4WKFA

Crystal structure of human chitotriosidase-1 catalytic domain in complex with chitobiose (2.5mm) at 1.10 a resolution
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
368
structure length
368
Chain Sequence
b'AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitotriosidase-1
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 128
structure length 368
sequence length 368
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wkfA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wkfA01
5C71A 2NW0A 1EHNA 4PTMA 3N11A 3WUGA 3KL5A 4S3JA 1JDDA 4WKAA 1R8LA 1B9ZA 2CKRA 3RJYA 2O9OA 1GCYA 2PBOA 3SCQA 4Z2JA 4QP0A 5CSUA 1QOXA 2D0HA 1CLXA 1FH8A 2BVYA 4UQBA 5I24A 3LPPA 3RM9A 5BROA 4CN4A 4YHGA 2VI0A 4V27A 5A6JA 1CENA 4AZBA 3ZSSA 3BC9A 1BF2A 1I75A 1NOWA 4DWSC 1W9UA 5A6MA 4HA4A 1PIFA 2CIPA 1GNXA 4UFMA 2XSAA 5CLTA 3WDJA 1V3HA 5I0DA 4CKQA 3FHQA 4D6DA 3U5UA 3S2CA 4TVDA 4UQEA 2ZXBA 4ML4A 5C70A 2D3LA 2G3NA 4H8VA 5F7UA 1CGTA 1XH2A 3ZJ7A 4JAWA 5A6KA 3S6TA 3A3HA 3MMDA 1X6NA 2J62A 4PRWA 3ARYA 1VJZA 2PF0A 3N12A 3L2LA 4GXPA 7TAAA 3M7SA 1CXEA 1AQMA 4UR9A 1GQLA 2VRKA 4AEFA 2WMIA 2XVGA 1UD2A 2GJRA 1BYCA 2AMGA 3VIMA 3GXDA 1VB9A 1CTNA 3AIBA 4U33A 3OB8A 1HKJA 3T08A 1VEPA 4UQCA 3T0AA 3UETA 4P8WA 4MNJA 4ZXOA 3DHPA 3WF3A 1OT1A 3CUJA 1W3LA 3AXIA 4W87A 4B3KA 4UFKA 3UG4A 1V08A 3RIKA 1B3YA 3T2PA 2E8YA 1CGWA 4JFVA 4MB5A 3PHAA 2WZHA 3O2LA 1OIMA 1E6SM 2PWHA 1B0IA 4ZXLA 3L4TA 4WKHA 1SMDA 2CCRA 2WMIB 1UR8A 1G94A 2VQTA 4P8UA 1GORA 5GPRA 4OOUA 1IZJA 2Y4SA 3ARUA 3BSGA 1RD6A 2NT1A 1DWFM 1J0HA 3N18A 3K4DA 1E55A 3VDHA 4A3HA 2WLYA 5LYRA 1XH0A 1B30A 5CXPA 1B3ZA 5CPTA 3TTSA 2JEPA 2J25A 3PN8A 3AXXA 3T2QA 1W1VA 3VIPA 1PX3A 4A4AA 5HOSA 3TTQA 3BXWA 1HJSA 4CU8A 1DTUA 3W26A 1VFMA 3TOPA 4XZBA 3U7VA 2A3HA 5M03A 1WCGA 3EMQA 1GQKA 3ZMRA 1EQPA 2QF8A 1A3HA 3SIMA 1E73M 5FL1A 3FHAA 4IM4A 3UEQA 4Y7EA 2YKKA 2YBTA 2A3AA 1K9TA 1C8YA 5E09A 1OGGA 3IJ9A 3N17A 1HN1A 3FY1A 3ARXA 1V6YA 2DH3A 3GZAA 4MJ4A 2XFRA 4DUVA 2CITA 3VX0A 1CGXA 3VD9A 2W4XA 1M53A 3AIRA 3LPFA 4TUFA 3WD2A 4LYRA 3WSUA 3GXMA 3WDIA 2X09A 1UH2A 4TXEA 4W5ZA 3IJ7A 1B2YA 4KH2A 1QHPA 4AZ5A 4D6JA 4P7QA 1E0VA 1WZKA 1WPCA 3KEHA 3PZTA 3VGGA 3AS3A 1WAWA 4PSRA 2DH2A 3SCWA 2VL4A 1TVNA 5A8MA 5CGMA 1AQHA 5E6YA 2CPUA 4HTYA 2XM1A 5I6SA 1CGVA 3FAWA 5JIWA 3JUGA 3CZLA 5CLWA 1V3MA 1E5NA 2WLZA 5D8WA 5A2CA 2WCGA 2XIBA 1TG7A 2X8RA 2QMJA 1TUXA 2ZUVA 2PB1A 1D2KA 4H2CA 1J0KA 3NIYA 3AHZA 5BCAA 2D3NA 1PZ3A 4CVUA 1E6XM 2Y5EA 3MMUA 5DMYA 3VGDA 2Q8XA 1WKYA 3RPMA 1V0LA 1BGAA 1JZ3A 1FOBA 1US2A 4HMEA 1FH7A 4CVWA 3SEPA 1MQQA 3CZGA 2MANA 3L4ZA 1GJWA 4OOZA 2UWFA 2CNCA 1JL8A 2XVKA 4AXNA 2RGMA 3EDEA 2FHFA 3VMPA 2VZSA 2QLYA 5CPSA 1E56A 3GNOA 5HBFA 3BSHA 1B3VA 1AVAA 1VBRA 3AMKA 4H8UA 1NM9A 1UD5A 1FFRA 4PUEA 1GOKA 4W8BA 3APGA 3AJ7A 3WUFA 5ABGA 2CHNA 1LLOA 1W9DM 2D20A 1IZKA 4PMVA 1Q6CA 5TD4A 4PYSA 5HNNA 3VINA 1D7FA 1VIWA 4D72A 2ZX6A 1K9DA 3I3DA 3W81A 4HZ7A 1R87A 3K46A 3SCTA 3WMSA 1MW1A 1M01A 4IPLA 1UR9A 2BFGA 4PMQA 1ISXA 1E71M 3WQ4A 3IJ8A 1KXTA 4B16A 1V0KA 1JI2A 1OSEA 1XSKA 4PCTA 3B8SA 2BS9A 3EDFA 5IHSA 3W29A 4C7GA 1XYZA 4QLKA 4LYQA 4UOZA 2OWCA 1AMYA 1XRVA 2WBGA 3WD4A 4OBSA 4J7RA 5AYIA 2EJ1A 4V28A 5AC5A 5FIPA 1Z32X 4ATWA 1JXKA 3GNRA 4PBGA 4AD2A 1CGYA 4F79A 2VX5A 1UA3A 2WW5A 4MNMA 2EXOA 4Z2HA 1WB0A 5IXEA 2YBUA 1U2YA 1V6XA 3ZO9A 3ZT7A 2VR5A 3AMLA 1JNDA 1A47A 5CG0A 5HDRA 2EPMX 2NT0A 3VKKA 2JIEA 4MPKA 2PWGA 3L2MA 3SCVA 1QI2A 2BNJA 1ODZA 1J9YA 3PZMA 2WHKA 3BAIA 4AW7A 4AZ7A 3M6DA 4QCEA 4CD8A 3CHDA 3KL3A 2V3EA 2DT0A 1QBBA 4XV0A 1OB0A 4JHOA 3VGBA 4W8AA 3AISA 4D6FA 4P7RA 5BWFA 1B3WA 1ISWA 3DYOA 3KL0A 4W5UA 1C92A 2EPKX 1JG9A 2G3JA 3MUY1 5EMYA 3ZOAA 4M8UA 2ZWZA 3EYPA 1HVQA 1UWIA 4PN2A 4S3KA 2XGIA 1VFOA 2EEXA 4MJ2A 1UKQA 1XCWA 3D5HA 1QBAA 4QFUA 3CZ8A 3WFLA 1MW3A 1V3LA 1XYFA 4V2XA 6CGTA 1KQYA 3WEMA 1C7SA 1BAGA 3AHXA 4UNIA 4NSBA 1IV8A 3EDDA 1ISZA 5C8BB 1UH3A 4W84A 3WNMA 5A8NA 2ZXQA 4R5EA 4OUEA 5GNXA 1JFHA 1OD0A 3AHVA 3AZSA 1TR1A 1W9VA 2YIHA 2JE8A 4GPNA 4JIEA 2VRQA 1JYWA 4H8HA 2EQDA 4AMCA 1F4HA 3WMBA 1TVPA 2D23A 3AHYA 1O6IA 4AZCA 1VAHA 2FGLA 2F2HA 1HJXA 2GDVA 4IUGA 2FHBA 3WNLA 1JAKA 5JBEA 1QNQA 3SCNA 4GI6A 3PZUA 2ZXAA 3EMCA 1NH6A 1UQZA 1HP4A 2VVNA 1CYGA 2WB5A 3CUIA 3NYDA 5BXPA 3VOCA 2VZOA 3J7HA 3QHMA 2CERA 3DECA 1OBAA 3QOKA 4MADA 2QMKA 2VCBA 1JZ6A 4ZENA 4YN5A 3N15A 3SUTA 4B3LA 4Z2GA 1BG4A 3VIKA 4C7DA 3AMDA 1GOMA 4HZ6A 4KGLA 4P7OA 2BVTA 4BQ2A 3BGAA 4LX4A 2JFEX 4AEEA 2RGLA 3WFZA 4CCEA 4J27A 5E0FA 4E8CA 2OSYA 4UOQA 2IUZA 2XYLA 2FGZA 2FH6A 4TVCA 4DWSA 2C0HA 3NDZA 3NJ3A 3DYPA 1PEZA 1EO5A 2QHAA 1I1WA 2ZIDA 1MXGA 5JIPA 3SUWA 3K8KA 5BRPA 2E40A 5E9AA 3PZIA 3N13A 2WAGA 3ARRA 1NP0A 1ZJAA 3GH5A 4M81A 3AIVA 1UUQA 2DSKA 4HA3A 1GOQA 1C93A 3WENA 1DEDA 2E9MA 2JALA 3RM8A 2WVVA 2YLLA 1SR0A 1OM0A 1E9LA 4P8VA 5LA2A 4JKLA 2XVPA 3OIHA 2V38A 4W7VA 4J3TA 4CN6A 4J3XA 3UR7A 1QNPA 1V6WA 1JZ7A 3VUPA 2ZUTA 1JF6A 4DWSB 1BSIA 4PMDA 3AHTA 1DWGM 3BMVA 1JDCA 1S46A 8CGTA 4Q7NA 1WDQA 2YL8A 2YDSA 4D6HA 3A6OA 7CGTA 4CGTA 1HL8A 1E40A 3VNYA 5FCZA 3ZSTA 4CD7A 1OD8A 4MDOA 4UFHA 2G4FA 2WANA 1LL4A 1QW9A 5CJ5A 1UWSA 1CEOA 2WVVB 1W1YA 2V3GA 4PMRA 1GW1A 2CBVA 4P8XA 4CU7A 1TA3A 1W3JA 3WQ5A 1FH9A 2YL9A 1K9FA 3UR8A 2VJXA 3VD4A 4U5KA 1D3CA 1J0IA 4ACZA 1W2PA 5LA1A 1UWUA 2HVMA 1KBBA 2Y2WA 5KZ6A 3VNZA 3B9EA 1JFXA 4H7VA 3GXFA 3DYMA 3W27A 4N0RA 9CGTA 3F5LA 1G1YA 1V03A 4M82A 4E4PA 2W62A 3FN9A 4W8LA 4F8XA 4PSPA 3ZT6A 1Y7VA 3NUKA 5A8QA 2XVLA 5EB8A 3T09A 3WF4A 1TA3B 2VRJA 4FLQA 3TTYA 3MUIA 2VNCA 1W9XA 2DT1A 4ACZB 1DWHM 2VZUA 4QCFA 5I23A 2NSXA 2UY2A 1KR0A 2WHLA 1NWSA 2D22A 6A3HA 4NF7A 4HU8A 3BLKA 3CUGA 1HKMA 1R7AA 4FF5A 4UQDA 2CEQA 1ISVA 3QR3A 1KCLA 4AYSA 4FK9A 2YLAA 3VM7A 1RH9A 1GPFA 3MANA 4RE2A 1UD3A 2F61A 1HXJA 3AS2A 2OSWA 1J18A 4CCDA 4GQRA 3ZR6A 1J0ZA 5CPQA 5DT5A 2XGBA 1UOKA 1H49A 1H0GA 3KE0A 4RE4A 5FL0A 1G0CA 2J7GA 3WF2A 4MNLA 4F9DA 3OLDA 6TAAA 1GVIA 1OT2A 2XFFA 3F4VA 3WL0A 1DP0A 3VIGA 1QHZA 1PAMA 1PJ9A 5BRQA 4CU6A 3G6LA 2AAAA 1CECA 1XC6A 2DSVA 3VD5A 2IXUA 4UTFA 3WH6A 1GZJA 5A95A 4WLCA 1V3IA 1HIZA 3AYSA 4HMCA 5I79A 2OLHA 1FA2A 3GYCA 3VDCA 1LQ0A 1F4AA 4HZ8A 2CYGA 3ARZA 3TONA 4LYPA 1V6VA 1WE5A 3BAKA 1Q6EA 4DUWA 5A6AA 4AD4A 1UR2A 3E1F1 2UY3A 2CETA 1PZ2A 3AS0A 3PZ9A 3VIIA 2WXDM 1QNOA 5E6ZA 3OLGA 2XVNA 4WSJA 4XZWA 1BPLB 4D71A 3GH4A 2JF6A 3WNOA 4TOQA 1QI4A 1H0IA 3VX1A 1B3XA 4MAZA 5AC4A 5A8OA 3WQ6A 1W3KA 3CMGA 1ITCA 1BYAA 5CGTA 2OSXA 2WPGA 5A69A 1E4IA 5BYWA 3MV11 2ZUSA 1LWHA 4U5IA 4WJXA 3CHFA 3CBWA 1NOFA 3WUBA 3WDQA 1LF1A 5GNZA 1EDTA 4PCSA 1XCXA 1E0WA 1GHRA 1UR0A 3MU7A 3GBDA 3AIQA 3RCNA 3W37A 1RP8A 4WF7A 4UOJA 1E3XA 2EBNA 1HT6A 3WF0A 2YL6A 2B31A 3BAWA 2VVSA 2G41A 2GVYA 4JFSA 2V3FA 3BLPX 1CBGA 1LL7A 1LL6A 3AS1A 1GOOA 1UR4A 2WMJA 1KQZA 4U2YA 5D9NA 3FNDA 1HP5A 4XB3A 2O9RA 3CZEA 3VIHA 3MMWA 4J3SA 4X0VA 3NSNA 5ABEA 2Z1SA 4GZIA 4W7WA 1JF5A 1UZ4A 1HX0A 2ZICA 3II1A 3A4AA 1H4PA 4D6EA 1ECEA 2DT2A 4BF7A 2EPOA 2ZWYA 1MFUA 1XD0A 2EPLX 1KXVA 4HOWA 1JD7A 3WD0A 5I77A 4W89A 2YDQA 4YHEA 2BHYA 1BYBA 4IISA 1O7AA 3OGVA 5GQBA 4TTGA 5A94A 5AY7A 3U57A 3BMWA 4W86A 1W32A 3L4UA 3PZOA 4RE3A 1UQYA 3VVGA 1JGIA 1WZLA 2J7HA 5DT7A 2WWDA 1KB3A 3EDJA 3VD3A 3WDRA 1HJQA 1UD8A 3ARWA 2WBKA 2J75A 1UKSA 4EAMA 3CGTA 4WIWA 1QNRA 1YHTA 4AD5A 3CLWA 4AY1A 3UESA 3PZNA 3RO8A 4UZSA 4AD0A 5E0CA 1JZ8A 1HNYA 1C8QA 2VMFA 4E8DA 2WNWA 4HA1A 4M29A 4FLSA 1KXQA 2G3IA 2VURA 1W2VA 2Z1KA 1SYTA 1W1PA 2WMFA 2GJXA 4JFUA 1G01A 3WUEA 3THDA 1ZB5A 4LQ1A 1WDRA 1CXIA 1HJUA 1OIFA 1GOIA 1Q6FA 1E4NA 1E3ZA 2J4GA 2WHMA 1EOKA 2V5DA 4BCEA 1FP8A 4B9YA 4TTUA 5IFTA 1CZ1A 2XM2A 4PMUA 1V02E 4HOXA 3WEZA 1W9BM 3HN3A 3L4XA 2V3DA 2E9LA 2XWDA 4NI3A 2PI6A 2E8ZA 3WH8A 3ZR5A 1V0MA 1CGUA 2D1ZA 2GJXB 3W28A 1QPKA 2WSKA 1EXPA 2OYMA 4UCFA 4MDPA 3T0DA 2ZE0A 4MB3A 1BYDA 1XH1A 3AXHA 3B9DA 3W25A 3PZQA 1BVZA 1QW8A 1QNSA 3ARTA 3GTNA 2DT3A 1NOUA 1XV8A 3MKKA 1C7TA 4FMVA 5EFDA 3A4XA 5BXSA 2ZUMA 2G3MA 1ZBCA 1P6WA 4U3AA 5A8PA 1UWQA 3NSXA 1JYXA 1ZJBA 1UKTA 1J12A 4LXFA 1PX8A 1OINA 1V3KA 2DDXA 5LA0A 1CXFA 3VM5A 1NWTA 1UKPA 3TTOA 4K68A 3ZT5A 3B9AA 1BG9A 1SFSA 1FFQA 1EIBA 1E72M 3WMCA 3SCRA 1X1NA 1M03A 3VIJA 1MW2A 3WD1A 2BY1A 2DEPA 4JCLA 2WC7A 3WD3A 2XUCA 4CD4A 3GH7A 2G8ZA 3BAYA 5M5DA 3W6LA 1Q6DA 4GINA 1E6QM 4M24A 2XPKA 3WDHA 1UH4A 2VX6A 2XIIA 3ZJ8A 3GNPA 4B9ZA 2VX4A 2E3ZA 1JXJA 3WH7A 1U30A 3RDKA 4OJYA 5A2BA 2GJPA 4DM1A 3BCDA 2CXGA 4ZEPA 5M3WA 2VZTA 4W88A 3CZJA 4JCMA 3F5JA 3WBAA 3AIUA 4H41A 1EDGA 4PTXA 1H2JA 1B90A 4IPNB 2F8QA 4AD1A 2HISA 4LGXA 2WKLA 2GUYA 2X0YA 3ZJ6A 4ZFMA 2WC3A 4PUDA 4JZ5A 3VMOA 3ZQ9A 3WNPA 1QHOA 3PBGA 3EMZA 4MB4A 4D6IA 5KEZA 4AZCB 3QHNA 4HPGA 3FXYA 5M17A 2GK1A 1EOMA 3L4WA 3WNKA 1GHSA 1HJWA 3IANA 1UHVA 2BY3A 4QLJA 4ATDA 4NRRA 2WKGA 2FHCA 3SUVA 5A3HA 1X6LA 4F66A 1E6ZA 1H09A 1SMAA 4FLOA 2XWEA 8A3HA 3WEOA 4ACYA 4TVUA 3DHUA 2CBUA 1NARA 2J7FA 2BHZA 3MS8A 1HVXA 1UWTA 3WBEA 1VJSA 2UY4A 3K8LA 2VT0A 1GOWA 2WM0A 3W53A 4KMQA 5I5RA 5A6BD 2DSUA 1ESWA 1HF6A 3PZGA 3VD7A 2GK1B 5DEZA 4PTWA 1ODUA 2D0FA 2O9PA 4QAWA 3VMNA 3OZOA 3VDAA 4X9YA 4EK7A 3AMGA 3PTQA 1V3JA 2A3BA 1KGUA 1B31A 3L4YA 1WP6A 2VCCA 2WYSA 4QLLA 1EDQA 3W38A 4AZGA 2V5CA 4RL3A 4PMOA 1UZ1A 1KR1A 1ZBKA 2DSWA 2YA1A 1W9PA 2D2OA 1WO2A 2X0HA 4W85A 1RPKA 3CMJA 1ZBWA 1XSIA 2JF7A 4E2OA 3T0BA 4PEEA 1BFNA 1CXHA 1C8XA 4OBRA 3RILA 2PBGA 3ZM8A 3GDBA 2O9TA 2TAAA 1HL9A 3UG5A 1CXKA 1ITXA 1YQ2A 3VIOA 4D6CA 3KWXA 4HPHA 1PX4A 2VO5A 1E15A 1GQIA 1VRXA 5FD0A 2FDMA 4JL2A 1I1XA 3SCUA 1GJUA 3O6AA 1NP2A 2VQUA 2J77A 5D9OA 1XSJA 2WCSA 1E5JA 1E4MM 2Y24A 1MWOA 2BXYA 3AZTA 4KRTA 3CHCA 2IXVA 1VENA 1E0XA 4J3VA 4A3YA 4AIUA 4UQAA 1E1EA 5GNYA 4AD3A 1CNVA 5IHRA 4KRUA 2J7DA 2J78A 3BAXA 1GVYA 5I3DA 3OG2A 3AROA 2JIWA 2BV9A 4P7LA 1UG6A 3IAQA 4KGJA 3ARVA 3U7BA 2YJQA 2J7BA 2DGAA 1J0JA 4Z2IA 1J01A 4X0NA 3HU7A 1ZBVA 2ZX8A 1J10A 1J0YA 1E43A 2WHJA 4WKFA 1QI0A 2ZX5A 4EKJA 3OBAA 1V6UA 2XTKA 3AI0A 3AIEA 5A6BA 5D9MA 1UD4A 1OWQA 3W4RA 1BTCA 1VEMA 4FLRA 2W63A 1EO7A 1DWIM 1TE1A 4UFJA 2WWCA 1JYNA 4MNKA 5A1AA 2CHOA 5ECUA 3VDBA 3ZJKA 4BA0A 5AYBA 1JI1A 1KWGA 4U2ZA 4TX6A 1E1FA 2AOSA 2VUYA 4M56A 2FH8A 4MB1A 4GO8A 3SUUA 2VZVA 3SCSA 2A3CA 3CZKA 3BCFA 1H1NA 4Q22A 4ATLA 2C8NA 3IAPA 1M04A 1L0PA 3NCOA 4L4PA 3OGSA 1VF8A 2YOCA 4NZCA 2PWEA 3POHA 2Y8VA 1FHLA 1C91A 1BQCA 2JEQA 7A3HA 2YA0A 1CWYA 2EO7A 1VBUA 4XX6A 4L4OA 1LWJA 3SURA 3RMEA 1LG2A 3QGVA 3NSMA 5IDIA 1TMQA 2W66A 3MV01 3A4WA 4QDMA 4AWEA 3MSGA 4J28A 1LG1A 1KGXA 2E0PA 4OZOA 2J8FA 3M46A 3A47A 5BXTA 2CKSA 4HP5A 1H5VA 4C7FA 1BLIA 1HJVA 5ABFA 4BS0A 4EE9A 5BXRA 3VGHA 2BXZA 3DC0A 1UR1A 1UKOA 1MW0A 3WY1A 2X1IA 3D3AA 3BAJA 1L8NA 3G6MA 4GZEA 2VR4A 1DWJM 3W6MA 3CHEA 1NWRA 3AFBA 3EDKA 5IFPA 3W24A 1J11A 1JAEA 1MFVA 3MSDA 3VU2A 3KZSA 5JUVA 4GI9A 3WQ8A 1K6AA 4PMZA 2O92A 2DQXA 1NWUA 5ABFB 4EANA 4JKKA 1CIUA 3WN6A 4KWUA 5E70A 1E6RA 2VOTA 3ARSA 5CQ1A 1KCKA 2WSPA 3HJEA 2D24A 5CSYA 4NRSA 1CLVA 4CN1A 3AZRA 1WDPA 2BY2A 3TA9A 3ARQA 2WVTA 3AYRA 4AIEA 4R27A 4ZE5A 5A6LA 3WQWA 3OGRA 5CZKA 4P7NA 2WK2A 4J3WA 4HOZA 2C7FA 1WZMA 3ALGA 2Y8KA 1VEOA 4AISA 4HU0A 3WL1A 1US3A 2PWDA 3LMYA 1XHGA 3MO4A 1PPIA 4D1IA 1EH9A 3CTTA 1W3HA 4JKMA 2W92A 1E4LA 3AQUA 1G9HA 1WZAA 2DPEA 4UFIA 2WMGA 1Q4NX 4JHZA 1R86A 3AOFA 1EQCA 5HPOA 3IK2A 4DM2A 1JDAA 4Z2KA 1BVNP 5A6SA 2ZX7A 1MVYA 3UERA 3AMCA 1JZ5A 4GQQA 4URIA 1EA9C 2W61A 1KXHA 2GSJA 3K8MA 2J74A 3W82A 2VCAA 3VGFA 4N42A 1W91A 1GQJA 3CO4A 4JFWA 1UD6A 1V0NA 3FW6A 3WH5A 3OA5A 1M7XA 1DWAM 4GO9A 2VX7A 3RM4A 2WCAA 1MXDA 3ZIZA 5FOOA 1ISYA 5HPCA 1E6PA 4U3CA 3N9KA 2XHYA 3WIJA 3K1DA 2WZEA 3LPOA 1BHGA 3UG3A 3N04A 4D1JA 4H04A 1QI3A 2ZXDA 3VPLA 2ZX9A 3CUFA 2W67A 5DO8A 1ZU8A 4Z2LA 2D0GA 3N1AA 4D6GA 4BQ3A 3K4AA 5EFFA 1QI5A 3SCOA 2E9BA 3I3BA 1B1YA 3OZPA 1KGWA 3EBVA 1XD1A 3GM8A 3MUZ1 2ZUUA 3T2OA 1JIBA 1H3GA 1H41A 3PTMA 3VTRA 4DUXA 1WDSA 4TX8A 4WSKA 3THCA 1K9EA 1TZ7A 4BQ4A 1R85A 1AQ0A 1EGZA 4BQ5A 1OCQA 2OYLA 3W0KA 4CCCA 4BZYA 3AICA 1G5AA 1R7OA 5EBAA 2QPSA 3UCQA 1BGGA 1UWRA 4GI8A 4AZIA 1C90A 2GDUA 3I3EA 2ZUNA 2E4TA 1TCMA 2BHUA 3WNNA 3WELA 1IT0A 4OIFA 2GFTA 3WF1A 1XGZA 1V02A 4M1RA 2J47A 5A2AA 4W7UA 1MQRA 1LJYA 3WKZA 1MYRA 4AZ6A 4DWSD 2ZOXA 1GUVA 3WQVA 4UFLA 3ARPA 1KFWA 3LPGA 1MQPA 1JNEA 2W5FA 2CBIA 1W1TA 4CD6A 5DF0A 3SUSA 2BVDA 1ZL1A 3GBEA 2OWWA 2XJ7A 3PZVA 5JBFA 3M07A 5JH8A 4AZHA 3VGEA 3QHOA 1KBKA 4F9JA 5D9PA 3L4VA 2CBJA 5JBDA 1CDGA 4MAVA 1JZ4A 1CPUA 3ALFA 1JD9A 2J8GA 1Q6GA 3OLIA 4JFTA 2W91A 2WVUA 4PTVA 4J3UA 5FKYA 1U33A 1UA7A 2WVSA 4HMDA 4CUCA 2DIJA 1E70M 1JZ2A 4OKDA 3WDPP 3CUHA 3U5YA 4GIAA 2BY0A 2YA2A 1WNOA 5DFAA 5I2UA 1UYQA 2WMKA 4PMNA 2CESA 2UY5A 5I78A 3F5KA 4XUYA 4B15A 2J79A 1ZS2A 4M80A 2PWFA 2ZUWA 4PMXA 2DIEA 4UQ9A 2ESCA 3BH4A 4AC1X 3QOMA 4GZJA 1PBGA 1TFVA 3VILA 1GONA 1H11A 2EPNA 5HXMA 3NDYA 5D8ZA 4CD5A 2WMHA 2PC8A 4JL1A 2J7EA 2OYKA 2WZIA 4GKLA 4U31A 4W93A 2X2YA 3MUAA 1KWKA 5D4YA 2YDRA 1HKIA 3CPUA 1OGBA 3TP4A 3CH9A 2XG9A 4ZE4A 1PIGA 3AIWA 1E6NA 3PTKA 3GXIA 2VTFA 2XFYA 1JYVA 1NQ6A 2J7CA 2XSBA 4PMYA 3CIVA 1DHKA 1CXLA 4MTVA 1N82A 3O9NA 1OGSA 4UZUA 3VO0A 2DSZA 3HMCA 2A3EA 3ECQA 4AIOA 2X05A 3VIFA 1EHAA 2QV4A 1QVBA 1HKKA 3POCA 3RJXA 1VFFA 3WH9A 1FHDA 1C3FA 1FP9A 1RP9A 4LPCA 4WK9A 4YPJA 3FAXA 1VFUA 2VC9A 3SCPA 2OWXA 2WC4A 5ABHA 2YL5A 3OLEA 2QPUA
chains in the Genus database with same CATH superfamily
2XZ7A 3N11A 3U2CA 4IJBA 3RJYA 3VAVA 4QIBA 1EA0A 1GCYA 3SCQA 4DBWA 4GMEA 1JQXA 1QOXA 2D0HA 3G1SA 4N6EA 4Y2WA 5LXXA 4X63A 4GBUA 5BROA 4YHGA 2NQZA 5A6JA 4AZBA 4QJ5B 4GKTA 4DWSC 1A49A 2C6QA 3SGUA 3WLTA 1SR9A 4UFMA 3WDJA 1V3HA 4Q8MA 4CKQA 4Q4PA 3FHQA 4C6MA 3S2CA 4TVDA 3P8IA 4ML4A 3N3MA 4RDVA 3N6QA 4GIRA 3CO8A 2NV1A 3ZJ7A 2AKZA 2NXIA 5D03A 3S6TA 4O1BA 3A3HA 4NG3A 4FNUA 3M5XA 2J62A 5F1UA 5CC5A 2VGBA 1W54A 1F6YA 2PF0A 2XP8A 2WV8A 5GVJA 4CQBA 1AQMA 1XQKA 3KZ7A 4UR9A 1U5JA 3BUVA 1GQLA 1JCJA 2VRKA 3NPVA 2XVGA 1UZHA 3NOYA 4WDUA 3ABXA 2QIWA 3OB8A 1HKJA 3LXCA 2Y88A 4KEMA 3UVAA 4UQCA 1GZ1A 3BG9A 2MLYA 1OT1A 1W3LA 2UZ9A 3E38A 3ABRA 4UFKA 2ADAA 2IKGA 2PSNA 3T2PA 4JFVA 5K9DA 3PHAA 2WZHA 3F03K 1W37A 1ROUA 4MGGA 3I7SA 1KLYA 4R7WA 1XKYA 3L4TA 4WKHA 1SMDA 2CCRA 2WMIB 2WSYA 1N8IA 3OVGA 5CSSA 1U22A 1UR8A 3B0VC 5GPRA 3GG0A 2CZ5A 5EMLA 3HG4A 4LRSA 1BXNA 3KDNA 4MJMA 4IIHA 3W1RA 4MY8A 3GNXA 2NT1A 1DWFM 5EU9A 1J0HA 4WJEA 4BF5A 3N18A 3GVRA 4A3HA 2WLYA 1XH0A 4S2BA 3HQNA 4NX0A 1B3ZA 2PP3A 3TTSA 3K5XA 4UR8A 4UB9A 4AF0A 3AXXA 3T2QA 3DCPA 4JNMA 1PX3A 1TQJA 4A4AA 5HR7A 3ES7A 3BXWA 1DTUA 3KABA 1J5TA 3TOPA 1FCQA 4YMZA 3ITCA 4IQ2A 1EQPA 2YB1A 3EX3A 4XK2A 2X42A 2Y1HA 3EGJA 3NNTA 5KZDA 3K1GA 2YYTA 3R11A 1LT8A 4Y7EA 1TJ1A 4MKNA 1K9TA 4LJ3A 2FQIA 1THFD 1C8YA 2H8XA 3IJ9A 1W6TA 1RCOB 1XWYA 3FY1A 3PANA 4ZQRA 2W79A 3IJIA 2NQHA 3R6IA 3GZAA 5F2LA 1KCZA 3HTWA 3LLXA 3WJWA 3OEXA 1SM9A 2HNHA 2ZQUA 3LPFA 3BQ5A 4UTTC 2Z2AA 3WSUA 1I45A 3GXMA 5DIVA 3VFCA 1NQKA 3N4AA 4KH2A 2J9ZA 2ZRXA 1WZKA 4I9AA 2YCLA 3VGGA 3AS3A 5AFDA 4PSRA 1TVNA 2CPUA 1AA1B 3T55A 4L9YA 4HTYA 3QPZA 2DORA 2ACUA 4C1KA 2H9AA 2XM1A 4NJGA 1PKLA 2HK1A 3M7WA 3FAWA 5I6SA 3CZLA 5A2CA 2WLZA 2P1FA 2XIBA 1TG7A 1ADOA 5HK4A 2X7VA 3JZEA 4C6DA 1W3IA 4DJFA 4M7SA 3U0HA 4H2CA 1J0KA 4NZFA 5BCAA 1XLHA 3BV7A 1E6XM 3P84A 3S83A 4LBRA 3RPMA 4C1NA 4ZZ9A 4QQ3A 5FJPA 3W72A 2GDQA 4HMEA 4O53A 4CVWA 2AMXA 3SEPA 1IWPA 3CZGA 1PINA 4DYEA 4K3ZA 5GPGA 1JCHB 3GVVA 3VOJA 2FHFA 3AWNA 3VMPA 2J9XA 3WCZA 3MA8A 3QV9A 4O28A 1ZAJA 4KETA 3BSHA 2FMOA 1AH0A 5T8GA 5C6MA 1B3VA 4UBPC 2C15A 4W8BA 3APGA 3OQEA 1DJIA 5ABGA 4DF2A 1LLOA 1W9DM 2R91A 4DRMA 2D20A 3R0DA 3O3RA 4M1BA 1Q6CA 1B57A 2ZQSA 4KRZA 3K30A 1D7FA 3HV9A 5T9CE 5EMKA 5BZAA 4D72A 4W9QA 3NQ8A 5I07A 1K9DA 3I3DA 1VKFA 1R87A 4EWND 3SCTA 2Y89A 1RJPA 1K8ZA 3EA1A 4PMQA 1ISXA 4S3AA 2ZADA 1KXTA 3UR5A 1KKRA 3UQAA 1XSKA 3TSMA 3B8SA 1BF6A 3EDFA 3B4UA 4C7GA 2DG4A 3EXSA 5CC3A 1XYZA 4HU3A 1LCOA 3EKZA 4WR3A 3WD4A 3EWZA 5DELA 2E6AA 4J7RA 3LEPA 2EJ1A 5REQB 5M2FX 4LYKA 4C60A 3GNNA 4GH3A 4WY0F 5FSDC 2FJUB 4AQLA 4AD2A 3ODKA 1IXOA 2VEGA 1GGOA 1V6XA 1DXIA 3ZT7A 1ZFJA 4OE7A 1A47A 5CG0A 2EPMX 2NT0A 4DEFA 2PWGA 3L2MA 1QI2A 1ODZA 1J9YA 2WHKA 4LUIA 3IS4A 4AZ7A 4QCEA 5I03A 2OLAA 3E6EA 1XYCA 2V3EA 3SDOA 1R5YA 1OB0A 4JHOA 3VGBA 4LF1A 2I56A 4D6FA 3USZA 4XAZA 3MI3A 3L65A 4P7RA 3LENA 3DYOA 3L21A 1YRRA 4IMEA 3AXKA 5HAOA 3E0VA 4HKPA 2OGJA 5EMYA 2ZRZA 4M8UA 2QDDA 2ZWZA 1HVQA 1UWIA 2YYUA 4PEKA 1HGWA 2Q5AA 2ZTKA 3CZ8A 3WFLA 2CLIA 4C5YA 6CGTA 4V2XA 1KQYA 3WEMA 3N4FA 1F7BA 3LY0A 3MW7A 4ZOAA 4PB4A 3LTSA 3LGGA 4LANA 3WNMA 5A8NA 2ZXQA 2AWGA 1K6WA 2YX0A 3AZSA 1TR1A 4GPNA 2VEMA 3V1HA 1JYWA 7TIMA 4PUMA 2V69A 2F6XA 3UFYA 4DYJA 3D3FA 4GGBA 1P6CA 3I6EA 4R33A 3EAUA 3QV6A 1VAHA 2V82A 4ASTA 5F4SA 3PVFA 3O0FA 3PWIA 1SSDA 2F2HA 1SU5A 9XIAA 4TX9A 1J4HA 1JAKA 5JBEA 2PDQA 2Z25A 3FX4A 5B7YA 1SZFA 4GI6A 1GKPA 2D2HA 2WB5A 3CUIA 4FZIA 1F61A 5RUBA 2VEFA 4HBOA 3FEQA 3FKKA 3GKFA 3G8EA 3A12A 4MADA 2QMKA 2VCBA 4PB3A 1OYAA 1LWIA 4YN5A 1QUMA 2NXHA 3W9ZA 4Z2GA 1BG4A 1XKJA 1KFJA 4C7DA 2DUAA 4GA8A 1P4CA 4ODQA 4HJWA 1XG3A 1XIDA 4LX4A 1XYAA 1ADSA 4QTGA 3IK4A 3SQSA 1OX4B 4J27A 3ANUA 4E8CA 2OSYA 4UOQA 1PS9A 3T05A 2G37A 1I0BA 1Q7QA 3NDZA 3NJ3A 3O5OA 1PEZA 5K2ZA 2GSHA 1OK4A 2A7NA 4LC6A 4A2RA 3O15A 1FD9A 2Y8UA 2RHGA 3APTA 2PDKA 2VR2A 3N13A 3ARRA 1ZJAA 4NZ4A 1UUQA 3SECA 4C1LA 1A5UA 4ZB0A 1C93A 2DJXA 1B3OA 3CWNA 2E9MA 2Y85A 1YNPA 2FYMA 2YLLA 1E9LA 5LA2A 2XVPA 4CN6A 3MI6A 1QNPA 3P6LA 2ZUTA 3S5SA 1YKWA 2AGKA 4PMDA 3KP1A 3AHTA 1DWGM 5L6UA 3OBKA 4FALA 1JDCA 5T26A 1EBGA 3EB4A 3E02A 4HB7A 1WDQA 3ONBA 5M1TA 4R9OA 4JTGA 1SW3A 4F0HA 3VKDA 3WQCA 3W1AA 1JGMA 7CGTA 2PDBA 4CGTA 3B0YA 3VNYA 4NAFA 5FCZA 1T0OA 3UPWA 4C6FA 1IGWA 4ODNA 5CJ5A 1X1OA 2WVVB 3GAKA 4OV4A 3GFZA 2P8CA 2FDSA 2DG3A 1VBJA 4PMRA 1GW1A 3VZZA 1DQXA 1HTIA 4KIRA 2YL9A 4R0XA 1DJQA 3UR8A 3RMJA 3CIXA 3FDKA 3VD4A 4U5KA 3E0IA 3O5EA 1J0IA 1W2PA 1VR6A 1UWUA 2C91A 3T8LA 2OX1A 2PTDA 1KBBA 3VNZA 1XRTA 4L64A 1YTEA 3GXFA 4N0RA 3F5LA 4H9MA 1K7FA 3CV6A 3IGUA 4G56A 3NL6A 3W3OA 4F8XA 2QCHA 1Y7VA 6XIMA 2PPNA 1ITQA 2XVLA 3PWGA 4ECLA 4UTIA 2LJ4A 4FLQA 4LSBA 1J2BA 2BP1A 4IXXA 3SFWA 4K8HA 1XLBA 2WHLA 3H7RA 4V33A 6A3HA 3BURA 1HKMA 3UT0A 4Y9MA 4FF5A 4NJIA 2CEQA 3QR3A 4AYSA 4FK9A 1I2OA 2YLAA 1RH9A 1XR2A 3MANA 1RQBA 2F61A 4XBSA 3CK5A 5EBUA 3AS2A 2OSWA 2G96A 3ZFHA 1ME8A 3ZR6A 1J0ZA 4ILSA 2XGBA 1WOBA 2PDNA 3NDOA 1LZOA 2BOEX 2XINA 5CBBA 1B54A 4RE4A 5FL0A 2YXXA 1RY8A 3WF2A 4QS6A 3OLDA 3N6JA 3T81A 3V5CA 6TAAA 4DBDA 4NVTA 1GVIA 4JNZA 4M6UA 1K77A 3VIGA 1QHZA 4A8NA 1PJ9A 1XI3A 5BRQA 3G6LA 1I0DA 2HE5A 3KM8A 1S39A 5K4ZA 1V3IA 3BMBA 2Z6JA 4KCUA 5F1VA 4HMCA 2GGJA 4I5RA 4QHRA 3VDCA 4C5ZA 2NVDA 5J04A 1QRQA 3ARZA 5CJMA 2XDFA 5DXXA 1V6VA 1WE5A 3BAKA 1VYRA 1EGMA 4DO5A 3F4DA 4AF0B 1D3GA 3HIJA 4IGNA 3UZZA 1PZ2A 3VIIA 1V7AA 1ZY9A 1QNOA 5E6ZA 2HQAA 3QPYA 1QI4A 4AH7A 4LF2A 4MAZA 5AC4A 1W3KA 1BYAA 3TIMA 3STGA 2DZVA 1I2QA 2ABAA 5A69A 1E4IA 1ITUA 1REQB 4L9XA 3LHZA 4LS0A 4BHYA 3WDQA 1E0WA 1GHRA 2NLYA 1EUNA 3GBDA 3AIQA 1RP8A 3VZXA 1BSLA 4WF7A 4UOJA 2XP3A 3RO6A 2TSYA 4IMGA 1U1JA 1HT6A 3UQNA 2PDIA 2VVSA 4I5UA 4DB7A 2ZZ7A 2R24A 3MPGA 4KWVA 1FKDA 3HQPA 4M0XA 2EKCA 1CI1A 2C13A 3FNDA 1TPWA 3STFA 2KAUC 1OABA 3UZYA 4X0VA 5FJJA 4BI7A 2PGFA 1D7KA 1JF5A 2YCLB 2C0AA 1HX0A 2J6XA 3UWVA 4HD5A 2X16A 1XD0A 4HOWA 4C6EA 1I2RA 3AC0A 4W89A 1BYBA 3QQ1A 1P0BA 3UY8A 4TTGA 3OYXA 3XINA 3TSDA 3W01A 3V35A 1EKOA 3W02A 1UP2A 3BGJA 3H22A 4TV6A 5DT7A 3U8GA 3EDJA 1YDOA 3OOQA 1UD8A 1GVOA 2DZSA 2AL1A 2J75A 1ZALA 2NV9A 3ZS4A 5AHIA 3ANYA 3UESA 3CNYA 3B0PA 3PZNA 3RO8A 1HUVA 1PIIA 1C8QA 2WNWA 2WKJA 4HA1A 4FLSA 1DIOA 1KXQA 2G3IA 1W2VA 2A7PA 2ISFA 2GJXA 4UMAA 3TJXA 3QZEA 3N34A 1DORA 3THDA 1HJUA 2Y7GA 1OIFA 1Q6FA 5C9RA 1YE6A 1W17A 4KWWA 3QPEA 1T6MA 4Y6GA 3WQFA 2P5NA 1CZ1A 4PMUA 3SB0A 3TV8A 3E96A 3WEZA 3B8UA 4O12A 3LTYA 3KOXA 2E9LA 1ZLPA 3FLUA 1K8XA 2XWDA 1NTHA 4UTJA 4GIVA 3MB9A 3S5NA 2E8ZA 1YLVA 1TELA 3EOLA 4IP5A 4NYUA 5BU6A 2P0OA 4RPPA 3SO7A 3CV2A 2PE4A 3OYZA 1D9EA 1H61A 5BOFA 4MDPA 3H6OA 2ZE0A 4MB3A 3P62A 2A7RA 3Q4DA 3TYCA 3A13A 4A8RA 1V51A 3EXTA 3PZQA 1BVZA 3LXBA 1G4PA 4PE8A 1T7LA 3N4EA 2F6UA 1J4EA 3T6CA 2DT3A 1NOUA 3RLUA 5F2IA 4MIMA 3EB3A 3MWCA 4KERA 3A4XA 5EMUA 1OYBA 1H7RA 3WQOA 2ZUMA 1F40A 1BKSA 3P0WA 4U3AA 3NSXA 3LMZA 2PDUA 2WZMA 1J12A 3MP5A 3NR0A 5LIUX 1EJTC 1V3KA 1E44A 2RDUA 2XISA 3VM5A 4L5ZA 4E2VA 1NWTA 1MUMA 1NSJA 2ZDSA 4HNUA 2Z6IA 3VCNA 1MMFA 1FFQA 5TIMA 4JTFA 2VD9A 1D8WA 3GC4A 3M0YA 4X9SA 1X1NA 4DNMA 3WD1A 1YPXA 3WD3A 4S3CA 2XUCA 2OZ8A 3GH7A 4YWSA 5M5DA 1UBSA 1Q6DA 4RZ5A 4GD0A 4Z08A 3U9IA 5C9WA 3SSJA 3UQIA 4INFA 1OVDA 4CQ8A 3WLMA 2VX4A 2E3ZA 3UGVA 3PBMA 4ROPA 2XN0A 3BSMA 1QW7A 1WBJA 4OJYA 1Q6LA 2GJPA 4DM1A 2CXGA 4NZ3A 4W88A 1YBQB 4F48A 5FEPA 3WLKX 2PDLA 4FR6A 1XLEA 1H2JA 4G50A 3TC5A 3KHDA 2ALDA 2C18A 4YXGA 2FVMA 2EG8A 3KVKA 4GUJA 3VOFA 4BI5A 2YDAA 3L0KA 1EEXA 5M17A 2D2GA 1GHSA 2J6VA 1BXCA 2BY3A 1P0KA 3LCWA 4LUYA 4GBDA 3QW3A 1NFGA 1PDYA 3M0JA 3THUA 2WKGA 3B4YA 2Y5SA 4JIQA 1E6ZA 1JCXA 2I7GA 5H8MA 1SMAA 5LNRA 2XWEA 1VZWA 5T9BG 3LCHA 3DHUA 2VXNA 4MZ1A 2J7FA 1I2NA 1ELSA 4F0SA 1MDRA 3RX4A 1XX1A 1DXEA 3K8LA 4IZGA 1UIPA 3GR8A 3JW7A 4JR5A 2VWSA 2VFEA 4KMQA 3ITTA 1GK8A 1MNSA 5I5RA 4MWAC 1PWMA 3T9PA 2DSUA 4EOUA 3C3UA 3V1PA 4AWSA 5LHFA 2GK1B 1GVQA 1ODUA 3RGTA 2QDGA 3VNMA 4QAWA 4O2TA 1UUOA 3OZOA 4JFMA 2ODOA 2Y7DA 2TYSA 4EK7A 1AODA 3B40A 1V3JA 3CAQA 4US5D 1XL9A 2YZ5A 3DX5A 4A8IA 2MNRA 2BGQA 1PBKA 5JH2A 4KFPA 4AZGA 1IWAA 4PMOA 4QG8A 1ZBKA 2DSWA 3F4WA 2E09A 1W9PA 4W85A 3CMJA 3VK5A 3MVIA 1R3VA 3T0BA 2PPOA 2A5HA 4GVGA 4IQLA 5JH1A 3EWCA 4MYAA 3RN6A 3MKVA 3VABA 2O9TA 3UG5A 3GTIA 1F8IA 1FWIC 3S42A 1TTQA 2SFPA 4Y90A 3TQVA 3ANVA 1VRXA 2YXGA 2FDMA 4QNWA 2W6RA 5BW6A 3W7MA 1POKA 5D2YA 4K8GA 1EEPA 4ZOCA 4AEOA 5FI8A 3O6AA 1LUCB 4IGSA 1DIDA 1NP2A 5AHEA 1S5WA 2VQUA 2J77A 1A80A 5D9OA 5AECA 2IQ0A 1XSJA 4YNGA 1LRQA 1E5JA 1MWOA 4KRTA 3F7JA 3CHCA 1VENA 1T41A 1UWAA 1KRMA 2PDXA 1X7IA 2R1PA 1CNVA 2CWNA 4MPQA 5IHRA 3RGCA 3BAXA 1GVYA 1FKTA 4P7LA 2ISSA 1UG6A 1NMVA 3C4UA 3U7BA 1A5CA 2YJQA 3EX2A 4ICNA 1TRDA 4QG9A 4Z2IA 4X0NA 3PAOA 3HU7A 4TR9A 4A21A 3TYZA 3S1XA 1E43A 5C7VA 2WHJA 4TYOA 4EKJA 1OX6A 3C52A 3DU0A 4O0KA 1BRLA 4PUNA 5D9MA 3QM3A 4DZ5A 3W4RA 1JPDX 3UI4A 4HK6A 1D7IA 1EO7A 1JYNA 5ECUA 4GQGA 1RBLA 4KQNA 4O4WA 3ZJKA 1JI1A 3TR2A 4C6LA 1XLLA 4I3GA 3NTPA 3NM1A 2AOSA 1MEIA 3PBWA 3WK3A 4MB1A 2HVNA 3SUUA 2VZVA 3CZKA 3KLLA 4O16A 4O4VA 4ATLA 4L1GA 2C8NA 3IAPA 1TSIA 4L4PA 2HVOA 1D3HA 4TMCA 2Y8VA 2YA0A 2EO7A 5HNUA 2JK2A 3SURA 3RMEA 1LG2A 1FBAA 1Q45A 2GVJA 1JCYA 1EL3A 1NIUA 1KGXA 4N6FA 5AVHA 4OZOA 1FY6A 3PPHA 2PV1A 3WJSA 3TUUA 1OFEA 3LI1A 2CKSA 5ABFA 3VNJA 1R30A 5J8LA 3V0UA 3VGHA 1J5SA 4BK9A 1UKOA 2ZC8A 3WY1A 2Y5JA 3D3AA 3TQPA 3WK1A 3UNDA 5LHEA 3BLEA 2QCDA 3G6MA 1TCOC 4E3TA 1J79A 3KX6A 2VR4A 2KE0A 1DWJM 3W6MA 5CC6A 3CV1A 1OX5A 4YWIA 4GGQA 4DAFA 5IFPA 2OQHA 5D32A 3MSDA 4H6QA 3N2TA 3I7QA 1VIZA 3PJWA 1GVSA 3WQ8A 1K6AA 1EF2A 4R7OA 1IXQA 1NWUA 3NL5A 4IFOA 4FAPA 3JS3A 3W1QA 4AHQA 2VOTA 1KCKA 2WSPA 4N9BA 3R10A 2HXUA 5CSYA 3O06A 4CN1A 3HGJA 7ENLA 3NXFA 4LCSA 3TA9A 5XIMA 4TU1A 3URBA 1N8WA 1MNZA 3IIOA 2CLMA 4YLWA 1M65A 1B4KA 2G5WA 5FJUA 1Q6UA 2Y8KA 1FRBA 1RLCL 4XAKA 4HU0A 3WL1A 2PWDA 4OGZA 3MHFA 3LMYA 3CPGA 1RZMA 3MO4A 3CS2A 2Q6ZA 4JKMA 3N14A 1E4LA 2REQB 5BMXA 4J2PA 3AUOA 2V5JA 4OV9A 1X98A 3PAJA 3AOFA 3KOYA 1X7FA 5HPOA 4KF1A 4HBKA 1PTDA 4PR4A 4Z2KA 3AO0A 1BVNP 2ZX7A 1R2TA 3AMCA 1JZ5A 4GQQA 4URIA 2ZZ2A 3RLHA 1H7XA 4DJFC 1O1HA 4EIVA 5CAHA 4NJJA 3VGFA 4N42A 3P80A 1W91A 1GVRA 1R3QA 1UD6A 3MHGA 3FW6A 2B81A 1Q6HA 4DO4A 2WCAA 4N19A 3SQMA 5FEZA 5FOOA 1ISYA 1I4NA 1OCBA 2WZEA 2ZVIA 4UTHA 3H2EA 3V0SA 1TR9A 3DFOA 1OG6A 2QCMA 4H9XA 4K2SA 1EX1A 5DO8A 3N1AA 2PBCA 3K4AA 3SN0A 5EFFA 3VZYA 1GW9A 4LV4A 3H2FA 3SGGA 1KGWA 2ZUUA 3I6TA 2QXWA 1H41A 2VEKA 4KFOA 1NDVA 1TV3A 2EGZA 3LHYA 3CQ0A 4YTQA 4TX8A 2H3DA 4WSKA 4J2MA 1K9EA 3GNDA 4Z0JA 4IMFA 3S1GA 1F5ZA 3CQJA 3NQDA 4BQ5A 3UWWA 5C5YA 1R3WA 4RDZA 2PS2A 2MUCA 3S46A 1W0MA 3WYZA 1OJXA 1SJCA 5EBAA 2AL2A 5T91A 1UWRA 2BSLA 2KO7A 3GVGA 4X2RA 3IWPA 4AZIA 3H24A 4EVZA 4Z1CA 3I3EA 4AMAA 3G1DA 2V67A 1YXYA 1S2CA 3GHRA 1GJPA 1IT0A 4OIFA 3NPWA 3FGCA 1XGZA 3KRUA 4OHQA 2GL5A 1UP0A 2VN1A 3UBPC 1LJYA 4DWSD 2ZOXA 4ZOEA 3CJPA 3LN3A 4HCLA 3SUSA 4UTKA 2BVDA 3KVLA 4O19A 4BJHA 3BOLA 5G4HC 4AIBA 2BDQA 2ZRUA 4AZHA 2OJPA 4F9JA 3PC0A 2FFIA 3WJYA 3R8GA 1Y0EA 1KTBA 2FLIA 2C79A 1CDGA 3KDOA 4O54A 5HJXA 4DI9A 4PTVA 2PURA 1FKJA 3NEVA 4AC7C 2E1WA 2WJZA 3RU8X 4WVXA 2WVSA 1EJVC 3GX9A 4CUCA 2GLKA 1JZ2A 4JEQA 3BVJA 4OKDA 1HKVA 2XSXA 1IHIA 2YA2A 5DFAA 4L56A 1XLJA 2E6FA 3PRDA 1EF3A 1D7JA 5K3VA 4Q33A 3SI9A 2KFWA 2CESA 3W6YA 3F5KA 4XUYA 4B15A 1ZS2A 1JCLA 1XP3A 2ZUWA 2GUBA 2DIEA 4GC4A 2IKHA 3LZ3A 1P5BA 3ORWA 3VILA 4CD5A 1W56A 3LV5A 3GRIA 2OYKA 5HW7A 3VKCA 3O5LA 2VDGA 4W93A 2D73A 3V18A 2NQLA 5D4YA 4ITZA 4IMCA 2YDRA 4GUIA 4OFCA 5LZLA 2ACRA 1YEYA 1CX9A 2XG9A 4ZE4A 3MBDA 3VNKA 4F0KA 1Z8AA 3GYEA 4NNBA 4ZQNA 2O55A 2XSBA 4FSAA 1X38A 3CIVA 1DHKA 2YZRA 1J96A 1OGSA 4UZUA 3T78A 2DSZA 3HMCA 4ADTA 3ECQA 4AIOA 3UGRA 4FNRA 4FR1A 4M7TA 1EHAA 2GGHA 2QV4A 1HKKA 1KM4A 3POCA 2YCJA 3QRHA 4NJKA 2A21A 1P6BA 1VFFA 2DZWA 2QUUA 3MSRA 4ZB5A 1C3FA 1YXCA 1FP9A 1RP9A 3NZRA 1W5PA 1VFUA 2XIOA 1UW9A 1JPIA 2YL5A 2QPUA 5C71A 4G1NA 4P2VA 4PTMA 3P2VA 2UZ5A 1XF0A 1R8LA 4H83A 1B9ZA 2CKRA 4JPGA 4ZL1A 1A5MC 2PBOA 4Z2JA 4XZIA 3GUGA 3TW7A 1FH8A 4UQBA 3C2RA 4CN4A 4LV9A 1OCJA 4V27A 4I9JA 3B0UX 2R1MA 1R2SA 1I75A 1W9UA 3GE7A 1V5XA 5KMYA 1V8EA 4Q4SA 1Y5WA 2BASA 4D6DA 3BICA 5FAJA 3O5GA 3W7OA 1EGVA 5C70A 2D3LA 3UD6A 4JN7A 1XDLA 1L8PA 1XGDA 5HWBA 2OQYA 1X97A 1S2AA 1V77A 1KBIA 2P3EA 1SZGA 4QT3A 1QTWA 7TAAA 4X22A 2IKIA 1S5NA 1QK2A 3W75A 1BYCA 4GC3A 2AMGA 5PTDA 1TJ2A 4MGVA 3FA3A 4NAEA 2MNTA 1DJWA 1PV8A 3ONCA 3T0AA 4J40A 3HBLA 5H1WA 3S2NA 4GVFA 4CNUA 1K4GA 3H55A 5L9FA 5LXEA 2H8ZA 1V08A 4QRNA 5HMSA 2VCDA 3TNBA 2FJKA 1KLZA 3IK8A 2XU2A 5DCEA 3SN1A 2E8YA 4C6BA 4J9JA 3NQ7A 1Z69A 3LCXA 3O2LA 3CAVA 3V3WA 5D2VA 1OIMA 1O60A 4NUWA 2PWHA 4ZXLA 1TO3A 4DROA 3NI6A 2XZ9A 1G94A 1J6PA 4Q32A 5I3GA 3FFSA 5A5WA 3JYJA 4B91A 3NG3A 4DN1A 1HW6A 3R12A 5AC8A 5LYRA 1B30A 1A0CA 3A4JA 3W7IA 5CBIA 3E74A 1H7OA 1HL2A 4IP4A 2EPHA 4O10A 1JULA 3MJYA 4U84A 3TTQA 3W26A 4XZBA 1WCGA 3UXLA 1IWBA 1DJZA 2QF8A 3I68A 4C6PA 1UASA 2GGEA 5FL1A 3KOFA 3U2OA 2VC7A 2A3AA 4PMJA 3LS9A 2INZA 1I8JA 1IT7A 4HHHA 2CFFA 3IVUA 4GYJA 5FF2A 1HN1A 4FS9A 1UB3A 3ARXA 1V6YA 3FV9A 2DH3A 4OECA 5E0KA 1NJJA 4ES4A 4LUSB 3ZYZA 2I17A 3ITGA 3AIRA 4TUFA 2OOFA 5BOEA 1T99A 4LYRA 4UCGA 4XD5A 1S2UA 4DQWA 1WBHA 1UH2A 4TXEA 4DI8A 3IJ7A 1UC4A 3H2MA 2RJHA 4AZ5A 1E0VA 1LROA 4PC8A 2G3FA 3SCWA 5FACA 5A8MA 1XLCA 5CGMA 5E6YA 4CNSA 3W1MA 2QJNA 1KT1A 3JUGA 1E5NA 2AQVA 2WCGA 3WK2A 3HPXA 2X8RA 3F1QA 4NNAA 1G67A 2BG5A 2R8WA 2D3NA 1PZ3A 4CVUA 4DRQA 2Y5EA 3CIWA 3NZ1A 5DMYA 3VGDA 2Q8XA 1WKYA 3DG7A 3JXVA 4JTJA 3H7VA 1YDVA 1E9YB 1TX2A 4QEEA 1W3NA 2YFNA 4AVNA 1JVWA 4ZPVR 2PCEA 1RVGA 4BEUA 3L12A 4B5UA 2QR6A 1GJWA 3B05A 4DIPA 4QISA 4XKMA 1JL8A 4AXNA 2P10A 3P81A 4IJCA 4QG6A 3PUDA 1IIHA 5DLCA 1S5TA 2Y63A 5CPSA 1DE6A 4NASA 5HBFA 3KCLA 5CPOA 4NNRA 3ZVHA 1AVAA 1R3YA 2QUNA 5D30A 2PTZA 4NXSA 1ZNNA 4HCDA 2XP4A 2BBFA 4RDWA 1S3TC 3RUBL 4PMVA 3GHUA 2HDJA 3SY5A 1QMLA 2LKNA 3B9OA 3CUXA 4EF8A 4O18A 4DO6A 1J4RA 3KCEA 4O14A 2ZX6A 1SO5A 4KWOA 1A3XA 4Z1AA 3LBCA 3RR1A 3UU0A 3UXAA 1PTGA 3R5EA 1XQLA 2QVNA 4GJIA 5U4NA 4AYGA 4WY0B 1JJKA 1E71M 4JYDA 1KM2A 3NQMA 1AG1O 3VOIA 2PP1A 4GUGA 4PCTA 2BS9A 5XINA 1FKSA 4NP7A 4E0CA 2BMBA 3SGZA 4HYWA 1XRVA 3RG6A 2WBGA 1J4IA 4IIBA 4AHOA 5AYIA 3XISA 5FIPA 4PBGA 5TBOA 4F79A 1CGYA 2VX5A 1UA3A 3VFLA 4MNMA 3M1ZA 5IXEA 2YBUA 4XSMA 2FIQA 3VAWA 4H9TA 1YPFA 3AMLA 2DW7A 3CV7A 1Q6OA 3OW1A 3C0SA 2JIEA 1LLZA 1F3EA 3SCVA 2YCKX 4C90A 5AB3A 2X41A 4C6CA 7ODCA 1M1BA 3PZMA 4LALA 4KQZA 4AW7A 3AUJA 4G7EA 4CD8A 3GG7A 2ZZ3A 5I3HA 1Q6IA 2DT0A 4WQ6A 4W8AA 3AISA 1XRFA 1IEVA 5BWFA 1B3WA 4QS5A 4ENLA 2UV8G 1UJQA 1JG9A 1C9HA 4CLMA 1LBLA 2G3JA 3IV8A 4EX4A 4S3KA 2QUVA 1F07A 1UKQA 4QM1A 1QBAA 4IFRA 2D69A 4C91A 2CW6A 4QFUA 3PBYA 1XYFA 4Q8NA 4REQB 3HPSA 1BAGA 3AHXA 4NSBA 3TJ4A 1BVWA 4RNIA 2PV2A 1ISZA 1UH3A 1Q1CA 3UXIA 4IIFA 4R5EA 4OUEA 1JFHA 3UWZA 3AHVA 5KITA 4YYFA 4JIEA 1ONXA 1SO4A 1F4HA 3O5FA 3WMBA 4Q4QA 3AHYA 3OQ8A 3O0KA 4L80A 2Z26A 1VRDA 1EIXA 4R53A 3ZZ1A 3WNLA 3E9AA 3SCNA 3TKFA 3ITXA 2OXNA 4KW2A 4KCVA 1GT8A 1O94A 3WK0A 5DCDA 3RR4A 4HNOA 4QSHA 3SIZA 2FB2A 2CERA 1OBAA 1A5AA 1GRJA 3GK0A 4JFLA 1VPXA 1XRSA 1EJUC 1KRCC 4TW8A 1QXLA 2GJLA 1E1CA 3AMDA 1GOMA 4HZ6A 3BARA 4DH0A 2AAMA 2PCQA 4JQ2A 3E49A 4CEXC 3IRDA 2RGLA 1JDEA 3SZ8A 3N2BA 2CLHA 1P0DA 1M41A 4CCEA 2FPYA 1M5WA 3STEA 2BOFX 3IHZA 1H7NA 1IT8A 1PE1A 1XXXA 2XYLA 4PBFA 1UROA 1FHUA 1EO5A 4K1WA 2CLPA 4JTIA 4C6JA 2PD9A 1RQEA 3ERPA 2ZRYA 1MXGA 3FYPA 3K8KA 3RF9A 1HZYA 3B06A 3EWXA 5E9AA 1NP0A 4M81A 4JTUA 2DSKA 1FWCC 6ALDA 2V8ZA 2Y7EA 3WENA 1UOZA 3TR9A 3H2OA 3RM8A 1VYPX 1QZ2A 1JUKA 3BOFA 4MVAA 1SW7A 1FKGA 3EB2A 4W7VA 1TPFA 3H21A 4J3TA 1AK5A 2FB3A 3UR7A 4QIUA 1JZ7A 1JF6A 2EG7A 4DWSB 2DZXA 4GGHA 3MC5A 4GY0A 1XIJA 3R4IA 4ICMA 1KM6A 1TPDA 3QVQA 4Q7NA 3GU2A 3T07A 1QPQA 3GG1A 4D6HA 3A6OA 1E51A 1JCTA 4CD7A 4M19A 4C02B 3LU2A 1G4TA 2QJMA 4UFHA 3GXPA 2G4FA 4WZHA 2WANA 3SRFA 3HURA 3B97A 4AY7A 2QZRA 3Q2DA 3W1TA 3GTYX 2V3GA 3ZLGA 2HROA 4PODA 4GISA 1NF0A 1TA3A 1W3JA 2ATMA 3HG3A 4WGXA 3DH7A 2WSRA 3HB9A 1QFEA 4OT7A 4L9ZA 3FJLA 4IICA 4ACZA 1OADA 3LX9A 3WMLA 4TW6A 2HVMA 3L66A 2Y2WA 1F8MA 3QKEA 3B9EA 4MFDA 3EY6A 3W27A 3NL3A 2ACQA 5B8IC 2W62A 3FN9A 4W8LA 4PSPA 4ZODA 3R0UA 3ZT6A 5A8QA 3T09A 2HRWA 2GSEA 3MUIA 3W2MA 2FVKA 3LLFA 5E9XA 1H60A 2XH2A 2G95A 1XUZA 3BLKA 3CUGA 4DVOA 1R7AA 1T5AA 2QF7A 3UPBA 3NRKA 4UQDA 1HQTA 1KCLA 5AHLA 1ICPA 2H90A 3WQEA 2GJNA 5D33A 1GPFA 1RCQA 1FUYA 1KRAC 1WDDA 4JICA 3GFXA 4NNCA 5DIUA 3DI0A 3QR1A 4V15A 4RW5A 4OVXA 3R0KA 1TPH1 2F38A 3GD6A 3G1HA 2ANUA 5FSEC 2R1LA 3ES8A 5K9CA 3GU0A 3EPMA 3W2UA 1DXFA 3MVTA 2FTWA 2WJDA 1SW0A 3F4VA 3WL0A 4YCOA 1KBJA 4CU6A 2AAAA 3URQA 2GYIA 1PKNA 4NQ1A 1S2TA 4NXKA 1PCKA 4UTFA 2ATSA 1MI3A 4WLCA 1X8FA 1HIZA 3PG8A 4LNCA 1P48A 2OLHA 1FA2A 3GYCA 3KHJA 1F4AA 3O8AA 4LYPA 3NQAA 1Q6EA 1TTJA 2NXGA 3CEPA 4XBKA 3E1F1 5CPLA 2UY3A 2PLCA 5EA9A 3PZ9A 4A3UA 5EKYA 3GR7A 3LNPA 4RJEA 1TV8A 5CEWA 2ZKMX 3GU1A 4XZWA 2PDWA 2JF6A 3TYEA 1H0IA 3QQWA 2PMQA 4DJDA 4XTDA 1KFKA 2QIIA 4JFIA 1SUXA 1ITCA 4QJ1A 2OSXA 2WPGA 3S2JA 2ZTJA 5FA5A 4X61A 4U5IA 4WJXA 1BL4A 1TMLA 3CHFA 2RDWA 1JRBA 1UR0A 3RCNA 3W37A 1W31A 3H9RB 4DJED 5A8GA 4WCJA 4AX6A 2B31A 2G41A 2V3FA 4UNLA 3V36A 1GOOA 2WMJA 1KQZA 1K7EA 4GXWA 4GH1A 2WSQA 2HCVA 3VIHA 1S3HA 3WJXA 3MMWA 2B5UB 2QCGA 1X1ZA 2PDFA 5EY5A 4CEUC 3DGBA 1AW1A 3II1A 3BTNA 1H4PA 2HK0A 2NUYA 1ME7A 3LK6A 3UYCA 1ECEA 4BF7A 2ZWYA 1XLGA 2INFA 2YSWA 5DBTA 2EPLX 1IZCA 1KXVA 1JD7A 3R1ZA 3WD0A 3LHVA 5I77A 2YDQA 2CZDA 4IISA 4UTWC 3HOJA 3OGVA 3I4KA 3K13A 1C9DA 4K36A 2ZQTA 1RBOB 1W32A 3L4UA 4RE3A 5I09A 1WZLA 2J7HA 4GXMA 4IT6A 4Y96A 3KBNA 5CBJA 4AG0A 3H4XA 3ITYA 3ARWA 1RALA 4EAMA 1UPMB 5G2HA 4A3QA 4AD5A 3CLWA 4AY1A 1QO2A 3EWDA 3UZ5A 2R1KA 3TC3A 5G4EA 1WQ5A 3B8WA 1LOSA 1EQ3A 1R47A 3D6NA 2DZAA 3UVIA 5G1TA 4XAFA 2VURA 1XBVA 2Z1KA 1SYTA 4I90A 1QK0A 1G01A 8XIMA 1DYSA 3WUEA 4CQ9A 2OX4A 4LQ1A 1WDRA 4S38A 4FB7A 5C7HA 1PZ0A 4XIAA 3TTEA 2RUCA 2J4GA 3ABQA 3N2XA 3TK7A 4JEJA 4B9YA 2N87A 4TTUA 3AAMA 1LP6A 3FVDA 4ERIA 4XKYA 5IFTA 2XM2A 3OZYA 1V02E 3FS2A 3TWBA 3WQDA 2FPVA 3GY1A 3L4XA 5FF7A 4H9VA 4DHGA 4IIDA 4XVDA 2V3DA 1B9BA 4KFNA 3GVQA 2BZNA 2D1ZA 1ZJIA 1D8CA 1K3UA 4E2BA 4JTRA 3NTYA 4YTUA 1QPKA 2WSKA 4FEZA 2OYMA 3T0DA 1XH1A 3B9DA 4E4UA 3HA1A 1XYBA 3GTNA 3OJGA 1Z48A 2CC0A 2GGIA 3AYTA 1SFLA 1TV4A 1O95A 1L6FA 3R8RA 3TAKA 4W9TA 4PULA 2QNEA 3GG8A 1UWQA 3LBOA 4BWLA 3DENA 4EWJA 3I6RA 4ZO8A 1XIHA 4LCQA 4DPPA 1FTXA 4ERAA 3HQ1A 2VGFA 4PZVA 4LXFA 1PX8A 4AVOA 1R6WA 1FKLA 1WKEA 4XAGA 4RW3A 4K68A 1ECQA 4B2DD 1EIBA 3U2ZA 1E72M 3SCRA 3VIJA 4QE5A 2FGBA 3P67A 3T0CA 2WC7A 2PU1A 3BAYA 3W6LA 6REQB 2AGTA 1TV2A 1E6QM 2XPKA 2VM8A 2G97A 3GC2A 3NWRA 3GNPA 1IEWA 1H7PA 4X2PA 3HFTA 1Q2RA 4ZOBA 1XIMA 1DJGA 1TWDA 1U30A 3RDKA 3NQBA 4JCMA 1A4LA 1P0EA 3F5JA 5HW8A 4IX2A 3A23A 4PFMA 5I02A 1EDGA 4PTXA 5I7GA 4IPNB 5D37A 4MWAA 4AD1A 3OP2A 3XIMA 2EKGA 1TTPA 4FNPA 2RUSA 2CZFA 2ZFAA 4YCPA 2JKEA 4DT4A 2WC3A 4RUBA 1W1IE 3VMOA 3ZQ9A 3WNPA 3PBGA 3DFHA 4FX8A 3FXYA 3L4WA 3GDRA 4GJJA 3IANA 4HNCA 3U48A 1P7TB 3QSTA 4JTKA 1DE5A 2V2DA 3PJTA 3NQ6A 3QMSA 2X30A 2J13A 2KGJA 4FLOA 3TA6A 1U1UA 3MZ2A 1S38A 1XLKA 4MUZA 4TVUA 1K03A 3W7JA 3G1YA 2G0WA 1HVXA 2WJFA 1UCWA 3REQA 5ENLA 2VT0A 4H3DA 1E1CB 2QDHA 3BJTA 5DBUA 3PPGA 1ESWA 3PZGA 2DP3A 3VD7A 5DEZA 2FFCA 2D0FA 1U79A 3VMNA 4EACA 3QTGA 4PRTA 4Y9AA 1BTMA 2H6RA 3UXKA 2BODX 1B31A 3LI0A 1R3SA 3W38A 2X1RA 3BCJA 4C6IA 4DRKA 4RL3A 5EYWA 1EYWA 1CW2A 1KR1A 1U1HA 3DFSA 3QFWA 3G2GA 1UR3M 2PD5A 1ZBWA 1XSIA 2JF7A 3H7UA 3MY9A 1BFNA 2PF8A 2ZZ5A 3T0TA 1CXHA 4OBRA 1IYXA 2PBGA 1LT7A 3GDBA 4GCAA 1LBMA 2KZHA 3RYSA 2GOKA 2DV0A 4GFIA 3KWXA 1BKHA 1PX4A 2VO5A 1YATA 4LVBA 1AW2A 3EOOA 5FD0A 4Q8UA 3R94A 4F2UA 2E25A 4DRPA 4ZB2A 1VS1A 1S1RA 2FZMA 3OO2A 2QUMA 1YX1A 4IQJA 4DLMA 3QQ0A 4IJRA 3W7KA 3QTPA 4KEUA 4GY1A 3M0HA 2B7OA 5D38A 2KR7A 1DPMA 2Y24A 3U6WA 4J3VA 1VFHA 4UQAA 2XH0A 1E1EA 3PR9A 2J78A 3EZ4A 1OC5A 3KRBA 3KRSA 2JIWA 2BV9A 1ZZMA 3H26A 2J24A 4GX9A 2J7BA 1FWAC 3TXZA 2OZ0A 2PU0A 3EEZA 3CQIA 4YS1A 1U5HA 4FN2A 3AI0A 2QEZA 1JRCA 4DJFD 1TPC1 1E0TA 2C3ZA 2W63A 2PDPA 3PA7A 5A1AA 2CHOA 2ITKA 3F2CA 1KWGA 4AHPA 3GU9A 4GVIA 4M56A 1P0NA 4LCRA 4DNHA 1M68A 4H1ZA 1SQ7A 5F4WA 3P0XA 4CNTA 1FWEC 1H1NA 2Z1BA 4Q22A 3DDMA 1M04A 2OVLA 1L0PA 3NAVA 3NCOA 3S6DA 1EZWA 3SFKA 1CB7B 4FIQA 3GFYA 3OGSA 4C65A 3KBJA 4JTSA 1YTKA 3VKBA 1FHLA 1YADA 7A3HA 3Q65A 3W74A 1UJPA 3IV3A 4JX4A 1JCNA 3PY2A 3UNTA 4GYKA 3P61A 2MPHA 3A3WA 3QGVA 3NSMA 2PZ0A 1TMQA 1DJXA 3IGSA 4AWEA 3AALA 5DANA 4K39A 2VKZG 4YTTA 3PS7A 2HEJA 2XIMA 4HP5A 3WLSA 4J4NA 4EE9A 5MKGB 1BWVA 5BXRA 3GDKA 5E93A 2BXZA 4E3VA 5I3KA 1IIGA 3IGHX 4HNNA 2OO0A 2ZVRA 1L8NA 1QASA 4CCZA 1XIBA 4F40A 4HSOA 4GZEA 2RAGA 2C14A 2NUWA 3T40A 4L1XA 4JGDA 1Q3NA 3SY8A 1VCGA 3GVWA 1Q2SA 3EA3A 3VU2A 5JUVA 3O5DA 1A50A 2O92A 2DQXA 4HU4A 4LUTA 4TW7A 5G1YA 1TWZA 3KAIA 4Z1BA 4JKKA 1CIUA 4H6RA 3WN6A 4AAJA 4ODKA 5E70A 4IUOA 4OU1A 3WLLA 1PB0A 5CQ1A 3PFRA 3FA5A 2V30A 4IIGA 3OU8A 3GQYA 3EWBX 4QROA 3AWOA 4NRSA 4L72B 1EUAA 3RU6A 3N2CA 5C9ZA 2A2IA 3KVJA 3ABSA 3LM3A 3PNZA 3CM4A 2HWGA 4S3FA 3QLLA 5CZKA 1RJRA 5C9XA 3V4BA 2PC4A 2Y7FA 4GYPC 2JKPA 5IM51 2WK2A 4HOZA 5EL1A 3BPWA 3H12A 2C7FA 2EJAA 3OVQA 1WZMA 3W76A 3C2EA 7REQA 3LHWA 1US3A 3ZWTA 1XHGA 3WLIA 2M1IA 1EH9A 2W92A 3PSWA 5E5CA 1T40A 1WZAA 3A64A 4UFIA 5D09A 1Q4NX 2QDEA 2EG6A 1H7WA 4HN4A 4RNJA 4DM2A 1JDAA 3CYVA 5A6SA 3CWHA 1MVYA 1ZP3A 4ZA0A 2W61A 2GSJA 3IIVA 2VEIA 2VCAA 4FI4A 1GQJA 4JFWA 4ORMA 3W2LA 4Q4RA 3QC3A 5HPCA 1L6YA 1E6PA 3RPDA 1FX6A 3P5ZA 3JU2A 3M43A 1BHGA 1AH3A 3N04A 1GVFA 1Q8JA 4MYXA 4D1JA 4H04A 3LV6A 1Z6KA 2ZXDA 2ZX9A 1SPQA 4HSNA 4Z42C 3KS6A 2Y0FA 3KXQA 2PDHA 3MDUA 1PO9A 1F9CA 3S9IA 4BR1A 2PAJA 3UQBA 1QI5A 3EWWA 3NPUA 4IG2A 5DMMA 3OZPA 1POJA 3ME3A 1XD1A 3GM8A 3S2MA 2OEJA 5SWUA 4EXBA 4JYFA 2R14A 4XZLX 4IFKA 4Q8OA 4U10A 3HPFA 1OCQA 2NX3A 2PDCA 2PWUA 4XAPA 3W0KA 1VP5A 3WX7A 4BZYA 3DFYA 2OGYA 1G5AA 1R7OA 1CB2A 3TFXA 3C8NA 1R46A 1BGGA 1O4UA 1IXNA 4GI8A 4PUUA 2P0IA 2ZUNA 2QS8A 2E4TA 2BHUA 4B5NA 1FDJA 3IIPA 2OCZA 3WNNA 5FF3A 2J47A 1JUEA 3PUOA 3W7LA 4W7UA 1MQRA 3S4TA 1MYRA 4NI8A 5I3FA 1ICQA 1GUVA 3BJSA 4IIEA 1YDYA 1LDCA 1OFRA 3BJFA 3LUTA 2XJ7A 4N9EA 5JH8A 2WNQA 3VGEA 3QHOA 4P61A 5D9PA 4JYEA 2INEA 5JBDA 1OC6A 3PJXA 4LW7A 1CCWB 1XDJA 3O5JA 4RNHA 5G2WA 3ALFA 4Z1DA 2I1OA 4XTIA 4MWAE 1K8YA 5BWAA 1UA7A 1IEIA 4HMDA 3UJFA 4GWEA 4DRIA 3WDPP 1F3XA 4Q6JA 2BY0A 5I2UA 1OHLA 1UYQA 3TJIA 2CWXA 3GWQA 1K8CA 1M7PA 1VYSX 3C3NA 3FIGA 4HK5A 1SO6A 3M4HA 4DELA 2PWFA 4UQ9A 1LLWA 2ESCA 5GJPA 5D2TA 4AC1X 4FXSA 1TFVA 5D8ZA 5JVLA 2PC8A 2Z2UA 3P60A 4ZO6A 4GI4A 4DYKA 1YPIA 2QYGA 5HJLA 3AIWA 3W7GA 3GXIA 3ABZA 2J7CA 4TQTA 1L6WA 4D9PA 3OG3A 4MM1A 3B8TA 1N82A 3O9NA 4GQBA 5HUOA 4FIRA 2I9EA 1FDYA 2YR1A 2X05A 1OFBA 3DOPA 1QVBA 4NL1A 4GRSA 3BZJA 1K1DA 4IWWA 1EWDA 2ZA3A 3WH9A 1A0DA 2QJIA 3KS5A 2ZQ0A 3T42A 4Q8TA 2RDXA 5AKQA 2HV5A 3NGJA 3SCPA 5ABHA 2RKXA 5AZ1A 1VH7A 3MO7A 5GJMA 3KL5A 2IMRA 2WJEA 2O9OA 3FJ6A 1FKBA 2OKTA 5CSUA 3QKZA 2AQWA 2BVYA 3HZ3A 3LPPA 2E5BA 2BGNE 1I6NA 5EGRA 1CENA 3R79A 3UWYA 3ZSSA 3BC9A 3KCJA 4NZ5A 1NOWA 3ELFA 3TMQA 1N55A 1YNQA 4HA4A 4ODLA 1PIFA 5G5IA 2CIPA 2XSAA 2Z2BA 1IQ8A 1V4YA 1FCBA 4H00A 4D8AA 1XLMA 3LRMA 4UQEA 3GTHA 4ZMGA 3PULA 1OFAA 1ZQ5A 5F7UA 1CGTA 4JAWA 4GIYA 2GVLA 3L0NA 5HUPA 4FXJA 3MMDA 3QZ6A 1X6NA 3ARYA 4S3DA 1VJZA 4JN6A 3N12A 3L2LA 4GXPA 2PDGA 3M7SA 1CXEA 4ONVA 3PRBA 1I2PA 4AEFA 2WMIA 1UD2A 3LQGA 1O1ZA 3VIMA 3GXDA 2PDMA 3AIBA 5CSRA 1A5KC 1M6JA 1AZ1A 4H6EA 2OT1A 4MNJA 4ZXOA 1KM3A 1F76A 3DHPA 5JMUA 3CUJA 3WF3A 3AXIA 4GE8A 2ISVA 3TYUA 4DUOA 3UG4A 1AMKA 3THQA 4A8LA 4GNKB 1B3YA 3W7CA 3W88A 1N1AA 3EXRA 1E6SM 5D75A 4NZJA 1W5MA 1FKRA 1DHPA 3M5ZA 5TF0A 1Q66A 4OOUA 2Y61A 3STCA 1G7UA 3TROA 4FPSA 5LNUA 3DFTA 5DX7A 4RV3A 3RHGA 1VFTA 7PTDA 1NVMA 1E55A 5MF5A 1VD6A 4UWMA 4CNOA 4TO8A 1O12A 4K7VA 4IHCA 1DBTA 2JEPA 3PN8A 1W1VA 3PFMA 2I14A 3VIPA 4HNTA 2QJHA 3L67A 1HJSA 4CU8A 3TLQA 3ITLA 2A3HA 3M16A 1GQKA 2DFAA 1XPYA 4GNVA 1S5MA 2HZGA 3SIMA 3WFAA 2PGEA 4IM4A 3UEQA 2VUNA 1ZUAX 1ONWA 2YBTA 1WUFA 4LAYA 3F2BA 4HVXA 1TV5A 3MP4A 1TZ9A 1SZEA 5E09A 1OGGA 3B7XA 2POZA 4HGXA 3H8AA 3OA3A 4MJ4A 4DXKA 3VX0A 3UZWA 4NIRA 4NILA 1CT5A 4QE1A 4DXXA 1XCFA 3IARA 3QW4B 2X09A 2C1HA 3IKDA 2Y6ZA 4W5ZA 4W9PA 2GQ9A 1B2YA 1QHPA 3MT1A 1WXJA 3A9BA 1PZ1A 3KEHA 3LB0A 4WRHA 2DH2A 2VL4A 4NJHA 3W1LA 4G2DA 3QGKC 2C71A 3MTWA 2OTDA 5CLWA 1V3MA 5D8WA 3RAOA 4LH8A 3VOGA 1N8FA 3MMTA 4JX5A 1JNSA 2QMJA 3JRKA 3GXTA 4PUKA 2ZUVA 3HJZA 1WA3A 3AHZA 1ZAIA 2BWGA 4R88A 2RH9A 4ZQCA 3RLVA 1LQAA 4IPIA 1V0LA 3G8RA 1BGAA 1JZ3A 1FOBA 1US2A 3NO5A 3NGFA 3QY7A 4DJDC 4ORIA 1BD0A 2VGIA 3L4ZA 4XUGA 2VC5A 3CASA 3IJDA 2K8IA 3WLHA 3TOYA 2UWFA 2H9AB 2XVKA 1NDYA 2Q02A 4Q7IA 3GW0A 4ZSUA 4XZHA 3IJQA 3BOXA 2DZPA 2QLYA 3BK0A 1JPMA 1N2VA 1E56A 2PDYA 4ML9A 3DFNA 2IF4A 1DJNA 4Z17A 3NA8A 4UTMA 4F2BA 1NFBA 4FF7A 4Q4KA 3MUCA 4C1NB 1UD5A 1GOKA 3AJ7A 1O5XA 4PL2A 1QOPA 3WUFA 3F4CA 2CHNA 3S1UA 2P88A 1NAL1 5C9UA 5TD4A 4PYSA 5K9XA 4O11A 5HNNA 3VINA 3ZXWA 4GLEA 1XISA 3P3BA 3BANA 1RUSA 3W85A 5REQA 1VIWA 3UF9A 4L1WA 4XD3A 3K46A 2ZZ6A 1RD5A 3WMSA 1QPFA 1MW1A 2ZR4A 4IPLA 1UR9A 3TDFA 2BFGA 1TCDA 3E2QA 3S8HA 2A0NA 3WQ4A 4B16A 5LKYA 1QPLA 2F84A 3URNA 1AQFA 4I7VA 4DZIA 3W29A 4DRSA 3LHUA 3TE9A 5CZTA 4QLKA 3O5KA 4LYQA 2OWCA 1AMYA 2XFWA 4IX0A 5CPNA 2J66A 3HQOA 4DRHA 1XLFA 1R2RA 4ATWA 4FX6M 4LAUA 3GNRA 1IXPA 2E7FA 2WW5A 2EXOA 3TYDA 4YL2A 1FQ0A 2P76A 3VNLA 3ZO9A 2VR5A 4IP7A 5HJYA 3NPXA 2IS7A 3VKKA 3G1AA 4MPKA 3MI2A 3SRDA 3EPNA 4QNEA 4EPBC 5AHFA 2TRSA 3M6DA 3M44A 3Q58A 3CHDA 1FWRA 3KL3A 1WXYA 1QBBA 2DVTA 4L61A 4XV0A 1ZCOA 5H91A 1XS2A 2Z7GA 3ITVA 3Q67A 2Z24A 4W5UA 2X0SA 2ZCGA 1VGAA 2EPKX 2PEVA 4R9XA 1FWJC 3ICJA 4PUJA 2NUXA 3MUY1 3W87A 3ZOAA 5HNRA 3EYPA 3IIXA 5HQLA 1VFOA 4MJ2A 1L6GA 1NY1A 3S0CA 4BF9A 1WKFA 1V3LA 2X1UA 4N02A 4EXQA 5ABTA 1C7SA 4WUIA 4J4KA 1TPB1 3DKLA 1IV8A 3C2FA 5LSMA 1MZHA 2O4QA 1TQXA 5GNXA 2XP5A 2JKAA 1OD0A 2YIHA 4RLIA 2E67A 2XN1A 3WLNA 5LIKX 2EQDA 1RBAA 4AMCA 1GKRA 4GJ1A 3LLDA 1TVPA 1TTIA 1O6IA 5HKGA 3VCRA 4AZCA 4HCHA 1W1A1 4AY8A 3Q94A 2PV3A 1HJXA 2GDVA 4IUGA 3NO1A 4BWLC 5HWCA 3DERA 3OTRA 2OODA 1OX4A 1RK5A 2A6LA 3PZUA 4H9YA 1LM1A 3EMCA 3RFWA 4HPXA 1UQZA 2VVNA 1DKWA 1T11A 1CYGA 3S3GA 3NYDA 5BXPA 3DN5A 3NZQA 4LWWA 3A21A 2VFFA 2BOGX 3QOKA 4MHBA 4ZENA 1GG0A 4B3LA 3TZFA 1W1ZA 1S5VA 3VIKA 2TMDA 4PA8A 4KPLA 4KGLA 4P7OA 1XLIA 4RDYA 4QR6A 2BVTA 3O6YX 3BGAA 5HANA 3O07A 2DJLA 2JFEX 1SFJA 2DG9A 3UWEA 5E0FA 1XYMA 2Z1WA 2IUZA 3C86A 2FGZA 2R6OA 2FH6A 4TVCA 3EPOA 3DYPA 2QHAA 1RV8A 1BEUA 3NQCA 1I1WA 5HA7A 3PG9A 4I9MA 5BRPA 2PGRA 2RFGA 2NQ9A 3GAYA 3ENLA 2E40A 1J2WA 2WAGA 4RXFA 3G3MA 3GH5A 1KA9F 2XN2A 1GOQA 2E6DA 1H63A 1DEDA 2XIQA 2WVVA 3PSVA 1Y0OA 1OM0A 2DZTA 2OB3A 4E4FA 3TLLA 5IDZA 4P8VA 4JKLA 2V38A 3MCMA 4I6KA 3PP7A 3VUPA 1BSIA 4GABA 4IPPA 3VKAA 3BMVA 5LNWA 4OBTA 2ZA2A 1S46A 1WKDA 1MDLA 2NWSA 5F4XA 4Y8EA 5XIAA 4KESA 1E40A 1NDZA 3AXMA 1OD8A 2BX7A 4MDOA 3KTSA 4MFEA 3TU9A 1AW5A 5E1QA 3GDMA 1W1YA 3VNIA 4P8XA 2OR2A 3EOSA 2BB0A 4CU7A 3WQ5A 2PRLA 1K9FA 3O5MA 3IPWA 4JIRA 4IL0A 5D2WA 2PDJA 2KI3A 3E2VA 4O1AA 1Y8BA 1TE6A 3RITA 5LA1A 3GO2A 4Q8WA 1Z44A 3KRZA 4P5UA 1TPUA 4DPQA 3H70A 1BQGA 3KVMA 3G0SA 1W5OA 4NAFB 3DYMA 2E6YA 1G1YA 1V03A 1FJDA 3NQVA 4XQ6A 1Z42A 3NUKA 5CPMA 2QCLA 1MSSA 2V2CA 4DZ2A 5EB8A 3E12A 1P1XA 4JOMA 3P82A 4A3RA 1QO5A 4XIMA 2M08A 2VNCA 1W9XA 4XBJA 3L7RA 1ML1A 3SBFA 1VC4A 1DWHM 2VZUA 2NSXA 2GVGA 2UY2A 1NWSA 2V5BA 2D22A 4GOAA 1SZNA 2FVLA 4PL1A 3TSBA 3UI6A 1TUFA 1ISVA 2HBXA 2C19A 3VM7A 3FYYA 1GWJA 1J18A 3A9IA 5CPQA 3VUSA 5DT5A 3OHIA 3CYJA 1UOKA 3QXBA 4DBEA 2P8BA 1H0GA 1XINA 3QMRA 4ZTXA 1PKMA 3SM0A 4XZNX 2RQSA 3FCPA 1G0CA 3M5YA 2J7GA 3PTDA 1GTHA 2UBPC 1QAPA 1IEQA 3HGRA 3LGEA 1DP0A 1XC6A 2DSVA 4Q8VA 3B8IA 1JPHA 2IXUA 1GZJA 3BQ6A 1MEWA 4KCWA 1ZCNA 2P3ZA 4M6QA 2FKPA 1REQA 5I79A