4IT4A

Crystal structure of residues 1-211 of cg17282
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
207
Chain Sequence
DWYVGTEWEDKNRGLAKKVIGLQFTEMDKPTIISTVEFSVNKKATNLGGRPSKYLVSDTYPQKHSLEMGTSLTAVDCYLELLLQQFVPGETAACSITTKTGERIEFELKLEKIVKNTQVEKLSAAEIYEVALRLKESGVATFKTFPKFAFDYFVRAAKLLITYKPFDKLTKKTNGINGQAVEELFIQIQTNLAACLLQEKRYEHVIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords CG17282
publication title Noncanonical FK506-Binding Protein BDBT Binds DBT to Enhance Its Circadian Function and Forms Foci at Night.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 59
structure length 207
sequence length 210
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18023 FKBP_N_2 BDBT FKBP like N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4it4A02
3.10.50.60 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4it4A01
2K3WA 4U7IA 1WCRA 2JQKA 2V6XA 4U2ZA 2WY2A 4A5XA 2MPKA 2LRKA 2V6YB 2RPAA 4U31A 4U2YA 2V6YA 3ZSSA 2LRLA 3ZSTA 4P1NA 3K1SA 5FVKA 2CRBA 5LB7B 1WFDA 4CN6A 4IT4A 4CN1A 5CJ5A 2JQ9A 4U33A 4CN4A 4IT6A 2JQHA 2DL1A 3ZT5A 3ZT7A 4U3CA 4U7YA 1WR0A 5FVLA 3EABA 2W2UA 4ZEYA 2A9UA 2XZEA 2WWVA 5CGMA 1YXRA 3ZT6A 2CPTA 4WZXA 4NIQA
chains in the Genus database with same CATH superfamily
3IKGA 4ODPA 3OTOT 4ZI7E 2ZQVA 1YW0A 2DG4A 2AWGA 4ZHQE 3WD1A 3L8RA 3KFWX 3QK6A 5GPGA 3UULA 2XQ5A 4U85A 2PN0A 2YOEA 1WYCA 4AIUA 1FFQA 5HWYA 2XY8B 3ZYLA 5CB4E 3GTYX 2K5BB 4QKNA 4B6XA 3LBXB 3B5MA 5FXVA 5AQRB 2MF9A 1SA0E 3EI0A 1Y0OA 3AE7A 4UDMA 2JQQA 2JMKA 2XAHB 1WR6A 4DR4T 3ZT5A 3PUZF 1QPFA 2BS2A 3VAWA 4QH5A 3SFDA 1LQ0A 5LBQB 4X5TA 3IA3A 4UIGA 3TLSA 3UI5A 3UI6A 2ODVA 2WAUA 5L47A 2OA5A 4KBMB 4IT6A 3UUMA 3PRDA 4CXYA 4GOUA 4WKFA 3RGCA 5ETWA 3JXVA 5LP6E 4PK5A 1HG2A 3QNUA 1D0XA 4WZXA 5LGUB 1YW5A 4AKGA 2CWYA 5E0OA 3LBXA 4H9NC 3NZQA 4W9PA 5HW7A 4MLKA 2KSRA 2N87A 1UK5A 3P8CD 4HGAA 1XMQT 4U3CA 5J2UE 5AQSB 3T8OA 2XPAA 1UX5A 4XZCA 2DPEA 2DT3A 2V7LA 5B8IC 5ADXL 1ZBKA 4AXPA 1X6LA 4DRHA 4EB6E 3MZKB 5IYZE 1FKHA 1W9UA 4CXWA 1FD9A 3TKLB 4N19A 2W66A 4ODOA 1ZHCA 4TUYE 3RM4A 3AEFA 1ZKEA 3OYZA 4IL4A 4XAXB 2ZR4A 3WQVA 1HTJF 5FY7A 4ILBA 4GKJT 3UQBA 2VK9A 4ZI2C 4ZXLA 3AQUA 2LSYA 3AE4A 4UEMA 1JNRA 5GONE 1EYMA 1MMAA 4YJ3E 3VU7H 3C4WA 3IBPA 3B9DA 3I9YA 1HFAA 3AE8A 4GK5E 4O8SA 3RIAA 4TYOA 1IBLT 2ES0A 2Q9QB 5JVDE 4IGUA 4YHJA 3ESLA 4WIWA 4JI8T 4QX7B 2OLTA 3ETVA 2VB6A 4AI6A 1K9TA 4O4JE 2YN6A 1W1VA 3M3ZB 5L4HA 2P4VA 1G8XA 2YU2A 3ZC1A 4HBEA 5J6EA 4P1NA 2HPLA 4MBQA 3VR9A 4YXDA 4YSYA 5L3BB 5H6RB 4XAKA 4HTEA 1SR0A 5JRCB 1WR0A 2WK2A 3KBUA 1HR0T 2BKPA 2X9WA 3MACA 4U7IA 2CHOA 2DI4A 3SOLA 4L3NA 1FIOA 2LKHA 4O4LE 4DRPA 2FJDA 1X9BA 2LRLA 4ADZA 2JIWA 5DQWA 1L0VA 2LSIA 2IC6A 2DL1A 1N1AA 1T8BA 2H3RA 2Q9QA 2WB5A 4DRKA 2J47A 1OGGA 3EVYA 4UF0B 3LSVA 1N33T 4LF9T 2V5CA 2JQKA 1XWMA 2LHNA 2XQ6A 3ARWA 2KWHA 3UU5A 1D1CA 4ILAA 2KGJA 1KFWA 5L3GB 2DT2A 3AE3A 4AY1A 5AQOB 4YJ2E 2IW5B 4ZZCA 3PUSA 3GN5A 1HJVA 3DJBA 3ZMSB 5L2LA 2QGSA 5JRCA 4O2AE 1P5QA 3K8PC 3PJAJ 3ZMVB 4Q25A 4ANJA 2IUZA 3RKOA 3KVAA 2UXCT 1R8IA 1FKDA 3SFEA 2ZM0A 4LAVA 3Q5WA 5LYJE 4DMWA 2DWKA 5JDHA 2XM2A 2C5IT 3HR0A 1LVFA 4IDPA 4UF0A 3KADA 2VVSA 3ALGA 2LOPA 3HKDE 3AA7B 3CX6B 3I0QA 2VURA 1VRBA 5FXZA 5L3DB 4U2YA 3QUJA 2A2FX 3B13A 3WAJA 4TX0A 3AEAA 2D0TA 1NH6A 4JFJA 3ONJA 1TFVA 2G8ZA 5ABHA 4ISTA 2E8IA 3WD4A 4QHOA 4DWSD 4HARA 5KMGP 4JFKA 3OJAA 3GU0A 1VF8A 4BF8A 4PW8A 5BR8T 4JFLA 4C91A 2XP9A 2MOZA 4MNLA 3ABVA 3L39A 2C5KT 3CQXC 5LHHB 5AFUL 1QLBA 3RYHE 3AAIA 4EGWA 5HWBA 4DV0T 2KNDA 2VL0A 4I55E 1RD6A 4IIJE 2MTQA 3JAEA 3TCZA 4DRMA 5LG3A 3WIJA 5JR9B 1H0GA 2JQ9A 3KAIA 2ETNA 2GK9A 1UURA 2LSGA 3AA0B 3JCFA 3ZCIA 2L2SA 1XNRT 2IIUA 2N2NA 4IQCA 5AQKB 2XP8A 2Q9QC 1JCHB 1FKKA 2K8IA 2M1IA 3ETUA 5FNVE 5HAXA 2PPNA 1V9DA 4L9IA 4X1IE 4BJMA 4ZI2D 2MLZA 5DF0A 4HE8A 5FL0A 1QZ2A 4ZPWR 3F57A 1Z0PA 3PDYA 4LMJA 3ARQA 4WBNE 3O5IA 3CKDA 4LF4T 2UXXB 3O5DA 2X0LB 5HBFA 5JDMA 3G6LA 4KQZA 5JR9A 1NMWA 4GKKT 2D9FA 1HG5A 2M08A 3WAKA 1YQ4A 4DMVA 2RSEA 3N2KE 2ZM6T 3PUYF 2WU5A 2JRKA 2V6YB 2H88A 4QX8B 2W4XA 3KAGA 2FJEA 2W63A 3K1SA 2WWUA 4DWSB 3CHFA 4JYSA 4JEHB 1CTNA 2R6GF 5JDFA 4DZ3A 2XAQB 1JNEA 1OWQA 3PE0A 5AQVB 2F21A 2WLZA 1GQEA 5AQNB 3Q9DA 2IC9A 4A97A 1DU2A 3MDYB 4O4HE 3A8YC 4H9OC 2RP4A 4KHZF 5AQLB 5TAOA 4U33A 1CHUA 1W1YA 2F4EA 2X9HA 5FP3A 1X79A 4EOZB 4XBFB 1W1TA 1YKEB 2NOXA 5AQTB 2HPJA 3KDSE 2FKEA 1N34T 1XDOA 2PV1A 4R5EA 2V6YA 2X68A 3FB2A 3KV5A 4IE0A 4YT0A 4W9QA 1I94T 3WI3A 2WMNA 1HKIA 3P7IA 3ALFA 3RMEA 2DWGA 4DWSA 3FXDB 2ZM8A 4ODNA 1ZP0A 1JNSA 3Q2MA 1FJGT 2CPTA 3B57A 2RUCA 3CZ8A 4I4TE 1EQ3A 4I50E 5JQGE 4JLEA 4LFBT 2DNXA 4E7ZA 3TLVA 2KXPB 3UFGA 3DTOA 2XQYA 4TNVA 4P8UA 3KZ7A 4YSXA 2AOSA 2LM9A 2KMFA 3J9X1 1WNOA 2A3AA 3UFEA 1J5WA 2K3WA 4JBWF 1E6ZA 2LT3A 2H7OA 4B3TT 5KXJA 5AQUB 3NWIA 3MA9A 1M62A 1C9HA 1YD8G 3CVRA 4S3KA 3FZFB 4N78D 4OHFA 2CBIA 4QH4A 2B1EA 2XAJB 4B3RT 3S4UA 2XQAA 3JADA 2WLYA 2K24A 2I0MA 4HN9A 4DRJA 1XHGA 4MNMA 3RX6A 3AROA 4G2AA 4NZCA 3FXEB 1MMDA 3EY6A 4YY3T 2B76A 2E9XB 4TWFA 2QA7A 1JNZA 1HJXA 1MNEA 3HKCE 4QT2A 4HFBA 3ZKRA 2J1DG 5JTGA 4U74A 3VKHA 4G2PA 5KX5E 2A3BA 3VHLA 2XTLA 5HUAA 2BS4A 1EHNA 3X1DA 1HS7A 1T11A 2LEHA 4HFDA 4IDNA 3IHZA 1B6CA 2UU9T 3TC5A 1KT0A 4J2CA 3C98B 2KFWA 5IWAT 4LF5T 3W15B 2EHOD 2ESCA 3JAFA 2XUEA 2D5UA 4HFVA 3O5OA 1YQ3A 3PRBA 2NW9A 4L72B 1WYBA 5BMVE 3CH9A 3UU3A 4AQFA 4FN2A 2KWIB 3PUAA 3ZMUB 1IAPA 2Q9QD 4LGXA 4URIA 2YINA 2E9XA 1MIYA 1E6PA 4HKAA 4IHJE 5IHYA 2XP5A 3N9NA 3N9MA 1LVKA 1W26A 4OYJA 2BBHA 2QRXA 4TWHA 4DWSC 3N9LA 4JI6T 2F23A 2AXDS 3MJXA 3ZN1B 3CQCB 2XAGB 2X66A 2VASA 3JYMA 4TZ4C 2E5VA 5GQBA 1U5PA 3AVSA 4MNKA 5FYMA 1VCSA 4TX5A 2FUPA 3O9XA 4J4NA 1UR8A 3P4RA 5FY1A 1D2KA 4JEUB 4P8WA 4W9OA 4EEBA 1J1JA 2NWBA 4DIDB 4KUMB 4IE4A 1HX8A 4OFZA 3IKDA 4O4IE 1QSDA 4MTVA 2C0SA 5F8PA 3KBTA 5AQFB 4ZPTR 4NUVA 4MHCA 1W9PA 4CZZB 3I0OA 2BZBA 1TCOC 4H63H 2KZ7B 4I0UA 3QOKA 5JDGA 2QVAA 2VL8A 4UVCB 3O5EA 4YLHA 4ODMA 1X6NA 2PJQA 2CA5A 3VRBA 2IHR1 5LMUT 3TLWA 4EYYR 3QOFA 2KT9A 2LSKA 1OXZA 2EHOB 1GUVA 3V5UA 1U4QA 2D9DA 1W0AA 4IE7A 2XP4A 1ZB5A 3FZLB 4IDZA 3Q5DA 5HW8A 4WK9A 4U86A 2Y78A 5LHIB 1ROTA 2M67A 3EIPA 2ZQSA 3CIRA 3HA4A 2A72A 4JI3T 2J62A 3P4SA 2V6XA 3RRWA 1Y01A 3ZPOA 2PG8A 4K0KT 3G06A 3RQWA 3RKGA 3BXWA 5EK2A 2I59A 3L3PA 4EZ4A 4LF8T 2Y6XA 5AQGB 1J5ET 3GN5B 5M4YA 1H0IA 4AQFC 1D7JA 3ARRA 2W61A 2YKSA 3NTPA 4A98A 4U7YA 1O6IA 4X62T 4Z91A 1HNZT 3OYXA 2M2AA 2A3DA 3ZT6A 2E9XC 2OFNA 2BKOA 5D75A 2EHOA 5HCMA 4BA9A 1M7KA 4DV5T 3B7XA 3LK42 4ILUA 4PFPA 4LFCT 3WL1A 1W9RA 3ARXA 1QPLA 4TNSA 4LMLA 1NENA 2BG9B 4Z8XA 2MNTA 3U3IA 2M6IA 1KEYA 1E6RA 2H89A 1FAPA 2SPCA 2VWAA 2X9XA 3N9PA 4HFEA 3ZYMA 1GPFA 4X66T 3KV6A 2YDRA 2WZIA 3O5QA 2CBJA 2FBWA 5LGNB 2UUBT 2LJ4A 1OGBA 1B7TA 5IUXA 2CLYB 2VQFT 4CN6A 1BR2A 1LRZA 3H3AA 1IBMT 4COFA 3O5RA 2AE9A 1ZOYA 2I6HA 1AJ3A 2WM0A 1NWMX 3UU6A 1NWSA 4UV8B 4DV6T 1N36T 1FKJA 2XAFB 1UCUA 2XP3A 3C50A 1NWTA 3AEEA 2PBCA 4PK6A 5JH8A 5J0ZA 2BG9A 5LOVE 5HEJA 3ARYA 3CHEA 3FZKB 4LMKA 5FY0A 3NRKA 1HKJA 2YBUA 2ZQUA 3O5JA 2XJ7A 4QXBB 4DBRA 3CMLA 5ABGA 3NZPA 4MNJA 2L3LA 2LGOA 4H9SE 2XQ3A 3PUGA 1LJYA 2Q5AA 3RPUA 4JFIA 1M5YA 3O1HA 1QUUA 1A7XA 4DR2T 3UUNA 3LDQB 2PBIA 3WL0A 1T98A 4P8XA 4I43B 3RFWA 4B3ST 4LF7T 5H6QB 5J2TE 1XRVA 2IMLA 4PTMA 1IX5A 3PUQA 5DEZA 2F2DA 3ARSA 2XQ9A 1GRJA 1E9LA 3N9QA 4TV8E 4P8VA 3WH0A 4JI0T 4JFMA 3AEBA 4DV2T 3GPKA 1SUMB 3BK9A 2PI6A 4R0XA 3ANWB 4NXNT 2LE8A 3Q5EA 4PNIA 3LUOA 4ZI3C 3O5FA 4HFHA 4QT3A 1FKTA 1HXVA 2EHOC 2WBLA 4GGQA 1L1PA 4F6RC 2JJ9A 2YBTA 3ZN0B 3AEGA 2BS3A 3TLTA 3ZYKA 5GPRA 4QXHB 1BR0A 4NSBA 2WY2A 1YKHB 2RPAA 2HHHT 4TV9E 2DSUA 2FAPA 4GK0E 3W4RA 4DR5T 1S94A 3H37A 2DSWA 2BG9E 4ILCA 3I6CA 3OPCA 1J4IA 2PFVA 2J4GA 4H9PC 2LJLA 3ANWA 1S35A 4U2ZA 2WDRA 2NW8A 5LCYA 4HWHA 3V5SA 4MFRA 2YDSA 2IF4A 2E2AA 3RH3A 4HWFA 2MLXA 1R9HA 1H7CA 1Y64B 4OYKA 4DV7T 1W1PA 4NUUA 4WKAA 1FKSA 3N2OA 2XSAA 2WMOA 3WD2A 3PU3A 3AB3B 1ROUA 2LKGA 1FEWA 3C4XA 3KINB 4A5XA 4PFOA 4WNKA 2BG9C 1XMOT 3WKZA 5FMNA 1E44A 4AKRB 3CX8B 1FKGA 5KDMC 2ITKA 2BVMA 3FAPA 3RF1A 5J1GA 3EABA 3O5LA 3RIUA 2E9XD 2V5DA 2ACZA 2CLYC 5AQIB 3HKBE 2A3CA 2LRKA 4ODRA 1E1HB 4TW8A 3PUVF 5HYAA 1LL4A 4HBOA 5HKGA 5JDLA 4DR1T 4M1PA 4WKHA 2VQET 3VKGA 3TDBA 2CXFA 1VOMA 3BQLA 3MK7C 1FKBA 1NMVA 4ODQA 1W09A 4O2BE 1FFRA 4MAVA 1KNRA 2KE0A 4ASKA 2DSVA 1I6ZA 5DJQC 3ZMZB 3C4ZA 2K48A 2ZMAA 3AA6B 1JNDA 2CMRA 4Z2GA 3IK8A 2V7MA 5F5WA 2A9UA 4DR7T 3FBLA 3GMIA 2MBGA 1MMNA 2ACXA 2DT0A 3OOBA 2DHRA 4DR3T 4CI3B 2UUAT 4U31A 3J7Yq 4ZZBA 5C8YE 4UR9A 4A56A 4U72A 3AXJB 4HFIA 4AKHA 3WQWA 1WB0A 4CN4A 4TN7B 2Z6EA 3DP7A 1LL7A 4YTNA 3BMBA 1US7B 4DV1T 5DIUA 4DT4A 3KACA 2V7IA 2UZ5A 3FY1A 4DVDA 4IPXA 5LXTE 2ZM2A 3F31A 4X20E 1D1BA 5F3JA 4P0BA 2LLYA 2JZVA 4KMCA 2JPFA 1OEDE 1WFDA 3AE9A 1E7PA 3ZT7A 2VKDA 4LFAT 4WJXA 5FVLA 3OKQA 3UU4A 1BKFA 5ABEA 1GOIA 3L09A 2L9QA 3ZEFB 3E22E 4DO0A 2NR4A 3PA7A 1KNPA 4HWIB 1D6OA 5LJNA 1MNDA 2BBJA 5I98A 2UXNB 3QB5A 4CXXA 2RQSA 3U78A 4Z2IA 3AXJA 2ZLYA 1HNWT 4CI1B 1FKFA 4JUYA 4ZS2A 4IL9A 5HXSA 4Z2KA 1FJDA 4MPKA 3AS2A 2W67A 4DUZT 5A1LA 4JYAT 1ITXA 3NI6A 4ZI3D 4EAHA 4YHHT 3CGMA 3ZJ1A 5C3JA 3LG7A 5FVKA 1IJ5A 3RIUC 1HNXT 1LG1A 3UQ4A 3KVBA 4F8HA 3I9WA 2JMHA 5DIVA 2KLQA 3O4XE 5HEOA 4WW0A 3E0ZA 2PPPA 4P09A 2VKJA 4QWNB 3UT5E 2W62A 3UUXB 2CXLA 5HCJA 3WD3A 2CE7A 1CUNA 3A5XA 3O5MA 2Y48B 3RYFE 5DO2A 2WU2A 4H9RC 1E6NA 5LMNT 3AS1A 2CWOA 5C2TA 2XQ4A 4IDOA 2BDEA 4C90A 2RA1A 1KNZA 4KP3C 4YSZA 3E08A 3AEDA 2QF8A 1Z8UA 3CGNA 2X51A 1IZNB 3ZSTA 4JI7T 3KABA 5CA0E 1FKIA 1JVWA 4ZS3A 4HFCA 2X67A 3NBXX 4HWDA 4ERRA 3ARPA 4UVAB 3LK3B 2N1GA 3D0TA 2LSJA 1ZV4X 2KO7A 2NW7A 2XASB 3B9AA 4KR0B 5HWXA 1WRDA 4K0UA 5LG4A 2FJAA 4NXMT 2WDQA 3PU8A 4TW6A 2NP9A 4DUYT 3EAMA 3LK2B 1HX1B 5JH7E 3LJCA 1Q1CA 2ZQTA 4LAXA 1F40A 3M65A 2RUQA 2CEAA 1KT1A 3QC9A 4DROA 5L3CB 5HXEA 2OV9A 2C5JA 3WD0A 5LBMA 5AQJB 3GWHA 3ARVA 2DSZA 4NPPA 4PJLA 3H9RB 1HJWA 4IT4A 4H9QC 2FJBA 2WSSV 4KI0F 3EHZA 4HWCA 2ZR5A 2MYSA 1ZCNA 2CCQA 1N32T 1PINA 2G41A 4S3JA 4B3MT 1JNTA 2ODUA 2MPKA 3VRAA 1Q6HA 3T1YT 1ZEEA 4YTMA 1W0BA 5LGTB 4ODLA 4AQYT 2Y8DA 2LKNA 3FZHB 3AS0A 3BQIA 2B5UB 4EV6A 5HXRA 4EZHA 1UUSA 2YEVC 3HI2A 4Q22A 2UXDT 3AVRA 3K3NA 5HT1A 2DG3A 3AE5A 3SWHA 5JDNA 4IDQA 3CWZB 4PJJA 3CQGB 1Q6UA 5HWCA 4O2TA 4OK0A 4QXCB 1XZYA 2BVLA 4GIVA 5ABFB 3P50A 4L0RA 1NEKA 2PTFA 3AAAB 4E7SA 3MXZA 5L4EA 3ONLC 3R6NA 1MIWA 4DNDA 4DH0A 3JC6C 3G6MA 3P4PA 5FL1A 2D0UA 2EULA 3P4QA 1BR1A 2XQ8A 2PV3A 3FXYA 1HCIA 2VKHA 3ODKA 4CN1A 5HW6A 1EZ3A 1KFYA 3F2EA 4AQGA 3RM8A 1W9VA 4ZEYA 3PR9A 3C51A 4JI5T 4YTPA 5AQHB 4DRIA 3O5GA 4PJMA 4IREA 5L3EB 4DR6T 1SYTA 5DITA 2LOSA 3AE2A 5ABFA 1NSGA 2XPKA 5AQPB 3OA5A 3HKEE 2X0YA 2OLHA 2KINB 3IEEA 4Z2LA 2CHNA 4W5UA 5FXWA 4QZVB 2M6BA 3KV9A 3TLUA 4DRQA 2L8KA 3RHWA 1E2AA 3K3QC 2H7VC 2YDQA 3RYCE 3UQAA 1UX4A 5FXXA 2V8SV 1HKMA 1XNQT 4Z2JA 3N5LA 2LM2A 2XPBA 3CX7B 4EIWA 4ISSA 5DABA 1T72A 1KF6A 3O1JA 2UUCT 4FI5A 5LJMA 3ARTA 5BXJA 3RYIE 3AECA 2O92A 3KAFA 1F8AB 4PK4A 4Z2HA 2CRBA 2WP9A 5HXCA 5CFBA 4DV3T 4DV4T 2HH7A 2V7KA 3PRAA 4LAYA 1FKRA 4CI2B 3FZMB 2IAKA 1J4HA 1LKXA 2P9BA 4ZOLE 4UV9B 4Z90A 2V7JA 2XHEB 3AE1A 2A3EA 2VCDA 5L3FB 2DG9A 4CQIA 3PURA 3SRZA 2QYWA 4BAYB 4KX6A 4C02B 5CGMA 3RI5A 2UXBT 4FJOA 5LNKA 1IJ6A 3IF8B 3ONXA 2XSBA 2X0HA 4X1YE 1WAWA 1BR4A 5HTGA 1SHZC 2DCFA 1G73A 5CJ5A 3IHRA 3CPZA 4HEAA 4X65T 4QIBA 5AQQB 3KV4A 2W00A 4JI1T 4NNRA 1O3XA 1FKLA 4LAWA 2B31A 1HF8A 1LG2A 2IDOB 4QH1A 1OEDB 4LF6T 2K9AA 2V1DB 2DT1A 1BL4A 2WZHA 2E5LT 3ZMTB 2VKOA 1PBKA 2FDMA 1J6YA 3FHNA 1ZBVA 3CK6A 1VCTA 3B9EA 1D0ZA 3H3MA 3ZSSA 4TWDA 4ML4A 4WYVA 4MGVA 1UGOA 5CA1E 4X1KE 5HEUA 2N9DA 2PPOA 3RQUA 4L5GA 4EXTA 2MPHA 4JI4T 3N2GE 4UXNB 3MKDA 4Q7NA 1ZK6A 1NWUA 1OEDA 5EZYE 3AE6A 3ZCJA 1EIBA 3A7MA 2LPVA 4H63V 2D2SA 3PJAA 4MALA 3T1HT 5HXHA 3EUHA 4JI2T 3O5KA 3PUXF 2G0UA 4AKIA 2RURA 5LHGB 2O9OA 3N9OA 3Q5XA 1WCRA 2WS3A 1LL6A 3UQIA 5AQMB 3JC6D 3UU8A 4MSPA 2NTXA 1Q6IA 4BJNA 3NRYA 2MAWA 4IQ2A 1WLXA 2JQHA 3ZJ2A 4DIPA 1YATA 1ZBWA 4DRNA 3SS1A 2ZR6A 3I1AA 2VN1A 1XDPA 3OVUA 4NIQA 2XP6A 5FKYA 4GYRA 3UTKA 4WBOA 4FAPA 3RRCA 2NTYA 4U84A 1IBKT 5LB7B 2HN1A 1OWAA 3RM9A 4AKLA 4TW7A 3QB5K 2WCAA 3K3OA 5LA6E 1D7HA 2W2UA 2KI3A 2IUBA 4J4OA 2KR7A 3ARUA 1D1AA 3R84B 3FBZA 1UR9A 3HL6A 5EK4A 2V26A 3PUWF 1D7IA 3KAHA 5HEHA 2RUDA 3RLFF 4GIWA 3NKZA 1MIVA 4PJNA 1NAFA 4KHPT 3OBVE 5JREA 1U79A 4DBQA 2MLYA 3EDVA 2XQ7A 3RC8A 4G50A 1NWRA 4IE6A 4ITZA 3KCEA 1HKKA 2VVNA 1MMGA 2YK0A 2W0GA 3LFMA 3ARZA 3EDUA 4AISA 3O1IA 2HN2A 3UF8A 2X9YA 4ZPVR 2WDVA 4PAGA 3UUBA 1SE7A 2YU1A 2DLRA 4TNWA 3VR8A 2PV2A 3PV0F 1FMVA 2WWVA 1FMWA 3CHCA 5EK3A 3RIFA 3O5PA 4JV5T 3AAEB 3UI4A 1KK7A 2WM9A 3RC3A 1ZU8A 3C64A 1ZBCA 3ZLIA 3ZC0A 3RGLA 1T7SA 4YFSA 3B8SA 5HEGA 2LHRA 5DQVA 2CM0A 1E15A 4EYUA 3P4WA 4UVBB 4EEDA 4X64T 3UQ7A 2WQYA 2XP7A 1OEDC 4ODKA 4IE5A 4V1Av 4DZ2A 4OX9T 2F4VT 5JR9C 3BQKA 3PTRB 2BKNA 3AS3A 1D0YA 4G63A 3GA8A 4P0AA 3AA1B 3NRXA 4UELA 4ZS6A 3JYJA 1J4RA 2XM1A 1ZL1A 4GYSA 3CHDA 3NVOA 2CXDA 1EDQA 2XZEA 1YXRA 5JDQA
chains in the Genus database with same CATH topology
4Q22A 3RFWA 3IKGA 2F21A 5HT1A 2DG3A 2WLZA 4ODPA 1XRVA 4PTMA 1IX5A 5DEZA 2F2DA 2ZQVA 3ARSA 3MDYB 2DG4A 1Q6UA 2AWGA 3WD1A 5HWCA 4O2TA 1E9LA 4U33A 4GIVA 5GPGA 4U85A 1W1YA 4P8VA 3WH0A 2F4EA 4JFMA 1FFQA 3GPKA 2PI6A 4R0XA 4DH0A 1W1TA 2FKEA 2MF9A 3G6MA 3LUOA 2PV1A 3O5FA 4R5EA 2V6YA 4QT3A 1Y0OA 1FKTA 4W9QA 2PV3A 3FXYA 1HXVA 1HKIA 3ALFA 3ODKA 4CN1A 3RMEA 4DWSA 5HW6A 3ZT5A 4GGQA 1L1PA 2YBTA 4ODNA 1QPFA 3RM8A 1W9VA 4ZEYA 3PR9A 3VAWA 1LQ0A 1JNSA 5GPRA 2CPTA 4DRIA 2RUCA 3CZ8A 4NSBA 3O5GA 2WY2A 3UI5A 3UI6A 1EQ3A 2RPAA 2DSUA 2FAPA 1SYTA 4P8UA 3KZ7A 2AOSA 3W4RA 4IT6A 5DITA 3PRDA 3RGCA 4WKFA 3JXVA 1NSGA 2DSWA 3I6CA 3OA5A 1J4IA 2OLHA 1WNOA 2A3AA 4Z2LA 4WZXA 4W5UA 2K3WA 1E6ZA 1YW5A 4QZVB 4U2ZA 4DRQA 2IF4A 1C9HA 4S3KA 3UQAA 2MLXA 4W9PA 1R9HA 5HW7A 1HKMA 2N87A 4Z2JA 1W1PA 4U3CA 2WLYA 2XPBA 4WKAA 2XPAA 4DRJA 1FKSA 3WD2A 2DPEA 1ROUA 1XHGA 2DT3A 5B8IC 1ZBKA 3AROA 4MNMA 1X6LA 4DRHA 4A5XA 4NZCA 3ARTA 5BXJA 3EY6A 1FKHA 1W9UA 2O92A 3WKZA 3KAFA 1FD9A 1F8AB 1HJXA 1FKGA 2CRBA 4N19A 4Z2HA 4QT2A 2ITKA 4ODOA 3FAPA 3RM4A 3EABA 2ZR4A 3PRAA 4LAYA 3O5LA 3WQVA 1FKRA 4G2PA 3UQBA 2A3BA 3AQUA 5HUAA 2A3CA 1EHNA 2LRKA 1EYMA 1J4HA 4ODRA 1T11A 4TW8A 3IHZA 3B9DA 1B6CA 3TC5A 1KT0A 1LL4A 4TYOA 4HBOA 2KFWA 5HKGA 2A3EA 2VCDA 2DG9A 2ESCA 4WKHA 3O5OA 3TDBA 4L72B 3PRBA 4WIWA 4C02B 5CGMA 1FKBA 1NMVA 3CH9A 4ODQA 1K9TA 4FN2A 1FFRA 1W1VA 4MAVA 1WAWA 4LGXA 2KE0A 4HBEA 4P1NA 4URIA 5J6EA 5HTGA 2DSVA 5CJ5A 4XAKA 1E6PA 1SR0A 4QIBA 1JNDA 4Z2GA 3IK8A 1WR0A 2XP5A 2WK2A 4NNRA 2A9UA 1W26A 1FKLA 4LAWA 2B31A 4U7IA 2DT0A 4DWSC 3OOBA 1LG2A 4U31A 4L3NA 4DRPA 2LRLA 3JYMA 5GQBA 3WQWA 1WB0A 4CN4A 2DL1A 1N1AA 4MNKA 2DT1A 1BL4A 1LL7A 5DIUA 4DT4A 4DRKA 1OGGA 3KACA 1PBKA 2FDMA 4J4NA 1J6YA 2UZ5A 1UR8A 2JQKA 1ZBVA 3ARWA 3FY1A 1D2KA 4IPXA 4P8WA 4W9OA 3B9EA 2KGJA 3ZSSA 1KFWA 2DT2A 4AY1A 2JZVA 4ML4A 1WFDA 4MGVA 1HJVA 3IKDA 3ZT7A 4MTVA 4WJXA 5FVLA 1BKFA 2PPOA 1GOIA 1P5QA 2MPHA 4ZPTR 1W9PA 2IUZA 4Q7NA 3PA7A 1ZK6A 1D6OA 1NWUA 1TCOC 1FKDA 5I98A 4LAVA 3QOKA 2RQSA 1EIBA 2LPVA 3O5EA 4Z2IA 4ODMA 1X6NA 3O5KA 2RURA 2O9OA 1FKFA 1GUVA 3KADA 1WCRA 3ALGA 4Z2KA 1FJDA 1LL6A 3UQIA 4MPKA 3AS2A 4MSPA 4U2YA 1ITXA 3NI6A 3CGMA 1Q6IA 2XP4A 1ZB5A 5FVKA 5HW8A 4WK9A 1LG1A 4TX0A 4IQ2A 2JQHA 4U86A 4DIPA 1YATA 2Y78A 1ZBWA 1NH6A 4DRNA 1ROTA 4JFJA 2ZR6A 1TFVA 2G8ZA 2VN1A 5DIVA 3WD4A 2ZQSA 4NIQA 2XP6A 4FAPA 2V6XA 4DWSD 4HARA 4JFKA 3BXWA 1VF8A 2PPPA 4U84A 4BF8A 5LB7B 3RM9A 1H0IA 4JFLA 4TW7A 2XP9A 1D7JA 3ARRA 3WD3A 3NTPA 1D7HA 4U7YA 4MNLA 3O5MA 1O6IA 2W2UA 2KI3A 4J4OA 5DO2A 2M2AA 2KR7A 3ZT6A 3ARUA 1E6NA 2OFNA 3AS1A 5D75A 1UR9A 5HWBA 3B7XA 2QF8A 3CGNA 3ZSTA 1D7IA 1RD6A 3WL1A 3KAHA 2RUDA 3TCZA 3KABA 3ARXA 1QPLA 4TNSA 4DRMA 3WIJA 1H0GA 2MNTA 2JQ9A 3KAIA 1E6RA 1FKIA 1FAPA 1JVWA 1U79A 2MLYA 4G50A 1NWRA 1GPFA 2L2SA 3ARPA 4ITZA 3KCEA 1HKKA 3O5QA 4IQCA 3ARZA 2XP8A 2LJ4A 1OGBA 2KO7A 3B9AA 4KR0B 3UF8A 4CN6A 4ZPVR 4TW6A 1FKKA 2K8IA 1Q1CA 2ZQTA 2PV2A 2M1IA 3O5RA 4LAXA 1F40A 2WWVA 2PPNA 3CHCA 2RUQA 1KT1A 3O5PA 4DROA 2WM0A 2MLZA 5DF0A 3UI4A 1QZ2A 1NWSA 4ZPWR 3WD0A 1FKJA 1ZU8A 2XP3A 3ARVA 3ARQA 2DSZA 1ZBCA 1NWTA 3O5IA 3H9RB 2PBCA 3B8SA 1HJWA 3O5DA 4IT4A 5JH8A 5HBFA 1E15A 3G6LA 4KQZA 1NMWA 2D9FA 3ARYA 3CHEA 2M08A 2ZR5A 3NRKA 1HKJA 1ZCNA 1PINA 2XP7A 2ZQUA 2YBUA 2G41A 3O5JA 4ODKA 4S3JA 1JNTA 4DZ2A 2RSEA 2MPKA 1Q6HA 2V6YB 4MNJA 2LGOA 3AS3A 3KAGA 3K1SA 4ODLA 4DWSB 3CHFA 1LJYA 2Q5AA 4JYSA 4ZS6A 2LKNA 3JYJA 4JFIA 1J4RA 1ZL1A 3CHDA 1CTNA 1M5YA 3AS0A 1A7XA 4DZ3A 1EDQA 1JNEA 2XZEA 3WL0A 1YXRA 1OWQA 4P8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3W A;  4U7I A;  1WCR A;  2JQK A;  2V6X A;  4U2Z A;  2WY2 A;  4A5X A;  2MPK A;  2LRK A;  2V6Y B;  2RPA A;  4U31 A;  4U2Y A;  2V6Y A;  3ZSS A;  2LRL A;  3ZST A;  4P1N A;  3K1S A;  5FVK A;  2CRB A;  5LB7 B;  1WFD A;  4CN6 A;  4IT4 A;  4CN1 A;  5CJ5 A;  2JQ9 A;  4U33 A;  4CN4 A;  4IT6 A;  2JQH A;  2DL1 A;  3ZT5 A;  3ZT7 A;  4U3C A;  4U7Y A;  1WR0 A;  5FVL A;  3EAB A;  2W2U A;  4ZEY A;  2A9U A;  2XZE A;  2WWV A;  5CGM A;  1YXR A;  3ZT6 A;  2CPT A;  4WZX A;  4NIQ A; 
#chains in the Genus database with same CATH topology
 3IKG A;  4ODP A;  3OTO T;  4ZI7 E;  2ZQV A;  1YW0 A;  2DG4 A;  2AWG A;  4ZHQ E;  3WD1 A;  3L8R A;  3KFW X;  3QK6 A;  5GPG A;  3UUL A;  2XQ5 A;  4U85 A;  2PN0 A;  2YOE A;  1WYC A;  4AIU A;  1FFQ A;  5HWY A;  2XY8 B;  3ZYL A;  5CB4 E;  3GTY X;  2K5B B;  4QKN A;  4B6X A;  3LBX B;  3B5M A;  5FXV A;  5AQR B;  2MF9 A;  1SA0 E;  3EI0 A;  1Y0O A;  3AE7 A;  4UDM A;  2JQQ A;  2JMK A;  2XAH B;  1WR6 A;  4DR4 T;  3ZT5 A;  3PUZ F;  1QPF A;  2BS2 A;  3VAW A;  4QH5 A;  3SFD A;  1LQ0 A;  5LBQ B;  4X5T A;  3IA3 A;  4UIG A;  3TLS A;  3UI5 A;  3UI6 A;  2ODV A;  2WAU A;  5L47 A;  2OA5 A;  4KBM B;  4IT6 A;  3UUM A;  3PRD A;  4CXY A;  4GOU A;  4WKF A;  3RGC A;  5ETW A;  3JXV A;  5LP6 E;  4PK5 A;  1HG2 A;  3QNU A;  1D0X A;  4WZX A;  5LGU B;  1YW5 A;  4AKG A;  2CWY A;  5E0O A;  3LBX A;  4H9N C;  3NZQ A;  4W9P A;  5HW7 A;  4MLK A;  2KSR A;  2N87 A;  1UK5 A;  3P8C D;  4HGA A;  1XMQ T;  4U3C A;  5J2U E;  5AQS B;  3T8O A;  2XPA A;  1UX5 A;  4XZC A;  2DPE A;  2DT3 A;  2V7L A;  5B8I C;  5ADX L;  1ZBK A;  4AXP A;  1X6L A;  4DRH A;  4EB6 E;  3MZK B;  5IYZ E;  1FKH A;  1W9U A;  4CXW A;  1FD9 A;  3TKL B;  4N19 A;  2W66 A;  4ODO A;  1ZHC A;  4TUY E;  3RM4 A;  3AEF A;  1ZKE A;  3OYZ A;  4IL4 A;  4XAX B;  2ZR4 A;  3WQV A;  1HTJ F;  5FY7 A;  4ILB A;  4GKJ T;  3UQB A;  2VK9 A;  4ZI2 C;  4ZXL A;  3AQU A;  2LSY A;  3AE4 A;  4UEM A;  1JNR A;  5GON E;  1EYM A;  1MMA A;  4YJ3 E;  3VU7 H;  3C4W A;  3IBP A;  3B9D A;  3I9Y A;  1HFA A;  3AE8 A;  4GK5 E;  4O8S A;  3RIA A;  4TYO A;  1IBL T;  2ES0 A;  2Q9Q B;  5JVD E;  4IGU A;  4YHJ A;  3ESL A;  4WIW A;  4JI8 T;  4QX7 B;  2OLT A;  3ETV A;  2VB6 A;  4AI6 A;  1K9T A;  4O4J E;  2YN6 A;  1W1V A;  3M3Z B;  5L4H A;  2P4V A;  1G8X A;  2YU2 A;  3ZC1 A;  4HBE A;  5J6E A;  4P1N A;  2HPL A;  4MBQ A;  3VR9 A;  4YXD A;  4YSY A;  5L3B B;  5H6R B;  4XAK A;  4HTE A;  1SR0 A;  5JRC B;  1WR0 A;  2WK2 A;  3KBU A;  1HR0 T;  2BKP A;  2X9W A;  3MAC A;  4U7I A;  2CHO A;  2DI4 A;  3SOL A;  4L3N A;  1FIO A;  2LKH A;  4O4L E;  4DRP A;  2FJD A;  1X9B A;  2LRL A;  4ADZ A;  2JIW A;  5DQW A;  1L0V A;  2LSI A;  2IC6 A;  2DL1 A;  1N1A A;  1T8B A;  2H3R A;  2Q9Q A;  2WB5 A;  4DRK A;  2J47 A;  1OGG A;  3EVY A;  4UF0 B;  3LSV A;  1N33 T;  4LF9 T;  2V5C A;  2JQK A;  1XWM A;  2LHN A;  2XQ6 A;  3ARW A;  2KWH A;  3UU5 A;  1D1C A;  4ILA A;  2KGJ A;  1KFW A;  5L3G B;  2DT2 A;  3AE3 A;  4AY1 A;  5AQO B;  4YJ2 E;  2IW5 B;  4ZZC A;  3PUS A;  3GN5 A;  1HJV A;  3DJB A;  3ZMS B;  5L2L A;  2QGS A;  5JRC A;  4O2A E;  1P5Q A;  3K8P C;  3PJA J;  3ZMV B;  4Q25 A;  4ANJ A;  2IUZ A;  3RKO A;  3KVA A;  2UXC T;  1R8I A;  1FKD A;  3SFE A;  2ZM0 A;  4LAV A;  3Q5W A;  5LYJ E;  4DMW A;  2DWK A;  5JDH A;  2XM2 A;  2C5I T;  3HR0 A;  1LVF A;  4IDP A;  4UF0 A;  3KAD A;  2VVS A;  3ALG A;  2LOP A;  3HKD E;  3AA7 B;  3CX6 B;  3I0Q A;  2VUR A;  1VRB A;  5FXZ A;  5L3D B;  4U2Y A;  3QUJ A;  2A2F X;  3B13 A;  3WAJ A;  4TX0 A;  3AEA A;  2D0T A;  1NH6 A;  4JFJ A;  3ONJ A;  1TFV A;  2G8Z A;  5ABH A;  4IST A;  2E8I A;  3WD4 A;  4QHO A;  4DWS D;  4HAR A;  5KMG P;  4JFK A;  3OJA A;  3GU0 A;  1VF8 A;  4BF8 A;  4PW8 A;  5BR8 T;  4JFL A;  4C91 A;  2XP9 A;  2MOZ A;  4MNL A;  3ABV A;  3L39 A;  2C5K T;  3CQX C;  5LHH B;  5AFU L;  1QLB A;  3RYH E;  3AAI A;  4EGW A;  5HWB A;  4DV0 T;  2KND A;  2VL0 A;  4I55 E;  1RD6 A;  4IIJ E;  2MTQ A;  3JAE A;  3TCZ A;  4DRM A;  5LG3 A;  3WIJ A;  5JR9 B;  1H0G A;  2JQ9 A;  3KAI A;  2ETN A;  2GK9 A;  1UUR A;  2LSG A;  3AA0 B;  3JCF A;  3ZCI A;  2L2S A;  1XNR T;  2IIU A;  2N2N A;  4IQC A;  5AQK B;  2XP8 A;  2Q9Q C;  1JCH B;  1FKK A;  2K8I A;  2M1I A;  3ETU A;  5FNV E;  5HAX A;  2PPN A;  1V9D A;  4L9I A;  4X1I E;  4BJM A;  4ZI2 D;  2MLZ A;  5DF0 A;  4HE8 A;  5FL0 A;  1QZ2 A;  4ZPW R;  3F57 A;  1Z0P A;  3PDY A;  4LMJ A;  3ARQ A;  4WBN E;  3O5I A;  3CKD A;  4LF4 T;  2UXX B;  3O5D A;  2X0L B;  5HBF A;  5JDM A;  3G6L A;  4KQZ A;  5JR9 A;  1NMW A;  4GKK T;  2D9F A;  1HG5 A;  2M08 A;  3WAK A;  1YQ4 A;  4DMV A;  2RSE A;  3N2K E;  2ZM6 T;  3PUY F;  2WU5 A;  2JRK A;  2V6Y B;  2H88 A;  4QX8 B;  2W4X A;  3KAG A;  2FJE A;  2W63 A;  3K1S A;  2WWU A;  4DWS B;  3CHF A;  4JYS A;  4JEH B;  1CTN A;  2R6G F;  5JDF A;  4DZ3 A;  2XAQ B;  1JNE A;  1OWQ A;  3PE0 A;  5AQV B;  2F21 A;  2WLZ A;  1GQE A;  5AQN B;  3Q9D A;  2IC9 A;  4A97 A;  1DU2 A;  3MDY B;  4O4H E;  3A8Y C;  4H9O C;  2RP4 A;  4KHZ F;  5AQL B;  5TAO A;  4U33 A;  1CHU A;  1W1Y A;  2F4E A;  2X9H A;  5FP3 A;  1X79 A;  4EOZ B;  4XBF B;  1W1T A;  1YKE B;  2NOX A;  5AQT B;  2HPJ A;  3KDS E;  2FKE A;  1N34 T;  1XDO A;  2PV1 A;  4R5E A;  2V6Y A;  2X68 A;  3FB2 A;  3KV5 A;  4IE0 A;  4YT0 A;  4W9Q A;  1I94 T;  3WI3 A;  2WMN A;  1HKI A;  3P7I A;  3ALF A;  3RME A;  2DWG A;  4DWS A;  3FXD B;  2ZM8 A;  4ODN A;  1ZP0 A;  1JNS A;  3Q2M A;  1FJG T;  2CPT A;  3B57 A;  2RUC A;  3CZ8 A;  4I4T E;  1EQ3 A;  4I50 E;  5JQG E;  4JLE A;  4LFB T;  2DNX A;  4E7Z A;  3TLV A;  2KXP B;  3UFG A;  3DTO A;  2XQY A;  4TNV A;  4P8U A;  3KZ7 A;  4YSX A;  2AOS A;  2LM9 A;  2KMF A;  3J9X 1;  1WNO A;  2A3A A;  3UFE A;  1J5W A;  2K3W A;  4JBW F;  1E6Z A;  2LT3 A;  2H7O A;  4B3T T;  5KXJ A;  5AQU B;  3NWI A;  3MA9 A;  1M62 A;  1C9H A;  1YD8 G;  3CVR A;  4S3K A;  3FZF B;  4N78 D;  4OHF A;  2CBI A;  4QH4 A;  2B1E A;  2XAJ B;  4B3R T;  3S4U A;  2XQA A;  3JAD A;  2WLY A;  2K24 A;  2I0M A;  4HN9 A;  4DRJ A;  1XHG A;  4MNM A;  3RX6 A;  3ARO A;  4G2A A;  4NZC A;  3FXE B;  1MMD A;  3EY6 A;  4YY3 T;  2B76 A;  2E9X B;  4TWF A;  2QA7 A;  1JNZ A;  1HJX A;  1MNE A;  3HKC E;  4QT2 A;  4HFB A;  3ZKR A;  2J1D G;  5JTG A;  4U74 A;  3VKH A;  4G2P A;  5KX5 E;  2A3B A;  3VHL A;  2XTL A;  5HUA A;  2BS4 A;  1EHN A;  3X1D A;  1HS7 A;  1T11 A;  2LEH A;  4HFD A;  4IDN A;  3IHZ A;  1B6C A;  2UU9 T;  3TC5 A;  1KT0 A;  4J2C A;  3C98 B;  2KFW A;  5IWA T;  4LF5 T;  3W15 B;  2EHO D;  2ESC A;  3JAF A;  2XUE A;  2D5U A;  4HFV A;  3O5O A;  1YQ3 A;  3PRB A;  2NW9 A;  4L72 B;  1WYB A;  5BMV E;  3CH9 A;  3UU3 A;  4AQF A;  4FN2 A;  2KWI B;  3PUA A;  3ZMU B;  1IAP A;  2Q9Q D;  4LGX A;  4URI A;  2YIN A;  2E9X A;  1MIY A;  1E6P A;  4HKA A;  4IHJ E;  5IHY A;  2XP5 A;  3N9N A;  3N9M A;  1LVK A;  1W26 A;  4OYJ A;  2BBH A;  2QRX A;  4TWH A;  4DWS C;  3N9L A;  4JI6 T;  2F23 A;  2AXD S;  3MJX A;  3ZN1 B;  3CQC B;  2XAG B;  2X66 A;  2VAS A;  3JYM A;  4TZ4 C;  2E5V A;  5GQB A;  1U5P A;  3AVS A;  4MNK A;  5FYM A;  1VCS A;  4TX5 A;  2FUP A;  3O9X A;  4J4N A;  1UR8 A;  3P4R A;  5FY1 A;  1D2K A;  4JEU B;  4P8W A;  4W9O A;  4EEB A;  1J1J A;  2NWB A;  4DID B;  4KUM B;  4IE4 A;  1HX8 A;  4OFZ A;  3IKD A;  4O4I E;  1QSD A;  4MTV A;  2C0S A;  5F8P A;  3KBT A;  5AQF B;  4ZPT R;  4NUV A;  4MHC A;  1W9P A;  4CZZ B;  3I0O A;  2BZB A;  1TCO C;  4H63 H;  2KZ7 B;  4I0U A;  3QOK A;  5JDG A;  2QVA A;  2VL8 A;  4UVC B;  3O5E A;  4YLH A;  4ODM A;  1X6N A;  2PJQ A;  2CA5 A;  3VRB A;  2IHR 1;  5LMU T;  3TLW A;  4EYY R;  3QOF A;  2KT9 A;  2LSK A;  1OXZ A;  2EHO B;  1GUV A;  3V5U A;  1U4Q A;  2D9D A;  1W0A A;  4IE7 A;  2XP4 A;  1ZB5 A;  3FZL B;  4IDZ A;  3Q5D A;  5HW8 A;  4WK9 A;  4U86 A;  2Y78 A;  5LHI B;  1ROT A;  2M67 A;  3EIP A;  2ZQS A;  3CIR A;  3HA4 A;  2A72 A;  4JI3 T;  2J62 A;  3P4S A;  2V6X A;  3RRW A;  1Y01 A;  3ZPO A;  2PG8 A;  4K0K T;  3G06 A;  3RQW A;  3RKG A;  3BXW A;  5EK2 A;  2I59 A;  3L3P A;  4EZ4 A;  4LF8 T;  2Y6X A;  5AQG B;  1J5E T;  3GN5 B;  5M4Y A;  1H0I A;  4AQF C;  1D7J A;  3ARR A;  2W61 A;  2YKS A;  3NTP A;  4A98 A;  4U7Y A;  1O6I A;  4X62 T;  4Z91 A;  1HNZ T;  3OYX A;  2M2A A;  2A3D A;  3ZT6 A;  2E9X C;  2OFN A;  2BKO A;  5D75 A;  2EHO A;  5HCM A;  4BA9 A;  1M7K A;  4DV5 T;  3B7X A;  3LK4 2;  4ILU A;  4PFP A;  4LFC T;  3WL1 A;  1W9R A;  3ARX A;  1QPL A;  4TNS A;  4LML A;  1NEN A;  2BG9 B;  4Z8X A;  2MNT A;  3U3I A;  2M6I A;  1KEY A;  1E6R A;  2H89 A;  1FAP A;  2SPC A;  2VWA A;  2X9X A;  3N9P A;  4HFE A;  3ZYM A;  1GPF A;  4X66 T;  3KV6 A;  2YDR A;  2WZI A;  3O5Q A;  2CBJ A;  2FBW A;  5LGN B;  2UUB T;  2LJ4 A;  1OGB A;  1B7T A;  5IUX A;  2CLY B;  2VQF T;  4CN6 A;  1BR2 A;  1LRZ A;  3H3A A;  1IBM T;  4COF A;  3O5R A;  2AE9 A;  1ZOY A;  2I6H A;  1AJ3 A;  2WM0 A;  1NWM X;  3UU6 A;  1NWS A;  4UV8 B;  4DV6 T;  1N36 T;  1FKJ A;  2XAF B;  1UCU A;  2XP3 A;  3C50 A;  1NWT A;  3AEE A;  2PBC A;  4PK6 A;  5JH8 A;  5J0Z A;  2BG9 A;  5LOV E;  5HEJ A;  3ARY A;  3CHE A;  3FZK B;  4LMK A;  5FY0 A;  3NRK A;  1HKJ A;  2YBU A;  2ZQU A;  3O5J A;  2XJ7 A;  4QXB B;  4DBR A;  3CML A;  5ABG A;  3NZP A;  4MNJ A;  2L3L A;  2LGO A;  4H9S E;  2XQ3 A;  3PUG A;  1LJY A;  2Q5A A;  3RPU A;  4JFI A;  1M5Y A;  3O1H A;  1QUU A;  1A7X A;  4DR2 T;  3UUN A;  3LDQ B;  2PBI A;  3WL0 A;  1T98 A;  4P8X A;  4I43 B;  3RFW A;  4B3S T;  4LF7 T;  5H6Q B;  5J2T E;  1XRV A;  2IML A;  4PTM A;  1IX5 A;  3PUQ A;  5DEZ A;  2F2D A;  3ARS A;  2XQ9 A;  1GRJ A;  1E9L A;  3N9Q A;  4TV8 E;  4P8V A;  3WH0 A;  4JI0 T;  4JFM A;  3AEB A;  4DV2 T;  3GPK A;  1SUM B;  3BK9 A;  2PI6 A;  4R0X A;  3ANW B;  4NXN T;  2LE8 A;  3Q5E A;  4PNI A;  3LUO A;  4ZI3 C;  3O5F A;  4HFH A;  4QT3 A;  1FKT A;  1HXV A;  2EHO C;  2WBL A;  4GGQ A;  1L1P A;  4F6R C;  2JJ9 A;  2YBT A;  3ZN0 B;  3AEG A;  2BS3 A;  3TLT A;  3ZYK A;  5GPR A;  4QXH B;  1BR0 A;  4NSB A;  2WY2 A;  1YKH B;  2RPA A;  2HHH T;  4TV9 E;  2DSU A;  2FAP A;  4GK0 E;  3W4R A;  4DR5 T;  1S94 A;  3H37 A;  2DSW A;  2BG9 E;  4ILC A;  3I6C A;  3OPC A;  1J4I A;  2PFV A;  2J4G A;  4H9P C;  2LJL A;  3ANW A;  1S35 A;  4U2Z A;  2WDR A;  2NW8 A;  5LCY A;  4HWH A;  3V5S A;  4MFR A;  2YDS A;  2IF4 A;  2E2A A;  3RH3 A;  4HWF A;  2MLX A;  1R9H A;  1H7C A;  1Y64 B;  4OYK A;  4DV7 T;  1W1P A;  4NUU A;  4WKA A;  1FKS A;  3N2O A;  2XSA A;  2WMO A;  3WD2 A;  3PU3 A;  3AB3 B;  1ROU A;  2LKG A;  1FEW A;  3C4X A;  3KIN B;  4A5X A;  4PFO A;  4WNK A;  2BG9 C;  1XMO T;  3WKZ A;  5FMN A;  1E44 A;  4AKR B;  3CX8 B;  1FKG A;  5KDM C;  2ITK A;  2BVM A;  3FAP A;  3RF1 A;  5J1G A;  3EAB A;  3O5L A;  3RIU A;  2E9X D;  2V5D A;  2ACZ A;  2CLY C;  5AQI B;  3HKB E;  2A3C A;  2LRK A;  4ODR A;  1E1H B;  4TW8 A;  3PUV F;  5HYA A;  1LL4 A;  4HBO A;  5HKG A;  5JDL A;  4DR1 T;  4M1P A;  4WKH A;  2VQE T;  3VKG A;  3TDB A;  2CXF A;  1VOM A;  3BQL A;  3MK7 C;  1FKB A;  1NMV A;  4ODQ A;  1W09 A;  4O2B E;  1FFR A;  4MAV A;  1KNR A;  2KE0 A;  4ASK A;  2DSV A;  1I6Z A;  5DJQ C;  3ZMZ B;  3C4Z A;  2K48 A;  2ZMA A;  3AA6 B;  1JND A;  2CMR A;  4Z2G A;  3IK8 A;  2V7M A;  5F5W A;  2A9U A;  4DR7 T;  3FBL A;  3GMI A;  2MBG A;  1MMN A;  2ACX A;  2DT0 A;  3OOB A;  2DHR A;  4DR3 T;  4CI3 B;  2UUA T;  4U31 A;  3J7Y q;  4ZZB A;  5C8Y E;  4UR9 A;  4A56 A;  4U72 A;  3AXJ B;  4HFI A;  4AKH A;  3WQW A;  1WB0 A;  4CN4 A;  4TN7 B;  2Z6E A;  3DP7 A;  1LL7 A;  4YTN A;  3BMB A;  1US7 B;  4DV1 T;  5DIU A;  4DT4 A;  3KAC A;  2V7I A;  2UZ5 A;  3FY1 A;  4DVD A;  4IPX A;  5LXT E;  2ZM2 A;  3F31 A;  4X20 E;  1D1B A;  5F3J A;  4P0B A;  2LLY A;  2JZV A;  4KMC A;  2JPF A;  1OED E;  1WFD A;  3AE9 A;  1E7P A;  3ZT7 A;  2VKD A;  4LFA T;  4WJX A;  5FVL A;  3OKQ A;  3UU4 A;  1BKF A;  5ABE A;  1GOI A;  3L09 A;  2L9Q A;  3ZEF B;  3E22 E;  4DO0 A;  2NR4 A;  3PA7 A;  1KNP A;  4HWI B;  1D6O A;  5LJN A;  1MND A;  2BBJ A;  5I98 A;  2UXN B;  3QB5 A;  4CXX A;  2RQS A;  3U78 A;  4Z2I A;  3AXJ A;  2ZLY A;  1HNW T;  4CI1 B;  1FKF A;  4JUY A;  4ZS2 A;  4IL9 A;  5HXS A;  4Z2K A;  1FJD A;  4MPK A;  3AS2 A;  2W67 A;  4DUZ T;  5A1L A;  4JYA T;  1ITX A;  3NI6 A;  4ZI3 D;  4EAH A;  4YHH T;  3CGM A;  3ZJ1 A;  5C3J A;  3LG7 A;  5FVK A;  1IJ5 A;  3RIU C;  1HNX T;  1LG1 A;  3UQ4 A;  3KVB A;  4F8H A;  3I9W A;  2JMH A;  5DIV A;  2KLQ A;  3O4X E;  5HEO A;  4WW0 A;  3E0Z A;  2PPP A;  4P09 A;  2VKJ A;  4QWN B;  3UT5 E;  2W62 A;  3UUX B;  2CXL A;  5HCJ A;  3WD3 A;  2CE7 A;  1CUN A;  3A5X A;  3O5M A;  2Y48 B;  3RYF E;  5DO2 A;  2WU2 A;  4H9R C;  1E6N A;  5LMN T;  3AS1 A;  2CWO A;  5C2T A;  2XQ4 A;  4IDO A;  2BDE A;  4C90 A;  2RA1 A;  1KNZ A;  4KP3 C;  4YSZ A;  3E08 A;  3AED A;  2QF8 A;  1Z8U A;  3CGN A;  2X51 A;  1IZN B;  3ZST A;  4JI7 T;  3KAB A;  5CA0 E;  1FKI A;  1JVW A;  4ZS3 A;  4HFC A;  2X67 A;  3NBX X;  4HWD A;  4ERR A;  3ARP A;  4UVA B;  3LK3 B;  2N1G A;  3D0T A;  2LSJ A;  1ZV4 X;  2KO7 A;  2NW7 A;  2XAS B;  3B9A A;  4KR0 B;  5HWX A;  1WRD A;  4K0U A;  5LG4 A;  2FJA A;  4NXM T;  2WDQ A;  3PU8 A;  4TW6 A;  2NP9 A;  4DUY T;  3EAM A;  3LK2 B;  1HX1 B;  5JH7 E;  3LJC A;  1Q1C A;  2ZQT A;  4LAX A;  1F40 A;  3M65 A;  2RUQ A;  2CEA A;  1KT1 A;  3QC9 A;  4DRO A;  5L3C B;  5HXE A;  2OV9 A;  2C5J A;  3WD0 A;  5LBM A;  5AQJ B;  3GWH A;  3ARV A;  2DSZ A;  4NPP A;  4PJL A;  3H9R B;  1HJW A;  4IT4 A;  4H9Q C;  2FJB A;  2WSS V;  4KI0 F;  3EHZ A;  4HWC A;  2ZR5 A;  2MYS A;  1ZCN A;  2CCQ A;  1N32 T;  1PIN A;  2G41 A;  4S3J A;  4B3M T;  1JNT A;  2ODU A;  2MPK A;  3VRA A;  1Q6H A;  3T1Y T;  1ZEE A;  4YTM A;  1W0B A;  5LGT B;  4ODL A;  4AQY T;  2Y8D A;  2LKN A;  3FZH B;  3AS0 A;  3BQI A;  2B5U B;  4EV6 A;  5HXR A;  4EZH A;  1UUS A;  2YEV C;  3HI2 A;  4Q22 A;  2UXD T;  3AVR A;  3K3N A;  5HT1 A;  2DG3 A;  3AE5 A;  3SWH A;  5JDN A;  4IDQ A;  3CWZ B;  4PJJ A;  3CQG B;  1Q6U A;  5HWC A;  4O2T A;  4OK0 A;  4QXC B;  1XZY A;  2BVL A;  4GIV A;  5ABF B;  3P50 A;  4L0R A;  1NEK A;  2PTF A;  3AAA B;  4E7S A;  3MXZ A;  5L4E A;  3ONL C;  3R6N A;  1MIW A;  4DND A;  4DH0 A;  3JC6 C;  3G6M A;  3P4P A;  5FL1 A;  2D0U A;  2EUL A;  3P4Q A;  1BR1 A;  2XQ8 A;  2PV3 A;  3FXY A;  1HCI A;  2VKH A;  3ODK A;  4CN1 A;  5HW6 A;  1EZ3 A;  1KFY A;  3F2E A;  4AQG A;  3RM8 A;  1W9V A;  4ZEY A;  3PR9 A;  3C51 A;  4JI5 T;  4YTP A;  5AQH B;  4DRI A;  3O5G A;  4PJM A;  4IRE A;  5L3E B;  4DR6 T;  1SYT A;  5DIT A;  2LOS A;  3AE2 A;  5ABF A;  1NSG A;  2XPK A;  5AQP B;  3OA5 A;  3HKE E;  2X0Y A;  2OLH A;  2KIN B;  3IEE A;  4Z2L A;  2CHN A;  4W5U A;  5FXW A;  4QZV B;  2M6B A;  3KV9 A;  3TLU A;  4DRQ A;  2L8K A;  3RHW A;  1E2A A;  3K3Q C;  2H7V C;  2YDQ A;  3RYC E;  3UQA A;  1UX4 A;  5FXX A;  2V8S V;  1HKM A;  1XNQ T;  4Z2J A;  3N5L A;  2LM2 A;  2XPB A;  3CX7 B;  4EIW A;  4ISS A;  5DAB A;  1T72 A;  1KF6 A;  3O1J A;  2UUC T;  4FI5 A;  5LJM A;  3ART A;  5BXJ A;  3RYI E;  3AEC A;  2O92 A;  3KAF A;  1F8A B;  4PK4 A;  4Z2H A;  2CRB A;  2WP9 A;  5HXC A;  5CFB A;  4DV3 T;  4DV4 T;  2HH7 A;  2V7K A;  3PRA A;  4LAY A;  1FKR A;  4CI2 B;  3FZM B;  2IAK A;  1J4H A;  1LKX A;  2P9B A;  4ZOL E;  4UV9 B;  4Z90 A;  2V7J A;  2XHE B;  3AE1 A;  2A3E A;  2VCD A;  5L3F B;  2DG9 A;  4CQI A;  3PUR A;  3SRZ A;  2QYW A;  4BAY B;  4KX6 A;  4C02 B;  5CGM A;  3RI5 A;  2UXB T;  4FJO A;  5LNK A;  1IJ6 A;  3IF8 B;  3ONX A;  2XSB A;  2X0H A;  4X1Y E;  1WAW A;  1BR4 A;  5HTG A;  1SHZ C;  2DCF A;  1G73 A;  5CJ5 A;  3IHR A;  3CPZ A;  4HEA A;  4X65 T;  4QIB A;  5AQQ B;  3KV4 A;  2W00 A;  4JI1 T;  4NNR A;  1O3X A;  1FKL A;  4LAW A;  2B31 A;  1HF8 A;  1LG2 A;  2IDO B;  4QH1 A;  1OED B;  4LF6 T;  2K9A A;  2V1D B;  2DT1 A;  1BL4 A;  2WZH A;  2E5L T;  3ZMT B;  2VKO A;  1PBK A;  2FDM A;  1J6Y A;  3FHN A;  1ZBV A;  3CK6 A;  1VCT A;  3B9E A;  1D0Z A;  3H3M A;  3ZSS A;  4TWD A;  4ML4 A;  4WYV A;  4MGV A;  1UGO A;  5CA1 E;  4X1K E;  5HEU A;  2N9D A;  2PPO A;  3RQU A;  4L5G A;  4EXT A;  2MPH A;  4JI4 T;  3N2G E;  4UXN B;  3MKD A;  4Q7N A;  1ZK6 A;  1NWU A;  1OED A;  5EZY E;  3AE6 A;  3ZCJ A;  1EIB A;  3A7M A;  2LPV A;  4H63 V;  2D2S A;  3PJA A;  4MAL A;  3T1H T;  5HXH A;  3EUH A;  4JI2 T;  3O5K A;  3PUX F;  2G0U A;  4AKI A;  2RUR A;  5LHG B;  2O9O A;  3N9O A;  3Q5X A;  1WCR A;  2WS3 A;  1LL6 A;  3UQI A;  5AQM B;  3JC6 D;  3UU8 A;  4MSP A;  2NTX A;  1Q6I A;  4BJN A;  3NRY A;  2MAW A;  4IQ2 A;  1WLX A;  2JQH A;  3ZJ2 A;  4DIP A;  1YAT A;  1ZBW A;  4DRN A;  3SS1 A;  2ZR6 A;  3I1A A;  2VN1 A;  1XDP A;  3OVU A;  4NIQ A;  2XP6 A;  5FKY A;  4GYR A;  3UTK A;  4WBO A;  4FAP A;  3RRC A;  2NTY A;  4U84 A;  1IBK T;  5LB7 B;  2HN1 A;  1OWA A;  3RM9 A;  4AKL A;  4TW7 A;  3QB5 K;  2WCA A;  3K3O A;  5LA6 E;  1D7H A;  2W2U A;  2KI3 A;  2IUB A;  4J4O A;  2KR7 A;  3ARU A;  1D1A A;  3R84 B;  3FBZ A;  1UR9 A;  3HL6 A;  5EK4 A;  2V26 A;  3PUW F;  1D7I A;  3KAH A;  5HEH A;  2RUD A;  3RLF F;  4GIW A;  3NKZ A;  1MIV A;  4PJN A;  1NAF A;  4KHP T;  3OBV E;  5JRE A;  1U79 A;  4DBQ A;  2MLY A;  3EDV A;  2XQ7 A;  3RC8 A;  4G50 A;  1NWR A;  4IE6 A;  4ITZ A;  3KCE A;  1HKK A;  2VVN A;  1MMG A;  2YK0 A;  2W0G A;  3LFM A;  3ARZ A;  3EDU A;  4AIS A;  3O1I A;  2HN2 A;  3UF8 A;  2X9Y A;  4ZPV R;  2WDV A;  4PAG A;  3UUB A;  1SE7 A;  2YU1 A;  2DLR A;  4TNW A;  3VR8 A;  2PV2 A;  3PV0 F;  1FMV A;  2WWV A;  1FMW A;  3CHC A;  5EK3 A;  3RIF A;  3O5P A;  4JV5 T;  3AAE B;  3UI4 A;  1KK7 A;  2WM9 A;  3RC3 A;  1ZU8 A;  3C64 A;  1ZBC A;  3ZLI A;  3ZC0 A;  3RGL A;  1T7S A;  4YFS A;  3B8S A;  5HEG A;  2LHR A;  5DQV A;  2CM0 A;  1E15 A;  4EYU A;  3P4W A;  4UVB B;  4EED A;  4X64 T;  3UQ7 A;  2WQY A;  2XP7 A;  1OED C;  4ODK A;  4IE5 A;  4V1A v;  4DZ2 A;  4OX9 T;  2F4V T;  5JR9 C;  3BQK A;  3PTR B;  2BKN A;  3AS3 A;  1D0Y A;  4G63 A;  3GA8 A;  4P0A A;  3AA1 B;  3NRX A;  4UEL A;  4ZS6 A;  3JYJ A;  1J4R A;  2XM1 A;  1ZL1 A;  4GYS A;  3CHD A;  3NVO A;  2CXD A;  1EDQ A;  2XZE A;  1YXR A;  5JDQ A; 
#chains in the Genus database with same CATH homology
 4Q22 A;  3RFW A;  3IKG A;  2F21 A;  5HT1 A;  2DG3 A;  2WLZ A;  4ODP A;  1XRV A;  4PTM A;  1IX5 A;  5DEZ A;  2F2D A;  2ZQV A;  3ARS A;  3MDY B;  2DG4 A;  1Q6U A;  2AWG A;  3WD1 A;  5HWC A;  4O2T A;  1E9L A;  4U33 A;  4GIV A;  5GPG A;  4U85 A;  1W1Y A;  4P8V A;  3WH0 A;  2F4E A;  4JFM A;  1FFQ A;  3GPK A;  2PI6 A;  4R0X A;  4DH0 A;  1W1T A;  2FKE A;  2MF9 A;  3G6M A;  3LUO A;  2PV1 A;  3O5F A;  4R5E A;  2V6Y A;  4QT3 A;  1Y0O A;  1FKT A;  4W9Q A;  2PV3 A;  3FXY A;  1HXV A;  1HKI A;  3ALF A;  3ODK A;  4CN1 A;  3RME A;  4DWS A;  5HW6 A;  3ZT5 A;  4GGQ A;  1L1P A;  2YBT A;  4ODN A;  1QPF A;  3RM8 A;  1W9V A;  4ZEY A;  3PR9 A;  3VAW A;  1LQ0 A;  1JNS A;  5GPR A;  2CPT A;  4DRI A;  2RUC A;  3CZ8 A;  4NSB A;  3O5G A;  2WY2 A;  3UI5 A;  3UI6 A;  1EQ3 A;  2RPA A;  2DSU A;  2FAP A;  1SYT A;  4P8U A;  3KZ7 A;  2AOS A;  3W4R A;  4IT6 A;  5DIT A;  3PRD A;  3RGC A;  4WKF A;  3JXV A;  1NSG A;  2DSW A;  3I6C A;  3OA5 A;  1J4I A;  2OLH A;  1WNO A;  2A3A A;  4Z2L A;  4WZX A;  4W5U A;  2K3W A;  1E6Z A;  1YW5 A;  4QZV B;  4U2Z A;  4DRQ A;  2IF4 A;  1C9H A;  4S3K A;  3UQA A;  2MLX A;  4W9P A;  1R9H A;  5HW7 A;  1HKM A;  2N87 A;  4Z2J A;  1W1P A;  4U3C A;  2WLY A;  2XPB A;  4WKA A;  2XPA A;  4DRJ A;  1FKS A;  3WD2 A;  2DPE A;  1ROU A;  1XHG A;  2DT3 A;  5B8I C;  1ZBK A;  3ARO A;  4MNM A;  1X6L A;  4DRH A;  4A5X A;  4NZC A;  3ART A;  5BXJ A;  3EY6 A;  1FKH A;  1W9U A;  2O92 A;  3WKZ A;  3KAF A;  1FD9 A;  1F8A B;  1HJX A;  1FKG A;  2CRB A;  4N19 A;  4Z2H A;  4QT2 A;  2ITK A;  4ODO A;  3FAP A;  3RM4 A;  3EAB A;  2ZR4 A;  3PRA A;  4LAY A;  3O5L A;  3WQV A;  1FKR A;  4G2P A;  3UQB A;  2A3B A;  3AQU A;  5HUA A;  2A3C A;  1EHN A;  2LRK A;  1EYM A;  1J4H A;  4ODR A;  1T11 A;  4TW8 A;  3IHZ A;  3B9D A;  1B6C A;  3TC5 A;  1KT0 A;  1LL4 A;  4TYO A;  4HBO A;  2KFW A;  5HKG A;  2A3E A;  2VCD A;  2DG9 A;  2ESC A;  4WKH A;  3O5O A;  3TDB A;  4L72 B;  3PRB A;  4WIW A;  4C02 B;  5CGM A;  1FKB A;  1NMV A;  3CH9 A;  4ODQ A;  1K9T A;  4FN2 A;  1FFR A;  1W1V A;  4MAV A;  1WAW A;  4LGX A;  2KE0 A;  4HBE A;  4P1N A;  4URI A;  5J6E A;  5HTG A;  2DSV A;  5CJ5 A;  4XAK A;  1E6P A;  1SR0 A;  4QIB A;  1JND A;  4Z2G A;  3IK8 A;  1WR0 A;  2XP5 A;  2WK2 A;  4NNR A;  2A9U A;  1W26 A;  1FKL A;  4LAW A;  2B31 A;  4U7I A;  2DT0 A;  4DWS C;  3OOB A;  1LG2 A;  4U31 A;  4L3N A;  4DRP A;  2LRL A;  3JYM A;  5GQB A;  3WQW A;  1WB0 A;  4CN4 A;  2DL1 A;  1N1A A;  4MNK A;  2DT1 A;  1BL4 A;  1LL7 A;  5DIU A;  4DT4 A;  4DRK A;  1OGG A;  3KAC A;  1PBK A;  2FDM A;  4J4N A;  1J6Y A;  2UZ5 A;  1UR8 A;  2JQK A;  1ZBV A;  3ARW A;  3FY1 A;  1D2K A;  4IPX A;  4P8W A;  4W9O A;  3B9E A;  2KGJ A;  3ZSS A;  1KFW A;  2DT2 A;  4AY1 A;  2JZV A;  4ML4 A;  1WFD A;  4MGV A;  1HJV A;  3IKD A;  3ZT7 A;  4MTV A;  4WJX A;  5FVL A;  1BKF A;  2PPO A;  1GOI A;  1P5Q A;  2MPH A;  4ZPT R;  1W9P A;  2IUZ A;  4Q7N A;  3PA7 A;  1ZK6 A;  1D6O A;  1NWU A;  1TCO C;  1FKD A;  5I98 A;  4LAV A;  3QOK A;  2RQS A;  1EIB A;  2LPV A;  3O5E A;  4Z2I A;  4ODM A;  1X6N A;  3O5K A;  2RUR A;  2O9O A;  1FKF A;  1GUV A;  3KAD A;  1WCR A;  3ALG A;  4Z2K A;  1FJD A;  1LL6 A;  3UQI A;  4MPK A;  3AS2 A;  4MSP A;  4U2Y A;  1ITX A;  3NI6 A;  3CGM A;  1Q6I A;  2XP4 A;  1ZB5 A;  5FVK A;  5HW8 A;  4WK9 A;  1LG1 A;  4TX0 A;  4IQ2 A;  2JQH A;  4U86 A;  4DIP A;  1YAT A;  2Y78 A;  1ZBW A;  1NH6 A;  4DRN A;  1ROT A;  4JFJ A;  2ZR6 A;  1TFV A;  2G8Z A;  2VN1 A;  5DIV A;  3WD4 A;  2ZQS A;  4NIQ A;  2XP6 A;  4FAP A;  2V6X A;  4DWS D;  4HAR A;  4JFK A;  3BXW A;  1VF8 A;  2PPP A;  4U84 A;  4BF8 A;  5LB7 B;  3RM9 A;  1H0I A;  4JFL A;  4TW7 A;  2XP9 A;  1D7J A;  3ARR A;  3WD3 A;  3NTP A;  1D7H A;  4U7Y A;  4MNL A;  3O5M A;  1O6I A;  2W2U A;  2KI3 A;  4J4O A;  5DO2 A;  2M2A A;  2KR7 A;  3ZT6 A;  3ARU A;  1E6N A;  2OFN A;  3AS1 A;  5D75 A;  1UR9 A;  5HWB A;  3B7X A;  2QF8 A;  3CGN A;  3ZST A;  1D7I A;  1RD6 A;  3WL1 A;  3KAH A;  2RUD A;  3TCZ A;  3KAB A;  3ARX A;  1QPL A;  4TNS A;  4DRM A;  3WIJ A;  1H0G A;  2MNT A;  2JQ9 A;  3KAI A;  1E6R A;  1FKI A;  1FAP A;  1JVW A;  1U79 A;  2MLY A;  4G50 A;  1NWR A;  1GPF A;  2L2S A;  3ARP A;  4ITZ A;  3KCE A;  1HKK A;  3O5Q A;  4IQC A;  3ARZ A;  2XP8 A;  2LJ4 A;  1OGB A;  2KO7 A;  3B9A A;  4KR0 B;  3UF8 A;  4CN6 A;  4ZPV R;  4TW6 A;  1FKK A;  2K8I A;  1Q1C A;  2ZQT A;  2PV2 A;  2M1I A;  3O5R A;  4LAX A;  1F40 A;  2WWV A;  2PPN A;  3CHC A;  2RUQ A;  1KT1 A;  3O5P A;  4DRO A;  2WM0 A;  2MLZ A;  5DF0 A;  3UI4 A;  1QZ2 A;  1NWS A;  4ZPW R;  3WD0 A;  1FKJ A;  1ZU8 A;  2XP3 A;  3ARV A;  3ARQ A;  2DSZ A;  1ZBC A;  1NWT A;  3O5I A;  3H9R B;  2PBC A;  3B8S A;  1HJW A;  3O5D A;  4IT4 A;  5JH8 A;  5HBF A;  1E15 A;  3G6L A;  4KQZ A;  1NMW A;  2D9F A;  3ARY A;  3CHE A;  2M08 A;  2ZR5 A;  3NRK A;  1HKJ A;  1ZCN A;  1PIN A;  2XP7 A;  2ZQU A;  2YBU A;  2G41 A;  3O5J A;  4ODK A;  4S3J A;  1JNT A;  4DZ2 A;  2RSE A;  2MPK A;  1Q6H A;  2V6Y B;  4MNJ A;  2LGO A;  3AS3 A;  3KAG A;  3K1S A;  4ODL A;  4DWS B;  3CHF A;  1LJY A;  2Q5A A;  4JYS A;  4ZS6 A;  2LKN A;  3JYJ A;  4JFI A;  1J4R A;  1ZL1 A;  3CHD A;  1CTN A;  1M5Y A;  3AS0 A;  1A7X A;  4DZ3 A;  1EDQ A;  1JNE A;  2XZE A;  3WL0 A;  1YXR A;  1OWQ A;  4P8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...