4IT4A

Crystal structure of residues 1-211 of cg17282
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
207
Chain Sequence
DWYVGTEWEDKNRGLAKKVIGLQFTEMDKPTIISTVEFSVNKKATNLGGRPSKYLVSDTYPQKHSLEMGTSLTAVDCYLELLLQQFVPGETAACSITTKTGERIEFELKLEKIVKNTQVEKLSAAEIYEVALRLKESGVATFKTFPKFAFDYFVRAAKLLITYKPFDKLTKKTNGINGQAVEELFIQIQTNLAACLLQEKRYEHVIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG17282
publication title Noncanonical FK506-Binding Protein BDBT Binds DBT to Enhance Its Circadian Function and Forms Foci at Night.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Unknown function
total genus 59
structure length 207
sequence length 210
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18023 FKBP_N_2 BDBT FKBP like N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4it4A02
3.10.50.60 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4it4A01
4IT4A 2JQKA 5CGMA 5CJ5A 4U7IA 4U7YA 2JQHA 2LRLA 2V6YA 2V6XA 4CN1A 1WFDA 4ZEYA 2WWVA 4CN4A 1WR0A 2JQ9A 2K3WA 2WY2A 4U3CA 2DL1A 2MPKA 4U2YA 1YXRA 5FVLA 4CN6A 4U33A 1WCRA 5LB7B 3EABA 3ZT6A 4U31A 2CRBA 2XZEA 3ZSTA 3K1SA 2A9UA 2LRKA 2CPTA 2V6YB 4P1NA 4A5XA 4U2ZA 3ZSSA 2RPAA 4WZXA 4NIQA 4IT6A 2W2UA 5FVKA 3ZT5A 3ZT7A
chains in the Genus database with same CATH superfamily
3UU3A 3CK6A 4KHPT 2HH7A 1X6LA 2XQ3A 4B6XA 2CHOA 4JEUB 4AKRB 4UVAB 4AKGA 2CCQA 1MIYA 1FEWA 2XQ6A 3GU0A 3O5EA 2W63A 4YJ3E 3ZSTA 5C2TA 1FIOA 2D0TA 2EHOA 3C51A 3RRWA 5L3CB 1WAWA 3UU4A 3FZKB 2WCAA 3TLVA 2YBTA 3PJAJ 3ZC0A 1CHUA 4P8UA 2ZR6A 1U79A 5LG4A 3O5RA 3AA1B 2WDVA 4LF8T 1Q6HA 3IKGA 3P4SA 4NNRA 4HARA 2LPVA 2W66A 4IE6A 1I6ZA 1JVWA 4DMWA 2WK2A 3PE0A 1JNZA 4HBOA 3O5DA 2LJLA 5FXVA 4KHZF 3LK2B 2WLZA 4DVDA 2LKGA 2WM9A 3P4RA 1FFRA 3GTYX 2DT2A 4MHCA 3HR0A 1IBLT 1FAPA 2VWAA 1B6CA 2BS3A 1J5WA 3UF8A 4QZVB 1ZBKA 4YLHA 4W5UA 2HPLA 2UU9T 3ZJ1A 4LFCT 4ZS6A 2ZR5A 1XZYA 1WR0A 3CX7B 2LT3A 4LAYA 3IBPA 2JMHA 5FY7A 2A3EA 1LRZA 1HFAA 4ZS2A 4ODQA 4JYSA 4IDOA 4A97A 2XPAA 4KP3C 3QK6A 2NWBA 4O4LE 4WBOA 2Q9QB 4GGQA 3BQIA 4DWSA 4DR4T 4HFDA 5FKYA 2J4GA 4OHFA 4DRNA 4R5EA 2C5JA 2KZ7B 4DZ3A 5GPGA 3AS1A 2FAPA 1BR1A 1FKRA 2JQQA 2E9XD 3IA3A 1MMAA 3UU6A 2R6GF 3ZSSA 4EAHA 4W9QA 4O2TA 3GN5B 2OLTA 3FZHB 1YQ3A 4LMJA 2I59A 3HKBE 2XAGB 4CQIA 1ZB5A 3UI4A 4ODKA 4EEDA 4QT3A 5CB4E 2E8IA 3VR8A 4GIWA 2LSYA 4YTPA 3FZLB 4JEHB 4V1Av 1T11A 2L8KA 3TLWA 2JQKA 4HWHA 3PUQA 5HW7A 5C3JA 5FY1A 2BKPA 2I0MA 3ZEFB 3UI5A 2EHOD 4PAGA 4AKHA 5J6EA 4YT0A 3FY1A 3HA4A 3QOFA 3ANWB 4TNSA 2KINB 3M65A 2D9FA 1N1AA 3RH3A 5L2LA 4EOZB 3Q5EA 2X9WA 2A3DA 2CHNA 2LM9A 2WWVA 2GK9A 3X1DA 3O1IA 4HFCA 1WCRA 1ZP0A 5LNKA 4X1YE 4DWSB 2LHRA 5HCMA 3ARQA 4ZZBA 5HWBA 2BS2A 2F2DA 1IJ5A 4LF6T 5LBMA 3OJAA 4MBQA 5JR9B 2XM1A 2A72A 4X20E 3N9OA 4ODMA 5HXSA 1FFQA 2PFVA 2XY8B 4URIA 2X0HA 3AB3B 5JDQA 3A5XA 2BVLA 2MPKA 1D7IA 5HXEA 2XM2A 1EHNA 5DIUA 2VCDA 4LF9T 1FKLA 1LL7A 5FXWA 5IWAT 4P09A 1S35A 2MAWA 3ZMZB 3AQUA 1HKKA 5JDHA 1XNRT 1LL4A 1CUNA 3C98B 5JVDE 1Q6UA 3WD4A 1ZL1A 2BKOA 3L39A 4HWCA 2CMRA 4I0UA 4DWSD 5AQJB 4B3MT 2JMKA 3CWZB 4IL9A 5AQVB 2W00A 1X79A 4F8HA 2YU2A 2MOZA 4DV4T 4HFEA 4QXHB 5L3EB 3KABA 4U31A 4LAXA 1W0BA 3CHCA 3OTOT 2YINA 1TFVA 3K3QC 2N87A 2PI6A 5FXXA 1JCHB 3CKDA 4O2BE 1H0GA 2AE9A 2WLYA 3CHFA 4EXTA 4X1IE 5CA0E 4UVCB 2LSJA 2G0UA 3DTOA 3ABVA 4TWDA 5LGUB 4Z90A 2KFWA 2YBUA 4JI4T 3B5MA 3KBUA 1ZOYA 1SYTA 4WIWA 4DR6T 2V6XA 5C8YE 2KMFA 4U86A 2MLXA 1IBMT 4JI1T 2D5UA 4LGXA 1OEDA 1UX5A 2B76A 2JPFA 1W9VA 4MAVA 1YKHB 5H6QB 3UQAA 4TNVA 1ZBWA 3KADA 2J1DG 2YKSA 4HKAA 1MMDA 2D2SA 4CXXA 4LFBT 3IHRA 5HBFA 4WKFA 5LHHB 4NIQA 5AQUB 1YW0A 2ZM0A 5J2UE 3A8YC 4IE4A 1JNEA 2DSWA 4AIUA 3N9NA 4ILUA 3UU5A 3JYMA 1FKGA 5DQWA 2MLZA 2BDEA 1ZBVA 5F5WA 1JNDA 1WLXA 2ZM6T 3SFEA 4M1PA 3NI6A 4NSBA 4QT2A 3O5IA 3O5FA 4OX9T 3QUJA 3GWHA 1FKFA 1UX4A 4YJ2E 4DUYT 4YHJA 2CXDA 3CGMA 2FBWA 2X9HA 2YDSA 3FXDB 3N9MA 5AQKB 2LRLA 5LMNT 4QHOA 3KVAA 4HFHA 1D7JA 3RI5A 3T1YT 4DBQA 1D6OA 3ARPA 3DP7A 3KINB 1M62A 5L3GB 5J0ZA 4DR1T 3KFWX 3RHWA 4J2CA 4L3NA 1HX1B 4AQFA 1E2AA 4HBEA 3EIPA 4QXCB 3AE1A 4ANJA 2XQ8A 3CQCB 1KFYA 4P8WA 2H3RA 2M6IA 3ZMVB 4TWHA 4IQCA 3RRCA 1XDOA 3BQKA 2IC9A 4DUZT 3AEFA 2PPPA 3TLSA 1HNXT 1KT1A 5KXJA 4JFKA 2DNXA 4DMVA 1OEDE 1OEDB 4DT4A 2ZQTA 1D0XA 3B7XA 3ZCIA 3FXYA 2IC6A 3UQ7A 1GQEA 4BJMA 1FKHA 2E5VA 1WYCA 2UUBT 3ARSA 2WAUA 5DIVA 3C64A 1QLBA 4EZ4A 2XP5A 2IUBA 1H7CA 4WYVA 3AAIA 2XP4A 1YKEB 2CXFA 2QF8A 4ZPTR 3FXEB 5LCYA 3KV6A 4YFSA 2CLYB 1KNZA 4ZPVR 2BS4A 4UEMA 2WDQA 2WZIA 1BR2A 5HTGA 4LFAT 4IPXA 3CH9A 2L3LA 5HWXA 4DR3T 1T8BA 2JRKA 4CXWA 2H7OA 3AECA 4LF5T 1BR4A 4I50E 4DRKA 3W4RA 4ZZCA 1ZBCA 3CVRA 3VRAA 3ARVA 4LAVA 5KDMC 4H9OC 5BR8T 3O5PA 2X0YA 3RF1A 4R0XA 4WK9A 4PK5A 2AOSA 3ZCJA 3KACA 2JJ9A 2LSGA 4H63H 5IUXA 4LAWA 4HTEA 4ODLA 3VAWA 3OBVE 3BMBA 5JQGE 3UFGA 2LLYA 5JRCA 4ODOA 1Z0PA 5L3DB 3Q5DA 3EI0A 4CI3B 2BBJA 4WZXA 5ETWA 2LOPA 1FKIA 3VKHA 2ACXA 5LGNB 1E1HB 2LHNA 2KLQA 4PJJA 2VKJA 5FVLA 3EY6A 5AQQB 4DRHA 4TNWA 1JNSA 1HKIA 4W9PA 3ZMTB 3PUVF 4U74A 3K3OA 3LBXA 3U78A 5JH8A 3AEAA 4DRJA 1C9HA 4X65T 2CEAA 3BQLA 3ZJ2A 2OLHA 4LMKA 2VASA 1XHGA 1NWTA 2C0SA 3O5MA 2YOEA 2DSZA 4ZPWR 2DL1A 4JI2T 5AQHB 2LSIA 1FMWA 2A2FX 2PTFA 3C4ZA 1WYBA 1OWAA 3QOKA 4E7ZA 4H9RC 3PDYA 2MLYA 2UXNB 4NUUA 5CFBA 3UUBA 2NTYA 3PUZF 4YTMA 1N33T 1A7XA 1HJVA 3B9EA 4UELA 4AKIA 4NUVA 3CQXC 5JREA 3O5OA 3ARUA 4OK0A 4EB6E 3B57A 1J4HA 5AQGB 2OFNA 3KAIA 3NZPA 4X1KE 2LGOA 1Y64B 4J4NA 2KI3A 2Z6EA 3RIAA 3ARRA 1JNTA 1ZK6A 4TN7B 5D75A 5DEZA 4O2AE 3ETVA 1J4IA 4JFLA 4DRPA 3EAMA 3Q9DA 4Z2JA 3MKDA 5EK4A 1EYMA 2CRBA 1XDPA 1E15A 1J1JA 1UUSA 3AE9A 3KV9A 4HE8A 3CZ8A 2RPAA 2DSVA 3H37A 4NZCA 2DCFA 4B3ST 4ZXLA 1SUMB 1W1VA 4WKAA 5EK3A 2DHRA 4DO0A 4B3TT 2H89A 4DV5T 3VRBA 5IYZE 3S4UA 4H9PC 2Y6XA 2E9XB 2CM0A 1HX8A 5GPRA 3AA6B 3V5UA 3OKQA 3NRKA 1IBKT 2RP4A 2VK9A 3JCFA 2WY2A 2K48A 3AE4A 3R84B 2M08A 3PU8A 4GKKT 2DI4A 2FDMA 4PK4A 1W09A 1EQ3A 3V5SA 2LEHA 4DV2T 5F3JA 1O6IA 4GOUA 2W0GA 4JI7T 4H9QC 2JQ9A 3ZN1B 5BMVE 2EHOB 4JFJA 4IGUA 2DG9A 3KAGA 3FHNA 2WM0A 3ZYLA 4YSYA 2A9UA 4X5TA 3AS3A 3T1HT 4Z91A 1KEYA 2G8ZA 5AFUL 2PPNA 3E08A 3MACA 3PUAA 2NW8A 5CA1E 1X9BA 2WS3A 1D2KA 3SS1A 5FP3A 4U3CA 5DABA 4IE5A 5LGTB 3JC6C 4WNKA 2PV2A 2KNDA 4MNJA 5F8PA 1PINA 4A56A 1LVKA 2QRXA 1HR0T 3RC3A 2VQET 1R9HA 2DWGA 2PBCA 4IDQA 4ZOLE 2WZHA 2ODVA 2ZMAA 3B9AA 2PV3A 4MNMA 3AE3A 1NWMX 2CBIA 3ODKA 2YDRA 4ADZA 4I55E 5AQPB 1KFWA 2WBLA 2V1DB 4TW8A 3AAAB 4KMCA 1MNDA 1ZHCA 1YQ4A 1LL6A 1BR0A 4TX0A 5AQFB 1HJXA 2K8IA 2XSAA 4U7YA 3NKZA 2M67A 2RSEA 1G73A 2V7MA 1YD8G 3VHLA 1IZNB 5ABEA 4ILBA 4DR5T 3UT5E 3N2GE 1NMWA 3JAEA 3PJAA 2WMNA 2X66A 1ZV4X 2KSRA 2W2UA 1M7KA 4MTVA 2C5KT 2XP8A 1FKKA 4JFMA 3H3AA 4HWDA 2MPHA 2XP9A 4AI6A 4LMLA 4IDPA 4Z2HA 4JI3T 2CLYC 1T98A 1FD9A 4O8SA 2Y48B 2XAJB 2IW5B 4HWFA 4BA9A 4PJNA 3R6NA 4EZHA 4O4JE 1VOMA 3C4XA 1L0VA 1US7B 4P0BA 4HN9A 2VKHA 3UUMA 4YTNA 3LK3B 1Y01A 4BAYB 2PG8A 2QVAA 4DNDA 3WD3A 1SHZC 2VKDA 1W9RA 4P8XA 2V5DA 4G63A 4TW6A 2M6BA 4CN6A 3MZKB 1KT0A 5KX5E 3PRAA 2W4XA 3IEEA 1HG2A 4COFA 5HCJA 4MNKA 2Q5AA 3F2EA 4JUYA 2LKHA 3ZYKA 4QX7B 5J2TE 3RYCE 4CZZB 3KCEA 5HYAA 2J62A 4J4OA 3RM9A 1SA0E 3CX8B 2IDOB 2VKOA 3HL6A 1X6NA 4DH0A 5L3BB 1TCOC 3UQBA 4PFOA 4TV9E 1UK5A 1W0AA 3AA7B 2V6YA 2XP3A 2XP6A 4ASKA 4HFBA 3RQWA 3N9LA 2YU1A 1J5ET 2UXXB 2RUDA 2RQSA 4HGAA 4NPPA 4IDZA 2UUAT 5BXJA 3NZQA 1N36T 4ZI7E 2CXLA 1EIBA 2O92A 5ABGA 4HFIA 5HEGA 4DIDB 4NXMT 4ODNA 2BG9C 2RURA 2JQHA 1WFDA 2L9QA 4JFIA 3AE2A 3ZC1A 2IIUA 2ZQUA 2MYSA 3GA8A 2A3CA 2XSBA 1W1PA 1D7HA 3Q5WA 4DR7T 5LG3A 1W9UA 2AXDS 4I4TE 4ISSA 2N1GA 4KI0F 2A3BA 4MPKA 3AEGA 3N9QA 4MLKA 4FJOA 1E6PA 3B9DA 2RUCA 1HJWA 2FKEA 2VB6A 3N9PA 1H0IA 2B1EA 1L1PA 1LG1A 4IIJE 4IREA 2CA5A 3RQUA 3ONLC 2XQYA 4JI8T 4IDNA 1KK7A 1E6ZA 1UR9A 4E7SA 5FXZA 5JH7E 2JIWA 2D0UA 5ABFA 4Q7NA 5FYMA 3RGCA 2K9AA 1D0ZA 4Z2KA 1Z8UA 3LJCA 2WU5A 4IQ2A 1FJDA 4PFPA 3RLFF 4HFVA 2KGJA 5JDNA 3N2KE 5AQSB 5L4EA 1XNQT 2BBHA 4JI5T 4S3KA 2BVMA 4TZ4C 5FNVE 2MF9A 4I43B 4QIBA 4TW7A 3PUYF 5HXCA 5CGMA 3LDQB 3AXJA 3ZMSB 4GK5E 1N34T 4YSZA 2C5IT 4ZS3A 3P4WA 1XMQT 2DPEA 1J4RA 4QKNA 2XQAA 4TYOA 1J6YA 3T8OA 4P0AA 3PR9A 1B7TA 3J7Yq 4P8VA 1ZEEA 1YATA 1KF6A 3NBXX 2NR4A 4EV6A 3PRBA 3I9YA 2NOXA 2VN1A 4JI6T 3I0OA 2Q9QC 4PJLA 4YSXA 1V9DA 4GIVA 1AJ3A 3F57A 4AY1A 2VL8A 2XTLA 1WB0A 1Q1CA 3H9RB 5LP6E 1RD6A 2XZEA 2LRKA 3UUXB 1NWRA 3ALGA 1UGOA 3O1JA 1QSDA 4ZHQE 3LK42 2WB5A 3KAHA 4AKLA 1ZU8A 4AXPA 3JXVA 1D1AA 1QZ2A 3VU7H 2OV9A 4K0UA 3NRYA 3NVOA 5HEJA 4TWFA 1FKBA 4OYJA 3RPUA 2B31A 3EABA 4UF0A 3M3ZB 2YDQA 3WL1A 1VCSA 2VL0A 5JDLA 2NP9A 4H63V 1LJYA 3HI2A 1F40A 2IHR1 2LE8A 4DRIA 4Q22A 1PBKA 4ILCA 1ITXA 5L4HA 3OVUA 3WQWA 3PUSA 4FN2A 5HXRA 3I0QA 5LHIB 4Z2IA 3H3MA 2V7IA 2WP9A 2UXDT 1VCTA 3E0ZA 2KWHA 3PRDA 3AA0B 5LHGB 1HNZT 3ZT5A 2E5LT 4ZEYA 1FKJA 5TAOA 2DSUA 2YN6A 3PUWF 1HKJA 2Y8DA 3ONJA 3RYFE 1EDQA 3WD1A 1E9LA 1HXVA 3EHZA 1XWMA 1BL4A 4B3RT 3K3NA 2ZQSA 4XAKA 1WR6A 2P9BA 3ARZA 4G50A 4DWSC 1O3XA 4NXNT 4PJMA 2FJEA 4DR2T 4S3JA 5JR9C 2MTQA 2M2AA 2WQYA 4PK6A 2X9XA 4CN4A 3O5JA 5FL1A 2KO7A 1W26A 1JNRA 2VVNA 4QWNB 1GRJA 4ODPA 3RMEA 2LKNA 2VQFT 1W1TA 2V5CA 4AISA 3C4WA 1GPFA 4AQYT 3EUHA 3RIUC 2RA1A 3JADA 2KT9A 4N19A 3RX6A 3MJXA 1W9PA 4X62T 4ML4A 4IL4A 3RFWA 3Q2MA 4MALA 1VRBA 4DRMA 5AQRB 2QGSA 2PBIA 4WW0A 2CPTA 1S94A 3RKOA 4A5XA 1ROTA 4KQZA 2DT0A 3SRZA 3CHEA 2ESCA 2ETNA 5AQOB 2DT3A 3CIRA 2B5UB 3AE6A 5JRCB 2IMLA 2LOSA 3P50A 2BZBA 1CTNA 2Q9QA 2OA5A 1U5PA 2WU2A 4CI2B 1QPFA 3IF8B 1Y0OA 3L09A 5DQVA 4WJXA 2D9DA 2PV1A 2PPOA 1T72A 2XPKA 3KAFA 1IJ6A 3PA7A 4KBMB 3KDSE 2W62A 3LBXB 2NW9A 2RUQA 2A3AA 3GN5A 2K5BB 5L47A 2UZ5A 4YHHT 3WD0A 3ARTA 1E7PA 4L0RA 2FJBA 3I1AA 5ADXL 5AQTB 5LJMA 3ZT7A 2KE0A 4UV8B 2LM2A 4UVBB 3MDYB 2V7KA 2MNTA 3K8PC 1VF8A 2W61A 2XJ7A 3P8CD 5LB7B 1E6RA 4H9NC 3FB2A 4EGWA 5DITA 4X66T 3ZKRA 3AS0A 4C91A 3CGNA 5HUAA 1UCUA 4OYKA 2KXPB 3PU3A 4JBWF 4PW8A 3ANWA 3RIFA 4YXDA 4U7IA 1BKFA 4DROA 5HEUA 5HT1A 3UI6A 1W1YA 3D0TA 1EZ3A 3ARXA 2XAFB 1U4QA 4ZI3C 3ARWA 1OGGA 3CPZA 2ODUA 3G6LA 3AEEA 2EULA 3WQVA 3ZT6A 2O9OA 4DBRA 2V8SV 4QX8B 1MIVA 2XUEA 4GK0E 4ZI2C 1IX5A 1I94T 4TV8E 2IF4A 4EYYR 5LYJE 2WSSV 3FAPA 5JR9A 3WAJA 1HNWT 3RKGA 4C02B 3RGLA 2CWYA 2SPCA 4MFRA 5EK2A 3KZ7A 3PURA 4ERRA 3ZN0B 4QXBB 4IE0A 5LMUT 3UUNA 3IHZA 2P4VA 1HKMA 1NMVA 3L3PA 1ZCNA 3RIUA 4Z8XA 1OXZA 4QH1A 3TLTA 3OPCA 2XASB 3WI3A 3RM4A 4UR9A 1LQ0A 2IAKA 1WRDA 4L5GA 4N78D 2ZM8A 5HEOA 4P1NA 5H6RB 5JDGA 3ZPOA 1FMVA 2Q9QD 3O1HA 3CQGB 2YK0A 1ROUA 1OEDC 4IT4A 2NW7A 3FZFB 2V7LA 3L8RA 3UQIA 3N5LA 3UU8A 1GOIA 3CMLA 3SWHA 4U2YA 3AE7A 3HKDE 4HWIB 2K24A 1YW5A 1UURA 4K0KT 4WKHA 1HTJF 1M5YA 2HPJA 4DZ2A 3G6MA 4U2ZA 4HEAA 3PV0F 4YY3T 3AS2A 5CJ5A 2I6HA 5AQIB 4G2PA 4EYUA 3SOLA 5HW8A 1ZKEA 2LJ4A 4FI5A 4EIWA 4DV1T 2V26A 3NWIA 3PTRB 5JTGA 2Y78A 2XAHB 5LOVE 4ILAA 3GMIA 2CE7A 2DT1A 3AEDA 4LF4T 2PJQA 3MXZA 2HHHT 2QYWA 2LSKA 4KR0B 4DV0T 1E44A 1FJGT 3WKZA 2H88A 3BXWA 1LG2A 4JV5T 3UFEA 2WMOA 4CXYA 2ACZA 3AVSA 5HAXA 4H9SE 4AQFC 4O4HE 3C50A 5L3FB 2X67A 3AROA 2H7VC 1SR0A 2XQ4A 3AEBA 1NEKA 1MMNA 3PUGA 2XHEB 3RC8A 5LJNA 3B8SA 4MGVA 2G41A 2XPBA 3CHDA 4MNLA 3U3IA 2FUPA 1NH6A 3QB5A 1MNEA 2ZR4A 2MBGA 4BF8A 2FJDA 4FAPA 3LFMA 5JDFA 5KMGP 2CWOA 4GYSA 2X0LB 4EEBA 4Z2LA 2L2SA 1D0YA 3EDVA 3E22E 4GYRA 5HW6A 3UTKA 1HF8A 3TKLB 4UIGA 3VKGA 1NWSA 1K9TA 3AE8A 3LUOA 1G8XA 1T7SA 3OOBA 3PUXF 4XBFB 4CI1B 1DU2A 2ES0A 1LKXA 1FKTA 3MA9A 3ONXA 2XQ9A 2W67A 4LF7T 5FMNA 1D1CA 5AQLB 3A7MA 1OGBA 5AQMB 2X51A 3EVYA 2WWUA 2FJAA 3KV4A 4ITZA 4PTMA 3IKDA 3JAFA 2DLRA 4OFZA 1NSGA 1KNPA 1MIWA 3NRXA 3QC9A 4F6RC 3ZYMA 3FBLA 3FZMB 5FVKA 2F4VT 2ZQVA 3KBTA 3ZMUB 4DIPA 1SE7A 3JYJA 2ZLYA 4DRQA 2K3WA 1OWQA 5LBQB 5DJQC 1Q6IA 4G2AA 3BK9A 4GKJT 3TLUA 2KR7A 4TX5A 2V6YB 2VVSA 5FL0A 1QUUA 3KV5A 2QA7A 2XQ7A 3P7IA 5AQNB 5HWYA 2E9XC 4X64T 3ARYA 5HEHA 5A1LA 5FY0A 3WAKA 3O9XA 5GONE 2DG3A 4QH4A 4U85A 2XAQB 3OYXA 1WNOA 3K1SA 1HS7A 3TC5A 5J1GA 4IT6A 3P4PA 2X68A 2BKNA 4ZI3D 3ALFA 1HCIA 3OYZA 4XAXB 3QNUA 4XZCA 1GUVA 4UXNB 3FBZA 1R8IA 2ZM2A 2V7JA 4ZI2D 3UULA 3NTPA 3AE5A 2UXCT 4MSPA 4DV7T 4L9IA 2EHOC 5JDMA 5LA6E 5HWCA 3P4QA 5DO2A 4JI0T 2IUZA 1LVFA 2X9YA 3DJBA 4ODRA 4KUMB 3JC6D 2NTXA 3I9WA 3SFDA 3WIJA 3ZLIA 5HXHA 2HN2A 4IE7A 4IHJE 1NENA 5ABFB 1D1BA 4Q25A 3G06A 3RYIE 1QPLA 3CX6B 5ABHA 1KNRA 2HN1A 3Q5XA 2UUCT 2DG4A 5IHYA 4Z2GA 2E2AA 4PNIA 3F31A 5B8IC 4TUYE 4W9OA 2BG9A 3RYHE 2JZVA 2N9DA 1HG5A 1E6NA 5DF0A 2KWIB 5LXTE 4U84A 4DV6T 5EZYE 3QB5K 3AXJB 3AVRA 2J47A 2CBJA 1NAFA 2ITKA 2AWGA 2F4EA 4JLEA 3HKCE 3UQ4A 1N32T 4A98A 2N2NA 3ESLA 3VR9A 2XP7A 1F8AB 2DWKA 5HKGA 3W15B 5I98A 2WDRA 3EDUA 4O4IE 4U72A 2F21A 4WBNE 3WD2A 4JYAT 3MK7C 4L72B 3LG7A 4C90A 4UDMA 3OA5A 4KX6A 4CN1A 4AQGA 3I6CA 3TDBA 3LSVA 3GPKA 1MMGA 3N2OA 3TCZA 4ISTA 2UXBT 3WH0A 1NWUA 3O4XE 3O5KA 2YEVC 3O5LA 2PN0A 1IAPA 1XMOT 5GQBA 3O5GA 2M1IA 3ETUA 1FKDA 4UF0B 2E9XA 4BJNA 3HKEE 4UV9B 4QH5A 3WL0A 3AAEB 1YXRA 3J9X1 2F23A 4U33A 2XQ5A 5E0OA 3IK8A 2VURA 5M4YA 1P5QA 1UR8A 1FKSA 3B13A 1XRVA 4DV3T 2BG9E 3KVBA 3RM8A 3O5QA 2BG9B
chains in the Genus database with same CATH topology
4DT4A 1HKMA 2ZQTA 3B7XA 3FXYA 1NMVA 1X6LA 1ZCNA 2V6YA 2XP3A 2XP6A 1FKHA 3RM4A 1LQ0A 2RUDA 2RQSA 3O5EA 3ARSA 5BXJA 5DIVA 3ZSTA 1EIBA 2XP5A 4P1NA 2O92A 2XP4A 2QF8A 4ZPTR 1ROUA 1WAWA 4IT4A 4ODNA 2RURA 2JQHA 3UQIA 2YBTA 4ZPVR 1WFDA 1GOIA 4P8UA 4JFIA 2ZR6A 1U79A 3O5RA 4U2YA 2ZQUA 1Q6HA 3IKGA 1YW5A 5HTGA 2A3CA 3CH9A 4IPXA 4WKHA 4NNRA 4HARA 1M5YA 1W1PA 4DZ2A 1D7HA 2LPVA 3G6MA 4U2ZA 4DRKA 1JVWA 1W9UA 3W4RA 1ZBCA 3ARVA 2WK2A 4LAVA 4HBOA 3O5PA 2A3BA 3O5DA 4MPKA 3AS2A 5CJ5A 4R0XA 4G2PA 1E6PA 2WLZA 5HW8A 2LJ4A 3B9DA 4WK9A 2RUCA 1HJWA 2AOSA 2FKEA 1FFRA 1H0IA 3KACA 1L1PA 2DT2A 1LG1A 4LAWA 4ODLA 1FAPA 3VAWA 1B6CA 2Y78A 4ODOA 3UF8A 2DT1A 4QZVB 4WZXA 1ZBKA 1E6ZA 1FKIA 1UR9A 4KR0B 4W5UA 3WKZA 4Q7NA 3BXWA 1LG2A 3RGCA 4ZS6A 2ZR5A 4Z2KA 1WR0A 5FVLA 4IQ2A 3EY6A 1FJDA 4LAYA 4DRHA 1JNSA 1HKIA 4W9PA 5JH8A 3AROA 2A3EA 2KGJA 4DRJA 4S3KA 1SR0A 4ODQA 1C9HA 4JYSA 2XPAA 2MF9A 4QIBA 2OLHA 4TW7A 4GGQA 1XHGA 5CGMA 1NWTA 4DWSA 3O5MA 2DSZA 4ZPWR 2DL1A 3B8SA 4DRNA 2DPEA 4R5EA 1J4RA 4DZ3A 4MGVA 5GPGA 3AS1A 2G41A 4TYOA 2FAPA 1J6YA 2XPBA 3CHDA 1FKRA 4MNLA 3PR9A 3ZSSA 4W9QA 3QOKA 4O2TA 4P8VA 1YATA 3PRBA 2MLYA 1NH6A 2VN1A 2ZR4A 1A7XA 1HJVA 4GIVA 3B9EA 4BF8A 1ZB5A 4AY1A 3UI4A 3O5OA 4ODKA 3ARUA 1WB0A 1Q1CA 3H9RB 4QT3A 4FAPA 1RD6A 2XZEA 2LRKA 1J4HA 4Z2LA 2OFNA 2L2SA 3KAIA 5HW6A 1NWRA 3ALGA 1T11A 2LGOA 4J4NA 2JQKA 2KI3A 3KAHA 3ARRA 1NWSA 1ZU8A 3JXVA 5HW7A 1JNTA 1QZ2A 1ZK6A 1K9TA 5D75A 5DEZA 3LUOA 3UI5A 1J4IA 3OOBA 4JFLA 4DRPA 1FKBA 5J6EA 2B31A 4Z2JA 3FY1A 1EYMA 3EABA 1FKTA 2CRBA 3WL1A 1E15A 4TNSA 3CZ8A 2D9FA 2RPAA 1LJYA 2DSVA 4NZCA 1F40A 1N1AA 4DRIA 4Q22A 1PBKA 1OGBA 1ITXA 3WQWA 1W1VA 4WKAA 2WWVA 4FN2A 4ITZA 4PTMA 4Z2IA 3IKDA 1WCRA 1NSGA 4DWSB 3PRDA 3ARQA 5HWBA 2F2DA 5FVKA 5GPRA 2ZQVA 3ZT5A 4ODMA 3NRKA 4DIPA 1FFQA 3JYJA 4URIA 4ZEYA 1FKJA 4DRQA 2K3WA 2WY2A 2DSUA 2MPKA 1HKJA 1OWQA 1D7IA 1Q6IA 2M08A 1EDQA 3WD1A 1E9LA 1EHNA 1HXVA 5DIUA 2KR7A 2VCDA 1FKLA 1LL7A 1BL4A 2FDMA 2ZQSA 2V6YB 4XAKA 3ARZA 4G50A 4DWSC 1EQ3A 3AQUA 1O6IA 1HKKA 3ARYA 4S3JA 1LL4A 2M2AA 4CN4A 2JQ9A 3O5JA 1Q6UA 2KO7A 1W26A 3WD4A 1ZL1A 4JFJA 2DG9A 3KAGA 2DG3A 2WM0A 4U85A 4ODPA 3RMEA 4DWSD 2LKNA 1WNOA 3K1SA 2A9UA 3AS3A 1W1TA 3TC5A 2G8ZA 4IT6A 1GPFA 2PPNA 3ALFA 4N19A 1W9PA 1D2KA 4U3CA 4ML4A 1GUVA 3RFWA 2PV2A 4DRMA 3NTPA 4MNJA 1PINA 4MSPA 3KABA 4LAXA 4U31A 5HWCA 5DO2A 2IUZA 3CHCA 2CPTA 1ROTA 4A5XA 4KQZA 2DT0A 1R9HA 3CHEA 2ESCA 1TFVA 2PBCA 4ODRA 2N87A 2PI6A 3B9AA 2PV3A 2DT3A 1H0GA 4MNMA 3ODKA 2WLYA 3WIJA 3CHFA 1CTNA 1KFWA 4TW8A 1QPFA 1Y0OA 4WJXA 2KFWA 2YBUA 1LL6A 2PV1A 4TX0A 2PPOA 1HJXA 2K8IA 1QPLA 3KAFA 3PA7A 1SYTA 4U7YA 2RSEA 2DG4A 4WIWA 2V6XA 4Z2GA 4U86A 2MLXA 2RUQA 4LGXA 2A3AA 5B8IC 4W9OA 1W9VA 4MAVA 2JZVA 3UQAA 2UZ5A 1E6NA 5DF0A 1ZBWA 3WD0A 1NMWA 3ARTA 3KADA 4U84A 5HBFA 4WKFA 4NIQA 2W2UA 4MTVA 3ZT7A 2KE0A 2XP8A 1FKKA 4JFMA 3MDYB 1JNEA 2AWGA 2DSWA 2ITKA 2MPHA 2XP9A 2MNTA 2F4EA 4Z2HA 1VF8A 1FD9A 3JYMA 2XP7A 1FKGA 1F8AB 5LB7B 1E6RA 2MLZA 1ZBVA 1JNDA 4NSBA 4QT2A 5HKGA 3NI6A 3O5IA 3O5FA 5I98A 5DITA 3AS0A 1FKFA 2F21A 3CGNA 3WD2A 5HUAA 3CGMA 4L72B 4U7IA 1BKFA 3WD3A 2LRLA 3OA5A 4DROA 4CN1A 4P8XA 5HT1A 3UI6A 1W1YA 3ARXA 4TW6A 1D7JA 3ARWA 1OGGA 1D6OA 4CN6A 3ARPA 3I6CA 3TDBA 3GPKA 3G6LA 1KT0A 3TCZA 3WQVA 3ZT6A 2O9OA 3PRAA 3WH0A 1NWUA 1IX5A 4L3NA 3O5KA 3O5LA 4MNKA 2Q5AA 5GQBA 2IF4A 4HBEA 3O5GA 2M1IA 1FKDA 3FAPA 4P8WA 4IQCA 3WL0A 3KCEA 1YXRA 4U33A 4C02B 4J4OA 3RM9A 2PPPA 3IK8A 1KT1A 4JFKA 1P5QA 1UR8A 1FKSA 3KZ7A 1XRVA 1X6NA 4DH0A 3RM8A 3O5QA 3IHZA 1TCOC 3UQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IT4 A;  2JQK A;  5CGM A;  5CJ5 A;  4U7I A;  4U7Y A;  2JQH A;  2LRL A;  2V6Y A;  2V6X A;  4CN1 A;  1WFD A;  4ZEY A;  2WWV A;  4CN4 A;  1WR0 A;  2JQ9 A;  2K3W A;  2WY2 A;  4U3C A;  2DL1 A;  2MPK A;  4U2Y A;  1YXR A;  5FVL A;  4CN6 A;  4U33 A;  1WCR A;  5LB7 B;  3EAB A;  3ZT6 A;  4U31 A;  2CRB A;  2XZE A;  3ZST A;  3K1S A;  2A9U A;  2LRK A;  2CPT A;  2V6Y B;  4P1N A;  4A5X A;  4U2Z A;  3ZSS A;  2RPA A;  4WZX A;  4NIQ A;  4IT6 A;  2W2U A;  5FVK A;  3ZT5 A;  3ZT7 A; 
#chains in the Genus database with same CATH topology
 3UU3 A;  3CK6 A;  4KHP T;  2HH7 A;  1X6L A;  2XQ3 A;  4B6X A;  2CHO A;  4JEU B;  4AKR B;  4UVA B;  4AKG A;  2CCQ A;  1MIY A;  1FEW A;  2XQ6 A;  3GU0 A;  3O5E A;  2W63 A;  4YJ3 E;  3ZST A;  5C2T A;  1FIO A;  2D0T A;  2EHO A;  3C51 A;  3RRW A;  5L3C B;  1WAW A;  3UU4 A;  3FZK B;  2WCA A;  3TLV A;  2YBT A;  3PJA J;  3ZC0 A;  1CHU A;  4P8U A;  2ZR6 A;  1U79 A;  5LG4 A;  3O5R A;  3AA1 B;  2WDV A;  4LF8 T;  1Q6H A;  3IKG A;  3P4S A;  4NNR A;  4HAR A;  2LPV A;  2W66 A;  4IE6 A;  1I6Z A;  1JVW A;  4DMW A;  2WK2 A;  3PE0 A;  1JNZ A;  4HBO A;  3O5D A;  2LJL A;  5FXV A;  4KHZ F;  3LK2 B;  2WLZ A;  4DVD A;  2LKG A;  2WM9 A;  3P4R A;  1FFR A;  3GTY X;  2DT2 A;  4MHC A;  3HR0 A;  1IBL T;  1FAP A;  2VWA A;  1B6C A;  2BS3 A;  1J5W A;  3UF8 A;  4QZV B;  1ZBK A;  4YLH A;  4W5U A;  2HPL A;  2UU9 T;  3ZJ1 A;  4LFC T;  4ZS6 A;  2ZR5 A;  1XZY A;  1WR0 A;  3CX7 B;  2LT3 A;  4LAY A;  3IBP A;  2JMH A;  5FY7 A;  2A3E A;  1LRZ A;  1HFA A;  4ZS2 A;  4ODQ A;  4JYS A;  4IDO A;  4A97 A;  2XPA A;  4KP3 C;  3QK6 A;  2NWB A;  4O4L E;  4WBO A;  2Q9Q B;  4GGQ A;  3BQI A;  4DWS A;  4DR4 T;  4HFD A;  5FKY A;  2J4G A;  4OHF A;  4DRN A;  4R5E A;  2C5J A;  2KZ7 B;  4DZ3 A;  5GPG A;  3AS1 A;  2FAP A;  1BR1 A;  1FKR A;  2JQQ A;  2E9X D;  3IA3 A;  1MMA A;  3UU6 A;  2R6G F;  3ZSS A;  4EAH A;  4W9Q A;  4O2T A;  3GN5 B;  2OLT A;  3FZH B;  1YQ3 A;  4LMJ A;  2I59 A;  3HKB E;  2XAG B;  4CQI A;  1ZB5 A;  3UI4 A;  4ODK A;  4EED A;  4QT3 A;  5CB4 E;  2E8I A;  3VR8 A;  4GIW A;  2LSY A;  4YTP A;  3FZL B;  4JEH B;  4V1A v;  1T11 A;  2L8K A;  3TLW A;  2JQK A;  4HWH A;  3PUQ A;  5HW7 A;  5C3J A;  5FY1 A;  2BKP A;  2I0M A;  3ZEF B;  3UI5 A;  2EHO D;  4PAG A;  4AKH A;  5J6E A;  4YT0 A;  3FY1 A;  3HA4 A;  3QOF A;  3ANW B;  4TNS A;  2KIN B;  3M65 A;  2D9F A;  1N1A A;  3RH3 A;  5L2L A;  4EOZ B;  3Q5E A;  2X9W A;  2A3D A;  2CHN A;  2LM9 A;  2WWV A;  2GK9 A;  3X1D A;  3O1I A;  4HFC A;  1WCR A;  1ZP0 A;  5LNK A;  4X1Y E;  4DWS B;  2LHR A;  5HCM A;  3ARQ A;  4ZZB A;  5HWB A;  2BS2 A;  2F2D A;  1IJ5 A;  4LF6 T;  5LBM A;  3OJA A;  4MBQ A;  5JR9 B;  2XM1 A;  2A72 A;  4X20 E;  3N9O A;  4ODM A;  5HXS A;  1FFQ A;  2PFV A;  2XY8 B;  4URI A;  2X0H A;  3AB3 B;  5JDQ A;  3A5X A;  2BVL A;  2MPK A;  1D7I A;  5HXE A;  2XM2 A;  1EHN A;  5DIU A;  2VCD A;  4LF9 T;  1FKL A;  1LL7 A;  5FXW A;  5IWA T;  4P09 A;  1S35 A;  2MAW A;  3ZMZ B;  3AQU A;  1HKK A;  5JDH A;  1XNR T;  1LL4 A;  1CUN A;  3C98 B;  5JVD E;  1Q6U A;  3WD4 A;  1ZL1 A;  2BKO A;  3L39 A;  4HWC A;  2CMR A;  4I0U A;  4DWS D;  5AQJ B;  4B3M T;  2JMK A;  3CWZ B;  4IL9 A;  5AQV B;  2W00 A;  1X79 A;  4F8H A;  2YU2 A;  2MOZ A;  4DV4 T;  4HFE A;  4QXH B;  5L3E B;  3KAB A;  4U31 A;  4LAX A;  1W0B A;  3CHC A;  3OTO T;  2YIN A;  1TFV A;  3K3Q C;  2N87 A;  2PI6 A;  5FXX A;  1JCH B;  3CKD A;  4O2B E;  1H0G A;  2AE9 A;  2WLY A;  3CHF A;  4EXT A;  4X1I E;  5CA0 E;  4UVC B;  2LSJ A;  2G0U A;  3DTO A;  3ABV A;  4TWD A;  5LGU B;  4Z90 A;  2KFW A;  2YBU A;  4JI4 T;  3B5M A;  3KBU A;  1ZOY A;  1SYT A;  4WIW A;  4DR6 T;  2V6X A;  5C8Y E;  2KMF A;  4U86 A;  2MLX A;  1IBM T;  4JI1 T;  2D5U A;  4LGX A;  1OED A;  1UX5 A;  2B76 A;  2JPF A;  1W9V A;  4MAV A;  1YKH B;  5H6Q B;  3UQA A;  4TNV A;  1ZBW A;  3KAD A;  2J1D G;  2YKS A;  4HKA A;  1MMD A;  2D2S A;  4CXX A;  4LFB T;  3IHR A;  5HBF A;  4WKF A;  5LHH B;  4NIQ A;  5AQU B;  1YW0 A;  2ZM0 A;  5J2U E;  3A8Y C;  4IE4 A;  1JNE A;  2DSW A;  4AIU A;  3N9N A;  4ILU A;  3UU5 A;  3JYM A;  1FKG A;  5DQW A;  2MLZ A;  2BDE A;  1ZBV A;  5F5W A;  1JND A;  1WLX A;  2ZM6 T;  3SFE A;  4M1P A;  3NI6 A;  4NSB A;  4QT2 A;  3O5I A;  3O5F A;  4OX9 T;  3QUJ A;  3GWH A;  1FKF A;  1UX4 A;  4YJ2 E;  4DUY T;  4YHJ A;  2CXD A;  3CGM A;  2FBW A;  2X9H A;  2YDS A;  3FXD B;  3N9M A;  5AQK B;  2LRL A;  5LMN T;  4QHO A;  3KVA A;  4HFH A;  1D7J A;  3RI5 A;  3T1Y T;  4DBQ A;  1D6O A;  3ARP A;  3DP7 A;  3KIN B;  1M62 A;  5L3G B;  5J0Z A;  4DR1 T;  3KFW X;  3RHW A;  4J2C A;  4L3N A;  1HX1 B;  4AQF A;  1E2A A;  4HBE A;  3EIP A;  4QXC B;  3AE1 A;  4ANJ A;  2XQ8 A;  3CQC B;  1KFY A;  4P8W A;  2H3R A;  2M6I A;  3ZMV B;  4TWH A;  4IQC A;  3RRC A;  1XDO A;  3BQK A;  2IC9 A;  4DUZ T;  3AEF A;  2PPP A;  3TLS A;  1HNX T;  1KT1 A;  5KXJ A;  4JFK A;  2DNX A;  4DMV A;  1OED E;  1OED B;  4DT4 A;  2ZQT A;  1D0X A;  3B7X A;  3ZCI A;  3FXY A;  2IC6 A;  3UQ7 A;  1GQE A;  4BJM A;  1FKH A;  2E5V A;  1WYC A;  2UUB T;  3ARS A;  2WAU A;  5DIV A;  3C64 A;  1QLB A;  4EZ4 A;  2XP5 A;  2IUB A;  1H7C A;  4WYV A;  3AAI A;  2XP4 A;  1YKE B;  2CXF A;  2QF8 A;  4ZPT R;  3FXE B;  5LCY A;  3KV6 A;  4YFS A;  2CLY B;  1KNZ A;  4ZPV R;  2BS4 A;  4UEM A;  2WDQ A;  2WZI A;  1BR2 A;  5HTG A;  4LFA T;  4IPX A;  3CH9 A;  2L3L A;  5HWX A;  4DR3 T;  1T8B A;  2JRK A;  4CXW A;  2H7O A;  3AEC A;  4LF5 T;  1BR4 A;  4I50 E;  4DRK A;  3W4R A;  4ZZC A;  1ZBC A;  3CVR A;  3VRA A;  3ARV A;  4LAV A;  5KDM C;  4H9O C;  5BR8 T;  3O5P A;  2X0Y A;  3RF1 A;  4R0X A;  4WK9 A;  4PK5 A;  2AOS A;  3ZCJ A;  3KAC A;  2JJ9 A;  2LSG A;  4H63 H;  5IUX A;  4LAW A;  4HTE A;  4ODL A;  3VAW A;  3OBV E;  3BMB A;  5JQG E;  3UFG A;  2LLY A;  5JRC A;  4ODO A;  1Z0P A;  5L3D B;  3Q5D A;  3EI0 A;  4CI3 B;  2BBJ A;  4WZX A;  5ETW A;  2LOP A;  1FKI A;  3VKH A;  2ACX A;  5LGN B;  1E1H B;  2LHN A;  2KLQ A;  4PJJ A;  2VKJ A;  5FVL A;  3EY6 A;  5AQQ B;  4DRH A;  4TNW A;  1JNS A;  1HKI A;  4W9P A;  3ZMT B;  3PUV F;  4U74 A;  3K3O A;  3LBX A;  3U78 A;  5JH8 A;  3AEA A;  4DRJ A;  1C9H A;  4X65 T;  2CEA A;  3BQL A;  3ZJ2 A;  2OLH A;  4LMK A;  2VAS A;  1XHG A;  1NWT A;  2C0S A;  3O5M A;  2YOE A;  2DSZ A;  4ZPW R;  2DL1 A;  4JI2 T;  5AQH B;  2LSI A;  1FMW A;  2A2F X;  2PTF A;  3C4Z A;  1WYB A;  1OWA A;  3QOK A;  4E7Z A;  4H9R C;  3PDY A;  2MLY A;  2UXN B;  4NUU A;  5CFB A;  3UUB A;  2NTY A;  3PUZ F;  4YTM A;  1N33 T;  1A7X A;  1HJV A;  3B9E A;  4UEL A;  4AKI A;  4NUV A;  3CQX C;  5JRE A;  3O5O A;  3ARU A;  4OK0 A;  4EB6 E;  3B57 A;  1J4H A;  5AQG B;  2OFN A;  3KAI A;  3NZP A;  4X1K E;  2LGO A;  1Y64 B;  4J4N A;  2KI3 A;  2Z6E A;  3RIA A;  3ARR A;  1JNT A;  1ZK6 A;  4TN7 B;  5D75 A;  5DEZ A;  4O2A E;  3ETV A;  1J4I A;  4JFL A;  4DRP A;  3EAM A;  3Q9D A;  4Z2J A;  3MKD A;  5EK4 A;  1EYM A;  2CRB A;  1XDP A;  1E15 A;  1J1J A;  1UUS A;  3AE9 A;  3KV9 A;  4HE8 A;  3CZ8 A;  2RPA A;  2DSV A;  3H37 A;  4NZC A;  2DCF A;  4B3S T;  4ZXL A;  1SUM B;  1W1V A;  4WKA A;  5EK3 A;  2DHR A;  4DO0 A;  4B3T T;  2H89 A;  4DV5 T;  3VRB A;  5IYZ E;  3S4U A;  4H9P C;  2Y6X A;  2E9X B;  2CM0 A;  1HX8 A;  5GPR A;  3AA6 B;  3V5U A;  3OKQ A;  3NRK A;  1IBK T;  2RP4 A;  2VK9 A;  3JCF A;  2WY2 A;  2K48 A;  3AE4 A;  3R84 B;  2M08 A;  3PU8 A;  4GKK T;  2DI4 A;  2FDM A;  4PK4 A;  1W09 A;  1EQ3 A;  3V5S A;  2LEH A;  4DV2 T;  5F3J A;  1O6I A;  4GOU A;  2W0G A;  4JI7 T;  4H9Q C;  2JQ9 A;  3ZN1 B;  5BMV E;  2EHO B;  4JFJ A;  4IGU A;  2DG9 A;  3KAG A;  3FHN A;  2WM0 A;  3ZYL A;  4YSY A;  2A9U A;  4X5T A;  3AS3 A;  3T1H T;  4Z91 A;  1KEY A;  2G8Z A;  5AFU L;  2PPN A;  3E08 A;  3MAC A;  3PUA A;  2NW8 A;  5CA1 E;  1X9B A;  2WS3 A;  1D2K A;  3SS1 A;  5FP3 A;  4U3C A;  5DAB A;  4IE5 A;  5LGT B;  3JC6 C;  4WNK A;  2PV2 A;  2KND A;  4MNJ A;  5F8P A;  1PIN A;  4A56 A;  1LVK A;  2QRX A;  1HR0 T;  3RC3 A;  2VQE T;  1R9H A;  2DWG A;  2PBC A;  4IDQ A;  4ZOL E;  2WZH A;  2ODV A;  2ZMA A;  3B9A A;  2PV3 A;  4MNM A;  3AE3 A;  1NWM X;  2CBI A;  3ODK A;  2YDR A;  4ADZ A;  4I55 E;  5AQP B;  1KFW A;  2WBL A;  2V1D B;  4TW8 A;  3AAA B;  4KMC A;  1MND A;  1ZHC A;  1YQ4 A;  1LL6 A;  1BR0 A;  4TX0 A;  5AQF B;  1HJX A;  2K8I A;  2XSA A;  4U7Y A;  3NKZ A;  2M67 A;  2RSE A;  1G73 A;  2V7M A;  1YD8 G;  3VHL A;  1IZN B;  5ABE A;  4ILB A;  4DR5 T;  3UT5 E;  3N2G E;  1NMW A;  3JAE A;  3PJA A;  2WMN A;  2X66 A;  1ZV4 X;  2KSR A;  2W2U A;  1M7K A;  4MTV A;  2C5K T;  2XP8 A;  1FKK A;  4JFM A;  3H3A A;  4HWD A;  2MPH A;  2XP9 A;  4AI6 A;  4LML A;  4IDP A;  4Z2H A;  4JI3 T;  2CLY C;  1T98 A;  1FD9 A;  4O8S A;  2Y48 B;  2XAJ B;  2IW5 B;  4HWF A;  4BA9 A;  4PJN A;  3R6N A;  4EZH A;  4O4J E;  1VOM A;  3C4X A;  1L0V A;  1US7 B;  4P0B A;  4HN9 A;  2VKH A;  3UUM A;  4YTN A;  3LK3 B;  1Y01 A;  4BAY B;  2PG8 A;  2QVA A;  4DND A;  3WD3 A;  1SHZ C;  2VKD A;  1W9R A;  4P8X A;  2V5D A;  4G63 A;  4TW6 A;  2M6B A;  4CN6 A;  3MZK B;  1KT0 A;  5KX5 E;  3PRA A;  2W4X A;  3IEE A;  1HG2 A;  4COF A;  5HCJ A;  4MNK A;  2Q5A A;  3F2E A;  4JUY A;  2LKH A;  3ZYK A;  4QX7 B;  5J2T E;  3RYC E;  4CZZ B;  3KCE A;  5HYA A;  2J62 A;  4J4O A;  3RM9 A;  1SA0 E;  3CX8 B;  2IDO B;  2VKO A;  3HL6 A;  1X6N A;  4DH0 A;  5L3B B;  1TCO C;  3UQB A;  4PFO A;  4TV9 E;  1UK5 A;  1W0A A;  3AA7 B;  2V6Y A;  2XP3 A;  2XP6 A;  4ASK A;  4HFB A;  3RQW A;  3N9L A;  2YU1 A;  1J5E T;  2UXX B;  2RUD A;  2RQS A;  4HGA A;  4NPP A;  4IDZ A;  2UUA T;  5BXJ A;  3NZQ A;  1N36 T;  4ZI7 E;  2CXL A;  1EIB A;  2O92 A;  5ABG A;  4HFI A;  5HEG A;  4DID B;  4NXM T;  4ODN A;  2BG9 C;  2RUR A;  2JQH A;  1WFD A;  2L9Q A;  4JFI A;  3AE2 A;  3ZC1 A;  2IIU A;  2ZQU A;  2MYS A;  3GA8 A;  2A3C A;  2XSB A;  1W1P A;  1D7H A;  3Q5W A;  4DR7 T;  5LG3 A;  1W9U A;  2AXD S;  4I4T E;  4ISS A;  2N1G A;  4KI0 F;  2A3B A;  4MPK A;  3AEG A;  3N9Q A;  4MLK A;  4FJO A;  1E6P A;  3B9D A;  2RUC A;  1HJW A;  2FKE A;  2VB6 A;  3N9P A;  1H0I A;  2B1E A;  1L1P A;  1LG1 A;  4IIJ E;  4IRE A;  2CA5 A;  3RQU A;  3ONL C;  2XQY A;  4JI8 T;  4IDN A;  1KK7 A;  1E6Z A;  1UR9 A;  4E7S A;  5FXZ A;  5JH7 E;  2JIW A;  2D0U A;  5ABF A;  4Q7N A;  5FYM A;  3RGC A;  2K9A A;  1D0Z A;  4Z2K A;  1Z8U A;  3LJC A;  2WU5 A;  4IQ2 A;  1FJD A;  4PFP A;  3RLF F;  4HFV A;  2KGJ A;  5JDN A;  3N2K E;  5AQS B;  5L4E A;  1XNQ T;  2BBH A;  4JI5 T;  4S3K A;  2BVM A;  4TZ4 C;  5FNV E;  2MF9 A;  4I43 B;  4QIB A;  4TW7 A;  3PUY F;  5HXC A;  5CGM A;  3LDQ B;  3AXJ A;  3ZMS B;  4GK5 E;  1N34 T;  4YSZ A;  2C5I T;  4ZS3 A;  3P4W A;  1XMQ T;  2DPE A;  1J4R A;  4QKN A;  2XQA A;  4TYO A;  1J6Y A;  3T8O A;  4P0A A;  3PR9 A;  1B7T A;  3J7Y q;  4P8V A;  1ZEE A;  1YAT A;  1KF6 A;  3NBX X;  2NR4 A;  4EV6 A;  3PRB A;  3I9Y A;  2NOX A;  2VN1 A;  4JI6 T;  3I0O A;  2Q9Q C;  4PJL A;  4YSX A;  1V9D A;  4GIV A;  1AJ3 A;  3F57 A;  4AY1 A;  2VL8 A;  2XTL A;  1WB0 A;  1Q1C A;  3H9R B;  5LP6 E;  1RD6 A;  2XZE A;  2LRK A;  3UUX B;  1NWR A;  3ALG A;  1UGO A;  3O1J A;  1QSD A;  4ZHQ E;  3LK4 2;  2WB5 A;  3KAH A;  4AKL A;  1ZU8 A;  4AXP A;  3JXV A;  1D1A A;  1QZ2 A;  3VU7 H;  2OV9 A;  4K0U A;  3NRY A;  3NVO A;  5HEJ A;  4TWF A;  1FKB A;  4OYJ A;  3RPU A;  2B31 A;  3EAB A;  4UF0 A;  3M3Z B;  2YDQ A;  3WL1 A;  1VCS A;  2VL0 A;  5JDL A;  2NP9 A;  4H63 V;  1LJY A;  3HI2 A;  1F40 A;  2IHR 1;  2LE8 A;  4DRI A;  4Q22 A;  1PBK A;  4ILC A;  1ITX A;  5L4H A;  3OVU A;  3WQW A;  3PUS A;  4FN2 A;  5HXR A;  3I0Q A;  5LHI B;  4Z2I A;  3H3M A;  2V7I A;  2WP9 A;  2UXD T;  1VCT A;  3E0Z A;  2KWH A;  3PRD A;  3AA0 B;  5LHG B;  1HNZ T;  3ZT5 A;  2E5L T;  4ZEY A;  1FKJ A;  5TAO A;  2DSU A;  2YN6 A;  3PUW F;  1HKJ A;  2Y8D A;  3ONJ A;  3RYF E;  1EDQ A;  3WD1 A;  1E9L A;  1HXV A;  3EHZ A;  1XWM A;  1BL4 A;  4B3R T;  3K3N A;  2ZQS A;  4XAK A;  1WR6 A;  2P9B A;  3ARZ A;  4G50 A;  4DWS C;  1O3X A;  4NXN T;  4PJM A;  2FJE A;  4DR2 T;  4S3J A;  5JR9 C;  2MTQ A;  2M2A A;  2WQY A;  4PK6 A;  2X9X A;  4CN4 A;  3O5J A;  5FL1 A;  2KO7 A;  1W26 A;  1JNR A;  2VVN A;  4QWN B;  1GRJ A;  4ODP A;  3RME A;  2LKN A;  2VQF T;  1W1T A;  2V5C A;  4AIS A;  3C4W A;  1GPF A;  4AQY T;  3EUH A;  3RIU C;  2RA1 A;  3JAD A;  2KT9 A;  4N19 A;  3RX6 A;  3MJX A;  1W9P A;  4X62 T;  4ML4 A;  4IL4 A;  3RFW A;  3Q2M A;  4MAL A;  1VRB A;  4DRM A;  5AQR B;  2QGS A;  2PBI A;  4WW0 A;  2CPT A;  1S94 A;  3RKO A;  4A5X A;  1ROT A;  4KQZ A;  2DT0 A;  3SRZ A;  3CHE A;  2ESC A;  2ETN A;  5AQO B;  2DT3 A;  3CIR A;  2B5U B;  3AE6 A;  5JRC B;  2IML A;  2LOS A;  3P50 A;  2BZB A;  1CTN A;  2Q9Q A;  2OA5 A;  1U5P A;  2WU2 A;  4CI2 B;  1QPF A;  3IF8 B;  1Y0O A;  3L09 A;  5DQV A;  4WJX A;  2D9D A;  2PV1 A;  2PPO A;  1T72 A;  2XPK A;  3KAF A;  1IJ6 A;  3PA7 A;  4KBM B;  3KDS E;  2W62 A;  3LBX B;  2NW9 A;  2RUQ A;  2A3A A;  3GN5 A;  2K5B B;  5L47 A;  2UZ5 A;  4YHH T;  3WD0 A;  3ART A;  1E7P A;  4L0R A;  2FJB A;  3I1A A;  5ADX L;  5AQT B;  5LJM A;  3ZT7 A;  2KE0 A;  4UV8 B;  2LM2 A;  4UVB B;  3MDY B;  2V7K A;  2MNT A;  3K8P C;  1VF8 A;  2W61 A;  2XJ7 A;  3P8C D;  5LB7 B;  1E6R A;  4H9N C;  3FB2 A;  4EGW A;  5DIT A;  4X66 T;  3ZKR A;  3AS0 A;  4C91 A;  3CGN A;  5HUA A;  1UCU A;  4OYK A;  2KXP B;  3PU3 A;  4JBW F;  4PW8 A;  3ANW A;  3RIF A;  4YXD A;  4U7I A;  1BKF A;  4DRO A;  5HEU A;  5HT1 A;  3UI6 A;  1W1Y A;  3D0T A;  1EZ3 A;  3ARX A;  2XAF B;  1U4Q A;  4ZI3 C;  3ARW A;  1OGG A;  3CPZ A;  2ODU A;  3G6L A;  3AEE A;  2EUL A;  3WQV A;  3ZT6 A;  2O9O A;  4DBR A;  2V8S V;  4QX8 B;  1MIV A;  2XUE A;  4GK0 E;  4ZI2 C;  1IX5 A;  1I94 T;  4TV8 E;  2IF4 A;  4EYY R;  5LYJ E;  2WSS V;  3FAP A;  5JR9 A;  3WAJ A;  1HNW T;  3RKG A;  4C02 B;  3RGL A;  2CWY A;  2SPC A;  4MFR A;  5EK2 A;  3KZ7 A;  3PUR A;  4ERR A;  3ZN0 B;  4QXB B;  4IE0 A;  5LMU T;  3UUN A;  3IHZ A;  2P4V A;  1HKM A;  1NMV A;  3L3P A;  1ZCN A;  3RIU A;  4Z8X A;  1OXZ A;  4QH1 A;  3TLT A;  3OPC A;  2XAS B;  3WI3 A;  3RM4 A;  4UR9 A;  1LQ0 A;  2IAK A;  1WRD A;  4L5G A;  4N78 D;  2ZM8 A;  5HEO A;  4P1N A;  5H6R B;  5JDG A;  3ZPO A;  1FMV A;  2Q9Q D;  3O1H A;  3CQG B;  2YK0 A;  1ROU A;  1OED C;  4IT4 A;  2NW7 A;  3FZF B;  2V7L A;  3L8R A;  3UQI A;  3N5L A;  3UU8 A;  1GOI A;  3CML A;  3SWH A;  4U2Y A;  3AE7 A;  3HKD E;  4HWI B;  2K24 A;  1YW5 A;  1UUR A;  4K0K T;  4WKH A;  1HTJ F;  1M5Y A;  2HPJ A;  4DZ2 A;  3G6M A;  4U2Z A;  4HEA A;  3PV0 F;  4YY3 T;  3AS2 A;  5CJ5 A;  2I6H A;  5AQI B;  4G2P A;  4EYU A;  3SOL A;  5HW8 A;  1ZKE A;  2LJ4 A;  4FI5 A;  4EIW A;  4DV1 T;  2V26 A;  3NWI A;  3PTR B;  5JTG A;  2Y78 A;  2XAH B;  5LOV E;  4ILA A;  3GMI A;  2CE7 A;  2DT1 A;  3AED A;  4LF4 T;  2PJQ A;  3MXZ A;  2HHH T;  2QYW A;  2LSK A;  4KR0 B;  4DV0 T;  1E44 A;  1FJG T;  3WKZ A;  2H88 A;  3BXW A;  1LG2 A;  4JV5 T;  3UFE A;  2WMO A;  4CXY A;  2ACZ A;  3AVS A;  5HAX A;  4H9S E;  4AQF C;  4O4H E;  3C50 A;  5L3F B;  2X67 A;  3ARO A;  2H7V C;  1SR0 A;  2XQ4 A;  3AEB A;  1NEK A;  1MMN A;  3PUG A;  2XHE B;  3RC8 A;  5LJN A;  3B8S A;  4MGV A;  2G41 A;  2XPB A;  3CHD A;  4MNL A;  3U3I A;  2FUP A;  1NH6 A;  3QB5 A;  1MNE A;  2ZR4 A;  2MBG A;  4BF8 A;  2FJD A;  4FAP A;  3LFM A;  5JDF A;  5KMG P;  2CWO A;  4GYS A;  2X0L B;  4EEB A;  4Z2L A;  2L2S A;  1D0Y A;  3EDV A;  3E22 E;  4GYR A;  5HW6 A;  3UTK A;  1HF8 A;  3TKL B;  4UIG A;  3VKG A;  1NWS A;  1K9T A;  3AE8 A;  3LUO A;  1G8X A;  1T7S A;  3OOB A;  3PUX F;  4XBF B;  4CI1 B;  1DU2 A;  2ES0 A;  1LKX A;  1FKT A;  3MA9 A;  3ONX A;  2XQ9 A;  2W67 A;  4LF7 T;  5FMN A;  1D1C A;  5AQL B;  3A7M A;  1OGB A;  5AQM B;  2X51 A;  3EVY A;  2WWU A;  2FJA A;  3KV4 A;  4ITZ A;  4PTM A;  3IKD A;  3JAF A;  2DLR A;  4OFZ A;  1NSG A;  1KNP A;  1MIW A;  3NRX A;  3QC9 A;  4F6R C;  3ZYM A;  3FBL A;  3FZM B;  5FVK A;  2F4V T;  2ZQV A;  3KBT A;  3ZMU B;  4DIP A;  1SE7 A;  3JYJ A;  2ZLY A;  4DRQ A;  2K3W A;  1OWQ A;  5LBQ B;  5DJQ C;  1Q6I A;  4G2A A;  3BK9 A;  4GKJ T;  3TLU A;  2KR7 A;  4TX5 A;  2V6Y B;  2VVS A;  5FL0 A;  1QUU A;  3KV5 A;  2QA7 A;  2XQ7 A;  3P7I A;  5AQN B;  5HWY A;  2E9X C;  4X64 T;  3ARY A;  5HEH A;  5A1L A;  5FY0 A;  3WAK A;  3O9X A;  5GON E;  2DG3 A;  4QH4 A;  4U85 A;  2XAQ B;  3OYX A;  1WNO A;  3K1S A;  1HS7 A;  3TC5 A;  5J1G A;  4IT6 A;  3P4P A;  2X68 A;  2BKN A;  4ZI3 D;  3ALF A;  1HCI A;  3OYZ A;  4XAX B;  3QNU A;  4XZC A;  1GUV A;  4UXN B;  3FBZ A;  1R8I A;  2ZM2 A;  2V7J A;  4ZI2 D;  3UUL A;  3NTP A;  3AE5 A;  2UXC T;  4MSP A;  4DV7 T;  4L9I A;  2EHO C;  5JDM A;  5LA6 E;  5HWC A;  3P4Q A;  5DO2 A;  4JI0 T;  2IUZ A;  1LVF A;  2X9Y A;  3DJB A;  4ODR A;  4KUM B;  3JC6 D;  2NTX A;  3I9W A;  3SFD A;  3WIJ A;  3ZLI A;  5HXH A;  2HN2 A;  4IE7 A;  4IHJ E;  1NEN A;  5ABF B;  1D1B A;  4Q25 A;  3G06 A;  3RYI E;  1QPL A;  3CX6 B;  5ABH A;  1KNR A;  2HN1 A;  3Q5X A;  2UUC T;  2DG4 A;  5IHY A;  4Z2G A;  2E2A A;  4PNI A;  3F31 A;  5B8I C;  4TUY E;  4W9O A;  2BG9 A;  3RYH E;  2JZV A;  2N9D A;  1HG5 A;  1E6N A;  5DF0 A;  2KWI B;  5LXT E;  4U84 A;  4DV6 T;  5EZY E;  3QB5 K;  3AXJ B;  3AVR A;  2J47 A;  2CBJ A;  1NAF A;  2ITK A;  2AWG A;  2F4E A;  4JLE A;  3HKC E;  3UQ4 A;  1N32 T;  4A98 A;  2N2N A;  3ESL A;  3VR9 A;  2XP7 A;  1F8A B;  2DWK A;  5HKG A;  3W15 B;  5I98 A;  2WDR A;  3EDU A;  4O4I E;  4U72 A;  2F21 A;  4WBN E;  3WD2 A;  4JYA T;  3MK7 C;  4L72 B;  3LG7 A;  4C90 A;  4UDM A;  3OA5 A;  4KX6 A;  4CN1 A;  4AQG A;  3I6C A;  3TDB A;  3LSV A;  3GPK A;  1MMG A;  3N2O A;  3TCZ A;  4IST A;  2UXB T;  3WH0 A;  1NWU A;  3O4X E;  3O5K A;  2YEV C;  3O5L A;  2PN0 A;  1IAP A;  1XMO T;  5GQB A;  3O5G A;  2M1I A;  3ETU A;  1FKD A;  4UF0 B;  2E9X A;  4BJN A;  3HKE E;  4UV9 B;  4QH5 A;  3WL0 A;  3AAE B;  1YXR A;  3J9X 1;  2F23 A;  4U33 A;  2XQ5 A;  5E0O A;  3IK8 A;  2VUR A;  5M4Y A;  1P5Q A;  1UR8 A;  1FKS A;  3B13 A;  1XRV A;  4DV3 T;  2BG9 E;  3KVB A;  3RM8 A;  3O5Q A;  2BG9 B; 
#chains in the Genus database with same CATH homology
 4DT4 A;  1HKM A;  2ZQT A;  3B7X A;  3FXY A;  1NMV A;  1X6L A;  1ZCN A;  2V6Y A;  2XP3 A;  2XP6 A;  1FKH A;  3RM4 A;  1LQ0 A;  2RUD A;  2RQS A;  3O5E A;  3ARS A;  5BXJ A;  5DIV A;  3ZST A;  1EIB A;  2XP5 A;  4P1N A;  2O92 A;  2XP4 A;  2QF8 A;  4ZPT R;  1ROU A;  1WAW A;  4IT4 A;  4ODN A;  2RUR A;  2JQH A;  3UQI A;  2YBT A;  4ZPV R;  1WFD A;  1GOI A;  4P8U A;  4JFI A;  2ZR6 A;  1U79 A;  3O5R A;  4U2Y A;  2ZQU A;  1Q6H A;  3IKG A;  1YW5 A;  5HTG A;  2A3C A;  3CH9 A;  4IPX A;  4WKH A;  4NNR A;  4HAR A;  1M5Y A;  1W1P A;  4DZ2 A;  1D7H A;  2LPV A;  3G6M A;  4U2Z A;  4DRK A;  1JVW A;  1W9U A;  3W4R A;  1ZBC A;  3ARV A;  2WK2 A;  4LAV A;  4HBO A;  3O5P A;  2A3B A;  3O5D A;  4MPK A;  3AS2 A;  5CJ5 A;  4R0X A;  4G2P A;  1E6P A;  2WLZ A;  5HW8 A;  2LJ4 A;  3B9D A;  4WK9 A;  2RUC A;  1HJW A;  2AOS A;  2FKE A;  1FFR A;  1H0I A;  3KAC A;  1L1P A;  2DT2 A;  1LG1 A;  4LAW A;  4ODL A;  1FAP A;  3VAW A;  1B6C A;  2Y78 A;  4ODO A;  3UF8 A;  2DT1 A;  4QZV B;  4WZX A;  1ZBK A;  1E6Z A;  1FKI A;  1UR9 A;  4KR0 B;  4W5U A;  3WKZ A;  4Q7N A;  3BXW A;  1LG2 A;  3RGC A;  4ZS6 A;  2ZR5 A;  4Z2K A;  1WR0 A;  5FVL A;  4IQ2 A;  3EY6 A;  1FJD A;  4LAY A;  4DRH A;  1JNS A;  1HKI A;  4W9P A;  5JH8 A;  3ARO A;  2A3E A;  2KGJ A;  4DRJ A;  4S3K A;  1SR0 A;  4ODQ A;  1C9H A;  4JYS A;  2XPA A;  2MF9 A;  4QIB A;  2OLH A;  4TW7 A;  4GGQ A;  1XHG A;  5CGM A;  1NWT A;  4DWS A;  3O5M A;  2DSZ A;  4ZPW R;  2DL1 A;  3B8S A;  4DRN A;  2DPE A;  4R5E A;  1J4R A;  4DZ3 A;  4MGV A;  5GPG A;  3AS1 A;  2G41 A;  4TYO A;  2FAP A;  1J6Y A;  2XPB A;  3CHD A;  1FKR A;  4MNL A;  3PR9 A;  3ZSS A;  4W9Q A;  3QOK A;  4O2T A;  4P8V A;  1YAT A;  3PRB A;  2MLY A;  1NH6 A;  2VN1 A;  2ZR4 A;  1A7X A;  1HJV A;  4GIV A;  3B9E A;  4BF8 A;  1ZB5 A;  4AY1 A;  3UI4 A;  3O5O A;  4ODK A;  3ARU A;  1WB0 A;  1Q1C A;  3H9R B;  4QT3 A;  4FAP A;  1RD6 A;  2XZE A;  2LRK A;  1J4H A;  4Z2L A;  2OFN A;  2L2S A;  3KAI A;  5HW6 A;  1NWR A;  3ALG A;  1T11 A;  2LGO A;  4J4N A;  2JQK A;  2KI3 A;  3KAH A;  3ARR A;  1NWS A;  1ZU8 A;  3JXV A;  5HW7 A;  1JNT A;  1QZ2 A;  1ZK6 A;  1K9T A;  5D75 A;  5DEZ A;  3LUO A;  3UI5 A;  1J4I A;  3OOB A;  4JFL A;  4DRP A;  1FKB A;  5J6E A;  2B31 A;  4Z2J A;  3FY1 A;  1EYM A;  3EAB A;  1FKT A;  2CRB A;  3WL1 A;  1E15 A;  4TNS A;  3CZ8 A;  2D9F A;  2RPA A;  1LJY A;  2DSV A;  4NZC A;  1F40 A;  1N1A A;  4DRI A;  4Q22 A;  1PBK A;  1OGB A;  1ITX A;  3WQW A;  1W1V A;  4WKA A;  2WWV A;  4FN2 A;  4ITZ A;  4PTM A;  4Z2I A;  3IKD A;  1WCR A;  1NSG A;  4DWS B;  3PRD A;  3ARQ A;  5HWB A;  2F2D A;  5FVK A;  5GPR A;  2ZQV A;  3ZT5 A;  4ODM A;  3NRK A;  4DIP A;  1FFQ A;  3JYJ A;  4URI A;  4ZEY A;  1FKJ A;  4DRQ A;  2K3W A;  2WY2 A;  2DSU A;  2MPK A;  1HKJ A;  1OWQ A;  1D7I A;  1Q6I A;  2M08 A;  1EDQ A;  3WD1 A;  1E9L A;  1EHN A;  1HXV A;  5DIU A;  2KR7 A;  2VCD A;  1FKL A;  1LL7 A;  1BL4 A;  2FDM A;  2ZQS A;  2V6Y B;  4XAK A;  3ARZ A;  4G50 A;  4DWS C;  1EQ3 A;  3AQU A;  1O6I A;  1HKK A;  3ARY A;  4S3J A;  1LL4 A;  2M2A A;  4CN4 A;  2JQ9 A;  3O5J A;  1Q6U A;  2KO7 A;  1W26 A;  3WD4 A;  1ZL1 A;  4JFJ A;  2DG9 A;  3KAG A;  2DG3 A;  2WM0 A;  4U85 A;  4ODP A;  3RME A;  4DWS D;  2LKN A;  1WNO A;  3K1S A;  2A9U A;  3AS3 A;  1W1T A;  3TC5 A;  2G8Z A;  4IT6 A;  1GPF A;  2PPN A;  3ALF A;  4N19 A;  1W9P A;  1D2K A;  4U3C A;  4ML4 A;  1GUV A;  3RFW A;  2PV2 A;  4DRM A;  3NTP A;  4MNJ A;  1PIN A;  4MSP A;  3KAB A;  4LAX A;  4U31 A;  5HWC A;  5DO2 A;  2IUZ A;  3CHC A;  2CPT A;  1ROT A;  4A5X A;  4KQZ A;  2DT0 A;  1R9H A;  3CHE A;  2ESC A;  1TFV A;  2PBC A;  4ODR A;  2N87 A;  2PI6 A;  3B9A A;  2PV3 A;  2DT3 A;  1H0G A;  4MNM A;  3ODK A;  2WLY A;  3WIJ A;  3CHF A;  1CTN A;  1KFW A;  4TW8 A;  1QPF A;  1Y0O A;  4WJX A;  2KFW A;  2YBU A;  1LL6 A;  2PV1 A;  4TX0 A;  2PPO A;  1HJX A;  2K8I A;  1QPL A;  3KAF A;  3PA7 A;  1SYT A;  4U7Y A;  2RSE A;  2DG4 A;  4WIW A;  2V6X A;  4Z2G A;  4U86 A;  2MLX A;  2RUQ A;  4LGX A;  2A3A A;  5B8I C;  4W9O A;  1W9V A;  4MAV A;  2JZV A;  3UQA A;  2UZ5 A;  1E6N A;  5DF0 A;  1ZBW A;  3WD0 A;  1NMW A;  3ART A;  3KAD A;  4U84 A;  5HBF A;  4WKF A;  4NIQ A;  2W2U A;  4MTV A;  3ZT7 A;  2KE0 A;  2XP8 A;  1FKK A;  4JFM A;  3MDY B;  1JNE A;  2AWG A;  2DSW A;  2ITK A;  2MPH A;  2XP9 A;  2MNT A;  2F4E A;  4Z2H A;  1VF8 A;  1FD9 A;  3JYM A;  2XP7 A;  1FKG A;  1F8A B;  5LB7 B;  1E6R A;  2MLZ A;  1ZBV A;  1JND A;  4NSB A;  4QT2 A;  5HKG A;  3NI6 A;  3O5I A;  3O5F A;  5I98 A;  5DIT A;  3AS0 A;  1FKF A;  2F21 A;  3CGN A;  3WD2 A;  5HUA A;  3CGM A;  4L72 B;  4U7I A;  1BKF A;  3WD3 A;  2LRL A;  3OA5 A;  4DRO A;  4CN1 A;  4P8X A;  5HT1 A;  3UI6 A;  1W1Y A;  3ARX A;  4TW6 A;  1D7J A;  3ARW A;  1OGG A;  1D6O A;  4CN6 A;  3ARP A;  3I6C A;  3TDB A;  3GPK A;  3G6L A;  1KT0 A;  3TCZ A;  3WQV A;  3ZT6 A;  2O9O A;  3PRA A;  3WH0 A;  1NWU A;  1IX5 A;  4L3N A;  3O5K A;  3O5L A;  4MNK A;  2Q5A A;  5GQB A;  2IF4 A;  4HBE A;  3O5G A;  2M1I A;  1FKD A;  3FAP A;  4P8W A;  4IQC A;  3WL0 A;  3KCE A;  1YXR A;  4U33 A;  4C02 B;  4J4O A;  3RM9 A;  2PPP A;  3IK8 A;  1KT1 A;  4JFK A;  1P5Q A;  1UR8 A;  1FKS A;  3KZ7 A;  1XRV A;  1X6N A;  4DH0 A;  3RM8 A;  3O5Q A;  3IHZ A;  1TCO C;  3UQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...