA 4CQBA 3NRKA 4YU1A 3BJTA 3KDOA 4F2UA 2EEXA 1FFRA 1OSEA 3JXVA 1XLGA 1QJWA 3Q65A 4LCSA 2A3LA 2ZZ6A 2VFHA 4MDOA 4BCEA 2OWXA 3T8LA 4FNPA 1I8JA 1O12A 2CBJA 2TMDA 4RW5A 4BZYA 4DH0A 4IMGA 2Z2UA 3VIHA 4E5TA 3OGVA 2PDKA 3WLNA 4AVOA 4DWDA 1F61A 1D7IA 4DNHA 1MQPA 2V5DA 1KR0A 3U3HA 3KOFA 3CZJA 4N4PA 4N4QA 5IM51 4H8HA 2ASHA 3RFAA 3FIGA 3T07A 4HPHA 3IGXA 3GHTA 4K38A 1IV8A 3V4BA 1H11A 5EA9A 4L6HA 2WM0A 1TZ7A 5A6LA 1BG9A 4O1CA 1EC7A 4D1JA 4Q22A 3MI6A 3AHTA 1ADSA 3NQBA 1ZNNA 4XZMX 2QCGA 4LSBA 1RQBA 4IMDA 2ZA2A 1U1UA 1TTJA 2R6OA 5MKGB 2ZR6A 3M9YA 4P8VA 5HWBA 2RDUA 4GXMA 4WLCA 4AYSA 1H61A 1W9PA 1VEPA 2GSJA 1Y0OA 3T0DA 4NAFA 3W00A 1KQYA 4IPIA 4NI3A 1CECA 1EX1A 3WLIA 1CT5A 3PWGA 1DXFA 3CMFA 4L4LA 1H09A 1IWAA 3ZJ7A 2EF9A 4FLSA 1RJQA 5M1TA 1JCMP 4OHQA 1IEWA 4HMDA 4XV0A 2TODA 4TXEA 3GH7A 3MMUA 3BQ5A 1F8AB 2FGZA 5F1UA 3QQ0A 1QWGA 1EC8A 5HOSA 3BCJA 2PWHA 4PMOA 2CCRA 4G6CA 5KZ6A 1CW2A 1EX5A 1AH3A 3RR1A 3RMJA 3QV8A 4GVHA 4M5PA 3VKKA 5ABFA 2PLMA 4PUDA 3W7CA 3SADA 4Q4QA 1ZFJA 4JIIX 4GHRA 5FD0A 4LF2A 1MEWA 3C0LA 4N6EA 2Y5EA 4I7VA 4X0VA 1EWDA 2WZIA 5CSSA 3LHZA 4J7RA 1J0YA 3E3HA 1FD9A 1OX5A 1J0HA 1K4GA 4ILSA 1Z48A 4CN6A 3JVAA 1NY1A 2X2GA 4C6BA 1A3XA 3QMSA 1T5AA 2VX6A 3ZLFA 5IXEA 2DVUA 4PMJA 1UZ4A 4KS0A 4PMNA 2QULA 5LIXX 2GUYA 1XKJA 1WBJA 4PUUA 2I5QA 1B3YA 1E6XM 1TIMA 4KEZA 3W1TA 4DZ2A 1ZY9A 3I4EA 4IP7A 1FA2A 3AMCA 3U9IA 3OP2A 1TCOC 2IXVA 1EPVA 1BXBA 4GMEA 4GFSA 3HZ3A 3D3FA 1NDZA 2FGLA 2PD9A 1WZMA 4DJED 3W7JA 1DWHM 1W1IE 1QPQA 7ENLA 1G5AA 4NNRA 4XO7A 4EWND 2RSEA 1SR0A 4G2PA 3T78A 1JZ3A 4PUEA 2OQYA 2Z2BA 4WDWA 4PMVA 1GQIA 2E6YA 3GC5A 1NP0A 3EKGA 2V67A 3DG3A 4H9XA 4IT4A 1WOBA 1G7UA 4KW2A 4ZB0A 5DIVA 3T0CA 4ZOEA 2DUAA 1ML1A 1GEHA 3BG3A 3DBPA 3GLCA 4AW7A 2I57A 4X3ZA 2XP7A 1JDAA 2W67A 3SSZA 3S1WA 3JYJA 2D9FA 5CQ1A 2FZDA 1KW1A 1AJZA 4WUIA 4AUBA 1UR2A 4M1BA 1ME9A 2VR5A 3W83A 1MO0A 4DWSC 4J3TA 1QT1A 3QZAA 4DO5A 1CXLA 2J6XA 3OA3A 2E28A 1DIOA 4UTLA 1H1YA 1YNYA 5CPTA 3RO8A 4J27A 3KZPA 1UD4A 3H2NA 2I16A 3I3EA 2UY4A 2MANA 1MUWA 3VDCA 1POKA 4UOJA 1HKIA 1XPYA 1Q65A 4GIAA 5CPOA 4OT7A 4JN8A 1W1A1 1YTDA 3EDFA 3I7SA 4IMAA 3TR2A 1H62A 1GORA 3WJYA 3BAKA 3UCCA 4D8AA 1IT0A 5KZDA 1ZAIA 4ZO8A 2UZ9A 3LERA 3C8FA 4P7QA 2PU1A 4JFMA 4GC3A 4JQ1A 4HA1A 1ZBCA 3UESA 1C9WA 3HPFA 3R6IA 3EMCA 4HBEA 2O4MA 2DY3A 4N0RA 2XP6A 7REQB 3LK6A 2O92A 4W9TA 2OOFA 4CQ8A 1WYIA 2A2IA 3OLDA 2WQPA 4LBUA 2QV4A 3MUZ1 1VIWA 4X60A 3FYPA 3AYRA 7CGTA 2VGGA 1YW1A 1GPWA 1UH3A 3OB8A 2FZ9A 3P5YA 4G7EB 4TQTA 1I0BA 4DXVA 5EBAA 4UQ9A 4RJEA 1D3GA 3SW6A 4RV8A 3CLMA 1W5PA 1SYTA 4G1KA 2HROA 1OWQA 2CLLA 3PPCA 5AVNA 1CBGA 4W9QA 3O1NA 3SY5A 2BWGA 2NQZA 2ZC1A 3QHNA 3NQ7A 1RPKA 2ZOXA 3QGVA 4RL3A 4KFPA 3C6CA 3SECA 4RNIA 2YA0A 3GBEA 2EAWA 3FSUA 1NOFA 4ADUA 2CBUA 3UF9A 5DMNA 4C1NA 2DSWA 1PKMA 1UROA 2J74A 3R0DA 2QQ6A 4CEXC 3LI0A 3WJXA 1G4PA 2Y1HA 4M29A 3W1QA 2NVCA 5CC3A 2JF7A 4FI4A 3BVJA 2VZSA 4LBRA 4BS0A 4FK9A 2QCFA 4N9EA 1NF7A 3LBCA 1VIZA 3NG3A 3ANUA 3U57A 4OV4A 4FAPA 2PDJA 1YBQB 5D8WA 3O5GA 5IFTA 3CB3A 1SR9A 1N8IA 3GDTA 1XLHA 4UTFA 3THUA 3RLHA 3C2FA 3L0KA 2VD8A 1E15A 1W1PA 2Z28A 1QI4A 4MB5A 2ZRZA 2J7DA 4W8LA 3NL6A 5HWJA 1GZ1A 2IPGA 6CGTA 2R91A 1Q13A 1QATA 4JIPA 2C0AA 4JQ3A 3W1AA 4KWSA 1EDQA 1VFSA 3SRHA 4AC7C 1O5KA 2VDHA 2WCAA 1L0PA 3VO0A 1TV4A 4JTSA 2WHLA 4AIBA 2WM1A 2NV9A 2FHBA 3ARVA 2DPEA 5AHEA 3BV7A 3USZA 1PKLA 5KEZA 3EA2A 4FF7A 3HM7A 1B5TA 1PJ9A 2J75A 1VPYA 4I8DA 4GZIA 4CD8A 4JIHA 3SCOA 1T6MA 1OF6A 3LLDA 5GPGA 3DYPA 3QQWA 3B0XA 5CZTA 4PCSA 2OZ0A 1GOKA 4JYSA 1BRLA 3EWWA 2VZOA 1OC5A 3GXDA 2YXGA 1M5WA 3PG9A 4C91A 4LAOA 1XLDA 5JIWA 1EJSC 2X40A 1RVKA 2ZICA 3F03K 1DPMA 4XIMA 2VZUA 2WSPA 4H83A 3R89A 4L1WA 4ZXOA 1U2YA 1ZALA 2XH7A 3S5SA 1WAWA 3WD0A 3OYZA 4TW7A 3M0XA 2FDSA 3ZOAA 1V93A 3W6YA 5LNRA 5HWMA 5K9DA 2BXYA 3N12A 2FIQA 5E9AA 3UU0A 2VRJA 1B3XA 1AD1A 3BCFA 3TJLA 3KUMA 4DRIA 1FP9A 3N15A 2HISA 1FH8A 2UY2A 1L1PA 4EANA 3WQOA 2BOFX 2GVEA 4CCZA 1QMLA 4HZMA 3LV5A 1HJUA 1ODZA 1V3MA 1PX8A 5JQ9A 1VEOA 4FNQA 3GX9A 5GJMA 5TD4A 3R11A 1MXSA 5K3VA 2ZYFA 3VX0A 4Z1YA 5DCDA 1W5MA 3MTWA 4D6EA 1DYSA 2VUNA 3QHOA 1YPIA 2XFWA 4FN2A 1K9TA 2UWFA 4ACYA 3KVLA 3RX3A 5E6YA 1I0DA 1TG7A 3N18A 3OLEA 3WJWA 4HYWA 1FWJC 3IIXA 4O0KA 3VVGA 3D0CA 4XD6A 1QCWA 1W37A 4BF8A 3OG3A 3WQGA 3NDZA 1SFLA 4QS5A 4ERGA 3W7NA 1LL4A 3M7SA 1LDCA 1A7XA 4CD5A 1GJPA 2WMHA 3DYOA 3VM5A 3TOYA 1GQJA 5CGMA 2RGLA 4AX6A 1S1PA 3WNLA 1CLKA 4M7SA 3RM8A 4CQAA 3QV9A 3WK1A 1ME8A 3GG1A 3O6YX 1PUDA 3BH4A 2OG9A 3O16A 1OX6A 3GG8A 4LVAA 3GC4A 5D9NA 2PWDA 4WZHA 1FKLA 3TYZA 3IJ8A 4US5A 1VPQA 4HNTA 3PJWA 4A21A 4XAPA 3BGJA 4K1GA 3WJSA 3C52A 1XS2A 1DWAM 2Z7KA 3N29A 5AC4A 5C2XA 3MSDA 1X39A 1KT0A 1J0IA 3U7VA 5DT5A 2A6LA 3ATYA 3KVKA 5C9WA 1E71M 1V3JA 4JKMA 2E09A 5AB3A 4QBXA 4ASTA 1IZCA 4TW6A 2VELA 4KIRA 2ZX7A 3O6AA 3MV11 3NO1A 3FCPA 4OOZA 3LRKA 2XHYA 5CLTA 5LGXA 4LPCA 4GZ7A 2EPMX 3VNJA 3UR7A 2J79A 5DXYA 3RAOA 1RVGA 1OADA 4XZLX 1A0EA 3DHDA 4GYFA 2AQOA 4IIDA 4FA3A 1E0TA 3S9ZA 2G8ZA 2DZBA 1R9HA 5E09A 3NQCA 1A4LA 2D22A 2GWNA 4WJXA 2WAGA 2HE8A 2O9PA 3WF1A 3DENA 3BLPX 2KO7A 2G37A 1QOQA 2XVLA 1X1OA 2E25A 1VS1A 1WZAA 1E9LA 3NPXA 4JTHA 3F5JA 1Q6RA 1RPXA 4DBDA 4GYPA 3KDNA 3QFWA 4HN8A 2D2OA 3WL0A 3RYSA 4PTXA 4UR8A 3FK4A 1BYDA 2BVTA 4GQRA 2QXWA 3W6LA 2FQIA 2Z27A 3OODA 3UF8A 3G18A 1JFXA 3OQEA 3B8SA 1EB3A 3MW7A 3W22A 1XH0A 4JHZA 2FDMA 2WJDA 3UVAA 4ZQNA 4I8YA 1VFFA 2Z26A 1L6YA 2V5CA 4RXGA 1ZU8A 1F4HA 3ME3A 4FLQA 3KTXA 3R0KA 3LCHA 3VDAA 3N2BA 1B4EA 5GQBA 1QNRA 4I5XA 3CPUA 1LUCB 4EX4A 4AISA 3H9RB 1CXIA 1R2SA 4KR0B 4PCFA 3IS4A 3LPGA 4ZE4A 2FKPA 1DORA 4M6VA 1IGSA 2YZRA 3TYEA 3W7KA 4PL2A 1O94A 3RM9A 4JX6A 3WX7A 5DO2A 3IJLA 1PX3A 4LS2A 1PCWA 3V75A 3OLIA 2WHJA 1V0KA 4ZO9A 2VWSA 3UWZA 3O5MA 1GZGA 5A8MA 3KABA 2ZTKA 2VOTA 3SUSA 5A2CA 4UB9A 5LNVA 3PBGA 5DCEA 4H8NA 4FX8A 3UXDA 1VRXA 2VYOA 4IPLA 3UPMA 1OIMA 2CLFA 1F7BA 3W82A 3AIRA 2HQAA 1RBAA 4UQCA 5BRBA 2VEMA 3WBXA 5T26A 4HTBA 3C61A 4RW3A 3DAQA 1KRBC 2VR2A 4WSHA 4JL1A 1ZCNA 1UR0A 1ZGDA 2F61A 3RILA 4X9YA 4XD3A 1FKBA 3AHXA 1RD6A 4H6EA 4HNVA 4U4MA 3PY2A 2E77A 4R33A 5CSRA 1BGAA 4LV4A 1C3FA 2YLLA 4US6A 3M6DA 1MW2A 3VIMA 4LAXA 2JK2A 1UIOA 4DZAA 1G01A 3B9DA 1FHUA 3TNOA 1FHDA 4AF0A 2CESA 2POTA 1GQNA 1OFRA 3PPFA 3SUUA 3ITCA 3MC5A 1ZBWA 2EGZA 5F1VA 4Z1BA 2YL9A 3BW3A 4EXBA 3HV9A 2Z1XA 4XQ6A 1TPFA 1TA3A 3K4WA 4E3VA 1QHZA 1KBLA 1DQXA 3VYLA 2PF0A 3TQVA 2WC7A 4L9ZA 3S1XA 4BI5A 4YTQA 2A7NA 4E8DA 1B31A 3GVGA 4N9DA 3ZWSA 2YDRA 5EMKA 4L61A 5D05A 3UQIA 4RR4A 2D0FA 4KRZA 5B80A 4Y9AA 3AXIA 2J27A 1XW8A 3VGBA 2VJXA 4QRNA 3G1HA 1JCYA 1YDNA 1VFMA 3VGHA 4EPBC 2VC7A 4XBSA 4XSLA 2ZTJA 1WPCA 1POJA 5LA1A 1B9BA 2ZVRA 1A5AA 3M5ZA 4DAIA 3GFZA 1WUEA 1GOQA 2Z0IA 1UPPA 3PJUA 2A5HA 1MNZA 1JYVA 3CAWA 2BP1A 5TIMA 1Q6FA 4ZCWA 1EJTC 1DHPA 3NM3A 3AS1A 4XUYA 4L1GA 2X2YA 1X38A 4O52A 1E0VA 1I2RA 1V6WA 1XRSA 4QP0A 4DBEA 4ROQA 4L9XA 3ABQA 1TWIA 3G8RA 2WYSA 1A5CA 2QDGA 5XIAA 3CZ8A 5PTDA 3DFHA 3TXZA 4QSHA 3GU0A 5AC5A 4YVXA 4DZ3A 2XPAA 3KOXA 1GOXA 2Q3OA 3I4KA 1JNDA 2WZTA 3B8DA 5HWCA 3SO7A 2XFFA 2EKGA 4IL0A 3TTOA 4FB7A 1ZK6A 1CENA 1OT2A 2V6AA 1PDZA 4FOUA 4J3ZA 3TV8A 4S2BA 3OG2A 5LXEA 4S39A 4LANA 2QUNA 3W1MA 4LVFA 4XIAA 2IXUA 4LS0A 1J10A 3L4UA 4HMEA 1KCZA 4MKNA 2EQDA 1CGYA 1QUMA 2ZQTA 4AD3A 3B40A 2RDTA 2VEIA 1UQYA 3LTSA 1G6CA 4RDZA 1U30A 1KRAC 4GYJA 1FXPA 3ZLGA 5AFDA 3Q4DA 1XLJA 1UKOA 2GUUA 1JCHB 2RURA 2QPSA 4AZGA 1IXNA 3G5EA 3LUTA 1TUXA 2D73A 2Z1KA 4K39A 2Y89A 3W7QA 3NOEA 4GQGA 4JTDA 4ML9A 5GNZA 5A8OA 4YHEA 4BK9A 4E4UA 3BQ6A 2NQJA 5C2GA 3E38A 4L5ZA 4QAIA 4TR9A 2Y7EA 3DHFA 4O13A 1TPC1 1XLMA 4NYYA 5HK4A 1XGDA 6A3HA 4PRRA 3I10A 3S9YA 4L1XA 3PBWA 2ABBA 3TW6A 4Q7IA 4ODMA 1PIFA 2R82A 5FJJA 3N25A 3WQ6A 5BYWA 1GVYA 5H8PA 1SO5A 2BX7A 4GNVA 2X1IA 3MKKA 4NX0A 4C6JA 3VKJA 1OVDA 3BJFA 5AKQA 3AMDA 3GD6A 1MXGA 3ZJKA 3W81A 4GC4A 3K8LA 1HTIA 1X6LA 1ZPTA 4C6FA 3UNDA 2KAUC 3WF0A 1TPDA 1AUSL 2CYGA 3T2OA 3NR0A 3OJGA 3VM7A 4JKKA 5LIYX 4MUPA 3LLXA 4LCQA 3NDOA 4U31A 1AA1B 2B7PA 2HPIA 4YS1A 6TAAA 2PBOA 4AAJA 2PTDA 1FWSA 3UWVA 4HK7A 4US5D 3AIBA 3GC2A 3B0YA 3UZZA 1YQ2A 2M2AA 2AQVA 3W38A 1DWGM 4MJ2A 3MBDA 2BHUA 1RP8A 3BLIA 4KWWA 3W7PA 1JZ4A 1JZ8A 3EOEA 1YDVA 4HZ6A 1W1YA 1LROA 4UQAA 2V2CA 1TJPA 2JEQA 4JY9A 1VF8A 3UBPC 1VKFA 1Q6DA 3W07A 2KR7A 5AYXA 3T09A 3DI1A 3AIVA 2F2KA 4HHHA 4F0LA 1PDYA 1LJYA 1XDMA 2QYGA 1IWPA 2E5CA 2EO7A 3CGTA 1DJIA 5IFPA 2OKOA 1LZOA 1XCFA 3ANYA 1YLVA 4AXKA 4P61A 3L2IA 3GVRA 1J0ZA 4A8NA 3O5PA 4YWIA 4HGXA 4C6NA 3O06A 3ARRA 3VIPA 1CGVA 1TA3B 1V03A 3PZGA 1K03A 1E72M 3LOTA 4J40A 3JYMA 3OBAA 1Z9AA 1BHGA 3QGAC 3H7RA 4C6QA 5D2YA 1IEXA 1PCKA 4A8RA 2AMXA 1UP2A 4FLRA 2X8RA 4GIVA 3OA5A 4POCA 2NT1A 3W2LA 1JCTA 5CSYA 2O9RA 3KZSA 1NDWA 3O0FA 3PM6A 1BQGA 4V28A 1WAUA 4U2ZA 4GFIA 4GINA 3HB9A 2ISDA 1TTIA 5C71A 2Y7GA 2FB2A 3PZVA 3S83A 4YLWA 4HBKA 1LLOA 3URQA 1UR3M 1DJGA 2Z6IA 1XIGA 4UOQA 3HA1A 3G6MA 1SO3A 4AXNA 3L23A 1WE5A 4FIRA 1DKWA 4EXQA 3FGCB 2GQ8A 1K9EA 1GTEA 3ONBA 4Z2LA 1I9CB 2KGJA 2NLYA 2GDVA 1KGXA 3CQIA 3NSNA 1A5BA 1FWEC 1VGAA 4JFTA 2ATSA 3TCZA 1B3OA 1H2JA 3H21A 3IK8A 1XDLA 4Z2IA 1LWHA 2FMNA 3KEHA 1HO1A 3CMGA 1CB2A 5D32A 4LOCA 3WO8A 5BWFA 4X22A 3KL5A 3N2CA 1WKYA 5HT1A 1VPXA 4OFCA 4E2OA 1X96A 2XIIA 1IR1A 4I7WA 1O5QA 4CD7A 3L4WA 1XI3A 3T0TA 1C92A 1IGWA 3WFLA 3DU0A 1FKRA 2OYLA 4DI8A 5HQMA 3UWYA 1OCNA 4A3RA 3MO4A 5HTGA 2DZPA 4K8HA 2BASA 2ZADA 3RPMA 4D6JA 3BSMA 3QBUA 4S3AA 3OZPA 4JTCA 2B7NA 2B81A 1CGUA 2JIWA 3PZMA 1X7IA 3AOFA 3NPVA 5A2BA 5HXMA 3SGUA 3U4AA 3CHDA 1J18A 1Z89A 4J9JA 2PC4A 4XKYA 1E6SM 2F7FA 3FS2A 4TTUA 3TAOA 4Z2GA 1L2QA 4R27A 1EZWA 2P0OA 1XYFA 3L9CA 3QQ1A 3MUIA 5A8QA 2N87A 3BZJA 2VXNA 4QNWA 4MPKA 2XVKA 2RHGA 3W25A 3VGDA 3RR4A 2QCLA 1P0NA 2WXDM 1H5YA 5AZ0A 1VZWA 2V5JA 5FEWA 4DZHA 4IUOA 3GXPA 5B7YA 1NEYA 3P8IA 4DUWA 3UI5A 1MUCA 3EEGA 2ZE0A 4D72A 3VGGA 5CC7A 3QYQA 4Y7EA 2Z25A 2EPLX 3M5XA 1UW9A 3P3BA 3E0IA 4G2DA 2WC4A 5I3KA 2BS9A 4AY1A 2VFIA 5E1QA 2FZBA 1VFUA 3ATZA 1UKPA 3NQ2A 1JPMA 1L6SA 4WOZA 3MANA 2A3BA 1BSIA 1XBVA 4GKTA 1RH9A 3ABSA 1ONWA 3ZQ9A 1HJSA 4DUVA 2OCZA 4LU0A 3HTWA 3FAWA 3S0CA 1J96A 5JMUA 1FCBA 5K9XA 3EOSA 1V3KA 4LTSA 4RPQA 1UUOA 4MWAB 4RZBA 1Q6OA 3BOFA 3N4FA 4Z0JA 4ERAA 1CXKA 3GZ3A 4UR9A 2XVGA 1ZJAA 4WR3A 3K4AA 3KCOA 1ZLPA 4IMEA 1HT6A 1IX5A 1E6QM 4K6AA 1EP2A 3JW7A 4MYAA 4C6KA 1BYBA 2J9YA 2LPVA 2ZRWA 3LCLA 3UGRA 4JFSA 5A2AA 3E2VA 2OOGA 2ESCA 1C7SA 1FDYA 3KHJA 4H00A 2JQXA 4H8VA 2YSWA 3E96A 3XIMA 2D0GA 1XIMA 2VGIA 3R0UA 3CBWA 2WMJA 3GHSA 2IKIA 2I1OA 1ENUA 3HPXA 1F6PA 3PPGA 4P7OA 2HNEA 2VC6A 4XZHA 1PV8A 1QNVA 5I79A 2DSKA 5C6MA 1XBYA 3TYCA 1KFBA 1KV5A 1JUEA 1C9HA 3O8AA 4UBPC 3TN3A 2DIJA 1Q1CA 2GWGA 3GRIA 1M65A 3GDBA 4Y90A 2X0SA 1JZ2A 2RDWA 4NAEB 3B9EA 1YADA 2YYTA 1WDPA 4RE0A 3QKZA 3F4DA 1RHCA 2BHZA 2NUYA 1Z8AA 4GNKB 3IUDA 3N4AA 3GFXA 3FGCA 1BEUA 1CLXA 1V02A 3URAA 4LNCA 4OU1A 1SJBA 2WNNA 1SJCA 3R8RA 1EWEA 2OKTA 1S2CA 1TTPA 3M0KA 5CBIA 1QBAA 3ARQA 4RDWA 1OABA 2XINA 5JXQA 3B8TA 1KLZA 4I7UA 3ISIX 5DXXA 3RLVA 7PTDA 1K9FA 5A69A 3C3NA 2YA1A 1EBHA 2X7WA 2VHLA 1XIFA 5CAHA 4ICNA 3VKAA 3L21A 2BGSA 3BOXA 3BXWA 3QOMA 1PAMA 4LB3A 1XD1A 5HNRA 3PRDA 2PD5A 1I60A 4AD1A 2E4TA 1IXPA 4TW8A 1HL8A 3Q94A 1W1ZA 4QG9A 2FVLA 1O5RA 4ZO7A 4DRJA 1TMHA 1JL8A 3RXZA 3T1GA 2BODX 4O1FA 3CT2A 1I2QA 3ICJA 2Y63A 4H7VA 4RE2A 7TIMA 4MZYA 1JZ7A 2A85A 3WLSA 1U1JA 1UMYA 5J6EA 1BWKA 1ZRQA 2WSRA 1SUXA 3GDMA 5D09A 3K4DA 1KFJA 4Q8QA 4DXXA 3VAWA 5U4NA 2JEPA 3OOBA 3N34A 4DJDA 5DITA 1US3A 4G7FA 1EQPA 3FKRA 5F4WA 1QW9A 2OQHA 2CLEA 3BURA 1AL8A 2YPIA 2YCJA 2B0MA 2CLKA 2HS8A 3UJ2A 3EWZA 3TFCA 4AD5A 3OGRA 2ZR5A 3M0MA 4LRTA 3ARTA 1FKXA 3N4EA 4LCRA 4DRPA 1Q6HA 2YA2A 4MVAA 4ZE5A 3KOZA 3H7VA 3HQPA 4RE3A 2Y62A 3R12A 2R8WA 3VNLA 4LAVA 4HD5A 5FF0A 3CZGA 4EPDC 1GJWA 3L68A 1XPGA 2J7FA 2XZ9A 4Z17A 2P0IA 3WZ0E 1E4IA 2XSAA 4QT2A 2VN1A 4H6KA 4HQVA 1ALDA 3W7DA 1TWZA 3FDGA 4NJHA 5CPNA 1O66A 1BWLA 4IIBA 1GPFA 2GJLA 3A23A 4C6LA 1JVWA 4NJKA 4KQZA 1LWIA 4KEVA 2RFGA 2WW5A 2DQWA 2A1YA 1KM5A 1SO4A 3TSBA 4ODNA 5CPLA 1HKVA 3MZ2A 1MXDA 3KXQA 3EYPA 3KOYA 2FTPA 2GOUA 3UR5A 3H8AA 2EPOA 3KE0A 3LHTA 4LAYA 3BAYA 3P84A 1ZCOA 3QFEA 4ZPWR 3T55A 3F4CA 2ON3A 3LCWA 1CDGA 4LQ1A 5EMJA 2YB4A 1RSCA 1R3VA 4EPEC 1J79A 4BJHA 2V5LA 3GYEA 5LA0A 3W01A 3TN4A 3A5VA 4PUJA 1S46A 1PBGA 2WKJA 3VNYA 1VLWA 2J78A 3QSTA 4HCLA 3UZXA 4MG4A 3GIQA 1UOZA 4EWJA 2CLIA 4FO4A 2VDGA 1DTUA 2LJ4A 1WOAA 3SEPA 4L80A 3PG8A 4S3BA 2JIEA 3QOKA 1QI2A 4LAZA 3EX2A 4F79A 3PZ9A 2JZVA 3SCVA 2MPHA 1J2WA 2F38A 2A6NA 1XIJA 1UR1A 3TW7A 4ADTA 5A6SA 1EHNA 1DWFM 3QMTA 1NFPA 4LGXA 1RQHA 2JGYA 4MAVA 4GNJA 4JEJA 1JDDA 3B03A 3WKZA 2EJAA 3SZ8A 6PTDA 5A6JA 2CC0A 3MBFA 4JTEA 2EPKX 2FTWA 2GVLA 1LRTA 1TREA 3AS2A 1DVJA 1MDLA 1JNEA 3MHFA 1H7XA 4EACA 3UWUA 3QR1A 4PTVA 1BTMA 2EBNA 3W88A 3GU1A 3IUHA 4KCTA 3WMSA 2HCVA 1XBXA 1XUZA 4I9TA 4AZHA 3NQ8A 1G94A 1UR4A 4I6KA 3L4XA 4J3SA 3CV6A 4CNOA 1XBZA 2HBXA 1OCBA 4NAEA 4NYUA 3HMJG 1EJXC 1GHRA 4E2DA 1UUMA 1DL3A 4BQ5A 4EPKA 4PEKA 1ZJIA 4QJ1A 2D1ZA 1FHLA 4FF5A 4ZENA 1ZP3A 4D6FA 1Y5VA 1O6IA 4AWUA 5BMWA 3GXFA 4UFIA 1OBAA 4JDBA 4JNMA 3TK7A 4HK6A 4ALDA 1H7WA 4MOZA 2VFFA 4DBUA 2NUXA 1VJSA 2XU2A 2OFJA 4ODOA 4CCEA 3T9PA 3A4AA 3CL7A 3UCQA 5DF0A 4U86A 4DUXA 2YL8A 4MZ1A 3SFWA 1KV8A 1X1NA 3ZSTA 1GYNA 4TO8A 3SQMA 3TMLA 4UZUA 3URBA 1X8CA 2LLEA 1K8ZA 1TTQA 4BQ3A 3AMKA 4N6FA 2O56A 4XAYA 4YHGA 2YJQA 3GK0A 4Q8WA 5BRQA 1YPFA 3NQGA 4PH6A 5F4XA 2PDNA 5TAOA 1BG4A 2DT3A 1WZKA 3E12A 2VOMA 1GUVA 3VZYA 3RCNA 3V35A 1WBHA 3QR3A 3KBMA 3EX6A 3PPHA 1H51A 3LCFA 2W3ZA 1S5WA 1R3WA 2PDIA 4DUOA 1FJDA 1AL7A 1JF6A 4UTWA 3SCSA 3UJEA 2G41A 4BEUA 1E5NA 2OX1A 5C5YA 1EIXA 3S2LA 4RE4A 1NSJA 1P6WA 1E56A 1UH4A 5LXXA 1FKJA 1E6NA 3NGJA 3M07A 4KEMA 3F7JA 3LCGA 2Z1VA 3SIMA 2V9DA 3BICA 3RLUA 3KRSA 3QHMA 4P8WA 1A5SA 2BDQA 1XFBA 1MNSA 4IQ2A 3MUY1 3H53A 4QG6A 4H2CA 1M7XA 1AG1O 3ZT7A 1DHKA 3IIZA 2CXEA 1R38A 3NYZA 1SFJA 3UG4A 3R7MA 1VBRA 3IEBA 1K7XA 1LT7A 5EKYA 3HQNA 2PEVA 2YLAA 4AYGA 4ECLA 3IRSA 2A3AA 4J3UA 2W66A 3VCRA 5H91A 4S3KA 3KCEA 2XUCA 3WG6A 3CEUA 2VZTA 3EZ4A 1UWUA 1BXCA 4DVOA 1AQ0A 4UIOA 3IIVA 3DKLA 1GYLA 1KKOA 2BFGA 2OO0A 3VXGA 1VFLA 4WXZA 3UPWA 5M17A 2VRKA 4O54A 2E0PA 1RA0A 5FF7A 2PP0A 1ESWA 2VL4A 3A12A 4HMNA 3QC3A 3TN6A 3ZVIA 1VEMA 4GZEA 4RZ5A 1VFHA 1S5VA 2NV2A 3VCNA 2O9OA 1QXLA 4ICMA 2O55A 4B15A 3TROA 1B30A 1J6PA 3S47A 1SJAA 3LV6A 4PODA 3O6CA 4W5ZA 1Q6GA 3AUOA 3AALA 4NVTA 4MFDA 1NMWA 4S2CA 1A4MA 1A5NC 4KWVA 1C29A 3UQNA 1VBUA 2PP1A 3G1YA 4YYCA 5LIKX 4LUSA 2D2GA 3KCJA 3D6NA 2WZMA 3PZUA 4DEFA 2HVNA 1V77A 2X05A 5M03A 1PEZA 4QHRA 3NTPA 1R3RA 3GY1A 3IAPA 3L5AA 3GTFA 1IIGA 4PUWA 2WPGA 1E9YB 2ZDRA 4GACA 2NQ5A 3UZJA 1FWRA 4K7VA 3PUGA 1W9VA 4DLFA 2W0UA 3ZS4A 4Z2JA 2ZDSA 1F40A 1WCGA 1JEZA 2PGRA 3S8HA 4QLJA 1OYAA 4J4KA 4JFVA 3QEZA 3AMGA 2VMFA 4R7OA 3R25A 3GW3A 3KLLA 4QXIA 2PS2A 1P5BA 3EXRA 4IG2A 4NJGA 3MPGA 1AW1A 5AC8A 3R8GA 4O18A 4F0RA 5D2VA 4BR1A 4DM1A 3WLPA 3P14A 5AHFA 2I9UA 1C8QA 3I3DA 2YFNA 4AMCA 3GIYA 4H41A 5DT7A 5E0KA 2DUZA 2VX5A 4LUTA 4LAWA 4NXKA 2PDGA 2F23A 3ZO9A 3NZGA 3G1RA 6XIMA 2E68A 3C2VA 2D24A 4YN5A 3LQLA 4DRHA 3OIHA 1V7YA 3KCLA 1TJ1A 1Q45A 1P48A 4RCXA 2E9BA 1B1YA 1SZGA 4H8UA 5DMLA 3VPLA 3E0WA 3PJTA 2V82A 3BLLA 4Q6XA 2XP5A 1T11A 2QDHA 5HWNA 1LOQA 3B0PA 1LP6A 1TRIA 2JALA 3S5YA 2OO6A 2B5UB 1XXXA 3TOPA 1F6KA 2E8ZA 3DC0A 4DNMA 2WLYA 3ABRA 7REQA 2HJPA 4AEEA 2W27A 3TC5A 2XVNA 4ATDA 3W02A 3TC7A 3VE9A 1YDOA 3BLKA 3MSGA 1TWSA 1JZ5A 3E74A 4AD0A 2D3LA 2ZX5A 5FF3A 4IJBA 1XJBA 2WNQA 1OX4B 4FIQA 4B90A 4L7ZA 3CM4A 4Q8VA 3GWQA 4O2TA 1SGJA 1Q7QA 3TZFA 3KS5A 1H5VA 1TPWA 2OZ3A 2VQTA 4DROA 5HULA 1KFLA 5H8MA 3ARSA 1GVQA 1J93A 4W4QA 1KBJA 4KERA 4HA3A 3CL6A 4DRMA 1MEIA 4XUGA 2DORA 3FOKA 5A8GA 5KTLA 2G4FA 3MMTA 3M5YA 5HKGA 4K36A 1M53A 1ISWA 2FJKA 4L6DA 3A4WA 4UTKA 1JAEA 2GGIA 4IT6A 2PDFA 4A8IA 4MWAE 5EFDA 5TBOA 4CUCA 5HR7A 3HPAA 4TNSA 3GVWA 1H63A 1ZS2A 3LA4A 2JGQA 1ZB5A 1LYXA 4WGHA 3EXTA 2V30A 3V36A 4Z1DA 1FWAC 4YCPA 3IV3A 3LENA 3DERA 1K8CA 1MQQA 1WDQA 2G3NA 3DH7A 4QCFA 1UWIA 5M2FX 1G69A 3EWDA 1K6WA 4MNLA 3EMZA 1EGMA 3DIPA 1W26A 1XLCA 1EA9C 4O4WA 3BAXA 3UVIA 2GVJA 1Q5MA 1S2TA 2GJNA 1VRDA 5G4WA 3AFBA 4AF0B 4MY1A 1JAKA 2ACSA 2REQB 2BXZA 4GY0A 4OTKA 3TNBA 2YCIX 4BFAA 3VX1A 4BHYA 4HJFA 2V63A 2UV8G 1JULA 2INEA 4IIHA 4H3DA 1MQRA 3DG7A 2GPTA 3B0UX 4O1BA 1RV8A 4R3UA 4GUHA 4BQ2A 5D37A 4JFLA 4X61A 2CKSA 2WZEA 1J4IA 4NF7A 3VIOA 4MB3A 2IQDA 1CB7B 2YIHA 3RGCA 1N1AA 2PWVA 3CIVA 5D9PA 3MCMA 1SW7A 3Q37A 2WVTA 4FP1A 1PX4A 4I9AA 3R5EA 1HUVA 4K3ZA 2PC8A 1LQAA 3H4XA 4ACZB 3RIKA 3NGFA 3U4FA 3HQOA 4ZVJA 3TEVA 3PB2A 2WOQA 1IEVA 2AOSA 3WNOA 3F1QA 4GX9A 3W84A 1H50A 4UTUA 2DH2A 4N9BA 3BPWA 3VIJA 1OT1A 4W88A 1AFSA 1YYAA 2TRSA 1UP3A 2LGOA 3E6EA 1GYMA 1W0MA 2ZBTA 4HT3A 3VZZA 5BU9A 3MKCA 1J01A 2PP3A 3ALGA 4XBJA 1QR7A 4U2YA 2I9EA 5CXPA 5AY7A 3E5PA 4LH8A 1DIEA 4CNUA 4ICCX 3C0JA 3CV2A 4WKFA 2QJMA 1HP5A 4ZODA 3M0LA 1XCXA 3PFRA 2X30A 2DEPA 5I78A 3PUOA 1S3HA 3NI6A 5HUAA 4XBKA 1JCXA 2G3JA 5MKGA 2GGJA 3UPBA 5FESA 3AS3A 5CZJA 3QF0A 5F4SA 4MY8A 3H2CA 4J28A 1YTKA 4G5DA 3VABA 5DMMA 1JPHA 3W2JA 5JUVA 3SY8A 3GS6A 2G3IA 1UASA 4FXRA 5XIMA 3WELA 1ROTA 3VA8A 1FCVA 4JQ2A 3TTQA 2OODA 1FCUA 2RQSA 2EKCA 2VC9A 4DB7A 3O5LA 3OGSA 2AL2A 4DJEC 1R46A 2ABAA 1BGGA 1M7OA 2VCBA 4D8LA 2ADAA 2QUTA 1Y5WA 1Y0EA 1T96A 1PSCA 1TKKA 3TFXA 5LNWA 2V38A 1X6NA 5FIPA 1FKGA 2CLHA 1RXOB 1W3NA 4S23A 4EK7A 3DZ1A 4LUYA 2X42A 3BE7A 5CJ5A 4JIQA 4GE8A 4B4FA 2J47A 2PWFA 2QCDA 1TIWA 2ODOA 4MKSA 1H1NA 2P3EA 2Z4GA 3EDDA 3EWYA 3FN9A 1R7OA 3C0QA 4L6OA 3TJ4A 3AAMA 2A7PA 3MI3A 2G0WA 3P5ZA 3TIMA 3RGTA 4H01A 5DY3A 4DO7A 5FL1A 1EOKA 1XINA 3O5RA 4WJ8A 3RDKA 3WK3A 1OD0A 5CGTA 3G8EA 1GZJA 4AVNA 4U33A 1XYBA 3K8KA 3L2LA 4M80A 3AIUA 3LNPA 4F3HA 4UNKA 3G1AA 1TPB1 3CUXA 1N7KA 2QW5A 3W70A 2WZHA 3KAGA 4DIAA 4E4PA 4UMAA 3KFTA 3UG5A 3UY7A 2J7BA 2VFDA 3QW3A 1VYSX 2E7FA 3ZJ8A 3S9IA 1N55A 3LU2A 2AL2B 4UFJA 4Q4PA 3CIWA 4EAMA 3HPSA 4DJFD 1E9ZB 3LI1A 4GRSA 1W91A 4Z2HA 1V3LA 4O17A 4ZQCA 2F84A 1KXQA 1PXGA 4HU0A 4IG2B 2GSHA 3T4CA 4J1OA 4LJ3A 5HJLA 4A05A 1P0DA 1S5TA 4O16A 2C14A 2PV2A 4DT4A 4GUGA 5FJOA 3VILA 3TA9A 3A9IA 3KWXA 3NXLA 2OZ8A 2WCGA