4WKFA

Crystal structure of human chitotriosidase-1 catalytic domain in complex with chitobiose (2.5mm) at 1.10 a resolution
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
368
structure length
368
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitotriosidase-1
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 128
structure length 368
sequence length 368
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wkfA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wkfA01
3MMWA 1VEMA 3VVGA 2WMIA 2JIEA 2V3EA 5BYWA 2VO5A 4DUXA 5EMYA 3WH8A 4MJ2A 3UESA 1BQCA 3AISA 2VCBA 1HKKA 2VX6A 2FH6A 1E3XA 1XH2A 3FAXA 4M56A 1SR0A 2D2OA 5M03A 1LF1A 1UD6A 1GZJA 1X1NA 3WY1A 1CECA 2J25A 3WF1A 4NZCA 2XVKA 4P7NA 1MQQA 2Y24A 5ABFA 4PMYA 2WZHA 1V02A 4LYPA 5AY7A 2Z1SA 4W8AA 1CXHA 1D2KA 1KGUA 4BZYA 4U31A 5CLTA 2FHBA 1EQPA 4HMCA 1XSKA 1QNPA 3AROA 1MW3A 5FOOA 1BFNA 1J0ZA 4P8WA 4DUVA 2EPKX 4RE3A 5I0DA 2EBNA 2W67A 1JNDA 3CPUA 1IT0A 4PMVA 2A3CA 4BS0A 4V27A 1G0CA 3GTNA 3B9EA 2VZVA 1TMQA 4AD1A 4D6FA 4ATLA 1FHDA 1GCYA 1E6XM 1DEDA 4AYSA 2VL4A 4OOZA 2BHZA 5A6SA 5CSYA 2J79A 1WB0A 5BXRA 2WNWA 4MDOA 3MUIA 4MNJA 3FNDA 2UY3A 2OYLA 5CG0A 4U3CA 5E70A 3BXWA 4DWSC 2WKGA 1V0NA 1NOFA 5A2BA 3T0DA 4U5IA 2YL6A 4LQ1A 3W0KA 1UWSA 4YPJA 1PBGA 4D6CA 1J0JA 1D7FA 1ZL1A 3AXIA 1JD9A 3NDZA 4AXNA 1ODUA 4PTXA 3L2MA 1LLOA 2XM2A 5D8ZA 4JIEA 2XUCA 3WF3A 2ZUVA 1C90A 1B31A 1JAKA 4MDPA 5I5RA 1UD2A 4DUWA 2D0HA 1W9PA 2XGBA 3BAXA 3VM7A 5JBDA 2JF6A 4GXPA 3FXYA 3S2CA 3TA9A 1GOIA 5I78A 4D6GA 4PCSA 2QV4A 4AZCB 3VNZA 1W2VA 3W29A 3N1AA 1E0VA 4TVDA 3SCRA 4Z2KA 2GDUA 2BVYA 1KBBA 1GHSA 1MW1A 4QDMA 3MV11 1MFUA 1WDPA 1IV8A 4ZXLA 3MSGA 3I3EA 3A4WA 1C92A 5CJ5A 5A6BD 1C3FA 1H09A 3HMCA 2D22A 4GI6A 1JG9A 5BXSA 3RM8A 1OB0A 3EYPA 1OD8A 1FA2A 3SUVA 3O2LA 4TUFA 4UFHA 4JAWA 2VX4A 1TA3B 4E4PA 4YHEA 1JFHA 3M46A 4AIOA 2GJXA 3LPGA 1BLIA 2EO7A 3WNNA 2ZX8A 3WMBA 3WN6A 1MYRA 5GNZA 1HJSA 1M03A 1VEOA 1MXGA 2O9RA 4PYSA 3AIWA 4W8BA 5BWFA 1QOXA 1UR0A 1VFMA 4AZ5A 1WZMA 3BCDA 1W3KA 1C8XA 4JHZA 4P8XA 2JE8A 4PBGA 1B3ZA 3WH9A 5AC5A 4JL1A 5HPOA 3OLEA 2QPSA 1UA3A 2WVTA 2W91A 1RP9A 3WEOA 3PBGA 3CH9A 2CPUA 1GQLA 4UFIA 3M07A 3ZJKA 2J62A 2CESA 2CETA 1B1YA 5ABGA 4AMCA 4AZBA 2Y5EA 4JFSA 5D9MA 1DWAM 3EDEA 1WZAA 4V28A 2X8RA 5ECUA 1R87A 2BS9A 3AZRA 3THDA 2XG9A 2YL8A 2X0HA 1V3HA 5LA2A 1CWYA 2WKLA 2WHLA 1KQZA 2RGMA 3KL5A 3HJEA 2OWXA 3QHOA 4N42A 4XUYA 3KWXA 2BVTA 3KEHA 4GZJA 1QPKA 3QHMA 1X6NA 1R85A 4FLSA 4PMRA 8A3HA 2WB5A 2ZXDA 2VCCA 1XH0A 5CPSA 2DSKA 4MB4A 3ARXA 1S46A 3VIPA 5ABEA 1E6ZA 4H7VA 1MXDA 1JZ6A 2GFTA 3N04A 1QNOA 4JKLA 1I1XA 1V3KA 4HU0A 5JH8A 3L4WA 1UWIA 3CUFA 3VPLA 5M5DA 5BRPA 1JAEA 1EDTA 4K68A 1RD6A 1BYBA 3CUGA 3NSMA 3ARTA 4Z2LA 1JZ7A 1CXLA 1GOOA 4UNIA 1C7TA 1EIBA 3UG4A 1XRVA 3WD1A 3FY1A 3MU7A 4CU8A 2AMGA 1K9EA 3AXXA 1JF5A 1HKIA 1XH1A 4W84A 3GNOA 1EGZA 4MNKA 4GZEA 5I2UA 4TXEA 1H4PA 4KGLA 5A6AA 4U2YA 4AIUA 4UOJA 4MNMA 3F5LA 3VX0A 3CZGA 5A2AA 2PWHA 4AZCA 4B3KA 4BQ5A 4AY1A 1CXEA 1GJUA 2YLLA 2Y4SA 1XCXA 3TTOA 1OSEA 5E6YA 3AS0A 3FHAA 3ARRA 4IISA 4QLLA 1AQMA 4C7FA 2NSXA 4Z2HA 3VDHA 1UH2A 3WDQA 1E73M 1BG4A 2YBUA 1XD1A 2J47A 1BYAA 4PMQA 2CERA 4QFUA 1MWOA 4M81A 2ZICA 3M6DA 3AS1A 2FHFA 1KCKA 2NT0A 3MV01 1RPKA 3BGAA 2WWCA 1NM9A 1K6AA 3UG5A 3L4UA 3VGDA 3ZT7A 2YA0A 1HN1A 4XX6A 2VRKA 1RP8A 3EMQA 1HXJA 1NWTA 2WPGA 4HOXA 4HPGA 3PZUA 1EA9C 2DIJA 2WHJA 3F4VA 4UZSA 3TTQA 2JIWA 2J4GA 1SYTA 1TA3A 3ALGA 3GXDA 1WZKA 5AC4A 1JFXA 2EPNA 4ZENA 3IJ9A 2E4TA 2OYKA 3OGRA 1BPLB 2G41A 1ZU8A 1GJWA 1CNVA 2C7FA 5A6KA 5HOSA 3NJ3A 3FAWA 1K9TA 3AMCA 4Y7EA 1E0WA 2C0HA 2E9BA 1JZ5A 2VUYA 4GI9A 1WZLA 5FKYA 2VZOA 1GNXA 1OINA 3WNMA 3RIKA 3L4VA 2YJQA 2PB1A 3CUIA 3OB8A 1SMDA 2BY1A 3UR7A 4HZ7A 1JXKA 5A94A 2CBUA 1V6VA 1MVYA 5EFDA 3ZSTA 3ZQ9A 2VQTA 4PN2A 1KXVA 5D9PA 4RE4A 1W1YA 3CIVA 5A8QA 1EHNA 1UZ1A 3SCWA 3SUSA 1CEOA 4XZBA 4PMXA 2CKSA 1JZ8A 5D9OA 1C91A 4OJYA 3GH7A 4QCEA 5DFAA 1W3JA 1HP4A 5CGTA 4HOZA 3EMCA 1HP5A 4PUEA 1E56A 1TUXA 1GQKA 1XYFA 2D20A 4UTFA 5A1AA 2W62A 3GBDA 2TAAA 2G4FA 3AZSA 2DT1A 1KGWA 3VMPA 2XFFA 4J3UA 1DWHM 4WF7A 2VJXA 3AFBA 4F9DA 1CLXA 2J7HA 1XSIA 1W1VA 2IUZA 2YDSA 1M53A 5EFFA 3VU2A 4CU7A 2G3JA 1C7SA 3N11A 4W88A 1EHAA 3EDFA 4N0RA 1HVQA 4D1IA 2ZX6A 3WH5A 1W91A 3ZMRA 3JUGA 2DT0A 4IM4A 3VD9A 4URIA 2XIBA 3OLDA 3SIMA 1PIGA 1CXKA 3W37A 1K9DA 2YLAA 1UWQA 1QNQA 1ODZA 2VURA 3W25A 2XJ7A 1UD5A 5IFPA 4AZ7A 2G3NA 4QCFA 1JYXA 9CGTA 1OCQA 3WNKA 5HBFA 3T2PA 4DWSD 1V3IA 3CZKA 1BAGA 1JDCA 8CGTA 3CMGA 3WUFA 1UD3A 1NWRA 1J0KA 4UR9A 2ZWZA 3GM8A 1U30A 2OLHA 3ZO9A 1PX3A 4KRUA 1QHOA 3WSUA 4EKJA 2PWEA 1V02E 1FH7A 3WENA 2WMJA 3CUJA 1JYVA 3O6AA 3WDJA 3APGA 3LPOA 2ZUTA 3ARSA 3SCPA 2BY3A 3EDJA 2JFEX 2EQDA 4CVWA 1ISVA 3PZOA 5E9AA 1BGGA 1ESWA 5I24A 3RO8A 2ZXAA 1J0YA 3U5YA 3ARWA 2G3MA 3BMWA 4XZWA 2WANA 2WVVB 2XSAA 3CZ8A 1GVIA 1FH8A 3N17A 1J0IA 4X0VA 2VI0A 5I77A 1E4LA 3CHCA 2ZUUA 3K8MA 1V6XA 1CTNA 5A8OA 4JKKA 2WSPA 2V3FA 1H0GA 5JBFA 4HZ6A 1E70M 1HL8A 3SCOA 4TX8A 1V03A 3F5JA 1XYZA 3I3BA 1JI1A 5AYIA 3VIIA 1U33A 1U2YA 2BXZA 1V0LA 4AEEA 4F9JA 4A3HA 1MQPA 1Y7VA 1B3VA 3WDRA 2ESCA 3WIJA 4OBSA 2VMFA 4P7OA 2JALA 3AQUA 5DT7A 1E6NA 3MKKA 3WMCA 4X9YA 1E1EA 3CZLA 3VKKA 3PZGA 3EDKA 1UA7A 3U5UA 2E9MA 3AOFA 3VDBA 1VEPA 2X2YA 2D0GA 3MSDA 1N82A 4PMOA 4AISA 2J75A 4M24A 4P7RA 3OZPA 1DWIM 2W61A 3WF0A 1UWTA 1UR8A 2UWFA 4D6IA 3WNPA 3UG3A 4PRWA 2WMFA 2BY2A 3VMOA 3DYOA 2VRJA 1JYWA 1E0XA 5DEZA 2VCAA 1V6WA 3J7HA 2DH3A 5CPQA 3MUAA 3N12A 1V0KA 1PEZA 1E1FA 4W7VA 2DH2A 3WD2A 4AD3A 2O92A 4BF7A 2WLZA 3VINA 1ECEA 3THCA 4C7DA 1GPFA 3U7BA 1TVPA 3HU7A 3NSNA 3PZTA 2XVGA 3CO4A 2CHOA 4LXFA 3AIUA 3W28A 2ZX9A 2YOCA 4J27A 3SCSA 3EMZA 1JZ4A 4UCFA 1WKYA 2X09A 2NW0A 3VGHA 2WMHA 1W1PA 3TOPA 1PZ3A 1VENA 1BGAA 3VIOA 5IHSA 4P8VA 1QI5A 4JKMA 2WVSA 2VNCA 2XPKA 2WM0A 3U7VA 3WNOA 4CN1A 4S3JA 1KFWA 3W53A 3UEQA 2WYSA 1FP8A 3WH7A 2FDMA 2AOSA 1YHTA 3CMJA 1HX0A 1KBKA 4H41A 4FLRA 1EDGA 1BF2A 1UYQA 2J8GA 4MNLA 1WE5A 3ALFA 1LWJA 1PX8A 4D1JA 3OZOA 5AYBA 3W27A 1UR9A 3AJ7A 3GBEA 2CITA 1QI0A 3UCQA 2W4XA 4Z2GA 1V3MA 3EBVA 4AEFA 5BROA 2ZUWA 2DT3A 1UUQA 1QI2A 4M82A 3RPMA 3ZT6A 2VOTA 4UQCA 1Q6DA 1HNYA 3BCFA 3SUTA 3VNYA 5A6BA 3DHUA 2XWEA 1W9DM 4A4AA 2XSBA 2EEXA 3RCNA 4B16A 1H41A 1ISWA 1KR1A 2D1ZA 2CEQA 4PMDA 3BLPX 1Q6EA 1C8YA 2WVVA 5IHRA 2ZE0A 1G01A 3KL3A 3A4AA 4KMQA 5FL0A 1XD0A 2WMKA 5I23A 2Y8KA 3GYCA 2J7DA 1E4IA 4ZFMA 4OOUA 3B8SA 4J3SA 3VIKA 2E0PA 1DP0A 2BV9A 6CGTA 1KGXA 3SCQA 2EPOA 4PTMA 3EDDA 1AQHA 2DQXA 3GXFA 1EOMA 1K9FA 1M7XA 1PX4A 3ZOAA 3CZJA 4F66A 5JIWA 1TFVA 1QHZA 4NI3A 3N15A 4UQ9A 2A3HA 1MQRA 5DO8A 1HKMA 3T08A 1H49A 1CGWA 4CD5A 4U3AA 4PMZA 3RJXA 2D23A 3A3HA 3NCOA 4LYRA 1I75A 4B15A 4CU6A 2E8ZA 2FGLA 1EO5A 1ZBWA 1HJWA 2WC7A 1NOWA 2F61A 2QHAA 1CZ1A 4ML4A 4GIAA 5KZ6A 3WF4A 1W2PA 2XGIA 4FMVA 3U57A 3VO0A 4FLOA 1HJXA 4UFKA 1UKOA 1B3YA 4BQ2A 5C8BB 3WL1A 1CBGA 5C71A 5BCAA 2F2HA 1EQCA 1CXIA 1F4AA 3ARYA 4NF7A 4BCEA 4P7LA 3II1A 4X0NA 3WEZA 3GH4A 4ACYA 1NH6A 1OGSA 4TTGA 1RH9A 5I3DA 5M3WA 2XIIA 1SFSA 1OIFA 3KE0A 1OIMA 4B3LA 2J78A 3ECQA 5I79A 4EE9A 2PWFA 3N13A 3WQWA 3AI0A 1W1TA 2BHYA 1KWGA 7TAAA 4D71A 2WAGA 4D72A 3WL0A 4F8XA 2GUYA 4D6JA 1DHKA 3T0BA 4HA1A 1JD7A 4H04A 4W86A 5A95A 4E2OA 1ISXA 3PZNA 3MO4A 4PUDA 3QOKA 3CHEA 1QHPA 2WHKA 3WFLA 2O9TA 4WSKA 4YN5A 2OYMA 4KWUA 3ZIZA 2X1IA 5FD0A 3K4DA 3CLWA 1D3CA 5GNYA 4NSBA 3ZT5A 3SCNA 2WLYA 2QPUA 1GOKA 3FW6A 1M04A 3PHAA 2PWDA 1HJVA 2YDQA 1R8LA 1JXJA 5A6LA 2V5DA 1M01A 4CN4A 2MANA 2W5FA 3AICA 4UQAA 1UD8A 1YQ2A 3PTKA 1UZ4A 5LYRA 1OT1A 3WDIA 3ZJ6A 5CQ1A 5IFTA 4DWSB 2FHCA 4AZGA 1PZ2A 3WUGA 1OT2A 1WO2A 1E6QM 3CUHA 5CLWA 3VX1A 3NIYA 1OBAA 1VFUA 2DSWA 1XC6A 2V3GA 3BLKA 1J0HA 1VBUA 3NDYA 2PF0A 1E43A 3D5HA 3UETA 4W93A 2ZXQA 3ZR6A 1O7AA 1KCLA 5BXPA 1E3ZA 4JFTA 4AZHA 3CHDA 3TONA 1CGYA 2G8ZA 4TX6A 3IAPA 1E6RA 2JEQA 2ZUSA 4J3XA 2X0YA 2UY2A 4DM2A 1ISYA 3WBAA 2XWDA 3W81A 2DPEA 1KQYA 4NRSA 2VVNA 3I3DA 4OUEA 1VAHA 4CD8A 2E3ZA 2XHYA 3A6OA 4KGJA 4W5ZA 5JIPA 1PAMA 2D3LA 5GQBA 4JCMA 2QMKA 6TAAA 4AZIA 3AMGA 3ARUA 2HVMA 3SEPA 1ZBVA 4J28A 3ZM8A 1LG1A 1BSIA 3K8LA 7A3HA 1TG7A 4OZOA 1JYNA 2EXOA 1BVNP 4PCTA 4S3KA 2YA2A 4DM1A 3S6TA 2VVSA 4QP0A 2WC3A 4JFUA 2E9LA 1JI2A 2IXVA 3L4ZA 4WK9A 4CD6A 4EAMA 1ZBKA 3BMVA 1BYDA 1V3JA 1H0IA 4J3VA 3RM4A 2EJ1A 1CENA 2QF8A 2GDVA 2A3EA 3NSXA 3ZJ8A 3ZSSA 3VDAA 1TZ7A 1GQJA 4UOZA 3LMYA 4CD7A 4IPNB 2UY5A 2BVDA 3AYRA 3WD0A 2WBKA 4ZXOA 2CYGA 3AMDA 1R7OA 3AHTA 1R7AA 1V6UA 2C8NA 3WF2A 4Q7NA 2WW5A 3LPFA 4NRRA 1O6IA 2Y2WA 2DIEA 1UR4A 1LL6A 4GI8A 2DDXA 1VJSA 1GONA 4KRTA 4B9YA 2BHUA 5JBEA 2WZEA 1US2A 2VZUA 2NT1A 1UQZA 1WNOA 2ZX5A 4M1RA 1CGUA 2JEPA 1G94A 1DWJM 3E1F1 3AHYA 5EB8A 1FH9A 1Z32X 1QBBA 1NOUA 2W63A 1KXQA 4L4OA 2XFRA 3AYSA 3WDHA 4UFJA 1ITXA 4YHGA 2EPMX 1KXTA 1LL7A 3WELA 2EPLX 3RM9A 3T0AA 3VILA 3WFZA 1X6LA 4UOQA 1G9HA 1TE1A 4MJ4A 1BVZA 2VTFA 4UQBA 2GK1B 2G3IA 1QW9A 1BYCA 1CGVA 1E5NA 2YKKA 1P6WA 2RGLA 1GOWA 4WLCA 5BRQA 4KH2A 1NQ6A 4J3WA 3W4RA 3OGVA 3MANA 1ISZA 5A6JA 4OIFA 1AMYA 1LG2A 4J7RA 3WKZA 2QMJA 1E6SM 3AZTA 5E0CA 1VJZA 3ZR5A 4CVUA 4AD2A 3T09A 5IXEA 4WKAA 2CXGA 2DSVA 1E5JA 4AIEA 4LPCA 3WQVA 2ZXBA 1UH4A 1XGZA 1IZJA 3MMUA 4DWSA 1L8NA 5E0FA 1GOMA 3QOMA 3VGGA 2OWCA 4HP5A 1HT6A 5A3HA 1C8QA 4H8UA 1VB9A 5CSUA 3VGEA 1A3HA 3SCTA 1CPUA 4V2XA 1W32A 3AXHA 4AD5A 2WXDM 3IJ7A 1GORA 1WPCA 1PIFA 3IJ8A 3DYMA 1AQ0A 3BAJA 1E72M 3RILA 3PZMA 3VDCA 4GQRA 3BSGA 1B2YA 1AVAA 2GSJA 1ZJBA 3WQ4A 1QI3A 1E15A 4HTYA 4M8UA 3L4YA 4GQQA 3DECA 3B9AA 3GXMA 1BHGA 1ZJAA 1OD0A 1NP0A 4JCLA 3RDKA 2WWDA 3FHQA 4JFWA 2W92A 5D8WA 2XYLA 4P8UA 1UQYA 3BAYA 2J7CA 2CCRA 1OGBA 1VRXA 5A2CA 2YBTA 4PTWA 3GXIA 5IDIA 3VOCA 5TD4A 3IANA 3M7SA 1C93A 3D3AA 2ZWYA 1WP6A 2HISA 4PTVA 2VX7A 4OBRA 2ZX7A 4MPKA 1B3WA 3HN3A 2VR5A 2YA1A 3VGBA 1CYGA 3POHA 1QVBA 4MB3A 1OWQA 4U33A 1VFFA 3PZ9A 3VIJA 4TOQA 2WCAA 4JHOA 1J12A 4A3YA 3OGSA 2VX5A 5D9NA 3QGVA 3L4XA 1XHGA 3POCA 2CIPA 3TP4A 1VF8A 3A47A 4PSRA 5KEZA 1JZ2A 3AIBA 4CGTA 3WQ5A 4FF5A 4QLJA 2VZSA 3AIVA 2WK2A 5GPRA 1EXPA 3AHZA 3PN8A 3VIGA 1OGGA 2VZTA 1B0IA 3MS8A 4LYQA 3PTMA 1VIWA 4U2ZA 4QAWA 4E8CA 1UG6A 4H8VA 1DWFM 5HNNA 1GQIA 1GUVA 2CKRA 2W66A 2OWWA 1H11A 3GDBA 3UR8A 2WZIA 3G6MA 4JZ5A 3DC0A 4R27A 3CZEA 1TVNA 2PBOA 4HOWA 1XSJA 2ZUMA 3CBWA 1B3XA 3PZIA 4AD4A 3BAWA 2VR4A 1MFVA 2ZOXA 3AMKA 1FOBA 3SUUA 2PWGA 5JUVA 1KB3A 1H3GA 4U5KA 2DSZA 2F8QA 3K8KA 1XV8A 2ZUNA 1GOQA 3VD5A 2YIHA 3KL0A 1L0PA 2A3BA 1UHVA 2AAAA 4ZE4A 2WVUA 1H5VA 3W6MA 4RL3A 4F79A 1NWSA 4GZIA 3TTSA 1F4HA 1JZ3A 4ATWA 1CLVA 2Y8VA 3PTQA 1LL4A 3WNLA 2GK1A 3SUWA 2J8FA 4HZ8A 2VRQA 1JNEA 3K46A 1R86A 3OA5A 4IUGA 3BAIA 3OG2A 1HL9A 3AHVA 4TTUA 1CGTA 1UKPA 3ARQA 4WKFA 3B9DA 2XVPA 3AIQA 1TR1A 2PC8A 4UFLA 1QI4A 3F5KA 4GO8A 2CBIA 4H8HA 2CNCA 3VUPA 2DGAA 1KWKA 1OM0A 1V6YA 4W87A 3T2OA 4D6DA 1MW0A 3AIEA 2E8YA 4MAVA 4MAZA 3L2LA 1UOKA 4AW7A 1E71M 1V08A 4M29A 4UQEA 3SCVA 3W82A 4ATDA 4WJXA 1JF6A 1JDAA 2QLYA 1J9YA 3WQ6A 3WQ8A 7CGTA 4MB5A 3IK2A 1JGIA 3OLGA 1I1WA 1EOKA 4GO9A 2WSKA 3VTRA 3ARZA 3W24A 2YL9A 1Q6GA 3RMEA 3CGTA 5HPCA 4PSPA 1CGXA 3AHXA 5D4YA 3DHPA 1W9XA 5LA1A 2ZIDA 2WCGA 4BQ4A 2WMGA 5LA0A 4L4PA 4EK7A 1FFRA 1J11A 2CHNA 4WSJA 3BH4A 4HU8A 1GW1A 1EDQA 1NARA 3GZAA 4HPHA 2IXUA 2A3AA 1DTUA 5A69A 3VIFA 5E09A 1J18A 4FK9A 4MTVA 4ACZB 1JIBA 1KR0A 1W3HA 4LX4A 4E8DA 2XVLA 2BFGA 4CCCA 4FLQA 1E4NA 3WD3A 5CZKA 1E6PA 3ARVA 4OKDA 5FIPA 4ZE5A 5BXTA 3PZQA 4CD4A 1QNRA 3OBAA 1W3LA 4M80A 3QR3A 3NYDA 5I6SA 1CXFA 4CCDA 3WD4A 5FCZA 1US3A 3VIMA 2OSWA 5HDRA 2XM1A 1PPIA 3LPPA 3L4TA 1FFQA 1QNSA 2CBVA 2J7BA 4GKLA 5DT5A 2FGZA 4AD0A 4ZEPA 3TTYA 1G5AA 1CDGA 2PBGA 2VC9A 2Q8XA 4W89A 4D6EA 2WHMA 4B9ZA 4W85A 1Q6CA 4HA3A 2B31A 4CKQA 1VBRA 5E6ZA 3CTTA 1JDDA 3WEMA 1UWUA 2WMIB 3K1DA 5GNXA 4Z2JA 4AWEA 2Z1KA 4C7GA 3GNRA 4W8LA 5DMYA 1XCWA 1TCMA 1UKQA 3VD4A 1UR2A 5C70A 5A8MA 4UZUA 3W38A 4BA0A 3IAQA 5HXMA 1HJQA 1EO7A 5DF0A 3VD7A 4CCEA 3W26A 5FL1A 2X05A 4HA4A 4Q22A 2CBJA 3WDPP 6A3HA 2XFYA 3AIRA 3AMLA 4W7WA 1J10A 3N9KA 1PJ9A 1ZS2A 2JF7A 1ZBCA 3VMNA 2GJRA 4MB1A 2YDRA 5ABFB 2OSYA 3ZJ7A 5A8NA 3PZVA 2DT2A 2V5CA 5CPTA 5A6MA 1FHLA 1UWRA 2GJPA 4JL2A 2D3NA 4UFMA 1B9ZA 1HJUA 3MMDA 2XVNA 2BY0A 5EBAA 1LJYA 3ARPA 2J74A 2VQUA 1GHRA 1V3LA 1G1YA 3CHFA 1ZB5A 3DYPA 3SURA 1DWGM 2J7GA 1BG9A 3AS2A 1A47A 2PI6A 2FH8A 1JL8A 3NUKA 5CXPA 4XV0A 2DEPA 2OSXA 3GH5A 1CIUA 4QLKA 5ABHA 3VD3A 4Z2IA 1QBAA 4J3TA 1KXHA 3WUEA 4WKHA 2WCSA 1HF6A 1IZKA 3SCUA 3G6LA 2J77A 1WDSA 4PEEA 1W9UA 3OIHA 4TVUA 4RE2A 3QHNA 3GNPA 2D0FA 2V38A 1J01A 1UKTA 1Q4NX 1UKSA 1ITCA 4BQ3A 5CGMA 2VT0A 1LWHA 2YL5A 4HMDA 3WBEA 2XTKA 4R5EA 4AZ6A 4JFVA 2E40A 4UQDA 3UERA 1NWUA 4WIWA 1W9BM 3W6LA 1GVYA 3MUZ1 1H1NA 2BXYA 3VIHA 3BC9A 2V3DA 4XB3A 1B90A 4PMUA 4AC1X 4W5UA 3OLIA 2J7FA 1MW2A 4CN6A 2J7EA 2GVYA 3T2QA 2BNJA 4H2CA 1LQ0A 3BSHA 1FP9A 4P7QA 1WDQA 3WUBA 5F7UA 1E4MM 1E40A 4ACZA 1UD4A 1VFOA 3O9NA 3WMSA 1HVXA 1UH3A 2DSUA 3A4XA 1Q6FA 1SMAA 1WDRA 4W7UA 4LGXA 1H2JA 4TVCA 4CUCA 3FN9A 3BAKA 4HMEA 2WC4A 2UY4A 1HKJA 4EANA 3WH6A 3AS3A 3MUY1 4PMNA 1EH9A 1WCGA 1W9VA 4GINA 4GPNA 4MADA 1UR1A 1NP2A 3K4AA 3VM5A 2O9OA 1WAWA 2D24A 3RJYA 2WBGA 3KZSA 4D6HA 1QW8A 1V0MA 5M17A 1B30A 1HIZA 3VGFA 1BTCA 2O9PA 1E55A 4IPLA 5A8PA 3N18A 1E9LA 2GJXB
chains in the Genus database with same CATH superfamily
2VFIA 1PKNA 3NM3A 5BYWA 4JTCA 3V7PA 3KRSA 4KWWA 5SWUA 5RUBA 2Y7GA 4KBXA 2P4VA 4GYFA 4MJ2A 3W01A 4C6NA 2VCBA 3IACA 3LUOA 1J5TA 2FFIA 1E3XA 3I7RA 3IV3A 3OJGA 1Q6OA 3C2FA 1FBAA 4A6GA 1LF1A 1IF2A 3VCNA 1CECA 2J25A 4NZCA 3HPZA 3WK1A 2I7GA 5E5CA 3V3WA 1MQQA 1S5MA 2WZHA 5AY7A 4W8AA 3KDNA 1O66A 4S2CA 5F4XA 4BZYA 4IJRA 4HMCA 4EACA 1LBMA 4N19A 3I6RA 4F0RA 3EA3A 2C1HA 2ISFA 1ICSA 1J0ZA 4JTSA 4ZPWR 3IRSA 4JN7A 2J9ZA 2KFWA 4XAPA 4LB3A 4AC7C 1I2NA 3DCPA 3ZLHA 3NXFA 1JNDA 4LCRA 3CPUA 4PMVA 2A3CA 4BS0A 1IXQA 1G0CA 2VZVA 3ITVA 4PUNA 4AYSA 2Z2BA 4UTWA 4E5TA 5I7GA 4JTGA 1L6SA 5CG7A 4GQGA 1XGDA 3NXLA 2WNWA 3DFTA 4MDOA 3MUIA 5EPDA 4NP7A 2UY3A 4U3CA 3WLOA 5E70A 3BXWA 4DWSC 1FKXA 4R33A 2FTPA 1V0NA 1SQ7A 4XTDA 4A8IA 3SY5A 3W87A 2NQ5A 3USBA 1ZL1A 3AXIA 3IKGA 2XH7A 5DQPA 4RPPA 3THQA 1BXCA 3L2MA 1LLOA 2FGBA 4JIEA 1Z7AA 2PTDA 1FY6A 3UZXA 1RBLA 5EA9A 4HGXA 3K4WA 1GYLA 1PWLA 3HGOA 4JYDA 3BAXA 4XBSA 4GXPA 4K36A 5I78A 3GG8A 4D6GA 5FF4A 3GE7A 5E1QA 5CAKA 1LRNA 3MVTA 3GC4A 3PS7A 3N1AA 2X30A 2OQLA 1E0VA 4TVDA 3UWQA 3SCRA 2ZTJA 3C5QA 4Z2KA 2GDUA 5FEZA 2R8WA 4XWUA 5C2CA 4GI4A 1YNQA 3MYOA 3P62A 1P6CA 3VA8A 1AG1O 3GR8A 3QTGA 1O1ZA 3MV11 3HOJA 1WDPA 1IV8A 3GVWA 4R34A 4ZXLA 3RHGA 2PA6A 3A4WA 2FZ9A 1C92A 5A6BD 1R9YA 4ZO7A 3E6EA 3HMCA 5CSRA 3SGZA 3RM8A 3W2JA 1X7FA 3NQ6A 1OB0A 3LTPA 2REQA 1OD8A 4QQUA 3UNTA 4UFHA 3M0ZA 2VX4A 3GHUA 3WLJA 5JVLA 2YZ5A 4GH3A 3CT7A 4O2TA 4MY1A 4FNUA 3WNNA 4EVZA 1MYRA 5GNZA 4H9YA 1VEOA 2PDCA 2O9RA 1B6CA 2DUXA 3NR0A 4RW5A 3AIWA 1CX9A 1UR0A 4AZ5A 3PJTA 3LSBA 1ZFJA 1N1AA 1F8AB 1W3KA 2HNHA 3T78A 4JHZA 1P43A 4P8XA 2P0OA 4PBGA 5F4WA 5AC5A 2PDBA 4JL1A 1GGOA 1VHNA 3UP8A 2ZDSA 5HPOA 4ODKA 2FPYA 3PBGA 3ZLFA 4HNTA 2QNEA 1A53A 2H90A 4K8GA 3VABA 2F21A 1GQLA 5DMMA 2GWNA 3CUZA 5C6MA 3NG3A 1OJXA 4XKYA 4LAMA 1CW2A 2V67A 4PTNA 1RJPA 3RO6A 4GYPA 3THDA 2XG9A 7ODCA 3KACA 2X0HA 5LA2A 1T0OA 5KTLA 4MUPA 1DIKA 3P84A 3R7MA 4BI7A 1SO6A 4XAKA 3CWHA 4D8AA 4N42A 2VFFA 3STFA 3S1UA 3O5EA 2X1TA 3WLRA 2YFNA 8A3HA 4X2PA 2DSKA 5MHBA 4XZHA 3TYCA 1S46A 2I5IA 5ABEA 3E0WA 4DJEA 2TODA 4HPXA 3N04A 1I9CB 1EPXA 3CGNA 1SJBA 2VGIA 2P0IA 2RKXA 3GHTA 1C29A 1TIMA 5JH8A 3CUFA 3NOEA 3B0UX 3C56A 3HV8A 5M5DA 1QCWA 3ZVIA 4R9OA 4AXKA 5DELA 3WQPA 3OYZA 3EX3A 2YB1A 4DRIA 4Z2LA 1JZ7A 4DJFC 3H2AA 4UNIA 1Q13A 1XRVA 1F05A 4ZFCA 3JW7A 4DZ2A 4LAWA 5DLCA 4MNKA 1IIGA 1JULA 1ALDA 4TXEA 1H4PA 4KGLA 4MSSA 1PV8A 3DFOA 5LGXA 3LHZA 2ZQTA 2POZA 2Q02A 2PWHA 1SR9A 4AZCA 4BQ5A 1AQFA 4JXCA 2X7VA 1IWBA 5E6YA 2QCEA 3QF0A 2VFGA 3M0JA 1K77A 1XLMA 4B5WA 1FRBA 3FYOA 2YBUA 2Z1XA 4PMQA 1D7IA 2CERA 2NV1A 4WRHA 1FDYA 2NT0A 4B90A 3MV01 1H63A 4JHMA 3OIXA 4A29A 1J4RA 4W9OA 2WWCA 3L4UA 3O5MA 3VGDA 1HN1A 4XX6A 3FJNA 1HXJA 2Y7EA 3NPUA 1QMLA 4HNNA 3JYJA 3SDOA 5F2IA 5HR6A 4WCJA 3B9OA 1KRBC 3M0IA 3F4NA 4KIRA 2D2JA 2JIWA 5H2ZA 2J4GA 4FOJA 3T07A 1SYTA 1B57A 3ALGA 3GXDA 1F7BA 1WZKA 3FGCB 4KF1A 3MVIA 3H4WA 2OTDA 3JVAA 3QW4B 2VDHA 2G41A 2PDYA 4ERAA 1GJWA 1CNVA 4M5PA 1JR1A 2DZUA 5A6KA 1DVJA 1RD5A 5REQB 2IPJA 3LCGA 1VIZA 2P50A 1JZ5A 4QITA 4ICNA 4LCSA 1WZLA 2VZOA 1GNXA 3KVKA 3OO2A 2AQOA 3OTRA 2YJQA 2H3DA 3TFCA 2PB1A 1M7JA 3O5JA 4MJZA 1GVQA 5L9FA 1JXKA 3S1GA 5A94A 2R1MA 1MVYA 4LF1A 2CFFA 2PUZA 4DUOA 2AGKA 2V2CA 4RE4A 4EAYA 3D0CA 2CZVA 3DKLA 1ROUA 2R24A 1EHNA 1TPH1 4PRTA 1S5WA 2QJJA 4N9DA 3ABSA 1FKJA 4OJYA 3GH7A 3G18A 4JTTA 4HOZA 4ZMGA 1HP5A 4FX7A 2QR6A 5A1AA 1CB7B 4L1WA 3O5DA 1SW3A 2DT1A 3VMPA 1P1XA 3NI6A 4J3UA 1Z44A 5EBUA 4RXGA 4FA3A 2YDSA 4GNJA 3M0XA 4WY0B 3OBKA 4CU7A 1TWWA 1AZ2A 2G3JA 3P82A 5K9CA 1DJIA 4AX6A 4W88A 1EHAA 4N0RA 2FIQA 3NPXA 4D1IA 2W6RA 4LNCA 2ZX6A 1W91A 4E2VA 2V2HA 3QN3A 2DT0A 3CAQA 3IUDA 4Y8EA 5D04C 5HJLA 3VD9A 1RCOB 3SIMA 3E96A 3NTPA 1OX4B 4DB7A 4G5DA 4AX7A 3B8VA 1UD5A 5TAOA 5IFPA 1I4NA 1OCQA 3TN4A 3WNKA 5HBFA 1OYAA 2WJFA 2GQ9A 3T2PA 2XIQA 1V3IA 2WZTA 3WUFA 4DYJA 1UD3A 1NWRA 3MSYA 5HUOA 4UR9A 1HO1A 4MYAA 1QTWA 2NQHA 3NQ2A 4PUKA 3WJXA 3TCEA 4GNKB 3ZO9A 1YW5A 4KRUA 1QHOA 3WSUA 1V02E 2WMJA 3AXKA 1QUMA 3QGAC 1JYVA 3O6AA 3CL7A 3WDJA 3APGA 4DROA 2ZUTA 3ARSA 3VXGA 5J04A 4UBPC 4B4HA 1F3WA 1BGGA 3GXPA 3U5YA 3ARWA 3OEXA 1FH8A 5M1TA 3N3TA 3N17A 4KIEA 4X0VA 2VI0A 2RFGA 2XIMA 5LXEA 1E4LA 3CHCA 2WZMA 3T40A 4N9BA 3C86A 3K8MA 1V6XA 1CTNA 3QTPA 1FWNA 2DZAA 1K3UA 5A8OA 4DI8A 3CV2A 3EY6A 1H0GA 2FZDA 4HZ6A 4XSMA 1HL8A 1XYZA 3FDGA 3I3BA 4UTIA 1NDZA 1JI1A 5AYIA 3VIIA 2BXZA 2NSOA 4PFHA 4A3HA 3QW3A 5XIMA 4JTKA 3GYEA 4GVIA 4Q4RA 2NX9A 2JALA 3AQUA 4DF0A 1EZ2A 1E1EA 4X9SA 5D75A 2Y61A 3ZYZA 3PZGA 3WBWA 4Z42C 1BKSA 1ME7A 3C2VA 3FSTA 2OZ3A 3U5UA 4YXGA 4WY0F 4DRJA 2PP1A 1TV4A 2KX9A 3MSDA 5AHNA 4V33A 1DJYA 1L2UA 4RZ5A 4D6IA 3VC5A 4B5XA 4G1NA 3BLLA 1NMVA 5HT1A 2BY2A 3VMOA 2ZRWA 4AU0A 2VKZG 4Q7BA 1FKKA 4WEVX 2DH3A 4XISA 5HWCA 1WYIA 2IPGA 3FA5A 3SZ8A 5IBXC 2DVXA 4IMFA 1NFBA 3W2LA 4MYXA 4Q4MA 1R9ZA 4HNCA 4DBSA 3WD2A 4EF8A 2WLZA 1FTXA 3NM1A 4QE4A 1GPFA 1Q2SA 2CZDA 1PWMA 2PV2A 4LXFA 1XISA 3CASA 3LD5A 3Q4DA 4F0SA 1Q1CA 3AIUA 3HFTA 1K70A 3EMZA 3RLUA 1SO4A 3GR4A 4PA8A 1S3HA 2Z6JA 3KVJA 2P88A 2VD8A 2X09A 3VGHA 3NZQA 3TOPA 1QO2A 1HQTA 5G2WA 4NKCA 1AMKA 2ABBA 5IHSA 2PTYA 4JKMA 2PDQA 2VNCA 4PTDA 4QRNA 2RAGA 4QJ1A 1XRTA 2PDIA 3T8QA 1FWDC 3W1UA 4YTRA 1XIBA 4LANA 2FDMA 4ZQRA 1YHTA 5U7SA 1FWJC 4ZTYA 4H41A 2GQAA 3NDOA 1BF2A 3IJIA 2J13A 2OZTA 3UXAA 4MUZA 2J8GA 3BJSA 4Q8WA 3OZOA 3W27A 1UR9A 3PC0A 3GBEA 1MEWA 5HW6A 3GDKA 5JH2A 1TUFA 4AEFA 4HHLA 3TXZA 1QI2A 3OQEA 2G4JA 4MWAB 2VOTA 4I6KA 4UQCA 4LUSB 1Q6DA 1NJJA 3P0WA 3LHWA 3BOXA 2XWEA 3DHUA 4RNJA 3A23A 2I5QA 2XSBA 5LNVA 2H6RA 1ZJIA 3TJIA 2AKMA 3MY9A 4OV4A 4I7WA 5D02A 3S83A 4PMDA 1DJHA 2QCDB 5IHRA 1NQKA 5FL0A 1XD0A 5I23A 3UQBA 2Y8KA 3GYCA 2J7DA 1E4IA 3I7QA 4OOUA 2QJGA 3GTYX 2KO7A 2Z29A 1QRQA 3VIKA 1O5KA 6CGTA 1KGXA 3MI2A 3NTYA 3ERPA 3SCQA 1CI1A 1EOMA 2Y70A 1M7XA 5CZTA 3B7XA 3H7UA 3CZJA 1QHZA 1UR3M 4JDYA 4PODA 2ACUA 2UZ9A 3KXQA 4UQ9A 2A3HA 1ZAJA 2G50A 1UOZA 3T08A 4JIHA 1H49A 1YBQA 1DIOA 2J6XA 2Z2UA 1TKKA 4XG1A 1EPVA 1VFLA 4Q4OA 3VFCA 1XKYA 2D23A 3NCOA 3QZEA 2PGRA 4LYRA 3LHYA 4L9YA 3UWZA 4RDYA 2WC7A 1HJWA 4GNVA 2QHAA 3ITYA 1CZ1A 3VKBA 1GJPA 3W84A 1WDWA 1PUDA 1AFSA 5CPNA 2PDPA 4IHCA 2J8TA 3U57A 4S3AA 1KTNA 4JTUA 3TYAA 5C8BB 2RUSA 1BF6A 5BCAA 4KS0A 5CCZA 2PLKA 4X0NA 2A5HA 3LHUA 5H6HA 2W79A 1ZPTA 4MY8A 2ZCGA 3CYJA 3ID7A 4TTGA 1RH9A 5I3DA 5M3WA 2XIIA 4B3LA 4UXDA 1I2QA 5KITA 4FX6M 1QDSA 1DBTA 2JGYA 1PIIA 3N13A 3RPDA 1XLKA 2BHYA 2YCEA 2OT1A 4NT0A 4HA1A 4E0CA 3CAKA 4W86A 3L21A 3TOYA 2VC7A 3MO4A 3LTSA 2E6FA 3N6HA 3UZ5A 2WHKA 2YXGA 4H7ZA 2O9TA 3NQAA 1D3CA 2DVTA 3H2NA 3SCNA 2QPUA 3FW6A 3IIXA 3PHAA 3ELFA 2PWDA 5HMDA 4ADUA 5A6LA 1S1RA 2V5DA 1J6OA 1FHVA 4UNLA 4UQAA 5HINA 4GGQA 5HWMA 1XBZA 5LYRA 4KW2A 3IIOA 3WDIA 4KEUA 3ZWTA 5CQ1A 1PZ2A 3WUGA 1OT2A 1WO2A 3VNLA 4LC8A 3VX1A 3B8WA 3NDYA 2PF0A 3P8JA 1WXJA 3D5HA 3UETA 1YTEA 5BXPA 1JCNA 1E3ZA 4XBKA 4AZHA 4YWSA 2HWGA 3TONA 2WJEA 4DZ3A 3C0SA 1FXPA 1KM3A 1E6RA 2JEQA 2ZUSA 2X0YA 3GNDA 1ISYA 2DPEA 1DOSA 6REQB 2PDWA 2A7RA 1GK8A 4OUEA 1IHIA 2ISSA 1GYNA 3A6OA 4KPLA 2PDJA 1TX2A 1XP3A 2IQ0A 4NNRA 2E6AA 1RJQA 1EJXC 4J28A 1LG1A 1TPEA 3GNNA 5T8GA 4ZODA 4Z1YA 2PDUA 3SM0A 3QY8A 4S3KA 3W1PA 1XLGA 4LWWA 2WC3A 1Z69A 1FKWA 3MKVA 3U4FA 2IXVA 3G24A 4CD6A 3KP1A 3BMVA 1V3JA 1EA0A 3GFYA 2YBVA 2GDVA 3GHRA 3ZJ8A 1QXLA 2NXGA 3VDAA 1FWTA 2E68A 2YYTA 2Z28A 3E2QA 4MWAC 4CEUC 1L6WA 3PWGA 2WPBA 1SPQA 5TQLA 3LMYA 4C65A 4CD7A 2OGJA 3H26A 4I9TA 5LIUX 1S2CA 1XLFA 4PUUA 3STCA 4Q8TA 5T26A 1MI3A 4ZXOA 3LCHA 3AMDA 3AHTA 1S1PA 1J96A 2WW5A 3LPFA 2WNZA 1UR4A 1LL6A 3O6YX 1Q7QA 3DFHA 2MLZA 1QOPA 4B9YA 5F4SA 4LV9A 1UC5A 2WZEA 3LM7A 4WDTA 3KFTA 2NT1A 1VC4A 3DG7A 4ICCX 2RUCA 2ZX5A 2JEPA 2GGHA 4IQCA 1G94A 3A24A 2KI3A 2QJHA 4QQ3A 1Z32X 2DJLA 1QBBA 1KXQA 3CB3A 4ZCWA 4HHPA 1KFEA 3VOJA 3MBDA 1KXTA 4IWWA 3T0AA 2BZNA 3VILA 3V75A 3M6YA 1VPYA 4MJ4A 4UQBA 3MMTA 4ORMA 2PODA 1UP3A 4GCXA 1P6WA 4DO6A 4WLCA 3ITXA 3UZWA 4B5VA 5BRQA 1EC9A 3L2IA 3W9ZA 3OGVA 4B5SA 3F4WA 1HZYA 1DQWA 4J7RA 1MMFA 2M08A 3B8TA 4WOZA 3AZTA 5E0CA 1KCXA 4CVUA 2J6VA 5D2WA 3U48A 4GJJA 4WKAA 2DSVA 3WQVA 5B80A 1U1JA 2FDSA 3V0SA 4LNYA 1UH4A 3MMUA 4DWSA 3MP4A 4L56A 3HQNA 1MZRA 2C6QA 2F23A 3K2GA 3RU6A 3G1DA 2O4MA 1HT6A 1L1PA 5I3GA 1C8QA 3W7MA 4AAJA 1ZK6A 1A5OC 3VGEA 2ZC1A 1TRIA 4K38A 3DG3A 4G2PA 1W32A 1EUNA 2CXEA 3IJ7A 3IJ8A 4DZIA 2IQDA 1AQ0A 3WH0A 1S2WA 3MCOA 3VDCA 4K8HA 3M5XA 4I90A 1AVAA 2GSJA 1B9BA 3OHMB 3WQ4A 1QI3A 4HTYA 1TSIA 2MUCA 1X97A 3EXRA 5DXYA 5IDZA 2BOGX 3B9AA 1ZJAA 3RDKA 4UTLA 2BDQA 2W92A 4C6JA 2CLLA 1A5NC 1AZ1A 2CCRA 3CWOX 2C14A 1OGBA 1VRXA 5GJPA 4HPNA 4PTWA 3NQ7A 3VOCA 2PN0A 3IANA 3M7SA 3GC2A 4L80A 1CLKA 3RF9A 2VDGA 3DENA 3HN3A 4NAFB 3FEMA 4DY1A 1QVBA 1OWQA 3RX4A 3V35A 1XIEA 1R3QA 2IQTA 2WCAA 1J12A 2PDFA 1X8FA 1U1UA 2Y63A 4QTGA 2FPTA 4BF9A 3A47A 4LUIA 5KEZA 3C2EA 1GVRA 3F4DA 4BI5A 2VZSA 5GPRA 3AHZA 3PN8A 1H61A 3M4HA 3WYZA 3TW9A 3MS8A 4FO4A 1VIWA 3W2MA 1KRAC 4H8VA 2IKJA 2PRMA 1GUVA 1T8XA 3GDBA 3O3RA 5D2XA 1C9HA 3DC0A 4R27A 3SB0A 1XYBA 1TVNA 3EOUA 4GIEA 3RYSA 4HOWA 4UIOA 4JIPA 1B3XA 3TC7A 4KWSA 4WQ6A 4AF0B 1QK2A 1XLJA 2ZOXA 1FOBA 3P74A 2E77A 1TWIA 4LS1A 1Z8AA 2PGFA 3K8KA 3ANYA 2GWGA 1RZMA 1GOQA 2QEZA 3VD5A 2AAAA 4Q6JA 4ZE4A 5AVNA 1GVEA 3M1ZA 4E2BA 5FEXA 3W6MA 3GO2A 1F4HA 5I98A 4ATWA 1CLVA 3KP0A 3GU0A 3GXTA 3WNLA 4LW7A 3FFSA 1RQEA 4J35A 4FXJA 2V5BA 3KRBA 3IIZA 3K46A 1LUCB 1R86A 3OA5A 4DZHA 4IUGA 3OG2A 1HL9A 3AHVA 3ES7A 3WJSA 3KCEA 3ARQA 1ZAHA 4LS0A 2ANUA 1TR1A 2PC8A 2YZRA 3WJYA 1QI4A 3UJSA 2QAFA 2NX3A 1KWKA 1EEXA 1V6YA 4G7EB 3P14A 3E0LA 4MAZA 2VEKA 3TQ0A 4WGXA 1V08A 4M29A 1EJTC 4PUMA 4ATDA 3WQ8A 2QCFA 2V69A 4IT1A 4B5NA 2KGJA 4MKNA 1EOKA 1MNSA 2WSKA 4DJFA 3CS2A 3H53A 3ARZA 4FHAA 4CEXC 2YL9A 1Q6GA 5C7HA 1IXPA 4DWDA 4PSPA 1R30A 1TPDA 3LBOA 3FX4A 3DHPA 4BQ4A 2FQIA 3S0CA 1J11A 2CHNA 2PFHA 4UTTC 4DF1A 3GZAA 2OFJA 1DTUA 4PUWA 3VIFA 4H6QA 3EX6A 1DXFA 2GPTA 2PEVA 4O14A 1N8FA 1KR0A 4E3VA 1M7PA 2IMRA 4E8DA 1NMWA 4FLQA 3A13A 3QZAA 1E4NA 1E6PA 3APTA 4ZE5A 4JS3A 5BXTA 3MDUA 3NNTA 4EF9A 1GEHA 4RXFA 4QX4A 3OBAA 2GJLA 3H22A 3QR3A 3NYDA 2ZQSA 4CCDA 1US3A 4GOAA 4GMEA 2DUZA 3ZVHA 4GUHA 2DW7A 2M2AA 2L2SA 4GC4A 5G2IA 5DT5A 4ZB0A 4GYKA 4GIRA 3TTYA 1SZNA 4H8NA 2POTA 4C1NB 4C6PA 2WHMA 1W26A 1IT8A 4HA3A 1TWDA 3U6WA 4CKQA 2DZWA 3BURA 1JDDA 3CTTA 1UWUA 3K1DA 4Z2JA 3NOYA 5AYXA 3O5KA 1AW2A 2HRWA 4QIUA 1TCMA 3VD4A 4I8DA 3H24A 2BP1A 5A8MA 2W9MA 1KD0A 2OO0A 4HZMA 3W1TA 3EB3A 2ZQ0A 1HJQA 4O4WA 5DF0A 3VD7A 5LNUA 3W26A 4PZVA 2X05A 1CT5A 4Q22A 5I3KA 6A3HA 4JICA 1LDCA 4TYOA 1UP2A 3IJLA 1PJ9A 3O5LA 2JF7A 3OP2A 3VMNA 4MB1A 3NZPA 3MKCA 4M6PA 4IG2A 4ZGYA 5A8NA 1O68A 1E1CA 1HJUA 1IR2A 4JFJA 3HM7A 3CV7A 4US6A 4JTHA 2OMAA 1GHRA 1JQVA 1JVNA 3CHFA 2GJNA 2XZ7A 2J7GA 3AS2A 2PI6A 2XU2A 1XCFA 2FH8A 1JL8A 4XV0A 4L6OA 3GH5A 4AVFA 1CIUA 3URBA 3B8IA 4XAYA 3VD3A 1QBAA 4J3TA 2C13A 4TV6A 2D73A 3AALA 3FKRA 3LRKA 1HF6A 3N29A 5HQLA 4O52A 3TMQA 1OFQA 1A0EA 1W9UA 3OIHA 5BNKA 2HE5A 4TVUA 4A2RA 1YX1A 2QDHA 2X40A 1XBXA 3EOOA 4H00A 1J01A 1UKTA 1EF2A 1Q4NX 1MRAA 3UF8A 2VT0A 1H1ZA 4OQVA 3UY7A 3KBMA 2I14A 4R5EA 4AZ6A 4KFNA 2E1WA 3GTXA 2XN1A 4JFVA 2E40A 3TCSA 3QFWA 3UERA 1R2SA 1NWUA 1W9BM 4Z1CA 3W6LA 2MNTA 2VFDA 1KM6A 2BXYA 3O63A 1XIJA 3KDOA 1QK0A 4GK8A 1B90A 4W5UA 1DHPA 1OK4A 3RR1A 3EEZA 3OLIA 2J7FA 3RMJA 4R3UA 2GQ8A 3LS9A 3WLIA 4DZ5A 1SSDA 3MZNA 4H2CA 3DGRA 1X98A 3PULA 1PBKA 3BSHA 4P7QA 1FAPA 1OF8A 5LIKX 1NELA 3BZJA 5F7UA 3O5IA 1RCXB 2G97A 4K8EA 5CBIA 2KR7A 4RCXA 2X16A 2OGYA 4R9XA 1E40A 4ZS6A 5XINA 5AZ0A 3IVSA 3FDKA 1MUMA 3A4XA 1Q6FA 2HV5A 4TVCA 4AMAA 2CLOA 3FN9A 3BAKA 2J9YA 1HKJA 5AHLA 3QRHA 2ATMA 2NWSA 2PDHA 3MI3A 2RDXA 3WK3A 3JXVA 1OYCA 3L66A 3PSWA 3KZSA 1XYMA 3LNPA 2WQPA 3EOSA 1A3XA 2REQB 2NVDA 3R0KA 3BCJA 4CNPA 4U85A 3VAVA 3VZYA 2NQJA 1FWGC 1E55A 1MO0A 5A8PA 3E0VA 1YDNA 1BL4A 1VEMA 3PB2A 2WMIA 2V3EA 5DCDA 5DCEA 4KWVA 4QHRA 1EGVA 4C6OA 5HATA 3WH8A 2GLKA 3R6IA 9RUBA 3D47A 3S9ZA 1Q85A 2CLFA 2FH6A 3QPZA 2Z4GA 2D2OA 1F07A 4PCNA 1GZJA 1X1NA 3WY1A 4DH0A 1XC4A 4FNSA 4JQ3A 3WF1A 1KM1A 2W27A 2VN1A 2JBMA 3TDFA 2Y24A 5ABFA 2Z1SA 1X39A 3A21A 4XKYB 4QAIA 9XIAA 2P10A 1CXHA 2ZRXA 5JU6A 5C7VA 5CLTA 4IIHA 5CPOA 2EG8A 3STEA 4PBFA 3APYA 2PD5A 4IZGA 5FOOA 2ZYFA 4IIDA 5I0DA 1EBGA 1KFLA 5IBXA 3JYMA 1EP2A 4FSAA 2YW3A 3SQLA 1Z42A 1P0NA 4BWLC 1JPDX 1DV7A 4H6EA 3GTNA 3B9EA 5K7JA 2Y1HA 4D6FA 4ATLA 3MQTA 1B4EA 1GCYA 1ZALA 3ATZA 1XF0A 3SSZA 4M3PA 3PUOA 1SZFA 2J79A 2B7NA 2A21A 3O07A 3FNDA 4ZOCA 1O1HA 3DFNA 5A2BA 4KEMA 4U5IA 4Z17A 2YL6A 4LQ1A 1UWSA 5HNUA 5HMSA 3TMLA 1J0JA 1TMLA 2V5KA 2QJMA 1ODUA 2ZVRA 5D8ZA 2XM2A 2XUCA 3IHZA 1LLZA 3V4BA 4NI8A 1AW5A 2ZUVA 3CV6A 3TWBA 2D0HA 1W9PA 4TU1A 3AAMA 3BPWA 2Z00A 5F2GA 3TN5A 3NA8A 1Y0OA 4L7ZA 1KM2A 1VRDA 1X38A 2ACSA 1GOIA 4AZCB 1LBLA 1KFCA 1KBBA 1OZMA 3SJNA 2ZZ6A 1T7LA 1DJZA 1VBJA 1XWYA 1TRDA 4LC6A 3H12A 1K8CA 2E09A 3W1XA 4TQTA 3CEPA 1W0MA 3ICJA 1UROA 3MSGA 3I3EA 1K7XA 1HW6A 5EY5A 4D8ZA 1KLYA 1V7YA 1SJCA 3KBVA 4FX8A 1AW1A 2OEJA 3KAFA 1C3FA 4GYJA 3CK5A 3HO8A 4GI6A 5L6UA 3UGVA 1KC7A 5C0QA 3LN3A 1E9YB 3S42A 4GABA 3CM4A 2EAWA 2OG9A 4FXSA 4E4PA 1JFHA 3UZYA 5LIXX 3PF3A 2EO7A 1D7JA 2ZX8A 3WMBA 4YYCA 1MXGA 4G6CA 2Y8UA 3T0CA 4W8BA 5BWFA 2IKGA 1J93A 3P5YA 3NPVA 3MB9A 2PD9A 3JZUA 2JE8A 1XDJA 1EEPA 3OLEA 4WUIA 1FHUA 2W91A 3RGCA 3OW1A 3WEOA 1XJBA 3CH9A 2Y7FA 4DI9A 3E2VA 2CPUA 3M07A 3H4GA 4HJFA 3P93A 6XIAA 1G7UA 5ABGA 2ZVIA 4O1EA 2XP7A 4AZBA 2Y5EA 4ERIA 4G50A 1DWAM 3EDEA 3N4FA 3GLCA 2PDNA 1XYCA 3AZRA 3SO7A 2F9RA 1U79A 5G4EA 2GVJA 2IF4A 5HMEA 2AL1A 1J2WA 3KL5A 3HJEA 1FUYA 2OWXA 3V36A 1YXCA 4MJMA 1QPKA 2BGNE 1TPVA 5AHIA 3U2CA 4LUTA 2ZKMX 4FLSA 4NY2A 2Z6IA 2UV8G 2WB5A 7REQA 3NURA 4IMAA 3HV9A 3E5PA 3S1VA 3ARXA 3VIPA 2VYOA 3K1GA 1E6ZA 1GYMA 4H7VA 2WJDA 1MXDA 5D2VA 5H8PA 4YVVA 3QV6A 1UPPA 5DN1A 1VLIA 1M9HA 2DFAA 1TTIA 4Y90A 4HU0A 2F38A 3L4WA 1UWIA 4ALDA 3VPLA 5BRPA 2P76A 4E3TA 1EDTA 1LCOA 4XVDA 1YMYA 2PURA 5EMLA 3ARTA 4WZHA 1N8IA 4DXVA 1CXLA 1GOOA 3LDVA 1EIBA 1O95A 1AK5A 3WD1A 3LLXA 4LVFA 3MU7A 4LV4A 5BMWA 2AMGA 4CU8A 2OZ0A 1FKIA 1K9EA 1HKIA 1XH1A 3C2OA 4W84A 4HBEA 1UZHA 1W54A 4GZEA 4L61A 1VHCA 4U2YA 3UJRA 2PCQA 3MHUA 4UOJA 4JQ1A 4NJJA 3SRKA 3VX0A 4L9ZA 4PC8A 4B3KA 4DBWA 4DJEC 1VCVA 1GJUA 2Z25A 3W7LA 1YATA 1OSEA 1ZLPA 2VM8A 1NIUA 3AS0A 3ARRA 5CH9A 3NGJA 4Z2HA 3VDHA 1TPWA 3WMLA 2ALRA 3WDQA 1BG4A 3KZPA 1BYAA 4GE8A 1Q6LA 1MWOA 3S5NA 4Q8OA 1DIEA 4YS1A 2ZICA 4MOZA 3M6DA 1VCGA 3LXBA 4MKVA 4IMGA 4HB7A 4L64A 3TUUA 1IT7A 1ZGDA 4GY0A 3ME3A 4JFKA 3W85A 4HYVA 3LHTA 3ZT7A 2YA0A 3VNIA 1RP8A 1NWTA 3RLVA 3BSMA 3PZUA 3BGGA 3DUGA 1DIDA 3EA1A 3NQGA 4GWEA 4TW6A 1XLEA 4N02A 1TA3A 3R25A 3H21A 2LPVA 3S2LA 1WKDA 4O50A 4ZENA 4DNMA 2E4TA 4F2BA 1KV5A 1BPLB 1ZU8A 4HKPA 3TQVA 4PCFA 3MCNA 3FAWA 1K9TA 4Y7EA 2C0HA 1VYPX 4O19A 1RVKA 4C6KA 2GVLA 4N9EA 3CUXA 5D09A 3QQ1A 4GI9A 4KCTA 2X2GA 1VJIA 3WNMA 3I6EA 4O4VA 1IEXA 4Z08A 2IKIA 1QPLA 1Q8JA 3W7OA 2CBUA 4LSBA 5B7ZA 5EFDA 3ZSTA 1PCKA 2ZRZA 3ZQ9A 3C8NA 1KM0A 5D9PA 1KTBA 1W1YA 2ZC8A 5A8QA 3A3XA 3M47A 4XZBA 2FTYA 2QGYA 5AYZA 1C91A 1K8YA 4I5UA 5CC7A 5CGTA 3EMCA 2ZR6A 4PUEA 3E74A 1TUXA 1XYFA 3HTWA 1TTJA 3O5OA 4RZ6A 2G0WA 4H1ZA 3AZSA 1ZQ5A 1KGWA 1CB2A 2XFFA 3A64A 1DWHM 1JUBA 4WF7A 1O94A 2VJXA 4F9DA 2IUZA 4RZ4A 4F0KA 4K7YA 5EFFA 2X41A 3VU2A 1MSSA 1C7SA 5T9CE 4J2MA 3EDFA 1HVQA 3I6CA 3WH5A 4GVGA 3ZMRA 5BOOA 3LYEA 5K4ZA 1A5KC 2QQ6A 3K5XA 4IM4A 1XPGA 3PRAA 2XIBA 1PIGA 1UBPC 2YCIX 1CXKA 1I60A 4WVXA 4C91A 2EKCA 2YLAA 1RY0A 4P5UA 1QNQA 3W25A 1AD1A 4NYYA 3R0DA 3W88A 4AZ7A 5CC6A 3RFAA 4QCFA 4IP4A 4Y2WA 3VKCA 2AGTA 4DWSD 1RY8A 3CZKA 1BAGA 3UWVA 4QJ4B 4CNNA 4HK5A 2JZVA 3QR1A 1EJWC 2ZZ5A 1YIXA 3EGJA 5E9XA 2FJKA 2B5UB 2OLHA 3OPSA 2V8ZA 1PINA 3TYUA 2V9DA 4NZ5A 3TKFA 1M1BA 3G3DA 5JQ9A 1FH7A 3WENA 1RXOB 1F8IA 3KOXA 4V15A 3LPOA 2R1NA 3SCPA 3XIMA 2I9UA 2EQDA 3S47A 2QUNA 3UQIA 1ESWA 2W0UA 5I24A 3QEZA 3RO8A 1QWGA 1FKTA 1JGMA 2CWXA 3BMWA 1EJSC 2XSAA 3DKJA 4R88A 1GVIA 1XQKA 3ISIX 2WSQA 5FI8A 1MEHA 1BTMA 4D9PA 2QXWA 1SGJA 1TJ2A 3XISA 2ZUUA 4IPJA 4BF5A 2DZPA 3M43A 1KFJA 3SW6A 2WSPA 2ADAA 2V3FA 5JBFA 2PDXA 4LAYA 3KHJA 3TJXA 2Y89A 3SCOA 3F5JA 1FCBA 1U33A 1U2YA 1XLAA 2XZ9A 1YBQB 2CC0A 4ML9A 1B3VA 4JIIX 3WDRA 2TMDA 2ESCA 4OBSA 1TJPA 4P7OA 1PTAA 3TXVA 1E6NA 4X9YA 5BW6A 3VFLA 4ADTA 1UA7A 3W1RA 4IGNA 2E9MA 3AOFA 3CQHA 3VDBA 5FJOA 3SFKA 2X2YA 3FLUA 1X96A 3VOIA 2J75A 1DWIM 2W61A 4X3ZA 1R46A 4A3QA 1OFOA 1D6OA 2WMFA 1M7OA 1MDLA 1SJDA 1I8JA 4C6FA 3DYOA 1JYWA 1FWEC 3MWCA 5TIMA 4PR4A 1PS9A 4O8AA 3N12A 1DPMA 3PWIA 4XZMX 1R3VA 4TO8A 2YCLA 3CV1A 4E2DA 1E1FA 3AYVA 4S2BA 3ZFHA 4UMAA 2O92A 3VINA 1ECEA 4N7QA 3QC0A 4IL2A 3NSNA 3F7JA 1P0KA 2XVGA 2A79A 1WXZA 3VAWA 1TTQA 2HS6A 2CLMA 3MP5A 2QCHA 3UZJA 4J27A 4PULA 3P0XA 3I7SA 1X1ZA 4UCFA 1WKYA 4NG3A 4CNTA 3GVRA 1IEWA 3W71A 1VENA 5I3FA 1QI5A 2WVSA 5EMKA 4JTFA 3NZGA 2WM0A 3WNOA 3IV8A 3L65A 4CN1A 3W53A 3N6QA 1JPKA 3REQA 2BX7A 3DFQA 3FIGA 1FP8A 4GD0A 4NNAA 3WH7A 1YEYA 4H9TA 3EA2A 3U4AA 4IXXA 3CMJA 3N4EA 4FLRA 5TF0A 1NF7A 1A7XA 3QV9A 1YPIA 4EOUA 1WE5A 1LWJA 1PX8A 2ZRUA 4RLIA 5G4WA 3L12A 1MZHA 2AL2A 4G7FA 3W1LA 3UCQA 4FNTA 1V3MA 2Z1BA 1W1IE 4HU4A 3TA6A 5H8UA 1HNYA 3BLIA 4FI4A 4IGMA 1PXGA 4A4AA 5K4XA 3RCNA 1H41A 1TB3A 3EOLA 1KR1A 2D1ZA 4O57A 2G3FA 2ZZ7A 4J4NA 3BLPX 1Q6EA 2WVVA 3NAVA 2CZ5A 5J5DA 3KL3A 2QUMA 1XBYA 2VEFA 5D30A 1EFZA 3B8SA 2OCZA 1G4EA 3VE9A 1PHQA 2BV9A 4NL1A 1FKHA 4JEQA 4OVXA 3N2CA 2EPOA 4PTMA 3EDDA 4GXWA 1K9FA 3GXFA 4NQ1A 1OEPA 1PX4A 4GRSA 4LTSA 4F66A 1KBJA 5JIWA 4H7CA 4Y9OA 3IVUA 1OX5A 2QVHA 1MQRA 2PE4A 1PE1A 1NSGA 4H3DA 1DQUA 1IE7C 1Z41A 1WOBA 3RX3A 1EP1A 3H70A 1YKWA 4YL2A 3A3HA 1RLCL 3DBPA 4B15A 4C6IA 4CU6A 2ZZ4A 3TVAA 3EAUA 4IF2A 2FGLA 1EO5A 5BRBA 1WXYA 3XINA 2Q3OA 4RV3A 3PRBA 4GIAA 4M7SA 5KZ6A 2OOFA 3N34A 1Q63A 3QPYA 2LKNA 4DRHA 4FLOA 4UFKA 4RJEA 3CPGA 1UKOA 1B3YA 1G6CA 3C52A 4BQ2A 1ONWA 3WL1A 3UPBA 5C71A 1W5NA 5DXXA 2O7QA 4BCEA 3W6YA 2EKGA 4FEZA 2HMCA 4QR6A 4I6VA 1Q2RA 4I9JA 1OGSA 2WM1A 1FD9A 1Y65A 3PP7A 1MRQA 3F03K 1OIFA 4H9XA 1EB3A 3H4XA 4EE9A 3QR0A 3MJYA 1SO5A 3EX4A 1TYGA 3AI0A 4JQ2A 1KWGA 4M6QA 7TAAA 4D72A 4F8XA 1D8WA 4UTHA 1JD7A 3WLMA 1SSGA 3PZNA 4S38A 4A3RA 3QOKA 3CHEA 2F2KA 2EULA 2OYMA 4KWUA 3ZIZA 5FD0A 5GNYA 1DJXA 4JD4A 1KA9F 1M04A 5HNTA 1HJVA 3E2SA 4M1BA 1H62A 4CN4A 2W5FA 2CZEA 4QDPA 3I10A 1QASA 3HQOA 4A8RA 2YDAA 1OT1A 2VGFA 2WSYA 1PYFA 4DWSB 4M7TA 1M5WA 4AZGA 4L1XA 3V5CA 3NIYA 4JFIA 1ZSXA 2GGIA 3QLLA 3BLKA 1XC6A 2RQSA 3QVQA 3O16A 4IQ2A 2BTMA 2V2DA 4DQWA 3WLQA 1A3WA 4W93A 4ZTXA 2PCEA 5FF3A 3ZR6A 1O7AA 4JFTA 3UY8A 1LROA 1EXBA 3BZGA 1RA0A 2G8ZA 3P60A 1GKRA 4DM2A 1F3EA 2FMNA 2PP0A 4IP5A 2YW4A 1ZAIA 2X1RA 1LP6A 2E3ZA 4KGJA 4Y9PA 4W5ZA 1BEUA 2J66A 4HSHA 1IXOA 2INFA 1W17A 6TAAA 3N6JA 4HU3A 4AZIA 3AMGA 3MDWA 3NQFA 3ARUA 1I45A 3SEPA 1TPFA 5H1WA 3K8LA 2AKZA 7A3HA 5XIAA 4N4PA 2WSRA 1S5TA 3FA4A 1IEQA 3BDKA 4OZOA 4ZSTA 4IFOA 2YA2A 3S6TA 1XLBA 3BLOA 3TWAA 1PCWA 4DIAA 3PUGA 1RAKA 3NL3A 3RR4A 3WLHA 2QUUA 4EAMA 3KABA 1ZBKA 1H1YA 1R3SA 1BYDA 2V63A 2EJ1A 1C8VA 4XO6A 1TZ7A 1OG6A 1M5YA 3CEUA 3PAJA 2XINA 4GCAA 8XIAA 4NZJA 2BVDA 2E67A 3AYRA 1G4SA 1O12A 2WBKA 2AQVA 3WLTA 4JN8A 4EPKA 1A0DA 4FOKA 4GC3A 1R7OA 1H7PA 4Q7NA 3GNXA 4J1OA 1VD6A 4NRRA 1O6IA 3TLLA 3NQVA 2BHUA 5EU9A 3R8GA 5JBEA 4R7OA 2VZUA 5EYWA 3TCZA 3RPTA 1WNOA 1JCYA 4PEKA 4W9QA 4DAFA 3NL5A 3GPKA 2NXHA 1OK6A 3MHFA 4R7WA 3OOQA 1SVDA 3URAA 3AHYA 5EB8A 4MZ8A 4EXBA 1XG4A 4NJKA 1SJAA 4DT4A 2W63A 4L4OA 2XFRA 3WDHA 1SU5A 5KZDA 3FOKA 4YHGA 2GUUA 4ZQMA 2Z7KA 3FJLA 1N2VA 3RM9A 2EPLX 3G1VA 3WFZA 4JTAA 2NUYA 3O5RA 1G9HA 2Q71A 4YLWA 3P2VA 4LH8A 2H9AA 3B05A 1E5NA 2RGLA 3S1XA 1GOWA 4Q8PA 4BWLA 4ZB5A 4K6AA 1NTHA 1ADSA 3KAOA 3TYBA 4W9TA 4OIFA 1F40A 4ODOA 4DO5A 1WUEA 1SFTA 1E6SM 4QE1A 4HJWA 4AD2A 4FXFA 2CXGA 3Q94A 3H8AA 2PPOA 4AIEA 5DO2A 3PK7A 2XH2A 1R0MA 3S3GA 4Q4QA 1V6TA 3C61A 1L8NA 5E0FA 4HP5A 1VB9A 5CSUA 1K8ZA 1NU5A 6TIMA 3UPMA 1CPUA 4V2XA 2F84A 1XLLA 2CLEA 3UVAA 1R2RA 2X7WA 1A50A 4K1WA 3MW7A 3BAJA 1E72M 3LI1A 4YVXA 3BSGA 4C6EA 3MSRA 2HSAA 1MXSA 4MF4A 2J24A 4M8UA 1QR7A 3N14A 4ONVA 3FK4A 4L4LA 2PRHA 1QT1A 3GXMA 2XP5A 3BJTA 3EWDA 3FHQA 2VCDA 1FWAC 4KRZA 3CNYA 1QW7A 2NUXA 3W7EA 2J7CA 4GHRA 5A2CA 2YBTA 3GXIA 4NX5A 3JU2A 4QBXA 1WP6A 2INEA 3EWWA 3HF3A 3KBJA 3ZVHB 4O10A 1FWHC 4MPKA 4DRPA 5T91A 2CHRA 3VGBA 1W1A1 3POHA 3T4CA 4K1GA 3STGA 1VFFA 3LZ5A 3TQPA 3WJWA 3VIJA 1XG3A 5D9NA 3QGVA 3HIJA 2NX1A 4XAZA 4XBJA 1VF8A 3WQ5A 4QLJA 1Q7ZA 4Q8QA 4E38A 1FKDA 4NJIA 3OQ8A 2VZTA 1B0IA 4LYQA 1AA1B 3LGGA 4U2ZA 1JVWA 4QAWA 4E8CA 2W66A 2CKRA 4AHOA 3BUVA 3UR8A 2WZIA 1XS2A 4IX0A 3G6MA 1XIFA 1MUCA 4OWGA 3DG6A 2ZUMA 4IG2B 2A2IA 3PZIA 4AD4A 4RNIA 2RH9A 4JIQA 1MFVA 1E1CB 1JCLA 3QQ0A 5JUVA 4PE8A 1BKHA 1H3GA 1T41A 4U5KA 3A22A 1A80A 4AUBA 1TMHA 4J9JA 3R13A 1Q5MA 2A3BA 5LZLA 3N2TA 3MPGA 4AWUA 1X8CA 4RL3A 4F79A 1NWSA 3IWPA 3TTSA 1I6NA 5HJXA 1A4MA 2Y8VA 3PTQA 1LL4A 1Q65A 2GK1A 4IICA 4YNGA 2VC5A 3CL8A 1T99A 2VRQA 3TZFA 1OY0A 1YDVA 1AODA 4TTUA 1L9WA 1PDYA 2F6XA 2I56A 3BL3A 1UKPA 3BOLA 4WKFA 2KE0A 2XVPA 1WDDA 8TIMA 3IUHA 4GO8A 2CBIA 3GK0A 4WXYA 4C1KA 4QISA 3B97A 4EXQA 3VUPA 2A0NA 3M44A 4LAVA 3RFWA 2Y5SA 5HKGA 4JR5A 5HULA 4W87A 1MW0A 3BV4A 4GIVA 5HA7A 1E71M 6PTDA 4L72B 4WJXA 2QLYA 4MKSA 5DMLA 3CH0A 3KWSA 4L1GA 1I1WA 3B9NA 1P4CA 3VTRA 9XIMA 2VUNA 3RMEA 3HFYA 3L0GA 1QPOA 2C79A 5FJRA 2VEGA 1EWEA 1Z9AA 5I00A 2PGWA 5FF0A 3UPWA 2XP9A 5D4YA 1TCDA 2ISDA 1FX6A 1W9XA 5LA0A 2EG6A 3DFSA 4EK7A 5FJIA 4N6FA 3NYZA 1GW1A 3IRDA 1JEZA 1KBLA 2A3AA 1GVFA 1J18A 1TJRA 1ML1A 4FK9A 3CB8A 4MTVA 3S5OA 1JIBA 1W3HA 1YXDA 4CCCA 1WKFA 3UXIA 1RJRA 1YTDA 2QJIA 3WD3A 3PNUA 3L5LA 3ARVA 2I17A 4OKDA 3SN4A 4AWTA 3IGSA 3W7JA 3AWNA 5AYYA 1P1MA 5CAHA 3W7KA 5AHEA 3NZ1A 4DX3A 3WD4A 5FCZA 3E0FA 3UJEA 1W8SA 3L4TA 2YCJA 1FFQA 1RV8A 2VOMA 2CBVA 3C2RA 4KWOA 3UU0A 1Q7MA 4GKLA 3QMSA 4NNBA 4ZEPA 4UTMA 1G5AA 2VC9A 2Q8XA 2HTMA 4H9UA 3GVQA 1AUSL 3TC5A 4S39A 3KLLA 3KS6A 3P5ZA 3IKDA 3W7DA 2WMIB 5GNXA 4N4QA 4AIBA 4C7GA 1NDWA 1NAL1 2C16A 2A7PA 3VKAA 4E6MA 3CWNA 5C70A 4UZUA 3W38A 4IIEA 1NVMA 4BA0A 2PZ0A 7ENLA 1U22A 2DZBA 2WNNA 3WDPP 3AMLA 1BXBA 1YADA 3N9KA 3W2KA 1ZS2A 1ZBCA 1LM1A 2BG5A 3FKKA 3R12A 4LJ3A 4LY8A 1HTIA 5ABFB 4MWAD 3PZVA 3WQFA 5CPTA 3UNDA 2FKEA 3W22A 1UWRA 2GJPA 4JL2A 2D3NA 1DKWA 2Z7GA 3KVMA 3MMDA 4LVAA 1NFPA 2I1OA 1JRBA 1XW8A 5EBAA 1LJYA 4B91A 3QC3A 3QY6A 4C6DA 3NWRA 4ECLA 3ARPA 3WBXA 2J74A 2VQUA 3Q67A 5HMFA 1ZB5A 3DYPA 4OFCA 3FS2A 4Y9MA 2VHLA 4F2TA 4WDUA 1W5QA 2BODX 2DEPA 5ABHA 1R38A 4E4UA 3M9YA 3KAGA 3WUEA 1EBHA 4D8LA 4N6EA 4XUGA 3NO1A 3SCUA 4LUJA 5HWBA 3M0KA 3LCWA 1WDSA 4HCDA 4A8NA 3P67A 5AFDA 4RE2A 3H2MA 3AUOA 3GNPA 4JTEA 4LALA 2D0FA 3UF9A 3UW6A 2WOQA 4XSLA 4AY8A 4C6QA 3QY7A 1YPXA 1LWHA 2YL5A 1EJUC 3WBEA 2TRSA 4UQDA 1XM3A 1TPB1 3SN0A 1Y5WA 3QLDA 1GVYA 1H1NA 3BC9A 4AC1X 4DVOA 4CN6A 4ZOAA 4IPPA 2GVYA 3L67A 1LQ0A 2B4GA 4OGZA 3UFYA 4QEEA 5G1YA 4LAXA 4ZQCA 1LZOA 5ENLA 1E4MM 5CBBA 4ACZA 1UD4A 2X42A 4XQ6A 1GG1A 4LEFA 3KOZA 3WMSA 4LAOA 2DSUA 2NZLA 4UCGA 1SMAA 1WDRA 3E2RA 2BXVA 2WC4A 2UY4A 1OX6A 4EANA 3WH6A 1VPQA 2NUWA 4GINA 5FSEC 3K4AA 5BMXA 1Q6HA 2WBGA 4D6HA 3QFEA 1QW8A 4DNHA 1Q6IA 1V0MA 4IL0A 1OC7A 5M17A 3VGFA 4XKMA 1BTCA 2O9PA 1ZP3A 2V0TA 1FQ0A 1XUUA 1ICQA 3VVGA 3S46A 2JIEA 3UVIA 4DUXA 5EMYA 4HD5A 3NEHA 1ZJHA 3EPNA 1LQ2A 1NDVA 3ZXWA 3UESA 3VKDA 3B0PA 4H9MA 3H54A 1HFBA 1BQCA 2F6KA 3AISA 3JR2A 1HKKA 3UI4A 2VX6A 1Z6KA 1XH2A 4A2SA 3FAXA 2DUAA 1SR0A 2GGJA 5M03A 2FTWA 1K02A 1OABA 3QSTA 2EJAA 4O0QA 4ZL1A 2WQDA 1R3TA 5D2YA 3U2ZA 3G22A 3THUA 1KNWA 4PMYA 2F2DA 3DERA 4NU7A 4LAUA 4Z1BA 4JTDA 4I5XA 5JXQA 4C6BA 2FHBA 1EQPA 3TJ4A 1VP5A 5JMUA 2XPAA 1DJNA 1QNPA 3OOBA 1MW3A 2OX4A 4LAKA 1WX0A 4DUVA 2EPKX 4RE3A 4LUTB 3QSRA 3G0SA 4DZAA 3TQKA 4ZOBA 2W67A 7REQB 3CQJA 2DG9A 1VFSA 2PZNA 1E9IA 2ACRA 2PBCA 1TMQA 1FHDA 3C6CA 3RGTA 3W23A 1E6XM 2YSWA 1DEDA 1Y8BA 2ATSA 3A9IA 4DJDC 2VL4A 3EKLA 1WOAA 3SJ3A 5MF5A 2BHZA 1LBFA 3AC0A 4MNJA 2OYLA 4HSNA 2ZA2A 2QJNA 3NVTA 1NOFA 1I2PA 4YPJA 1DE5A 4D6CA 2E25A 3H7VA 4MY9A 3N3MA 1D7FA 3SQSA 1DQXA 4JYEA 1JD9A 3NDZA 5H8MA 1MEIA 3T05A 1ZY9A 4O1AA 3WF3A 1SZRA 5I3IA 4YTSA 1TV8A 1JAKA 3KX6A 4WX2A 5I5RA 1UD2A 4QT3A 3C8FA 5HW7A 3B8UA 1O60A 3VM7A 2YXXA 2XH4A 3UWYA 4Y9NA 2JF6A 3SRDA 1XUZA 2P3ZA 4YCPA 5CSSA 2ODOA 4HK7A 2RDTA 1V79A 3OG3A 3HA1A 2PTWA 2VFEA 2K8IA 4QDMA 2GOUA 4Q8VA 1MFUA 2DIKA 4JYFA 4LAZA 1SM9A 1LLWA 5CJ5A 4N9CA 4DPQA 4GIYA 3TAKA 1A5SA 2D22A 1JG9A 5BXSA 3CYVA 3GD6A 2PAJA 1WBJA 2XP3A 5HR7A 3EYPA 2DU2A 5C2XA 1FA2A 3SUVA 4TUFA 4JAWA 4JYSA 1DL3A 1TA3B 4YHEA 1TELA 2A6LA 4ZO9A 3KOYA 3LPGA 5M2FX 4XD4A 1V77A 2CW6A 3WN6A 1XQLA 4DXKA 1T8QA 3UZZA 1QOXA 3W7RA 3QYQA 1GKPA 3EPMA 4LRSA 4HYWA 1WZMA 3BCDA 4US5A 4KR0B 3PR2A 1C8XA 1J2BA 3TIMA 4R0XA 1B3ZA 2V82A 2PPNA 4REQA 2QPSA 2NQZA 1RP9A 3SIZA 2MLXA 1I2OA 3HQPA 3RLGA 3NFUA 1F6KA 2HXUA 1RVGA 2QDGA 1JCJA 5FEWA 3ZJKA 2J62A 2CESA 1SW7A 2CETA 3VNMA 4JY8A 1LQAA 4RPQA 3GVVA 4AMCA 4JFSA 2QCNA 3AWOA 3FAPA 3U0HA 3R0UA 4EXAA 1P0BA 2YL8A 1CWYA 4DPPA 4JQ4A 2WKLA 4RE0A 2NV2A 3GTHA 2WHLA 4Q3MA 3S5ZA 1KQZA 4ZQOA 3KAHA 3VOHA 1GW9A 4XUYA 4MHBA 3KWXA 2CZFA 2BVTA 3KEHA 4GZJA 2PPPA 1X6NA 1R85A 4PMRA 2VCCA 1XH0A 3WQGA 2VR2A 3CO8A 4MB4A 3KHDA 2V30A 4ICMA 4QS5A 1JZ6A 3WBYA 2GFTA 2QZRA 5K2ZA 4JKLA 1I1XA 3G1YA 3ABXA 3UI5A 3PBMA 1PL9A 5EMUA 2QCGA 1JAEA 4B92A 3ZR4A 4WDXA 1UIPA 4JTIA 3RCMA 2QIIA 4X63A 5CJNA 3CUGA 2NVAA 1QPNA 4BEUA 3VNJA 3H2FA 4KCUA 3FY1A 4LEQA 2ZRVA 1OCJA 4PL2A 3TYDA 1BSLA 4IPXA 3AXXA 1RR2A 3C0JA 5DCBA 2Y0FA 3GNOA 1KFBA 5I2UA 1UCWA 1IYXA 3VYLA 4MNMA 1I2RA 2MF9A 1FKGA 2QUVA 3F5LA 1UMLA 3CZGA 3Q58A 1KM4A 2C1GA 5CPLA 1VR6A 4AY1A 2YLLA 1GT8A 3YPIA 3FHAA 4QLLA 2NSXA 4O17A 1J5SA 3O0KA 2M1IA 1HGYA 2R91A 1E73M 3FCPA 4QFUA 2JKAA 1CCWB 1TWSA 3L0NA 3AS1A 1PTDA 4YWIA 3W7CA 1XFCA 4AF0A 2VD9A 3BGAA 3UA4A 2PU0A 2HPMA 4DRMA 1K6AA 4ASTA 1LRTA 3UG5A 1EC7A 1C9DA 3PM6A 2RUQA 3BLEA 3HPAA 1EZWA 2PV3A 3INPA 2WPGA 4HOXA 1L6GA 1T6MA 4M51A 4NX0A 1EA9C 2TSYA 1D3HA 2DIJA 2WHJA 3F4VA 3TTQA 4DBEA 2PSNA 1YXYA 3G77A 1LOLA 3PBVA 4OBTA 2HCVA 5FAJA 1HUVA 3HURA 3PBWA 1JUEA 3BG9A 1FCQA 2VELA 1JFXA 3W02A 4BF8A 2JKEA 3OGRA 4DRQA 4DXXA 3AO0A 2Z1WA 2C7FA 5HOSA 3NJ3A 1E0WA 3GSMA 4OHQA 2PLJA 3BVJA 2VUYA 4UR8A 5DY3A 1EL3A 3L4VA 4BHYA 1BRLA 3PFRA 1DYSA 3CUIA 4GX9A 4J5NA 3OB8A 2BY1A 3C3NA 3NQ8A 4HZ7A 3RX2A 4YTQA 1AJ0A 1V8EA 1V6VA 3O5PA 4ZPTR 1U5VA 2VFHA 1ENUA 2BASA 3HBLA 3GX9A 3BW4A 1UP0A 4S3DA 5BXJA 1XINA 1SUXA 1UZ1A 3SCWA 3WLLA 2VDIA 4PMXA 2CKSA 2RURA 1XICA 5D9OA 4BY3A 1OFRA 1JZ8A 4QCEA 2WKJA 1FKSA 3MA8A 5DFAA 3IGUA 3F2CA 4KERA 1E56A 2YCLB 4UTFA 2GYIA 1JCXA 4K39A 2W62A 4HQVA 3GBDA 2TAAA 4RV8A 4BJHA 2D2HA 1J4IA 1KW1A 3EB2A 5U4NA 5AHFA 1CLXA 1K7EA 1YNPA 1W1VA 1T11A 1VS1A 1VFHA 5E93A 3L7RA 4YTUA 1GWJA 4ZA0A 3KRUA 3N11A 4RK8A 3S8HA 4CCZA 1D8CA 1UBSA 4MM1A 5C9UA 3PTDA 5C54A 1W3NA 1FXQA 4I9AA 3REQB 4B3ZA 3KVLA 4BFAA 4XZLX 1ODZA 2VURA 2E6DA 1JNTA 3PUDA 4JNZA 4Y96A 4H4IA 4NAEA 1GRJA 2OQHA 1XR2A 5C9RA 3K13A 2HBVA 1JDCA 8CGTA 1UJQA 3CMGA 3RLHA 3D3FA 1XDMA 1R3YA 2AL2B 6ENLA 1SFJA 2ZWZA 3GM8A 5FESA 4L6DA 4EPEC 3WQDA 2B7PA 5AVHA 2J9XA 1PX3A 4ROQA 4JBRA 4O1DA 3M0MA 3V1HA 3CUJA 3P8IA 5AN7A 3FV9A 3QV7A 4HHHA 4FXRA 4F2UA 3SN1A 3BW3A 2BY3A 3SSJA 3A12A 2JFEX 3DDMA 3ABQA 1A4LA 4CVWA 2DZTA 3PZOA 4IIFA 4OE7A 2ZZ2A 3B04A 1K4HA 3EWUA 2Q01A 2ZXAA 3W7IA 4W9PA 4NVTA 1JUKA 2G3MA 4ZB2A 2WANA 2WVVB 4EPDC 3S4TA 3TFXA 1FKLA 2PMQA 1NY1A 3L68A 4GUIA 1J0IA 4O12A 3M7WA 3WLSA 3EXTA 5C5YA 4ZSUA 3IGXA 4JKKA 4LB4A 2OT0A 3GIYA 2FKPA 2Y5JA 3IIPA 5CC5A 1BWKA 4UDMA 4TX8A 3LCLA 4CQAA 2QCLA 3M0YA 4ZPVR 4GGHA 1Y7VA 3OBEA 3TSMA 4WJ8A 3OA3A 3GDLA 3LRMA 2VEIA 2MPHA 3MKKA 3N2BA 3WMCA 4HNVA 4FR6A 2RJGA 5HWNA 3UR2A 4L5ZA 3WQOA 1ZENA 2VXNA 1VEPA 1U1HA 2YR1A 4HNLA 4CNSA 2D0GA 1YPFA 4HPJA 1N82A 3NQMA 4P2VA 4M24A 4P7RA 3OZPA 4OU1A 4Y8FA 3WF0A 2UWFA 1GVSA 3HG2A 3R5EA 4PRWA 1JDFA 3ITCA