4WKFA

Crystal structure of human chitotriosidase-1 catalytic domain in complex with chitobiose (2.5mm) at 1.10 a resolution
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
368
structure length
368
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitotriosidase-1
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 128
structure length 368
sequence length 368
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wkfA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wkfA01
3AROA 2FGZA 7TAAA 3O2LA 1BVNP 2VR5A 1BGGA 1V02E 3WQ6A 4X0NA 3ZO9A 5A6BD 3WH7A 4HP5A 3PZGA 4UFHA 1Q6CA 2BVYA 4M82A 5EBAA 3T08A 4S3KA 1CNVA 5ABEA 5C70A 5D8WA 3WNLA 3ZOAA 4WK9A 4Z2LA 3ARVA 2A3BA 3S6TA 4P7LA 1UD4A 5DO8A 2EPOA 3AYSA 4PTWA 4DM1A 1GPFA 4JFTA 4UZSA 1CGUA 4C7DA 2VC9A 2F2HA 3HN3A 3OA5A 3CHFA 5A6JA 3W53A 2DSKA 4TX6A 1E6NA 1GQIA 1TG7A 4LGXA 3VOCA 3IK2A 1OGBA 1TVNA 1JZ2A 4ATLA 1GOMA 5EFDA 3N04A 3WIJA 1US3A 1WDQA 1CPUA 5ECUA 5BXTA 5E0FA 2WBGA 1HL9A 2CEQA 2UY3A 5KZ6A 2W5FA 1V3IA 1OT2A 2D22A 1UG6A 4PTXA 1SFSA 1U2YA 2VURA 1HVQA 4BQ3A 2OYLA 1HKKA 1YQ2A 2CBVA 4YHGA 3T2OA 3L4UA 2A3HA 4AD1A 4OBRA 2ZE0A 3U7BA 2E8ZA 2PWFA 1V6YA 1I1WA 4D6EA 4U31A 2OSWA 3VD7A 5D9MA 2Y2WA 4BS0A 3WBEA 3SCOA 3ZT7A 1BG9A 2NW0A 3CO4A 3MO4A 1WO2A 2V3DA 4WLCA 3G6MA 1DWAM 3ZJ8A 3OGVA 1PX4A 2V38A 1W3JA 3WD0A 3MV01 4NZCA 5D8ZA 4DUXA 1CLXA 2D0FA 1FH7A 3VUPA 2O9RA 1JXKA 1UWSA 3BH4A 4PTMA 2XVKA 1FH8A 3POHA 3CUJA 1J0ZA 1PX3A 2VX6A 1E6QM 1V3JA 2BXZA 2W61A 1HN1A 4PMDA 4EE9A 3BAKA 3PTQA 3VD4A 4P7QA 3PHAA 2GFTA 2J7DA 3CZ8A 3AIEA 5A6BA 2DT2A 1VJZA 2DT0A 3WNOA 3WF2A 4UFIA 1VAHA 1PIFA 1WAWA 1KBBA 3RJXA 3A3HA 1MXDA 2X8RA 4KMQA 3PZNA 1O7AA 1V6VA 4OKDA 3AIRA 1XYFA 2VL4A 3ZM8A 1C8YA 4FF5A 4W7WA 4AISA 1WKYA 5A8QA 4W89A 1V0KA 3GXFA 2WVSA 1GQLA 1JF5A 3WQVA 1KGWA 2BHYA 5CGTA 5GNYA 3ZJKA 3ZSTA 2BVDA 1MFUA 4W5UA 1I75A 4A3HA 1US2A 1V03A 2DT3A 3WD1A 4J3XA 4HMEA 4LX4A 3MUY1 2GJXA 4RE3A 3VU2A 1WCGA 1J0IA 5D9OA 4DWSD 5A3HA 1NWRA 5E70A 1E43A 1BVZA 1E4NA 3MUZ1 1ZU8A 3IJ7A 1FP8A 3WDIA 4HZ6A 3AZTA 4HMCA 1WZLA 4UFJA 1V0LA 1Q6EA 4FLQA 2XGBA 8CGTA 4N42A 2CBUA 2WNWA 4PMOA 4D6FA 3AISA 4D6IA 4AZCA 4OJYA 3BAIA 1B1YA 4QLJA 2ZX8A 3WMCA 2YBTA 1NOUA 1UUQA 2J74A 1LJYA 2PWHA 3QHOA 1RP9A 2D24A 4QP0A 5I5RA 3GZAA 4UFMA 5IHRA 2WMKA 4WKFA 4GO9A 1OB0A 4WF7A 3ZR6A 2WCSA 4U3CA 4GI9A 1K9DA 1DHKA 5I77A 1IZKA 3NUKA 3SEPA 4WSKA 2ZUMA 2CXGA 2OLHA 2XVLA 4ML4A 4PEEA 4UOQA 3BGAA 4R5EA 4MAVA 1W91A 1XD0A 3WFZA 1QNOA 1ISXA 3SCUA 2J7FA 1VFUA 1XHGA 1R7OA 3W0KA 3UESA 1C93A 5JBFA 1GCYA 1VBRA 5FL1A 1QVBA 3WDJA 5CSYA 4GZIA 1IZJA 1C7SA 4M80A 5BXPA 2VZSA 2YJQA 1OGGA 1UD3A 4V28A 3AS2A 2QHAA 2ZUTA 4AIEA 1EO5A 2DT1A 1ISVA 2YA2A 4H41A 3PZUA 4AZ5A 1E4IA 1JXJA 1EDGA 2G41A 2W63A 2XM1A 2Y4SA 2RGLA 1VBUA 1SMDA 2WMGA 2YDRA 4EKJA 1KQZA 2WZHA 1UKSA 4CD8A 3RO8A 4DWSA 1V6UA 1H49A 3B9DA 3W4RA 1EA9C 4CUCA 1V0MA 3M7SA 1W1VA 4GQRA 4BCEA 3BCDA 1UWIA 5IFTA 2VNCA 1C92A 3WN6A 1JDCA 3GBDA 2ZWZA 7CGTA 1UOKA 1XC6A 4HU0A 3SUTA 4F8XA 1H3GA 3WQWA 4NRRA 2WVUA 3B9EA 5BRQA 1UWTA 3N12A 3N13A 5FIPA 1E6PA 2XVPA 1OSEA 1NWSA 3OLEA 1B3WA 3VNYA 4HA3A 4V27A 1HKJA 3EDKA 2IXVA 2FHBA 2WMHA 1BPLB 1BG4A 1UD2A 1OD0A 5BXRA 2DH2A 3WQ8A 4ZENA 1JD7A 2J4GA 2VRKA 1FP9A 4P8VA 1IV8A 3WDRA 3F5LA 1TA3A 3NDYA 3APGA 4OOZA 1Q6DA 1D2KA 1ESWA 4B9YA 1OT1A 2WBKA 4LQ1A 4IPNB 2PWEA 3VIHA 2OYMA 2QPSA 1UKPA 2WLZA 4TTUA 3CUGA 4TVCA 2YKKA 1B3ZA 4JKLA 2CITA 3L4TA 2VRJA 3EDFA 1E1EA 1DEDA 3MMUA 1OD8A 3EDJA 1FHDA 1XCXA 1UZ1A 2ZWYA 3FNDA 2YLAA 1ODUA 3U57A 2BVTA 1EHAA 1QHZA 4F9DA 2V3FA 2BY1A 3RJYA 2DIJA 2G8ZA 2YL6A 1GHRA 2VTFA 3FN9A 1TCMA 5FKYA 3WH9A 1NP0A 5A8PA 2FH8A 2VR4A 2ZX6A 3BMVA 3BAJA 5IFPA 5HDRA 4V2XA 1B31A 3PZMA 1J12A 4D71A 2VX4A 4AMCA 5EB8A 1J10A 3NIYA 5FOOA 1DWHM 2VZVA 2QPUA 5LA1A 1VEPA 3CHCA 4MB5A 3FXYA 2PBGA 3EMQA 2Z1SA 4PUDA 2XJ7A 1HJWA 1C7TA 3ZJ7A 1KXVA 2XGIA 4MB4A 4MNMA 4XUYA 1XH2A 1PJ9A 3VIPA 4PMNA 1TFVA 1WZKA 1VFFA 3CGTA 2WVTA 1MW3A 4OBSA 4GXPA 1C90A 4WIWA 1HP5A 4AW7A 3MUIA 2DGAA 4Q22A 1NARA 1FH9A 1QNQA 4PMQA 5ABFB 1H41A 3NYDA 3OGSA 3ARQA 1J9YA 3A4AA 1KGUA 5GNZA 1EDQA 3B8SA 4M1RA 4GQQA 1GQKA 2X0HA 2X2YA 1GUVA 1MVYA 4W88A 1PZ3A 4UCFA 4MJ2A 2V3GA 4ACZB 1QOXA 3S2CA 3CMJA 1GNXA 3T2QA 2VX5A 4AZIA 1ZBKA 3PN8A 2GVYA 3DHUA 4F79A 2VCAA 4UQAA 3RILA 2WCGA 1CXIA 1V6XA 2J7CA 3KZSA 4MNLA 4AZBA 4J3TA 1CGWA 7A3HA 2XG9A 1HL8A 1UD5A 2FHCA 2PF0A 1XYZA 1BF2A 3K1DA 3IJ9A 4D6GA 1WDPA 1HKMA 1HX0A 2UY5A 1CIUA 1ISWA 2C8NA 2WZIA 5DT7A 1EOKA 1E0WA 5A2CA 1Q6GA 2BY3A 2CESA 1SYTA 4R27A 1JGIA 3HU7A 3THDA 3CZLA 3MS8A 1UH3A 1W9PA 2WVVB 1PX8A 4FK9A 1QNSA 2ZUVA 2JEQA 4QFUA 3W26A 2QLYA 1NOWA 2VCBA 4PBGA 3W27A 5E6YA 1KXHA 4ZFMA 3VILA 3GXIA 4U2YA 2WC7A 1UR8A 1HF6A 4CCCA 3T0BA 1NQ6A 2EPNA 1WZMA 3OLGA 4MNJA 1VFMA 4CN6A 4TOQA 3WH8A 1KXQA 4JKMA 3BLPX 2WHKA 4Z2IA 3HMCA 3I3BA 2QF8A 2VZTA 3W81A 1K9TA 4E8DA 2AMGA 4GIAA 2J75A 4OOUA 2OWXA 4MTVA 4W87A 1JDDA 1W3HA 3EMZA 2YA0A 3A4WA 4W8AA 5A95A 1JAEA 3BMWA 3FY1A 5EFFA 4JHOA 1E72M 2WK2A 2GJRA 3CH9A 3BLKA 1JFXA 4KGJA 4AD4A 4BQ2A 3CLWA 2YA1A 4M24A 3GH5A 1UKOA 9CGTA 1RD6A 1E5JA 3ZSSA 2D3LA 3UCQA 3VGGA 2VRQA 4FLRA 3DYMA 4CD6A 4H04A 4P7OA 2W67A 4UFLA 6TAAA 5M3WA 3MMDA 1V0NA 4CVUA 3W6LA 5D9NA 4W7VA 4HTYA 2WMIA 4Z2HA 1JDAA 1Q4NX 3TTOA 1HVXA 4UQEA 3AJ7A 2JE8A 2WAGA 4J28A 4M8UA 1FFQA 3AHZA 3ECQA 1VIWA 5CQ1A 3ARXA 2CBJA 2YBUA 1G94A 4TXEA 5FD0A 1GQJA 4IPLA 4XX6A 4DUWA 2WC3A 1VRXA 4PMZA 1W3LA 1E1FA 1QI4A 3AZSA 1DP0A 1QI3A 4JKKA 1UZ4A 1E15A 2FGLA 3VGBA 5HPOA 2GK1A 5JH8A 1WP6A 2JIEA 3N17A 5IHSA 3WEZA 3AYRA 3VMOA 5A6MA 1KR1A 4Z2KA 3WH6A 4LPCA 4QLKA 4PMXA 1PAMA 2ZUSA 1WZAA 3W24A 1R86A 5I3DA 4HOWA 1JZ3A 1C3FA 1W2VA 1W3KA 3W38A 5CLWA 4OZOA 3ARPA 1Y7VA 3WENA 1XH1A 4UOJA 1DWIM 1D7FA 1UWUA 1E3XA 4UFKA 2J7GA 4F66A 5F7UA 5IDIA 3N18A 1E6SM 2BXYA 3UETA 5CPTA 4D6DA 4ZXLA 5A94A 4C7FA 1JZ8A 1JYXA 1E4LA 3VGFA 5A69A 1H0IA 2DIEA 3AHYA 1B2YA 4QLLA 5LA2A 2XM2A 1BYCA 1G5AA 3PZVA 5DMYA 1B9ZA 1EQCA 3VGEA 4WSJA 1UD6A 2GUYA 3VO0A 1PBGA 3U5UA 5M5DA 4JHZA 4ATDA 1S46A 1KQYA 2E9LA 3GNRA 3VX1A 3SIMA 1XSJA 5M03A 2PBOA 2XVNA 4M56A 4WKHA 1GOKA 4H2CA 3K46A 1PPIA 3WNMA 2VVNA 1A47A 1B3XA 1CWYA 1J18A 1OINA 1CENA 3W28A 3VTRA 5E0CA 3N15A 2FHFA 1UD8A 4JZ5A 5JBDA 3WF4A 4W86A 3RPMA 3BAWA 1E6XM 1M04A 4CKQA 1FOBA 5A6SA 4J27A 4QCFA 1RPKA 2XHYA 4W84A 3L4XA 4Z2JA 3OLDA 4IISA 3DECA 4Z2GA 3TONA 2JFEX 1XSKA 1Z32X 1AVAA 1E3ZA 2CETA 4W85A 3W29A 5EMYA 4YN5A 1X1NA 4HA4A 4QCEA 2A3AA 4PMYA 5CG0A 1UH4A 1VEOA 4AWEA 3L2MA 4FMVA 2DSZA 1AQHA 3VIOA 3CZGA 1B3YA 1R7AA 5ABHA 3M6DA 1EOMA 3CUIA 1JF6A 2DPEA 1LG1A 3VIGA 5D4YA 1GOIA 3BAXA 1BFNA 3G6LA 1C91A 2WMJA 1E55A 5AC5A 1QW9A 5ABGA 2WXDM 1LL6A 3SUSA 5AYIA 3ARWA 4XV0A 3PZTA 3WL1A 1LWJA 3CUFA 4AIUA 4A3YA 1WDSA 1EQPA 2WCAA 3POCA 2JIWA 3D3AA 1W1PA 3VKKA 4NF7A 4CU8A 1ECEA 4MDOA 1GONA 3WELA 3MSGA 5M17A 1FHLA 2DQXA 2YL8A 3FAWA 5C71A 1LG2A 5GNXA 3AQUA 2BNJA 2GSJA 3ZR5A 1UQZA 3WH5A 3MV11 1H5VA 4H7VA 3UR7A 1E71M 4PSRA 3W82A 4HOXA 2F61A 1E9LA 1JZ4A 2BS9A 1VF8A 2W62A 4ZE4A 1QI5A 2TAAA 3M46A 3GNPA 1GOOA 1E5NA 3GH4A 3VGDA 3CZJA 1VJSA 1GOQA 3WY1A 3WUFA 1CGYA 1E0XA 3WD3A 1QBBA 3NSXA 3WDPP 3AMDA 2D23A 4KH2A 2W92A 3LPFA 3WUEA 4BF7A 1I1XA 4UQBA 1MW0A 1UR0A 1UR1A 3WMSA 4GZEA 3GH7A 4PMRA 4EAMA 5LA0A 2ZUNA 1GW1A 1K9FA 5JIWA 1TVPA 1W9XA 5CPSA 5AY7A 3AXHA 5KEZA 5FL0A 4AD2A 4MADA 4PCTA 2ZXDA 4HA1A 3WF1A 3LMYA 3CMGA 3ALGA 1B30A 2VJXA 3TTSA 3SURA 3E1F1 4ZEPA 1GOWA 5HXMA 2VUYA 4W5ZA 4ATWA 5CJ5A 2W4XA 4AIOA 2G3IA 1W9BM 4J7RA 4GPNA 1KXTA 4B15A 1W2PA 1FA2A 1MQRA 3TOPA 1XH0A 5A8NA 1SMAA 4AZ7A 3OB8A 2XYLA 3UG3A 3PZQA 1UHVA 3N9KA 2Y8VA 4P8XA 5I24A 3WEMA 3LPOA 3VDHA 1LQ0A 2CYGA 3VIKA 4JFVA 4P8WA 4J3WA 1KGXA 2WWCA 2J7HA 2PC8A 1PEZA 1AQ0A 3AS3A 1CXLA 5A1AA 4UQ9A 5JUVA 2JF6A 1CYGA 1E70M 5HBFA 2WHLA 1WPCA 2G3JA 4TUFA 4P8UA 4BZYA 3W25A 3F5JA 1G01A 2BHUA 1GZJA 2WPGA 2WKLA 1B90A 4CD5A 1V3LA 4X9YA 3CHEA 3AXIA 3BC9A 2GJXB 4CCDA 5I23A 5DEZA 2JALA 2WHJA 2VX7A 4JL2A 3JUGA 1LL4A 3BCFA 2ESCA 1NOFA 2OSYA 4LYPA 4PYSA 3WBAA 3GNOA 4CU6A 1ZB5A 4XZBA 2QMKA 1LLOA 2XTKA 3BXWA 3SUUA 4UOZA 4U3AA 1O6IA 2VZUA 1E4MM 2EO7A 3N11A 3CZEA 1HKIA 2UWFA 2D20A 2EQDA 4JL1A 2CIPA 4U33A 3A4XA 3PBGA 2VCCA 3WF0A 4AZCB 4HPHA 3TTYA 1JZ6A 1EO7A 2O92A 1QNPA 2YDQA 2J8FA 3VIMA 2XIBA 1W9UA 2A3EA 1TUXA 1MXGA 1BGAA 2PWGA 2D2OA 2DDXA 3T0AA 1K9EA 3LPGA 4GKLA 5E9AA 3QOMA 5BXSA 1J0KA 2AAAA 5CXPA 4J3SA 2WANA 2WYSA 2ZXAA 3AS1A 3DC0A 3AMGA 2XIIA 4H8UA 4HZ8A 3ZIZA 4LXFA 1JZ5A 1H11A 2A3CA 3WUGA 3AHXA 2WM0A 3IAPA 3VD3A 1KCKA 2G3NA 3IJ8A 1CXHA 3WF3A 2B31A 1L0PA 1QPKA 1ZJBA 3DHPA 4W7UA 2JF7A 4JAWA 4MAZA 3N1AA 2WC4A 2XWEA 3SCTA 4URIA 1W9VA 1BYDA 4PRWA 4U2ZA 1FFRA 1JIBA 2FDMA 4W8LA 1G1YA 3KWXA 3K8LA 3ZJ6A 4PUEA 4HU8A 3KE0A 2OYKA 2J77A 4PN2A 4D1JA 1C8QA 2CERA 3QHNA 3T09A 3RMEA 2BV9A 3GTNA 5I0DA 2NSXA 4GZJA 1MFVA 2BHZA 1J0YA 4FLOA 1BAGA 4MB3A 2HISA 3QHMA 1JG9A 5AYBA 3CHDA 2WSPA 3OZPA 1J01A 1ZJAA 1UA7A 3ARUA 1GORA 2G3MA 4MNKA 3ARTA 1ZS2A 3VVGA 5DF0A 2EPMX 2X1IA 2ZX5A 3BSHA 3VIIA 5AC4A 2XSAA 1TZ7A 4DWSB 3FAXA 1QHPA 3U5YA 3RCNA 1HJVA 2OWWA 4NI3A 3PZOA 2CBIA 2XPKA 4UQDA 3VIJA 4AC1X 4JFUA 1UYQA 3ZT6A 2FH6A 3WDHA 5I2UA 3BAYA 4D1IA 3II1A 2NT0A 3TA9A 4LYRA 2E9MA 2J79A 1RP8A 4NRSA 3NDZA 4X0VA 1QBAA 2YIHA 3W37A 8A3HA 4UQCA 3SUWA 2O9PA 2HVMA 5TD4A 1KFWA 3VM5A 1V3KA 1UA3A 2XFFA 4AEEA 4PTVA 3OIHA 1ISYA 1V08A 4YHEA 3ARZA 4UR9A 1RH9A 2QV4A 3VMPA 2W91A 2ZUWA 3EDEA 2Q8XA 5A2AA 2BY0A 2YDSA 4B3LA 1CGXA 2Y24A 2ZICA 3OZOA 3TTQA 3CPUA 4NSBA 2WW5A 4QDMA 1G9HA 1H1NA 3PTKA 2CHNA 1ISZA 4B9ZA 2EEXA 4FLSA 4E2OA 4UTFA 1TA3B 4GI6A 1JYNA 1YHTA 3OBAA 4AD5A 1XV8A 4F9JA 4HOZA 4CD4A 1WE5A 5CGMA 5HNNA 3ZMRA 2G4FA 3M07A 5A6AA 1VENA 3VGHA 3AHTA 3DYPA 3T2PA 1UR9A 1HJQA 1CGVA 1JZ7A 3IAQA 3ARYA 4TX8A 1CXFA 4WJXA 1CZ1A 1EHNA 2E3ZA 3AHVA 1BLIA 3RM8A 3WMBA 1OWQA 5BWFA 2O9TA 1ZBVA 1R87A 4MDPA 2ZUUA 5JBEA 2E8YA 1QI0A 2NT1A 3VD9A 1ZBCA 4JCLA 3CBWA 6A3HA 1HNYA 4DM2A 2YLLA 3CUHA 1E56A 4J3VA 3UG5A 1JYWA 2VO5A 3NJ3A 2VZOA 3OG2A 4H8VA 4MPKA 2WMFA 3GYCA 1GVYA 1W9DM 4OUEA 2BY2A 2E4TA 3WFLA 3RM4A 5E09A 2J47A 3A6OA 5BCAA 4C7GA 4CCEA 1NP2A 2V3EA 4KRTA 4CVWA 1EXPA 1HXJA 3AXXA 1OM0A 1PIGA 2WSKA 2D1ZA 3J7HA 3AI0A 1H09A 1XD1A 5CSUA 3NSMA 1GJUA 3MANA 3W6MA 3L4YA 3F5KA 3L2LA 3WUBA 4M81A 3AIUA 3K4AA 2X05A 2JEPA 1IT0A 1XRVA 2XFYA 1JL8A 3GM8A 3WL0A 1AQMA 3AIVA 3VNZA 1OGSA 3K8KA 4RE2A 2AOSA 4A4AA 3UERA 3KL5A 3RIKA 3UR8A 4PSPA 1B3VA 2E0PA 4ZXOA 1QW8A 3SCPA 2XWDA 4XB3A 1UQYA 3WQ5A 2WWDA 1BQCA 1UWQA 4CN4A 1E0VA 5ABFA 2UY4A 4AZGA 3VINA 1CXKA 1Q6FA 3EMCA 1DWJM 3WNNA 5I6SA 5HOSA 2BFGA 3ZQ9A 2ZIDA 3SCWA 2D0GA 4JFWA 1JNDA 4QAWA 1XCWA 3WSUA 1NH6A 3OGRA 1VFOA 1CTNA 3AIQA 4U5KA 1JI2A 1HJSA 4JCMA 4PMUA 4AZ6A 4MJ4A 4ACZA 3AFBA 4P7NA 1CGTA 2DEPA 4IUGA 5A8MA 5A6KA 1NWUA 3VPLA 1BYBA 1W1YA 2GJPA 2IUZA 2PI6A 2XFRA 3OLIA 4RL3A 5HPCA 5GQBA 3O6AA 3QGVA 2VVSA 2QMJA 3L4VA 4PMVA 1E6ZA 2EXOA 2J78A 3NSNA 1CBGA 3AMLA 1E6RA 2YL9A 1V02A 3MSDA 4EANA 1WNOA 1HP4A 1MYRA 2E9BA 1HT6A 2PB1A 1XGZA 4U5IA 2Y5EA 4D6CA 3GBEA 1CEOA 4EK7A 1KWGA 3SUVA 2WB5A 1E40A 2WVVA 2CCRA 3PZIA 1M01A 4M29A 1J0HA 3D5HA 1UR4A 1V3MA 4AD0A 1V6WA 2EPKX 3VDAA 5A8OA 1TE1A 1R85A 1N82A 4OIFA 3CIVA 3K4DA 3VM7A 3RDKA 3WD2A 3CZKA 4RE4A 1CECA 4GI8A 4DWSC 5I78A 1A3HA 6CGTA 2F8QA 1M03A 2XUCA 2ZX7A 4E4PA 3CTTA 4KGLA 2YOCA 2D0HA 5JIPA 4YPJA 4ZE5A 3WD4A 1U30A 1LWHA 1HJXA 1UKTA 2GDVA 3VMNA 1J0JA 3AZRA 5LYRA 1MW2A 2ZX9A 3WDQA 2YL5A 5DT5A 1TMQA 2OSXA 1JFHA 4GO8A 1GJWA 2PWDA 3AIWA 4CN1A 1KCLA 5CZKA 1P6WA 2WMIB 4Y7EA 1DWGM 1JD9A 4P7RA 1DTUA 4B3KA 4AYSA 3SCNA 1JI1A 3A47A 5CLTA 4N0RA 4KRUA 1CXEA 2J7EA 4TVDA 2CNCA 1WB0A 2ZXBA 3AMCA 1HJUA 3EYPA 1JYVA 1F4AA 3ARRA 2Z1KA 2X09A 4XZWA 2X0YA 1X6LA 1WDRA 3UEQA 1EGZA 3SCRA 5IXEA 3U7VA 2V5DA 2WHMA 1LF1A 2OWCA 2J8GA 1QNRA 1BSIA 4TTGA 4UNIA 3I3EA 4K68A 1JAKA 2GK1B 3MUAA 1BTCA 3VIFA 2DSVA 3VDCA 2GDUA 3AMKA 4AY1A 3AIBA 1SR0A 1QI2A 1K6AA 3IANA 1UH2A 3AS0A 4JFSA 3KL3A 3PTMA 3VDBA 1CDGA 5C8BB 4W8BA 1MWOA 2C7FA 2CKRA 3AOFA 5DFAA 4H8HA 3WNPA 2CHOA 2UY2A 4BA0A 3DYOA 3KEHA 4D6JA 4W93A 4HMDA 1ZL1A 1CLVA 2XVGA 2VMFA 5I79A 1H0GA 1VB9A 3FW6A 4AXNA 3QR3A 1EH9A 4CU7A 5BYWA 1TR1A 2VT0A 4B16A 3SCQA 2J7BA 1KWKA 1EDTA 3K8MA 2IXUA 4J3UA 3VD5A 1UKQA 1B0IA 4D6HA 3F4VA 4HZ7A 4DUVA 2VQTA 3BSGA 3TP4A 1JNEA 2DH3A 4Q7NA 3SCSA 3ALFA 1V3HA 4GINA 1G0CA 2VQUA 2WZEA 3I3DA 3LPPA 4CGTA 2XSBA 1MQPA 1XSIA 1U33A 2VOTA 1QHOA 1R8LA 3ZT5A 1MQQA 2J25A 2DSUA 1KB3A 1J11A 1F4HA 5D9PA 3L4ZA 3NCOA 5CPQA 4PCSA 4TVUA 1ITCA 1OIFA 3UG4A 1OCQA 1M7XA 5A6LA 4D72A 1BHGA 4L4OA 2RGMA 1L8NA 3WEOA 4AZHA 4WKAA 1GVIA 4ACYA 1W1TA 1AMYA 2ZOXA 3L4WA 4HPGA 2Y8KA 3FHQA 2CPUA 5BRPA 2W66A 4BQ4A 3WKZA 1OIMA 4IM4A 5FCZA 4BQ5A 2C0HA 3EDDA 3KL0A 4JIEA 1KBKA 4L4PA 3WQ4A 3O9NA 4LYQA 3MMWA 2EPLX 3MU7A 2V5CA 3GXDA 1ITXA 1HIZA 5E6ZA 3FHAA 1W32A 1E73M 1LL7A 3B9AA 4S3JA 2MANA 2O9OA 1OBAA 1BYAA 1H2JA 5BROA 1MW1A 1ZBWA 2EBNA 2EJ1A 3THCA 4KWUA 1DWFM 3MKKA 3GXMA 2J62A 4UZUA 1X6NA 1VEMA 1NM9A 2CKSA 1M53A 1H4PA 3QOKA 1PZ2A 2VI0A 4AD3A 4MB1A 2WKGA 1D3CA 3RM9A 1KR0A 3AICA 3HJEA 4E8CA 1NWTA 1C8XA 3ARSA 5A2BA 3WNKA 5GPRA 4AEFA 3EBVA 3T0DA 1ODZA 3GDBA 1GHSA 3VX0A 2ZXQA 1EIBA 3SCVA 1UWRA 2D3NA 3PZ9A 4CD7A 2DSWA 2E40A 1UR2A 2WLYA
chains in the Genus database with same CATH superfamily
5HTGA 4WY0F 2VR5A 1BGGA 1QASA 4O28A 4JEJA 4IWWA 6ENLA 3IIOA 3NPWA 3XISA 2JK2A 8XIAA 2IQDA 1YTDA 1D8WA 4MJMA 2XIJA 4R34A 4Y9NA 3EX2A 3AYSA 4JFTA 4UZSA 3OG3A 1CGUA 3VOHA 3PBUA 5TNVA 1P6CA 5I02A 3F2BA 1R0MA 4GKTA 3CV2A 3IKGA 2LGOA 3W53A 2DSKA 4TX6A 4OBTA 4DBSA 4LGXA 1C9WA 4PL2A 3CGNA 3H4WA 1OGBA 3IK2A 3VOCA 1GOMA 5EFDA 1OFRA 3WIJA 1YATA 1GEQA 1J2BA 5CBJA 3NEVA 1RLCL 4DNMA 3P14A 2W3ZA 4DPQA 5ECUA 3UWQA 4A05A 3T7VA 5KZ6A 1V3IA 4PL1A 1OT2A 1TQJA 2PDUA 3B9OA 3G3MA 4C90A 2VURA 3T9PA 3W76A 5BOOA 3GK0A 3TYDA 3L4UA 3PR9A 3UXAA 3BANA 4JTSA 1I1WA 5D9MA 3V3WA 1YPXA 4QISA 1T6MA 3WBEA 3SCOA 4GIEA 3IJQA 3OODA 1PYFA 3CV6A 2PSNA 3PBWA 3EIPA 3MO4A 2RDTA 3N25A 2L2SA 4RE0A 4C6FA 2ZVIA 4KBXA 2POTA 1E9ZB 2DZUA 4DUXA 2TODA 5KINA 3STEA 1JXKA 3BH4A 2XVKA 3CTLA 4HNTA 1X1ZA 2VX6A 2AGKA 4O0QA 1V3JA 3HGRA 2WJDA 5XINA 3WJYA 3EKLA 3UPMA 1VS1A 1RBLA 3ITLA 1AL8A 4IQEA 1TWSA 3ABRA 3ICJA 4KEMA 3G1AA 4E2BA 4HNCA 2OX4A 1PIFA 4KT2A 1WAWA 3RJXA 3A3HA 3W75A 3C52A 1DV7A 4L6OA 3UD6A 4DJEA 5G1MA 5FJIA 2Z28A 4G2DA 1QUMA 3ZM8A 1MSSA 4W7WA 3GVVA 3ZLHA 5FJTA 4IIGA 1F40A 1GQLA 1JF5A 3WQVA 2HNEA 3IIVA 4AQLA 4HNNA 1US2A 4DAIA 6ALDA 2DT3A 4Q4QA 4J3XA 2DIKA 4HMEA 3TAOA 4GC4A 3MUY1 3V5CA 3VU2A 4A8IA 2PDWA 2YPIA 1PTDA 2H8XA 3VNLA 2YXOA 4UXDA 4KWVA 5E70A 3UJRA 1SJBA 1E4NA 1Q1CA 5LIYX 1D7HA 3CGMA 2RAGA 5ECVA 1PO9A 2NLIA 1KTNA 4HZ6A 3AZTA 3PS7A 2DZWA 1Q45A 3R1ZA 3HPSA 3SGZA 3R8HA 5G5IA 4YS1A 2WNWA 1V7AA 2YDAA 4PMOA 3UNDA 4D6IA 4OJYA 2ZX8A 5HKGA 3WMCA 3P5YA 1M5WA 1NOUA 1OC6A 3KOZA 1EPVA 1NDWA 4D8AA 4GD0A 4PRRA 1JUBA 3W70A 4GGQA 2D24A 4ODQA 4QP0A 2MNRA 4C6KA 1TVLA 2WMKA 4WF7A 3NGFA 4GI9A 4JYFA 5AHMA 1DHKA 3NQ2A 1YE4A 1IZKA 2CLOA 2ZUMA 4DB7A 2OLHA 4HZMA 2P0OA 2XVLA 4UOQA 3BGAA 4R5EA 1DE6A 1XD0A 2XGZA 3LCFA 5FF2A 2GGEA 1BL4A 3W7PA 5CBIA 1S3TC 1V77A 3UESA 1C93A 2G0WA 3B03A 3MSYA 3BOFA 2Q3OA 3QPEA 3R8RA 5LXEA 4ZCWA 1S5MA 5CSYA 4M80A 4B5UA 3A22A 2VZSA 2YJQA 3R94A 1E51A 2A0NA 1XIDA 1UD3A 5IBXC 3BLIA 1TCOC 1ISVA 1LRTA 3DERA 5JU6A 1JCJA 2DG3A 1JCXA 5D2VA 1EDGA 2G41A 2UZ5A 3B8TA 4ZB0A 1VBUA 1RLDA 4YJ5A 2WMGA 3UWYA 4H8NA 1SM9A 2QDGA 4DWSA 3B9DA 3W4RA 4LJ3A 1V0MA 3KVKA 1FWGC 3G77A 4XWUA 2ABBA 2VN1A 5IFTA 3S6OA 3IUHA 3KVJA 3VYLA 2ZWZA 2NVDA 4Z42C 2HS8A 3S47A 1VBGA 3LA4A 3WQWA 4NRRA 3QV7A 1P0KA 3WLRA 3OYXA 5H8PA 4WUIA 2J88A 3N13A 1F8IA 2VUNA 4LUTA 3W7OA 4QE5A 1E6PA 1Q85A 4EIVA 1NWSA 3NRKA 2YYUA 1B3WA 3VNYA 1HKJA 3G0XA 3PRBA 2FHBA 1G6CA 1B5TA 2E7FA 3EEZA 3GHUA 4MLRA 1KTBA 4JPGA 2ONEA 4DROA 2PU1A 3LTPA 1WKDA 3CAQA 3M5ZA 4LBRA 1JD7A 3CUXA 2VRKA 4AEOA 1W5QA 4H9YA 3O05A 3E2SA 1IV8A 3DN5A 1EGMA 3TKFA 1ONXA 2HMCA 1IXOA 1TA3A 2ZADA 1MMFA 3APGA 1OT1A 3TSMA 2WBKA 4LQ1A 2WSRA 3DFYA 1UKPA 4ADUA 4C60A 3OA3A 1THFD 2DJLA 4ZTYA 2ON3A 4GYPC 4CQ9A 2GQ9A 1VH7A 2I16A 3CV7A 2Q8ZA 1E1EA 3IIZA 3B0UX 3MMUA 1XCXA 1YBQB 3QY8A 2ITKA 1IEIA 3UW6A 1UPMB 2H6RA 1ODUA 1JVNA 2QCFA 2XN1A 3RJYA 2DIJA 2G8ZA 3FN9A 3W7MA 1TCMA 3BURA 1PBKA 5J04A 4Q7IA 3BAJA 4V2XA 1G67A 1DXEA 1J12A 4IMFA 1OX4A 3MHGA 4QJ5B 3KBJA 5EB8A 5DMLA 1VYSX 3IEBA 2VZVA 3MT1A 3UPBA 4QQUA 1VEPA 2CLEA 4NYYA 3FXYA 3EMQA 1XLHA 2XJ7A 1C7TA 2HE5A 4C91A 2DG4A 3UVAA 2XGIA 4MNMA 3LSCA 3KCOA 4KQZA 1WZKA 1VFFA 4LVBA 4AVNA 2WVTA 3FGCB 3GDLA 5RUBA 1MW3A 2ODOA 4AW7A 1SW3A 3MUIA 4O4WA 3LV5A 1FH9A 3W71A 4Q8OA 5ABFB 1N1AA 3MKCA 5I06A 1KGUA 1KV8A 3B8SA 1JUKA 5HW7A 4GQQA 1EP3A 4KFOA 1GQKA 1V8EA 2W0UA 1X39A 2X2YA 1MVYA 1PZ3A 5A6TC 3LM3A 4UCFA 2Z26A 3KAGA 2J66A 4J5NA 1QOXA 3GR8A 3S2CA 1GNXA 2QAPA 2VX5A 4AZIA 3K30A 6XIAA 4G7EB 3RILA 4KS0A 1V6XA 2J7CA 3IGSA 4L56A 4MNLA 5GJPA 4J3TA 3QMRA 7A3HA 4G56A 4XQ6A 2N87A 2JGYA 3CWHA 2I14A 2PF0A 1DQXA 1XYZA 1AW5A 1BF2A 3MCNA 3SY1A 1VFLA 3HG4A 4D6GA 1WDPA 3LU2A 3BG3A 4FX8A 3WQPA 1SZEA 2CESA 1SYTA 2F4EA 2ZQUA 1ZCNA 1JGIA 3P82A 3THDA 3WBYA 1XIJA 1XG3A 2OU4A 3H2CA 1XDJA 1PX8A 2V2CA 3O0FA 3U8GA 2JEQA 4ZQPA 4A21A 4B5SA 3KBSA 4NZ5A 4QFUA 1ZRQA 2VCBA 4WY0A 3W26A 3W27A 4ZFMA 1U5HA 4IUOA 4CCCA 3MP5A 2IF4A 4JN8A 5IM51 2MF9A 3E0IA 4Z1YA 1KM5A 2B7NA 3S4TA 1PTAA 1VR6A 3MDUA 4Z2IA 3PFMA 1RV8A 1PDZA 1Z3NA 5JH2A 1K9TA 4KCUA 3TNOA 2AMGA 2ZBTA 2J75A 5GPGA 4OOUA 1A4LA 1JDDA 1FKWA 3U6WA 5A95A 2D2HA 2RHGA 3PG8A 4WHBA 5T8GA 3FY1A 1FKTA 3MI6A 2GJRA 4HJWA 4ZQNA 4AD4A 4KGJA 2OLSA 2YW3A 3KS6A 3B4UA 1E5JA 3MJYA 3ID7A 2W67A 2V6AA 3MMDA 4S3EA 1XUZA 2OO0A 4XAZA 4CVUA 4PMJA 2WMIA 1A5MC 2E09A 1JDAA 1Q4NX 1HVXA 3WLLA 4M8UA 1FFQA 3AHZA 1F5ZA 1VIWA 4DXKA 3G1SA 2Z2BA 3A3XA 4H2HA 5DX7A 3TXVA 3TW6A 4C6QA 3LBCA 2YBUA 3NO3A 1G94A 2P53A 5F4XA 1EIXA 3VKBA 1OVDA 1GQJA 1GPWA 4GG9A 2WC3A 1VRXA 4JX6A 4H6KA 1W3LA 3S5OA 3TDFA 2D9FA 1UZ4A 4H9UA 4WDXA 4K3ZA 4JFIA 2JIEA 3QJAA 3N2OA 1FDJA 1AH0A 3MYPA 3L0KA 4OVXA 2ZUSA 2ZZ7A 1WZAA 4FNPA 4ZVJA 1Y0EA 3PVFA 3FVMA 3EWCA 3T8QA 3DBNA 4ADTA 3ARPA 4AHQA 1DWIM 3UF9A 4UFKA 3WZ0E 4F66A 1F73A 1E6SM 4QR6A 2FVLA 5CPTA 4ZXLA 5A94A 1E4LA 3DKLA 1XLCA 2F6XA 3TVAA 1B2YA 4QLLA 3CC1A 1Y5XA 4S3DA 2ZKMX 2FTPA 4WSJA 4GI4A 3VO0A 2PZ0A 4LRTA 4JHZA 1KQYA 1K1DA 2GVLA 2WZMA 5BZAA 1XSJA 3UY7A 4IGNA 2XVNA 4EACA 4WKHA 4K8GA 3CMFA 2CZVA 4UTTA 4NZ4A 1J18A 1OINA 3CEPA 3ABXA 5FI8A 1M1BA 4S3AA 3GVRA 3N15A 2Y1HA 3QM3A 4PCPA 4JZ5A 1LUCA 1A49A 4IIFA 3FA4A 3RPMA 1EJVC 1JDFA 3BAWA 3C3UA 4K37A 4CKQA 2VFIA 4J27A 4NZFA 4QS5A 4QCFA 3SSZA 3PTDA 2A7RA 4Z2JA 1TTIA 2F84A 5DIVA 3MI2A 2JFEX 2QUNA 2PGFA 2QDHA 4ODOA 1S5WA 2Z0IA 1CLKA 1EOMA 2DPEA 1N8WA 5HJLA 2PLMA 3KRSA 5F2IA 5D4YA 4Z0JA 3BAXA 3G6LA 2QEZA 2QCEA 5AC5A 1QW9A 4K8EA 1FWTA 1BVWA 4JIRA 1QNVA 5CJMA 1JPMA 3WL1A 1XPGA 3O06A 4YCPA 2XP7A 2CLHA 1KM1A 4RW5A 4MDOA 1GONA 4AU0A 5CPLA 1FHLA 5C71A 1M5YA 1SFTA 2JGQA 3D47A 1YADA 2HWGA 4HKPA 4RDWA 5M1TA 3L65A 4DY1A 4QG9A 1FY6A 1QMLA 2XZ9A 3UWZA 1FCVA 3VK5A 3UR7A 4GNKB 1T40A 4HOXA 4LANA 1EXBA 1YPFA 2BASA 1E9LA 1JZ4A 3TC5A 2BS9A 2O7QA 1QK0A 1SO5A 5CC7A 3RMJA 2A85A 3GH4A 4KIRA 4XD6A 4RDVA 3AUOA 4L4MA 1BRLA 1GOQA 2W9MA 4RXFA 3WUFA 2OGYA 1KW1A 1QBBA 3PSVA 4L7ZA 3VOFA 4Q4MA 1YDYA 3NOEA 1F74A 3Q37A 3WDPP 1DJYA 4BF7A 4IMDA 3NFUA 3GW0A 1UR1A 2KZHA 3I7QA 3TJLA 4LWWA 3GH7A 2V63A 5D02A 4Y90A 4RCXA 1S2TA 1TVPA 3E9AA 3K13A 3PULA 1QJWA 1CB7B 4HCHA 4NP7A 2JKPA 4I6VA 1GZGA 5J8LA 4MADA 2QCGA 3C2FA 4DNHA 3CMGA 4Q4RA 4HBEA 3TTSA 1O66A 3MWAA 1O5QA 4IFRA 4R88A 2VEKA 5CJ5A 3IUIA 2OT0A 4WR3A 1JDEA 1I2RA 3C86A 2G3IA 5FAJA 1KXTA 2DFAA 4HHPA 2ZA3A 4I9JA 1W2PA 3OJGA 3PNZA 3CIWA 2QJIA 1XH0A 5A8NA 1SMAA 4LUIA 3TSDA 1MUWA 3FOKA 3QTPA 3N9KA 4Z1CA 5I24A 3LPOA 2QVNA 1XIBA 2CYGA 3VIKA 2X1TA 1UJPA 1KCXA 4P8WA 1R2RA 2PRLA 4IIDA 2FLIA 3OTRA 1TJ1A 4Y9AA 3AS3A 2EKGA 3GHSA 4LCQA 5I03A 4Q32A 4DF0A 2VDIA 3BQ5A 4L72B 1WPCA 3W22A 2G3JA 4V15A 2YFNA 3UJ2A 5LSMA 1QCWA 3W25A 1BKSA 2WPGA 4JN7A 3LDVA 4CD5A 3CHEA 3AXIA 2EG7A 5F1UA 2Y78A 4QS6A 5DEZA 2WHJA 3SBFA 2VX7A 4ZODA 5BU6A 3M9YA 2ESCA 4BI7A 3DFQA 1DORA 4JN6A 4XZBA 2QMKA 1LLOA 2PZNA 3BXWA 4ERGA 4ICNA 1E4MM 2EO7A 4NX5A 3CZEA 1HKIA 2J6XA 2WJZA 1TZZA 1IXQA 1YIXA 3EOUA 3Q58A 3QR1A 4UMBA 1Y65A 1UJQA 4HPHA 2FZDA 1JPKA 1EO7A 4QITA 5T26A 4XKYA 2J8FA 3NVTA 2XIBA 4IX2A 2A3EA 4JQAA 4C6BA 4WRHA 4NJJA 1EKOA 1KKOA 2PWGA 4DHGA 1K9EA 2BGQA 3G0SA 3VNIA 3AWNA 3OOQA 4J3SA 2WANA 2WYSA 4HZ8A 3QY7A 4LXFA 3UA4A 1JZ5A 2FTYA 1H11A 3CNYA 4RNJA 1Z42A 3U0HA 3VD3A 3IJ8A 2QGHA 4BF5A 1CXHA 4JTAA 3ITVA 1ZJBA 3DHPA 4P2VA 4O53A 5EL1A 1W9VA 5GVJA 4U2ZA 3W86A 2FDMA 4QX4A 1G1YA 3K8LA 3KVLA 3ZJ6A 4NNAA 1EF3A 3BMXA 3A9IA 2J77A 4PN2A 2XSXA 1NQKA 1C8QA 4N9CA 1U1JA 2ZRWA 3RMEA 2HXUA 2LKNA 1ZZMA 3PJUA 1O1HA 1H50A 3KOYA 4PB3A 1J0YA 3EKGA 4IGMA 2HISA 4FAMA 4G2PA 3DFHA 2EGZA 5FJJA 1UA7A 3ARUA 1J8VA 1ME7A 2G3MA 3ZFHA 3VVGA 1ADDA 2ZX5A 4ZR8A 3VIIA 4I5UA 5AC4A 4S39A 1TZ7A 5EMKA 4DWSB 1JNSA 1Q6OA 1HJVA 2A79A 5G2WA 2OWWA 3UQIA 1RQHA 4GIVA 2XPKA 4S3CA 5F2GA 2BG5A 1UYQA 4LEFA 3ZT6A 3RLUA 3KOWA 4D1IA 2ZR4A 3TA9A 1OFPA 3NDZA 2XFWA 4HB7A 2QF7A 3W37A 4EPEC 1Q8AA 1UR3M 2HVMA 4FSAA 2AL2A 1R46A 3NAVA 4LUTB 2XFFA 4PTVA 3PJTA 4IQDA 3OVRA 4ITZA 4V1YA 4XBSA 2QV4A 3DZ1A 3S42A 2WV8A 4C65A 2YDSA 3OVQA 1CGXA 4MIMA 1JPDX 4A8RA 1ZK6A 3O5RA 4X60A 4NSBA 2WW5A 4QDMA 1G9HA 1H1NA 3LD5A 1F6KA 4HNVA 7ODCA 3P0WA 5D33A 1DXIA 4LT9A 2BVWA 4C1KA 1TA3B 3E0LA 4DPPA 4OWGA 3OBAA 4F9JA 2GVEA 4XSMA 3E2RA 3MUCA 1IXPA 4ODKA 3M07A 1ZCOA 1DTNA 2IW0A 3MBFA 2O4MA 1FVPA 2OODA 2DZXA 1WXZA 2CHRA 2E3ZA 3RM8A 3PSWA 4FOJA 1E1CA 1OCBA 3V18A 3B7XA 1ZBVA 1TWIA 1R87A 1XIMA 3TYZA 1XW8A 2OJPA 2XP4A 2YLLA 1IR1A 3CUHA 1E56A 1JYWA 4IXHA 4DJEC 3NJ3A 2VZOA 5FJPA 1RCQA 2O4QA 2QULA 3EWUA 1OX4B 2F2KA 1HXVA 1CB2A 1V93A 2J47A 3A6OA 1NJJA 2A1YA 3CT2A 4QAIA 2F6UA 3MYOA 2V3EA 4Q4PA 5HWBA 1FKSA 4JTGA 4CVWA 1EXPA 1F6YA 3AXXA 2QCDA 3M1ZA 3ABQA 3NO5A 2D1ZA 4FHAA 3J7HA 3OVGA 1XD1A 2RUSA 3S1VA 1GJUA 4EPBC 4U10A 3BG5A 3F5KA 1XLBA 2XU2A 4RZ6A 1NSJA 3WUBA 2NZLA 1F3TA 3K4AA 2X05A 5K4XA 3FV9A 1IT0A 2V2HA 5DY2A 2X41A 1XRVA 2XFYA 3GM8A 1IGWA 4DXXA 5HANA 2A4AA 1TV7A 3TOYA 4MYXA 1RD5A 3K8KA 2A7NA 2QUMA 2FPVA 4EAYA 3GSMA 3V4BA 4KWOA 1B3VA 2E0PA 4ZXOA 1CX9A 4W4QA 1XFBA 1PVNA 4XSLA 5D2XA 1UQYA 2R91A 1VCVA 3AXMA 1W26A 2UY4A 2YCKX 1CXKA 1Q6FA 2VYOA 4FR6A 4JFJA 3H2AA 2CXEA 5C55A 1VBHA 3WSUA 3GD6A 3TYEA 1VFOA 1CTNA 4PH6A 1I6NA 2P4VA 1RAKA 4MUZA 4MY1A 4P7NA 1US0A 2DEPA 4IUGA 3QTGA 2VDGA 3TK7A 4RL3A 3WQFA 3N73A 4FAPA 3QGVA 4TMCA 3KAHA 1CBGA 3AMLA 1T5AA 1E6RA 2GGGA 2YL9A 4PUWA 4EANA 2QVHA 1MYRA 2E9BA 2PB1A 2FZ8A 1JUEA 4O16A 4B90A 1CEOA 3H22A 3H2OA 3IV8A 4IXXA 1A5CA 5JXQA 4DQWA 1OQFA 1E40A 3H7VA 4DZ5A 3BDKA 2CCRA 2VWTA 3EEGA 2KAUC 4S3GA 3LERA 4AD0A 1V6WA 2CWXA 2EPKX 5F2MA 2CU0A 3VDAA 4G5DA 1R85A 3TC7A 1Z7AA 2VXNA 2ZRYA 4S2CA 3CIVA 2Z1WA 3CZKA 4RE4A 1XXXA 4DWSC 6CGTA 3QW3A 3QC3A 2ZVRA 4O0ZA 2B0MA 2MUCA 5D2TA 5JIPA 4IJBA 4ZE5A 3WD4A 2GDVA 5AHIA 1HJXA 1J0JA 3AZRA 5LYRA 7REQA 2ZX9A 1SFLA 4BR1A 3O7UA 2G3FA 2PP1A 4GO8A 1GJWA 3TN6A 5H2ZA 5CZKA 3NPVA 2BODX 2WMIB 4C5YA 4GXWA 3W23A 2UZ9A 2QCNA 3OVPA 3LHYA 4W9TA 3A47A 5CLTA 4N0RA 3S1GA 2VGIA 1I45A 2UV8G 1IEWA 3AMCA 1HJUA 5H8UA 2IPJA 1X6LA 1NDZA 3O5JA 1B9BA 1WDRA 3P8JA 3UEQA 4ZPVR 4A3UA 3SCRA 4N7QA 1SPQA 1F8MA 2V5DA 5AVHA 3U7VA 3UFYA 1QNRA 1WBHA 4WJEA 3RITA 2DZTA 4UNIA 1F8AB 4K68A 5C9XA 2ZZ2A 1R3QA 3HIJA 1OX5A 2JKAA 1TV3A 2GDUA 3KRUA 3IANA 3VAVA 3KL3A 1XRSA 1TV4A 2GYIA 3PTMA 5C8BB 5F2LA 1A5BA 3R0DA 1PXGA 3S1UA 4C6LA 5KZMA 3EX3A 3V0UA 4XG1A 2UY2A 4LB4A 1SU5A 4J35A 2KE0A 1R3VA 3CQIA 4W93A 5CPMA 2HE8A 1ZL1A 4CCZA 5HUPA 3HPXA 2XVGA 1DJZA 2VMFA 2Y5SA 1A80A 4KW2A 3LTSA 3QGKC 3CM4A 1P5BA 1RVKA 2QCHA 1K70A 3KFTA 3SCQA 3MTWA 5DLCA 1EDTA 4JFMA 4NUWA 1NSGA 1UKQA 1B0IA 2NQZA 3W1TA 2DG9A 1M7OA 4UR7A 4HZ7A 4JEQA 4DUVA 2VQTA 2YYTA 1J79A 2RFGA 4LVDA 1IGSA 1ZP4A 3P5ZA 1MRQA 4QROA 4YVVA 4JTUA 2FQIA 3UJSA 5KETA 3NI6A 2XSBA 5K9XA 1U33A 2BB0A 3OHIA 1Q7QA 1QHOA 4ZTXA 2FZ9A 2PPPA 1MQQA 4GIRA 3W1AA 5D9PA 1LUCB 1K7FA 1ITCA 1OIFA 1OCQA 3L9CA 5TIMA 3L67A 1AA1B 3PB2A 1EBHA 4WKAA 5CC3A 1W1TA 3WLKX 1DJXA 3E0VA 3NQDA 4ZOEA 4FPSA 3FHQA 3ONCA 2CPUA 5BRPA 1VHNA 4IM4A 3LRLA 1C9DA 1GKQA 2C1IA 3NEHA 1TJ2A 3V35A 4BQ5A 4F2UA 1UZDA 3RO6A 3W3OA 1O95A 4MGGA 2R1NA 3O9NA 2EPLX 3LLXA 1ELSA 3MU7A 4JR5A 3W7RA 3GXDA 5E6ZA 3B9AA 2VEGA 5BROA 3L12A 1ZBWA 1V4YA 3VABA 3TC3A 1XLEA 4DF2A 4Q33A 1A7XA 3QOKA 1WX0A 1OG0A 4MB1A 3W1NA 3W2NA 3HJEA 3ARSA 5A2BA 3WLIA 5GPRA 4O18A 4AEFA 3T81A 4NU7A 1ODZA 1X8FA 3RR4A 3CB8A 1EIBA 2Y85A 1UWRA 5GJMA 4D9PA 2E40A 4KWWA 3W2MA 3AROA 2FGZA 7TAAA 1TZ9A 1BVNP 1V02E 4X0NA 2MNTA 1LOQA 4N9DA 1HW6A 1YW1A 3PZGA 2G4JA 1Q6CA 3T08A 1BRLB 4DJED 3V1PA 4HGXA 3H26A 3FAPA 5ABEA 3ZOAA 2Z25A 3P60A 4WK9A 3TSBA 4KRZA 1SZFA 1Y8BA 3S6TA 9XIMA 4P7LA 5DO8A 3TJXA 2HV5A 4DM1A 3U3HA 5I09A 2V69A 1AQFA 2C14A 1QOQA 5A6JA 3RR1A 2LPVA 2VFGA 1GQIA 1TG7A 3NTYA 4B2DD 3TXZA 4C1NA 5D2WA 1TO3A 4R9OA 3N04A 2NX1A 3O5FA 1XI3A 1CPUA 2CEQA 1GWJA 2UY3A 4HJFA 3WLJA 1KLZA 1QOPA 3F2CA 4NX0A 3G8EA 1UG6A 1N8IA 3FDKA 1SFSA 3O3RA 2ZZ6A 4BQ3A 2OYLA 3PNUA 1PHQA 3W7KA 4HCDA 1HKKA 2CBVA 2F21A 3INPA 2A3HA 2Y7GA 4C6NA 3T55A 2B5UB 3GDRA 4MMWA 3W1QA 3TQVA 3B8VA 1BG9A 1O60A 4IP7A 2NW0A 3KLKA 3CPGA 1GTHA 1UBPC 4WLCA 2WSYA 2DJXA 3LQGA 1PX4A 2E77A 5IDZA 5D8ZA 4C6IA 4EXBA 4NAEA 5D03A 5E0KA 1KRAC 2O9RA 4A8NA 4QEHA 4ZOBA 3VAWA 4AHPA 2BXZA 3PTQA 3VD4A 3MP4A 4P7QA 1LYXA 4YTQA 3O5PA 1YXCA 1J6YA 2J7DA 3CZ8A 3AIEA 4L5ZA 3KOXA 4AWTA 3HGJA 1VJZA 3WF2A 3O15A 4LCRA 2W79A 4O57A 1VAHA 4UFIA 1MXDA 4TV6A 2ALRA 3UA3A 1FAPA 4KMQA 3HTWA 3PZNA 4XAFA 2Y8UA 3N2CA 1MZRA 2QDEA 1V6VA 2GUUA 4ONVA 4GFIA 2OXNA 1OEPA 4XIAA 1WKYA 3H2EA 3HF3A 1KGWA 2BHYA 5CGTA 3ZJKA 3WFAA 1MFUA 4W5UA 2B7OA 4PUJA 1I75A 1V03A 4ZL1A 5C5YA 1WCGA 2XH7A 3LQLA 5D9OA 4DWSD 3EOLA 4WJ8A 1XQKA 2E1WA 4UTIA 1E43A 2YXGA 3LTYA 1ZU8A 1TTPA 4DBDA 4AY8A 4F0MA 4UTTC 1FP8A 1S3HA 3PBVA 3FXGA 3COTA 4HMCA 2OX1A 4IZGA 5HQEA 1V0LA 3UXLA 1J93A 4FLQA 2ATSA 4QDWA 1N7KA 1IZCA 2WQDA 4AZCA 4QLJA 4V33A 2YBTA 4RNIA 2GGHA 2DW7A 2E5DA 3C6CA 4QXIA 1PV8A 2QJGA 4UFMA 4WKFA 3AU6A 1OB0A 1XF0A 1W3IA 4TMBA 2OOGA 3R12A 2WCSA 1ROTA 1Z41A 1BEUA 4NZJA 3NUKA 2GWNA 3SEPA 3H21A 3RPTA 4U86A 3AALA 5CZTA 1VZWA 1XISA 1EX1A 3MCMA 3WFZA 2BOFX 1XYAA 2PDBA 3GTXA 3TFCA 1ISXA 3JYMA 3SCUA 2J7FA 5C7HA 4GJ1A 4DJFA 4YWIA 1H7XA 1M6JA 1GCYA 3W1XA 3WDJA 2P8BA 4HYWA 2D2JA 1TQXA 1U79A 1WA3A 1OGGA 4O11A 4AIEA 2DT1A 3L2IA 1NEYA 2PP3A 1DL3A 4LAMA 3T6CA 4C6CA 4G1KA 1K4GA 1AD1A 1REQA 1KT1A 3RFWA 1E4IA 2J13A 3LGEA 4K2SA 4OUIA 2PPGA 2RGLA 1JCMP 1ENUA 2WZTA 4MM1A 2YDRA 3E12A 2WZHA 3W01A 1UKSA 2E5BA 3RO8A 3V0SA 1EA9C 4J4OA 2E67A 2AL2B 2PDKA 4BCEA 1SVDA 1LLWA 2R24A 3I6EA 3WN6A 3M7WA 3W7IA 7CGTA 1UOKA 1GOXA 3VCCA 3L23A 3TDBA 5JH1A 1H3GA 2QW5A 1K8ZA 2QYGA 3SRDA 4C6PA 5D30A 1EC7A 1UWTA 1V7YA 3N12A 3MZ2A 5BRQA 4NT0A 5DQPA 2XVPA 1OSEA 3OLEA 4HA3A 2FFCA 4JQ1A 3JW7A 2IXVA 4I5XA 1BPLB 5CH9A 4UWMA 4TQTA 1AD4A 5AZ1A 1EBGA 4M7TA 4ZENA 2ZRZA 1MUMA 1DQUA 5HWCA 4P8VA 2QJMA 4H83A 1A5SA 1EWEA 5DBTA 3F5LA 4RPPA 5AYYA 3F03K 1D2KA 4AVOA 1E1CB 4TX0A 2HDJA 1K6WA 1R3TA 2PWEA 2OYMA 3PC0A 3QYQA 3E0FA 1AW1A 4LAVA 2YKKA 2XP6A 4LVFA 5I3IA 1EP1A 3L4TA 1JULA 2VRJA 3JS3A 5D37A 5HR7A 1NFBA 3F2DA 3CL7A 4C02B 1OD8A 1FHDA 4JNZA 4W9PA 4P61A 3KACA 3T78A 2PU0A 3TCZA 3FNDA 4Y6GA 4DWDA 2YLAA 3PG9A 1S1RA 3U57A 2BVTA 3KHJA 2PLJA 4NG3A 4O1FA 2V3FA 1EA0A 2QCCA 3GZ3A 4TX9A 4EOUA 1GHRA 2VTFA 2X42A 4PBFA 3SN4A 4KF1A 4GA8A 3E5BA 5A8PA 1SUXA 3AJXA 4INFA 3PF3A 3WLMA 5C0QA 2QGYA 4KETA 1QFEA 1R3SA 5HDRA 3ZS4A 1B31A 2PWVA 5B7ZA 2QZRA 4EF9A 3P80A 4FALA 1FKKA 4GOAA 5FOOA 3E02A 4H7CA 5K2ZA 1QPNA 5LA1A 3CHCA 4MB5A 3MZNA 3I6TA 1KXVA 4MB4A 2M2AA 4GYJA 1GGOA 4XUYA 1HGWA 4PMNA 4OBSA 1C90A 4XVDA 4Y9OA 4WIWA 3WMLA 2VGFA 1J2WA 1XYLA 3TN3A 3LLDA 4PMQA 4E3VA 3UPWA 1Q66A 2XP9A 3A4AA 1ADSA 2E6YA 1G4EA 3SGUA 4RNHA 2X0HA 3R11A 1HFBA 1Z89A 4MJ2A 2Z00A 4KEZA 3KLLA 3CMJA 3NQMA 1ZBKA 2GVYA 2VCAA 3ITGA 1Q3NA 3OZMA 4MSSA 2WCGA 3P8IA 2QV5A 3W83A 3P61A 4AZBA 4HU4A 3S2JA 1Q5MA 1HL8A 1UD5A 3I7RA 1MI3A 1HTIA 1SW0A 4K7YA 1V51A 2FHCA 3CYVA 4LTSA 3UQBA 3OPSA 4DAFA 1XLAA 1JCNA 3S1WA 1DJHA 1R3WA 4F0RA 3S2NA 2F7FA 1ISWA 2C8NA 2WZIA 4GH3A 5DT7A 1E0WA 2DZVA 1Q6GA 2BY3A 3NG3A 3S5SA 4IPPA 3GNNA 3HU7A 3B0PA 3SRHA 1T8QA 4X61A 1UH3A 4FK9A 2QLYA 4WQ6A 1D3HA 3DFOA 2AQOA 1H1ZA 2BTMA 3KBVA 4U2YA 2NQLA 3TLQA 4JTRA 4R9XA 4QJ1A 1NQ6A 5I07A 4L65A 2EPNA 2Q01A 2VENA 4MNJA 3OHMB 3HJZA 3W00A 4DJDA 4CQDA 1N8FA 4JKMA 3GUGA 3M0JA 2OO6A 3SADA 2A21A 2VZTA 3DFPA 4E8DA 3TV8A 1EJXC 2J6VA 4XZIA 2DUAA 4W87A 4MTVA 4JXCA 3EMZA 4JQ2A 3LXBA 4LV4A 2YA0A 1XIFA 4Y9PA 4W8AA 4QNWA 1ZGDA 3V16A 3KUMA 2B7QA 3BMWA 4X63A 2WKJA 4IQ2A 5AKQA 1E72M 3CH9A 5EY5A 3AAMA 1JFXA 4Q8VA 3CLWA 2YA1A 4M24A 9CGTA 1UKOA 5BNKA 5EYWA 4WEVX 2D3LA 1Q6UA 1PZ0A 3G8RA 3UCQA 5J5RA 4FLRA 4H04A 3HQNA 1ADOA 5I7GA 4GVFA 2ZYFA 3NOYA 1V0NA 1CCWB 2YCJA 4O8RA 2VFDA 4RJEA 4DRHA 3TTOA 4TYOA 2JE8A 4DZ2A 3BGGA 2CWNA 4J28A 4DZ3A 3GTYX 3HO8A 4GRSA 4QGCA 3TCEA 5CQ1A 1DVJA 1V79A 4TXEA 5FD0A 1AH4A 3EY6A 4IPLA 1M7PA 3WK3A 4O14A 5AVNA 4NJHA 3AZSA 2EF9A 1DP0A 1LDCA 1W56A 4KQNA 4YCOA 3NZ1A 4GY1A 2FGLA 2CLFA 1U5VA 5JH8A 2DUZA 3AYRA 3VMOA 5A6MA 1KR1A 4Z2KA 3MVTA 3P6LA 3LZ3A 1EJ7L 4LPCA 4A8LA 3IV3A 5I3DA 1R86A 2JZVA 1W5NA 4HOWA 4XZMX 5C2XA 1C3FA 1X38A 4WCJA 3W38A 3DCPA 3T8LA 3PY2A 1ITUA 1UMLA 1JCYA 4JD4A 4OQVA 4DO6A 4GYFA 1NVMA 1X97A 3N18A 1L6YA 5LHEA 1JZ8A 3EOOA 4FNTA 2PS2A 3O6CA 1UP0A 3BZGA 5DITA 5LA2A 4ODMA 2I5QA 4RPQA 3UXIA 5FF4A 4RK8A 2OFJA 2WJEA 1EQCA 4LYKA 5SWUA 3LENA 1L2QA 3U5UA 4HSNA 1S46A 1Z44A 1PKLA 3GNRA 3K2GA 5M03A 2HXTA 4L64A 3K4WA 2IKIA 3K46A 1PPIA 2AL1A 3WNMA 1B3XA 3E49A 3VNKA 2GZXA 1CENA 1S38A 2CLPA 3VTRA 2FHFA 5JBDA 1E6XM 5A6SA 2QJJA 4RLIA 1NF0A 2XHYA 4W84A 1TPC1 2ETNA 1YEYA 3GKFA 3QVQA 4PUNA 3TONA 1XSKA 4K36A 4YN5A 4HA4A 4QCEA 2A3AA 4NILA 3N9RA 2DSZA 1AQHA 3VIOA 3TCSA 2Z1XA 4YU1A 1R7AA 3UP8A 1KLYA 5ABHA 1EJRC 3CUIA 4CQBA 1LG1A 1GOIA 2OZ0A 1E55A 3QGAC 4LW7A 2WXDM 2TPSA 1FTXA 3SUSA 1RCXB 3ARWA 3R0UA 1LWJA 1W8SA 1C8VA 1WDSA 1EQPA 2QS8A 3BLOA 2WCAA 1W1PA 3VKKA 1VFSA 3WELA 2Y61A 5M17A 3OEXA 2Z29A 1XBXA 2DQXA 4EVZA 1LG2A 4IIEA 2Z24A 1HKVA 1HO4A 2GSJA 2X0SA 3CQKA 1UQZA 3ZR5A 2PTDA 3WH5A 1VYPX 1GVQA 3W74A 1H5VA 1NELA 2PBCA 1H7OA 4DZAA 2F61A 1PTGA 4KWSA 1EZ2A 4NNRA 1IIGA 4O15A 4Q8TA 1SO4A 3IGHX 3VGDA 1Q2RA 3CZJA 1H60A 3HA1A 4C1NB 3TLLA 3LXAA 4JTIA 4S23A 3VC5A 2JBMA 2ISWA 3EWXA 1L1PA 2D23A 5DCDA 4GQ0A 5DRCA 3GG7A 1NMVA 1A0EA 2DW6A 4PMRA 1ZPTA 1FCBA 3QKEA 2MLZA 3EXTA 2XPAA 4TIMA 2CZFA 4U85A 1YDNA 5AY7A 3QY6A 4DH0A 4ZOAA 3AXHA 4AD2A 3HG5A 1JRBA 2ZXDA 4DIPA 4HA1A 3LV6A 3EWDA 1B30A 2VJXA 4IQCA 5BOEA 4DRKA 2VEFA 4GH1A 4A22A 2BDQA 2V5JA 3LRKA 4GPNA 4NAFA 5AYXA 4NAEB 1LZOA 3H55A 3IGXA 4XK2A 2ZR5A 4GUGA 1KM3A 4RZBA 2VM8A 3O63A 1FA2A 1MQRA 1F3EA 4AZ7A 4ZSUA 1YNYA 2XYLA 3UG3A 1TIWA 1XWYA 1ZAJA 4CLMA 4JY9A 2PV2A 3WEMA 2OOFA 3VDHA 4JFVA 4Q4OA 1KGXA 5CGQA 4AY7A 2PC8A 2G37A 3LI0A 3UZ5A 2JQXA 1XP3A 3VOGA 5A1AA 1XCFA 5JUVA 2JF6A 1CYGA 1E70M 5HBFA 4HHMA 4BZYA 4EWJA 3F5JA 4J3ZA 3FA5A 5HW6A 2NV9A 3GO2A 1B90A 3N2MA 5CPNA 4X9YA 4K6AA 3C4UA 3R13A 4CCDA 1PUDA 3R0KA 5I23A 4ZFCA 3E2VA 1AG1O 4XZNX 3LUOA 4CEUC 1ECQA 1NOFA 1KBJA 1Z6KA 4LYPA 1ZB5A 3UZJA 4UOZA 1XLMA 1RR2A 3C61A 2CIPA 4UR8A 3GTIA 3KBMA 3LB0A 1IWAA 5C2CA 3WF0A 4CQCA 3GC4A 4AZCB 4C6OA 1GT8A 3EWYA 4HU3A 1R9XA 3RCYA 3UWEA 2NX9A 1IYXA 2TSYA 3QW4B 2TRSA 2D2OA 3LCXA 3T0AA 3URNA 3LPGA 3M0MA 1J0KA 4A29A 5LZLA 3B06A 4GZ7A 1S5NA 2AAAA 4IMCA 4OE7A 3EOEA 2ZXAA 3AMGA 2XIIA 3TE9A 2RKXA 4F4RA 3TIMA 2A3CA 5C9ZA 1U1HA 3KXQA 3CXOA 4KEVA 2B31A 1W5MA 4XD4A 3N1AA 4N2YA 4YWSA 4URIA 2IKHA 3C0QA 4LS2A 4GFSA 1OZMA 4GC3A 4W8LA 3KWXA 4FP1A 4PUEA 3FX4A 3KE0A 2OYKA 3LCIA 3R6IA 3O5GA 4B4FA 2CERA 4ZO9A 3APTA 3T09A 1YNQA 2BV9A 2NSXA 8XIMA 3H70A 2BHZA 2YZRA 1YE6A 6PTDA 2OQHA 5LIWX 4MB3A 3H23A 2XP8A 1REQB 2V5KA 3QZAA 4TW6A 5KITA 5KSWA 2WSPA 4IX0A 2Q3RA 1ZJAA 5DBUA 3T44A 4EPKA 2XDFA 1RVGA 3ARTA 1ZS2A 2EG8A 1KTCA 2EPMX 1PB0A 2XSAA 4M6VA 3RYSA 1M3UA 2PE4A 3C0SA 2C16A 4RV3A 1XIHA 1I2PA 1X98A 4NI3A 3PZOA 1W54A 2CBIA 5CAKA 3CK5A 3PPFA 1VYRA 1MNZA 3G1YA 2FH6A 3WDHA 3C8FA 4BI5A 4E4UA 1EC9A 1LRNA 1HG3A 1RP8A 3U4FA 1JCHB 3LHWA 1QBAA 1F2JA 1UUOA 3THQA 1QXLA 4AEEA 5AHEA 2RQSA 3MY9A 4B5WA 2ZUWA 1VLIA 3EDEA 3LGGA 2NUXA 2BY0A 2A6LA 2E6DA 3QKZA 4B3LA 1RPXA 4Q8UA 4LS0A 1LQ2A 1NDVA 2CHNA 5AYZA 1ZSXA 3O5LA 2X7WA 3DGBA 3L5AA 3UYCA 2C3ZA 4FLSA 3H2FA 4E2OA 2FZNA 2PFHA 1JYNA 3GRIA 2YCEA 1XV8A 3O6YX 4PODA 3TN4A 1WE5A 2GGIA 5KTLA 3AO0A 5HNNA 2GLKA 2GQ3A 2XZ7A 5A6AA 1A5AA 1RY8A 3CQ0A 2REQA 4YLWA 1LRQA 1IWBA 4AX6A 1JZ7A 3ARYA 4TX8A 1CZ1A 1EHNA 3IARA 3C2YA 1SFJA 1OFEA 3S6DA 3GXTA 1OWQA 1XINA 3D46A 1EX5A 3NQFA 1YYAA 1O1ZA 3S0CA 3GX9A 2QT3A 4JCLA 3CBWA 1YDOA 6A3HA 1HNYA 1NIUA 4PFHA 4ORIA 3B97A 2GUBA 4H8VA 8RUCA 4WX2A 1HKWA 2E4TA 5LGXA 5E09A 4RZ4A 1IIHA 3O5MA 4C7GA 4CCEA 4FNUA 2HSAA 4KRTA 1ZP3A 1TPVA 1Q7ZA 2PMQA 3MC5A 1H09A 3O0KA 1PIIA 3GVWA 1T11A 3MANA 2R9RA 4M81A 3AIUA 2ISFA 1XLDA 4PULA 4MSPA 3AIVA 2A3LA 4Y96A 1OGSA 3VNZA 4LC8A 4I7VA 3G1DA 3O1NA 2CZEA 1LM1A 1XBVA 4GIYA 1MO0A 2VELA 2P88A 4XB3A 4LF1A 3WQ5A 2PDHA 3SR7A 1BQCA 2VFFA 2DZPA 1KT0A 4AZGA 3VINA 4AF0A 1EPXA 2ZA2A 1KM6A 2OZ3A 3EMCA 5I6SA 3A9BA 1XKYA 2ZQTA 3TH6A 3SCWA 2VD9A 2H8ZA 1XKJA 3UCCA 3QMTA 2NQ5A 1OK6A 4AZ6A 3H12A 1T41A 3TR9A 1CGTA 4IFKA 3VPLA 3ZR4A 2IUZA 5G1YA 4W9QA 2XFRA 2HQAA 4D8ZA 1NF7A 5HPCA 3U9IA 4ROQA 3OQEA 4DJFC 4UNLA 5CEWA 1E6ZA 2EXOA 3NSNA 1JPHA 3SO7A 1ICQA 4JTKA 3Q67A 1S39A 1WNOA 4JYSA 3IK4A 4F3HA 3N19B 1HT6A 1EJUC 1XGZA 3T42A 4LUSA 2PGEA 4GNJA 4H6RA 4EK7A 4IPIA 1LORA 3M41A 4NJGA 2DQWA 2V67A 3SUVA 6XIMA 5CC5A 4XAPA 2WVVA 3MWCA 1J0HA 3D5HA 1V3MA 1UP2A 5CBBA 2OLAA 3SJNA 3M0ZA 1UROA 5BMWA 5A8OA 4NZ1A 2OQLA 3CWNA 3VM7A 3KAFA 2AQVA 4XBKA 1FWWA 2ZDSA 2F8QA 5U7SA 4AG0A 2XUCA 3LZ5A 2YSWA 2J9XA 3S5NA 3CTTA 4DRJA 3HB9A 5LNSA 1FKDA 3C3NA 1R30A 3PB0A 4YNGA 3VMNA 2OQYA 3E74A 2YL5A 4JICA 2F38A 3W1MA 5DT5A 1TMQA 1UC5A 2RDXA 5C7VA 3CS2A 1OCNA 3FSUA 4X2PA 4PUUA 5DXYA 3GHTA 4CN1A 1DWGM 1JD9A 1YTEA 4Y2WA 1LP6A 4C5ZA 3V75A 2DUXA 3WCZA 7TIMA 3QLLA 3S2LA 3SCNA 5L9FA 1GYNA 1RQEA 3NURA 3LY0A 2J7EA 3H7UA 4D2JA 4TVDA 1WB0A 5DMNA 1HGYA 1S1PA 1B57A 1JYVA 1F4AA 1FKLA 3DUGA 3FJ6A 2X2GA 2X0YA 3UZYA 4UTJA 3KCJA 1YKWA 1RJQA 3QYSA 2J8GA 4K1WA 2VFEA 5J5DA 4BKNA 3TNBA 1JAKA 4Z1AA 1TKKA 2DSVA 1BWKA 3AMKA 4QNEA 3AIBA 3ATZA 3AS0A 5D04C 3BLDA 5L6UA 1CDGA 3A64A 2FKPA 4W8BA 1MWOA 3GLCA 3O6DA 1GTEA 2QAFA 4TNSA 1TIMA 3TZFA 4ZO8A 3S9YA 1P48A 3SIZA 4LAOA 3WBWA 3IK8A 4PGLA 5A8GA 5CJNA 1N55A 4G7FA 3QMSA 3SRKA 3R79A 1PCKA 1H0GA 4HSOA 1X6UA 2X16A 1RK5A 1VB9A 3FW6A 1MRAA 3SB0A 1LBFA 3QR3A 1WV2A 3EXSA 4CU7A 1G4SA 2VT0A 3ZWSA 1X7FA 3LCHA 4K8HA 3M0LA 1UUMA 4AHOA 4GABA 4FNSA 4J3UA 2FVKA 4D6HA 2HZGA 3GU0A 3F4VA 4S2BA 2ADAA 2C6QA 1ROUA 2DH3A 3SCSA 3ALFA 4GINA 3WJZA 3MI3A 1FKHA 2WZEA 4M51A 4FX7A 3KWSA 1TJ0A 1MDLA 1MQPA 2EKCA 3DDMA 3EX1A 2J25A 1KB3A 1F4HA 2GVGA 3NCOA 4L1GA 3HM7A 1MZHA 1LOSA 3M43A 3GTHA 3LMZA 1DBTA 3EWZA 4IPJA 4ZQMA 4Q8NA 2RGMA 1GZ1A 1AMYA 2Y8KA 3HURA 3GFXA 4WOQA 3AU2A 2P5NA 1KCZA 4U4MA 2ISSA 3H7RA 1FWSA 3L7RA 3L5MA 1R3RA 3KL0A 5KMYA 1ICPA 4QQ3A 2V5CA 4GWEA 1MW1A 2EJ1A 3THCA 1AH3A 4WDTA 3NQBA 5EPDA 4M5PA 2CKSA 1M53A 3APYA 3QSRA 1PZ2A 2VI0A 4HNOA 2WKGA 1D3CA 3VKCA 3USZA 2BGSA 3RG6A 4E8CA 1C8XA 3W2LA 3WNKA 4O1BA 5HK4A 4FXRA 2V30A 4QDPA 2FB3A 2P10A 3GDBA 3VX0A 3OBEA 1QRQA 4B5TA 1UASA 4LY4A 4N02A 1P6BA 2D3NA 4UUIA 3RFAA 1ZY9A 4LOCA 4YXGA 3KAOA 3PBMA 4CD7A 1W31A 1J6PA 4YMZA 3W9ZA 3R4IA 2WLYA 3UVIA 3OP2A 4TR9A 1FWDC 3O2LA 2E28A 2PCQA 3WH7A 3EAUA 3IS4A 4M82A 2BVYA 4LS1A 4DJDC 3AWOA 5K9CA 1W3TA 3PUOA 5FF7A 5H6HA 5D8WA 1YNPA 4GCXA 3WNLA 4GXMA 4Z2LA 3ARVA 2A3BA 3BARA 1IR2A 3UYIA 3G1HA 3QQ1A 3C5QA 1Q6RA 3CU2A 3RX3A 4C7DA 2WNQA 4HNUA 3UI6A 2F2HA 1GVRA 4NIRA 3A5VA 3YPIA 3M5VA 3HN3A 1MNSA 4IMAA 1R9YA 2FAPA 1H7WA 2Z6IA 2HK1A 1TVNA 1JZ2A 1EP2A 4R85A 3O5QA 1KM2A 3VC6A 1I2OA 3H6OA 4LAZA 5HT1A 2YR1A 5F4WA 4ILSA 1U2YA 3QPZA 4NJKA 3T2OA 3ZVHA 4MUPA 1FJDA 2HK0A 3I4EA 3G22A 4AD1A 1E44A 3G1RA 4NAFB 2AWGA 3I4KA 1BF6A 5G4WA 2E8ZA 4ZB2A 3GC2A 4R53A 1V6YA 3IJDA 4MKVA 2OSWA 3IIXA 4EX4A 3ZT7A 3HV8A 4ODRA 1YXDA 3B0VC 1WO2A 2V3DA 3G6MA 1DWAM 2KR7A 1NY1A 2BP1A 3VCNA 3ZVIA 1Y0OA 5I00A 2V38A 1W3JA 1L6FA 2GJNA 3MV01 4NZCA 3R58A 1R9HA 4M19A 1GK8A 4DUOA 1UWSA 1FH8A 3HV9A 3CUJA 1J0ZA 1PX3A 1I4NA 3POHA 3RAOA 4GLEA 1KBLA 3CL8A 1E6QM 3IVSA 1HN1A 1RZMA 4PMDA 3BAKA 3B0YA 1KA9F 3M4HA 1ME8A 1UC4A 5A6BA 3M64A 2DT0A 3D3FA 3WNOA 4ZPWR 1RJRA 3GC5A 4AH7A 2X8RA 2NQ9A 3M47A 1O7AA 3VKAA 4IIHA 3AIRA 1RY0A 4JYEA 3B04A 4W89A 1V0KA 3VFLA 4TU1A 4O54A 3MJMA 5GNYA 3OOBA 3ZSTA 3R5EA 5EKYA 4A3HA 1VJIA 3CHVA 3DFTA 1EEXA 3NTPA 3I7SA 4XO7A 2INEA 2YCLA 3D6NA 1NU5A 1K7XA 1JQXA 3WDIA 4XKMA 2FJKA 3KBWA 4HK7A 5CC6A 2ZZ5A 1ZHAA 3M16A 4UFJA 3A12A 1Q6EA 2XGBA 3JYJA 3PM6A 4N42A 1F61A 4PR4A 3P81A 3NM1A 1JRCA 2I1OA 3SFWA 4D6FA 5LGZA 5JQ9A 3EPNA 2QIWA 5EU9A 3BAIA 4PB5A 1UUQA 4G6CA 1VC4A 1KM0A 2J74A 1LJYA 2PWHA 1RP9A 4G50A 4Z17A 5I5RA 5IHRA 3DU0A 2PDNA 1QZ2A 3ZR6A 4M6QA 3DG3A 4U3CA 4ALDA 3FIGA 5I77A 1P7TA 4QG6A 4JQ3A 4YTRA 4WSKA 1TELA 7XIMA 3BGJA 1W8GA 3U2OA 4LY8A 4ML4A 4PEEA 1W3NA 3REQB 4MAVA 1W91A 1GG0A 3TX9A 2G97A 2PUZA 4ROPA 2OCZA 3IUDA 1XHGA 1R7OA 1WBJA 2PLCA 1P0NA 1EQ3A 1U83A 1QVBA 1IZJA 1C7SA 3OU8A 5BXPA 4V28A 1RA0A 3LN3A 3W84A 2DZSA 4QHRA 1EO5A 2YA2A 2YZ5A 1UIOA 1VD6A 4KFNA 4AZ5A 1FWIC 2X1SA 3JR2A 2W63A 2XM1A 2VC5A 3I6RA 4RR4A 4EKJA 1KQZA 5H1WA 1K4HA 1EJTC 4CD8A 2XH4A 2NWSA 1H49A 2PC4A 3Q45A 1AW2A 1W1VA 1FXQA 2KO7A 1XRFA 4NL1A 3RLGA 5IOBA 5K3VA 4I9TA 4CQAA 1JDCA 5HMSA 3GBDA 2FB2A 3N9SA 1FHVA 1XC6A 4BWLA 3W02A 1Z8AA 3TROA 3SUTA 4F8XA 4QRNA 4IOTA 1Y5WA 3C0LA 1TV2A 9RUBA 2BX7A 2IS7A 3EDKA 1DIKA 4FO4A 3NWRA 4JBRA 1WOBA 4I90A 3VKDA 2WMHA 1BG4A 4LUYA 3THAA 1X1OA 1VGAA 1OD0A 1I2QA 4KERA 4B3ZA 2G5WA 5DN1A 1DIOA 3QLDA 5BXRA 2C71A 1A3WA 3WQ8A 3FKKA 4DZHA 2J4GA 3U2ZA 2REQB 1VRDA 2IPWA 2IKJA 2MLXA 4YTTA 3WDRA 5K7JA 5EMLA 5FF0A 4OOZA 1SZRA 4D8LA 4B9YA 3KABA 2GVJA 3VIHA 5HJYA 3U4AA 4KCTA 2WLZA 4TTUA 3CUGA 1AUSL 2OFNA 1B3ZA 2OELA 1S2AA 4JKLA 4LAWA 2FIQA 3H24A 3EDFA 2Y70A 3GS6A 3EDJA 4L9XA 1OYCA 1UZ1A 4PUMA 2BSLA 4US6A 3LS9A 4CNNA 1EYWA 4OHQA 2A6NA 3H9RB 1AJZA 3W2JA 2BY1A 1DPMA 2YL6A 3GVQA 1NP0A 1TPEA 2ZX6A 5CZJA 3UNTA 1QTWA 3NL5A 5IFPA 3P0XA 3PZMA 4XD5A 4YL2A 3QQ0A 1J10A 3NIYA 1OG6A 4DJDD 2QPUA 2PBGA 2G50A 4PUDA 1HJWA 1EUNA 2DORA 3N3TA 3UJFA 2OEMA 4FA3A 2W6RA 4J9JA 2XP5A 1S2UA 1PJ9A 3M44A 2ZZ1A 3CGTA 1EL3A 3QBUA 3WLNA 4GXPA 2PN0A 1A0CA 3FDGA 5I98A 2BWGA 3G1VA 1I60A 2XPBA 3NNTA 3IJIA 4Q22A 5KZDA 3OGSA 4AF0B 3ARQA 1J4HA 4XVEA 4DRNA 5GNZA 4HD5A 4JTLA 2DVTA 1VCFA 2V9DA 4UTWA 3WJXA 4Z08A 1QR7A 3SY8A 2Q02A 2PDLA 1UBSA 3N2XA 4G8TA 4DLFA 1AL7A 4R7WA 2GQAA 1ZALA 3F1QA 3T2QA 1TREA 4IFKB 4F79A 3WLHA 4E4FA 1Q6IA 1W1A1 1CXIA 2Y89A 3KZSA 3LHZA 5HQMA 1CGWA 3RX4A 2XG9A 4H9XA 3LX9A 3WQEA 5GJNA 2VGBA 1O94A 1WXYA 1F6PA 1HX0A 3TMQA 1S5TA 1YTKA 4LUSB 1EOKA 1TR9A 2KX9A 3GFZA 3KP1A 1ZUAX 1W9PA 3CUZA 2WVVB 3VZYA 3IJ6A 4ICCX 4WZHA 4GBDA 1QNSA 2ZUVA 3MB9A 4JTFA 4LVGA 4PBGA 1FCUA 1F9CA 3VILA 4BF8A 1UR8A 1QWGA 3DEQA 5HNRA 3ENLA 3QSTA 2O55A 2Y88A 1IT7A 2PWUA 1W1ZA 4MKSA 3CB3A 1TE6A 2YGYA 3PUDA 5FEWA 1XIGA 3WH8A 1KXQA 3BJTA 3BLPX 2WHKA 3GFYA 2ZZ4A 3HMCA 2QF8A 5I3KA 3W81A 2ACQA 1IF2A 2OWXA 4X22A 2R1KA 4HBKA 2VP8A 3RRXA 4JYDA 1JAEA 5EFFA 3ABSA 3S5ZA 4JHOA 3TN5A 2WK2A 4CNTA 4O2TA 5D75A 5IRPA 3GG8A 3GH5A 3GU9A 3ABOA 3WLSA 3SQSA 3ZSSA 2EJAA 5LNRA 1IX5A 2VRQA 4DVOA 4E6MA 5M3WA 3BL3A 3DG6A 1OJXA 2FPYA 3KRBA 3CH0A 3W6LA 3DAQA 4HTYA 3ME3A 1ML1A 4UQEA 3AJ7A 4O17A 1TCDA 2R14A 2WAGA 1XGDA 5TF0A 3BICA 3ECQA 1LT8A 3BLLA 1ONWA 2HPMA 4ERAA 1H62A 2QCMA 3KDNA 2Q09A 4XX6A 3HG3A 4DUWA 3ZXWA 3H53A 3UCDA 4B5NA 1E1FA 1QI3A 1TTJA 3DHFA 4DYJA 4TW7A 3P62A 1E15A 3V0TA 5HINA 2LLEA 3NYZA 2GK1A 5MF5A 1AK5A 3N17A 3KOFA 3WEZA 1PHWA 2H3DA 3KZ7A 3N4AA 3L0NA 5LIKX 4LNYA 2PDGA 4PMXA 1PAMA 3KADA 1GVSA 4MZ8A 5TQLA 2PP0A 4O1DA 5C6MA 5CLWA 3IIPA 4O1AA 1EYEA 2OKTA 4UOJA 1UWUA 1E3XA 5IDIA 3F4WA 1Q8JA 2BXYA 1TPB1 4D6DA 1JYXA 4DZIA 2O7SA 1H0IA 2CLIA 2DIEA 3AHYA 4WXZA 4CQ8A 2XM2A 4B2DA 3PZVA 1EYMA 4UC5A 5DMYA 1B9ZA 1UD6A 2GUYA 1PBGA 1FKGA 3NGJA 5M5DA 1B54A 3VX1A 2E9LA 3SIMA 3MMTA 3TU9A 5HMFA 1BXNA 1H1YA 3CAWA 3HG2A 1FWNA 4M1BA 4R3UA 3VE7A 1OC7A 2VVNA 1A47A 2V81A 2UBPC 3SW6A 2GPTA 3W28A 1NFGA 4EXQA 1IE7C 5E0CA 4XTIA 1I0BA 4UTKA 2PDMA 2J9ZA 4WOZA 4W86A 3MP3A 3OBKA 1RCOB 1FOBA 3LOTA 1KRBC 1RPKA 1VIZA 2YB4A 3AYVA 3L4XA 2O0TA 3B0XA 3F4CA 3R25A 4H19A 1Z32X 2FGBA 3T40A 2IQ0A 1X1NA 4NJIA 4N19A 4PMYA 1Q6HA 4AWEA 1MEWA 3CZGA 1K8YA 1UP3A 4HIBA 1GQNA 3RUBL 1JF6A 4QJ4B 2X7VA 4N6FA 4NY2A 1Y5VA 4MZ1A 1XM3A 1YPIA 3N6JA 2ZZ3A 4NNCA 2ZC1A 9XIAA 1LL6A 4HNLA 1SZGA 2RURA 5AYIA 4IT6A 1J5SA 3LBMA 3PZTA 4KIEA 1VHCA 2RSEA 3CUFA 4AIUA 4A3YA 1EZWA 1KBIA 3POCA 2ZR6A 2JIWA 1SO3A 3VNDA 4ECLA 1MUCA 1AJ2A 5FEPA 4GUJA 3T05A 4F40A 3A23A 1ECEA 4ZMGA 3MSGA 3PPGA 3RHGA 1TYGA 3F7JA 3FAWA 3R89A