4WKFA

Crystal structure of human chitotriosidase-1 catalytic domain in complex with chitobiose (2.5mm) at 1.10 a resolution
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
368
structure length
368
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chitotriosidase-1
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM.
pubmed doi rcsb
source organism Homo sapiens
total genus 128
structure length 368
sequence length 368
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wkfA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wkfA01
2E4TA 5CG0A 2OWWA 4GO9A 1Q6DA 3CO4A 1KQZA 1UZ4A 1GPFA 4BS0A 2GFTA 1V0MA 2WBKA 3OG2A 3AIQA 1JYVA 1TA3A 3GNOA 4OIFA 3K8MA 4W7UA 3WDRA 3VD7A 3WF1A 4WF7A 1V6VA 1UOKA 3W27A 2A3EA 2E9BA 3VUPA 1TCMA 2EPOA 4PCSA 5CLWA 3QHNA 2DSVA 2BY0A 2O9RA 5CPSA 4AEFA 3OLGA 1ECEA 1W9VA 1KGUA 1UD5A 1E55A 1WAWA 5D9MA 4AD4A 3W53A 3F5JA 5FL1A 4TVCA 5DEZA 2VRQA 1MXGA 4UFIA 2XYLA 4Z2LA 1W3JA 1JXKA 2X0YA 4KRUA 1QW9A 4Z2HA 1W32A 3WMBA 4NZCA 2BVDA 4PN2A 5D4YA 3BC9A 1W9PA 1MW0A 4B9YA 4AIOA 3AHYA 3GNPA 4HTYA 2QMJA 1MW2A 1CECA 3VIGA 4HZ7A 1TMQA 1TR1A 2YIHA 5A6BA 1E6ZA 2E8ZA 4JFSA 1VEOA 1ZS2A 1X1NA 6A3HA 4PTMA 4Q22A 1DWAM 1C92A 1G9HA 1VRXA 2X1IA 1UR9A 1H09A 3NSNA 4P7QA 3WBEA 3KWXA 3SIMA 3VMNA 5CGMA 2XWEA 3OGRA 3PZUA 5BYWA 5AYIA 2CKRA 1AVAA 4DUVA 1JYXA 1LWHA 4W8AA 4MNLA 1KCKA 3WQ6A 1JNEA 1O7AA 1JZ4A 2C8NA 3AHTA 5FD0A 1GCYA 2HISA 5A2CA 3W25A 3T0BA 5HPCA 3MUY1 1B9ZA 2D0GA 2CHNA 3KL3A 4R5EA 2VZTA 3HU7A 2QPSA 2YOCA 2XG9A 3WEZA 2XVPA 3K4AA 1V3MA 3ZT5A 1I1XA 5DT7A 3AI0A 3BAYA 4ACYA 3T2PA 5LA1A 3VX1A 1B2YA 1OD0A 1JZ6A 4D6HA 4E2OA 5D9PA 1R7AA 1CGTA 3W38A 1BAGA 4AD1A 1JNDA 1QI0A 3TOPA 2J4GA 2E0PA 3M07A 3SCQA 3PZMA 2G3NA 2YL8A 4UQDA 4W8LA 5A8QA 1E4NA 1C91A 3FW6A 2TAAA 4HZ8A 3CUJA 4TTGA 3AIEA 1XSKA 2BY3A 3WIJA 4D72A 2PWEA 4OBRA 1GORA 4MB3A 5BXSA 4D6EA 1UR1A 3I3EA 1TFVA 3W37A 2V3EA 5A2AA 2YBUA 4HA4A 4H04A 1K9FA 5I0DA 1LLOA 2A3HA 2PBGA 3DC0A 1GHRA 4U5IA 2W4XA 2C7FA 2GSJA 4DWSB 2EEXA 3MO4A 4PSRA 5JIWA 1B30A 3MUIA 2DPEA 3PBGA 5EFFA 4BQ3A 3UERA 4QFUA 1EOKA 1W2PA 2J79A 1ISVA 3AMKA 1N82A 4IUGA 3WNMA 1OM0A 1E56A 3VPLA 1XCXA 3RILA 3ZQ9A 4H41A 4B16A 3AIRA 5DFAA 2YDSA 2YDQA 2XGBA 4OOZA 1HJWA 4E8CA 5EB8A 2X8RA 4PMYA 1B3VA 1HIZA 1OT1A 1V0NA 4IM4A 4NI3A 3VGDA 2WAGA 3UESA 1JYNA 4QCFA 3U57A 4AZ5A 4PMVA 4CN4A 5GNYA 2VMFA 1F4AA 4FLQA 2UY3A 3ARUA 3WDJA 2DSWA 4D71A 1F4HA 1OINA 1UKTA 4BCEA 3LPFA 3UR8A 1V3HA 5CJ5A 3WQVA 2CNCA 4UTFA 1JD9A 2D2OA 2NT0A 5IDIA 1W1VA 1I1WA 1CXLA 4GQQA 1E3XA 3KL5A 4CD6A 1QHZA 4E8DA 2VI0A 1CYGA 3N18A 1W9UA 4JCLA 3UG5A 5JBFA 5C71A 1HJVA 1DWHM 3GH4A 3EDEA 3ZR5A 1VIWA 3AMDA 2J78A 4JFVA 5IHRA 3MUAA 1UWIA 1YQ2A 4TTUA 1XD0A 3ARQA 4OBSA 4JL1A 3AIWA 2YA1A 2WK2A 3BCDA 3M46A 2VCAA 2VZUA 1WZMA 1H41A 2CCRA 1HNYA 2D20A 3GXDA 4DWSD 1WDQA 3KEHA 5GPRA 3GM8A 2CXGA 1KXTA 3VTRA 3WUGA 3ARZA 3VMOA 2O92A 3VGGA 4P8WA 1GOOA 2O9TA 3PZTA 2BFGA 2ZX8A 4M29A 2V5CA 2VCBA 3O6AA 4LPCA 5A6AA 3KZSA 1ZBVA 1ODUA 1MYRA 3AQUA 5I78A 1HKMA 3WDQA 1GNXA 1DWIM 4W93A 1J01A 2PBOA 1PX8A 3E1F1 3MS8A 4EKJA 3VU2A 5JBEA 2CETA 5A6MA 1ZBWA 1V02A 1CLXA 2PI6A 3ZM8A 1NQ6A 2WMKA 3FY1A 3SUUA 1JI2A 2D3LA 1QI4A 1E40A 4XX6A 4WJXA 5FL0A 4EK7A 1KBBA 1MXDA 3SCRA 1JAKA 4QP0A 3NIYA 3ZO9A 4J3VA 3PTMA 1PIGA 5BXTA 4X0NA 1SFSA 3AS3A 3VKKA 1BVNP 5LA2A 3B9AA 3K1DA 3IAPA 1V6YA 3MUZ1 4BQ2A 4D6JA 5I2UA 1UR4A 1PX3A 3BCFA 4UQEA 3UETA 2XIIA 2ZUNA 3SUWA 1UD2A 3PTKA 4AZCB 1EHNA 2XWDA 5E6ZA 1P6WA 3SUSA 2EPKX 1QPKA 5DMYA 5E70A 1OBAA 1HVQA 1HX0A 5A6JA 3AZTA 5F7UA 1OIFA 2NSXA 4BA0A 4A3YA 3A6OA 5AC4A 2GJPA 1VAHA 4M81A 1XYFA 2V5DA 5ABFA 1H11A 1W1TA 1U2YA 3OZOA 2VUYA 1HKKA 2D1ZA 5HPOA 1GVIA 1JFHA 3AZRA 1HXJA 1WZAA 4D6CA 1QNOA 3VGEA 4PMXA 4HMDA 3VILA 3ZJ7A 3VIHA 1BTCA 1DWJM 4P7LA 4UR9A 1JZ8A 1UR0A 2VL4A 1W3KA 4CVUA 2WWDA 5BXPA 3ZMRA 1JAEA 2XPKA 3CHCA 3OA5A 2OYKA 3ALGA 1WE5A 1V6WA 2GJXA 3CBWA 1BYAA 3L4WA 4C7GA 2V3GA 1R86A 2JF6A 4ATLA 5A8NA 4KWUA 3ARXA 4AXNA 5I3DA 2G41A 1VEPA 1WNOA 2WMGA 2J25A 1E5NA 5GNZA 1AMYA 2CIPA 3IANA 4JHOA 1MVYA 1CXKA 4M8UA 5BXRA 3AIUA 3L4UA 4KMQA 3U7BA 2VC9A 3TONA 1J0IA 1J12A 3AS0A 2GDVA 2D3NA 2J7GA 1W9BM 3MKKA 4ATDA 3SCUA 1B1YA 5A6SA 4V27A 1E4LA 4PTWA 2V3DA 2WKGA 3AISA 1J10A 4Z2KA 3MMUA 4D1IA 1HKJA 3WFLA 3IJ7A 1V3KA 3N9KA 3GNRA 2UY5A 3AYSA 5EMYA 3POCA 1K6AA 3HN3A 1C7TA 4PTVA 5D9NA 1CXHA 2VRKA 4FLSA 3W26A 2J7HA 1FA2A 2CITA 3OLDA 1ISZA 1CBGA 1UR2A 3SEPA 3UG4A 5HOSA 2CERA 2WCSA 3F5LA 3WEOA 1J0HA 4WSJA 4GI9A 1VFOA 1MQQA 1QBAA 4M1RA 1E73M 1G94A 3DYMA 5CSYA 1PIFA 1V6UA 4L4PA 1BPLB 2XFYA 3N13A 2XVGA 1MW3A 4UZSA 3CHDA 2YL9A 3T0DA 5DT5A 2XGIA 1JG9A 4NRSA 4XV0A 2ZUTA 4LYPA 3I3BA 3TP4A 1UUQA 3FHQA 1GVYA 1BYCA 1HVXA 1E1EA 1V3JA 4XZBA 1J0JA 4CCDA 3THCA 5BCAA 3VIOA 4IISA 3EBVA 2WPGA 5C70A 3F5KA 2WMIB 2EJ1A 1KR1A 3L2MA 4M80A 2OLHA 3AROA 4W88A 4M82A 4W7WA 3T2OA 2WNWA 4LYQA 1HN1A 4GPNA 2VQTA 5ABGA 1J0YA 4W5ZA 4AZGA 2VT0A 1IT0A 4AIEA 2WVSA 5A69A 3BAXA 1OSEA 1A3HA 3WQ5A 1ODZA 1NOWA 4GXPA 3PZOA 3N11A 1ZJAA 5IHSA 4HPHA 3UEQA 1XRVA 4HU8A 3W29A 1IZKA 1JF6A 2OSXA 4MAZA 1YHTA 1X6NA 2WCAA 1X6LA 1LL4A 4F79A 5A1AA 1HJUA 2VX5A 1RP8A 4UFMA 1NH6A 1GOIA 2JALA 1NOUA 2GUYA 1CGWA 1ZB5A 3RPMA 1KB3A 2ZUUA 4MB5A 4EE9A 1EH9A 3VGBA 3AS2A 4U33A 3RM4A 1BQCA 5E6YA 1TA3B 1V08A 2Y2WA 3AJ7A 1E0VA 4HA3A 4J3UA 1EO7A 4RL3A 1E70M 1UYQA 1FH9A 1KXVA 1PX4A 4WIWA 3BAIA 2ZICA 2FHBA 2A3BA 4V28A 3PZ9A 3CZEA 5I79A 5DO8A 5A2BA 2ZE0A 3ECQA 2WM0A 2DQXA 3SCTA 8CGTA 3VNYA 4NF7A 4C7FA 2NT1A 1J0KA 4JAWA 4XZWA 1NP0A 4J28A 7TAAA 2BV9A 3W82A 1J9YA 3VIMA 3WNLA 5IFPA 3WH7A 4ACZA 1JDDA 4IPNB 1NWTA 4LGXA 5HNNA 4GZIA 1HT6A 3VNZA 4PMDA 4OKDA 1M53A 4KGJA 3TTOA 3ZT6A 4AEEA 1V3IA 1XYZA 3RMEA 4HMEA 2CKSA 1XV8A 1QI2A 4X9YA 3W81A 1CXFA 2VX6A 1GOMA 1V03A 5DF0A 2JE8A 3AS1A 3T2QA 3L2LA 4WKHA 1CGXA 3RDKA 4EAMA 1ZU8A 4ACZB 2OWXA 3BMVA 2JIEA 2BY2A 3VIPA 3RCNA 4MADA 1G1YA 4FMVA 2ZUSA 4PCTA 4MNKA 2PWDA 4WLCA 2DH3A 1LG2A 4CU7A 2X2YA 2DIEA 4RE3A 4YN5A 1BG4A 5I5RA 3OIHA 1BLIA 4HA1A 1BGAA 2DGAA 2VJXA 8A3HA 3VO0A 1KQYA 3ZSTA 4U31A 3J7HA 1WO2A 1JZ7A 4DUWA 1H4PA 2J8GA 1JL8A 4CU8A 1MQRA 5M03A 1ZBKA 1QNPA 2FH8A 3VIKA 1PAMA 2WMFA 1B3WA 3AYRA 3CZ8A 1FHDA 2AAAA 3IJ9A 3VD9A 1BSIA 1FP8A 4U2ZA 1A47A 1QOXA 2BVTA 3OBAA 2D0FA 2WKLA 3VINA 1V6XA 1FOBA 1BYBA 3CUGA 2WHJA 3WL0A 1FFQA 1H0GA 4F66A 1GOKA 6TAAA 3CMGA 4LX4A 4ZEPA 1SR0A 1E5JA 3WELA 4Y7EA 5A6BD 4CD8A 3N17A 2JEQA 1VBUA 3FNDA 4QLLA 4AZ7A 1XD1A 1H5VA 5D8ZA 4HZ6A 1GJUA 1XHGA 3PZIA 1M04A 4JKMA 2ZXAA 4MDPA 3VD5A 1ITCA 3CZGA 3RM9A 1KR0A 3WKZA 1UWUA 3I3DA 3CUHA 4PMNA 4M24A 3II1A 2WBGA 3BAWA 4GZJA 1HP5A 1EIBA 3WNKA 2FGLA 2W67A 3POHA 1E4MM 4D1JA 1KCLA 1J11A 3CIVA 5GNXA 2W61A 4LXFA 1JD7A 2J7DA 3TTYA 2WZEA 1WDPA 1E6SM 1E9LA 2YA2A 2ZUWA 3GH7A 5E0CA 1RD6A 3WH8A 3QHOA 4W7VA 5HBFA 3A3HA 4AD2A 3D5HA 3IJ8A 3VMPA 2FDMA 3PN8A 3KL0A 1QHOA 5CPTA 4CD7A 1BG9A 3THDA 1C93A 1DEDA 1VB9A 2WVVA 3FAXA 1E1FA 2WLYA 3N04A 2CBJA 2HVMA 4M56A 3ARRA 1EA9C 3WN6A 1WZLA 3K46A 1QBBA 5AC5A 4MTVA 3BAKA 2DSZA 1GHSA 2Y24A 5FKYA 1E15A 4MB1A 1WDSA 2BNJA 3EMQA 4QDMA 2YKKA 2BVYA 2YA0A 2VR5A 4EANA 1I75A 3AHVA 1C7SA 4BZYA 3CUFA 1W3LA 4JFWA 1LQ0A 2DSKA 4RE4A 2FGZA 4J27A 4PUDA 4P7RA 1MQPA 3W28A 3AFBA 5A6KA 4X0VA 3WEMA 4FLOA 4A4AA 2VX7A 3OB8A 2F2HA 4J3XA 1OGSA 5A6LA 4W84A 2WZHA 1CIUA 3APGA 3WFZA 2XUCA 4BQ4A 1H3GA 4XUYA 4KRTA 5AYBA 3WD2A 4D6IA 1J0ZA 1JDCA 1UH4A 1E43A 1UQZA 5HDRA 3DHPA 3ZJ8A 2E8YA 4AC1X 2CHOA 3EDDA 2RGLA 2FHFA 3S6TA 5A3HA 2E3ZA 1R7OA 1ISYA 3DHUA 4KH2A 1M01A 3N1AA 4JIEA 4OOUA 1RPKA 2V38A 1GUVA 2WLZA 1KGWA 1EDGA 4CVWA 1WCGA 2XFFA 2YJQA 2XVLA 4L4OA 1EDQA 2W92A 3WQWA 1MFVA 3K8KA 3JUGA 1OB0A 4B3LA 3T09A 3GXMA 3DYPA 3VGHA 1FFRA 4P8VA 3HMCA 3GBEA 4BF7A 3NSMA 1GQIA 3AOFA 1QI5A 4D6DA 1W9DM 3SCSA 5ABFB 3L4ZA 1WZKA 3SUVA 4P8UA 2WSPA 2ZUVA 3MMDA 4GO8A 1BVZA 1E72M 1PEZA 3K4DA 5CLTA 3WF0A 3QGVA 3W4RA 1XSJA 3CHFA 3VVGA 2XIBA 1PZ2A 3S2CA 3OGSA 5HXMA 2CPUA 1Q6FA 4HP5A 3WNOA 2D0HA 1BHGA 1WB0A 1L0PA 4MB4A 3GXFA 2VZVA 1G01A 2ZX5A 3TA9A 5JIPA 7CGTA 3EDJA 4CCEA 3UG3A 1E4IA 7A3HA 3MSGA 2GJXB 3NJ3A 3VDAA 3DECA 1Q4NX 1UZ1A 4MDOA 4J7RA 2VRJA 3PTQA 2VVNA 2GDUA 4Z2JA 4TXEA 3WMCA 1LF1A 1EGZA 4UQBA 3A47A 2J77A 1VJZA 2IUZA 1OGBA 3AZSA 1J18A 2EO7A 4QAWA 1QVBA 4TVDA 2JIWA 3WSUA 1JZ2A 1C8XA 1O6IA 3GYCA 4PMRA 4UZUA 2PWFA 2CBVA 2WWCA 1DWGM 1QHPA 2J8FA 4GKLA 4J3SA 1UKSA 2UWFA 3ZJ6A 5A94A 4MJ2A 4S3KA 2J62A 1XH1A 3UCQA 4V2XA 5KEZA 2G8ZA 1OGGA 3VD3A 2CBUA 1G0CA 3KE0A 4GINA 3G6MA 4HPGA 4AZHA 3VDBA 9CGTA 3TTQA 1IZJA 2BY1A 1OIMA 1B31A 4CD5A 1EQPA 3F4VA 2Z1KA 2A3AA 1CGYA 2WYSA 2DDXA 3ARWA 2YDRA 3CHEA 3MANA 4TX8A 3SCOA 1XSIA 2WC3A 4UQ9A 1GQJA 4J3WA 1XGZA 1CLVA 1GZJA 1GOQA 1PPIA 2UY4A 2ZXBA 3SCWA 1UWTA 2B31A 2X0HA 4ZXOA 2EBNA 3U5YA 3RO8A 3BLKA 3WQ4A 4JHZA 1C3FA 3T08A 3WF2A 3BMWA 2X05A 3VIIA 4DWSC 1E6NA 3WUBA 1E0WA 5A8OA 2VVSA 2XFRA 3ARYA 2VQUA 1H49A 3LPPA 1E6XM 1W9XA 5CXPA 3WQ8A 2QF8A 3T0AA 1UKPA 1V3LA 1AQMA 3SUTA 3MU7A 2VZOA 4HU0A 2BXYA 3ZJKA 4AZIA 3AMCA 1KFWA 2WHLA 3EYPA 3W24A 4H2CA 1UWRA 3AIVA 1UA7A 2JFEX 4AMCA 2GJRA 1FH7A 3NUKA 1NWRA 5E0FA 2XSBA 4IPLA 4URIA 1E6QM 4GI8A 2QPUA 4P8XA 3CPUA 4F9JA 2DT3A 1XC6A 2JF7A 4YPJA 2JEPA 4D6GA 1K9TA 2ZX6A 2DSUA 2Y5EA 1GW1A 2Z1SA 4QLKA 1UWQA 1CPUA 3LPOA 2F8QA 1Q6GA 4JKKA 3L4XA 1XH0A 1JFXA 1W1PA 1EQCA 3N15A 2WMJA 5CGTA 1S46A 4CGTA 1HKIA 4W5UA 2VX4A 4GIAA 3W6MA 1ZL1A 4MNJA 3SCPA 3CLWA 3NCOA 5LYRA 1BYDA 2Y8VA 1VFMA 1CENA 3A4XA 2W66A 4TOQA 1D2KA 2E9MA 2WB5A 1SYTA 4FF5A 4JFTA 2XJ7A 3OLEA 3ZR6A 1GONA 3VX0A 1AQ0A 3RJXA 1D7FA 4AIUA 1Q6CA 4CU6A 3WENA 4CCCA 2QV4A 1WPCA 3PZNA 4U3CA 4P7OA 1UKOA 4ZE5A 1KXQA 3O2LA 4H8VA 1TVPA 2EPNA 3AIBA 3M7SA 2FH6A 2G3MA 2ZIDA 1U33A 4CKQA 1CXIA 3AMLA 3VM5A 3QOMA 3HJEA 2EQDA 4HOWA 3WH9A 1ESWA 4DUXA 2DEPA 2RGMA 3AHXA 1UHVA 1EDTA 3EMZA 2O9OA 4RE2A 4ML4A 1E6PA 1G5AA 1GOWA 4AYSA 1EOMA 3EDFA 2AOSA 1OD8A 4UFHA 3BGAA 3AXHA 4MAVA 2VO5A 4CD4A 4XB3A 4PRWA 4DM2A 4GI6A 5ABHA 4AZBA 3NSXA 5LA0A 3NDYA 1LL6A 1NP2A 2IXUA 5BWFA 3GH5A 3WDIA 3ZT7A 1C90A 2PC8A 4MNMA 4U3AA 5EBAA 3PZVA 3CZJA 3WH5A 2J7BA 3VIFA 4HOXA 3GBDA 3L4VA 5ECUA 5BRQA 1JF5A 3WUEA 5AY7A 4FK9A 2UY2A 3MV01 1ZBCA 1QI3A 3ARVA 2QLYA 3CZKA 1ISWA 1BFNA 1WDRA 2OSWA 3AHZA 1TE1A 4ZENA 2O9PA 1HL8A 2E9LA 5M5DA 4DWSA 2ESCA 5A8MA 2BHZA 2DT0A 3BSHA 4JZ5A 4WKAA 1JIBA 1MWOA 3WL1A 2GK1A 2GVYA 2WW5A 3B8SA 5D8WA 2BXZA 1JXJA 4WSKA 3CTTA 5IXEA 2ZXDA 4WKFA 4PMQA 1C8QA 2G3JA 3ARTA 2WSKA 3CMJA 1QNSA 3CUIA 1OWQA 1VEMA 1RH9A 2WC4A 3O9NA 3CZLA 1M7XA 2ZXQA 2J47A 4AW7A 2V3FA 2DH2A 3AICA 2XHYA 4NRRA 2W63A 1R87A 1FP9A 1UH3A 2GK1B 3PZGA 2VR4A 1H2JA 2J7FA 3EMCA 4CN6A 1C8YA 2QHAA 1PBGA 4UOZA 1E6RA 3MV11 5KZ6A 1CTNA 5TD4A 4J3TA 2ZX9A 2OSYA 3FN9A 3NYDA 4B3KA 3WF4A 1US3A 3B9EA 3WD0A 3GZAA 4PTXA 3D3AA 3W6LA 2ZUMA 4UNIA 2XM1A 3K8LA 1UQYA 5BRPA 5BROA 1PJ9A 4W86A 1HF6A 2PWGA 4TX6A 3WDPP 3ALFA 2C0HA 3WMSA 4JFUA 4MPKA 4P7NA 3OGVA 2G3IA 4H8UA 1KWKA 1EXPA 2XM2A 4PMZA 5CZKA 1KBKA 2XSAA 2BS9A 3L4TA 4WK9A 1ISXA 2ZOXA 3VGFA 3ARPA 2VZSA 1NWSA 2Q8XA 2J7CA 4W87A 4N0RA 5ABEA 1Q6EA 4PMOA 3MSDA 2EXOA 4JCMA 1TVNA 1CXEA 2WC7A 1FHLA 2Y8KA 2DT2A 4PSPA 4ATWA 1E71M 1UD3A 4N42A 1CNVA 4QLJA 1B3ZA 2PF0A 4BQ5A 3CH9A 4AZ6A 1V0LA 1OCQA 1GJWA 1UWSA 4GZEA 2AMGA 4JL2A 5E9AA 5A95A 3BSGA 4CUCA 1HJXA 3ZIZA 2Y4SA 1K9DA 4UQAA 1ZJBA 1JZ3A 4UOJA 1W1YA 3QR3A 1VENA 1CZ1A 2BHUA 1ITXA 2WVVB 3U5UA 1FH8A 2WMHA 5I77A 1QNRA 4UFKA 4AD0A 3WNNA 1CWYA 5FOOA 4K68A 5CQ1A 4ZFMA 1NWUA 2D24A 3WUFA 4C7DA 3BH4A 4UFLA 1LJYA 1Z32X 2NW0A 3NDZA 4AZCA 2ZX7A 3G6LA 3OLIA 1UR8A 1BF2A 1TUXA 3WBAA 1RP9A 1HJSA 2YLAA 1MFUA 5GQBA 1DTUA 2WVTA 3MMWA 5JH8A 1LG1A 2EPMX 4PEEA 3RIKA 3UR7A 2BHYA 4PYSA 5I24A 3EDKA 4HMCA 4CN1A 2YBTA 2OYLA 3FAWA 2VOTA 1WP6A 1JDAA 4OZOA 4AY1A 3AXXA 1LL7A 1PZ3A 1HP4A 1M03A 5FIPA 1CDGA 2VURA 3PHAA 1BGGA 2XVKA 1UG6A 5JUVA 4UOQA 2WXDM 2ZWYA 1LWJA 1GQLA 5JBDA 3LMYA 3QHMA 4ZE4A 2J7EA 5FCZA 1W91A 3ARSA 1QNQA 4UFJA 1DWFM 5I6SA 3RJYA 2OYMA 4PUEA 3SURA 1UKQA 5D9OA 3VD4A 5I23A 2A3CA 4LYRA 2MANA 3B9DA 3VM7A 5A8PA 4HOZA 3OZPA 3VIJA 1R8LA 3WF3A 1SMDA 1KGXA 1H1NA 1JZ5A 1B90A 4MJ4A 1L8NA 4KGLA 1VFFA 1XH2A 3AXIA 3A4AA 5IFTA 4D6FA 4U2YA 3FHAA 1U30A 2XVNA 2CESA 2W62A 2WCGA 2IXVA 1K9EA 2W5FA 1EO5A 1IV8A 3GXIA 3M6DA 3WD4A 1UD8A 2D22A 3FXYA 4E4PA 2YLLA 1KXHA 4W85A 1OT2A 3A4WA 4PMUA 4H7VA 1SMAA 3CGTA 3L4YA 4W89A 4OJYA 1WKYA 4TVUA 3PZQA 3WD1A 1NM9A 2DT1A 1UD6A 1HJQA 3WD3A 5E09A 3IK2A 1HL9A 1AQHA 4AISA 2G4FA 1UA3A 4TUFA 4LQ1A 4B9ZA 2J74A 2VNCA 3SCVA 2D23A 1Y7VA 3BLPX 5C8BB 1JGIA 2OWCA 4NSBA 4R27A 3QOKA 4DM1A 1R85A 4OUEA 2VCCA 2DIJA 3SCNA 2YL5A 2WZIA 1JYWA 1VFUA 5M17A 1V02E 1W3HA 2YL6A 4UQCA 1TG7A 4GQRA 4PBGA 1E0XA 1NOFA 2WHKA 2WHMA 1QW8A 2W91A 5M3WA 4Z2GA 3DYOA 1E3ZA 3W0KA 5CPQA 1VF8A 1H0IA 4AD5A 2ZWZA 2CEQA 3WNPA 2J75A 4F8XA 1B0IA 3GDBA 4S3JA 2PB1A 4FLRA 4Q7NA 1XCWA 1DP0A 3ZSSA 1VBRA 2CBIA 3IAQA 4Z2IA 2WMIA 4QCEA 1CEOA 1EHAA 3TTSA 4ZXLA 3ZOAA 1VJSA 4UCFA 1V0KA 2E40A 1DHKA 3VDHA 3AMGA 2EPLX 3RM8A 4U5KA 1B3XA 4A3HA 4YHGA 1CGUA 2WVUA 4AWEA 3N12A 2CYGA 4H8HA 3VDCA 3U7VA 3BAJA 1TZ7A 1US2A 3GTNA 4W8BA 3WH6A 3WDHA 3VOCA 3WY1A 5CSUA 1UD4A 4AD3A 2FHCA 1JI1A 1UH2A 2F61A 2WANA 1W2VA 1NARA 1D3CA 3BXWA 3LPGA 4YHEA 2XTKA 1GQKA 2VTFA 1MW1A 1CGVA 5EFDA 1KWGA 1B3YA 4B15A 4F9DA 2X09A 4JKLA 2PWHA 2QMKA 6CGTA
chains in the Genus database with same CATH superfamily
2E4TA 3GNNA 4ZO8A 5BWAA 2C16A 1KQZA 3NI6A 4BS0A 3LQGA 2AQWA 5LIWX 2ZQSA 4ORIA 2PDXA 3I6TA 3K8MA 4NKCA 4OIFA 4QDPA 3WDRA 3PRBA 3BLIA 3VA8A 2PPNA 4PCSA 3JW7A 2NXGA 3NOEA 3QHNA 2DSVA 2RQSA 4HBKA 3SFKA 4C6EA 4U4MA 2A85A 4K38A 2PP0A 4MHBA 1KGUA 1HTIA 2E6FA 3UXLA 3COTA 3O5JA 2XYLA 4Z2LA 1W3JA 4Z2HA 1R38A 2YZ5A 2BVDA 3WLPA 2Z1WA 1TREA 4DBSA 5D4YA 3P81A 5KITA 4DO5A 2BLEA 3L7RA 1MW0A 1TV7A 1SPQA 3I7RA 4AIOA 5I3HA 3C8FA 4LRTA 4A21A 1A4MA 2YIHA 2QCMA 4JFSA 1F6PA 4PTMA 1ZRQA 5LGZA 3M5YA 1WQ5A 4CCZA 3LYEA 1NELA 3NSNA 3KWXA 3VMNA 4BKNA 6REQB 3M0KA 3UPMA 3EXRA 5BYWA 1JYXA 1DJZA 1LWHA 2FZ9A 2QNEA 2RDUA 2W0UA 1KCKA 3WQ6A 2C8NA 1GCYA 2HISA 3MVTA 3P80A 3S1WA 4H19A 1B9ZA 5EMMA 2CHNA 1M6JA 3N2TA 3HU7A 2YOCA 1LT7A 2DZXA 3UQNA 1TELA 3EGJA 1KRMA 1I1XA 3EA1A 3MMTA 1EKOA 4YL2A 3L0NA 1OD0A 4S1FA 4IMEA 4H6QA 1JZ6A 4D6HA 3ZWTA 1CGTA 3W38A 5XIMA 1EZWA 1QI0A 1RLDA 2E0PA 4Z1CA 3PZMA 3OZYA 3M7WA 2NUXA 3LRMA 4JTUA 1F3WA 4WVXA 2HRWA 2YL8A 4UQDA 4H6EA 4PCNA 5A8QA 1KRAC 4IT6A 4HZ8A 1I2OA 1XSKA 2BY3A 3VFLA 4QQ3A 4D72A 4MB3A 3B0YA 5BXSA 1H7PA 1TFVA 5HQEA 3LUOA 4M6QA 1Z7AA 3N4EA 2QJIA 1G7UA 2NLYA 3A24A 4TV6A 1LLOA 1EF3A 2PBGA 3DC0A 1GHRA 2V5JA 3NOYA 3ORWA 2DW7A 2DPEA 4ODNA 1R2RA 4BQ3A 1LWIA 2WSYA 2Z4GA 3AMKA 4NG3A 1LOQA 4MSPA 3WNMA 3IIVA 5LZLA 3RLHA 2QKFA 2I14A 1J2WA 1HL2A 1EJWC 2RDWA 1HJWA 4E8CA 5EB8A 2AGKA 1B3VA 1V0NA 1XF0A 4AQLA 2Z7GA 3VGDA 3D46A 4Q4OA 4RE0A 1TJ1A 1T11A 3MVIA 3U57A 5GNYA 3WJZA 4FLQA 1TV3A 3LXCA 3KCOA 1K03A 1F4HA 1UKTA 2PZNA 1J4EA 5EY5A 3LPFA 4BCEA 5FF2A 5CJ5A 4UTFA 3W00A 1ZPTA 4E4UA 1O94A 5AB3A 1E3XA 4O18A 3W1TA 2YB4A 1QHZA 3HMJG 3WG6A 4E8DA 2OQLA 4QBXA 3N18A 3SR7A 4UBPC 2Y88A 2PTXA 2RUCA 1X8FA 1HJVA 1DWHM 2PDGA 3MP3A 1EX1A 3WQDA 3AMDA 4U28A 1OQFA 3MUAA 1YQ2A 1DJWA 4TTUA 3ARQA 5FACA 3ELFA 2LLEA 4GH1A 3BCDA 2VZUA 1ZNNA 1QPNA 3W1PA 1GG0A 1F74A 1DIKA 2P5NA 3VAWA 3Q2DA 4EXQA 5FJIA 1PCWA 3NVDA 3KEHA 3KABA 1WOAA 4HYWA 1KXTA 2BASA 3ARZA 5DBTA 2O92A 2E5BA 1FKWA 4XVDA 4M29A 3ITXA 2V5CA 2VCBA 3KZSA 1LQAA 1ZBVA 5AN7A 3AQUA 3DHDA 5I78A 3WDQA 1DWIM 1DQUA 1P1XA 4FN2A 3DFQA 3KAIA 1EJ7L 4EKJA 3UF8A 5JBEA 3UJEA 1PBKA 5HANA 4NNRA 1N8FA 1GKPA 1CLXA 1TVLA 2D3LA 4TNSA 3KZ7A 1V8EA 3MWAA 3PANA 4WJXA 5FL0A 1MXDA 3QQWA 4J3VA 3PTMA 2REQB 3VNIA 4RUBA 3TJ4A 3I6CA 1XLFA 1R3WA 1D7KA 1W0MA 4Q4SA 2QCHA 3QGKC 4FIRA 2VENA 2XIIA 3SUWA 1QASA 3OBKA 5GVJA 4YTTA 2OX4A 1UD2A 4AVFA 1EHNA 3PG8A 3S9ZA 1P6WA 3VK5A 3OQEA 3V18A 2ZZ5A 3RXZA 4Z42C 3S42A 5DMYA 1OBAA 5HUOA 4FAMA 3B06A 2ZDRA 1DVJA 2NSXA 3A6OA 3RU8X 3CHVA 1A4LA 2V5DA 4B3ZA 4HU4A 4PGLA 4QJ4B 3LHYA 4O19A 1IZCA 2ZC1A 1JFHA 3NXFA 1WZAA 1W8GA 1QNOA 3VGEA 4ECLA 1GVRA 3USBA 3VILA 3GRIA 1KM2A 2YCJA 1JZ8A 3FEQA 3SFWA 3BMXA 4O1DA 4LVBA 4CVUA 1JAEA 1SW7A 4DXVA 2P76A 4DRIA 1OF8A 1XIJA 2GJXA 3CBWA 5EBUA 2G37A 3L4WA 4YIWA 1K7XA 2ZR6A 4NYYA 1XGEA 4GH3A 4ATLA 4KWUA 3W83A 1VEPA 1A0DA 3SI9A 1H7RA 2J25A 2FKPA 3OTRA 2CIPA 5E1QA 2I17A 4MOZA 2ALDA 4IPPA 1I45A 1OFAA 1SUXA 3U7BA 1J0IA 1N8WA 2CZFA 5BZAA 4D9PA 3VNDA 4RDZA 2GDVA 3L67A 3DBNA 3FYPA 1DJIA 1W9BM 4ATDA 2GVLA 3S5OA 4LVGA 1J10A 4Z2KA 3O0KA 1FKJA 1SU5A 2PWUA 5HWJA 1EA0A 3TCEA 1V3KA 1SJDA 3CJPA 2VHLA 3GNRA 2UY5A 3H9RB 5BOOA 2JKAA 4ZO7A 1ZFJA 1K6AA 3HN3A 3R58A 1CXHA 1BKSA 2VOMA 2VRKA 3HF3A 2J7HA 4KEUA 3TC6A 4ZB2A 3UJ2A 2CITA 3TW7A 4L7ZA 1CBGA 4Q6XA 4N2YA 5HOSA 2D73A 2CERA 3WEOA 1XLKA 1MQQA 4FNSA 1CLKA 3FSUA 1V79A 3GDLA 1G94A 3NQ6A 4IMGA 3AXMA 1UUMA 1UOZA 1PSCA 3C4UA 3N13A 2XVGA 3B8TA 4KFNA 1OCJA 4F2TA 1ZK6A 1S2WA 4D2JA 5DT5A 4JQ3A 2XGIA 1JG9A 3I3BA 3VZZA 3TP4A 1UUQA 5GJNA 1GVYA 3STEA 3EOEA 3NXLA 4L6HA 1V3JA 3NQ2A 3VIOA 2Q71A 3SQSA 2R91A 3DIPA 3EBVA 3SAZA 2WPGA 3NQFA 3SGGA 4M0XA 3ONCA 5C70A 4NXSA 2WMIB 4RNJA 1K4HA 1KNWA 2DU2A 1YBQB 3MCNA 2KO7A 4Q8TA 4W88A 4DH0A 4W7WA 4LRSA 3CV7A 5LNRA 4I5RA 5FJRA 4LYQA 1HW6A 4L72B 3PPCA 3BO9A 5ABGA 2PV1A 4I5XA 2VT0A 1TX2A 1ZAHA 4V1XA 5A69A 1OSEA 1YPFA 2Q8LA 2ZZ4A 3JS3A 1EJRC 1P7TA 1A3HA 1BWLA 1X1ZA 4WY0B 1VP5A 4DAIA 1KFCA 1LUCA 2EKCA 4IQEA 2TMDA 4HPHA 1XRVA 1JF6A 1N55A 4E3TA 1PZ0A 4MAZA 1X6NA 1R2TA 5JMUA 4QT2A 3T07A 4YS1A 1LL4A 1S2CA 1WKFA 4X63A 5A1AA 1NY1A 4OE7A 5KZEA 3B04A 1NH6A 1GOIA 2JALA 3V0TA 2FTYA 1ZB5A 4EE9A 2WSRA 3VGBA 1WXZA 3RM4A 5EMLA 5BU9A 3AJ7A 1E0VA 1WDWA 4L6OA 4HA3A 4J3UA 1EO7A 2W3ZA 3ITYA 2VD9A 1FWIC 4QITA 2C91A 3C3UA 2A3BA 4Y96A 8XIMA 1BXNA 2Q3RA 3IJIA 1RZMA 3B40A 3CZEA 5I79A 2ZE0A 2IKJA 4QX4A 1MO0A 3RAOA 1GYNA 7ODCA 5BW6A 1Z42A 4C6FA 2VP8A 4LNYA 3VNYA 4UTWC 2B5UB 1ZP4A 1A80A 4JAWA 4ZOBA 2BV9A 3Q94A 2HEJA 3WK0A 4C6CA 4BHYA 4DN1A 4BF5A 3VNZA 1S5WA 4UTTC 2IPFA 4PMDA 2OZ8A 1VH7A 3BW4A 3ZT6A 4AEEA 1XYZA 1A53A 1O5XA 4DJFC 4MLRA 2VX6A 3S5ZA 5BRBA 1F3XA 1TE6A 1V03A 4NAEB 4H7ZA 3WBYA 3L2LA 5HMDA 3UI4A 3SJNA 3BMVA 2BY2A 3RCNA 4KKXA 4MADA 4MNKA 3LOTA 3IACA 2NQ9A 3MSRA 4FNPA 5I5RA 4JYEA 3MSYA 1BLIA 1BGAA 2DGAA 3CV1A 8A3HA 1FKXA 2ZCGA 1KQYA 3VYLA 1P5QA 2GGIA 2OR2A 3J7HA 2FGBA 5B80A 1JL8A 4CU8A 3P5ZA 2Z6IA 1ZBKA 3W7EA 3O5OA 2Z6JA 1GRJA 3EXSA 1QNPA 2FH8A 3EAUA 1PAMA 4QAIA 2AQOA 2QW5A 3CZ8A 1FHDA 2AAAA 3C61A 1FHVA 1HFBA 2BVTA 2WKLA 3E0WA 2D0FA 1SGJA 1FOBA 3M0ZA 3AUJA 3VINA 4F0SA 2VEIA 4Z0SA 2DZSA 1TPC1 2ZVRA 3UCDA 3F1QA 3RR4A 1DJGA 3MI6A 3LBCA 3SBFA 6TAAA 4RPPA 4PB4A 3REQA 4IJRA 1SR0A 3WELA 4Y7EA 5FJJA 5A6BD 5HNRA 1LTDA 2C13A 4AXKA 1VBUA 4AZ7A 3WLNA 3O5MA 2L5HA 3N2BA 4HZ6A 5D8ZA 2ZZ3A 3PZIA 3H4XA 3TFCA 3Q67A 1IR2A 3GVQA 4GNVA 1UWUA 2VXNA 1S2TA 3K2GA 2VC6A 1XWYA 3TX9A 1O5RA 1P0BA 4TQTA 2PP3A 3WNKA 3POHA 4LY8A 4DWDA 2QV5A 3PR9A 1DORA 4GQBA 4HMNA 3SGZA 3AAMA 4DYJA 3U2EA 5GNXA 2PV2A 1JD7A 2J7DA 3NURA 2WZEA 4OBTA 1E6SM 1E9LA 2YA2A 2ZUWA 4RW5A 3L5AA 3M0HA 1BSLA 3BW3A 1KRCC 3WH8A 3TKFA 1F5ZA 3A3HA 4AD2A 3KBMA 3NO1A 3IJ8A 1EX5A 1DV7A 1KV5A 2FDMA 3WCZA 2PGRA 4WUIA 2DG9A 3UQIA 3PN8A 3WLMA 4E8GA 3EWZA 1XLBA 4FIQA 3FAXA 4IGHA 2XIMA 4W4QA 3O6CA 2ZQ0A 2Z1XA 1PYFA 4YJ5A 1EYWA 1EA9C 1N8IA 3GE7A 1FDYA 5AC5A 1IR1A 4HARA 3RMJA 3STCA 4C5YA 4UMCA 3EOLA 2BG5A 3EMQA 4QDMA 3TU9A 2MLZA 1W5NA 4IFKB 1TPEA 2VR5A 2C71A 1DJHA 4BZYA 4LEQA 3R8HA 1W3LA 3GKFA 3E12A 2ZADA 1VPYA 3EX4A 1XW8A 4L5ZA 4LJ3A 2YXGA 1RQBA 4J27A 4P7RA 1H63A 3AFBA 4W9TA 4DXXA 1KC7A 3UZXA 4TU1A 4FLOA 3KS5A 2VX7A 4W84A 1F3EA 4NZ5A 5HATA 4ADSA 4LV9A 4GC3A 1AFSA 1EJXC 2XUCA 4HB7A 4BQ4A 4XUYA 2IKHA 4KRTA 3V0SA 1J0ZA 2QCDB 1Y0OA 1E43A 1UQZA 5HDRA 4MFDA 4P5UA 1EBHA 3DHPA 3RGCA 2PPGA 2GOUA 3OP2A 2RGLA 2FHFA 1KCZA 1S3TC 1M01A 2CLFA 4OOUA 1X98A 4JYSA 2V38A 3T81A 2WLZA 1KGWA 3QTPA 4LCRA 3H2EA 1EDGA 1U1JA 1D7IA 3FA4A 4CVWA 4I90A 1P6CA 1WCGA 1Q7MA 1RBLA 1TV8A 2XFFA 2XVLA 4IUOA 1V77A 4L4OA 4L9ZA 4H9XA 1EDQA 1W31A 5CZ0A 3V1PA 1H7WA 4GGQA 1XYAA 3IRDA 2C79A 4H9ZA 2OOGA 4D6DA 3L4ZA 4GUHA 3NNTA 1K8XA 4XQ6A 1XGDA 1QATA 4IJCA 1TPH1 1PEZA 4RV8A 2HDJA 1KT0A 2XZ7A 2VDIA 4B5UA 4NZJA 3VVGA 3NRKA 4AG0A 4QTGA 1OCBA 1B57A 3OGSA 4H8NA 2BMBA 4NXKA 1XLMA 2QCEA 3MPGA 3WNOA 4PL2A 1RCQA 4IMDA 4GFSA 4NAFB 3GXFA 1X1OA 3QTGA 5JIPA 1U79A 4CCEA 1GQNA 3W1LA 2DZTA 2DZBA 3T6CA 1E4IA 7A3HA 3MSGA 3H7VA 4XD5A 3BJSA 3DECA 3W2LA 3PTQA 2ATMA 1S38A 3H54A 2ZE3A 1G4EA 1LF1A 5CJMA 5AKQA 1VJZA 1J18A 1J8VA 5E0KA 2LKNA 1GTEA 3DG3A 1QVBA 3VC6A 3WBXA 4RPQA 5GJPA 1REQA 1C8XA 3GYCA 4B2DA 2PWFA 2CBVA 4IP7A 3KRZA 2J8FA 4GKLA 4J3SA 4WQ6A 3ZJ6A 3CUZA 4DO6A 4S3KA 3HQ1A 1VLIA 1Q2RA 1VYPX 3OVGA 4KPLA 1G0CA 3ITTA 4GINA 9CGTA 4HNVA 3GW0A 4JNMA 4CD5A 1PDZA 7REQB 2Z1KA 3C86A 3W1XA 2A3AA 3T0CA 4JY8A 2EKGA 4LUTA 3PVFA 2G95A 4XBSA 1H1YA 3ARWA 3MANA 1EJUC 1KBLA 1NMVA 3QGAC 1GOQA 1PPIA 2UY4A 2ZXBA 2E5DA 4X2RA 1CT5A 1MUMA 4F0RA 2MF9A 2EBNA 1EYEA 4RZ6A 3BARA 1FWNA 5LXXA 2ACUA 1IT7A 2QAPA 3RO6A 3T08A 3FA3A 3WF2A 1SO4A 4C1KA 3BMWA 4AU0A 3AUOA 5HWCA 2X2GA 1E6NA 2YCEA 2XU2A 4K8GA 5A8OA 2XFRA 2VQUA 1W9XA 1XDJA 3QC3A 1UKPA 1V3LA 3KRUA 4A2SA 3OEXA 2VZOA 4HU0A 3ZJKA 1I6NA 2CZ5A 3AMCA 3WBWA 4O0ZA 2ICSA 4DUOA 3G1RA 3IIPA 1HGYA 3DN5A 3T9PA 3W24A 3M0JA 4H2CA 1NEYA 3LRLA 4AMCA 1A50A 1NWRA 4UDMA 3A64A 1FWEC 1E6QM 3PB0A 9XIMA 2BGSA 2DT3A 1TWZA 2YXOA 3GHTA 1AA1B 4GYKA 4D6GA 3W73A 3E3HA 1JQVA 3W75A 3W1MA 4LAMA 1BKFA 4U84A 2Y5EA 1BWKA 1UWQA 4CNUA 2M1IA 2VFIA 3LQLA 3B4YA 1AW1A 4O4VA 1JFXA 3L21A 4C6QA 2WMJA 4UMBA 3O05A 4GJ1A 1XBXA 5G2HA 3IUHA 3EWYA 3QQ1A 3S2NA 1HKIA 1BEUA 2VX4A 4GIAA 3EX3A 4TV5A 3W6MA 2Z2UA 1ZL1A 1XLAA 1D2KA 4LUYA 1SVDA 1AQ0A 4NX5A 1MRQA 4AEOA 1A5BA 4AIUA 4CU6A 1NDWA 3TSMA 3WENA 4RDWA 3WZ0E 3WO8A 4Q33A 4I9AA 3HA1A 3NPWA 4JTJA 1KXQA 3O2LA 4H8VA 1FKKA 1TVPA 2EPNA 3BW2A 4TX9A 3M7SA 2FH6A 3CWHA 2G3MA 2ZIDA 4IGSA 5FEZA 4CKQA 1G69A 1CXIA 3AMLA 3GK0A 3VM5A 1SZEA 2EG6A 1RPXA 3HJEA 5CAHA 2PLKA 3ANUA 4O53A 2E77A 1Q7QA 3EMZA 4NVTA 2O9OA 2V81A 3MDUA 1Q8AA 4CQAA 2R1MA 3UW6A 1E9ZB 4UFHA 3NEHA 2RJHA 2BSLA 4AAJA 2BX7A 4BK9A 5LA0A 3NDYA 1ZALA 3U48A 3TJXA 5BWFA 2GWGA 2FZNA 3ZT7A 2C18A 4HPNA 2H8XA 3WH5A 4HOXA 3L4VA 4XZMX 5ECUA 3LDVA 1ONWA 4E5TA 4UCGA 2MPHA 1ISWA 3K5XA 3E5PA 1WDRA 1EC9A 2Y89A 3G1VA 4ZENA 1TE1A 3KXQA 3ZZ1A 2OQHA 4F40A 2PGFA 1MXSA 3B9OA 1IEIA 4WKAA 4OV4A 1AJZA 4ZTXA 2YR1A 2NLIA 2E09A 2WW5A 3TW6A 3QFWA 5D8WA 5K9DA 3MZ2A 5TIMA 5D03A 3DU0A 3CTTA 2QCLA 4R53A 5D2VA 1VLWA 1QNSA 4JQ4A 3CUIA 1VEMA 2ETNA 2WC4A 5C6MA 1M7XA 1U83A 3O5RA 5G1MA 1BRLB 1Q6RA 1R3QA 3V5OA 4YCOA 3GFZA 3PZGA 4A8LA 1B54A 2J7FA 1ZQ5A 4CN6A 1C8YA 2QHAA 4AYGA 1D7JA 1PBGA 1NSJA 5AOUA 2PUZA 1W5OA 1E6RA 3MV11 1CTNA 3K4WA 3BJFA 4JD4A 4J3TA 3B8IA 4B3KA 1US3A 3ZVHA 3WD0A 3BG5A 3VE9A 3R0UA 3FDKA 2ZUMA 4UNIA 4TR9A 2XM1A 3KAHA 1EC8A 1UQYA 1X6UA 2NZLA 4TW6A 4JN8A 1PKNA 1W1B1 1EPXA 3KADA 2C0HA 1Q6IA 4MLJA 4IJBA 1O68A 1XR2A 3VI2A 3G3MA 1EP2A 3L4TA 4WK9A 4UXDA 1VYSX 1YLVA 4L4MA 2Y61A 4JCMA 3JZEA 1XQLA 3OU8A 5K3VA 1TRDA 3TWAA 1CNVA 4QLJA 1B3ZA 3R4IA 3LSCA 3URAA 1KFLA 3MKCA 5EL1A 3FJ6A 1DE6A 1UWSA 2G3FA 4JL2A 5E9AA 2V8ZA 1Z44A 3BSGA 4HCLA 2MLXA 3LCXA 1HJXA 4HTBA 2Y4SA 1VCGA 3WK1A 1W1YA 3GAKA 2PODA 3QBUA 4NILA 4ZQRA 1ITXA 3KBSA 2WMHA 3L12A 3EB3A 4JTTA 4X60A 3B9NA 3H12A 4IIHA 5FOOA 3R43A 5AVHA 5AFDA 4ZFMA 3FK4A 3VZXA 1XDLA 4PZVA 3C3NA 3EB2A 2DY3A 4GYJA 1VBHA 2YZRA 5REQB 3NDZA 2ZX7A 2OEMA 3OLIA 5JU6A 3BK0A 2FTPA 2PTDA 2B0MA 3P82A 1XYBA 1TUXA 2X7WA 4K8HA 2VC7A 1HJSA 5GQBA 2WVTA 5JH8A 1LG1A 2EPMX 3UZYA 2QJMA 4PYSA 1PVNA 5I24A 4CN1A 4EOUA 2VOTA 3RFWA 1K70A 4DNHA 4DY1A 1M03A 1CDGA 2ADAA 1XIGA 3PHAA 3SRHA 3IVTA 4AF0A 5JUVA 3FCPA 4UOQA 2WXDM 1KLYA 2FZDA 1ENUA 2RAGA 1FWTA 5JBDA 4OECA 3TYDA 1W91A 5G1YA 4JR5A 2OFJA 4DF0A 5I6SA 1KTNA 1JVWA 3RJYA 2OYMA 1UMYA 4JEJA 1UKQA 4PUEA 3SURA 3VD4A 3V7PA 3QC0A 2XIJA 4BI5A 4LYRA 3D3FA 3GIQA 2MANA 2UZ9A 3VM7A 1FKLA 3NPVA 1J96A 3LHUA 3BV7A 1AW5A 4I7VA 3VIJA 3WLJA 3WF3A 1KGXA 3C2RA 1H1NA 3ENLA 1L8NA 1VFFA 3AXIA 3C2OA 3UGVA 1OFOA 3VKBA 2NQ5A 1JUKA 2CESA 1EYMA 4IFOA 3KHJA 4LAWA 1ELSA 4H1ZA 1K9EA 3GR8A 3M6DA 3WD4A 1A0EA 2D22A 3PR2A 3FXYA 4BF9A 2YLLA 4JTGA 4JTRA 1OT2A 2EAWA 1SMAA 3P6LA 4BEUA 1UJPA 4Y9AA 1UMLA 3K13A 4OJYA 2J6VA 1OYAA 1M5WA 2CW6A 4PL1A 3WD1A 3JR2A 1UD6A 4MIMA 3NL2A 1HL9A 5DBUA 4AY7A 3U2CA 3PFMA 3NPUA 3E0VA 3LLXA 4PEKA 4HK7A 1ZZMA 4B9ZA 2PPPA 5C8BB 3UWWA 2SFPA 4G2DA 4O17A 3UP8A 3QMRA 1JGIA 3G1SA 4LH8A 4C6DA 3QOKA 5H8UA 2QQ6A 2E68A 2D2GA 4DM1A 4OUEA 2OOFA 2DIJA 1RY0A 2YL5A 1VFUA 3DDMA 1W3HA 2CWNA 1NOFA 2WHKA 3TFXA 1AODA 5IM51 7PTDA 1DBTA 4AD5A 3CL7A 2ZRWA 1TTQA 3FLUA 4GVGA 3OW1A 5CZJA 4XVEA 1XCWA 3ZSSA 5HQLA 2CBIA 3TQPA 4DBWA 3FAPA 4ZXLA 3URQA 4NJGA 1QOQA 4UCFA 3LERA 1AK5A 3M5VA 3AMGA 3A9BA 3RM8A 4U5KA 2Q6ZA 1E0TA 3MUXA 3N12A 5DY3A 4H8HA 1XRTA 2P0OA 3BQ5A 2CXEA 4FZIA 3AC0A 3TMQA 1US2A 3VOCA 1TV4A 2HPIA 2F21A 3O6DA 1UH2A 4S3FA 5FJTA 3W1QA 1SSGA 1UPMB 2XTKA 2VTFA 4PUWA 4CQ9A 1LRQA 1B3YA 4B15A 4JKLA 2PWHA 2PU0A 6CGTA 3BGJA 2OZ3A 4Y9PA 1Q6DA 2OWWA 4Y9NA 3CO4A 1X7FA 2GFTA 1FWWA 4IMAA 4PE8A 3OG2A 4PFHA 2P88A 3VXGA 1JYVA 1IXPA 1TA3A 3GNOA 4W7UA 4GIRA 1UROA 4EPDC 4WF7A 2PS2A 1LLZA 2GVJA 3KRSA 3NQ7A 2E9BA 1Q2SA 1TCMA 2BY0A 2WZTA 2F7FA 2O9RA 3UPWA 1VYRA 3TYBA 3CPRA 1I2PA 4M1BA 1ECEA 3NQGA 1UD5A 1GYMA 3W53A 5FL1A 5DEZA 1XG3A 2ZTKA 2Z00A 4DBUA 2HVOA 3O06A 1W32A 1NFGA 4FXJA 3HTWA 1ZCNA 1GOXA 4GCXA 2ZRUA 2KGJA 4DX3A 2H9AA 1C9DA 3GNPA 3NAVA 4G50A 4HTYA 4I8DA 3O5KA 1TWSA 1KW1A 1EC7A 1MW2A 1CECA 4O8RA 2OO0A 4HZ7A 1V7YA 1QPQA 4WCJA 1E6ZA 5HMFA 1VEOA 3VOJA 2KR7A 1UBPC 3P84A 1C92A 2KX9A 3DH7A 2Q5AA 3HG2A 3SIMA 3FYOA 3XIMA 5AHEA 2ZFAA 3E02A 5IBXA 1V6TA 3R11A 2Z24A 1AVAA 4DUVA 2O0TA 3E2SA 1RCXB 3QV9A 2OGJA 4RNIA 2R1PA 3PY2A 4MNLA 2X7VA 3F2DA 3M9YA 4HHLA 1J2BA 3S47A 1O7AA 5FD0A 4WDXA 5A2CA 5HPCA 3QFEA 4UTJA 2QPSA 4J1OA 3WEZA 2WO5A 3NPXA 1KFBA 1TTIA 5C0QA 4H9TA 4AWTA 1B4EA 5D9PA 3M0YA 4XTIA 4AD1A 4QR6A 3GQYA 3LCWA 3TOPA 2J4GA 3G8EA 1XLEA 3M07A 3CQJA 2BGNE 4B5WA 1LLWA 5LIUX 4DROA 4GIVA 1IWBA 2QUUA 3TE9A 3FW6A 2TAAA 5HMEA 3M0LA 3AIEA 4LUSB 1EUAA 1F9CA 4OBRA 1H1ZA 4V1YA 1SQ7A 4KCWA 4D6EA 1UR1A 4E2BA 1FKHA 1Z69A 3E2RA 2POTA 4GUIA 2H6RA 1K9FA 4WR3A 2C7FA 4DF2A 2GSJA 3ZLGA 4DWSB 2EEXA 4PSRA 4DRMA 4QIBA 1B30A 3MUIA 4JXCA 2YCLA 3PBGA 2INEA 3UERA 4S3BA 4FPSA 1W2PA 1ISVA 3CK5A 3UJRA 4KIEA 2ACSA 1XCXA 3RILA 3IWPA 3ZFHA 4EX4A 4IG2B 5LNSA 3JVAA 3AIRA 2XGBA 1VRDA 2X8RA 2YBVA 3G1AA 3IUDA 1H5YA 1W54A 3UQBA 4NI3A 2WAGA 1A5KC 1JYNA 4ES4A 4AZ5A 3Q37A 4CN4A 1Z89A 5A6TC 2ZQVA 1F4AA 3ARUA 2C1IA 3WDJA 4D71A 3WQVA 2D2OA 2ABBA 3L5LA 4MSSA 3UYCA 4X2PA 1W1VA 1I1WA 2H3DA 1CXLA 1GVQA 3BSMA 5HR6A 1SZFA 1QZ2A 3V75A 4HNOA 4Q4KA 4CD6A 3E5BA 3SN4A 3LXAA 1TWWA 4DXKA 2PC4A 3BZGA 1W9UA 1GG1A 3MI3A 1IWPA 1FXQA 2TPSA 4G8TA 4DEFA 3EDEA 1VIWA 2CLIA 4IPJA 4PMJA 5HNTA 3BGGA 4DJED 2YA1A 3M64A 3TYEA 4IICA 1KM6A 4JX6A 1B6CA 2K8IA 1WZMA 3LGEA 3GTFA 4AVOA 4ERGA 3EOUA 4N19A 5D75A 2R94A 3THQA 3A3XA 5GPRA 2CXGA 3VTRA 3W1RA 2Y0FA 1RA0A 3RN6A 3VMOA 3VGGA 1IEXA 1SZRA 1H50A 1Y0EA 2ZX8A 5A6AA 1ODUA 1MYRA 4DI8A 1HKMA 2PA6A 3GB6A 2F4EA 2E1DA 1J01A 3H70A 4BF8A 1QWKA 1X38A 5A6MA 4AIBA 1V02A 4W9PA 3LHVA 1R9HA 1RY8A 4YVXA 3SUUA 1JI2A 3H4WA 1QI4A 4C6JA 1K3UA 2F2KA 4RV3A 1JAKA 4QP0A 4O0QA 3GC5A 4QNWA 3IK4A 4PUNA 3VKKA 1BVNP 5LA2A 1NDVA 4GY0A 4UR8A 5BOFA 3IAPA 3MUZ1 4ZPWR 1FKIA 5I07A 3NG3A 2V6AA 2GOKA 5G1TA 1EZ2A 1S2VA 1WOBA 3NQBA 4MY8A 1YXYA 3SUSA 1GK8A 4N9BA 1E1CB 5KETA 2QCFA 3AO0A 1HVQA 1HX0A 2XFWA 4LU0A 5EYWA 1OIFA 4ZO6A 1GTHA 4XTDA 2PDLA 3SSJA 4BA0A 5FF4A 5HJYA 1VAHA 1XIBA 1Q5MA 4LAVA 4IOTA 3JRKA 4EVZA 1VZWA 1H11A 2FMNA 1PTDA 3OZOA 2R82A 5C2CA 1RLCL 3HZ3A 3EEGA 2VUYA 4JFLA 1DJNA 4C6KA 3R8GA 1HXJA 1B9BA 2HCVA 2R1NA 4HMDA 8XIAA 1DWJM 4P7LA 4HPJA 1XC4A 2FLIA 1M1BA 1POJA 1W3KA 7XIMA 5BXPA 4X3ZA 1RBAA 2XPKA 3OA5A 2OYKA 5DANA 1WE5A 3GDKA 3U0HA 2V3GA 4IIBA 4I3GA 1R86A 3I6EA 3PBVA 5A8NA 2VEMA 3ARXA 4DO7A 1W5MA 5I3DA 2G41A 5K7JA 5H8MA 2NQZA 1AMYA 1Y5VA 1PHQA 2LPVA 5H91A 3W7QA 4XKMA 4KR0B 3IANA 4YNGA 5FF7A 4DYEA 4C1NB 3LTSA 1W5PA 4MWAB 2J7GA 4Z08A 3ICJA 5A6SA 5J04A 1VQTA 1IHIA 4PTWA 3DFTA 1JCMP 3HGJA 4Q4QA 2AQVA 3IJ7A 1KM5A 3N9KA 2NXIA 3AYSA 5B7YA 3LI0A 4AX7A 3M16A 3POCA 3B97A 3CLMA 4PTVA 5D9NA 4FLSA 1I0BA 3URNA 1JPIA 1UR2A 3SEPA 4O14A 3DFYA 3W07A 2WCSA 3PWAA 3RCMA 1OX4A 3P5YA 1U5JA 5LKYA 3M0XA 1YIXA 2CLHA 3L68A 2G97A 5CSYA 2HV5A 4A05A 1YBQA 5IRPA 1MW3A 4HPXA 3CHDA 5HUPA 3T0DA 4GY7A 4XV0A 4OHQA 4H00A 1BYCA 1HVXA 1TQXA 1J0JA 3THCA 2QDDA 2I5GA 3LA4A 3C6CA 2R1LA 4Y9OA 3O5PA 1S2AA 4AX6A 3N73A 4L9YA 4E2VA 2ATSA 2MNTA 1E51A 2Y6ZA 3B7XA 5E5CA 3T2OA 4UMAA 2WNWA 4S2CA 3LM7A 3N4AA 3R25A 1J0YA 1RK5A 4AZGA 1IT0A 1ZAJA 4PUJA 4EP8C 4NJIA 4JIHA 4H01A 3WQ5A 4WJEA 1S5TA 2Z29A 1ODZA 1W3NA 3B0PA 3NGFA 3PZOA 5KMYA 1ZJAA 1PZ1A 2GL5A 1RA5A 1A49A 1IZKA 3NQMA 1V4YA 3Q65A 1Q6HA 3UZ5A 2NV1A 3T4WA 3LNPA 2VX5A 5D02A 1JR1A 3NQCA 1ZJHA 4HA0A 1CGWA 3EKGA 1TZ9A 3RPMA 4MB5A 4B5SA 4QXIA 4U33A 2FPYA 1RK6A 4QIUA 1V08A 2CHRA 2Y2WA 3GXTA 4QHRA 4QROA 1X8CA 1QMLA 3EKZA 1E9IA 2DG3A 3I10A 1KXVA 1F8MA 1K6WA 1PX4A 5ENLA 5BU6A 3BAIA 1UASA 5I3IA 1W5QA 2FHBA 2V63A 4V28A 1Q85A 4PCPA 3UNDA 3N29A 5AHMA 1K4GA 3P14A 2VEPA 2NX9A 3SRDA 5LNVA 3A5VA 3ECQA 4EXAA 2YPIA 4LAYA 3QMTA 3S5YA 1KFJA 1DHPA 2RUQA 2PRLA 3KFTA 4US5A 3GVRA 4XZWA 3VNJA 7TAAA 5GJMA 3VIMA 3WNLA 3WH7A 1XPYA 1AW2A 1VPXA 2I1OA 4IGMA 4YMZA 4GZIA 4OKDA 1FCBA 1M53A 1FWBC 3K30A 1DXFA 3D0CA 4HMEA 2QVNA 4GJJA 1XV8A 4XAFA 3HPSA 1LBMA 3L5MA 3PWGA 1HQTA 4WKHA 1I2QA 4EAMA 2AWGA 2W27A 1ZU8A 2OWXA 4R9XA 3BDKA 2W6RA 4FXRA 3DG6A 3VIPA 4AB4A 1G1YA 2FFCA 2ZUSA 3C0JA 4ZQOA 4WLCA 4I7WA 1LG2A 3QH2A 2X2YA 3UCCA 2DIEA 2MUCA 4GUJA 4YN5A 3B4UA 2ZZ1A 5DELA 1YDNA 3L0GA 3VO0A 3H55A 1WO2A 2OT1A 1CI1A 4DUWA 1H4PA 1YW5A 2J8GA 4QS6A 1TV5A 5M03A 1UIPA 2HPMA 4JX5A 2PU1A 1YNYA 4YWSA 4YTRA 4PCFA 1B3WA 4U2ZA 3LGDA 2HVNA 1QOXA 3CB3A 3W85A 3FA5A 2OEJA 2PFHA 1J6YA 3CUGA 2WHJA 3LRKA 4XAPA 3WL0A 4LBSA 4O13A 1FFQA 2NVCA 3AYTA 1IEVA 2PDFA 3UNTA 1IIGA 2J9YA 3CMGA 4ZEPA 1GKRA 4CD8A 1SFJA 3N17A 1H51A 3THUA 1F7BA 4FO4A 3FV9A 4IGNA 4KETA 4O1BA 1XHGA 1OVDA 4Q8UA 3OHMB 5AC7A 2ZXAA 3W22A 3VD5A 3RM9A 3PJWA 3WKZA 2YFOA 3CUHA 1P0KA 4LBRA 2R14A 2XH7A 3BAWA 2BWGA 2FGLA 1FKSA 3NZRA 4GA8A 1TWDA 1KCLA 1E44A 1J11A 3CIVA 3RITA 3KP0A 5KINA 4XKYA 1MEWA 1JNSA 3TTYA 5HA7A 1CB7B 1FKRA 2DUAA 4MY9A 1F3TA 5E0CA 4UTWA 4W7VA 2F38A 2V2HA 3ITVA 3W01A 3I4KA 3LNMA 4TIMA 3KL0A 1R3SA 4HT3A 2PTYA 3S1GA 3TAKA 1QHOA 4XG1A 1BG9A 1HO4A 1Z41A 2Y63A 3THDA 3STGA 3LGGA 1WKEA 4JFMA 4JQ2A 1H62A 4UTTA 2HVMA 1OFEA 4LOCA 2QJJA 3BLLA 4DJFA 3WN6A 1WZLA 4O0KA 4GG9A 1GHSA 5CH9A 1YPXA 1E15A 5CCZA 4MB1A 4QGCA 1WDSA 1ME8A 3GD6A 3H7RA 5F2GA 2YA0A 4LANA 4QM1A 3TW9A 1C7SA 3CUFA 1LQ0A 1QK2A 2OEKA 4RE4A 1XIFA 5EGRA 3U3HA 1T96A 4EACA 1MQPA 1HXVA 2NVAA 1ICQA 1X39A 3R7MA 5A6KA 3WEMA 5TNVA 3ZLHA 4A4AA 4EIVA 5A6LA 1OGSA 4JTQA 3KVMA 3CV2A 5DO2A 3ES7A 2INFA 1OF6A 3KAOA 2FKEA 1H3GA 3WK2A 3GTYX 5AYBA 3WD2A 1UH4A 3BE7A 1JGMA 1L2UA 4O11A 2CHOA 3TQVA 2P3EA 1Q45A 4ZSUA 2E3ZA 3ATZA 4WXZA 3DHUA 1I60A 3N1AA 4JIEA 3MYPA 1OK4A 1T7LA 3LU2A 5KZDA 3TH6A 3TN5A 3CT2A 3E0IA 8TIMA 1UUOA 4CQDA 2DZAA 4ZS6A 2YJQA 4C02B 3W7NA 1XLCA 3U4AA 2Y7DA 3LEPA 1ZCOA 3IVUA 4B3LA 3GXMA 3DYPA 3VGHA 1PKLA 5T9BG 3GTIA 1J93A 3GS6A 4LAKA 3G5EA 4NAFA 4QQUA 2QCGA 2QUTA 4NJHA 1WZKA 2X0SA 3SUVA 4GNKB 4P8UA 3M43A 3MMDA 2ZUVA 1BVZA 1E72M 3H7UA 3HOJA 2AL1A 3H2FA 4DRJA 1JRCA 1GVOA 3W4RA 3GTHA 2A7RA 2XIBA 2XDFA 5HXMA 5D2TA 2B81A 2A7PA 2D0HA 1WB0A 1L0PA 2ZX5A 4FEZA 4JN7A 1PL9A 3UG3A 2GJXB 5XIAA 3NJ3A 3VDAA 1Q4NX 2X1UA 2IKGA 2VVNA 4B5NA 2G0WA 5HW8A 4A6GA 4Z2JA 4O4WA 3WMCA 5EU9A 3N2OA 2QCCA 2J27A 2IUZA 3R5EA 1FDJA 1YNQA 4JFIA 1I2NA 4TVDA 5C9UA 1JZ2A 2ZZ7A 2HNHA 4LVFA 3A9IA 3GU2A 3SRKA 4RK8A 1UKSA 5A94A 3BV4A 1DIEA 4DRSA 2J62A 3UCQA 4JS3A 2VEFA 3P93A 3BMBA 3H2MA 3VD3A 1XPGA 2CBUA 4MPQA 4B5XA 3VDBA 1FVPA 1WXJA 4DIAA 3KCEA 1OIMA 2UV8G 2WYSA 3P0XA 2CZVA 2YDRA 2FVMA 3CHEA 4TX8A 1XCFA 4HNNA 1V7AA 3SCOA 2WC3A 3KX6A 1GQJA 2PDYA 1CLVA 1GZJA 2XH4A 3OVQA 4AVNA 3SCWA 4DJEC 1JULA 5C2XA 4ZXOA 3RO8A 5AC6A 4Q8QA 3S83A 5DIUA 3UR5A 1C3FA 2X05A 5FJPA 4Q4PA 5ECVA 4AUBA 2P53A 3S0CA 1H49A 3WQ8A 3W7JA 3T0AA 4EPEC 4NP7A 3MU7A 3G24A 2JGYA 4R33A 2BXYA 3H22A 3W1NA 1ZP3A 2CLEA 2AL2A 2BOFX 5CKSA 1BL4A 4QG8A 4WOZA 4G7EA 4CNSA 5KSWA 1IIHA 1UR3M 3IK8A 2JFEX 1FH7A 5DIVA 1E0UA 3LHTA 3RU6A 2XSBA 1CX9A 3GVWA 2P10A 4URIA 4P8XA 3CPUA 1T8XA 1JEZA 5M1TA 1XC6A 1XXXA 2FJKA 3M44A 1RJQA 2JEPA 1SW0A 3EOOA 3LSBA 4FNUA 2X42A 3WQEA 1P7TB 1GW1A 3S1VA 1LUCB 1CPUA 4QEHA 1Q6GA 1QRQA 1AG1O 1XH0A 2E7FA 1W1PA 3N15A 1S3HA 1ZGDA 5EMUA 1S46A 3L23A 2DG4A 3DC8A 4DT4A 3MO7A 1AH4A 5M2FX 4LAUA 3MKVA 2VCDA 4J40A 3ABZA 4S39A 3SCPA 2GQ3A 3NCOA 1VFMA 2E9MA 4JFTA 2V30A 3AALA 1D8WA 2V69A 2XJ7A 3VX0A 4C6IA 4C6OA 3KBNA 1D7FA 2X40A 1XLJA 2R9RA 2QV4A 3UZWA 3QPZA 1WXYA 3R94A 4X9SA 4ZE5A 3DFHA 3XINA 3HO8A 3UF9A 3W3OA 2BOEX 2V0TA 4H9MA 5LHEA 1ESWA 7TIMA 3TROA 3WLTA 3OIXA 4RE2A 1YE4A 1ME9A 4OFCA 2Q8ZA 1EOMA 3WQGA 4DLMA 1QPRA 1SFLA 4MAVA 2DFAA 2QVHA 2VO5A 3SB0A 5U7SA 4R7OA 4CD4A 4LEFA 4DM2A 2HSAA 5HW7A 3TLQA 2Q09A 4ZQMA 3S6OA 1GVFA 4LAOA 3ME3A 4G6CA 2PC8A 3BUVA 3S9YA 5EBAA 1B4KA 5CBJA 1L6WA 3PTDA 3PZVA 3CZJA 3PG9A 2Y62A 4JTEA 5BRQA 1JF5A 1M7JA 4QJ1A 4FK9A 3LS9A 3MV01 1ZBCA 1QI3A 2QLYA 3CZKA 4JDYA 3IJDA 3HJZA 3AHZA 1P0EA 3B03A 1R9ZA 3WQPA 4ZB5A 1TB3A 3GG7A 2DT0A 3FIGA 2VR2A 2BXZA 2VWTA 3GXNA 4ZPTR 1S5MA 3EX6A 4WSKA 2ZXDA 2BZNA 4A8IA 4PMQA 2QIIA 2WSKA 1TMLA 3OVPA 2VC5A 3EIPA 3CAKA 3UWZA 1MDRA 2V3FA 2DH2A 2XPBA 2W63A 4C6NA 2GK1B 3O5DA 2VR4A 1H2JA 1ME7A 2OKTA 4N9CA 2HK0A 3ONBA 5CZTA 4LT9A 1C9WA 3PP7A 2PBCA 2YYUA 3LCIA 3RGTA 3E6EA 1XI3A 4WGHA 2ZX9A 3B8WA 2OSYA 1JUEA 3ABOA 1OC6A 4KT2A 5FAGA 4FR1A 3D3AA 4DRKA 3W6LA 4FR6A 2R24A 5BROA 3CQHA 3QKEA 4EPBC 3ZYZA 4O1AA 4W86A 3P60A 1FCVA 3H4GA 3MC5A 1A5SA 3ALFA 4WGXA 3REQB 4MPKA 2G3IA 3WK3A 4A2RA 1EXPA 5JH1A 1M5YA 1KD0A 1F6YA 1SSDA 5FF3A 3VUSA 3GDTA 4J2PA 3O5QA 1XINA 3LM3A 5BNKA 4L61A 1NU5A 2G5WA 3T05A 1FY6A 2CLKA 3JYMA 4NUWA 1YRRA 2DT2A 5D09A 4PSPA 4ATWA 1UP3A 1UD3A 3GNDA 3RCYA 3C2VA 4BQ5A 3BOFA 3CH9A 4ROQA 4AZ6A 1V0LA 4I8YA 4RDVA 1GJWA 3GSMA 3O5FA 5A95A 2NUYA 5XINA 1D6OA 4CUCA 1K9DA 4UQAA 1ZJBA 3P74A 1JZ3A 2OU4A 3EXTA 4MZ1A 2POZA 3NO3A 4UOJA 4EAYA 4ZOCA 1VENA 1FKTA 4DZ5A 3U5UA 1O12A 3S1XA 2RUSA 2HBVA 2UBPC 3CAVA 4JPGA 4YYCA 2Y7GA 2QULA 3WUFA 1Q6UA 1XLDA 3BH4A 4UFLA 4LWWA 3UYIA 1LJYA 2NW0A 3CTLA 4AZCA 3G6LA 3PM6A 1T5AA 1VR6A 2WQDA 5J5DA 1OFRA 1LORA 2AMXA 1HO1A 3RIKA 4Q8OA 4P2VA 2BHYA 5DMNA 3EDKA 4HMCA 2OYLA 1Q6LA 3FAWA 3PUOA 4M6PA 3BLDA 4AY1A 3AXXA 1DJXA 5FEPA 1LL7A 4GFIA 5G4HC 4E2DA 3W74A 3MB9A 4ZR8A 2NV9A 3UVIA 2C15A 1R2SA 4IX2A 4Q7IA 2Y1HA 3NEVA 4S3EA 2VEGA 1GQLA 2WSQA 3D6NA 4N7QA 3QHMA 5C9RA 3DGRA 1XDMA 1RR2A 1VFSA 1SO5A 2OO6A 1VKFA 3MDYB 1BTMA 5HJXA 4GCAA 3C2EA 1CW2A 4DRQA 2A3CA 3GUGA 2HQAA 5LIXX 2QAFA 3DGBA 3QV6A 3SADA 2PDHA 3SRFA 1ROTA 4KQZA 1XYLA 4V33A 1XH2A 3SECA 4FA3A 2C3ZA 1M68A 1XBZA 3FHAA 5IDZA 5DRCA 4QJ3B 2A6NA 2PD9A 2WCGA 5I3FA 2IXVA 2W5FA 1IV8A 1EF2A 4UWMA 2M08A 5AHNA 4UR7A 1V93A 5D32A 2YCIX 1R47A 1TO3A 4XIMA 1KXHA 4DRPA 3N2XA 2GUUA 3A4WA 3QZAA 5FESA 3L4YA 4W89A 1Q63A 1F61A 3DFOA 3FVDA 1W56A 4NI8A 1KM1A 1Z48A 3FJLA 4RXFA 1OC5A 1FDZA 3R0KA 1FUYA 3N6HA 1HJQA 5E09A 2F6KA 2ZA2A 1UJQA 3G8RA 1XISA 3CQKA 4AISA 2G4FA 4K39A 1UA3A 3HQNA 4D8ZA 4GHRA 1FJDA 4IHCA 5DCDA 4ERIA 1ZUAX 2D23A 3GG0A 4NX0A 3BLPX 4FXFA 3SM0A 4Q4RA 2Q01A 2ZRVA 1DKWA 4GGBA 3S5NA 4U86A 4XO6A 2FMOA 1PKYA 4PODA 2VCCA 3IKGA 3SCNA 1TJRA 3P0WA 1YADA 1JYWA 3JYJA 4UQCA 3G1HA 5FA5A 2DIKA 4PBGA 2GPTA 3B05A 4Y8FA 1OFPA 1Z6KA 2RDXA 5M3WA 2DVXA 2HZGA 3DYOA 1DXEA 1OX6A 1H0IA 2ZWZA 2PURA 1X7IA 2J75A 4HQVA 3SGUA 4F8XA 3WLOA 1ADDA 3NQ8A 4FLRA 4Z2IA 3GG8A 3IAQA 1AJ2A 4QCEA 1CEOA 1FD9A 4BFAA 1VJSA 1V0KA 4MVAA 4JIPA 4TW8A 1LCOA 4H4IA 3TZNA 4UB9A 1B3XA 1C9HA 4YHGA 3N25A 4LUTB 2C1GA 2WVUA 2X1TA 1HKVA 2D69A 3VDCA 4IQ2A 3U7VA 4FX6M 3HFTA 3GTNA 1FKFA 4W8BA 3WDHA 1IWAA 5CSUA 3TN3A 3NQVA 6XIMA 2FHCA 3PRDA 5H8PA 1D3CA 2NVDA 2EULA 3BXWA 2AKZA 4QZVB 5AVNA 3SDOA 1CGVA 4J9JA 3UQAA 1KWGA 4HHMA 4F9DA 3QRHA 3QMSA 2TYSA 3EPMA 2GJNA 1V0MA 1VFHA 1KFKA 3BLOA 4U10A 4OV9A 3STPA 3NM1A 1V6VA 1UOKA 1XIEA 4RNFA 3QYSA 1TV2A 3VUPA 2P1FA 4PUKA 5CLWA 4YVVA 2GVEA 2PDCA 5CPSA 3WH0A 4R0XA 1FXPA 3O5EA 4NT0A 5LSMA 3M1ZA 1H7OA 5D2YA 1W9VA 3W2MA 2A79A 1E55A 4XO7A 3VCCA 1DOSA 4AD4A 3HM7A 3F5JA 4TVCA 4UFIA 1BD0A 2X0YA 4KRUA 4Z1BA 1JCXA 4PN2A 4FB7A 2JZVA 1IGWA 3ITLA 3BC9A 1W9PA 2FJUB 4PUMA 3TC7A 2IPWA 4B9YA 1RBOB 2WZMA 3MHFA 2QMJA 4XWUA 3H23A 3QKZA 4DRHA 1TR1A 5A6BA 2E8ZA 5JQ9A 2C19A 3HPFA 4Q22A 1P6BA 2P0IA 3MCMA 1DWAM 3IS4A 4JTSA 2PWVA 1A5MC 1G9HA 2GWNA 2BDQA 1UR9A 1H09A 5CGMA 1TPDA 2PLJA 3OGRA 5BMXA 1L1PA 4JHMA 1A0CA 2ZR4A 4GQ0A 4W8AA 2YW3A 3P2VA 5FSEC 3VCRA 1JZ4A 3AHTA 1ECQA 3KAFA 3W25A 3T0BA 2Z2BA 3MUY1 1JPDX 4R5EA 2VZTA 4FP1A 5LXEA 1Q3NA 1GZGA 3G1XA 3K4AA 3APTA 1V3MA 3ZT5A 4AHPA 4LUSA 4ACYA 3FGCA 3T2PA 3VX1A 4WX2A 1NQKA 4J4KA 2P4VA 3KAGA 1TWIA 5HR7A 3O8AA 4CQ8A 3C56A 1R7AA 1JNDA 4GXWA 1PB0A 1K02A 2PF8A 3TV8A 3KVLA 3PSVA 3EB4A 4PC8A 3SCQA 4JTCA 2DZWA 1MNZA 2V5BA 1E4NA 1A3WA 3NFUA 2A4AA 1JVNA 3RRXA 1QO2A 3TVAA 2O56A 1GORA 3I3EA 3W37A 2D2JA 1DE5A 2YBUA 4HIBA 1Q1CA 4HNUA 2MLYA 3MZNA 4H04A 4X22A 5I0DA 3LX9A 3KOWA 2W4XA 4HSNA 5E9XA 3MO4A 3LBMA 1XIMA 3W7RA 4UTLA 2PTWA 2J79A 4LUIA 4RKAA 1FWAC 5EMKA 4IUGA 1E56A 3VPLA 1NFBA 1VPQA 4D8LA 1EBGA 3TQKA 3NM3A 4H41A 2IQTA 4B16A 2YDQA 3ABXA 1WAUA 4OOZA 1HIZA 4OVXA 3N6QA 3L0KA 1CB2A 3UESA 3UGRA 4PMVA 1J6PA 3W7HA 3IGSA 4MKVA 5I98A 1TX0A 1OINA 1FKDA 3VKAA 1V3HA 5H2ZA 2CNCA 4GRSA 1JD9A 2NT0A 3RUBL 1S1PA 3KCLA 1MSSA 3CMFA 3NR0A 5G4WA 3ZVHB 2B7OA 3KL5A 3WLLA 3CC1A 3SY1A 1XP3A 1PKMA 2A1YA 1CYGA 1M3UA 4TMBA 1TTJA 2VFFA 1XUZA 1TJ0A 3GLCA 3UG5A 5JBFA 1OK6A 5C71A 1F8IA 3GH4A 1AH0A 4LALA 3EA3A 4JFVA 2QDHA 4O2TA 5PTDA 1XD0A 4OBSA 4JL1A 4UNLA 3AIWA 3FXGA 6ENLA 4ZOAA 1AD1A 3M46A 8RUCA 2VCAA 4F0HA 2IS7A 1QTWA 4LSBA 5TF0A 3PUDA 3L9CA 1SZNA 3N14A 3GXDA 3UXAA 1RJRA 4DWSD 2RHGA 2EG8A 2HXUA 3GM8A 2ISDA 1DXIA 2GDQA 1U1HA 3WUGA 1O5QA 4LS2A 3O1NA 1GOOA 2BFGA 5SWUA 2B4GA 3F03K 2QJGA 4L64A 2YYTA 1GNXA 1O4UA 3UXDA 4FHAA 4W93A 2ZC8A 2KZHA 1SM9A 2PBOA 4GYPC 1PX8A 3E1F1 3MS8A 1H61A 3U6WA 1ZBWA 1PYMA 2PI6A 3KACA 5C2GA 1KCXA 4HBEA 1T6MA 3HIJA 3ZM8A 4LB3A 3MBFA 3FY1A 4DBEA 4XX6A 2Z26A 4GXMA 1KBBA 5AYZA 3RPDA 4NASA 2XINA 4X0NA 1SFSA 2J88A 3AS3A 3TA6A 1DL3A 2DP3A 3LLDA 4AFYA 4D6JA 3MI2A 5I2UA 3GAYA 3Q58A 3BCFA 3BQ6A 4UQEA 3JZUA 4ODPA 3KTXA 1YPIA 3CIXA 3CNYA 2B7QA 3IRSA 2OGYA 2EPKX 3B0XA 1QPKA 4FI4A 3BLFA 4W9OA 5E70A 5A6JA 2J8TA 5F7UA 1P5BA 1Y5WA 1YW1A 2J6XA 3G0XA 2FAPA 3MHGA 3KTSA 5T91A 4A3YA 5AC4A 2GJPA 4M81A 4PFMA 1PDYA 5ABFA 1G7VA 1U2YA 3N3TA 3F7JA 1HKKA 4AF0B 2D1ZA 5HPOA 1GVIA 1NJJA 4HNTA 1FWGC 3OG3A 5HJLA 4KW2A 3PWIA 4D6CA 1D3GA 4FOUA 2F84A 4PMXA 3ZJ7A 4B4HA 4UTKA 1IGSA 3VOGA 2NUWA 4ODRA 1DTNA 2VL4A 1FWFC 3LV6A 4JEQA 2WWDA 2DVTA 3UA3A 3ALGA 1R9YA 4MKSA 2QJHA 4C7GA 4POCA 2OXNA 2O4QA 3F4NA 4AWUA 2JF6A 4Y6GA 1Y5XA 3MTWA 1U5HA 3WLKX 5G2IA 4UUIA 5F4XA 1E5NA 5GNZA 1ICSA 3BZJA 3E2VA 4LFYA 3E0FA 4MZ8A 4M8UA 4ZBCA 1OCNA 2VC9A 3TONA 4FALA 2WJZA 3S46A 2D3NA 4INFA 4HNCA 2OKOA 4H3DA 3W72A 2YW4A 2PEVA 1B1YA 2E67A 3ITOA 1E4LA 2V3DA 1R3RA 5TAOA 1LRNA 3MMUA 3PF3A 4GMEA 4D1IA 3WFLA 4M19A 3THAA 3WJSA 2GGGA 3IPWA 4G7FA 3TAOA 3LCFA 3W26A 1FA2A 1DJQA 3UG4A 4L1XA 2VUNA 3F5LA 4I9JA 4WSJA 3V5CA 1QW7A 1QBAA 4F48A 4LY4A 4M1RA 2PMQA 4UC5A 1E73M 4MG4A 1VBGA 2YB1A 2V5LA 3PJTA 4NZFA 3DYMA 4DLFA 1V6UA 4L4PA 1BPLB 1PV8A 2ZBTA 4NYUA 2I57A 1VCFA 2XFYA 3TC3A 4ZTYA 3W9ZA 1XKJA 2CZEA 4UZSA 2YL9A 4NHVA 1MDLA 2Y85A 1ICPA 3ITGA 4G56A 4NRSA 2XIQA 3EPNA 3V35A 2VFEA 1E1EA 4XZBA 3GHSA 5BCAA 4IISA 4G5DA 2HS8A 3MW7A 1KR1A 3L2MA 4JICA 4M80A 2GGEA 2OLHA 1WDDA 2ISWA 2V68A 4M82A 3BOXA 1G67A 1XBYA 1TMHA 4C60A 4NZ3A 3BCJA 3PRAA 1F2JA 1YTEA 3MP4A 3L2IA 1S5NA 4MWAD 4W5ZA 1POKA 4RXGA 4AIEA 5C9XA 3PB2A 3IGHX 2FIQA 4GIEA 3I7QA 3UWVA 2PDMA 3ABRA 2HWGA 5KTLA 4L4LA 3CASA 2JK2A 2J66A 3B8UA 5F4SA 1EJTC 4HU8A 3W29A 4R34A 4JOMA 2Q02A 3GU9A 2WCAA 1JCTA 3C0LA 4V15A 4Q32A 1HJUA 1RP8A 2RURA 2PSNA 3NQDA 3GNXA 1EH9A 1GVEA 3U2ZA 3AS2A 1SJCA 1TA3B 3MCOA 3KBWA 3WJYA 1FH9A 5MKGA 5DQPA 3QZEA 1XLGA 3VC5A 1Q66A 2BXVA 2ZICA 1VCVA 5F2IA 1OFBA 3F4WA 2PLCA 3W70A 3PZ9A 3USZA 4DELA 4WDWA 2WM0A 1I0DA 2DQXA 3TOYA 4C7FA 3GKAA 2NT1A 2XP4A 1BXBA 4F4RA 3W82A 5K9CA 3L65A 2H9AB 3BL3A 1JDDA 1NWTA 1KM4A 4LGXA 2VWSA 3ODKA 3HPAA 2WOQA 1HT6A 1YMYA 4HK6A 4JN6A 1EIXA 4KF1A 5DRIA 5K4ZA 4KGJA 3TTOA 1TIWA 3LCHA 3RK8A 5LGXA 1JCLA 3HBLA 1IYXA 1AH3A 1QI2A 2Z1VA 1YKWA 3UWEA 1GOMA 3N6JA 2XSXA 3PAOA 4UIOA 1IXNA 5DF0A 3WX7A 3H53A 2JE8A 3AS1A 3T2QA 3RDKA 1IEWA 4N9DA 4ACZB 1KV8A 3NA8A 1WUFA 2JIEA 2ZQUA 5CC6A 1UP2A 2OMAA 4J5NA 1OADA 3TN6A 4PCTA 2H90A 3UXIA 4ZOEA 1EQ3A 1OZMA 4RE3A 5FI8A 3OIHA 4E38A 3KOXA 3FKRA 4ZSTA 4H9YA 2VJXA 3B0VC 1GKQA 1UIOA 4ODOA 1DJYA 4RNHA 3B8DA 3ISIX 5JH2A 4U31A 3FKKA 1KKRA 1NAL1 3MA8A 3N34A 4J2MA 1MQRA 4R85A 2JQXA 3TXVA 4IF2A 2WMFA 3E49A 3TMLA 3AYRA 3VD9A 1BSIA 3CAWA 2HBXA 3NGJA 3F2BA 3OBAA