4IT4A

Crystal structure of residues 1-211 of cg17282
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
207
Chain Sequence
DWYVGTEWEDKNRGLAKKVIGLQFTEMDKPTIISTVEFSVNKKATNLGGRPSKYLVSDTYPQKHSLEMGTSLTAVDCYLELLLQQFVPGETAACSITTKTGERIEFELKLEKIVKNTQVEKLSAAEIYEVALRLKESGVATFKTFPKFAFDYFVRAAKLLITYKPFDKLTKKTNGINGQAVEELFIQIQTNLAACLLQEKRYEHVIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Noncanonical FK506-Binding Protein BDBT Binds DBT to Enhance Its Circadian Function and Forms Foci at Night.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Unknown function
molecule keywords CG17282
total genus 59
structure length 207
sequence length 210
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18023 FKBP_N_2 BDBT FKBP like N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4it4A02
3.10.50.60 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4it4A01
3ZSTA 5CJ5A 2RPAA 2XZEA 2JQHA 4ZEYA 4P1NA 3ZT5A 3ZT6A 1YXRA 4U31A 2JQ9A 2MPKA 2LRKA 3ZSSA 4U2ZA 4U3CA 4NIQA 2W2UA 4IT4A 3K1SA 3ZT7A 4U2YA 2JQKA 2K3WA 4U7IA 4A5XA 5LB7B 3EABA 2V6YB 1WCRA 2V6XA 1WFDA 5FVLA 4CN1A 4U7YA 2V6YA 2A9UA 4U33A 1WR0A 4CN4A 2CRBA 2LRLA 4WZXA 2WY2A 5CGMA 2DL1A 5FVKA 4CN6A 2CPTA 4IT6A 2WWVA
chains in the Genus database with same CATH superfamily
1OGBA 3LDQB 4TW8A 2XQ6A 1FKLA 2PV2A 2XPAA 4NXNT 2UXCT 1VOMA 3TLVA 3ZSSA 2FJBA 3BQIA 3ARVA 2XAQB 4QT3A 1OWQA 1YKHB 1FFRA 2LM2A 3RLFF 4ZI7E 1Q1CA 2A3AA 2DSWA 2OA5A 5DO2A 5JREA 1BR0A 4DV1T 2D0TA 2X66A 1LQ0A 3CPZA 5KX5E 5J1GA 3AA1B 5FXWA 3PRAA 4DV2T 1MIYA 2VL0A 2X0HA 4FJOA 5HBFA 5HEUA 5L3FB 3CGMA 3KV6A 4ITZA 2VN1A 2F23A 1FKDA 5LG3A 4IDZA 1O6IA 2XQYA 2CCQA 4NUUA 2V7LA 2HH7A 2FJAA 3Q5XA 4H63H 3WI3A 2X51A 3NBXX 4UVBB 2XP6A 4BAYB 4O8SA 2XSBA 4YHJA 1NWTA 5AQNB 3U3IA 4DR2T 3FXEB 3UU6A 2Z6EA 4A56A 4HWHA 2R6GF 3OKQA 2LSJA 2DHRA 5HEGA 2D0UA 5FY7A 2ZM2A 4JFKA 5HW8A 3KV5A 3ZCJA 3O5PA 4DRMA 4ODMA 2VASA 4CN1A 2UUBT 3FZFB 1JNZA 5CJ5A 1ROUA 4Q25A 2N1GA 5A1LA 2ZMAA 1ZU8A 2OFNA 4EGWA 3B13A 4E7ZA 1D7JA 1RD6A 2YDRA 2A72A 4TZ4C 1FEWA 3LK42 2KE0A 2B5UB 3WL1A 2KNDA 3H3AA 3NI6A 2VVNA 2XQ9A 3FZKB 4MNJA 2DT3A 4Z2HA 4Z90A 3UFEA 2WCAA 3AXJA 4YSZA 3LK3B 4DRHA 4J4OA 1T7SA 2Y78A 3EUHA 3AAIA 2DPEA 2O9OA 2XTLA 2AWGA 3OA5A 3B8SA 4WZXA 5FY0A 2MF9A 3K3NA 2LKGA 2BDEA 1OEDA 3J7Yq 2MLZA 3AE2A 4X62T 1BR1A 3VR9A 3PE0A 2MLXA 2M67A 1T72A 1NWMX 4QX7B 4XBFB 4U72A 2LPVA 4AI6A 2L3LA 3NRKA 4WKFA 1GOIA 3ANWB 3KV4A 3TLWA 2LT3A 1I94T 3JAEA 1XMQT 1W09A 3N2GE 3N9PA 2VQET 4CXXA 4IGUA 4DVDA 3CX6B 2JRKA 2I6HA 1WNOA 1HXVA 2M08A 4B3ST 3UQBA 3R6NA 3UQ7A 1KEYA 2CWYA 3HA4A 1NSGA 2KLQA 2UUAT 1Z8UA 3OVUA 2JIWA 2IAKA 2K24A 2ETNA 3GPKA 4N19A 3MZKB 4FN2A 5CA0E 3F57A 2N2NA 5DITA 5LHIB 2DI4A 5LHGB 1U79A 1HG5A 3ZJ2A 3H3MA 2JMKA 3AXJB 1HTJF 4LF5T 2E9XB 4MFRA 2A3BA 2WQYA 3PUGA 3G06A 2PPOA 4U3CA 3O5MA 3CK6A 4IE4A 2MTQA 3UF8A 2WZHA 3GMIA 2BBJA 2VKJA 3HKCE 5HUAA 3P50A 4BJNA 2B31A 2Y8DA 4DRKA 3LJCA 2XQAA 3OBVE 5LNKA 3O9XA 5KXJA 4OYKA 2EHOD 2P9BA 3P4SA 3CKDA 2XAFB 3L09A 2ZLYA 1YKEB 2L8KA 4A5XA 2FUPA 1D7IA 5ADXL 3PUYF 3PUSA 5AQKB 3RC3A 3JAFA 1D2KA 3WQVA 2C0SA 1X9BA 4P8UA 3SFEA 3RM4A 2KMFA 3TLTA 1D1BA 4TWFA 2QRXA 3CH9A 1X79A 3EI0A 2Q5AA 2A3EA 3IBPA 1FJDA 1KK7A 3PU3A 4HWDA 3UUBA 2CMRA 3QC9A 1YW0A 2AE9A 3WD2A 3R84B 3ZYMA 4J2CA 3ZC0A 4IE0A 4KMCA 1GUVA 1H0IA 2IHR1 2YU1A 3N2OA 2ZQVA 5LGTB 2LKNA 4G2AA 3CHDA 3MJXA 5DEZA 2BVLA 4EZ4A 2MBGA 3FHNA 2BS3A 2BBHA 4YXDA 3GWHA 3ZMSB 3SRZA 4DMVA 4KP3C 3K3OA 4QH4A 1HX1B 2LEHA 4JFJA 5LBMA 4ANJA 3TC5A 2MLYA 3FZMB 3HKEE 5BR8T 4IDPA 1D0XA 2PFVA 5HYAA 3QOFA 2PG8A 4QH1A 2DSZA 1Z0PA 2A3CA 3NWIA 2MYSA 3IHRA 3Q2MA 4H9OC 3IKDA 4G2PA 3ETVA 3GN5A 2RA1A 3KACA 1MMAA 2X9XA 2NW8A 4LFAT 3SOLA 1AJ3A 4U7YA 2BS4A 2XP9A 1EYMA 5B8IC 2H88A 2L2SA 4TYOA 2UXXB 3H9RB 3V5UA 3H37A 5DABA 4TWHA 3GN5B 3CHCA 5HWYA 4PW8A 2WZIA 3NRYA 3PU8A 1HG2A 2XPBA 4U2ZA 1EZ3A 1HS7A 5L4HA 1JNEA 4LMJA 3I0QA 4P8VA 2IUZA 4JFIA 2I59A 2X9YA 4NZCA 2LSIA 1D7HA 3ZYLA 4IT6A 3HR0A 1ZBCA 5FXXA 2G0UA 3RKGA 3FXYA 1N32T 4FAPA 3P7IA 4LMLA 4JI2T 2D9FA 1W9VA 4WNKA 5JQGE 4X5TA 3EAMA 2WM9A 2E5VA 2VKDA 1N36T 1E44A 2V7MA 4GIVA 5C8YE 4UVCB 2BKNA 3PA7A 4NXMT 5J6EA 1GPFA 3AEGA 4ASKA 1L0VA 4CI1B 1CUNA 3EVYA 2I0MA 2PBCA 4LF8T 3I9YA 2ZR6A 3VRBA 3AB3B 2IUBA 4YTPA 4NNRA 3SS1A 4U84A 2XHEB 4O4HE 4H9SE 1HNZT 4JYAT 4HBEA 1E1HB 3PRBA 3O5EA 1WCRA 4HFVA 2VK9A 3PUZF 4Z91A 4QXCB 3KV9A 3LBXB 1XDOA 5L4EA 2LJLA 2Y48B 4P8XA 1G73A 1PBKA 2HHHT 1TCOC 3PTRB 3O1HA 1YQ3A 4DR4T 4TX5A 1LRZA 2ZR4A 1M7KA 3CMLA 1GRJA 2WWUA 1EQ3A 3O1JA 4ISSA 3O1IA 2WWVA 4EYUA 2DSUA 3JXVA 5HXRA 1LKXA 4DNDA 4ILBA 4HARA 4GYRA 1MNDA 3L39A 5HCJA 1E6ZA 2EHOA 2YKSA 4NSBA 4TNSA 4AKHA 4TWDA 2O92A 2ACXA 4TNWA 2X0LB 3NZPA 3B9DA 1WFDA 4JI1T 4R5EA 4DR5T 3AA6B 3KFWX 4QWNB 2NW7A 4K0KT 2RPAA 4LF7T 4DROA 1CHUA 4DRJA 2F2DA 1A7XA 1WR6A 1N1AA 4KHPT 4U2YA 3WIJA 4TV9E 4GK5E 1VCTA 2LSGA 4DV3T 2CHNA 2ES0A 5ABHA 3DJBA 3CGNA 1UR8A 2YBTA 3AECA 1QUUA 1C9HA 1UURA 4W9QA 4COFA 1R9HA 2M2AA 3P8CD 3AEEA 2WDVA 1ROTA 3KAHA 2XAGB 2V5CA 5LGNB 4KR0B 2F4EA 3AROA 3KVAA 4P09A 4JI5T 2ITKA 3AE1A 5LMNT 5LJMA 2UXBT 5AQHB 5FKYA 1XRVA 4G50A 2X9WA 4BF8A 5JDNA 3UQAA 3PUAA 4DIDB 5JTGA 4CN6A 5JRCB 2QA7A 3CHEA 4HFBA 1ZKEA 3ARXA 4TV8E 5DJQC 1VRBA 3LSVA 4X64T 3TCZA 3EIPA 2PI6A 4IIJE 2KFWA 1HR0T 4LAVA 4X1KE 2DG4A 3MK7C 5FL1A 2P4VA 5LXTE 1M5YA 5AQTB 3ARQA 3AEFA 4DV7T 3AE7A 4S3JA 5JR9A 4NUVA 4DV0T 1W0AA 1KF6A 1O3XA 1ZCNA 2XAHB 4EB6E 1LL4A 1E7PA 4DO0A 2GK9A 3M65A 3PJAA 4PJNA 3N9QA 2X9HA 2KINB 1WB0A 3ZT6A 1HNWT 3K8PC 3D0TA 4AQGA 5AFUL 4AXPA 3V5SA 1B6CA 4DV6T 4LAWA 3T8OA 3ODKA 5L3BB 4H63V 2DSVA 3FY1A 4HFDA 4BA9A 2XM1A 4ODOA 4UF0A 3RYCE 1X6NA 3B57A 2FJEA 3ARRA 3ALGA 2QF8A 1NMVA 4L3NA 1NENA 3B5MA 4A97A 2V7IA 4X65T 1BKFA 3P4RA 4YT0A 4EYYR 3RYIE 1S94A 3OOBA 4I43B 4X1IE 3UTKA 3ZMUB 3RKOA 2JQQA 1ITXA 4OK0A 5LBQB 5DIVA 3TLSA 4OX9T 2LHNA 2PJQA 3ZSTA 4TW6A 4NPPA 4DR1T 4A98A 4C91A 1FKKA 3AVRA 1EHNA 3C51A 4P0AA 1V9DA 3P4PA 2W00A 2LE8A 4L0RA 4CQIA 3C64A 2DT1A 2XUEA 1PINA 2WLYA 2DT0A 3RM9A 3HL6A 3EHZA 1EIBA 3SFDA 5L2LA 3P4WA 1OWAA 2EHOB 2KWHA 4MALA 5AQGB 4DWSA 5CA1E 3F2EA 3I0OA 2DWGA 4ZPTR 4UXNB 4O2TA 2V5DA 3TLUA 5CB4E 3OTOT 2UU9T 2W4XA 2NR4A 5HWXA 4DR7T 4HKAA 2RP4A 5AQLB 4AQFA 3WAJA 4L5GA 2WK2A 3PURA 3O5KA 4EEDA 4UDMA 2M6BA 5HAXA 3RI5A 2XPKA 3TKLB 3LK2B 2NP9A 4Z2GA 2PTFA 3IHZA 2HN1A 3RQWA 3F31A 1XMOT 4L72B 1IJ5A 4LF6T 3NKZA 2XASB 4O2BE 4OHFA 4CZZB 2DLRA 1WLXA 1W9RA 2ZQUA 2LRKA 3PUWF 4ILAA 4QKNA 5IUXA 3UULA 4DT4A 2KSRA 1W1PA 4L9IA 2J1DG 1D6OA 1OEDE 2WU2A 4MGVA 1HX8A 3W15B 4TNVA 4DUYT 1WAWA 4EXTA 3QNUA 1FKSA 2A2FX 1T11A 2RURA 2WP9A 4IREA 2LOPA 3IEEA 3RGLA 1FKBA 3VHLA 4DWSB 2H3RA 3ARSA 3B7XA 4V1Av 4JEHB 3JADA 2NWBA 3I9WA 2PPNA 3ZKRA 3C4ZA 1W1VA 1MMNA 2DCFA 2YINA 3RIUA 4PNIA 1W1TA 4KQZA 2ZQTA 3JC6C 2DT2A 3JC6D 5I98A 5AQIB 3ARUA 1T8BA 5IWAT 2K5BB 1LVFA 4IDQA 2VVSA 4NIQA 4IT4A 4H9QC 5KMGP 1ZEEA 4YFSA 4IDNA 3CIRA 1E6NA 4K0UA 2Q9QD 3O5GA 2G8ZA 5ABGA 3NZQA 5HW6A 5C2TA 4O4IE 2FBWA 2CEAA 2AOSA 3FZLB 4EAHA 4ZEYA 1IBLT 4QZVB 4P1NA 4DRQA 1HNXT 3RGCA 2W61A 2L9QA 4UR9A 3AS1A 1JNRA 2ACZA 1FKIA 4ODRA 3ZT7A 5FYMA 5GPGA 3KZ7A 4MSPA 4B6XA 1Q6UA 2PV1A 4I55E 2JJ9A 4IQ2A 3C50A 3IF8B 4MLKA 5HXCA 3Q5WA 4YSYA 4I4TE 4AKGA 1ZBKA 2CPTA 3RQUA 2XAJB 3QB5A 3ZC1A 4HFHA 3ZMVB 5FP3A 2CE7A 3LUOA 3OPCA 4ZS2A 3PJAJ 1LL7A 2MPKA 4WIWA 2W2UA 3RYFE 4DZ2A 1IAPA 1HFAA 2JZVA 3AA7B 1VCSA 4EIWA 5JDMA 2UZ5A 5DQWA 5F3JA 5HEJA 4MAVA 4ZS3A 3O5OA 5LJNA 4ZXLA 5ETWA 2WAUA 4JI6T 4AKLA 3CHFA 1EDQA 4P0BA 4CI3B 1W9UA 3KVBA 4JI0T 1FKRA 3WH0A 4IHJE 4OFZA 4WBNE 5D75A 2W67A 4DBRA 3O4XE 3M3ZB 4CXWA 3PRDA 1OEDB 3AEBA 5FNVE 2H7VC 2KT9A 1BL4A 4IL4A 4DZ3A 1J1JA 1J5WA 3MXZA 1FKJA 4XAXB 4DWSD 4KHZF 4J4NA 3K1SA 4AIUA 3KDSE 4LFCT 5LB7B 2V6YB 1NWUA 2VKHA 4CN4A 2VL8A 2CBJA 2PPPA 2DL1A 2VKOA 3AE5A 2X67A 2BG9C 2X0YA 5HWCA 3I6CA 2DG9A 3NTPA 3PUQA 2DWKA 5ABEA 1CTNA 3J9X1 4ZI2C 2ZR5A 2V7KA 2W62A 3TDBA 4ZZBA 3BXWA 1KFWA 3PR9A 3IA3A 2IDOB 2M1IA 1LVKA 3AEDA 5ABFA 1D1CA 2QGSA 4AKRB 2F4VT 3UT5E 2AXDS 3G6MA 4ZPVR 3UI6A 4WKHA 4I0UA 2BZBA 3B9EA 3ETUA 4PFPA 3VR8A 4ILCA 3WD0A 3KBTA 1QPLA 2LJ4A 5HXSA 4QX8B 2WY2A 2OLTA 1D1AA 5L47A 4MTVA 2Y6XA 3UI5A 4MNMA 3ZJ1A 3PUVF 2JQ9A 5C3JA 2ODVA 4JYSA 2E2AA 1J6YA 1XWMA 3MKDA 1MMDA 2WMNA 4Z8XA 4IDOA 3LFMA 2FAPA 1XZYA 3AA0B 4EZHA 2RUQA 2RQSA 2IMLA 3E22E 2QYWA 3CQCB 5LMUT 4HFCA 1T98A 2WM0A 2V7JA 1UK5A 4DR6T 1ZK6A 3HKBE 4KI0F 1N34T 3ONJA 1HKMA 4W9PA 3ZT5A 5JR9B 3AS3A 4PAGA 5FXVA 3IKGA 3GTYX 1E2AA 2IC9A 4EV6A 1D0YA 2Q9QA 4TX0A 4H9RC 4JBWF 2WLZA 2RUCA 3HKDE 3CX7B 3GA8A 4JFLA 1NH6A 4AISA 5FL0A 1B7TA 4AQFC 1SUMB 2CXLA 5LG4A 4DUZT 5HKGA 3ARPA 1HJXA 5BXJA 4TW7A 1NAFA 4HWIB 3JYMA 4KBMB 3BQLA 3DP7A 5EZYE 4Q22A 4ODNA 1XNRT 2Q9QC 3LG7A 3CX8B 2JQHA 4QIBA 1Q6IA 2OLHA 4HN9A 3ZYKA 2IF4A 1W0BA 1XNQT 3AE8A 5AQMB 1JCHB 1UCUA 4QHOA 4UV9B 2WU5A 3CQXC 5JH7E 5CGMA 2MAWA 2KI3A 2E9XD 2OV9A 2NTYA 4Z2IA 4WK9A 5LOVE 4AY1A 3N9LA 5J2UE 3WD1A 3RMEA 2MPHA 5LCYA 2BG9A 3Q9DA 1IZNB 1XHGA 2M6IA 4H9NC 4HEAA 4ILUA 4HGAA 1OEDC 5HXEA 4E7SA 3FBLA 5LYJE 3A8YC 3VKHA 3O5FA 2CLYB 3ANWA 2K8IA 5HT1A 1IBKT 4LFBT 3AS0A 4C02B 2JPFA 4ZS6A 2IC6A 3BK9A 3S4UA 3RH3A 1ZL1A 5FXZA 3SWHA 2YEVC 3ZN1B 1KT1A 4YLHA 5HWBA 4O4LE 1YD8G 5L3DB 4GYSA 2H7OA 2VQFT 2WDRA 5L3EB 1J4RA 2W66A 4CXYA 1J5ET 2UXDT 2YBUA 3P4QA 1IBMT 1VF8A 3JYJA 1XDPA 4HFIA 1YATA 1E6RA 5LGUB 4MNLA 1KNRA 2KWIB 2FDMA 3UUNA 4PK6A 2XP4A 4FI5A 1KT0A 2HPLA 5FVLA 2E5LT 2BKOA 3RM8A 1QSDA 4BJMA 2MNTA 3RF1A 2XSAA 4EOZB 4XAKA 1D0ZA 3AS2A 5HTGA 3ZN0B 3CZ8A 2J4GA 5TAOA 3RRWA 3AE9A 3E08A 4ZOLE 4ODKA 4ERRA 5JDGA 3QOKA 1MIWA 5JDQA 4UF0B 2IIUA 5DQVA 3N9MA 2CRBA 3UUMA 3FZHB 2KGJA 3QB5K 1SYTA 4JI4T 4ZI3D 1LJYA 1HKIA 5LP6E 3O5LA 4R0XA 3OYZA 2JMHA 4UEMA 2WS3A 4HBOA 5GQBA 2LOSA 3FB2A 2HPJA 2V26A 1H7CA 3IK8A 1U5PA 2XP5A 2XQ4A 2KO7A 1M62A 3UQIA 3B9AA 1SHZC 4W5UA 2CA5A 4B3RT 4U74A 2BS2A 5AQRB 3RIUC 1ZBWA 5DF0A 5AQUB 1HKKA 5GONE 2K3WA 3C4XA 3VU7H 2J62A 5M4YA 2C5JA 4DR3T 3AVSA 1NEKA 4AKIA 3RHWA 2KR7A 4KX6A 2KXPB 3WL0A 4PTMA 4WYVA 5AQPB 1N33T 3FAPA 1J4IA 3VRAA 4DIPA 2LKHA 3RX6A 4MPKA 3N5LA 5AQJB 2LSYA 2XQ5A 5BMVE 5ABFB 3O5QA 5HW7A 2J47A 3I1AA 2ZM8A 3MDYB 2CXDA 2NTXA 1E6PA 5HEOA 4EEBA 2IW5B 3ABVA 3NVOA 3AE4A 3AE3A 3WAKA 4YSXA 1ZV4X 5J0ZA 5L3CB 1GQEA 3K3QC 4LF4T 1F40A 1MNEA 4JI3T 1KNZA 2ESCA 4O4JE 4YTNA 3AQUA 2XY8B 2BG9E 2YOEA 4ZZCA 2A3DA 5DIUA 2B76A 4U7IA 1W26A 5JVDE 4WKAA 4P8WA 2W63A 4IL9A 5JRCA 2E9XA 1FIOA 3AE6A 4GK0E 2PN0A 4O2AE 2EHOC 2EULA 2LSKA 4IPXA 3UFGA 1ZP0A 4ZHQE 1LL6A 1SR0A 2G41A 5HEHA 3X1DA 4DV5T 4CI2B 2V1DB 2C5KT 4JV5T 4DRNA 3A7MA 3O5IA 1HF8A 3PV0F 2ZM0A 2LGOA 3ONLC 2PBIA 3N9OA 2ODUA 2BG9B 4JI8T 3QK6A 4ZI3C 5GPRA 2CXFA 2W0GA 2K48A 4X20E 1ZB5A 3FXDB 3CQGB 5EK2A 3O5JA 2WBLA 2WDQA 4DV4T 4TN7B 2DNXA 4GIWA 3JCFA 2MOZA 1JNDA 1J4HA 3WKZA 4HE8A 2SPCA 3LBXA 5JDHA 3T1HT 1E9LA 4ZI2D 1FKFA 5IYZE 5JH8A 4PK4A 5LHHB 3OYXA 1WYCA 4PJMA 5L3GB 1K9TA 2XQ7A 2UXNB 3KABA 2N87A 2N9DA 1Y64B 5EK3A 2A9UA 4IE7A 2X68A 2NOXA 1NWRA 3ZMTB 3C98B 3CVRA 4MHCA 4ML4A 1ZBVA 4H9PC 4Z2LA 2CBIA 3KAFA 2YN6A 4U31A 4HWCA 3U78A 3MA9A 4LAYA 4GKJT 3N2KE 5H6QB 4WBOA 3PUXF 4U85A 4X66T 2ZQSA 5IHYA 3CWZB 3EDUA 2WB5A 4Z2KA 4PK5A 4MBQA 2CLYC 1ZOYA 3O5DA 3DTOA 1US7B 2XM2A 4OYJA 1BR2A 2CWOA 4GOUA 3UU8A 3ARWA 2QVAA 2YU2A 3KAIA 5HCMA 1UX5A 5AQFB 3N9NA 1SE7A 4JI7T 3VAWA 3EABA 1FMVA 4QXBB 4F6RC 3UU4A 5F5WA 4IQCA 2BVMA 4KUMB 4JEUB 4DRPA 1YQ4A 3L3PA 3UU3A 2KZ7B 1Y0OA 3RRCA 2XQ8A 1LG2A 3RIAA 1UR9A 4HWFA 1FMWA 1IJ6A 2JQKA 2C5IT 5JDFA 1IX5A 2H89A 2PV3A 2D9DA 3RPUA 2Q9QB 1HCIA 3UUXB 1FAPA 4LGXA 4U33A 3HI2A 2LHRA 1MMGA 1WYBA 4DWSC 3PDYA 2XZEA 5EK4A 2XP8A 5AQOB 5E0OA 1OXZA 4IE6A 4ADZA 4I50E 1X6LA 5FY1A 1HKJA 5J2TE 4JFMA 3RIFA 4YHHT 2WMOA 4Q7NA 4LF9T 2YDSA 2E8IA 2LRLA 3ZPOA 2D2SA 4YTMA 4DH0A 3RFWA 4ODPA 1YXRA 3GU0A 2D5UA 5JR9C 3KBUA 4YJ2E 2LM9A 5KDMC 4F8HA 1BR4A 3KINB 3VKGA 1Y01A 5AQQB 4B3MT 4W9OA 3UI4A 2NW9A 3ARYA 1DU2A 3KADA 3KCEA 2XP3A 1W9PA 4LMKA 4YY3T 5HXHA 2CHOA 2FJDA 5JDLA 2F21A 2XJ7A 4X1YE 1KFYA 2WSSV 3QUJA 4JLEA 3G6LA 1G8XA 4QT2A 1JNTA 3AEAA 3EDVA 2RSEA 3BQKA 3L8RA 3ARTA 4Z2JA 5AQSB 2K9AA 4QH5A 4QXHB 3O5RA 4DMWA 3ZMZB 1YW5A 3Q5DA 1E15A 1MIVA 3AAAB 1HJVA 4DBQA 3C4WA 2FKEA 1I6ZA 1LG1A 2XP7A 1WRDA 3OJAA 4UV8B 1S35A 1SA0E 2V6XA 1KNPA 4DRIA 2UUCT 4ZPWR 1WR0A 3E0ZA 4B3TT 4ISTA 3ONXA 1UUSA 5FVKA 4G63A 4UVAB 1QLBA 4XZCA 1OGGA 1FKTA 1H0GA 4AQYT 4PFOA 5AQVB 5FMNA 3ALFA 3ZLIA 3T1YT 2VWAA 3FBZA 4PJLA 1U4QA 4U86A 4S3KA 5F8PA 3ZEFB 4ODLA 4UIGA 3Q5EA 4IE5A 3RYHE 1TFVA 2YDQA 1QPFA 3WQWA 1NWSA 2VURA 4MNKA 2CM0A 4C90A 4TUYE 2B1EA 1QZ2A 1W1YA 2XQ3A 4HFEA 4WJXA 3ESLA 2VB6A 5H6RB 4URIA 4HTEA 1NMWA 2V8SV 1F8AB 3ZCIA 4JUYA 5CFBA 2HN2A 1FKGA 3WD4A 4LAXA 2BKPA 4GGQA 2E9XC 3RC8A 1UGOA 3MACA 2YK0A 4M1PA 3A5XA 1UX4A 4PJJA 3EY6A 3KAGA 4WW0A 1ZHCA 1JNSA 2ZM6T 1L1PA 4ODQA 1Q6HA 1JVWA 2LLYA 4UELA 4YJ3E 1FKHA 5LA6E 2VCDA 3UU5A 3NRXA 2RUDA 4N78D 1P5QA 3WD3A 1FFQA 2DG3A 3W4RA 3BMBA 2V6YA 4GKKT 3ARZA 1FJGT 3AAEB 3UQ4A 1FD9A 1HJWA 1R8IA
chains in the Genus database with same CATH topology
1GPFA 2AOSA 4PTMA 1OGBA 3WL0A 3FAPA 1J4IA 4DIPA 4ZEYA 4TW8A 1FKLA 2PBCA 2PV2A 2XPAA 4P1NA 2ZR6A 4QZVB 4DRQA 4MPKA 3RGCA 4NNRA 3AS1A 4U84A 3ZSSA 1FKIA 3O5QA 5HW7A 4ODRA 3ZT7A 5GPGA 4HBEA 3KZ7A 4MSPA 1Q6UA 2PV1A 3ARVA 3PRBA 3O5EA 3MDYB 1WCRA 4IQ2A 4QT3A 1OWQA 1E6PA 1FFRA 2A3AA 1Q1CA 1ZBKA 2CPTA 4P8XA 2DSWA 1PBKA 1TCOC 3LUOA 1F40A 5DO2A 1LL7A 2MPKA 4WIWA 2ESCA 3AQUA 2ZR4A 2W2UA 4DZ2A 2JZVA 5DIUA 1LQ0A 4U7IA 1W26A 2UZ5A 1EQ3A 3PRAA 4WKAA 4MAVA 4P8WA 3O5OA 5HBFA 2WWVA 2DSUA 3JXVA 3CGMA 3CHFA 4ITZA 1EDQA 2VN1A 1FKDA 4HARA 4IPXA 1W9UA 1E6ZA 1O6IA 4NSBA 4TNSA 1FKRA 2O92A 3WH0A 1LL6A 1SR0A 2G41A 3B9DA 1WFDA 5D75A 2XP6A 4DRNA 4R5EA 3PRDA 1NWTA 3O5IA 2LGOA 2RPAA 1BL4A 4DZ3A 4DROA 1FKJA 5GPRA 4DRJA 2F2DA 4DWSD 1A7XA 4JFKA 5HW8A 4J4NA 1ZB5A 1N1AA 3K1SA 3O5PA 4U2YA 3O5JA 3WIJA 4DRMA 4ODMA 5LB7B 2V6YB 4CN1A 1NWUA 4CN4A 1JNDA 2PPPA 1J4HA 2DL1A 3WKZA 5CJ5A 1ROUA 3CGNA 1UR8A 1E9LA 2YBTA 5HWCA 3I6CA 2DG9A 1FKFA 5JH8A 3NTPA 1C9HA 1ZU8A 2OFNA 4W9QA 1K9TA 1R9HA 2M2AA 3KABA 1D7JA 1RD6A 1ROTA 1CTNA 2N87A 2KE0A 2ZR5A 3WL1A 2A9UA 3KAHA 3NI6A 3TDBA 4Z2HA 4MNJA 2DT3A 1NWRA 3BXWA 1KFWA 3PR9A 4KR0B 4ML4A 2F4EA 1ZBVA 4Z2LA 3AROA 2M1IA 3KAFA 2ITKA 4U31A 4LAYA 1XRVA 4G50A 4DRHA 4J4OA 2Y78A 3G6MA 4ZPVR 3UI6A 4WKHA 4BF8A 4U85A 3B9EA 2DPEA 2O9OA 2ZQSA 3UQAA 3WD0A 1QPLA 2AWGA 2LJ4A 3OA5A 3B8SA 4WZXA 2WY2A 4CN6A 4Z2KA 2MF9A 2MLZA 3O5DA 4MTVA 3UI5A 3CHEA 3ARXA 4MNMA 2MLXA 3ARWA 2JQ9A 2LPVA 3KAIA 4JYSA 1J6YA 3NRKA 3VAWA 2FAPA 4WKFA 3TCZA 3EABA 1GOIA 2RUQA 2RQSA 2PI6A 2KFWA 4LAVA 4IQCA 4DRPA 2WM0A 2DG4A 1ZK6A 1HKMA 1M5YA 3ARQA 4W9PA 3ZT5A 1Y0OA 1LG2A 1UR9A 4S3JA 3AS3A 2JQKA 1WNOA 1IX5A 3IKGA 2PV3A 1HXVA 2M08A 1ZCNA 1LL4A 3UQBA 1FAPA 4LGXA 4U33A 4TX0A 1NSGA 4DWSC 2WLZA 2RUCA 1WB0A 2XZEA 2XP8A 4JFLA 3GPKA 3ZT6A 4N19A 1NH6A 1X6LA 1B6CA 4LAWA 4FN2A 1HKJA 3ODKA 2DSVA 4JFMA 3FY1A 5HKGA 3ARPA 4Q7NA 4ODOA 5DITA 1HJXA 5BXJA 1X6NA 4TW7A 2LRLA 3JYMA 1U79A 3ARRA 4Q22A 4ODNA 3ALGA 4DH0A 2QF8A 2JQHA 1NMVA 4QIBA 1Q6IA 2OLHA 3RFWA 4ODPA 4L3NA 1YXRA 2A3BA 2IF4A 2PPOA 4U3CA 3O5MA 1BKFA 3UF8A 4W9OA 3UI4A 3OOBA 1ITXA 5HUAA 3ARYA 3KCEA 3KADA 5DIVA 2XP3A 5CGMA 1W9PA 2KI3A 2B31A 3ZSTA 4DRKA 4Z2IA 4WK9A 4AY1A 4TW6A 3WD1A 2F21A 3RMEA 2MPHA 1FKKA 1EHNA 1XHGA 3G6LA 4QT2A 1JNTA 4A5XA 1D7IA 3O5FA 2RSEA 2K8IA 2DT1A 3ARTA 1PINA 1D2KA 2WLYA 5HT1A 3WQVA 4Z2JA 2DT0A 3RM9A 4P8UA 1EIBA 3RM4A 3AS0A 3O5RA 4C02B 4ZS6A 3CH9A 1YW5A 4DWSA 1ZL1A 2Q5AA 1E15A 2A3EA 1FJDA 1HJVA 1KT1A 2FKEA 2XP7A 1LG1A 5HWBA 4ZPTR 3WD2A 4O2TA 1J4RA 2V6XA 4DRIA 4ZPWR 1WR0A 1GUVA 1H0IA 5FVKA 2YBUA 2ZQVA 1OGGA 2LKNA 1FKTA 1H0GA 1VF8A 3JYJA 3CHDA 5DEZA 2WK2A 1YATA 3O5KA 1E6RA 4MNLA 3ALFA 2FDMA 4Z2GA 3IHZA 2XP4A 1KT0A 5FVLA 4S3KA 4U86A 4JFJA 3RM8A 4ODLA 3TC5A 2MLYA 4L72B 2MNTA 2DSZA 4XAKA 1TFVA 2A3CA 3AS2A 1QPFA 2ZQUA 1NWSA 3WQWA 4MNKA 5HTGA 3IKDA 4G2PA 3CZ8A 2LRKA 3KACA 4ODKA 3QOKA 1QZ2A 4U7YA 4DT4A 1W1PA 2XP9A 2CRBA 1D6OA 1EYMA 1W1YA 5B8IC 2L2SA 4MGVA 4WJXA 4TYOA 2KGJA 4URIA 1WAWA 3H9RB 1SYTA 1FKSA 1NMWA 1T11A 1F8AB 2RURA 3CHCA 1LJYA 1HKIA 2XPBA 4U2ZA 3O5LA 1FKBA 4R0XA 4DWSB 1FKGA 1JNEA 3ARSA 3WD4A 3B7XA 4HBOA 4P8VA 5GQBA 2IUZA 4LAXA 4JFIA 4GGQA 2PPNA 4NZCA 1W1VA 1D7HA 4IT6A 1ZBCA 1W1TA 4KQZA 2ZQTA 3IK8A 2XP5A 2DT2A 3EY6A 3FXYA 2KO7A 3KAGA 4FAPA 5I98A 3UQIA 1JNSA 3ARUA 3B9AA 4ODQA 2D9FA 1Q6HA 1L1PA 1W9VA 4W5UA 1JVWA 1FKHA 2VCDA 4NIQA 1ZBWA 2RUDA 4IT4A 5DF0A 1P5QA 1HKKA 2K3WA 3WD3A 1FFQA 2DG3A 3W4RA 1E6NA 4GIVA 2V6YA 3ARZA 3O5GA 2G8ZA 3PA7A 2KR7A 1FD9A 1HJWA 5HW6A 5J6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZST A;  5CJ5 A;  2RPA A;  2XZE A;  2JQH A;  4ZEY A;  4P1N A;  3ZT5 A;  3ZT6 A;  1YXR A;  4U31 A;  2JQ9 A;  2MPK A;  2LRK A;  3ZSS A;  4U2Z A;  4U3C A;  4NIQ A;  2W2U A;  4IT4 A;  3K1S A;  3ZT7 A;  4U2Y A;  2JQK A;  2K3W A;  4U7I A;  4A5X A;  5LB7 B;  3EAB A;  2V6Y B;  1WCR A;  2V6X A;  1WFD A;  5FVL A;  4CN1 A;  4U7Y A;  2V6Y A;  2A9U A;  4U33 A;  1WR0 A;  4CN4 A;  2CRB A;  2LRL A;  4WZX A;  2WY2 A;  5CGM A;  2DL1 A;  5FVK A;  4CN6 A;  2CPT A;  4IT6 A;  2WWV A; 
#chains in the Genus database with same CATH topology
 1OGB A;  3LDQ B;  4TW8 A;  2XQ6 A;  1FKL A;  2PV2 A;  2XPA A;  4NXN T;  2UXC T;  1VOM A;  3TLV A;  3ZSS A;  2FJB A;  3BQI A;  3ARV A;  2XAQ B;  4QT3 A;  1OWQ A;  1YKH B;  1FFR A;  2LM2 A;  3RLF F;  4ZI7 E;  1Q1C A;  2A3A A;  2DSW A;  2OA5 A;  5DO2 A;  5JRE A;  1BR0 A;  4DV1 T;  2D0T A;  2X66 A;  1LQ0 A;  3CPZ A;  5KX5 E;  5J1G A;  3AA1 B;  5FXW A;  3PRA A;  4DV2 T;  1MIY A;  2VL0 A;  2X0H A;  4FJO A;  5HBF A;  5HEU A;  5L3F B;  3CGM A;  3KV6 A;  4ITZ A;  2VN1 A;  2F23 A;  1FKD A;  5LG3 A;  4IDZ A;  1O6I A;  2XQY A;  2CCQ A;  4NUU A;  2V7L A;  2HH7 A;  2FJA A;  3Q5X A;  4H63 H;  3WI3 A;  2X51 A;  3NBX X;  4UVB B;  2XP6 A;  4BAY B;  4O8S A;  2XSB A;  4YHJ A;  1NWT A;  5AQN B;  3U3I A;  4DR2 T;  3FXE B;  3UU6 A;  2Z6E A;  4A56 A;  4HWH A;  2R6G F;  3OKQ A;  2LSJ A;  2DHR A;  5HEG A;  2D0U A;  5FY7 A;  2ZM2 A;  4JFK A;  5HW8 A;  3KV5 A;  3ZCJ A;  3O5P A;  4DRM A;  4ODM A;  2VAS A;  4CN1 A;  2UUB T;  3FZF B;  1JNZ A;  5CJ5 A;  1ROU A;  4Q25 A;  2N1G A;  5A1L A;  2ZMA A;  1ZU8 A;  2OFN A;  4EGW A;  3B13 A;  4E7Z A;  1D7J A;  1RD6 A;  2YDR A;  2A72 A;  4TZ4 C;  1FEW A;  3LK4 2;  2KE0 A;  2B5U B;  3WL1 A;  2KND A;  3H3A A;  3NI6 A;  2VVN A;  2XQ9 A;  3FZK B;  4MNJ A;  2DT3 A;  4Z2H A;  4Z90 A;  3UFE A;  2WCA A;  3AXJ A;  4YSZ A;  3LK3 B;  4DRH A;  4J4O A;  1T7S A;  2Y78 A;  3EUH A;  3AAI A;  2DPE A;  2O9O A;  2XTL A;  2AWG A;  3OA5 A;  3B8S A;  4WZX A;  5FY0 A;  2MF9 A;  3K3N A;  2LKG A;  2BDE A;  1OED A;  3J7Y q;  2MLZ A;  3AE2 A;  4X62 T;  1BR1 A;  3VR9 A;  3PE0 A;  2MLX A;  2M67 A;  1T72 A;  1NWM X;  4QX7 B;  4XBF B;  4U72 A;  2LPV A;  4AI6 A;  2L3L A;  3NRK A;  4WKF A;  1GOI A;  3ANW B;  3KV4 A;  3TLW A;  2LT3 A;  1I94 T;  3JAE A;  1XMQ T;  1W09 A;  3N2G E;  3N9P A;  2VQE T;  4CXX A;  4IGU A;  4DVD A;  3CX6 B;  2JRK A;  2I6H A;  1WNO A;  1HXV A;  2M08 A;  4B3S T;  3UQB A;  3R6N A;  3UQ7 A;  1KEY A;  2CWY A;  3HA4 A;  1NSG A;  2KLQ A;  2UUA T;  1Z8U A;  3OVU A;  2JIW A;  2IAK A;  2K24 A;  2ETN A;  3GPK A;  4N19 A;  3MZK B;  4FN2 A;  5CA0 E;  3F57 A;  2N2N A;  5DIT A;  5LHI B;  2DI4 A;  5LHG B;  1U79 A;  1HG5 A;  3ZJ2 A;  3H3M A;  2JMK A;  3AXJ B;  1HTJ F;  4LF5 T;  2E9X B;  4MFR A;  2A3B A;  2WQY A;  3PUG A;  3G06 A;  2PPO A;  4U3C A;  3O5M A;  3CK6 A;  4IE4 A;  2MTQ A;  3UF8 A;  2WZH A;  3GMI A;  2BBJ A;  2VKJ A;  3HKC E;  5HUA A;  3P50 A;  4BJN A;  2B31 A;  2Y8D A;  4DRK A;  3LJC A;  2XQA A;  3OBV E;  5LNK A;  3O9X A;  5KXJ A;  4OYK A;  2EHO D;  2P9B A;  3P4S A;  3CKD A;  2XAF B;  3L09 A;  2ZLY A;  1YKE B;  2L8K A;  4A5X A;  2FUP A;  1D7I A;  5ADX L;  3PUY F;  3PUS A;  5AQK B;  3RC3 A;  3JAF A;  1D2K A;  3WQV A;  2C0S A;  1X9B A;  4P8U A;  3SFE A;  3RM4 A;  2KMF A;  3TLT A;  1D1B A;  4TWF A;  2QRX A;  3CH9 A;  1X79 A;  3EI0 A;  2Q5A A;  2A3E A;  3IBP A;  1FJD A;  1KK7 A;  3PU3 A;  4HWD A;  3UUB A;  2CMR A;  3QC9 A;  1YW0 A;  2AE9 A;  3WD2 A;  3R84 B;  3ZYM A;  4J2C A;  3ZC0 A;  4IE0 A;  4KMC A;  1GUV A;  1H0I A;  2IHR 1;  2YU1 A;  3N2O A;  2ZQV A;  5LGT B;  2LKN A;  4G2A A;  3CHD A;  3MJX A;  5DEZ A;  2BVL A;  4EZ4 A;  2MBG A;  3FHN A;  2BS3 A;  2BBH A;  4YXD A;  3GWH A;  3ZMS B;  3SRZ A;  4DMV A;  4KP3 C;  3K3O A;  4QH4 A;  1HX1 B;  2LEH A;  4JFJ A;  5LBM A;  4ANJ A;  3TC5 A;  2MLY A;  3FZM B;  3HKE E;  5BR8 T;  4IDP A;  1D0X A;  2PFV A;  5HYA A;  3QOF A;  2PG8 A;  4QH1 A;  2DSZ A;  1Z0P A;  2A3C A;  3NWI A;  2MYS A;  3IHR A;  3Q2M A;  4H9O C;  3IKD A;  4G2P A;  3ETV A;  3GN5 A;  2RA1 A;  3KAC A;  1MMA A;  2X9X A;  2NW8 A;  4LFA T;  3SOL A;  1AJ3 A;  4U7Y A;  2BS4 A;  2XP9 A;  1EYM A;  5B8I C;  2H88 A;  2L2S A;  4TYO A;  2UXX B;  3H9R B;  3V5U A;  3H37 A;  5DAB A;  4TWH A;  3GN5 B;  3CHC A;  5HWY A;  4PW8 A;  2WZI A;  3NRY A;  3PU8 A;  1HG2 A;  2XPB A;  4U2Z A;  1EZ3 A;  1HS7 A;  5L4H A;  1JNE A;  4LMJ A;  3I0Q A;  4P8V A;  2IUZ A;  4JFI A;  2I59 A;  2X9Y A;  4NZC A;  2LSI A;  1D7H A;  3ZYL A;  4IT6 A;  3HR0 A;  1ZBC A;  5FXX A;  2G0U A;  3RKG A;  3FXY A;  1N32 T;  4FAP A;  3P7I A;  4LML A;  4JI2 T;  2D9F A;  1W9V A;  4WNK A;  5JQG E;  4X5T A;  3EAM A;  2WM9 A;  2E5V A;  2VKD A;  1N36 T;  1E44 A;  2V7M A;  4GIV A;  5C8Y E;  4UVC B;  2BKN A;  3PA7 A;  4NXM T;  5J6E A;  1GPF A;  3AEG A;  4ASK A;  1L0V A;  4CI1 B;  1CUN A;  3EVY A;  2I0M A;  2PBC A;  4LF8 T;  3I9Y A;  2ZR6 A;  3VRB A;  3AB3 B;  2IUB A;  4YTP A;  4NNR A;  3SS1 A;  4U84 A;  2XHE B;  4O4H E;  4H9S E;  1HNZ T;  4JYA T;  4HBE A;  1E1H B;  3PRB A;  3O5E A;  1WCR A;  4HFV A;  2VK9 A;  3PUZ F;  4Z91 A;  4QXC B;  3KV9 A;  3LBX B;  1XDO A;  5L4E A;  2LJL A;  2Y48 B;  4P8X A;  1G73 A;  1PBK A;  2HHH T;  1TCO C;  3PTR B;  3O1H A;  1YQ3 A;  4DR4 T;  4TX5 A;  1LRZ A;  2ZR4 A;  1M7K A;  3CML A;  1GRJ A;  2WWU A;  1EQ3 A;  3O1J A;  4ISS A;  3O1I A;  2WWV A;  4EYU A;  2DSU A;  3JXV A;  5HXR A;  1LKX A;  4DND A;  4ILB A;  4HAR A;  4GYR A;  1MND A;  3L39 A;  5HCJ A;  1E6Z A;  2EHO A;  2YKS A;  4NSB A;  4TNS A;  4AKH A;  4TWD A;  2O92 A;  2ACX A;  4TNW A;  2X0L B;  3NZP A;  3B9D A;  1WFD A;  4JI1 T;  4R5E A;  4DR5 T;  3AA6 B;  3KFW X;  4QWN B;  2NW7 A;  4K0K T;  2RPA A;  4LF7 T;  4DRO A;  1CHU A;  4DRJ A;  2F2D A;  1A7X A;  1WR6 A;  1N1A A;  4KHP T;  4U2Y A;  3WIJ A;  4TV9 E;  4GK5 E;  1VCT A;  2LSG A;  4DV3 T;  2CHN A;  2ES0 A;  5ABH A;  3DJB A;  3CGN A;  1UR8 A;  2YBT A;  3AEC A;  1QUU A;  1C9H A;  1UUR A;  4W9Q A;  4COF A;  1R9H A;  2M2A A;  3P8C D;  3AEE A;  2WDV A;  1ROT A;  3KAH A;  2XAG B;  2V5C A;  5LGN B;  4KR0 B;  2F4E A;  3ARO A;  3KVA A;  4P09 A;  4JI5 T;  2ITK A;  3AE1 A;  5LMN T;  5LJM A;  2UXB T;  5AQH B;  5FKY A;  1XRV A;  4G50 A;  2X9W A;  4BF8 A;  5JDN A;  3UQA A;  3PUA A;  4DID B;  5JTG A;  4CN6 A;  5JRC B;  2QA7 A;  3CHE A;  4HFB A;  1ZKE A;  3ARX A;  4TV8 E;  5DJQ C;  1VRB A;  3LSV A;  4X64 T;  3TCZ A;  3EIP A;  2PI6 A;  4IIJ E;  2KFW A;  1HR0 T;  4LAV A;  4X1K E;  2DG4 A;  3MK7 C;  5FL1 A;  2P4V A;  5LXT E;  1M5Y A;  5AQT B;  3ARQ A;  3AEF A;  4DV7 T;  3AE7 A;  4S3J A;  5JR9 A;  4NUV A;  4DV0 T;  1W0A A;  1KF6 A;  1O3X A;  1ZCN A;  2XAH B;  4EB6 E;  1LL4 A;  1E7P A;  4DO0 A;  2GK9 A;  3M65 A;  3PJA A;  4PJN A;  3N9Q A;  2X9H A;  2KIN B;  1WB0 A;  3ZT6 A;  1HNW T;  3K8P C;  3D0T A;  4AQG A;  5AFU L;  4AXP A;  3V5S A;  1B6C A;  4DV6 T;  4LAW A;  3T8O A;  3ODK A;  5L3B B;  4H63 V;  2DSV A;  3FY1 A;  4HFD A;  4BA9 A;  2XM1 A;  4ODO A;  4UF0 A;  3RYC E;  1X6N A;  3B57 A;  2FJE A;  3ARR A;  3ALG A;  2QF8 A;  1NMV A;  4L3N A;  1NEN A;  3B5M A;  4A97 A;  2V7I A;  4X65 T;  1BKF A;  3P4R A;  4YT0 A;  4EYY R;  3RYI E;  1S94 A;  3OOB A;  4I43 B;  4X1I E;  3UTK A;  3ZMU B;  3RKO A;  2JQQ A;  1ITX A;  4OK0 A;  5LBQ B;  5DIV A;  3TLS A;  4OX9 T;  2LHN A;  2PJQ A;  3ZST A;  4TW6 A;  4NPP A;  4DR1 T;  4A98 A;  4C91 A;  1FKK A;  3AVR A;  1EHN A;  3C51 A;  4P0A A;  1V9D A;  3P4P A;  2W00 A;  2LE8 A;  4L0R A;  4CQI A;  3C64 A;  2DT1 A;  2XUE A;  1PIN A;  2WLY A;  2DT0 A;  3RM9 A;  3HL6 A;  3EHZ A;  1EIB A;  3SFD A;  5L2L A;  3P4W A;  1OWA A;  2EHO B;  2KWH A;  4MAL A;  5AQG B;  4DWS A;  5CA1 E;  3F2E A;  3I0O A;  2DWG A;  4ZPT R;  4UXN B;  4O2T A;  2V5D A;  3TLU A;  5CB4 E;  3OTO T;  2UU9 T;  2W4X A;  2NR4 A;  5HWX A;  4DR7 T;  4HKA A;  2RP4 A;  5AQL B;  4AQF A;  3WAJ A;  4L5G A;  2WK2 A;  3PUR A;  3O5K A;  4EED A;  4UDM A;  2M6B A;  5HAX A;  3RI5 A;  2XPK A;  3TKL B;  3LK2 B;  2NP9 A;  4Z2G A;  2PTF A;  3IHZ A;  2HN1 A;  3RQW A;  3F31 A;  1XMO T;  4L72 B;  1IJ5 A;  4LF6 T;  3NKZ A;  2XAS B;  4O2B E;  4OHF A;  4CZZ B;  2DLR A;  1WLX A;  1W9R A;  2ZQU A;  2LRK A;  3PUW F;  4ILA A;  4QKN A;  5IUX A;  3UUL A;  4DT4 A;  2KSR A;  1W1P A;  4L9I A;  2J1D G;  1D6O A;  1OED E;  2WU2 A;  4MGV A;  1HX8 A;  3W15 B;  4TNV A;  4DUY T;  1WAW A;  4EXT A;  3QNU A;  1FKS A;  2A2F X;  1T11 A;  2RUR A;  2WP9 A;  4IRE A;  2LOP A;  3IEE A;  3RGL A;  1FKB A;  3VHL A;  4DWS B;  2H3R A;  3ARS A;  3B7X A;  4V1A v;  4JEH B;  3JAD A;  2NWB A;  3I9W A;  2PPN A;  3ZKR A;  3C4Z A;  1W1V A;  1MMN A;  2DCF A;  2YIN A;  3RIU A;  4PNI A;  1W1T A;  4KQZ A;  2ZQT A;  3JC6 C;  2DT2 A;  3JC6 D;  5I98 A;  5AQI B;  3ARU A;  1T8B A;  5IWA T;  2K5B B;  1LVF A;  4IDQ A;  2VVS A;  4NIQ A;  4IT4 A;  4H9Q C;  5KMG P;  1ZEE A;  4YFS A;  4IDN A;  3CIR A;  1E6N A;  4K0U A;  2Q9Q D;  3O5G A;  2G8Z A;  5ABG A;  3NZQ A;  5HW6 A;  5C2T A;  4O4I E;  2FBW A;  2CEA A;  2AOS A;  3FZL B;  4EAH A;  4ZEY A;  1IBL T;  4QZV B;  4P1N A;  4DRQ A;  1HNX T;  3RGC A;  2W61 A;  2L9Q A;  4UR9 A;  3AS1 A;  1JNR A;  2ACZ A;  1FKI A;  4ODR A;  3ZT7 A;  5FYM A;  5GPG A;  3KZ7 A;  4MSP A;  4B6X A;  1Q6U A;  2PV1 A;  4I55 E;  2JJ9 A;  4IQ2 A;  3C50 A;  3IF8 B;  4MLK A;  5HXC A;  3Q5W A;  4YSY A;  4I4T E;  4AKG A;  1ZBK A;  2CPT A;  3RQU A;  2XAJ B;  3QB5 A;  3ZC1 A;  4HFH A;  3ZMV B;  5FP3 A;  2CE7 A;  3LUO A;  3OPC A;  4ZS2 A;  3PJA J;  1LL7 A;  2MPK A;  4WIW A;  2W2U A;  3RYF E;  4DZ2 A;  1IAP A;  1HFA A;  2JZV A;  3AA7 B;  1VCS A;  4EIW A;  5JDM A;  2UZ5 A;  5DQW A;  5F3J A;  5HEJ A;  4MAV A;  4ZS3 A;  3O5O A;  5LJN A;  4ZXL A;  5ETW A;  2WAU A;  4JI6 T;  4AKL A;  3CHF A;  1EDQ A;  4P0B A;  4CI3 B;  1W9U A;  3KVB A;  4JI0 T;  1FKR A;  3WH0 A;  4IHJ E;  4OFZ A;  4WBN E;  5D75 A;  2W67 A;  4DBR A;  3O4X E;  3M3Z B;  4CXW A;  3PRD A;  1OED B;  3AEB A;  5FNV E;  2H7V C;  2KT9 A;  1BL4 A;  4IL4 A;  4DZ3 A;  1J1J A;  1J5W A;  3MXZ A;  1FKJ A;  4XAX B;  4DWS D;  4KHZ F;  4J4N A;  3K1S A;  4AIU A;  3KDS E;  4LFC T;  5LB7 B;  2V6Y B;  1NWU A;  2VKH A;  4CN4 A;  2VL8 A;  2CBJ A;  2PPP A;  2DL1 A;  2VKO A;  3AE5 A;  2X67 A;  2BG9 C;  2X0Y A;  5HWC A;  3I6C A;  2DG9 A;  3NTP A;  3PUQ A;  2DWK A;  5ABE A;  1CTN A;  3J9X 1;  4ZI2 C;  2ZR5 A;  2V7K A;  2W62 A;  3TDB A;  4ZZB A;  3BXW A;  1KFW A;  3PR9 A;  3IA3 A;  2IDO B;  2M1I A;  1LVK A;  3AED A;  5ABF A;  1D1C A;  2QGS A;  4AKR B;  2F4V T;  3UT5 E;  2AXD S;  3G6M A;  4ZPV R;  3UI6 A;  4WKH A;  4I0U A;  2BZB A;  3B9E A;  3ETU A;  4PFP A;  3VR8 A;  4ILC A;  3WD0 A;  3KBT A;  1QPL A;  2LJ4 A;  5HXS A;  4QX8 B;  2WY2 A;  2OLT A;  1D1A A;  5L47 A;  4MTV A;  2Y6X A;  3UI5 A;  4MNM A;  3ZJ1 A;  3PUV F;  2JQ9 A;  5C3J A;  2ODV A;  4JYS A;  2E2A A;  1J6Y A;  1XWM A;  3MKD A;  1MMD A;  2WMN A;  4Z8X A;  4IDO A;  3LFM A;  2FAP A;  1XZY A;  3AA0 B;  4EZH A;  2RUQ A;  2RQS A;  2IML A;  3E22 E;  2QYW A;  3CQC B;  5LMU T;  4HFC A;  1T98 A;  2WM0 A;  2V7J A;  1UK5 A;  4DR6 T;  1ZK6 A;  3HKB E;  4KI0 F;  1N34 T;  3ONJ A;  1HKM A;  4W9P A;  3ZT5 A;  5JR9 B;  3AS3 A;  4PAG A;  5FXV A;  3IKG A;  3GTY X;  1E2A A;  2IC9 A;  4EV6 A;  1D0Y A;  2Q9Q A;  4TX0 A;  4H9R C;  4JBW F;  2WLZ A;  2RUC A;  3HKD E;  3CX7 B;  3GA8 A;  4JFL A;  1NH6 A;  4AIS A;  5FL0 A;  1B7T A;  4AQF C;  1SUM B;  2CXL A;  5LG4 A;  4DUZ T;  5HKG A;  3ARP A;  1HJX A;  5BXJ A;  4TW7 A;  1NAF A;  4HWI B;  3JYM A;  4KBM B;  3BQL A;  3DP7 A;  5EZY E;  4Q22 A;  4ODN A;  1XNR T;  2Q9Q C;  3LG7 A;  3CX8 B;  2JQH A;  4QIB A;  1Q6I A;  2OLH A;  4HN9 A;  3ZYK A;  2IF4 A;  1W0B A;  1XNQ T;  3AE8 A;  5AQM B;  1JCH B;  1UCU A;  4QHO A;  4UV9 B;  2WU5 A;  3CQX C;  5JH7 E;  5CGM A;  2MAW A;  2KI3 A;  2E9X D;  2OV9 A;  2NTY A;  4Z2I A;  4WK9 A;  5LOV E;  4AY1 A;  3N9L A;  5J2U E;  3WD1 A;  3RME A;  2MPH A;  5LCY A;  2BG9 A;  3Q9D A;  1IZN B;  1XHG A;  2M6I A;  4H9N C;  4HEA A;  4ILU A;  4HGA A;  1OED C;  5HXE A;  4E7S A;  3FBL A;  5LYJ E;  3A8Y C;  3VKH A;  3O5F A;  2CLY B;  3ANW A;  2K8I A;  5HT1 A;  1IBK T;  4LFB T;  3AS0 A;  4C02 B;  2JPF A;  4ZS6 A;  2IC6 A;  3BK9 A;  3S4U A;  3RH3 A;  1ZL1 A;  5FXZ A;  3SWH A;  2YEV C;  3ZN1 B;  1KT1 A;  4YLH A;  5HWB A;  4O4L E;  1YD8 G;  5L3D B;  4GYS A;  2H7O A;  2VQF T;  2WDR A;  5L3E B;  1J4R A;  2W66 A;  4CXY A;  1J5E T;  2UXD T;  2YBU A;  3P4Q A;  1IBM T;  1VF8 A;  3JYJ A;  1XDP A;  4HFI A;  1YAT A;  1E6R A;  5LGU B;  4MNL A;  1KNR A;  2KWI B;  2FDM A;  3UUN A;  4PK6 A;  2XP4 A;  4FI5 A;  1KT0 A;  2HPL A;  5FVL A;  2E5L T;  2BKO A;  3RM8 A;  1QSD A;  4BJM A;  2MNT A;  3RF1 A;  2XSA A;  4EOZ B;  4XAK A;  1D0Z A;  3AS2 A;  5HTG A;  3ZN0 B;  3CZ8 A;  2J4G A;  5TAO A;  3RRW A;  3AE9 A;  3E08 A;  4ZOL E;  4ODK A;  4ERR A;  5JDG A;  3QOK A;  1MIW A;  5JDQ A;  4UF0 B;  2IIU A;  5DQV A;  3N9M A;  2CRB A;  3UUM A;  3FZH B;  2KGJ A;  3QB5 K;  1SYT A;  4JI4 T;  4ZI3 D;  1LJY A;  1HKI A;  5LP6 E;  3O5L A;  4R0X A;  3OYZ A;  2JMH A;  4UEM A;  2WS3 A;  4HBO A;  5GQB A;  2LOS A;  3FB2 A;  2HPJ A;  2V26 A;  1H7C A;  3IK8 A;  1U5P A;  2XP5 A;  2XQ4 A;  2KO7 A;  1M62 A;  3UQI A;  3B9A A;  1SHZ C;  4W5U A;  2CA5 A;  4B3R T;  4U74 A;  2BS2 A;  5AQR B;  3RIU C;  1ZBW A;  5DF0 A;  5AQU B;  1HKK A;  5GON E;  2K3W A;  3C4X A;  3VU7 H;  2J62 A;  5M4Y A;  2C5J A;  4DR3 T;  3AVS A;  1NEK A;  4AKI A;  3RHW A;  2KR7 A;  4KX6 A;  2KXP B;  3WL0 A;  4PTM A;  4WYV A;  5AQP B;  1N33 T;  3FAP A;  1J4I A;  3VRA A;  4DIP A;  2LKH A;  3RX6 A;  4MPK A;  3N5L A;  5AQJ B;  2LSY A;  2XQ5 A;  5BMV E;  5ABF B;  3O5Q A;  5HW7 A;  2J47 A;  3I1A A;  2ZM8 A;  3MDY B;  2CXD A;  2NTX A;  1E6P A;  5HEO A;  4EEB A;  2IW5 B;  3ABV A;  3NVO A;  3AE4 A;  3AE3 A;  3WAK A;  4YSX A;  1ZV4 X;  5J0Z A;  5L3C B;  1GQE A;  3K3Q C;  4LF4 T;  1F40 A;  1MNE A;  4JI3 T;  1KNZ A;  2ESC A;  4O4J E;  4YTN A;  3AQU A;  2XY8 B;  2BG9 E;  2YOE A;  4ZZC A;  2A3D A;  5DIU A;  2B76 A;  4U7I A;  1W26 A;  5JVD E;  4WKA A;  4P8W A;  2W63 A;  4IL9 A;  5JRC A;  2E9X A;  1FIO A;  3AE6 A;  4GK0 E;  2PN0 A;  4O2A E;  2EHO C;  2EUL A;  2LSK A;  4IPX A;  3UFG A;  1ZP0 A;  4ZHQ E;  1LL6 A;  1SR0 A;  2G41 A;  5HEH A;  3X1D A;  4DV5 T;  4CI2 B;  2V1D B;  2C5K T;  4JV5 T;  4DRN A;  3A7M A;  3O5I A;  1HF8 A;  3PV0 F;  2ZM0 A;  2LGO A;  3ONL C;  2PBI A;  3N9O A;  2ODU A;  2BG9 B;  4JI8 T;  3QK6 A;  4ZI3 C;  5GPR A;  2CXF A;  2W0G A;  2K48 A;  4X20 E;  1ZB5 A;  3FXD B;  3CQG B;  5EK2 A;  3O5J A;  2WBL A;  2WDQ A;  4DV4 T;  4TN7 B;  2DNX A;  4GIW A;  3JCF A;  2MOZ A;  1JND A;  1J4H A;  3WKZ A;  4HE8 A;  2SPC A;  3LBX A;  5JDH A;  3T1H T;  1E9L A;  4ZI2 D;  1FKF A;  5IYZ E;  5JH8 A;  4PK4 A;  5LHH B;  3OYX A;  1WYC A;  4PJM A;  5L3G B;  1K9T A;  2XQ7 A;  2UXN B;  3KAB A;  2N87 A;  2N9D A;  1Y64 B;  5EK3 A;  2A9U A;  4IE7 A;  2X68 A;  2NOX A;  1NWR A;  3ZMT B;  3C98 B;  3CVR A;  4MHC A;  4ML4 A;  1ZBV A;  4H9P C;  4Z2L A;  2CBI A;  3KAF A;  2YN6 A;  4U31 A;  4HWC A;  3U78 A;  3MA9 A;  4LAY A;  4GKJ T;  3N2K E;  5H6Q B;  4WBO A;  3PUX F;  4U85 A;  4X66 T;  2ZQS A;  5IHY A;  3CWZ B;  3EDU A;  2WB5 A;  4Z2K A;  4PK5 A;  4MBQ A;  2CLY C;  1ZOY A;  3O5D A;  3DTO A;  1US7 B;  2XM2 A;  4OYJ A;  1BR2 A;  2CWO A;  4GOU A;  3UU8 A;  3ARW A;  2QVA A;  2YU2 A;  3KAI A;  5HCM A;  1UX5 A;  5AQF B;  3N9N A;  1SE7 A;  4JI7 T;  3VAW A;  3EAB A;  1FMV A;  4QXB B;  4F6R C;  3UU4 A;  5F5W A;  4IQC A;  2BVM A;  4KUM B;  4JEU B;  4DRP A;  1YQ4 A;  3L3P A;  3UU3 A;  2KZ7 B;  1Y0O A;  3RRC A;  2XQ8 A;  1LG2 A;  3RIA A;  1UR9 A;  4HWF A;  1FMW A;  1IJ6 A;  2JQK A;  2C5I T;  5JDF A;  1IX5 A;  2H89 A;  2PV3 A;  2D9D A;  3RPU A;  2Q9Q B;  1HCI A;  3UUX B;  1FAP A;  4LGX A;  4U33 A;  3HI2 A;  2LHR A;  1MMG A;  1WYB A;  4DWS C;  3PDY A;  2XZE A;  5EK4 A;  2XP8 A;  5AQO B;  5E0O A;  1OXZ A;  4IE6 A;  4ADZ A;  4I50 E;  1X6L A;  5FY1 A;  1HKJ A;  5J2T E;  4JFM A;  3RIF A;  4YHH T;  2WMO A;  4Q7N A;  4LF9 T;  2YDS A;  2E8I A;  2LRL A;  3ZPO A;  2D2S A;  4YTM A;  4DH0 A;  3RFW A;  4ODP A;  1YXR A;  3GU0 A;  2D5U A;  5JR9 C;  3KBU A;  4YJ2 E;  2LM9 A;  5KDM C;  4F8H A;  1BR4 A;  3KIN B;  3VKG A;  1Y01 A;  5AQQ B;  4B3M T;  4W9O A;  3UI4 A;  2NW9 A;  3ARY A;  1DU2 A;  3KAD A;  3KCE A;  2XP3 A;  1W9P A;  4LMK A;  4YY3 T;  5HXH A;  2CHO A;  2FJD A;  5JDL A;  2F21 A;  2XJ7 A;  4X1Y E;  1KFY A;  2WSS V;  3QUJ A;  4JLE A;  3G6L A;  1G8X A;  4QT2 A;  1JNT A;  3AEA A;  3EDV A;  2RSE A;  3BQK A;  3L8R A;  3ART A;  4Z2J A;  5AQS B;  2K9A A;  4QH5 A;  4QXH B;  3O5R A;  4DMW A;  3ZMZ B;  1YW5 A;  3Q5D A;  1E15 A;  1MIV A;  3AAA B;  1HJV A;  4DBQ A;  3C4W A;  2FKE A;  1I6Z A;  1LG1 A;  2XP7 A;  1WRD A;  3OJA A;  4UV8 B;  1S35 A;  1SA0 E;  2V6X A;  1KNP A;  4DRI A;  2UUC T;  4ZPW R;  1WR0 A;  3E0Z A;  4B3T T;  4IST A;  3ONX A;  1UUS A;  5FVK A;  4G63 A;  4UVA B;  1QLB A;  4XZC A;  1OGG A;  1FKT A;  1H0G A;  4AQY T;  4PFO A;  5AQV B;  5FMN A;  3ALF A;  3ZLI A;  3T1Y T;  2VWA A;  3FBZ A;  4PJL A;  1U4Q A;  4U86 A;  4S3K A;  5F8P A;  3ZEF B;  4ODL A;  4UIG A;  3Q5E A;  4IE5 A;  3RYH E;  1TFV A;  2YDQ A;  1QPF A;  3WQW A;  1NWS A;  2VUR A;  4MNK A;  2CM0 A;  4C90 A;  4TUY E;  2B1E A;  1QZ2 A;  1W1Y A;  2XQ3 A;  4HFE A;  4WJX A;  3ESL A;  2VB6 A;  5H6R B;  4URI A;  4HTE A;  1NMW A;  2V8S V;  1F8A B;  3ZCI A;  4JUY A;  5CFB A;  2HN2 A;  1FKG A;  3WD4 A;  4LAX A;  2BKP A;  4GGQ A;  2E9X C;  3RC8 A;  1UGO A;  3MAC A;  2YK0 A;  4M1P A;  3A5X A;  1UX4 A;  4PJJ A;  3EY6 A;  3KAG A;  4WW0 A;  1ZHC A;  1JNS A;  2ZM6 T;  1L1P A;  4ODQ A;  1Q6H A;  1JVW A;  2LLY A;  4UEL A;  4YJ3 E;  1FKH A;  5LA6 E;  2VCD A;  3UU5 A;  3NRX A;  2RUD A;  4N78 D;  1P5Q A;  3WD3 A;  1FFQ A;  2DG3 A;  3W4R A;  3BMB A;  2V6Y A;  4GKK T;  3ARZ A;  1FJG T;  3AAE B;  3UQ4 A;  1FD9 A;  1HJW A;  1R8I A; 
#chains in the Genus database with same CATH homology
 1GPF A;  2AOS A;  4PTM A;  1OGB A;  3WL0 A;  3FAP A;  1J4I A;  4DIP A;  4ZEY A;  4TW8 A;  1FKL A;  2PBC A;  2PV2 A;  2XPA A;  4P1N A;  2ZR6 A;  4QZV B;  4DRQ A;  4MPK A;  3RGC A;  4NNR A;  3AS1 A;  4U84 A;  3ZSS A;  1FKI A;  3O5Q A;  5HW7 A;  4ODR A;  3ZT7 A;  5GPG A;  4HBE A;  3KZ7 A;  4MSP A;  1Q6U A;  2PV1 A;  3ARV A;  3PRB A;  3O5E A;  3MDY B;  1WCR A;  4IQ2 A;  4QT3 A;  1OWQ A;  1E6P A;  1FFR A;  2A3A A;  1Q1C A;  1ZBK A;  2CPT A;  4P8X A;  2DSW A;  1PBK A;  1TCO C;  3LUO A;  1F40 A;  5DO2 A;  1LL7 A;  2MPK A;  4WIW A;  2ESC A;  3AQU A;  2ZR4 A;  2W2U A;  4DZ2 A;  2JZV A;  5DIU A;  1LQ0 A;  4U7I A;  1W26 A;  2UZ5 A;  1EQ3 A;  3PRA A;  4WKA A;  4MAV A;  4P8W A;  3O5O A;  5HBF A;  2WWV A;  2DSU A;  3JXV A;  3CGM A;  3CHF A;  4ITZ A;  1EDQ A;  2VN1 A;  1FKD A;  4HAR A;  4IPX A;  1W9U A;  1E6Z A;  1O6I A;  4NSB A;  4TNS A;  1FKR A;  2O92 A;  3WH0 A;  1LL6 A;  1SR0 A;  2G41 A;  3B9D A;  1WFD A;  5D75 A;  2XP6 A;  4DRN A;  4R5E A;  3PRD A;  1NWT A;  3O5I A;  2LGO A;  2RPA A;  1BL4 A;  4DZ3 A;  4DRO A;  1FKJ A;  5GPR A;  4DRJ A;  2F2D A;  4DWS D;  1A7X A;  4JFK A;  5HW8 A;  4J4N A;  1ZB5 A;  1N1A A;  3K1S A;  3O5P A;  4U2Y A;  3O5J A;  3WIJ A;  4DRM A;  4ODM A;  5LB7 B;  2V6Y B;  4CN1 A;  1NWU A;  4CN4 A;  1JND A;  2PPP A;  1J4H A;  2DL1 A;  3WKZ A;  5CJ5 A;  1ROU A;  3CGN A;  1UR8 A;  1E9L A;  2YBT A;  5HWC A;  3I6C A;  2DG9 A;  1FKF A;  5JH8 A;  3NTP A;  1C9H A;  1ZU8 A;  2OFN A;  4W9Q A;  1K9T A;  1R9H A;  2M2A A;  3KAB A;  1D7J A;  1RD6 A;  1ROT A;  1CTN A;  2N87 A;  2KE0 A;  2ZR5 A;  3WL1 A;  2A9U A;  3KAH A;  3NI6 A;  3TDB A;  4Z2H A;  4MNJ A;  2DT3 A;  1NWR A;  3BXW A;  1KFW A;  3PR9 A;  4KR0 B;  4ML4 A;  2F4E A;  1ZBV A;  4Z2L A;  3ARO A;  2M1I A;  3KAF A;  2ITK A;  4U31 A;  4LAY A;  1XRV A;  4G50 A;  4DRH A;  4J4O A;  2Y78 A;  3G6M A;  4ZPV R;  3UI6 A;  4WKH A;  4BF8 A;  4U85 A;  3B9E A;  2DPE A;  2O9O A;  2ZQS A;  3UQA A;  3WD0 A;  1QPL A;  2AWG A;  2LJ4 A;  3OA5 A;  3B8S A;  4WZX A;  2WY2 A;  4CN6 A;  4Z2K A;  2MF9 A;  2MLZ A;  3O5D A;  4MTV A;  3UI5 A;  3CHE A;  3ARX A;  4MNM A;  2MLX A;  3ARW A;  2JQ9 A;  2LPV A;  3KAI A;  4JYS A;  1J6Y A;  3NRK A;  3VAW A;  2FAP A;  4WKF A;  3TCZ A;  3EAB A;  1GOI A;  2RUQ A;  2RQS A;  2PI6 A;  2KFW A;  4LAV A;  4IQC A;  4DRP A;  2WM0 A;  2DG4 A;  1ZK6 A;  1HKM A;  1M5Y A;  3ARQ A;  4W9P A;  3ZT5 A;  1Y0O A;  1LG2 A;  1UR9 A;  4S3J A;  3AS3 A;  2JQK A;  1WNO A;  1IX5 A;  3IKG A;  2PV3 A;  1HXV A;  2M08 A;  1ZCN A;  1LL4 A;  3UQB A;  1FAP A;  4LGX A;  4U33 A;  4TX0 A;  1NSG A;  4DWS C;  2WLZ A;  2RUC A;  1WB0 A;  2XZE A;  2XP8 A;  4JFL A;  3GPK A;  3ZT6 A;  4N19 A;  1NH6 A;  1X6L A;  1B6C A;  4LAW A;  4FN2 A;  1HKJ A;  3ODK A;  2DSV A;  4JFM A;  3FY1 A;  5HKG A;  3ARP A;  4Q7N A;  4ODO A;  5DIT A;  1HJX A;  5BXJ A;  1X6N A;  4TW7 A;  2LRL A;  3JYM A;  1U79 A;  3ARR A;  4Q22 A;  4ODN A;  3ALG A;  4DH0 A;  2QF8 A;  2JQH A;  1NMV A;  4QIB A;  1Q6I A;  2OLH A;  3RFW A;  4ODP A;  4L3N A;  1YXR A;  2A3B A;  2IF4 A;  2PPO A;  4U3C A;  3O5M A;  1BKF A;  3UF8 A;  4W9O A;  3UI4 A;  3OOB A;  1ITX A;  5HUA A;  3ARY A;  3KCE A;  3KAD A;  5DIV A;  2XP3 A;  5CGM A;  1W9P A;  2KI3 A;  2B31 A;  3ZST A;  4DRK A;  4Z2I A;  4WK9 A;  4AY1 A;  4TW6 A;  3WD1 A;  2F21 A;  3RME A;  2MPH A;  1FKK A;  1EHN A;  1XHG A;  3G6L A;  4QT2 A;  1JNT A;  4A5X A;  1D7I A;  3O5F A;  2RSE A;  2K8I A;  2DT1 A;  3ART A;  1PIN A;  1D2K A;  2WLY A;  5HT1 A;  3WQV A;  4Z2J A;  2DT0 A;  3RM9 A;  4P8U A;  1EIB A;  3RM4 A;  3AS0 A;  3O5R A;  4C02 B;  4ZS6 A;  3CH9 A;  1YW5 A;  4DWS A;  1ZL1 A;  2Q5A A;  1E15 A;  2A3E A;  1FJD A;  1HJV A;  1KT1 A;  2FKE A;  2XP7 A;  1LG1 A;  5HWB A;  4ZPT R;  3WD2 A;  4O2T A;  1J4R A;  2V6X A;  4DRI A;  4ZPW R;  1WR0 A;  1GUV A;  1H0I A;  5FVK A;  2YBU A;  2ZQV A;  1OGG A;  2LKN A;  1FKT A;  1H0G A;  1VF8 A;  3JYJ A;  3CHD A;  5DEZ A;  2WK2 A;  1YAT A;  3O5K A;  1E6R A;  4MNL A;  3ALF A;  2FDM A;  4Z2G A;  3IHZ A;  2XP4 A;  1KT0 A;  5FVL A;  4S3K A;  4U86 A;  4JFJ A;  3RM8 A;  4ODL A;  3TC5 A;  2MLY A;  4L72 B;  2MNT A;  2DSZ A;  4XAK A;  1TFV A;  2A3C A;  3AS2 A;  1QPF A;  2ZQU A;  1NWS A;  3WQW A;  4MNK A;  5HTG A;  3IKD A;  4G2P A;  3CZ8 A;  2LRK A;  3KAC A;  4ODK A;  3QOK A;  1QZ2 A;  4U7Y A;  4DT4 A;  1W1P A;  2XP9 A;  2CRB A;  1D6O A;  1EYM A;  1W1Y A;  5B8I C;  2L2S A;  4MGV A;  4WJX A;  4TYO A;  2KGJ A;  4URI A;  1WAW A;  3H9R B;  1SYT A;  1FKS A;  1NMW A;  1T11 A;  1F8A B;  2RUR A;  3CHC A;  1LJY A;  1HKI A;  2XPB A;  4U2Z A;  3O5L A;  1FKB A;  4R0X A;  4DWS B;  1FKG A;  1JNE A;  3ARS A;  3WD4 A;  3B7X A;  4HBO A;  4P8V A;  5GQB A;  2IUZ A;  4LAX A;  4JFI A;  4GGQ A;  2PPN A;  4NZC A;  1W1V A;  1D7H A;  4IT6 A;  1ZBC A;  1W1T A;  4KQZ A;  2ZQT A;  3IK8 A;  2XP5 A;  2DT2 A;  3EY6 A;  3FXY A;  2KO7 A;  3KAG A;  4FAP A;  5I98 A;  3UQI A;  1JNS A;  3ARU A;  3B9A A;  4ODQ A;  2D9F A;  1Q6H A;  1L1P A;  1W9V A;  4W5U A;  1JVW A;  1FKH A;  2VCD A;  4NIQ A;  1ZBW A;  2RUD A;  4IT4 A;  5DF0 A;  1P5Q A;  1HKK A;  2K3W A;  3WD3 A;  1FFQ A;  2DG3 A;  3W4R A;  1E6N A;  4GIV A;  2V6Y A;  3ARZ A;  3O5G A;  2G8Z A;  3PA7 A;  2KR7 A;  1FD9 A;  1HJW A;  5HW6 A;  5J6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...