4IT4A

Crystal structure of residues 1-211 of cg17282
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
207
Chain Sequence
DWYVGTEWEDKNRGLAKKVIGLQFTEMDKPTIISTVEFSVNKKATNLGGRPSKYLVSDTYPQKHSLEMGTSLTAVDCYLELLLQQFVPGETAACSITTKTGERIEFELKLEKIVKNTQVEKLSAAEIYEVALRLKESGVATFKTFPKFAFDYFVRAAKLLITYKPFDKLTKKTNGINGQAVEELFIQIQTNLAACLLQEKRYEHVIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG17282
publication title Noncanonical FK506-Binding Protein BDBT Binds DBT to Enhance Its Circadian Function and Forms Foci at Night.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Unknown function
total genus 59
structure length 207
sequence length 210
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18023 FKBP_N_2 BDBT FKBP like N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4it4A02
3.10.50.60 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4it4A01
4A5XA 2LRLA 4U2YA 4ZEYA 2W2UA 2JQHA 4U3CA 4CN1A 3ZSTA 3ZT5A 2CPTA 3ZT6A 2WWVA 3ZSSA 5CJ5A 2CRBA 4U31A 4CN4A 1WFDA 4U7YA 2A9UA 2V6YB 2JQ9A 2JQKA 1WR0A 5LB7B 1YXRA 3K1SA 2K3WA 4IT6A 2LRKA 4IT4A 4U2ZA 3EABA 2V6YA 5FVLA 4WZXA 4NIQA 4P1NA 3ZT7A 5CGMA 2WY2A 2XZEA 2V6XA 2MPKA 4CN6A 2DL1A 1WCRA 4U7IA 2RPAA 5FVKA 4U33A
chains in the Genus database with same CATH superfamily
1ROTA 4AISA 1GOIA 2X9HA 4TV9E 4IL9A 3RM4A 3PV0F 2XQAA 3WQVA 3ZCJA 3RM9A 2V7IA 5LXTE 4DV6T 3SRZA 3N9QA 4EXTA 5EK4A 3WI3A 4C02B 5HUAA 3J7Yq 3GMIA 3ZT7A 2XZEA 4PJNA 2DI4A 4DR4T 3NBXX 1WRDA 2YK0A 1HKJA 2NOXA 3PUWF 4ZEYA 1D0ZA 2UXNB 1W9RA 1HS7A 3JXVA 1E6RA 3UI6A 3AA6B 4DRHA 2EHOC 3PRAA 4JUYA 4YSXA 3PUGA 4IL4A 4IDQA 3K3QC 5LGNB 4WZXA 4ZXLA 1LVFA 3C98B 3RYHE 4UF0B 1XHGA 5AQIB 1ZEEA 5DJQC 2L2SA 3GTYX 3I9YA 4ANJA 1D1BA 4NUUA 4U31A 3AEFA 4V1Av 5L3DB 4DWSA 2J62A 2EHOB 2W0GA 3KV5A 4UXNB 2XQ3A 2WU5A 3AB3B 3QUJA 1XMOT 4DV1T 3TKLB 4UIGA 1XMQT 5HAXA 3L39A 3HR0A 1HR0T 4ZI3D 4HWDA 4CQIA 2DT2A 1UR9A 3KAHA 5M4YA 2DSZA 3A8YC 5IUXA 2NW7A 2VKHA 3AA1B 4HWIB 2KE0A 3RI5A 4UV9B 3MA9A 2XP6A 3AQUA 2PTFA 3WD3A 4H9NC 4G2PA 4BJMA 3UQBA 3KV4A 4ZZCA 5ADXL 5C8YE 2KMFA 2UXCT 3RQWA 5HCMA 3CGNA 2MF9A 3G06A 4B3TT 2NTXA 1VOMA 2XM2A 3VAWA 4QH1A 4XZCA 1UGOA 4ZI3C 3R84B 2V8SV 2WWUA 4DWSC 4KP3C 3ZC0A 2YBTA 2BVMA 3FBLA 5FXWA 1MIVA 1JVWA 5BXJA 1T98A 3O5RA 4J4NA 3IKGA 5HWCA 4EEBA 4DT4A 2FJBA 3LK2B 4HFHA 3PU8A 3PTRB 5AQFB 3JYJA 2W61A 4DWSB 2MBGA 4TWDA 1HJVA 4IQCA 3HA4A 5LB7B 2XAFB 4TV8E 5ETWA 2BVLA 4KX6A 4ODMA 4JFKA 1M7KA 3KV6A 4QXHB 1ZV4X 1D7HA 4URIA 2V6XA 4A98A 3QK6A 2E5VA 4U33A 4OFZA 3BQKA 4DRQA 2WM0A 3QC9A 2VKJA 3WH0A 2ACZA 4CN1A 2FJDA 1PINA 2WCAA 2CRBA 5FYMA 5DO2A 1WFDA 4MAVA 3P8CD 1HKIA 5H6QB 2M6IA 4U2ZA 2VKOA 2CWOA 4XAXB 4W9QA 2WAUA 1NH6A 1L1PA 4L72B 2FJEA 1E44A 2KSRA 2LPVA 2RURA 3AE9A 2WZIA 4QHOA 2ZLYA 5LBMA 5JR9A 3O9XA 2XY8B 3TLUA 5ABFA 2JQ9A 2W00A 1BR2A 3PDYA 3JADA 3B8SA 2UUCT 4NNRA 2C5JA 3CH9A 4JI8T 2DG9A 2DT0A 3RFWA 3BQLA 2EULA 4X62T 3E0ZA 2MTQA 4P8XA 5HXCA 4DIDB 4BJNA 4JLEA 1JNZA 3AA0B 5JDQA 1UX4A 1FKGA 3FZFB 2CXLA 3NRKA 4X64T 1WB0A 1VF8A 4HWFA 3EUHA 5HEHA 2W62A 4JI1T 2DPEA 2A3EA 4X1YE 2KI3A 2X67A 1H7CA 4ZHQE 2XTLA 3PA7A 1ZBVA 1TFVA 1FKDA 3B9EA 1HNWT 1NMVA 3PJAA 4S3KA 3HKDE 3JAEA 4LF9T 2V7JA 3EVYA 5JR9C 5ABHA 4MHCA 2LM2A 5CB4E 5J0ZA 1UX5A 5AQUB 4ODQA 2G41A 4LFBT 4H9OC 2D0TA 2NWBA 5JDLA 4B6XA 2LLYA 1W26A 5KMGP 3PR9A 2NW9A 3AE4A 5HEOA 4KBMB 2V5DA 3ARVA 2DL1A 4IE7A 1HNXT 5JR9B 2W2UA 5ABFB 1NENA 3FB2A 1PBKA 1N1AA 4Q7NA 1L0VA 4LF8T 3RHWA 3ARSA 1ITXA 1G8XA 2WP9A 2NP9A 5L3GB 3CK6A 5JRCA 3Q2MA 4Z2LA 4YXDA 1SR0A 2UU9T 4AQFC 2D9DA 3RC3A 3RRCA 5FL0A 1BR4A 3ODKA 4HE8A 1R8IA 1E1HB 5J1GA 2VCDA 1P5QA 4NSBA 4JI6T 2D0UA 3I1AA 3X1DA 5HEJA 2BG9E 3TLSA 4G50A 5CA0E 4WIWA 3NRXA 4ZPWR 1FKJA 3TLTA 4Z2HA 2O9OA 3UQ4A 1OWAA 2ZR6A 3VKGA 5F8PA 4IDOA 3Q9DA 4LAWA 2HH7A 4L0RA 3U3IA 1X6NA 5FMNA 3OPCA 1FEWA 4O2AE 4AIUA 3P50A 3MACA 4DMWA 4LF7T 4B3ST 4JI4T 3RYIE 4LAYA 3KVBA 1HG2A 3W15B 3CQXC 2MLXA 1N34T 2DWGA 3H3MA 4Z2IA 2A3AA 4IE5A 1UK5A 4ODOA 1BL4A 4DRIA 2IC6A 4IPXA 5JDNA 2ZMAA 3ZMVB 4IT4A 2RUDA 3BXWA 4UDMA 4ZPVR 4E7SA 4O4HE 3UU5A 2PV1A 1JNEA 4X20E 3WAKA 2PN0A 2F21A 2BS2A 2DCFA 1OGBA 5HWBA 3ZSTA 4TYOA 2LSYA 1WYCA 5JRCB 1XZYA 4HARA 1YD8G 5L4HA 1EIBA 5F3JA 2XP3A 1ZU8A 4I50E 4TW6A 3K1SA 2KT9A 2H7OA 2V7KA 3VR8A 2YDSA 1D7JA 4J2CA 3CX7B 1T7SA 2MPKA 4PJMA 3OA5A 4X1IE 3H3AA 4JI3T 2CXFA 2V1DB 2E9XD 1F40A 2ZM2A 3GPKA 3N5LA 1E15A 1XWMA 3AS3A 4GIVA 2CA5A 4DV7T 2RQSA 4MTVA 3MZKB 2N2NA 1YKHB 4QX7B 2YN6A 4LMLA 2OFNA 5I98A 4L5GA 4TNWA 4HFCA 4N78D 1BR0A 4AKHA 1MMNA 4H9PC 1J4HA 1GQEA 3VRAA 4IIJE 3B13A 1Z8UA 4DNDA 3WKZA 3MKDA 2XP5A 2IDOB 2ZQUA 4K0UA 4JI2T 3ARZA 3UF8A 2XHEB 3VKHA 1XNRT 3Q5XA 4ZOLE 4TNVA 1YXRA 3LFMA 1YATA 3Q5WA 3EDVA 1SA0E 4I43B 1KNZA 5LCYA 4AQYT 3N9MA 1X6LA 5L3CB 4LMKA 5GONE 4G63A 2L3LA 3ZN1B 4QH4A 4MLKA 2PPNA 3KBUA 4Z91A 4ODLA 3O5FA 1X9BA 3ABVA 4ILUA 2XP4A 1JNRA 5LBQB 1E6NA 2KZ7B 1WAWA 3ARTA 3LSVA 2X9YA 3B57A 3PUVF 4U72A 2M6BA 1WYBA 2MOZA 4YTMA 1W1TA 1HKMA 2XAQB 3DJBA 1LKXA 3FBZA 1HX1B 5AQMB 1OEDE 2MLYA 3FAPA 3ARQA 2ETNA 2N87A 4NXNT 2NW8A 4ADZA 1JCHB 5LHGB 2ZR5A 4WK9A 2V26A 3T1HT 1QPFA 2ESCA 4JYSA 2DHRA 2WM9A 2WLYA 3TDBA 4IGUA 3CKDA 4LF5T 4WYVA 2OLHA 3WIJA 2N9DA 4X65T 3AA7B 3NZQA 3AXJA 3ALFA 1KEYA 1R9HA 3P4RA 3Q5EA 3WD2A 4HN9A 2P9BA 5J6EA 3NI6A 4HWCA 4YT0A 3AE5A 2QA7A 2XJ7A 3N9LA 4F6RC 2XQ6A 3OYXA 2ODVA 5L3FB 5DIVA 5HWXA 4NIQA 4YJ2E 4C90A 3KVAA 4YSZA 3L8RA 4DO0A 3AVRA 1HJXA 1JNDA 2LSJA 4LAXA 3LUOA 4PK5A 2B31A 5CJ5A 1LQ0A 3A7MA 2V7LA 2CCQA 2WS3A 3N9OA 3AE1A 5FY7A 3B7XA 4L9IA 4OYKA 4HBEA 1J6YA 3ZN0B 3RGCA 2XPKA 4AQGA 3UFGA 1Q6UA 3ETVA 4P0AA 1J1JA 4H9SE 3O5LA 4PFPA 3TCZA 2X9XA 4DR1T 2YINA 1D1AA 1LVKA 5FP3A 5J2UE 5E0OA 3VU7H 2QF8A 2BS3A 4JV5T 1TCOC 4DH0A 1HNZT 4EB6E 4DWSD 3RKOA 1YW0A 3O1IA 2K5BB 3ARYA 1NWTA 3ARWA 3AAIA 3A5XA 2HN2A 3FZHB 4EGWA 3ZEFB 1DU2A 3M3ZB 3BMBA 5ABEA 5A1LA 3MDYB 3UQAA 4QWNB 2VQFT 4AI6A 1J4RA 2PJQA 2JMKA 2LSKA 3JAFA 4JFJA 2WDVA 3AXJB 1J5ET 4CI1B 2VVSA 3ARUA 2OA5A 2X9WA 5L47A 4LFCT 2WMNA 2J47A 3UT5E 4ERRA 3BK9A 3OKQA 5IHYA 1UR8A 3O5IA 1H0GA 5LGUB 5BR8T 4TX5A 4JFIA 2LOPA 2ZM8A 4TWFA 4ODKA 5TAOA 3CGMA 1D2KA 2ES0A 3WD0A 3I6CA 1UUSA 4KI0F 4GYSA 4R0XA 2WB5A 3ZMSB 3LK3B 3WD4A 4M1PA 5FXVA 1EQ3A 4IE6A 2LKNA 3DP7A 5DITA 2RP4A 3IKDA 4GKJT 3O5DA 5FY0A 4Z2JA 4DR7T 3ZYKA 1W1PA 3ARRA 2XPAA 2PFVA 5FKYA 3KINB 3W4RA 3EAMA 1EHNA 1SUMB 4GK0E 3ARPA 1I94T 3FZLB 3F2EA 3ZSSA 4NUVA 2UZ5A 1XRVA 2IC9A 1LL7A 3RLFF 4EAHA 1D7IA 3ETUA 3AEEA 2J4GA 2CEAA 3LBXA 4BF8A 5LMNT 4IDZA 2YDQA 4LFAT 2YDRA 2Y48B 2ODUA 2D9FA 5JH7E 3AEDA 2HPJA 4BA9A 2DT3A 1FJGT 4PTMA 3TLVA 4H63H 3UU6A 3R6NA 1HXVA 4GYRA 2Y6XA 2N1GA 4I4TE 3GA8A 1RD6A 1BKFA 4UVBB 4HGAA 2V7MA 2WU2A 2LKGA 4QZVB 4JEUB 3LG7A 5LOVE 4DV3T 3WAJA 2FAPA 2C5IT 5LJMA 1IAPA 4DR5T 3RM8A 2XSAA 3ONLC 1N32T 1NEKA 4LAVA 4G2AA 3OBVE 2RUCA 1YQ3A 1W1YA 4H63V 4YHJA 4Z2KA 3FY1A 1CHUA 5JVDE 5LMUT 3ZJ2A 4DBQA 4DV5T 2XP8A 4W9OA 4P8VA 4IE0A 3FXDB 2UUBT 1W0BA 1S94A 1ZP0A 3O1JA 3AE2A 2CMRA 5HW8A 2BDEA 4U85A 5F5WA 4S3JA 4N19A 4DRNA 2A3BA 4COFA 4Z8XA 2MLZA 3AS0A 1QZ2A 1NAFA 3ALGA 4K0KT 4MPKA 3WL1A 4O4IE 4X5TA 4DRMA 2ZM0A 4ODPA 5AQOB 2XAJB 4ZS6A 3M65A 4JFMA 2HPLA 3RH3A 4WKFA 1HCIA 1MNEA 4IDPA 2XQ4A 3ZMZB 1FJDA 2A3DA 5LG3A 2CHOA 4DBRA 1V9DA 5JH8A 1F8AB 3F57A 2E2AA 3KAFA 4IDNA 4DROA 2I59A 3RIUA 2YU2A 3UU4A 2AWGA 2I0MA 3EIPA 3EY6A 2JQKA 1FMWA 3C4ZA 5HKGA 3QOKA 4ZI2D 3AAEB 2Z6EA 4I0UA 2HN1A 3PUXF 4FN2A 1J5WA 4HFEA 2JMHA 3P4PA 4KHPT 3E08A 3KCEA 4B3RT 2KNDA 3JYMA 2F4EA 1ZL1A 2KR7A 5JREA 5LNKA 4QKNA 1OWQA 5AQRB 1OGGA 1XDOA 3DTOA 3VRBA 4X66T 1FD9A 2OLTA 2OV9A 2CE7A 4R5EA 2IMLA 5J2TE 1B7TA 5HCJA 5DEZA 4ZI2C 1HX8A 2G0UA 1HG5A 4HTEA 2FDMA 4CXXA 2GK9A 4DUYT 1KNPA 1W9VA 4NZCA 2BG9A 3MJXA 3IK8A 2IUBA 1O3XA 4A97A 4HFDA 4TN7B 5DQVA 4U84A 5JQGE 1HKKA 4TWHA 3KADA 2ZR4A 3CX8B 3PUYF 2H7VC 3AE8A 4X1KE 3UUNA 3FZMB 1EZ3A 1SE7A 4LF6T 3OJAA 3AEGA 5IWAT 4XBFB 4YTPA 4EOZB 5AQHB 2IAKA 5HXHA 5HXRA 1HF8A 4KR0B 2D5UA 4OYJA 4EV6A 3UUBA 5LHIB 2UUAT 5H6RB 5AQTB 1E7PA 4O8SA 3ZKRA 2Y8DA 3VR9A 2XM1A 2LGOA 3JC6D 4NPPA 3CHFA 1JNSA 4U86A 2MPHA 4GKKT 4YY3T 2AOSA 4AKGA 1MMAA 3TC5A 4ASKA 3ZLIA 1FKTA 2BG9C 2X51A 2WSSV 4UV8B 4EZHA 2YU1A 3C64A 5FL1A 1S35A 2YBUA 3WL0A 2H88A 3CMLA 1LRZA 4WW0A 3PRDA 1SHZC 1FKSA 1KFYA 1FKRA 2JJ9A 3EHZA 4DMVA 2NTYA 4UELA 3IF8B 3JC6C 4P8UA 2LRKA 2YOEA 4ILBA 1M5YA 4P1NA 4DV0T 2BG9B 1GPFA 1FAPA 2B1EA 4ML4A 2PPPA 5LGTB 2DG3A 3QNUA 4GOUA 3HKEE 2VK9A 2XPBA 3UTKA 2KO7A 1ZBCA 2PBIA 4CN4A 4QIBA 1FFRA 4JEHB 2LHNA 3GWHA 4HBOA 2MAWA 4QT3A 4P0BA 3KBTA 2ACXA 2FUPA 1IJ6A 1MMGA 1W1VA 2KFWA 4JYAT 2HHHT 2PPOA 4KQZA 4MSPA 1J4IA 2C0SA 5GQBA 2WY2A 4O4LE 2WLZA 1EDQA 3KV9A 4QH5A 2FBWA 2YKSA 1NWUA 4HFIA 4DUZT 4IREA 2LSGA 3AROA 3RC8A 4HWHA 2CHNA 1ZOYA 4TX0A 3RQUA 3ZJ1A 2JZVA 2RUQA 1Y64B 1OXZA 4PNIA 5L3BB 2W63A 3ARXA 3MXZA 3FHNA 1Q6HA 2PV3A 2C5KT 3RMEA 1XNQT 2VL8A 4EZ4A 2VB6A 3O5EA 4ZZBA 4LMJA 1LJYA 4EEDA 2PBCA 4MBQA 2UXBT 4YJ3E 5L2LA 2MNTA 2XQ9A 1U4QA 3ZC1A 1E6PA 4LGXA 1OEDA 3KZ7A 5JDMA 4YSYA 3K8PC 3EI0A 5FVLA 4YTNA 2XQ7A 3FZKB 3CHEA 5D75A 2QVAA 3PUQA 2B5UB 2P4VA 3K3OA 2CBJA 1LG1A 3ZMTB 3CHDA 1FKHA 2Q5AA 1Y01A 3ZCIA 4O4JE 3ZYMA 1QUUA 3JCFA 4EYYR 3O5PA 3O5KA 2BBJA 4PJLA 3QB5K 1ZCNA 3P4QA 3WQWA 3KAGA 4TNSA 3I0QA 1W9UA 4DV4T 1W0AA 5AQGB 5AQJB 2A9UA 2VN1A 4H9QC 1G73A 2QGSA 4OK0A 4W9PA 3AEBA 2DG4A 3B9AA 4B3MT 5HT1A 2E8IA 2V6YA 4WNKA 1ZB5A 4JFLA 5CGMA 2BZBA 1T11A 2K9AA 2RPAA 5GPRA 4KMCA 4JI7T 4P8WA 3HKBE 5HYAA 2ZQTA 1OEDC 4ITZA 2SPCA 3G6LA 4W5UA 3AECA 1EYMA 3L09A 5KDMC 2M2AA 3PUZF 5HXEA 3O5MA 4ZS2A 3CHCA 4PAGA 3N2KE 1O6IA 1Q1CA 2K3WA 5L3EB 4ZS3A 4DV2T 2KWIB 3OYZA 5DQWA 1I6ZA 3N9NA 1KT0A 5HTGA 3CVRA 3CWZB 5EZYE 3O5OA 1NWRA 5HXSA 3ONXA 3T1YT 2LSIA 4UR9A 2LRLA 5JTGA 4LF4T 3TLWA 1OEDB 3NTPA 2DLRA 4U3CA 4HKAA 3PUSA 2J1DG 3QOFA 4PK4A 2JRKA 5HWYA 5LYJE 4MFRA 3RRWA 3NVOA 2XQ8A 2VL0A 3ZMUB 2XASB 1ZBKA 5FY1A 2KLQA 3LDQB 3RF1A 3UUMA 5C2TA 5HBFA 2QYWA 1IJ5A 3PUAA 3PE0A 4U7IA 4PJJA 3AE7A 1MIWA 4JI0T 2PV2A 4WJXA 1D1CA 3UI5A 5AQLB 3HKCE 1K9TA 2DSUA 4AXPA 1E6ZA 3FXEB 3RYCE 4CI3B 2K8IA 4J4OA 2WDQA 3EABA 1YQ4A 2BKOA 5HW6A 2PG8A 1WLXA 3NZPA 1LL4A 4FAPA 2WK2A 2LJLA 3F31A 3UQ7A 2FKEA 2IUZA 1QSDA 5AQSB 2FJAA 1QPLA 2V6YB 4GIWA 5HEGA 2ZQVA 3C4XA 3I9WA 3RKGA 3I0OA 2BKNA 4Z90A 3C4WA 3UI4A 1ZHCA 4U2YA 4AKIA 4ZI7E 1C9HA 3ONJA 3AE6A 2DWKA 4GK5E 1Y0OA 4UEMA 2PI6A 3IHZA 1LL6A 5ABGA 4TUYE 4PK6A 1D6OA 3O5JA 1D0YA 2UXDT 5B8IC 4FJOA 3UU3A 4DVDA 4GGQA 2M67A 2Q9QA 2LOSA 1UCUA 4YLHA 4DRPA 4ILAA 3QB5A 3N2GE 4FI5A 4U74A 1FKFA 2IIUA 3P4SA 3LJCA 2DSWA 2LJ4A 2XQ5A 4U7YA 2VKDA 3ZPOA 1KNRA 3H9RB 2AXDS 3G6MA 2WDRA 3AVSA 5AQQB 1XDPA 4F8HA 4DR6T 5LHHB 2Q9QD 3O1HA 3Q5DA 2DNXA 1NSGA 4UVAB 4TW7A 3ZYLA 5JDHA 3CIRA 3KDSE 1LG2A 3ANWA 3RGLA 4TZ4C 1KFWA 4DZ2A 1A7XA 1MMDA 5CFBA 1MNDA 1M62A 2O92A 2F2DA 2VASA 2DT1A 5GPGA 4BAYB 3UUXB 1MIYA 3ESLA 4AQFA 4CXYA 5HEUA 3P4WA 1E2AA 4MNJA 5AFUL 5C3JA 2V5CA 4AKRB 2IF4A 4QX8B 2Y78A 2X68A 2LT3A 4YHHT 3PU3A 2XSBA 2Q9QC 4ILCA 4PFOA 2L8KA 2LEHA 2LM9A 3LBXB 5FNVE 4O2TA 3B5MA 4DZ3A 4O2BE 5LG4A 2VURA 4CN6A 1NWMX 1ROUA 3O5QA 2VVNA 2W67A 3E22E 3AEAA 3SFDA 3MK7C 2L9QA 2VQET 2WQYA 1KT1A 2ZM6T 4TW8A 2H3RA 1Q6IA 3AS2A 4H9RC 3P7IA 2ITKA 4MNKA 5EK2A 3RX6A 1B6CA 2Q9QB 2WMOA 1N36T 3V5SA 2UXXB 4P09A 2JPFA 4AKLA 4L3NA 5AQKB 5L4EA 1N33T 1X79A 5FVKA 3IA3A 2K24A 4ZPTR 4WBOA 2X0HA 4WBNE 4HEAA 2KWHA 2A2FX 3J9X1 1FKIA 4UVCB 1WR6A 2E5LT 3T8OA 1D0XA 4ISSA 4HFVA 2XAGB 3PRBA 1QLBA 3NKZA 3ANWB 4QXCB 5LA6E 2CPTA 5AQVB 3KACA 3SWHA 4IQ2A 2F4VT 1E9LA 4Q22A 4CZZB 2RSEA 4ODRA 3L3PA 1US7B 3V5UA 4KUMB 2ZQSA 1KK7A 2VWAA 2CWYA 2R6GF 3RYFE 2CXDA 3UQIA 2KXPB 5AQPB 4DR3T 3RIUC 3VHLA 2K48A 4PW8A 3U78A 1W9PA 1AJ3A 2XUEA 4EYUA 4MNMA 1VCSA 3NRYA 2BS4A 4JBWF 2D2SA 3B9DA 4MGVA 4DIPA 3UFEA 4OHFA 5KXJA 4AY1A 3BQIA 2JIWA 4OX9T 4XAKA 1BR1A 3HL6A 1IZNB 4HFBA 2DSVA 2NR4A 3EDUA 2LE8A 4E7ZA 2X0YA 4ISTA 2A3CA 3IBPA 3IEEA 5BMVE 1FKLA 2CBIA 3ZT6A 1FMVA 4JI5T 3PURA 3AS1A 1U79A 1U5PA 5LJNA 5CA1E 1ZBWA 3D0TA 2IHR1 2MYSA 1H0IA 1VCTA 4Z2GA 3SS1A 1GRJA 2KINB 1CUNA 2E9XA 3OOBA 2F23A 3LK42 4Q25A 4YFSA 1KF6A 2AE9A 4WKAA 1IBKT 5DIUA 3O5GA 1T8BA 1CTNA 2B76A 1IBLT 2WZHA 3AE3A 2G8ZA 1WR0A 4A56A 2BBHA 4IT6A 3PJAJ 1YKEB 2W66A 5AQNB 2W4XA 1T72A 3N2OA 5HW7A 1HTJF 2YEVC 1NMWA 3K3NA 3GN5A 4QT2A 5DABA 2CLYC 5FXXA 1VRBA 3KAIA 4ODNA 3KFWX 1SYTA 5JDFA 3IHRA 3CPZA 1FKKA 4MNLA 2XP9A 2QRXA 3UU8A 4DR2T 3NWIA 1WCRA 4A5XA 3UULA 2CLYB 3RIAA 4MALA 2X66A 2JQHA 1IX5A 3RIFA 4IHJE 2WWVA 1W09A 2XP7A 4DRKA 2XQYA 1JNTA 3OVUA 3CZ8A 4KHZF 1FIOA 1HJWA 2A72A 4EIWA 2E9XC 3HI2A 1YW5A 3FXYA 2X0LB 4CXWA 3C50A 2WBLA 4WKHA 4IE4A 1GUVA 1ZK6A 3CQCB 4I55E 1FFQA 3C51A 3OTOT 2M08A 1IBMT 4UF0A 2IW5B 2XAHB 5JDGA 1FKBA 3H37A 5LP6E 5FXZA 2CM0A 3CQGB 2I6HA 4CI2B 2E9XB 3S4UA 2EHOA 1WNOA 2BKPA 1UURA 1HFAA 2H89A 4DRJA 5EK3A 2LHRA 5IYZE 3RPUA 1NWSA 3O4XE 3N9PA 3ZT5A 4QXBB 2JQQA 3AAAB 4C91A 3SFEA 5KX5E 4NXMT 1Z0PA 5DF0A 3WD1A 3KABA 2RA1A 1ZKEA 3GN5B 3SOLA 2M1IA 2EHOD 3CX6B 2KGJA 3GU0A 2LKHA
chains in the Genus database with same CATH topology
1ROTA 2MLZA 2F21A 3AS0A 1GOIA 2PV2A 4WJXA 1OGBA 1QZ2A 3ALGA 5HWBA 4MPKA 3ZSTA 3RM4A 3UI5A 3WL1A 3WQVA 4TYOA 3RM9A 4DRMA 1K9TA 2DSUA 4HARA 1EIBA 4ODPA 2XP3A 1E6ZA 1ZU8A 4ZS6A 4TW6A 5HUAA 4JFMA 4C02B 2K8IA 4J4OA 3K1SA 4WKFA 1FJDA 3EABA 3ZT7A 1D7JA 5HW6A 2XZEA 2MPKA 5JH8A 1LL4A 1F8AB 3OA5A 4FAPA 1HKJA 2WK2A 3KAFA 4DROA 4ZEYA 1F40A 3GPKA 1E15A 3AS3A 2FKEA 4GIVA 2IUZA 2AWGA 3JXVA 1E6RA 3EY6A 2RQSA 3UI6A 4DRHA 4MTVA 1QPLA 2V6YB 2JQKA 3PRAA 2OFNA 5HKGA 2ZQVA 3QOKA 5I98A 4WZXA 3UI4A 4U2YA 1C9HA 4FN2A 1J4HA 1XHGA 2L2SA 1JNEA 3WKZA 1Y0OA 2XP5A 2ZQUA 3UF8A 3ARZA 2PI6A 4U31A 3KCEA 3JYMA 4DWSA 3IHZA 1LL6A 2F4EA 1YXRA 1ZL1A 2KR7A 1YATA 1D6OA 3O5JA 1OWQA 5B8IC 4GGQA 1OGGA 4DRPA 1X6LA 1FD9A 1FKFA 2DSWA 2DT2A 2LJ4A 1UR9A 4R5EA 3KAHA 4U7YA 2DSZA 5DEZA 2PPNA 3H9RB 3G6MA 2FDMA 4ODLA 3O5FA 2KE0A 2XP4A 1W9VA 2XP6A 4NZCA 3AQUA 1E6NA 1NSGA 3WD3A 1WAWA 3ARTA 4G2PA 3IK8A 3UQBA 4TW7A 4U84A 1HKKA 1LG2A 3KADA 2ZR4A 1KFWA 4DZ2A 3CGNA 1A7XA 1W1TA 2MF9A 2O92A 1HKMA 2F2DA 4DRNA 2DT1A 5GPGA 2MLYA 3FAPA 3VAWA 3ARQA 2N87A 2ZR5A 4WK9A 4MNJA 4DWSC 1QPFA 2ESCA 2IF4A 2YBTA 4JYSA 2WLYA 2Y78A 3TDBA 4KR0B 1JVWA 5BXJA 2OLHA 3WIJA 3O5RA 4O2TA 4J4NA 3IKGA 4DZ3A 3ALFA 5HWCA 4CN6A 4DT4A 1ROUA 1R9HA 2LGOA 3O5QA 3WD2A 5J6EA 3NI6A 1JNSA 3CHFA 3JYJA 1KT1A 4U86A 4TW8A 2MPHA 4DWSB 1Q6IA 3AS2A 1HJVA 2ITKA 4IQCA 5LB7B 2AOSA 4MNKA 1B6CA 3TC5A 4ODMA 4JFKA 5DIVA 1D7HA 1FKTA 4NIQA 4URIA 2V6XA 4L3NA 5FVKA 4U33A 2YBUA 3WL0A 1HJXA 4DRQA 4ZPTR 1JNDA 4LAXA 2WM0A 3WH0A 4CN1A 1PINA 3LUOA 2B31A 3PRDA 5CJ5A 1FKIA 2CRBA 1FKSA 1WFDA 1LQ0A 5DO2A 1FKRA 4MAVA 1HKIA 3B7XA 4P8UA 2LRKA 4U2ZA 4HBEA 1M5YA 1J6YA 3RGCA 4P1NA 1GPFA 4W9QA 1FAPA 1NH6A 1L1PA 1Q6UA 4L72B 4ML4A 2PPPA 3PRBA 2DG3A 3O5LA 2LPVA 2RURA 3TCZA 2XPBA 2CPTA 2KO7A 3KACA 1ZBCA 4IQ2A 4CN4A 1E9LA 2QF8A 4Q22A 4QIBA 2JQ9A 1FFRA 1TCOC 4ODRA 2RSEA 4DH0A 4DWSD 3ARYA 2ZQSA 1NWTA 3ARWA 3B8SA 4HBOA 4QT3A 3UQIA 4NNRA 3CH9A 1W9PA 2DG9A 2DT0A 3RFWA 4MNMA 3MDYB 1W1VA 2KFWA 3UQAA 4P8XA 1J4RA 3B9DA 4JFJA 4MGVA 4DIPA 2PPOA 4KQZA 4MSPA 1J4IA 1FKGA 3NRKA 5GQBA 4AY1A 1WB0A 2WY2A 1VF8A 4XAKA 2WLZA 3ARUA 1EDQA 2DPEA 2A3EA 2DSVA 1NWUA 2A3CA 3AROA 1FKLA 4TX0A 2KI3A 3ZT6A 1UR8A 2JZVA 2RUQA 3O5IA 3AS1A 3ARXA 1H0GA 1U79A 3PA7A 1ZBVA 4JFIA 1Q6HA 1TFVA 1ZBWA 1FKDA 3B9EA 2PV3A 1H0IA 4ODKA 3CGMA 3RMEA 4Z2GA 1NMVA 1D2KA 4S3KA 3WD0A 3I6CA 3O5EA 3OOBA 1LJYA 2PBCA 4R0XA 4ODQA 2MNTA 4WKAA 2G41A 5DIUA 3O5GA 1E6PA 4LGXA 1CTNA 3WD4A 1EQ3A 3KZ7A 2G8ZA 2LKNA 1WR0A 5DITA 1W26A 3IKDA 4IT6A 3O5DA 5FVLA 4Z2JA 3PR9A 5HW7A 3CHEA 5D75A 1W1PA 3ARVA 3ARRA 2DL1A 1NMWA 2XPAA 4QT2A 3W4RA 2W2UA 1EHNA 1LG1A 3ARPA 3CHDA 1PBKA 1N1AA 4Q7NA 3KAIA 4ODNA 3ZSSA 1FKHA 3ARSA 1SYTA 2Q5AA 2UZ5A 1XRVA 1ITXA 1LL7A 1D7IA 1FKKA 3O5PA 3O5KA 4MNLA 4Z2LA 2XP9A 1SR0A 4BF8A 1ZCNA 1WCRA 3ODKA 4A5XA 2VCDA 3KAGA 1P5QA 4NSBA 4TNSA 3WQWA 2JQHA 1IX5A 1W9UA 2D9FA 2WWVA 2XP7A 4DRKA 1JNTA 3CZ8A 2A9UA 2VN1A 4G50A 2DT3A 4WIWA 1HJWA 4W9PA 4PTMA 4ZPWR 2DG4A 1FKJA 3B9AA 1YW5A 4Z2HA 1HXVA 3FXYA 2V6YA 5HT1A 1ZB5A 2O9OA 4JFLA 5CGMA 2ZR6A 1RD6A 1T11A 4WKHA 1BKFA 1GUVA 1ZK6A 2RPAA 5GPRA 4P8WA 4LAWA 2ZQTA 4ITZA 1X6NA 1FFQA 4QZVB 2M08A 2FAPA 3G6LA 4W5UA 1EYMA 2M2AA 3RM8A 1FKBA 3O5MA 3CHCA 1O6IA 1Q1CA 2K3WA 4LAVA 2RUCA 1WNOA 1KT0A 5HTGA 1W1YA 3O5OA 1NWRA 4Z2KA 3FY1A 4DRJA 4LAYA 2LRLA 3NTPA 1NWSA 4U3CA 2MLXA 3ZT5A 2XP8A 4W9OA 4Z2IA 2A3AA 4ODOA 1BL4A 4P8VA 4DRIA 4IPXA 1ZBKA 5DF0A 3WD1A 3KABA 5HBFA 4IT4A 2RUDA 3BXWA 5HW8A 2M1IA 4U85A 4ZPVR 2PV1A 4S3JA 4N19A 4U7IA 2A3BA 2KGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A5X A;  2LRL A;  4U2Y A;  4ZEY A;  2W2U A;  2JQH A;  4U3C A;  4CN1 A;  3ZST A;  3ZT5 A;  2CPT A;  3ZT6 A;  2WWV A;  3ZSS A;  5CJ5 A;  2CRB A;  4U31 A;  4CN4 A;  1WFD A;  4U7Y A;  2A9U A;  2V6Y B;  2JQ9 A;  2JQK A;  1WR0 A;  5LB7 B;  1YXR A;  3K1S A;  2K3W A;  4IT6 A;  2LRK A;  4IT4 A;  4U2Z A;  3EAB A;  2V6Y A;  5FVL A;  4WZX A;  4NIQ A;  4P1N A;  3ZT7 A;  5CGM A;  2WY2 A;  2XZE A;  2V6X A;  2MPK A;  4CN6 A;  2DL1 A;  1WCR A;  4U7I A;  2RPA A;  5FVK A;  4U33 A; 
#chains in the Genus database with same CATH topology
 1ROT A;  4AIS A;  1GOI A;  2X9H A;  4TV9 E;  4IL9 A;  3RM4 A;  3PV0 F;  2XQA A;  3WQV A;  3ZCJ A;  3RM9 A;  2V7I A;  5LXT E;  4DV6 T;  3SRZ A;  3N9Q A;  4EXT A;  5EK4 A;  3WI3 A;  4C02 B;  5HUA A;  3J7Y q;  3GMI A;  3ZT7 A;  2XZE A;  4PJN A;  2DI4 A;  4DR4 T;  3NBX X;  1WRD A;  2YK0 A;  1HKJ A;  2NOX A;  3PUW F;  4ZEY A;  1D0Z A;  2UXN B;  1W9R A;  1HS7 A;  3JXV A;  1E6R A;  3UI6 A;  3AA6 B;  4DRH A;  2EHO C;  3PRA A;  4JUY A;  4YSX A;  3PUG A;  4IL4 A;  4IDQ A;  3K3Q C;  5LGN B;  4WZX A;  4ZXL A;  1LVF A;  3C98 B;  3RYH E;  4UF0 B;  1XHG A;  5AQI B;  1ZEE A;  5DJQ C;  2L2S A;  3GTY X;  3I9Y A;  4ANJ A;  1D1B A;  4NUU A;  4U31 A;  3AEF A;  4V1A v;  5L3D B;  4DWS A;  2J62 A;  2EHO B;  2W0G A;  3KV5 A;  4UXN B;  2XQ3 A;  2WU5 A;  3AB3 B;  3QUJ A;  1XMO T;  4DV1 T;  3TKL B;  4UIG A;  1XMQ T;  5HAX A;  3L39 A;  3HR0 A;  1HR0 T;  4ZI3 D;  4HWD A;  4CQI A;  2DT2 A;  1UR9 A;  3KAH A;  5M4Y A;  2DSZ A;  3A8Y C;  5IUX A;  2NW7 A;  2VKH A;  3AA1 B;  4HWI B;  2KE0 A;  3RI5 A;  4UV9 B;  3MA9 A;  2XP6 A;  3AQU A;  2PTF A;  3WD3 A;  4H9N C;  4G2P A;  4BJM A;  3UQB A;  3KV4 A;  4ZZC A;  5ADX L;  5C8Y E;  2KMF A;  2UXC T;  3RQW A;  5HCM A;  3CGN A;  2MF9 A;  3G06 A;  4B3T T;  2NTX A;  1VOM A;  2XM2 A;  3VAW A;  4QH1 A;  4XZC A;  1UGO A;  4ZI3 C;  3R84 B;  2V8S V;  2WWU A;  4DWS C;  4KP3 C;  3ZC0 A;  2YBT A;  2BVM A;  3FBL A;  5FXW A;  1MIV A;  1JVW A;  5BXJ A;  1T98 A;  3O5R A;  4J4N A;  3IKG A;  5HWC A;  4EEB A;  4DT4 A;  2FJB A;  3LK2 B;  4HFH A;  3PU8 A;  3PTR B;  5AQF B;  3JYJ A;  2W61 A;  4DWS B;  2MBG A;  4TWD A;  1HJV A;  4IQC A;  3HA4 A;  5LB7 B;  2XAF B;  4TV8 E;  5ETW A;  2BVL A;  4KX6 A;  4ODM A;  4JFK A;  1M7K A;  3KV6 A;  4QXH B;  1ZV4 X;  1D7H A;  4URI A;  2V6X A;  4A98 A;  3QK6 A;  2E5V A;  4U33 A;  4OFZ A;  3BQK A;  4DRQ A;  2WM0 A;  3QC9 A;  2VKJ A;  3WH0 A;  2ACZ A;  4CN1 A;  2FJD A;  1PIN A;  2WCA A;  2CRB A;  5FYM A;  5DO2 A;  1WFD A;  4MAV A;  3P8C D;  1HKI A;  5H6Q B;  2M6I A;  4U2Z A;  2VKO A;  2CWO A;  4XAX B;  4W9Q A;  2WAU A;  1NH6 A;  1L1P A;  4L72 B;  2FJE A;  1E44 A;  2KSR A;  2LPV A;  2RUR A;  3AE9 A;  2WZI A;  4QHO A;  2ZLY A;  5LBM A;  5JR9 A;  3O9X A;  2XY8 B;  3TLU A;  5ABF A;  2JQ9 A;  2W00 A;  1BR2 A;  3PDY A;  3JAD A;  3B8S A;  2UUC T;  4NNR A;  2C5J A;  3CH9 A;  4JI8 T;  2DG9 A;  2DT0 A;  3RFW A;  3BQL A;  2EUL A;  4X62 T;  3E0Z A;  2MTQ A;  4P8X A;  5HXC A;  4DID B;  4BJN A;  4JLE A;  1JNZ A;  3AA0 B;  5JDQ A;  1UX4 A;  1FKG A;  3FZF B;  2CXL A;  3NRK A;  4X64 T;  1WB0 A;  1VF8 A;  4HWF A;  3EUH A;  5HEH A;  2W62 A;  4JI1 T;  2DPE A;  2A3E A;  4X1Y E;  2KI3 A;  2X67 A;  1H7C A;  4ZHQ E;  2XTL A;  3PA7 A;  1ZBV A;  1TFV A;  1FKD A;  3B9E A;  1HNW T;  1NMV A;  3PJA A;  4S3K A;  3HKD E;  3JAE A;  4LF9 T;  2V7J A;  3EVY A;  5JR9 C;  5ABH A;  4MHC A;  2LM2 A;  5CB4 E;  5J0Z A;  1UX5 A;  5AQU B;  4ODQ A;  2G41 A;  4LFB T;  4H9O C;  2D0T A;  2NWB A;  5JDL A;  4B6X A;  2LLY A;  1W26 A;  5KMG P;  3PR9 A;  2NW9 A;  3AE4 A;  5HEO A;  4KBM B;  2V5D A;  3ARV A;  2DL1 A;  4IE7 A;  1HNX T;  5JR9 B;  2W2U A;  5ABF B;  1NEN A;  3FB2 A;  1PBK A;  1N1A A;  4Q7N A;  1L0V A;  4LF8 T;  3RHW A;  3ARS A;  1ITX A;  1G8X A;  2WP9 A;  2NP9 A;  5L3G B;  3CK6 A;  5JRC A;  3Q2M A;  4Z2L A;  4YXD A;  1SR0 A;  2UU9 T;  4AQF C;  2D9D A;  3RC3 A;  3RRC A;  5FL0 A;  1BR4 A;  3ODK A;  4HE8 A;  1R8I A;  1E1H B;  5J1G A;  2VCD A;  1P5Q A;  4NSB A;  4JI6 T;  2D0U A;  3I1A A;  3X1D A;  5HEJ A;  2BG9 E;  3TLS A;  4G50 A;  5CA0 E;  4WIW A;  3NRX A;  4ZPW R;  1FKJ A;  3TLT A;  4Z2H A;  2O9O A;  3UQ4 A;  1OWA A;  2ZR6 A;  3VKG A;  5F8P A;  4IDO A;  3Q9D A;  4LAW A;  2HH7 A;  4L0R A;  3U3I A;  1X6N A;  5FMN A;  3OPC A;  1FEW A;  4O2A E;  4AIU A;  3P50 A;  3MAC A;  4DMW A;  4LF7 T;  4B3S T;  4JI4 T;  3RYI E;  4LAY A;  3KVB A;  1HG2 A;  3W15 B;  3CQX C;  2MLX A;  1N34 T;  2DWG A;  3H3M A;  4Z2I A;  2A3A A;  4IE5 A;  1UK5 A;  4ODO A;  1BL4 A;  4DRI A;  2IC6 A;  4IPX A;  5JDN A;  2ZMA A;  3ZMV B;  4IT4 A;  2RUD A;  3BXW A;  4UDM A;  4ZPV R;  4E7S A;  4O4H E;  3UU5 A;  2PV1 A;  1JNE A;  4X20 E;  3WAK A;  2PN0 A;  2F21 A;  2BS2 A;  2DCF A;  1OGB A;  5HWB A;  3ZST A;  4TYO A;  2LSY A;  1WYC A;  5JRC B;  1XZY A;  4HAR A;  1YD8 G;  5L4H A;  1EIB A;  5F3J A;  2XP3 A;  1ZU8 A;  4I50 E;  4TW6 A;  3K1S A;  2KT9 A;  2H7O A;  2V7K A;  3VR8 A;  2YDS A;  1D7J A;  4J2C A;  3CX7 B;  1T7S A;  2MPK A;  4PJM A;  3OA5 A;  4X1I E;  3H3A A;  4JI3 T;  2CXF A;  2V1D B;  2E9X D;  1F40 A;  2ZM2 A;  3GPK A;  3N5L A;  1E15 A;  1XWM A;  3AS3 A;  4GIV A;  2CA5 A;  4DV7 T;  2RQS A;  4MTV A;  3MZK B;  2N2N A;  1YKH B;  4QX7 B;  2YN6 A;  4LML A;  2OFN A;  5I98 A;  4L5G A;  4TNW A;  4HFC A;  4N78 D;  1BR0 A;  4AKH A;  1MMN A;  4H9P C;  1J4H A;  1GQE A;  3VRA A;  4IIJ E;  3B13 A;  1Z8U A;  4DND A;  3WKZ A;  3MKD A;  2XP5 A;  2IDO B;  2ZQU A;  4K0U A;  4JI2 T;  3ARZ A;  3UF8 A;  2XHE B;  3VKH A;  1XNR T;  3Q5X A;  4ZOL E;  4TNV A;  1YXR A;  3LFM A;  1YAT A;  3Q5W A;  3EDV A;  1SA0 E;  4I43 B;  1KNZ A;  5LCY A;  4AQY T;  3N9M A;  1X6L A;  5L3C B;  4LMK A;  5GON E;  4G63 A;  2L3L A;  3ZN1 B;  4QH4 A;  4MLK A;  2PPN A;  3KBU A;  4Z91 A;  4ODL A;  3O5F A;  1X9B A;  3ABV A;  4ILU A;  2XP4 A;  1JNR A;  5LBQ B;  1E6N A;  2KZ7 B;  1WAW A;  3ART A;  3LSV A;  2X9Y A;  3B57 A;  3PUV F;  4U72 A;  2M6B A;  1WYB A;  2MOZ A;  4YTM A;  1W1T A;  1HKM A;  2XAQ B;  3DJB A;  1LKX A;  3FBZ A;  1HX1 B;  5AQM B;  1OED E;  2MLY A;  3FAP A;  3ARQ A;  2ETN A;  2N87 A;  4NXN T;  2NW8 A;  4ADZ A;  1JCH B;  5LHG B;  2ZR5 A;  4WK9 A;  2V26 A;  3T1H T;  1QPF A;  2ESC A;  4JYS A;  2DHR A;  2WM9 A;  2WLY A;  3TDB A;  4IGU A;  3CKD A;  4LF5 T;  4WYV A;  2OLH A;  3WIJ A;  2N9D A;  4X65 T;  3AA7 B;  3NZQ A;  3AXJ A;  3ALF A;  1KEY A;  1R9H A;  3P4R A;  3Q5E A;  3WD2 A;  4HN9 A;  2P9B A;  5J6E A;  3NI6 A;  4HWC A;  4YT0 A;  3AE5 A;  2QA7 A;  2XJ7 A;  3N9L A;  4F6R C;  2XQ6 A;  3OYX A;  2ODV A;  5L3F B;  5DIV A;  5HWX A;  4NIQ A;  4YJ2 E;  4C90 A;  3KVA A;  4YSZ A;  3L8R A;  4DO0 A;  3AVR A;  1HJX A;  1JND A;  2LSJ A;  4LAX A;  3LUO A;  4PK5 A;  2B31 A;  5CJ5 A;  1LQ0 A;  3A7M A;  2V7L A;  2CCQ A;  2WS3 A;  3N9O A;  3AE1 A;  5FY7 A;  3B7X A;  4L9I A;  4OYK A;  4HBE A;  1J6Y A;  3ZN0 B;  3RGC A;  2XPK A;  4AQG A;  3UFG A;  1Q6U A;  3ETV A;  4P0A A;  1J1J A;  4H9S E;  3O5L A;  4PFP A;  3TCZ A;  2X9X A;  4DR1 T;  2YIN A;  1D1A A;  1LVK A;  5FP3 A;  5J2U E;  5E0O A;  3VU7 H;  2QF8 A;  2BS3 A;  4JV5 T;  1TCO C;  4DH0 A;  1HNZ T;  4EB6 E;  4DWS D;  3RKO A;  1YW0 A;  3O1I A;  2K5B B;  3ARY A;  1NWT A;  3ARW A;  3AAI A;  3A5X A;  2HN2 A;  3FZH B;  4EGW A;  3ZEF B;  1DU2 A;  3M3Z B;  3BMB A;  5ABE A;  5A1L A;  3MDY B;  3UQA A;  4QWN B;  2VQF T;  4AI6 A;  1J4R A;  2PJQ A;  2JMK A;  2LSK A;  3JAF A;  4JFJ A;  2WDV A;  3AXJ B;  1J5E T;  4CI1 B;  2VVS A;  3ARU A;  2OA5 A;  2X9W A;  5L47 A;  4LFC T;  2WMN A;  2J47 A;  3UT5 E;  4ERR A;  3BK9 A;  3OKQ A;  5IHY A;  1UR8 A;  3O5I A;  1H0G A;  5LGU B;  5BR8 T;  4TX5 A;  4JFI A;  2LOP A;  2ZM8 A;  4TWF A;  4ODK A;  5TAO A;  3CGM A;  1D2K A;  2ES0 A;  3WD0 A;  3I6C A;  1UUS A;  4KI0 F;  4GYS A;  4R0X A;  2WB5 A;  3ZMS B;  3LK3 B;  3WD4 A;  4M1P A;  5FXV A;  1EQ3 A;  4IE6 A;  2LKN A;  3DP7 A;  5DIT A;  2RP4 A;  3IKD A;  4GKJ T;  3O5D A;  5FY0 A;  4Z2J A;  4DR7 T;  3ZYK A;  1W1P A;  3ARR A;  2XPA A;  2PFV A;  5FKY A;  3KIN B;  3W4R A;  3EAM A;  1EHN A;  1SUM B;  4GK0 E;  3ARP A;  1I94 T;  3FZL B;  3F2E A;  3ZSS A;  4NUV A;  2UZ5 A;  1XRV A;  2IC9 A;  1LL7 A;  3RLF F;  4EAH A;  1D7I A;  3ETU A;  3AEE A;  2J4G A;  2CEA A;  3LBX A;  4BF8 A;  5LMN T;  4IDZ A;  2YDQ A;  4LFA T;  2YDR A;  2Y48 B;  2ODU A;  2D9F A;  5JH7 E;  3AED A;  2HPJ A;  4BA9 A;  2DT3 A;  1FJG T;  4PTM A;  3TLV A;  4H63 H;  3UU6 A;  3R6N A;  1HXV A;  4GYR A;  2Y6X A;  2N1G A;  4I4T E;  3GA8 A;  1RD6 A;  1BKF A;  4UVB B;  4HGA A;  2V7M A;  2WU2 A;  2LKG A;  4QZV B;  4JEU B;  3LG7 A;  5LOV E;  4DV3 T;  3WAJ A;  2FAP A;  2C5I T;  5LJM A;  1IAP A;  4DR5 T;  3RM8 A;  2XSA A;  3ONL C;  1N32 T;  1NEK A;  4LAV A;  4G2A A;  3OBV E;  2RUC A;  1YQ3 A;  1W1Y A;  4H63 V;  4YHJ A;  4Z2K A;  3FY1 A;  1CHU A;  5JVD E;  5LMU T;  3ZJ2 A;  4DBQ A;  4DV5 T;  2XP8 A;  4W9O A;  4P8V A;  4IE0 A;  3FXD B;  2UUB T;  1W0B A;  1S94 A;  1ZP0 A;  3O1J A;  3AE2 A;  2CMR A;  5HW8 A;  2BDE A;  4U85 A;  5F5W A;  4S3J A;  4N19 A;  4DRN A;  2A3B A;  4COF A;  4Z8X A;  2MLZ A;  3AS0 A;  1QZ2 A;  1NAF A;  3ALG A;  4K0K T;  4MPK A;  3WL1 A;  4O4I E;  4X5T A;  4DRM A;  2ZM0 A;  4ODP A;  5AQO B;  2XAJ B;  4ZS6 A;  3M65 A;  4JFM A;  2HPL A;  3RH3 A;  4WKF A;  1HCI A;  1MNE A;  4IDP A;  2XQ4 A;  3ZMZ B;  1FJD A;  2A3D A;  5LG3 A;  2CHO A;  4DBR A;  1V9D A;  5JH8 A;  1F8A B;  3F57 A;  2E2A A;  3KAF A;  4IDN A;  4DRO A;  2I59 A;  3RIU A;  2YU2 A;  3UU4 A;  2AWG A;  2I0M A;  3EIP A;  3EY6 A;  2JQK A;  1FMW A;  3C4Z A;  5HKG A;  3QOK A;  4ZI2 D;  3AAE B;  2Z6E A;  4I0U A;  2HN1 A;  3PUX F;  4FN2 A;  1J5W A;  4HFE A;  2JMH A;  3P4P A;  4KHP T;  3E08 A;  3KCE A;  4B3R T;  2KND A;  3JYM A;  2F4E A;  1ZL1 A;  2KR7 A;  5JRE A;  5LNK A;  4QKN A;  1OWQ A;  5AQR B;  1OGG A;  1XDO A;  3DTO A;  3VRB A;  4X66 T;  1FD9 A;  2OLT A;  2OV9 A;  2CE7 A;  4R5E A;  2IML A;  5J2T E;  1B7T A;  5HCJ A;  5DEZ A;  4ZI2 C;  1HX8 A;  2G0U A;  1HG5 A;  4HTE A;  2FDM A;  4CXX A;  2GK9 A;  4DUY T;  1KNP A;  1W9V A;  4NZC A;  2BG9 A;  3MJX A;  3IK8 A;  2IUB A;  1O3X A;  4A97 A;  4HFD A;  4TN7 B;  5DQV A;  4U84 A;  5JQG E;  1HKK A;  4TWH A;  3KAD A;  2ZR4 A;  3CX8 B;  3PUY F;  2H7V C;  3AE8 A;  4X1K E;  3UUN A;  3FZM B;  1EZ3 A;  1SE7 A;  4LF6 T;  3OJA A;  3AEG A;  5IWA T;  4XBF B;  4YTP A;  4EOZ B;  5AQH B;  2IAK A;  5HXH A;  5HXR A;  1HF8 A;  4KR0 B;  2D5U A;  4OYJ A;  4EV6 A;  3UUB A;  5LHI B;  2UUA T;  5H6R B;  5AQT B;  1E7P A;  4O8S A;  3ZKR A;  2Y8D A;  3VR9 A;  2XM1 A;  2LGO A;  3JC6 D;  4NPP A;  3CHF A;  1JNS A;  4U86 A;  2MPH A;  4GKK T;  4YY3 T;  2AOS A;  4AKG A;  1MMA A;  3TC5 A;  4ASK A;  3ZLI A;  1FKT A;  2BG9 C;  2X51 A;  2WSS V;  4UV8 B;  4EZH A;  2YU1 A;  3C64 A;  5FL1 A;  1S35 A;  2YBU A;  3WL0 A;  2H88 A;  3CML A;  1LRZ A;  4WW0 A;  3PRD A;  1SHZ C;  1FKS A;  1KFY A;  1FKR A;  2JJ9 A;  3EHZ A;  4DMV A;  2NTY A;  4UEL A;  3IF8 B;  3JC6 C;  4P8U A;  2LRK A;  2YOE A;  4ILB A;  1M5Y A;  4P1N A;  4DV0 T;  2BG9 B;  1GPF A;  1FAP A;  2B1E A;  4ML4 A;  2PPP A;  5LGT B;  2DG3 A;  3QNU A;  4GOU A;  3HKE E;  2VK9 A;  2XPB A;  3UTK A;  2KO7 A;  1ZBC A;  2PBI A;  4CN4 A;  4QIB A;  1FFR A;  4JEH B;  2LHN A;  3GWH A;  4HBO A;  2MAW A;  4QT3 A;  4P0B A;  3KBT A;  2ACX A;  2FUP A;  1IJ6 A;  1MMG A;  1W1V A;  2KFW A;  4JYA T;  2HHH T;  2PPO A;  4KQZ A;  4MSP A;  1J4I A;  2C0S A;  5GQB A;  2WY2 A;  4O4L E;  2WLZ A;  1EDQ A;  3KV9 A;  4QH5 A;  2FBW A;  2YKS A;  1NWU A;  4HFI A;  4DUZ T;  4IRE A;  2LSG A;  3ARO A;  3RC8 A;  4HWH A;  2CHN A;  1ZOY A;  4TX0 A;  3RQU A;  3ZJ1 A;  2JZV A;  2RUQ A;  1Y64 B;  1OXZ A;  4PNI A;  5L3B B;  2W63 A;  3ARX A;  3MXZ A;  3FHN A;  1Q6H A;  2PV3 A;  2C5K T;  3RME A;  1XNQ T;  2VL8 A;  4EZ4 A;  2VB6 A;  3O5E A;  4ZZB A;  4LMJ A;  1LJY A;  4EED A;  2PBC A;  4MBQ A;  2UXB T;  4YJ3 E;  5L2L A;  2MNT A;  2XQ9 A;  1U4Q A;  3ZC1 A;  1E6P A;  4LGX A;  1OED A;  3KZ7 A;  5JDM A;  4YSY A;  3K8P C;  3EI0 A;  5FVL A;  4YTN A;  2XQ7 A;  3FZK B;  3CHE A;  5D75 A;  2QVA A;  3PUQ A;  2B5U B;  2P4V A;  3K3O A;  2CBJ A;  1LG1 A;  3ZMT B;  3CHD A;  1FKH A;  2Q5A A;  1Y01 A;  3ZCI A;  4O4J E;  3ZYM A;  1QUU A;  3JCF A;  4EYY R;  3O5P A;  3O5K A;  2BBJ A;  4PJL A;  3QB5 K;  1ZCN A;  3P4Q A;  3WQW A;  3KAG A;  4TNS A;  3I0Q A;  1W9U A;  4DV4 T;  1W0A A;  5AQG B;  5AQJ B;  2A9U A;  2VN1 A;  4H9Q C;  1G73 A;  2QGS A;  4OK0 A;  4W9P A;  3AEB A;  2DG4 A;  3B9A A;  4B3M T;  5HT1 A;  2E8I A;  2V6Y A;  4WNK A;  1ZB5 A;  4JFL A;  5CGM A;  2BZB A;  1T11 A;  2K9A A;  2RPA A;  5GPR A;  4KMC A;  4JI7 T;  4P8W A;  3HKB E;  5HYA A;  2ZQT A;  1OED C;  4ITZ A;  2SPC A;  3G6L A;  4W5U A;  3AEC A;  1EYM A;  3L09 A;  5KDM C;  2M2A A;  3PUZ F;  5HXE A;  3O5M A;  4ZS2 A;  3CHC A;  4PAG A;  3N2K E;  1O6I A;  1Q1C A;  2K3W A;  5L3E B;  4ZS3 A;  4DV2 T;  2KWI B;  3OYZ A;  5DQW A;  1I6Z A;  3N9N A;  1KT0 A;  5HTG A;  3CVR A;  3CWZ B;  5EZY E;  3O5O A;  1NWR A;  5HXS A;  3ONX A;  3T1Y T;  2LSI A;  4UR9 A;  2LRL A;  5JTG A;  4LF4 T;  3TLW A;  1OED B;  3NTP A;  2DLR A;  4U3C A;  4HKA A;  3PUS A;  2J1D G;  3QOF A;  4PK4 A;  2JRK A;  5HWY A;  5LYJ E;  4MFR A;  3RRW A;  3NVO A;  2XQ8 A;  2VL0 A;  3ZMU B;  2XAS B;  1ZBK A;  5FY1 A;  2KLQ A;  3LDQ B;  3RF1 A;  3UUM A;  5C2T A;  5HBF A;  2QYW A;  1IJ5 A;  3PUA A;  3PE0 A;  4U7I A;  4PJJ A;  3AE7 A;  1MIW A;  4JI0 T;  2PV2 A;  4WJX A;  1D1C A;  3UI5 A;  5AQL B;  3HKC E;  1K9T A;  2DSU A;  4AXP A;  1E6Z A;  3FXE B;  3RYC E;  4CI3 B;  2K8I A;  4J4O A;  2WDQ A;  3EAB A;  1YQ4 A;  2BKO A;  5HW6 A;  2PG8 A;  1WLX A;  3NZP A;  1LL4 A;  4FAP A;  2WK2 A;  2LJL A;  3F31 A;  3UQ7 A;  2FKE A;  2IUZ A;  1QSD A;  5AQS B;  2FJA A;  1QPL A;  2V6Y B;  4GIW A;  5HEG A;  2ZQV A;  3C4X A;  3I9W A;  3RKG A;  3I0O A;  2BKN A;  4Z90 A;  3C4W A;  3UI4 A;  1ZHC A;  4U2Y A;  4AKI A;  4ZI7 E;  1C9H A;  3ONJ A;  3AE6 A;  2DWK A;  4GK5 E;  1Y0O A;  4UEM A;  2PI6 A;  3IHZ A;  1LL6 A;  5ABG A;  4TUY E;  4PK6 A;  1D6O A;  3O5J A;  1D0Y A;  2UXD T;  5B8I C;  4FJO A;  3UU3 A;  4DVD A;  4GGQ A;  2M67 A;  2Q9Q A;  2LOS A;  1UCU A;  4YLH A;  4DRP A;  4ILA A;  3QB5 A;  3N2G E;  4FI5 A;  4U74 A;  1FKF A;  2IIU A;  3P4S A;  3LJC A;  2DSW A;  2LJ4 A;  2XQ5 A;  4U7Y A;  2VKD A;  3ZPO A;  1KNR A;  3H9R B;  2AXD S;  3G6M A;  2WDR A;  3AVS A;  5AQQ B;  1XDP A;  4F8H A;  4DR6 T;  5LHH B;  2Q9Q D;  3O1H A;  3Q5D A;  2DNX A;  1NSG A;  4UVA B;  4TW7 A;  3ZYL A;  5JDH A;  3CIR A;  3KDS E;  1LG2 A;  3ANW A;  3RGL A;  4TZ4 C;  1KFW A;  4DZ2 A;  1A7X A;  1MMD A;  5CFB A;  1MND A;  1M62 A;  2O92 A;  2F2D A;  2VAS A;  2DT1 A;  5GPG A;  4BAY B;  3UUX B;  1MIY A;  3ESL A;  4AQF A;  4CXY A;  5HEU A;  3P4W A;  1E2A A;  4MNJ A;  5AFU L;  5C3J A;  2V5C A;  4AKR B;  2IF4 A;  4QX8 B;  2Y78 A;  2X68 A;  2LT3 A;  4YHH T;  3PU3 A;  2XSB A;  2Q9Q C;  4ILC A;  4PFO A;  2L8K A;  2LEH A;  2LM9 A;  3LBX B;  5FNV E;  4O2T A;  3B5M A;  4DZ3 A;  4O2B E;  5LG4 A;  2VUR A;  4CN6 A;  1NWM X;  1ROU A;  3O5Q A;  2VVN A;  2W67 A;  3E22 E;  3AEA A;  3SFD A;  3MK7 C;  2L9Q A;  2VQE T;  2WQY A;  1KT1 A;  2ZM6 T;  4TW8 A;  2H3R A;  1Q6I A;  3AS2 A;  4H9R C;  3P7I A;  2ITK A;  4MNK A;  5EK2 A;  3RX6 A;  1B6C A;  2Q9Q B;  2WMO A;  1N36 T;  3V5S A;  2UXX B;  4P09 A;  2JPF A;  4AKL A;  4L3N A;  5AQK B;  5L4E A;  1N33 T;  1X79 A;  5FVK A;  3IA3 A;  2K24 A;  4ZPT R;  4WBO A;  2X0H A;  4WBN E;  4HEA A;  2KWH A;  2A2F X;  3J9X 1;  1FKI A;  4UVC B;  1WR6 A;  2E5L T;  3T8O A;  1D0X A;  4ISS A;  4HFV A;  2XAG B;  3PRB A;  1QLB A;  3NKZ A;  3ANW B;  4QXC B;  5LA6 E;  2CPT A;  5AQV B;  3KAC A;  3SWH A;  4IQ2 A;  2F4V T;  1E9L A;  4Q22 A;  4CZZ B;  2RSE A;  4ODR A;  3L3P A;  1US7 B;  3V5U A;  4KUM B;  2ZQS A;  1KK7 A;  2VWA A;  2CWY A;  2R6G F;  3RYF E;  2CXD A;  3UQI A;  2KXP B;  5AQP B;  4DR3 T;  3RIU C;  3VHL A;  2K48 A;  4PW8 A;  3U78 A;  1W9P A;  1AJ3 A;  2XUE A;  4EYU A;  4MNM A;  1VCS A;  3NRY A;  2BS4 A;  4JBW F;  2D2S A;  3B9D A;  4MGV A;  4DIP A;  3UFE A;  4OHF A;  5KXJ A;  4AY1 A;  3BQI A;  2JIW A;  4OX9 T;  4XAK A;  1BR1 A;  3HL6 A;  1IZN B;  4HFB A;  2DSV A;  2NR4 A;  3EDU A;  2LE8 A;  4E7Z A;  2X0Y A;  4IST A;  2A3C A;  3IBP A;  3IEE A;  5BMV E;  1FKL A;  2CBI A;  3ZT6 A;  1FMV A;  4JI5 T;  3PUR A;  3AS1 A;  1U79 A;  1U5P A;  5LJN A;  5CA1 E;  1ZBW A;  3D0T A;  2IHR 1;  2MYS A;  1H0I A;  1VCT A;  4Z2G A;  3SS1 A;  1GRJ A;  2KIN B;  1CUN A;  2E9X A;  3OOB A;  2F23 A;  3LK4 2;  4Q25 A;  4YFS A;  1KF6 A;  2AE9 A;  4WKA A;  1IBK T;  5DIU A;  3O5G A;  1T8B A;  1CTN A;  2B76 A;  1IBL T;  2WZH A;  3AE3 A;  2G8Z A;  1WR0 A;  4A56 A;  2BBH A;  4IT6 A;  3PJA J;  1YKE B;  2W66 A;  5AQN B;  2W4X A;  1T72 A;  3N2O A;  5HW7 A;  1HTJ F;  2YEV C;  1NMW A;  3K3N A;  3GN5 A;  4QT2 A;  5DAB A;  2CLY C;  5FXX A;  1VRB A;  3KAI A;  4ODN A;  3KFW X;  1SYT A;  5JDF A;  3IHR A;  3CPZ A;  1FKK A;  4MNL A;  2XP9 A;  2QRX A;  3UU8 A;  4DR2 T;  3NWI A;  1WCR A;  4A5X A;  3UUL A;  2CLY B;  3RIA A;  4MAL A;  2X66 A;  2JQH A;  1IX5 A;  3RIF A;  4IHJ E;  2WWV A;  1W09 A;  2XP7 A;  4DRK A;  2XQY A;  1JNT A;  3OVU A;  3CZ8 A;  4KHZ F;  1FIO A;  1HJW A;  2A72 A;  4EIW A;  2E9X C;  3HI2 A;  1YW5 A;  3FXY A;  2X0L B;  4CXW A;  3C50 A;  2WBL A;  4WKH A;  4IE4 A;  1GUV A;  1ZK6 A;  3CQC B;  4I55 E;  1FFQ A;  3C51 A;  3OTO T;  2M08 A;  1IBM T;  4UF0 A;  2IW5 B;  2XAH B;  5JDG A;  1FKB A;  3H37 A;  5LP6 E;  5FXZ A;  2CM0 A;  3CQG B;  2I6H A;  4CI2 B;  2E9X B;  3S4U A;  2EHO A;  1WNO A;  2BKP A;  1UUR A;  1HFA A;  2H89 A;  4DRJ A;  5EK3 A;  2LHR A;  5IYZ E;  3RPU A;  1NWS A;  3O4X E;  3N9P A;  3ZT5 A;  4QXB B;  2JQQ A;  3AAA B;  4C91 A;  3SFE A;  5KX5 E;  4NXM T;  1Z0P A;  5DF0 A;  3WD1 A;  3KAB A;  2RA1 A;  1ZKE A;  3GN5 B;  3SOL A;  2M1I A;  2EHO D;  3CX6 B;  2KGJ A;  3GU0 A;  2LKH A; 
#chains in the Genus database with same CATH homology
 1ROT A;  2MLZ A;  2F21 A;  3AS0 A;  1GOI A;  2PV2 A;  4WJX A;  1OGB A;  1QZ2 A;  3ALG A;  5HWB A;  4MPK A;  3ZST A;  3RM4 A;  3UI5 A;  3WL1 A;  3WQV A;  4TYO A;  3RM9 A;  4DRM A;  1K9T A;  2DSU A;  4HAR A;  1EIB A;  4ODP A;  2XP3 A;  1E6Z A;  1ZU8 A;  4ZS6 A;  4TW6 A;  5HUA A;  4JFM A;  4C02 B;  2K8I A;  4J4O A;  3K1S A;  4WKF A;  1FJD A;  3EAB A;  3ZT7 A;  1D7J A;  5HW6 A;  2XZE A;  2MPK A;  5JH8 A;  1LL4 A;  1F8A B;  3OA5 A;  4FAP A;  1HKJ A;  2WK2 A;  3KAF A;  4DRO A;  4ZEY A;  1F40 A;  3GPK A;  1E15 A;  3AS3 A;  2FKE A;  4GIV A;  2IUZ A;  2AWG A;  3JXV A;  1E6R A;  3EY6 A;  2RQS A;  3UI6 A;  4DRH A;  4MTV A;  1QPL A;  2V6Y B;  2JQK A;  3PRA A;  2OFN A;  5HKG A;  2ZQV A;  3QOK A;  5I98 A;  4WZX A;  3UI4 A;  4U2Y A;  1C9H A;  4FN2 A;  1J4H A;  1XHG A;  2L2S A;  1JNE A;  3WKZ A;  1Y0O A;  2XP5 A;  2ZQU A;  3UF8 A;  3ARZ A;  2PI6 A;  4U31 A;  3KCE A;  3JYM A;  4DWS A;  3IHZ A;  1LL6 A;  2F4E A;  1YXR A;  1ZL1 A;  2KR7 A;  1YAT A;  1D6O A;  3O5J A;  1OWQ A;  5B8I C;  4GGQ A;  1OGG A;  4DRP A;  1X6L A;  1FD9 A;  1FKF A;  2DSW A;  2DT2 A;  2LJ4 A;  1UR9 A;  4R5E A;  3KAH A;  4U7Y A;  2DSZ A;  5DEZ A;  2PPN A;  3H9R B;  3G6M A;  2FDM A;  4ODL A;  3O5F A;  2KE0 A;  2XP4 A;  1W9V A;  2XP6 A;  4NZC A;  3AQU A;  1E6N A;  1NSG A;  3WD3 A;  1WAW A;  3ART A;  4G2P A;  3IK8 A;  3UQB A;  4TW7 A;  4U84 A;  1HKK A;  1LG2 A;  3KAD A;  2ZR4 A;  1KFW A;  4DZ2 A;  3CGN A;  1A7X A;  1W1T A;  2MF9 A;  2O92 A;  1HKM A;  2F2D A;  4DRN A;  2DT1 A;  5GPG A;  2MLY A;  3FAP A;  3VAW A;  3ARQ A;  2N87 A;  2ZR5 A;  4WK9 A;  4MNJ A;  4DWS C;  1QPF A;  2ESC A;  2IF4 A;  2YBT A;  4JYS A;  2WLY A;  2Y78 A;  3TDB A;  4KR0 B;  1JVW A;  5BXJ A;  2OLH A;  3WIJ A;  3O5R A;  4O2T A;  4J4N A;  3IKG A;  4DZ3 A;  3ALF A;  5HWC A;  4CN6 A;  4DT4 A;  1ROU A;  1R9H A;  2LGO A;  3O5Q A;  3WD2 A;  5J6E A;  3NI6 A;  1JNS A;  3CHF A;  3JYJ A;  1KT1 A;  4U86 A;  4TW8 A;  2MPH A;  4DWS B;  1Q6I A;  3AS2 A;  1HJV A;  2ITK A;  4IQC A;  5LB7 B;  2AOS A;  4MNK A;  1B6C A;  3TC5 A;  4ODM A;  4JFK A;  5DIV A;  1D7H A;  1FKT A;  4NIQ A;  4URI A;  2V6X A;  4L3N A;  5FVK A;  4U33 A;  2YBU A;  3WL0 A;  1HJX A;  4DRQ A;  4ZPT R;  1JND A;  4LAX A;  2WM0 A;  3WH0 A;  4CN1 A;  1PIN A;  3LUO A;  2B31 A;  3PRD A;  5CJ5 A;  1FKI A;  2CRB A;  1FKS A;  1WFD A;  1LQ0 A;  5DO2 A;  1FKR A;  4MAV A;  1HKI A;  3B7X A;  4P8U A;  2LRK A;  4U2Z A;  4HBE A;  1M5Y A;  1J6Y A;  3RGC A;  4P1N A;  1GPF A;  4W9Q A;  1FAP A;  1NH6 A;  1L1P A;  1Q6U A;  4L72 B;  4ML4 A;  2PPP A;  3PRB A;  2DG3 A;  3O5L A;  2LPV A;  2RUR A;  3TCZ A;  2XPB A;  2CPT A;  2KO7 A;  3KAC A;  1ZBC A;  4IQ2 A;  4CN4 A;  1E9L A;  2QF8 A;  4Q22 A;  4QIB A;  2JQ9 A;  1FFR A;  1TCO C;  4ODR A;  2RSE A;  4DH0 A;  4DWS D;  3ARY A;  2ZQS A;  1NWT A;  3ARW A;  3B8S A;  4HBO A;  4QT3 A;  3UQI A;  4NNR A;  3CH9 A;  1W9P A;  2DG9 A;  2DT0 A;  3RFW A;  4MNM A;  3MDY B;  1W1V A;  2KFW A;  3UQA A;  4P8X A;  1J4R A;  3B9D A;  4JFJ A;  4MGV A;  4DIP A;  2PPO A;  4KQZ A;  4MSP A;  1J4I A;  1FKG A;  3NRK A;  5GQB A;  4AY1 A;  1WB0 A;  2WY2 A;  1VF8 A;  4XAK A;  2WLZ A;  3ARU A;  1EDQ A;  2DPE A;  2A3E A;  2DSV A;  1NWU A;  2A3C A;  3ARO A;  1FKL A;  4TX0 A;  2KI3 A;  3ZT6 A;  1UR8 A;  2JZV A;  2RUQ A;  3O5I A;  3AS1 A;  3ARX A;  1H0G A;  1U79 A;  3PA7 A;  1ZBV A;  4JFI A;  1Q6H A;  1TFV A;  1ZBW A;  1FKD A;  3B9E A;  2PV3 A;  1H0I A;  4ODK A;  3CGM A;  3RME A;  4Z2G A;  1NMV A;  1D2K A;  4S3K A;  3WD0 A;  3I6C A;  3O5E A;  3OOB A;  1LJY A;  2PBC A;  4R0X A;  4ODQ A;  2MNT A;  4WKA A;  2G41 A;  5DIU A;  3O5G A;  1E6P A;  4LGX A;  1CTN A;  3WD4 A;  1EQ3 A;  3KZ7 A;  2G8Z A;  2LKN A;  1WR0 A;  5DIT A;  1W26 A;  3IKD A;  4IT6 A;  3O5D A;  5FVL A;  4Z2J A;  3PR9 A;  5HW7 A;  3CHE A;  5D75 A;  1W1P A;  3ARV A;  3ARR A;  2DL1 A;  1NMW A;  2XPA A;  4QT2 A;  3W4R A;  2W2U A;  1EHN A;  1LG1 A;  3ARP A;  3CHD A;  1PBK A;  1N1A A;  4Q7N A;  3KAI A;  4ODN A;  3ZSS A;  1FKH A;  3ARS A;  1SYT A;  2Q5A A;  2UZ5 A;  1XRV A;  1ITX A;  1LL7 A;  1D7I A;  1FKK A;  3O5P A;  3O5K A;  4MNL A;  4Z2L A;  2XP9 A;  1SR0 A;  4BF8 A;  1ZCN A;  1WCR A;  3ODK A;  4A5X A;  2VCD A;  3KAG A;  1P5Q A;  4NSB A;  4TNS A;  3WQW A;  2JQH A;  1IX5 A;  1W9U A;  2D9F A;  2WWV A;  2XP7 A;  4DRK A;  1JNT A;  3CZ8 A;  2A9U A;  2VN1 A;  4G50 A;  2DT3 A;  4WIW A;  1HJW A;  4W9P A;  4PTM A;  4ZPW R;  2DG4 A;  1FKJ A;  3B9A A;  1YW5 A;  4Z2H A;  1HXV A;  3FXY A;  2V6Y A;  5HT1 A;  1ZB5 A;  2O9O A;  4JFL A;  5CGM A;  2ZR6 A;  1RD6 A;  1T11 A;  4WKH A;  1BKF A;  1GUV A;  1ZK6 A;  2RPA A;  5GPR A;  4P8W A;  4LAW A;  2ZQT A;  4ITZ A;  1X6N A;  1FFQ A;  4QZV B;  2M08 A;  2FAP A;  3G6L A;  4W5U A;  1EYM A;  2M2A A;  3RM8 A;  1FKB A;  3O5M A;  3CHC A;  1O6I A;  1Q1C A;  2K3W A;  4LAV A;  2RUC A;  1WNO A;  1KT0 A;  5HTG A;  1W1Y A;  3O5O A;  1NWR A;  4Z2K A;  3FY1 A;  4DRJ A;  4LAY A;  2LRL A;  3NTP A;  1NWS A;  4U3C A;  2MLX A;  3ZT5 A;  2XP8 A;  4W9O A;  4Z2I A;  2A3A A;  4ODO A;  1BL4 A;  4P8V A;  4DRI A;  4IPX A;  1ZBK A;  5DF0 A;  3WD1 A;  3KAB A;  5HBF A;  4IT4 A;  2RUD A;  3BXW A;  5HW8 A;  2M1I A;  4U85 A;  4ZPV R;  2PV1 A;  4S3J A;  4N19 A;  4U7I A;  2A3B A;  2KGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...