4WKFA

Crystal structure of human chitotriosidase-1 catalytic domain in complex with chitobiose (2.5mm) at 1.10 a resolution
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
368
structure length
368
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Chitotriosidase-1
total genus 128
structure length 368
sequence length 368
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wkfA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wkfA01
2GJRA 4ACYA 4U3CA 1EHNA 1ISYA 1D3CA 2YLLA 2ZUVA 1DWAM 5A6SA 5HPCA 1UWQA 5EFFA 1CEOA 3A3HA 4HU0A 1UR0A 1ITCA 2BXYA 2W66A 1UKOA 1WB0A 2X0HA 3VGBA 1J10A 1H3GA 1WZLA 2FGZA 4F66A 4IUGA 3FXYA 4TVCA 1E3ZA 1KWKA 5BRPA 3GNPA 3ZOAA 1OGSA 2X1IA 2BVYA 2QHAA 1E15A 1HP4A 4R5EA 4BF7A 2DQXA 1GOWA 1PZ3A 5IHRA 3GZAA 3SCVA 4ZXLA 1CXIA 2EPKX 3VIJA 1UQYA 1WKYA 2WVVB 1DWJM 2BHYA 3PBGA 1GHRA 1UHVA 4W84A 3WMCA 3MUAA 5A1AA 4PBGA 2ZWZA 3VGHA 3ARQA 1RH9A 1HVQA 3AS0A 3FN9A 2VL4A 3L4XA 3VOCA 3NDYA 1US2A 2WWCA 1ODUA 2UY2A 2QPSA 2XG9A 2ZUNA 3AIQA 2BHUA 2A3CA 5F7UA 1NOWA 2GK1A 2OYKA 4H8UA 1KR0A 5D9PA 1TMQA 3UERA 3BMVA 4FLQA 3WL1A 3K4AA 2WBGA 3MANA 1Q6EA 4OOZA 5EBAA 3ALFA 2V3EA 3AISA 2ZICA 3BLKA 1W2PA 2WW5A 3AMGA 3WDPP 1V0NA 2BXZA 4JKMA 4N0RA 1GUVA 1E55A 3TONA 4WF7A 2OSXA 3BAKA 1BQCA 3CUFA 2BHZA 1CXFA 2XSAA 1ISWA 5IHSA 3II1A 3TTOA 1Q4NX 4P7NA 3ZJKA 2CERA 4AIUA 4FK9A 2FH6A 2CPUA 1UUQA 1HJXA 1HKMA 1V02E 1CGUA 1KFWA 4QLJA 3EMZA 4V27A 4CKQA 2YL6A 5I24A 1B3XA 3S6TA 2VI0A 5BXPA 1D2KA 2C8NA 2CITA 1BSIA 4CCCA 3BLPX 4AIEA 2WVUA 3U5YA 1OD0A 2D22A 4PUEA 3VGFA 2YOCA 3AIRA 2WANA 3OGSA 2VZSA 1BG4A 3BC9A 1BVZA 4YHEA 3VU2A 1H11A 5JIWA 1ZBVA 2VQUA 3N17A 1E0VA 5C70A 2WYSA 1W9PA 1YHTA 5I3DA 4HA4A 4H2CA 1XRVA 1W9VA 1TFVA 1JNEA 3WEZA 4D72A 3SCQA 4C7FA 3SCRA 4BQ2A 4Z2HA 3VIFA 3KWXA 2DPEA 2CBUA 2DIEA 1NWUA 1G1YA 3ARSA 4WSKA 4AZBA 4ZENA 5KZ6A 1JNDA 1WDSA 4QDMA 1UR1A 3AHYA 5D8ZA 2FGLA 1RPKA 3W26A 2PWFA 1LLOA 3RO8A 4OUEA 1EQCA 4J3TA 4IM4A 1ZBCA 4M81A 3PN8A 1W9UA 2EQDA 2BVDA 4UOJA 3NSXA 4W87A 4CVWA 3LMYA 1EGZA 2OWXA 4XUYA 4C7GA 3KL5A 2UWFA 4J27A 5BRQA 3N1AA 2ZUMA 2MANA 2ZE0A 4AD1A 4BS0A 4QAWA 1KCLA 2GFTA 1X1NA 3THDA 2WNWA 4F8XA 1CLXA 2NT1A 5ABFA 4NRRA 1OCQA 3CTTA 1VEPA 4A3YA 4J3XA 5EFDA 2XM1A 1J0IA 4H41A 3WDIA 2ZWYA 1HF6A 1NWRA 4S3KA 3DYMA 3EMCA 4TX6A 4UTFA 3ARTA 4MPKA 3W28A 3SCNA 5C8BB 3PTMA 5IFPA 7TAAA 3WIJA 1QNRA 3EDJA 3MMDA 4GQRA 3SCSA 4AIOA 1E6NA 2J78A 1TZ7A 2JEPA 3AHZA 2V38A 3CZJA 1ZL1A 2GDUA 1BGAA 4U5KA 3M7SA 2YIHA 2YL9A 4GPNA 4UNIA 1G0CA 2VOTA 3SCWA 3OLIA 2C0HA 1UKQA 5I5RA 1SR0A 1UWRA 3PZGA 3ARUA 1F4HA 4PTVA 2AMGA 1IZJA 4NI3A 3THCA 2WMKA 4DWSA 1UH3A 1UD8A 3VDHA 3WL0A 1E0WA 2YA0A 4GI8A 5CGTA 5M3WA 1CGYA 4GXPA 1D7FA 1EH9A 1LL4A 2JF7A 1HKJA 2D0HA 4W85A 4TOQA 3RM4A 5LYRA 1J11A 3AXHA 4GO9A 4W7WA 1JFHA 4ZE4A 4AZCA 5JBFA 2VVSA 2XYLA 2VZVA 4AISA 4ML4A 4P8VA 4B9YA 2G41A 4LYQA 4QCEA 3AOFA 2CHNA 4J3WA 4B16A 3EDKA 4Z2KA 5GNYA 4W86A 1SMDA 1JYWA 2ZXQA 1XSIA 1FHLA 1W9DM 3RM8A 3ZJ7A 1CXKA 4R27A 1DWFM 4AD0A 5I23A 2VCAA 1K9DA 5CZKA 3W29A 4BA0A 2YBTA 3T2PA 3WNLA 3WN6A 4UZSA 4GQQA 3LPGA 3QGVA 5IFTA 1ZS2A 4JKKA 4OZOA 4D6GA 2XUCA 2CESA 1E3XA 2W91A 3LPPA 1XCXA 5CPSA 1V6UA 4GINA 1MQRA 5A2AA 1BPLB 4ATLA 3CZKA 4XB3A 1QOXA 1C91A 1DWGM 5I78A 1NP0A 2VR5A 4AZGA 2YJQA 3WDHA 1UR4A 1W1TA 3VIOA 4MAZA 1EQPA 4J7RA 2BY2A 3K1DA 5A3HA 1EHAA 1E4MM 3WFLA 1GPFA 3GBDA 1M53A 4UFMA 3BGAA 3O6AA 1IT0A 3F4VA 1UKPA 3GXIA 4UQEA 5DFAA 4CD7A 4CGTA 2WLYA 5D8WA 4HTYA 2WXDM 2D2OA 2WHLA 3W6MA 2WVTA 4M80A 1JI2A 1E9LA 1UKSA 1PIGA 1CZ1A 1W3JA 5JUVA 3SURA 2W4XA 1U30A 1R85A 3NYDA 1E1FA 3CUGA 3DYOA 1QI2A 4C7DA 4L4PA 4CVUA 2VMFA 2W61A 1VAHA 1W1YA 5I79A 3MUY1 1HJSA 3MS8A 4D6JA 1JZ7A 3AI0A 3K46A 4U31A 1TVNA 3WNNA 2GUYA 2VRKA 5BROA 3DECA 3M07A 2V3DA 3AZRA 1V03A 1DEDA 1GOOA 2WMHA 4XZBA 1I1XA 1NQ6A 4LYRA 1UD5A 1VBRA 5A95A 3W53A 3AICA 4AD3A 4CD4A 2WHKA 4WLCA 1B3WA 3VIMA 4B15A 1H2JA 1MFVA 1QNSA 4DWSD 1QBBA 1UWUA 1KBBA 4J3VA 4M8UA 4W5UA 2J7HA 4JFSA 1J0JA 3RILA 3MU7A 1JI1A 1VRXA 2NT0A 4UCFA 4TTUA 5BXSA 5KEZA 4OKDA 1WE5A 1E6QM 1TUXA 3VTRA 4CUCA 3GYCA 1KCKA 3EDEA 3VKKA 1M04A 3QOMA 4EK7A 4HZ6A 2J62A 3F5KA 3WH7A 2PWGA 1IZKA 3OLGA 4OIFA 1JDAA 2VT0A 5A6KA 3CZGA 1AQMA 1K9EA 4AD2A 4CD8A 2VZUA 2OSYA 1HX0A 1KXVA 3HMCA 4P8WA 1V6XA 2HISA 1V3LA 5TD4A 2AOSA 2XIIA 4YHGA 3ZO9A 2WVVA 3AZTA 4D6HA 1JYVA 4PMXA 2WC7A 1CENA 1WCGA 1BYAA 2GK1B 4D6CA 4D1JA 4JKLA 1PPIA 1OSEA 2WZHA 3NDZA 1BHGA 2BNJA 1IV8A 3VM7A 1BYDA 1UH4A 1J0ZA 3ZJ8A 1QW8A 1HKIA 4DM1A 4KH2A 5A8OA 1B3ZA 3MMUA 1QI4A 2XHYA 4JFTA 4YPJA 2G8ZA 3TA9A 1TE1A 1KXQA 1MW0A 3WDRA 3MSGA 4PTWA 5E6YA 1QI0A 3WD1A 2XFRA 2BY0A 3U7BA 1EDGA 2X05A 3NSMA 3POHA 3UETA 3HN3A 1W3LA 3WFZA 1RP8A 2PBOA 5E0CA 3L4TA 3WQVA 4DWSC 5HOSA 2JF6A 4PMOA 1M01A 1CNVA 1Q6GA 2WMIA 4CCEA 1W32A 3AMCA 1CBGA 3DC0A 3WD3A 2WKGA 3DHPA 4X0VA 3WQ5A 3VX0A 2ZX6A 4F79A 5LA0A 4PMVA 3TP4A 2NW0A 4MNKA 4FF5A 5ABHA 5M03A 3PZQA 2DDXA 5DEZA 4HPGA 2J7EA 2CNCA 1JFXA 2YL5A 1W9BM 3NSNA 2DSUA 2VVNA 1KB3A 2E0PA 4DUWA 3L2MA 3W27A 1MWOA 3UG3A 3VINA 3WEOA 1RP9A 1H09A 4UFLA 5HBFA 5E09A 1EDQA 2VTFA 2A3AA 3MUZ1 2UY3A 4BQ5A 1UD2A 4J3UA 3VD4A 3NIYA 3GNRA 1WPCA 2XJ7A 3L4ZA 3QHMA 4AZIA 1EDTA 3D3AA 4ACZA 4H8HA 1HKKA 3B9EA 3A4WA 3VIPA 4F9DA 4MDPA 3ZR5A 2PB1A 1BYBA 2WSKA 3AIBA 3WMBA 1XC6A 3ZR6A 3WQ4A 2BV9A 1OT2A 2CBIA 3CIVA 3WF1A 3HU7A 2J79A 2DIJA 1V3MA 1WZAA 1MXDA 3T09A 4ATWA 2C7FA 1VFFA 4CCDA 1C3FA 1HL9A 1GHSA 1GOQA 2ZUTA 4L4OA 1UD3A 1LF1A 2GDVA 3ZIZA 4P7QA 1B31A 1K6AA 1VFMA 3WH6A 1DWHM 5GQBA 4ZE5A 4E2OA 3WY1A 1CPUA 3PTKA 1JL8A 3VD3A 4MB4A 1CGWA 5ECUA 2WHMA 2CBJA 1JDCA 4QFUA 4CN4A 1QHOA 1XH2A 2WKLA 3KL0A 4HA3A 3VMOA 4U2YA 1E43A 3IJ8A 1VIWA 4XX6A 1EO5A 2TAAA 5DMYA 5LA1A 4MB5A 4U33A 3MO4A 1GJWA 3A47A 2J47A 3W0KA 2ZUWA 1QHZA 1UH2A 1S46A 5GNXA 3CHFA 1QBAA 2D3NA 5FOOA 9CGTA 1WZMA 4H7VA 4AZHA 1LG1A 3KZSA 2G3NA 1V3JA 1BYCA 4OBSA 3QR3A 1LL7A 1DWIM 4HMEA 3SUVA 3WD4A 3AIUA 2V3FA 1WP6A 4AEEA 3W82A 3AS1A 4W88A 3MMWA 3BMWA 1FFRA 6TAAA 1CGVA 2E9LA 2VRQA 1AMYA 1H5VA 3I3DA 2ZXBA 2V5DA 4D6EA 2IUZA 3POCA 3ZJ6A 4DM2A 1YQ2A 2VRJA 1CECA 1G01A 1B2YA 1QNPA 5A6JA 3AIEA 1TA3B 3AXIA 4GKLA 4BQ4A 2WZEA 2J74A 1QPKA 2GJPA 3WBAA 1KXHA 1ODZA 3GXDA 3LPFA 4TXEA 3RM9A 3UCQA 3ARWA 4WKHA 3AMDA 4RE4A 4PMRA 1R87A 3L4WA 2WMIB 1E4LA 1R8LA 4Z2LA 3MV11 1JD9A 3UG5A 2Z1SA 3D5HA 2X09A 3WNMA 1TA3A 4CD6A 1I1WA 1NOFA 1QI5A 1VJSA 4WK9A 1E72M 3MUIA 1G9HA 1ZU8A 2PF0A 5D4YA 4IISA 1W91A 4AZ6A 2V5CA 1FH9A 5IDIA 4IPLA 4E4PA 5A8NA 1HP5A 3CZEA 4TTGA 1A47A 1V02A 3E1F1 5A2BA 1BAGA 2OSWA 3WNPA 4PSRA 1HJQA 4HMCA 1ZJAA 4WIWA 2DSVA 2W63A 1Q6CA 2YA2A 3GDBA 1W1VA 3PZIA 4HOWA 2EXOA 3CUJA 1C92A 2WM0A 2Y8KA 4X0NA 2YLAA 4AC1X 4PYSA 3N13A 5DF0A 1QI3A 4HMDA 4MNMA 1E5NA 5HXMA 4TVUA 1NH6A 2G4FA 1HVXA 4JFUA 1EO7A 2CIPA 1NOUA 3DYPA 1KGUA 1B0IA 4UQ9A 1XGZA 4CD5A 3CMJA 1HJVA 1OBAA 3GXFA 3CMGA 1V0KA 1E6RA 1J12A 3K4DA 4EAMA 3GH4A 2VZOA 4HOZA 2JIEA 4FLOA 4MB3A 2BVTA 4LX4A 4ACZB 5CJ5A 1MYRA 3PZNA 2WC3A 3VD7A 3QHNA 5AC4A 1XHGA 4AYSA 4AW7A 2FHFA 2JEQA 1ISVA 3K8MA 1V6WA 1GCYA 4DWSB 4QP0A 1OM0A 3B8SA 1HXJA 2PWDA 1C8XA 5LA2A 1N82A 3PZTA 1BF2A 1JAKA 2OYLA 1B3YA 1E70M 1GQLA 2WB5A 4PMDA 3WQWA 2FH8A 4LYPA 4D6FA 2BY1A 1C8QA 2J7GA 1US3A 1E4NA 1CTNA 3TTQA 3I3EA 2E9BA 1VB9A 5AY7A 3G6MA 1MW1A 1V6VA 3VGEA 3B9DA 2DEPA 2A3BA 4Y7EA 3SUWA 1GVYA 3RJYA 4HZ7A 1GOIA 1GW1A 4LGXA 3T08A 5CLWA 2IXUA 5I6SA 4MDOA 3RIKA 3CHCA 4HA1A 3CGTA 2QF8A 3J7HA 2BFGA 3VUPA 3SCPA 2QPUA 4PSPA 2J7BA 4JAWA 4AZ5A 2WMJA 1GOMA 4XV0A 1O7AA 3WF3A 4JIEA 4JFVA 3OLEA 2X8RA 2J7CA 2VC9A 3WD2A 1ISXA 1XV8A 1K9TA 1TG7A 2VCCA 5ABEA 2EPLX 1FFQA 4AWEA 3QOKA 2J7DA 3CZLA 3SUTA 1JZ4A 3ZSSA 4QLKA 3GH5A 4M82A 3VILA 4HP5A 4HOXA 1FOBA 1PX4A 3CBWA 4AZ7A 4HU8A 2FHCA 3UR7A 1HN1A 3AMKA 5M17A 4GI6A 4AEFA 2EEXA 3VMPA 1KQZA 4NSBA 3BAYA 1W3HA 1VEOA 1VFUA 3BH4A 1UWIA 4LXFA 3G6LA 7A3HA 3ZQ9A 2J77A 4MNLA 1OB0A 2UY4A 2G3MA 4Z2IA 2D24A 4J28A 1L0PA 5I2UA 3AIVA 5FL1A 2PWHA 5HNNA 1KWGA 2Z1KA 5EB8A 1WDPA 2JALA 1C93A 2W92A 2O9OA 3SCOA 2A3EA 2XWDA 5DT5A 2WAGA 5AC5A 2OWCA 3N12A 4B3KA 3WMSA 1JG9A 1H49A 3SCTA 1JIBA 3W24A 2WC4A 5FCZA 2ZUSA 3WEMA 1SFSA 1LG2A 4GI9A 2ZIDA 1KQYA 2BY3A 5BYWA 3GBEA 2QMKA 5HDRA 5JIPA 3FY1A 1ISZA 4NF7A 4JHZA 4BQ3A 2Y2WA 4HPHA 4A4AA 8CGTA 2O9TA 3JUGA 3MKKA 1C7SA 4RE3A 4MB1A 2O92A 3CHDA 1NP2A 2XGIA 1VJZA 2EPNA 5CG0A 1WDQA 3ARYA 1HJUA 1V3IA 3CPUA 1DP0A 1QVBA 4KRTA 2DT2A 3WF4A 1X6LA 4NZCA 2ZX5A 3T2OA 2QV4A 1B1YA 3WF2A 1TVPA 2YL8A 2XVNA 3CHEA 5D9MA 2XTKA 1I75A 4XZWA 3ARRA 3BAXA 4UFKA 4CN6A 2WLZA 3M46A 1E6PA 3FNDA 1MFUA 1J0HA 1SYTA 1G94A 1PJ9A 3KL3A 3OB8A 2F2HA 5E70A 2PWEA 3CZ8A 3ARVA 1KXTA 1ESWA 3MSDA 4M56A 1UWSA 1JXJA 2EJ1A 2D0GA 3ARZA 3PHAA 3RDKA 2WVSA 1OGGA 2Q8XA 3WH5A 1FA2A 1V3KA 3I3BA 4HZ8A 3A4AA 1ZJBA 7CGTA 1UA3A 1GNXA 2PBGA 1Z32X 5A2CA 3WDJA 4P8UA 3N9KA 1JF6A 2DT0A 1CXHA 6A3HA 1KGWA 3FHAA 4AZCB 5D9NA 2CKRA 1AQHA 4MJ2A 1QNQA 1VFOA 5A6BA 3M6DA 1UD4A 4GO8A 5CPTA 5M5DA 1LJYA 3A4XA 5CPQA 5BXTA 2DSWA 3ECQA 4W93A 3W25A 1BLIA 3WUEA 4M24A 2E40A 1PIFA 2JE8A 3N18A 1NWSA 5A8QA 1PX3A 3WBEA 1GORA 3BAWA 1JZ8A 4E8CA 2WBKA 3VPLA 4LPCA 2VR4A 3WSUA 1FP8A 1KBKA 2D23A 4W7VA 3RCNA 3W4RA 5JBEA 1OIMA 3F5JA 4OOUA 2VO5A 1GOKA 4P7OA 4WJXA 4UR9A 1UR9A 3NJ3A 5BWFA 1OIFA 3CUHA 1E0XA 2YBUA 1WZKA 4FMVA 5A8PA 4Z2JA 4JL2A 3ZT5A 1H0GA 1TCMA 4D71A 3ZT7A 3IAQA 2F8QA 4TX8A 4MAVA 3ARXA 1W2VA 5A6AA 1UZ1A 1FH8A 2CYGA 4Z2GA 1HNYA 4CU7A 3FHQA 1KR1A 4PRWA 5A8MA 4GZJA 4URIA 3BSHA 3OGRA 4GIAA 4BZYA 1P6WA 3AMLA 1E1EA 2D1ZA 1CLVA 2PI6A 4PEEA 3OZOA 1XSKA 2BS9A 2DH2A 3T2QA 2QLYA 5DT7A 4D6IA 1JAEA 4UFHA 3IJ9A 4W8LA 3WDQA 3TTYA 2WCAA 1EIBA 3OBAA 4U5IA 2FHBA 1Q6DA 1O6IA 5FL0A 1CDGA 3WQ6A 1NWTA 1JXKA 2WPGA 3OIHA 4UQCA 3AFBA 3PZVA 4WKFA 2FDMA 2X2YA 4MADA 5FIPA 3OGVA 3BCFA 3WUGA 1QHPA 4PMZA 4KGJA 4ZFMA 3T0DA 1CXLA 4OBRA 1PBGA 1CGTA 3KE0A 4UFIA 4AMCA 4KRUA 4JL1A 1UYQA 3GTNA 4H8VA 2E8YA 3RMEA 1GQJA 3SCUA 3VO0A 1VBUA 1CWYA 1UKTA 1X6NA 3T0BA 2CXGA 3U5UA 1MVYA 1E73M 1VF8A 3VX1A 3VD5A 3RPMA 5FKYA 2D20A 1NM9A 4PMUA 1OT1A 4FLSA 1QW9A 3OG2A 1EOMA 2CCRA 3W6LA 1PZ2A 2Y5EA 2EO7A 1FP9A 3AS2A 5I0DA 1JF5A 2WCGA 5EMYA 1GJUA 1JZ2A 2XVPA 1UD6A 3AYRA 4IPNB 4ATDA 2EBNA 2VQTA 2WCSA 5ABFB 1H1NA 2WZIA 3AXXA 2DT1A 1E6SM 1LWHA 3A6OA 4EANA 1RD6A 1J01A 2J7FA 4RE2A 3FW6A 2D3LA 4P7LA 4UOQA 4V28A 1UR2A 2O9RA 1EOKA 2X0YA 3W38A 2W67A 1R7AA 1CXEA 1FHDA 2YDQA 3EBVA 3CUIA 3BAJA 1MW3A 3AS3A 1JZ6A 3ALGA 2D0FA 3VMNA 4W5ZA 4TUFA 4WKAA 1E56A 2OWWA 1OD8A 3ZM8A 3OLDA 2AAAA 3VNZA 1GVIA 5E9AA 5CSUA 2CEQA 1DHKA 3WUBA 1GQIA 1GZJA 3U57A 3WNKA 4F9JA 3SIMA 1XD0A 3IAPA 4U2ZA 3VNYA 2E4TA 3GNOA 2XGBA 1TR1A 2IXVA 3VVGA 5A6MA 3EMQA 1XSJA 3UEQA 4M1RA 3WUFA 3BAIA 1U33A 3BCDA 4UQBA 4AY1A 2DSZA 5GNZA 2XVLA 2XVGA 3EDDA 3VM5A 1MQQA 1MW2A 4A3HA 4P8XA 4KGLA 5BXRA 1J18A 3AROA 3VIGA 1H41A 1E6ZA 1E4IA 1LQ0A 1ZB5A 3VIHA 2XVKA 1J9YA 5CSYA 1SMAA 4DUVA 4S3JA 2RGLA 4D1IA 1XCWA 1E5JA 4AD5A 2VX4A 3APGA 4W7UA 1JD7A 5A6LA 2EPOA 3L4UA 1W9XA 2OYMA 1CIUA 1C90A 2WMGA 3AHVA 3AIWA 3AQUA 2QMJA 3U7VA 4UOZA 4JFWA 3PZUA 3F5LA 3CO4A 5AYBA 4GZEA 1JDDA 1JGIA 5CGMA 3T0AA 2VJXA 4KWUA 3O9NA 1V0LA 5HPOA 4LQ1A 2CHOA 1UOKA 3BSGA 4QCFA 3IJ7A 1H4PA 3ZT6A 1MXGA 2ESCA 2VURA 3PZMA 5JH8A 1HT6A 5DO8A 4AXNA 1WO2A 2WHJA 3AHXA 1PAMA 1HJWA 2ZOXA 3IANA 2J8GA 4W8BA 3WH9A 3ZSTA 4V2XA 5ABGA 2ZX7A 2J25A 2Y4SA 3UG4A 4U3AA 4PTXA 5CQ1A 6CGTA 3SUUA 1UA7A 4PMYA 3L4VA 1JZ5A 3OA5A 2YA1A 4MTVA 1UR8A 2WSPA 3WF0A 1XH0A 1WDRA 1U2YA 3KEHA 1GQKA 4PCSA 1ITXA 2Y8VA 3EYPA 2VX7A 4TVDA 2VX6A 2XFYA 1J0YA 1UG6A 4MNJA 4JCLA 1M03A 1MQPA 2E9MA 3GXMA 2ZX8A 2GJXA 4W89A 2A3HA 4UQAA 2VX5A 3QHOA 1Q6FA 2G3IA 3PTQA 4CU6A 3VIIA 3RJXA 1XH1A 1V08A 3WKZA 2VZTA 3S2CA 5BCAA 4UFJA 8A3HA 4CU8A 2OLHA 3WD0A 4CN1A 3WENA 3GM8A 1WAWA 2DH3A 1R86A 3BXWA 3TOPA 4B3LA 2G3JA 4H04A 4X9YA 4PCTA 2GJXB 2ZX9A 3ARPA 2DGAA 2VNCA 4M29A 1AQ0A 1VEMA 1W3KA 3K8LA 4Q22A 2NSXA 1ECEA 4FLRA 1JYNA 2DSKA 3GH7A 2RGMA 3N11A 3WQ8A 1JYXA 4N42A 1A3HA 2XM2A 4PUDA 1XD1A 2DT3A 4WSJA 1FH7A 3AJ7A 4AD4A 2XSBA 1OINA 5CLTA 1B30A 1V0MA 5GPRA 4ZEPA 3NUKA 1UQZA 2O9PA 3O2LA 3AHTA 1VENA 4K68A 3K8KA 2XFFA 3N04A 4PMQA 2CKSA 2CETA 1B9ZA 3W81A 1NARA 1HIZA 2YDRA 4YN5A 4BCEA 2WMFA 3WNOA 2GSJA 1UWTA 3TTSA 2YDSA 3N15A 4QLLA 1AVAA 1W1PA 1UZ4A 2ZXDA 3UR8A 4OJYA 1LL6A 2GVYA 5CXPA 5C71A 5IXEA 2VUYA 4B9ZA 3UESA 1LWJA 2W62A 3W37A 3IK2A 2YKKA 2CBVA 1KGXA 3DHUA 1V6YA 3FAXA 1ZBWA 4GZIA 3PZ9A 3AZSA 2W5FA 3SEPA 3L2LA 4Q7NA 1L8NA 2UY5A 2J8FA 5AYIA 1K9FA 4UQDA 3VD9A 4JZ5A 2JFEX 3VDAA 2J4GA 3MV01 2PC8A 3L4YA 1F4AA 1XYFA 2J75A 4PMNA 1XYZA 4PN2A 1Y7VA 1CGXA 1EXPA 1E71M 2EPMX 3VDBA 1PEZA 1BGGA 5FD0A 1GONA 1E40A 1BG9A 1C8YA 2JIWA 3VIKA 2WK2A 3VGDA 1B90A 4W8AA 1OGBA 2VCBA 4MJ4A 4EE9A 1EA9C 2XPKA 5I77A 1WNOA 5JBDA 3EDFA 2XIBA 1DTUA 4KMQA 4D6DA 1ZBKA 1E6XM 2ZXAA 3WH8A 2B31A 1PX8A 1J0KA 3VDCA 4JHOA 5A94A 5E0FA 4DUXA 3FAWA 5E6ZA 3OZPA 2V3GA 1M7XA 1B3VA 1CYGA 3HJEA 1V3HA 1R7OA 2XWEA 2Y24A 5D9OA 1HL8A 3CH9A 4UZUA 4P7RA 3ZMRA 4RL3A 2E8ZA 4ZXOA 1C7TA 4PTMA 1G5AA 3CLWA 4NRSA 3B9AA 1H0IA 5A6BD 3NCOA 3VGGA 2F61A 2HVMA 4J3SA 2E3ZA 1BFNA 4EKJA 5A69A 3SUSA 2ZUUA 4JCMA 3WELA 3AYSA 1BVNP 1QNOA 3LPOA 1JZ3A 3PZOA 1BTCA 2WWDA 4E8DA 1OWQA
chains in the Genus database with same CATH superfamily
4U3CA 3CUZA 3RLHA 3RHGA 1UWQA 3A3HA 5FEXA 3HGJA 1UR0A 3LHUA 1ITCA 2BASA 3O16A 2QR6A 4L1WA 4S3EA 4F66A 4DQWA 1M7JA 2QQ6A 5BRPA 3GNPA 4TYOA 2X1IA 1WKFA 4LVBA 2DQXA 3TWAA 4FAPA 4DBEA 3CQ0A 4HK7A 3SCVA 4ZXLA 1RCXB 2EPKX 1VPXA 2BHYA 1UHVA 2POZA 5I03A 2JKAA 1O1ZA 1MDRA 2CLHA 3ARQA 1HVQA 3AS0A 3WJSA 2UY2A 2ZUNA 1DL3A 4DVOA 4PZVA 4JFLA 5I98A 4H8UA 1UIPA 3UERA 4FLQA 3H4GA 4HN8A 1XLDA 1Q6EA 3AISA 1TTQA 2QCDB 4F2BA 4RPPA 1V0NA 1HO1A 1GUVA 1L9WA 3IVTA 4QROA 3BAKA 2OLSA 3ITTA 1CXFA 2PGFA 5IHSA 3II1A 1Q4NX 3PBVA 4N9DA 3EKGA 3ZJKA 2CERA 6XIAA 1ONEA 1FWFC 3KACA 2FH6A 2CPUA 3CQIA 1CCWB 4KT2A 3V75A 4QLJA 3P93A 4CKQA 4GIYA 4ZMGA 3W02A 1EZ2A 4JTJA 2C8NA 1BSIA 3W85A 3BLPX 4AIEA 3HG5A 2WVUA 2ICSA 4KWSA 1OD0A 3C6CA 4PUEA 2YB4A 3S46A 3VGFA 3D6NA 1B9BA 1PYMA 2WANA 4RZ6A 4ZGYA 4GJJA 3VU2A 1ZBVA 3N17A 3A21A 3QR0A 4Z1YA 4JOMA 4REQA 3PP7A 2PF8A 5C70A 2WYSA 3BDKA 4BFAA 3HPXA 5T91A 2G37A 5I3DA 4PFMA 4H2CA 2XP8A 4IT1A 3R8GA 4BQ2A 1P0DA 4JNZA 2E6DA 3UBPC 1KO0A 3O0FA 2IQ0A 3QTPA 3OVRA 1UP2A 1RAKA 1NAL1 1JNDA 3AHYA 2GQ9A 2OTDA 1EQ3A 1LLOA 1T40A 3RO8A 2WSQA 1ZJHA 3DGBA 3PN8A 1W9UA 1RZMA 2HCVA 2XP3A 5K4XA 5G2HA 4LAZA 1EGZA 2OWXA 2QNEA 2FVMA 4XUYA 3KL5A 1GVEA 3NPWA 1EJTC 4AD1A 2M2AA 4UTUA 3WLRA 1VRDA 1KCLA 1FHUA 2J9YA 1XIIA 3GR8A 1OCQA 3LB0A 1IE7C 4ZSUA 1VEPA 2IKGA 4J3XA 2XM1A 3TROA 4FHAA 3WDIA 2ZWYA 3KBSA 4Q8UA 3V0UA 4ODRA 1IGWA 2VEIA 4UTFA 3G1RA 3ARTA 3W28A 3MCOA 2QIIA 1XI3A 1KT1A 3PJTA 7TAAA 3WIJA 3EDJA 1U1UA 4NAEB 4LOCA 4FXFA 1DXIA 2NVCA 2X1UA 1TZ7A 2JEPA 3PUOA 4AHOA 3JW7A 1ZL1A 2GDUA 3DFQA 4GPNA 1OQFA 2PDXA 3F4DA 1N1AA 3H21A 3SCWA 3OLIA 2XH2A 2OEJA 1R30A 3UF8A 2ZZ2A 3G2GA 3TSDA 1WXZA 2J13A 3LCIA 3RGTA 3P0XA 3TN4A 1K8ZA 1IZJA 1TTIA 2FFIA 2PWUA 3VDHA 1E0WA 1T7LA 4HYRA 2VD9A 4GXPA 2VELA 1D7FA 1LL4A 2DG4A 3FDKA 2D0HA 4TOQA 2GUBA 1J11A 2PPOA 3L12A 4GO9A 4W7WA 4ZQPA 3DESA 2XYLA 1XLFA 1POJA 3M0LA 4ZOBA 2G41A 4N6EA 3AOFA 2FB3A 1TJ2A 1UBPC 1JR1A 2WZTA 4GNJA 2HVNA 1CXKA 1VIZA 3O5IA 1FKFA 4RNHA 4ITZA 1C9WA 4L4MA 5CZKA 4MFEA 1OFOA 2X30A 3VI2A 1VS1A 4PCFA 4OZOA 5IFTA 1Z6KA 1OX4B 2KO7A 1DJGA 4LCSA 1V6UA 3L65A 1RQEA 4GINA 1BPLB 4ATLA 1QOXA 4XBJA 1NP0A 2I1OA 4AZGA 3WDHA 4GD0A 4Y8FA 3MYOA 4KWVA 3H55A 4S3FA 2GOUA 1A5LC 1FWWA 3CPRA 1EHAA 3WFLA 3G1VA 3O6AA 3F4VA 3P6LA 5DFAA 5D8WA 2XP6A 2Z1WA 1A5BA 2EG8A 3N2BA 2ZR5A 2WHLA 3W6MA 3GIYA 1PBKA 3THUA 3GTXA 1UKSA 3B3DA 1CZ1A 2J66A 5BU9A 1OFQA 3DN5A 4UTHA 5I7GA 3KABA 1IWAA 3H12A 1XCFA 3MVTA 2ISVA 4QAIA 4YTSA 5M1TA 1EZWA 5I79A 3MUY1 1Q85A 1TVNA 4IIGA 1XC4A 3NO1A 3PWIA 1OYBA 3HPFA 3MDUA 4EPKA 3DBNA 3M07A 3KP0A 5MF5A 4GY1A 4Q4RA 1DEDA 4XZBA 1I1XA 1NQ6A 2YCJA 4LYRA 1JRBA 3GKAA 1GTEA 4QQUA 4UTLA 3VCCA 2A7RA 3AICA 3RLGA 1B3WA 1N8WA 3W1RA 3E0IA 4I5UA 1OFBA 1VCVA 4PEKA 3E74A 2HJPA 6REQA 5I3HA 3RILA 4KEVA 1IGSA 5C5YA 4YS1A 3EX4A 3N3MA 3KRUA 3W2KA 1Z42A 1O12A 4WGXA 4PE8A 3TX9A 4CUCA 4K7YA 4IIDA 2XGZA 3G1DA 2UBPC 4M6PA 1IZCA 2DZXA 4H2HA 3GYEA 3LHTA 4EK7A 2OQHA 2J62A 4OV4A 1ME7A 4Q8WA 1IZKA 4FOKA 3WLJA 1JDAA 3E0VA 5A6KA 4GXMA 4Q4PA 1AQMA 1EJRC 2TMDA 2VZUA 3HMCA 4P8WA 3TYUA 1V6XA 4WY0A 2AOSA 2XIIA 3LERA 1FX6A 3AZTA 4BF5A 3T6CA 4PMXA 3EOSA 3TQKA 1CENA 1WCGA 1BYAA 4K2SA 6XIMA 5DN1A 2PU1A 1CB7B 2E5BA 4JKLA 1OSEA 1XIFA 1EJWC 3WLMA 4Q3MA 3W7DA 3QW3A 3LBMA 4FNPA 1R3QA 2HDJA 1QW8A 3SY1A 1XDJA 4R7JA 2VN1A 4Z08A 5AZ0A 5D2XA 1HO4A 4RR4A 4RUBA 5I3IA 4AWSA 2C1IA 2XHYA 1HFBA 4C6QA 1VHNA 1YXYA 2R24A 4YPJA 1TRDA 4AMAA 5KMYA 3M0ZA 1KXQA 4LF1A 4ADTA 4BI7A 4NZJA 3GXNA 4DT4A 4XIMA 3GX9A 4C65A 3M16A 3QJAA 4DPQA 1I0BA 1LZOA 1J6YA 1EDGA 5CPMA 3POHA 2OVLA 3CM4A 3R11A 3L4TA 1TPVA 1XRFA 1JUEA 4Z42C 4PMOA 1YMYA 3LMZA 1Q6GA 1W32A 1SZFA 5RUBA 1XPGA 3B0PA 1JCJA 4X0VA 1NF0A 1WOBA 4LU0A 3TKFA 4GX8A 2TRSA 2V0TA 7REQB 4DWDA 3PZQA 3SSJA 4XAYA 1OX4A 2J7EA 5XIMA 2XDFA 3DXIA 2DSUA 1KFLA 3CL7A 1KB3A 4O17A 2ALDA 3L2MA 3W27A 1G4TA 3SM0A 5BZAA 2Y78A 3P5YA 2PRMA 4K36A 4PR4A 4Q8NA 4YYFA 1QDSA 3JU2A 2A3AA 1J96A 1G4EA 2ZFAA 3LN3A 1PKMA 3CUXA 3WQEA 1GVFA 2V5KA 3NM1A 3MW7A 1F74A 1HG3A 5AN7A 4IG2A 1PZ0A 4H8HA 2ZQ0A 3N9RA 4DB7A 4F9DA 4DJEA 2PB1A 3MBFA 4Q6JA 1D3HA 1V93A 3AIBA 3WMBA 4JY9A 4OGZA 3SN1A 3WJZA 1ZQ5A 2TPSA 4I3GA 2CBIA 2HXTA 3TV8A 3HU7A 1N8FA 2DIJA 1FKJA 5FAGA 4AY8A 1YNYA 4F40A 1MXDA 1AJ2A 1W3TA 4ATWA 4KETA 2C7FA 3R94A 3O0KA 2PBCA 3FOKA 3V7PA 1GHSA 1H7RA 1LF1A 2QJIA 1FVPA 4P7QA 1W37A 1B31A 1K6AA 3ITYA 4DF2A 3G0SA 4MWAB 3PTKA 2WHMA 5U7SA 2CWXA 5BOFA 4HNOA 2Z2AA 2OR2A 3IJ8A 1TV4A 5MHBA 2DY3A 5DMYA 2PDCA 5LA1A 2NX3A 3MO4A 5BU6A 3A47A 2J47A 4KFPA 3O5LA 1QHZA 3P3BA 4EF9A 3MHUA 3PBYA 3CHFA 5FOOA 4IT4A 4AZHA 3KZSA 2BVWA 1V3JA 1BYCA 4OBSA 3RR4A 3MQTA 2HV5A 3GO2A 2I57A 5HWJA 1UMYA 2C19A 4JFKA 3C0SA 3AS1A 3MI6A 7ENLA 4XO6A 3S8HA 1EGVA 3WLPA 3VKJA 2ATSA 1CGVA 4O0KA 2VRQA 3E0LA 2V5DA 2HK0A 3POCA 2BG5A 3UQNA 1F2JA 4QR6A 2VRJA 2HZGA 4JY8A 5G4HC 5CGQA 5A6JA 3PR9A 4ZB0A 2OQLA 3SRKA 2GJPA 2YBVA 3NDOA 2ZR6A 3SRDA 3WBAA 1KXHA 2X1SA 4JTHA 2REQA 1DJYA 3GE7A 4M0XA 4C6OA 4DRKA 3RM9A 4IXHA 3CB8A 4RE4A 4PMRA 3C52A 1FQ0A 2QCCA 5LIYX 2WMIB 4H6EA 2GPTA 4Z2LA 3BMXA 3CK5A 3LUTA 3MV11 2XP5A 4ZO7A 3EWZA 3D5HA 3TFCA 3WNMA 1TA3A 2B5UB 4S2BA 2F21A 3MUIA 2XP4A 3CAVA 2PF0A 8TIMA 3N6QA 5D4YA 4IISA 3LSBA 5AC7A 4XZ9A 4PB3A 4RKAA 4IPLA 5IDIA 5A8NA 2H6RA 4IL2A 2V2DA 4CQ9A 2Y5SA 1A47A 2PS2A 1R2SA 2ZC8A 4HBKA 4K3ZA 2FFCA 3B05A 2I5GA 1YEYA 3ODKA 4NJHA 3AUJA 4WIWA 2DSVA 1H50A 1KM6A 4C6MA 2QV5A 2RUSA 3GDBA 3QC3A 3SFKA 2NLYA 3RFWA 3L5AA 1Q1CA 4XD4A 2FZBA 4X0NA 3RLVA 3JRKA 3UI5A 3TN5A 5EGRA 1QI3A 4HMDA 4TVUA 3S6OA 3NEHA 5J6EA 1L8PA 4OHQA 4UTMA 1HVXA 1TCOC 2PDJA 4G9PA 3CWOX 5LXXA 1PINA 3DFPA 1KGUA 3DYPA 3SW6A 1DIEA 2P10A 1YTDA 4Z1BA 2P88A 4LUSB 1D7KA 1EYMA 3SRHA 3BW4A 3NPUA 3LRLA 3K30A 4LH8A 4G8TA 2BVTA 4LX4A 4XAFA 4HPJA 3VD7A 4JDYA 2DZBA 2JEQA 3FK4A 2AWGA 2BOFX 1J5SA 3AJXA 4DWSB 3CT7A 4QP0A 4C60A 2DU2A 3KLKA 1C8XA 2PPNA 1N82A 5J8LA 5HKGA 2HNEA 2GSHA 2VWSA 3U9IA 1E70M 2KAUC 1YNPA 2WB5A 3WQWA 1LROA 3GVQA 2PU0A 1A53A 4DO7A 3I10A 4LYPA 4D6FA 1US3A 3RXZA 3TTQA 5HWMA 3V5FA 4QGCA 1KLZA 1GG1A 1V6VA 3VGEA 4BI6A 3CH0A 1Y0EA 4HZ7A 1PKYA 4EF8A 5FEWA 1GW1A 3T08A 2IKHA 4LBRA 3WLTA 4ZO6A 4LWWA 1VC4A 3FA4A 3CQHA 3CHCA 4A2SA 3GK0A 4HA1A 4BY3A 4FNRA 4GLEA 3W7CA 3R5EA 4AZ5A 2WMJA 3SGZA 1O7AA 2VGBA 5C9ZA 4MVAA 2VUNA 2MLXA 5FI8A 4A8IA 3D47A 2QUVA 4DHGA 1AL8A 1QT1A 2VYOA 5H8MA 1RA5A 3QGKC 4I9JA 3CZLA 5CJMA 4JQ1A 1X8FA 4QLKA 1NQKA 1RA0A 2WQDA 3G1FA 3AO0A 4HOXA 1PX4A 2Z28A 4B4FA 3CBWA 1P4CA 1S2TA 1VYSX 5CC3A 1IEXA 3KVMA 4C1NB 4DRHA 1VEOA 2Y61A 4C6IA 1S2UA 3BH4A 1UWIA 3GXTA 5DRCA 7A3HA 2NQLA 2J77A 4HVXA 2X2GA 4MNLA 4JTTA 2HBXA 2UY4A 4QJ4B 2R82A 3QPYA 4GCAA 2D24A 3UZJA 3DU0A 5F2MA 4IIEA 2DG9A 4FX8A 2Z1KA 1WDPA 2W92A 2O9OA 2HROA 3LZ3A 3UA3A 2XWDA 4NVTA 4A21A 1A5MC 4H4IA 4B3KA 1JG9A 3AWNA 3SCTA 1PWLA 3LHYA 3MWCA 2WC4A 2VFIA 4FF7A 2PP1A 2ZUSA 5G2IA 1SFSA 2X41A 4H19A 4FP1A 2ZIDA 5J04A 3V36A 2BY3A 4HNCA 3S1UA 3NZPA 4CNPA 1XIGA 4JHZA 4BQ3A 1AD1A 3N4AA 8CGTA 1Q66A 1C7SA 4NL1A 3ZFHA 4UUIA 3VOFA 1X97A 6REQB 1SW3A 1BF6A 1NP2A 1GG0A 3MYPA 1YRRA 1POKA 4K1WA 1V3IA 1P48A 1UP3A 1DP0A 1QVBA 2DT2A 2PLJA 3LZ5A 4L9XA 1UUOA 4HJWA 3T2OA 3AWOA 1WXJA 3LLDA 2XVNA 4UIOA 3H4WA 3PTDA 4QDWA 3G1SA 4XZWA 4RXFA 4H7CA 2RDWA 2VGGA 4GKTA 4JS3A 3W7KA 1SYTA 3PNZA 1ML1A 3KL3A 3OB8A 1I2RA 5C9RA 5KETA 5E70A 1XDMA 4RZ4A 4JEJA 2PWEA 4MF4A 2EF9A 3ABSA 4M56A 5JH2A 2EJ1A 3ARZA 3CYJA 3QEZA 3LU2A 4JX6A 5KZMA 1JCYA 3EWXA 3W2NA 4HZ8A 1ZJBA 1XWYA 1LLZA 3U2OA 1UA3A 4S38A 3IARA 5A2CA 3WDJA 1JF6A 3WLIA 3TJLA 6A3HA 3FHAA 1LOQA 3OYZA 1AQHA 2IF4A 3SQMA 3C5QA 2VEPA 1TV5A 1XIMA 1KTNA 5CPQA 3EY6A 1NEYA 2HS8A 2DSWA 3ECQA 3B4YA 1GK8A 2ISSA 1HGWA 4UCGA 1I2OA 2E40A 2PD5A 4XD3A 2TYSA 4BEQA 3N9SA 5HJYA 5A8QA 1FJDA 1GORA 4E8CA 4LRSA 4Q6XA 3VPLA 1IR1A 2D23A 4GUFA 1GQNA 2PE4A 1SJAA 3QYQA 5KZEA 1GOKA 3UQAA 1V6TA 4JTUA 4P7OA 1UR9A 3NJ3A 3MP5A 4EWND 1E0XA 3MHFA 2Y70A 5AHNA 3GHTA 2ZADA 4HU3A 3S3GA 4JL2A 4PRTA 1B3OA 4ALDA 2NQZA 1FKRA 3IAQA 4ILSA 1UWAA 4L9YA 1FDJA 1WV2A 5DCDA 4ODNA 3GG0A 3BCJA 4MGVA 4C1KA 3OA3A 1HNYA 2ZR4A 5T26A 4DPPA 3DKLA 3ZLHA 4GIAA 3FVDA 1P6WA 4B5NA 2D1ZA 1TPFA 1IEWA 4DZ2A 3I68A 4B5VA 4JFJA 3NQ2A 4D6IA 2A3LA 1GZGA 1JAEA 2NX9A 3FGCB 4C5YA 3LTPA 5AB3A 2GUUA 3PR2A 1OJXA 8XIMA 3UW6A 3S1WA 2RFGA 1Q6DA 1CDGA 2OLAA 1O94A 5EMLA 1FCQA 3B4UA 5FJJA 4ZFMA 3T0DA 2IS7A 4OBRA 2H3BA 1PBGA 3LI1A 4LV9A 3KE0A 1JCTA 4WXZA 2OT0A 3WBWA 3LDVA 4QZVB 2I5QA 3ME3A 4X2RA 3UWZA 1UKTA 4D8ZA 1WOAA 5BOOA 3T0BA 3U5UA 3GB6A 1A5NC 3BICA 2DZAA 3PF3A 3UZ5A 1VF8A 3VX1A 4DIPA 3RAOA 3HPAA 3LV6A 4Q32A 5FKYA 4LAVA 1H7PA 3ITGA 1S5NA 3URQA 2GGGA 1XLGA 1GKQA 4JYSA 1NM9A 4YVVA 2HRWA 4FLSA 3OG2A 1EOMA 3W6LA 3NGFA 3UA4A 3AS2A 3VNJA 1KBLA 2QEZA 4OTKA 3KAGA 5ABFB 1P0BA 4G1NA 1TSIA 1F05A 3SECA 3UWYA 2DT1A 3EGJA 2K8IA 2ISWA 2R94A 4PFHA 4GBUA 4NKCA 2W67A 3MT1A 1CXEA 5BMXA 1FHDA 4NNRA 4HNNA 2E7FA 3LX9A 2D0FA 1NDZA 3NFUA 3N6JA 1R46A 4MMWA 3KZ7A 3LEPA 2YYTA 1OYAA 4LBUA 2Z00A 3PANA 3NQ6A 2P0IA 4E38A 1P5BA 3M7WA 4JHMA 1GVIA 2KE0A 3S6DA 1XG4A 4GE8A 5D09A 1YE6A 1FWIC 3WUBA 4F9JA 3SIMA 2XGBA 3BV4A 1R2TA 1E0UA 3TWBA 2WNZA 2PRHA 1DXEA 3EMQA 4O11A 4M1RA 3WUFA 5DMLA 3H53A 2DSZA 4PBEA 4HCLA 2XVGA 3VM5A 1QO5A 4YNGA 1M7OA 4JFIA 1MQQA 4QE5A 1ICQA 4KGLA 4K37A 3APYA 1H41A 3VIHA 1ZB5A 4NJJA 1J9YA 3R58A 5CSYA 2PUZA 3VK5A 4KS0A 4D1IA 3LOTA 4OVXA 4NHVA 4W7UA 1ZGDA 5A6LA 3LUOA 3MI2A 1FWRA 5CZTA 3U7VA 5H2ZA 2HBVA 1G7UA 3TCSA 2FVLA 3H7UA 1MXSA 5CGMA 4KWUA 3C8NA 4IP4A 2D2JA 3LM7A 4TMCA 3O9NA 3H2AA 4KKXA 3ZT6A 1H4PA 4ECLA 2ESCA 1G69A 4DI8A 3KTCA 1PVNA 2JQXA 3PZMA 5JH8A 3C0QA 4OUIA 4AXNA 4CCZA 1WO2A 2WHJA 4JGDA 1Q45A 2DFAA 4E2BA 2J8GA 1S5WA 3WH9A 4US5A 2YFNA 4K1GA 2J25A 1JCHB 5ECVA 4ODKA 3KVJA 3L21A 5K4ZA 3L4VA 2Q09A 1KFCA 3B7XA 2WSPA 1G4PA 4Q8MA 4GFIA 2VFHA 4LBSA 2RHGA 4NX0A 3GHRA 1GQKA 1R3WA 3GFZA 4QE1A 5E5CA 2P8CA 1V79A 2I5IA 1TR9A 2XFYA 4JYDA 5CJNA 4DXXA 1YDVA 4JCLA 1TQXA 2E9MA 4XK2A 3BGJA 3QY6A 3ANUA 1Q6FA 4LF2A 3F03K 3PTQA 5FESA 1V08A 2A7PA 1TMHA 3WKZA 3QLDA 4A8RA 2P4VA 5BCAA 5DIUA 3W87A 4CU8A 1AG1O 1AK5A 5IRPA 3WD0A 3WENA 1M9HA 3GM8A 1KT0A 5E0KA 3BXWA 4FS9A 1TX2A 4RDYA 2GJXB 2VNCA 4Q22A 2ZRUA 2I7GA 2YGYA 4ZL1A 2DSKA 1RJQA 3I65A 3ANVA 3RRXA 3N11A 4Q8QA 1A3HA 3H2CA 1R3TA 4IQJA 3PUGA 3AJ7A 2XSBA 4HNVA 2A1YA 4U84A 2CWNA 4ZEPA 1WX0A 3NUKA 1UQZA 2O9PA 1NDYA 1VENA 4HNLA 6PTDA 3DH7A 5HUAA 3E12A 3N04A 3I4EA 4PMQA 1H1ZA 1VLWA 1JNTA 1R5YA 4RE0A 5AHIA 5D38A 1TPEA 2GZXA 3UVAA 5D30A 5LGXA 1XLAA 2XH4A 2GSJA 1NFGA 4QLLA 1W1PA 4DRMA 4PUMA 3PG8A 5CXPA 5C71A 3UESA 1XBZA 2LJ4A 3TJXA 4H6KA 3P67A 1ELSA 2PDIA 2YKKA 1K4HA 3GKFA 2Y7GA 3MA8A 3V3WA 4ZQCA 3GC4A 2Z4GA 3W3OA 1P7TB 1V4YA 5AYIA 1O5KA 4UQDA 3V0SA 4HCDA 3ZVHB 3VD9A 4CEXC 2JFEX 4ZOAA 5K3VA 1F4AA 1XYFA 2Y5JA 4AY7A 2J75A 4PMNA 1PE1A 1XYZA 1NFBA 1CGXA 4UTJA 3DKJA 1MO0A 4H7ZA 2R8WA 1E40A 2JIWA 1S2VA 5LNUA 2QJJA 2ZZ7A 1B90A 1IWBA 2EG6A 2VCBA 5I77A 1WNOA 3B8TA 1DTUA 2PZNA 1ZBKA 1E6XM 4IMAA 2ZXAA 4QNEA 3IJIA 4UTTA 2HK1A 4Q4MA 3CPGA 5A94A 3LGEA 5E0FA 3FX4A 5EMUA 1LCOA 3IV3A 5E6ZA 4IMEA 2V3GA 3RX3A 5I02A 1B3VA 1LOSA 4GHRA 1FWHC 1R7OA 2XWEA 5D9OA 5FJTA 2V5LA 4LYKA 3LLFA 1W1A1 1W3IA 3G8EA 1H7NA 3B9AA 4GVIA 3OU8A 4JTRA 3QSRA 2E3ZA 4EKJA 5A69A 3APTA 3O5FA 2ZUUA 1QCWA 2OKTA 1JZ3A 1I2NA 2ATMA 1E9IA 4MWAC 2P5NA 5HR6A 4IG2B 4F0MA 4LAMA 1BXNA 4GQGA 2GJRA 4ACYA 1MEHA 1OC7A 1S1PA 2Z24A 4ORIA 1EHNA 2F6UA 1D3CA 1DWAM 1X1ZA 1L6WA 1Y65A 4L61A 3VGBA 4DRIA 1H3GA 2FGZA 1BWKA 4LCQA 4IUGA 3H2NA 4PB5A 4WJ8A 1E3ZA 4AX7A 3ZOAA 1OFDA 2QHAA 1E15A 4XZMX 4KQZA 4R5EA 1FKWA 4BF7A 3U0HA 3EOEA 3DAQA 1OCBA 2SFPA 1PZ3A 4MG4A 4UBPC 2V9DA 1CXIA 4M5PA 2QJNA 1IYXA 1FKHA 2WVVB 3BVJA 1SO5A 1GHRA 4AG0A 1JPMA 4W84A 3LCLA 2ZWZA 3C2EA 4QISA 3F1QA 4MYXA 3VOCA 3NDYA 5CC6A 1DJHA 1JVNA 5JU6A 2A3CA 1SO6A 3VUSA 4KIRA 1KR0A 3NL2A 3BMVA 1SM9A 3KADA 1N7KA 4UDMA 3MANA 4OOZA 3S83A 5EBAA 3FV9A 2ZICA 1ROTA 1HQTA 4E8GA 1W2PA 2WW5A 4O0QA 4RV8A 3WDPP 3EZ4A 4WF7A 1Q7QA 3A9IA 2PSNA 4NYYA 1B6CA 2ZRXA 3DG6A 4FK9A 4GUGA 1QPRA 4MKVA 3V16A 1HKMA 1V02E 2Z29A 3EMZA 4MWAD 2PTXA 4QITA 4R33A 2ANUA 2GGEA 2CITA 4CCCA 3TC5A 4O53A 1SQ7A 2VZSA 4JTSA 1BVZA 1B5TA 1SZNA 4OQVA 3ITXA 1XLBA 1FKXA 1XG3A 2G50A 1X98A 4IJBA 2V68A 2R1MA 1Z8AA 1IF2A 1TJRA 5DO2A 4ZSTA 4XWUA 1W9VA 4D72A 2BGQA 3SCQA 4Z1DA 1OFPA 3EAUA 3K5XA 3TU9A 3I7RA 1EUAA 4Z2HA 3VIFA 1TWIA 5DBTA 2CBUA 3VDGA 1DIOA 2DIEA 3KBVA 2OQYA 3I7QA 2GJNA 4WSKA 4WXYA 4AZBA 4ZENA 3LCWA 4QDMA 4J2PA 4E5TA 4IGSA 2PWFA 4FPSA 1EQCA 4S3CA 1FCUA 3C0JA 3G1XA 2PDBA 1BQGA 2KGJA 5CC5A 3N29A 5FF0A 2Y62A 3NPXA 1A49A 3NSXA 3TYEA 3RG6A 1TQJA 1WYIA 3IGSA 4C7GA 2DUAA 4L5ZA 3N1AA 2KR7A 1LRQA 2HWGA 2MANA 3IK4A 1LT7A 1RCQA 4O14A 3DGRA 3THDA 2WNWA 3MO7A 3REQB 1FCVA 4DAIA 4NRRA 3GDTA 3DHFA 3CTTA 5EFDA 2PD9A 4H41A 3U8GA 1AD4A 1QXLA 1LTDA 4ZB2A 3RU6A 3WLHA 3RCYA 3S1VA 3TC3A 1LUCA 3EMCA 3T9PA 4C5ZA 4ES4A 2QYGA 5C8BB 2QCLA 4H9VA 1DBTA 4G50A 1FBAA 1XLHA 3PTMA 1QNRA 3MMDA 1AUSL 2OZ3A 4AIOA 1IWPA 2WJZA 2J78A 4RNJA 3CZJA 3ZXWA 1BGAA 2YIHA 2YL9A 3OOBA 4UNIA 4XBSA 1G0CA 4B4HA 2G96A 3JVAA 2C0HA 5I5RA 1SR0A 4IPJA 1GT8A 3WK1A 4I9TA 2Z1BA 4GCXA 4KRZA 4ADUA 4PTVA 2WMKA 4DWSA 1UD8A 3WL0A 2FB2A 4GH3A 5CGTA 3TJIA 4MYAA 4M1BA 5M3WA 1CGYA 2NUXA 1EH9A 1Q63A 2JF7A 1HKJA 4RNIA 3RM4A 3AXHA 1GJPA 1JFHA 4XAGA 5BOEA 3LTYA 4TW6A 3CNYA 3P61A 2WPBA 4ML4A 1X7FA 4WX2A 3GC5A 4LYQA 5CPLA 3DFOA 4J3WA 2CHNA 4B16A 4O28A 4E6MA 3M44A 2FVKA 2C0AA 4L4LA 5A8GA 1IEQA 4R27A 5I23A 4MWAE 1AH0A 1K9DA 4BA0A 3W29A 2OCZA 4BWLA 3LNMA 3WN6A 3LPGA 1UIOA 2C14A 3TW9A 4ZQOA 2OEKA 3F4CA 2J24A 1XCXA 1A3XA 5CPSA 3UI4A 4OU1A 3CZKA 4IP7A 2VR5A 3VIOA 4C1NA 1M3UA 4MAZA 3QY8A 4J7RA 3DFYA 4ODOA 4REQB 2BY2A 1U79A 3PY2A 2Z2UA 1GPFA 1O66A 3PULA 4UFMA 4Q8TA 3T8QA 4CD7A 2PV1A 4CGTA 2FJKA 3KWSA 1XICA 2WXDM 2PDMA 2R1NA 1E0TA 2WVTA 2RJHA 1JI2A 4E3VA 4EXQA 1I4NA 5H1WA 3IRSA 5CBJA 1W3JA 3SURA 1O5RA 1DQWA 1U30A 3C2OA 3ATZA 3PS7A 3TYDA 3CUGA 5AKQA 4C7DA 3GR7A 4L4PA 4UMAA 3VYLA 3O05A 2VMFA 4K38A 1W1YA 1HJSA 3K46A 2BODX 2A5HA 3CWNA 3KCOA 2VRKA 4XZLX 1QUMA 4TX9A 3N6HA 3KCEA 2V3DA 1GOOA 1OG0A 3GD6A 3W2MA 5D2WA 2C71A 1TTPA 2IPJA 1UASA 4S23A 5D75A 3IUDA 5A95A 1P0EA 4CD4A 4WLCA 3MPGA 2V69A 3A3WA 2ZZ4A 3OTRA 2QULA 3IIOA 1H2JA 2QCNA 3THQA 1UWUA 1KBBA 2A7NA 4M8UA 3KOFA 1EF2A 4K8HA 3MU7A 3HURA 4TTUA 5HT1A 4Z0SA 4OKDA 3KVKA 4W9PA 1WE5A 3CASA 3VTRA 4WDXA 3GYCA 3UY7A 1EYWA 1KCKA 4FIQA 3VKKA 1J5TA 3VE9A 3STEA 3WQPA 4HARA 1ONWA 3NZGA 4OIFA 5T8GA 3SQSA 1ME8A 3L7RA 5REQA 3GR4A 4LVAA 4CD8A 1HX0A 1KXVA 4RX0A 2HISA 5TD4A 4XVDA 3IIPA 5CZSA 3W7GA 2WVVA 3KRBA 4ZBCA 4D6HA 1JYVA 1FTXA 4D6CA 3HG4A 4D1JA 4GY0A 3GLCA 3L23A 2WZHA 3GU1A 2OX1A 1MDLA 1E1CA 1BHGA 1W8SA 4PB4A 3LCFA 3CGNA 1XUZA 4N2YA 5EA9A 5C7HA 1UH4A 3WLOA 3SY8A 4KH2A 2E6YA 5BWAA 2VCDA 2PA6A 3R0KA 1CLKA 4RW5A 4B91A 2G8ZA 4V1YA 1L6YA 1TE1A 1BRLB 2BMBA 3O6DA 1MW0A 4JD4A 3WDRA 2ZTKA 3MSGA 2ZRZA 2PN0A 2O55A 2AAMA 2C91A 4GY7A 2Q5AA 3GDMA 4JN7A 3B40A 5EPDA 3WQCA 3QMTA 2BY0A 3A4JA 3UY8A 3U7BA 1AH4A 1FWJC 4LEQA 2X05A 3T40A 3HN3A 3UZZA 3WFZA 3L2IA 3KOYA 3BPWA 4PCPA 3QMRA 2CZEA 1M01A 2WMIA 2ZDRA 1F61A 3H2EA 1F8IA 4S2CA 5GVJA 3TOYA 1I2QA 1KFBA 1ZENA 2VHLA 3WQ5A 4MUPA 3VX0A 4I9MA 1FKBA 2HPIA 1CB2A 5LA0A 1VKFA 3G3MA 5ABHA 5B8IC 5M03A 4WVXA 1TKKA 2P3EA 1PCKA 4U4MA 3HJZA 4HPGA 4LUTB 2NUWA 2YL5A 3NSNA 3G24A 2E1DA 5HW6A 2VVNA 4IH3A 2KX9A 2PV2A 2F6KA 5HAOA 3UG3A 2P3ZA 1RP9A 3HPZA 1A5CA 2OX4A 3MJYA 3UZXA 4JEQA 5L9FA 4UFLA 3U4AA 2VTFA 4J1OA 2R1PA 2XIOA 3D46A 4BQ5A 3GDKA 4KPLA 3NIYA 5BRBA 3GNRA 1WPCA 2XJ7A 1GVOA 3DOPA 3QHMA 1EDTA 1GKRA 3FDGA 4RW3A 3B9EA 1KCZA 1KFKA 2VEGA 3ITVA 3VIPA 5HWNA 3ONCA 1BYBA 2WSKA 1RD5A 3C2FA 3ZR6A 1K7FA 4LY8A 4BHYA 3WF1A 3RGCA 1O5QA 2C3ZA 2QF7A 4J3ZA 1F3WA 3U2EA 1X96A 1VFFA 4CCDA 1C3FA 3TW7A 4C90A 1UD3A 2DG3A 4GNVA 3UNTA 3ZIZA 4N19A 1A4LA 3CAWA 3S5NA 3BJFA 3JYMA 4ZE5A 4E2OA 3WY1A 2Z7GA 1XLJA 4MB4A 3U3HA 1JDCA 4QFUA 1QHOA 1H51A 1MMFA 2ON3A 1QPLA 3VZYA 3OPSA 4AB4A 1E43A 3NO3A 4Z17A 2RUQA 2D9FA 1R3VA 1VIWA 3CS2A 2TAAA 4A35A 2ZZ5A 1IX5A 1EKOA 5DIVA 1A0DA 1DV7A 1R0MA 3W0KA 3CO8A 3UPBA 5C6MA 1S46A 3QY7A 4FOJA 1XUUA 1WZMA 4TW7A 4H7VA 1LG1A 2Y1HA 2G3NA 3MI3A 1AH3A 2OO6A 1DWIM 5AECA 4L7ZA 3V18A 2RUDA 4HMEA 5EY5A 3WD4A 2V3FA 3SZ8A 3W82A 2CFFA 4GUIA 4JTKA 1JPIA 1XIBA 4WJEA 4W9TA 3I3DA 1OEPA 2ZXBA 1M41A 4L6OA 4D6EA 1EJXC 4R7OA 4ROQA 1EC8A 4FXRA 1ME9A 4KESA 4M6VA 4MJMA 4NJIA 3AIEA 1TA3B 4GKLA 4N9BA 1Q6RA 2Y89A 3LG3A 2FJUB 4HB7A 3S0CA 2FKEA 4HSNA 4P5UA 3RNDA 2V67A 2C1GA 1ODZA 2YYUA 2B7PA 4TXEA 2LKNA 1LYXA 4WKHA 4PA8A 4ICNA 4B5WA 1E4LA 5D2YA 4OFCA 5XIAA 1PKLA 3O5MA 1HTIA 2X09A 3PSWA 1S2WA 1I1WA 2X0SA 4LB4A 1QI5A 2QJGA 1E72M 2IQDA 2XZ9A 2OKOA 1M68A 2V5CA 3FSUA 4EPDC 2PDHA 3GTYX 3DI0A 1VD6A 3TXVA 3LHVA 4TTGA 1MZHA 3FYOA 3ORWA 3HPSA 2VXNA 5HINA 1K8YA 2OSWA 3WNPA 5LIXX 1ECQA 1ZJAA 3NOEA 5HW8A 1SVDA 2GSEA 4IPPA 3PZIA 4HOWA 4Q4OA 4JNYA 2WM0A 2Y8KA 2YLAA 4AC1X 4TO8A 3S5OA 3N13A 5DF0A 4BF9A 5J5DA 1Q6HA 2CU0A 2G4FA 4N6FA 3PUEA 5D2VA 1B0IA 4UQ9A 4B5TA 2PLCA 3ICJA 1HJVA 1OBAA 2QW5A 4G2DA 1FWBC 1J12A 5FJIA 3GH4A 1ZJIA 4HOZA 4B5UA 1C9DA 3F2CA 4FLOA 1XLLA 1QMLA 5CJ5A 4XTDA 3S5ZA 3BE7A 3M6YA 3Q2DA 1ISVA 3GHSA 5HUOA 2QDHA 1OM0A 3GY1A 1UOZA 2PWDA 1VFLA 3T0TA 1KM1A 4G7EA 1DHPA 1BF2A 3PZTA 1XFBA 2O7QA 3QBUA 1KFJA 4PMDA 1TJ0A 3I6EA 1FKIA 3HG3A 1C8QA 1X39A 3Q67A 2J7GA 5FAJA 3PNUA 1XLIA 2E9BA 1VB9A 1UB3A 3W1XA 3NM3A 3B9DA 2DEPA 3W84A 1GOIA 3M0YA 2AL2B 3IUIA 3EX2A 2IXUA 3RIKA 4YMZA 3J7HA 1K8XA 4O13A 2QPUA 2J7BA 1FCBA 1BXBA 1ZK6A 3AYVA 2FZ8A 3PRBA 5DMMA 4JFVA 3B0VC 1BWLA 1TPB1 3SDOA 2X8RA 5C9XA 3TVAA 2J7CA 3WD2A 1BD0A 1FDYA 1ISXA 1XV8A 1K9TA 2VDHA 4MY9A 9RUBA 3KDOA 3I6TA 4M82A 3T42A 2FHCA 2NXGA 3UR7A 1HN1A 4YTQA 5FEZA 2J6XA 4GI6A 5M17A 1KQZA 4NSBA 1SZEA 3ZWTA 4IQCA 2HQAA 4MPQA 3AC0A 4PTDA 1E51A 3UZWA 1H62A 3C56A 3U2ZA 1W8GA 4I5RA 4K39A 4GYPC 1NIUA 1JNSA 3SCOA 2VFEA 1Y5VA 5DT5A 5AC5A 3WMSA 4QNWA 2PC4A 3GVRA 3W24A 3W7MA 5FCZA 2EULA 4F3HA 4RJEA 2IPGA 2DJXA 3V5OA 2IMRA 5CG7A 1A5SA 4N9EA 5G4WA 5HDRA 3FY1A 4TNSA 4NF7A 2WJDA 2Y2WA 4HPHA 4A4AA 3T0CA 5TNVA 2F9RA 1XPYA 4MB1A 1OADA 2M1IA 4O1BA 3BOFA 1VCGA 2XGIA 3MB9A 5CG0A 3ARYA 4ZPTR 3CPUA 3KTSA 3FA5A 3WF4A 2BP1A 1X6LA 3U2CA 3WF2A 3W22A 4EIVA 3T05A 2YL8A 1I75A 3ARRA 4CN6A 2WLZA 3M46A 3P80A 1MFUA 4JTAA 3H23A 4R85A 2F2HA 3COTA 4GYKA 1OYCA 4XD6A 2F84A 4H9UA 1FAPA 3QPEA 5DQPA 1XRTA 3R1ZA 4L6HA 3M0HA 1JXJA 4GJ1A 3HGRA 1LQ2A 3WH5A 1MUMA 1V3KA 3I3BA 4PC8A 4YU1A 3A4AA 3LSCA 1XYBA 3B8IA 2PBGA 2QXWA 3W86A 2Y88A 3B0UX 3GNDA 5F4WA 3O06A 3N9KA 1JRCA 2ZQUA 2JKEA 1QNQA 5A6BA 3M6DA 2V63A 1LJYA 1KD0A 1ZHAA 2QUMA 2AGKA 4FNQA 3W25A 1BLIA 6ALDA 3STGA 2A0NA 1PIFA 2JE8A 5CH9A 1PX3A 2F38A 3D0CA 3WBEA 3BAWA 4KQNA 4L80A 3AALA 4LPCA 5HMDA 4PRRA 1FP8A 3RCNA 3W9ZA 3LTSA 3G5EA 2YR1A 1NSGA 4IIHA 3TAOA 1Q6UA 4B90A 5DITA 4FR1A 4AQLA 4FMVA 2PPPA 1R9ZA 5I00A 3ZT5A 4AU0A 3ZT7A 4DO4A 1ZFJA 4QG9A 2QDGA 4TX8A 4MAVA 3MDWA 4DO5A 1IXPA 3ARXA 1BL4A 1UZ1A 2FTPA 1XRSA 2CYGA 2YXXA 7ODCA 4HKPA 5DX7A 1PDYA 3HQOA 2B81A 4PRWA 1YPIA 1RY0A 4URIA 4HBEA 5IOBA 3OGRA 4BZYA 5BMWA 1RK5A 1E1EA 3NQCA 1CLVA 2WSYA 2PI6A 3T55A 2BWGA 2GVJA 3BANA 4C91A 4UFHA 3IJ9A 4HHLA 4RV3A 5CPOA 3WDQA 5KINA 3TTYA 2EGZA 3OBAA 1EIBA 3R8HA 1R47A 1RK6A 1O6IA 3ONBA 5FL0A 3D3FA 4F0KA 2WPGA 1WUFA 3M41A 3AFBA 3PZVA 3URAA 5HUPA 2CLKA 3BCFA 4GI4A 4E2DA 2DZWA 1CXLA 3O3RA 2XN0A 1KBIA 1R3YA 3TA6A 4MKNA 4HPXA 1JUBA 2ACSA 1GQJA 4KIEA 2ACUA 1ADOA 4A8LA 3SCUA 3VO0A 4C6CA 2POTA 5LIWX 2CXGA 1MVYA 1E73M 4FSAA 4H9XA 3RPMA 4DZIA 3K4WA 2PDPA 4PMUA 3E3HA 1OT1A 2CHRA 1PZ2A 2Y5EA 3K1GA 4MY8A 4ZTYA 1FP9A 5I0DA 1ROUA 1JF5A 2WCGA 2QUTA 1KBJA 3KS5A 2WCSA 1RQBA 4S3GA 4C6EA 4DXKA 1YDYA 2BDQA 4JTEA 2PTWA 3A6OA 2X1TA 1J01A 2J7FA 3WK0A 2PTYA 3QR1A 4WDTA 4G2PA 1DQXA 2QPXA 3VABA 4PBFA 2E1WA 2PMQA 2VP8A 3LD5A 3G1HA 2Q6ZA 3EBVA 2VDGA 1VHCA 3O5OA 1EWEA 2OPJA 3FS2A 1VJIA 4W5ZA 5JMUA 2XN1A 4TUFA 1F3TA 3SN4A 2OWWA 1J79A 3PRDA 3C2YA 2AAAA 3VNZA 2G5WA 3LRMA 5E9AA 3QV7A 1KRCC 1GZJA 1VFTA 1XD0A 3TNOA 4U2ZA 1OG6A 2E4TA 1K6WA 4A2RA 4US6A 1OCJA 3V35A 5C9WA 3CIWA 4UQBA 4I90A 2ONEA 5GNZA 3NEVA 2DVTA 2A6LA 1UC5A 5BXRA 5EU9A 5HW7A 1F3EA 3EXTA 5CSSA 3ERPA 3O5RA 3R4IA 1SMAA 3QGAC 1P0NA 3IJ6A 2NXHA 2H8XA 3VZZA 2VX4A 3APGA 4J35A 2YZRA 4HGXA 4XZNX 3L4UA 4LUYA 1M5YA 4IQDA 1W9XA 2PTDA 2DVUA 3VAVA 9XIAA 2WMGA 3AHVA 3AIWA 1HXVA 3DG3A 2QMJA 1X6UA 1QAPA 3DFNA 4UWMA 1QNVA 1T41A 3PZUA 3Q58A 2NWSA 3IVUA 5G1TA 3GW3A 2VJXA 2INEA 1KM4A 1IEIA 1HKVA 1XFCA 2CHOA 3BSGA 3IJ7A 1BKFA 5FJRA 1Z48A 1FDZA 4Y8EA 3PSVA 1HT6A 2QDDA 1PAMA 4FA3A 1HJWA 2ZOXA 1WXYA 3C86A 4W8BA 4V2XA 1UZDA 2ABBA 2ZX7A 4GWEA 1PWMA 1DE5A 2YX0A 3R0DA 4DNHA 3QN3A 4NXSA 3SUUA 1UA7A 3NURA 1G67A 1JZ5A 4ZZ9A 3JZEA 2YA1A 5D05A 4MTVA 2H8ZA 1HW6A 1ZZMA 3CJPA 1OFEA 3H7RA 5IM51 1EUNA 1K70A 3IV8A 4PCSA 2Y8VA 3DBPA 3HTWA 2VX6A 4U28A 1MEIA 1J0YA 5HR7A 1M03A 2B7NA 2GJXA 2A3HA 4UQAA 2VX5A 3QHOA 1EGMA 3CQJA 2G3IA 1XLCA 1LOLA 3VIIA 3RJXA 4LJ3A 3VC5A 4GBDA 4UFJA 8A3HA 5I3FA 4LW7A 3DENA 3L68A 1UPMB 3O6YX 3O8AA 3TOPA 4X9YA 4PCTA 3OQ8A 3TCEA 2ZX9A 4MJZA 4DZ3A 3ARPA 2DGAA 2Z1VA 1AQ0A 1VEMA 4IPIA 4EOUA 5A5WA 1ECEA 1YPFA 4FLRA 1LM1A 3OZMA 3GH7A 4O18A 1Z9AA 1JYXA 2XM2A 2AQOA 4PUDA 1JPDX 2DT3A 4AD4A 1RXOB 1B30A 1V0MA 5GPRA 4DRJA 2RURA 3IPWA 1OZMA 3AHTA 1EB3A 3B97A 3UF9A 4TMBA 5TAOA 4RCXA 2YSWA 4UR7A 3VE7A 3BJTA 4HTBA 2HEJA 2HMCA 1VPQA 4J4NA 3W88A 3TTSA 1ZY9A 1M5WA 2YDSA 3MZ2A 3N15A 2RAGA 2ZXDA 1PTGA 5IXEA 4X60A 3KM8A 1LWJA 2W62A 3W37A 1LORA 3W1UA 8RUCA 1KGXA 3MSYA 1ZBWA 4GZIA 3AZSA 2GVLA 1G6CA 3OODA 1F8AB 2UY5A 2W27A 5A6TC 1SSGA 4Y9OA 2B7QA 3EPMA 3DX5A 2BGNE 3UCDA 3O63A 5CBBA 1VBHA 4IQLA 1Y7VA 4PN2A 1QPFA 2EPMX 3NVDA 1BGGA 5FD0A 2ZE3A 5AHEA 3VIKA 1C8YA 4G5DA 4EPEC 2BZNA 3G22A 1EC9A 4LRTA 3IGHX 4W8AA 1OGBA 3F4NA 2XPKA 3DI1A 4KMQA 4D9PA 1TV3A 4YL2A 4R9XA 3GC2A 3KP1A 4GGHA 1J0KA 1F9CA 3S5YA 3RO6A 4JHOA 1Q6IA 4DUOA 1U83A 3FAWA 3AYTA 2E6FA 3HQNA 2QCHA 1V3HA 1UR3M 4LAUA 1HL8A 3CH9A 4N02A 1TPDA 4P7RA 4UZUA 2GQAA 4RL3A 2R14A 1NMVA 2E8ZA 3LRKA 3WQOA 4M6UA 1G5AA 1Q8JA 1H0IA 4F4RA 4LV4A 3VNDA 4BR1A 3MSRA 3BL3A 1S39A 1BFNA 4WOZA 1B4EA 4OE7A 4JCMA 1T99A 3WELA 1BVNP 5EMKA 3RR1A 5I09A 3HGSA 4B2DA 3REQA 3W1TA 2A4AA 1YPXA 4L65A 4H9ZA 1N2VA 1OWQA 1JUKA 5F2IA 4DBUA 2PAJA 3FA3A 4PUNA 3GG8A 2YLLA 5A6SA 3KHJA 5HPCA 5EFFA 4G7EB 1JVWA 1CEOA 3RX4A 1DVJA 3BLIA 5CKSA 4NZ4A 3TQVA 2CZVA 2BXYA 4J2MA 1WB0A 3BTNA 1RQHA 1J10A 1WZLA 4JQ3A 5BXJA 3MMTA 3FXYA 3CT2A 2J27A 3QYSA 2QCFA 4TVCA 4BF8A 2ISFA 4HA0A 3TUUA 4GVFA 2BVYA 3P5ZA 2I9EA 4HD5A 1AZ1A 5C0QA 4WZHA 2D2GA 5IHRA 1AW2A 4QE4A 1UQYA 1S5MA 1EEXA 3W7NA 4O12A 1S38A 4NIRA 4JTGA 3WMCA 4W9OA 5LNSA 3WG6A 3MUAA 1W1ZA 3A3XA 1F7BA 5L6UA 2VEFA 1GYNA 1RH9A 1D7JA 4IX2A 1FXPA 3LXBA 3L4XA 3CL8A 4H9MA 4F0HA 4AC7C 1ODUA 1J6PA 2QPSA 2XG9A 3GHUA 2JK2A 2BHUA 3N34A 3OVGA 1XBVA 4LAXA 3K2GA 1QPOA 1WBJA 5F7UA 5TIMA 1ZLPA 3NQAA 3PG9A 1TMQA 3TQPA 1J6OA 3WL1A 4BWLC 3K4AA 3TSBA 2V3EA 1WUEA 4NP7A 4LNYA 3DC8A 3QKEA 1JEZA 2BXZA 4JKMA 4N0RA 3BLFA 3TONA 1BQCA 3CUFA 2BHZA 2YB1A 2XSAA 1ISWA 2VFFA 3TTOA 4C6NA 4P7NA 4AIUA 1RV8A 5G2WA 3PB0A 3DCPA 2FMOA 2Q3OA 1KFWA 4V27A 2P0OA 3ES8A 3HO8A 4QS6A 2FTWA 2PRLA 1B3XA 5I24A 4NQ1A 2CLOA 3S6TA 4ODQA 2ITKA 2GGIA 1CW2A 3G1AA 2NV9A 3OZYA 3AUOA 2D22A 2YOCA 7TIMA 2FPYA 3HQ1A 3OGSA 1A5KC 3BC9A 1K03A 2OGJA 3UJ2A 2VQUA 3KAOA 3HZ3A 4Q8PA 2GYIA 4ZPWR 3GG7A 3KS6A 4UC5A 4KCWA 4HA4A 4JXCA 1EPVA 1XRVA 1TFVA 1JNEA 4LANA 3MZNA 3VNKA 4JIRA 3SCRA 1DOSA 4XISA 3S2JA 3KWXA 1W5PA 1K8CA 1G1YA 3QH2A 1OHLA 1Z3NA 4YYCA 4AVFA 1TPC1 5KZ6A 1WDSA 1UR1A 5D8ZA 3OP2A 4HU4A 2D73A 2FGLA 2BLEA 2WNQA 4D8AA 1RPKA 2Z0IA 5B80A 4OUEA 1L2UA 4J3TA 2PV3A 4IM4A 1ZBCA 4M81A 4ZQNA 3CWHA 5LIKX 5HWBA 2OMAA 1M65A 4NASA 4DZHA 4W87A 3KXQA 1K3UA 3CGMA 2XPBA 4ODPA 1VBGA 3IJDA 5BRQA 1O4UA 1A3WA 1ZUAX 2P50A 4K6AA 5D03A 4QAWA 2DZVA 3LM3A 2GFTA 3N2MA 4IICA 5LHEA 1GVRA 1CLXA 3UQIA 2NT1A 5ABFA 1NSJA 4A3YA 5CAKA 5EYWA 1NWRA 4S3KA 3W1QA 2JBMA 3UGRA 3E49A 4MPKA 3Q4DA 3N14A 5IFPA 4MZ8A 4GQRA 3SCSA 1P43A 3T8LA 3AHZA 1TIWA 3M7SA 4POCA 1XBXA 3MUXA 5C2CA 2VOTA 3E6EA 1THFD 3SADA 3O5QA 3WO8A 1E44A 3A5VA 4MWAA 1TV8A 3WJXA 1UJPA 2EKGA 4WQ6A 2AMGA 4NI3A 2XZ7A 1K77A 2YA0A 4GI8A 2X40A 4LVGA 1MNSA 3KAHA 4DRPA 3VFLA 1I6NA 5LYRA 1OF6A 2VWTA 4AZCA 1QTWA 5JBFA 5KTLA 2VVSA 4QSFA 4CNSA 2H9AB 5LXEA 4F0RA 3PWAA 1JCMP 2GQ8A 4AWUA 3SB0A 1ZAJA 3TYCA 1JYWA 2OOFA 2ZXQA 1FHLA 3TJ4A 4DELA 4NXKA 1A4MA 5KZDA 4DROA 3QTGA 4IIBA 3ABRA 3JZUA 4DBDA 2VCAA 1S2AA 4WGHA 3PFMA 4AXKA 2DQWA 2YBTA 3ID7A 3T2PA 3CEPA 5FF4A 1XJBA 4GQQA 4RDZA 3QGVA 2PGEA 4QDPA 4Q7BA 3W2LA 2XUCA 2CESA 1E3XA 2W91A 5EBUA 1PB0A 3RITA 2E67A 3SI9A 1MQRA 1KV8A 4XB3A 1C91A 1UR4A 1W1TA 5HWCA 1UPPA 3IIVA 1EQPA 2ASHA 1FKTA 4Y6GA 3IEBA 5A3HA 3G18A 1E4MM 4HNUA 3GBDA 4US5D 1DJQA 3BGAA 1IT0A 5HA7A 1UKPA 3IUHA 4JTIA 4UQEA 4CNUA 1OCNA 4INFA 3NPVA 2ZQTA 4HTYA 2D2OA 3UZYA 3KOWA 4HHHA 4HCHA 2ZYFA 1PIGA 4DJEC 1H63A 5JUVA 4K7VA 1DTNA 4H6RA 2W4XA 4O57A 1E1FA 4OBTA 1XS2A 3DYOA 1QI2A 4CVUA 4LB3A 1TVLA 1VAHA 1O5XA 2B4GA 3LHWA 1OFRA 1JDFA 3O6CA 1A80A 4U31A 3PPHA 3TYBA 1TWSA 3WNNA 2GUYA 4F2UA 3QLLA 3B0XA 2VOMA 5AHMA 2INFA 5BROA 1VGAA 3AZRA 3QV6A 1V03A 1UJQA 3V0TA 2E28A 3P81A 4FNUA 2NV2A 1VBRA 1Q7MA 3W53A 5C9UA 3ITLA 4UMCA 2WHKA 4UTWC 3VIMA 3RFAA 4GFSA 1QNSA 4DWSD 3WH0A 2PDLA 4J3VA 2J7HA 4JFSA 4DRQA 3C8FA 1JI1A 1VRXA 4UCFA 5JH1A 5BXSA 5KEZA 1GEQA 1QASA 2QGHA 4WY0B 3RU8X 3IVSA 3VA8A 4AYGA 3H7VA 2DZTA 2CZ5A 5U4NA 4HZ6A 4RDVA 3WH7A 3HFYA 3QPZA 1J8VA 1KLYA 1PV8A 3H70A 2B0MA 1K9EA 4AD2A 5HJXA 3IJQA 1SJCA 1U5HA 3I6RA 1V3LA 5DELA 1TB3A 1FKKA 4YHGA 2WC7A 2GK1B 1FWAC 3M0XA 5TF0A 4IMFA 2A79A 4HN4A 1F73A 3UXKA 4QM1A 4B3ZA 1LBFA 5SWUA 1AMKA 1J0ZA 4Z1AA 4DM1A 2NQHA 4ENLA 2M08A 3MMUA 1WAUA 4JFTA 2G0WA 5HJLA 3Q94A 4LY4A 3TA9A 1BEUA 3PUDA 2Q8ZA 1S3HA 3W73A 3W01A 2X42A 5E6YA 2OG9A 1QI0A 3WD1A 4TV6A 1ZP3A 4JIHA 4O1AA 1KTBA 2NUYA 3JYJA 3NR0A 3PA7A 4HBOA 1ZRQA 4A3QA 3N4EA 3RK8A 1RP8A 2QKFA 2PBOA 5E0CA 1Q6OA 1AFSA 4AF0A 1EP3A 3T44A 3PJUA 4DWSC 3W1MA 5HOSA 4AEOA 4O2TA 2JF6A 1CNVA 1T96A 4CCEA 2MNTA 1HGYA 4LALA 1VP5A 3WD3A 4C6KA 1QPNA 1MUWA 3DHPA 3P84A 2ZX6A 3H54A 1EP1A 3A22A 4NAFB 2QJMA 4F79A 1C29A 2RQSA 4PMVA 4MNKA 4HHPA 4FF5A 4H01A 1E9YB 3S2LA 3CAQA 1GEHA 3FXGA 3VC6A 2DDXA 5DEZA 2CNCA 1JFXA 2E0PA 4DUWA 1YADA 3S42A 3AXKA 1MWOA 3W76A 2VM8A 3VINA 3TZFA 4I7WA 1DJXA 1H09A 3ZVIA 5E09A 5HBFA 1EDQA 3HIJA 3HF3A 4JN6A 3JXVA 3HG2A 3HFTA 3PWGA 3W7IA 4LUTA 3OYXA 3VD4A 3GZ3A 4IF2A 3IIZA 4S1FA 1RVGA 2DZSA 3L4ZA 4QEEA 1EC7A 3D3AA 3BW2A 2OZTA 3WBYA 2OB3A 1PZ1A 4I5XA 3A4WA 3GAYA 4ERIA 3QMSA 2QZRA 4LUSA 2Y7EA 3P7YA 3NQ7A 4ZTXA 1GZ1A 2MNRA 2R1KA 4UTKA 1XM3A 3R25A 2BV9A 3FEQA 1OT2A 3CIVA 3NOYA 4E0CA 2F7FA 1T11A 1PUDA 2J79A 1JPKA 1V3MA 4XVEA 3EA3A 1WZAA 3VKDA 3T09A 5LNVA 3GRIA 5CPNA 1HL9A 1GOQA 3CIXA 3W75A 1LQAA 3MJMA 1VFMA 3GW0A 3WH6A 3A9BA 3BLOA 4CQCA 1RJRA 2V5JA 3LV5A 3C4UA 4LUIA 1CPUA 4FEZA 3VD3A 1JL8A 4J4OA 5KSWA 2CBJA 2WO5A 4HA3A 3GTFA 4JNMA 1GYLA 4MFDA 1EO5A 1KKOA 4L3NA 3T1GA 3MKCA 4MB5A 4U33A 5F2GA 4E3TA 1OK4A 1UH2A 4WY0F 2DUZA 3S1GA 4LT9A 4PGLA 5GNXA 3EEGA 4IHCA 5REQB 2D3NA 9CGTA 4X63A 4O4VA 3B04A 1MI3A 3C0LA 3ZVHA 3AIUA 1WP6A 4RK8A 5HMSA 4PUKA 3MMWA 6TAAA 3UVIA 4Q8OA 2FZ9A 4NZ1A 3EIPA 2E9LA 3V4BA 1H5VA 5CEWA 3M47A 3PAJA 4EAYA 3UWUA 3QVQA 4TX0A 2IUZA 2KI3A 1B57A 2PFHA 4ZOEA 4MM1A 3E02A 3ZJ6A 1CECA 1G01A 4DZ5A 3G8RA 1RBLA 1R38A 1MRAA 2HS6A 3AXIA 3Q45A 3NQDA 2D69A 2J74A 4HHMA 4DY1A 3PAOA 1QPKA 4GK8A 3EWUA 4N4QA 3EOOA 2EHHA 2C1HA 1Q13A 3IGXA 4B92A 1V77A 1W3NA 3AMDA 2XH7A 1SO3A 3L4WA 2YCIX 1JD9A 2CW6A 1YIXA 2A21A 3S2NA 1DJIA 5CZJA 1UROA 4IQEA 1VJSA 4XQ6A 3SFWA 4Y9NA 1S5VA 1G9HA 1ZU8A 1PHQA 3RF9A 2CLEA 1W91A 4AZ6A 3O5GA 5FACA 4NJKA 4E4PA 1HP5A 3CZEA 4NX5A 5EMMA 1OVDA 1KRAC 1V02A 5A2BA 4JX5A 2Q02A 4GGQA 2C79A 4HMCA 3NI6A 2W63A 2NLIA 1PCWA 3QF0A