4IT4A

Crystal structure of residues 1-211 of cg17282
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
207
Chain Sequence
b'DWYVGTEWEDKNRGLAKKVIGLQFTEMDKPTIISTVEFSVNKKATNLGGRPSKYLVSDTYPQKHSLEMGTSLTAVDCYLELLLQQFVPGETAACSITTKTGERIEFELKLEKIVKNTQVEKLSAAEIYEVALRLKESGVATFKTFPKFAFDYFVRAAKLLITYKPFDKLTKKTNGINGQAVEELFIQIQTNLAACLLQEKRYEHVIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG17282
publication title Noncanonical FK506-Binding Protein BDBT Binds DBT to Enhance Its Circadian Function and Forms Foci at Night.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Unknown function
total genus 59
structure length 207
sequence length 210
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18023 FKBP_N_2 BDBT FKBP like N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4it4A02
3.10.50.60 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4it4A01
3ZSSA 4P1NA 3ZT7A 2W2UA 4U31A 4A5XA 4CN1A 4ZEYA 5CJ5A 5CGMA 4U7YA 5FVLA 2WWVA 4U3CA 2JQHA 4IT4A 2A9UA 4U2ZA 3ZT5A 1WCRA 2K3WA 2CRBA 5LB7B 4U7IA 4NIQA 3ZT6A 2MPKA 2LRKA 1WR0A 1WFDA 3EABA 4CN4A 4U33A 2RPAA 2WY2A 2XZEA 3K1SA 4IT6A 2CPTA 5FVKA 4WZXA 4CN6A 2V6YB 2JQ9A 4U2YA 2JQKA 2V6YA 3ZSTA 2LRLA 2DL1A 2V6XA 1YXRA
chains in the Genus database with same CATH superfamily
2W66A 3O5MA 3N9OA 3R6NA 2WWVA 3VKHA 4HKAA 5LHGB 2XQ4A 3I9YA 1FKBA 5HXRA 3OA5A 2AWGA 3BMBA 4WKHA 1W9UA 2KT9A 2FAPA 2H7OA 5J6EA 2XP5A 1OWAA 3C50A 1VCSA 2WAUA 4JI8T 3AE5A 1ROUA 1FJGT 4DRNA 4JUYA 1FKFA 1SR0A 1SYTA 5AQUB 3S4UA 2ITKA 2UU9T 4Q22A 5LHIB 5HEGA 4WNKA 3O5GA 4Z2GA 5AQQB 4URIA 1OEDC 2WLYA 2K5BB 2E9XA 3KVBA 4H9QC 2NTYA 2M6BA 3ESLA 4UV8B 4TNSA 2WZHA 2WDVA 4ILUA 4DR2T 3N9NA 3RF1A 1IBLT 2X9WA 4YXDA 1ZV4X 4MNLA 4I50E 1E7PA 4AQYT 3KBTA 2WDRA 2V26A 3KFWX 4MALA 1E9LA 3ARYA 4ODPA 5FMNA 2JIWA 4HFVA 1ZBWA 1E2AA 2CLYC 1VCTA 2A3CA 2PPPA 3C4WA 4CI2B 4PJLA 1LG1A 1NEKA 5HEUA 4XBFB 1D7HA 1WLXA 3CQGB 3ZPOA 3WH0A 4HBEA 1HKJA 3H9RB 5LB7B 2K24A 1YW0A 1OXZA 1JCHB 4Z2IA 3UTKA 5FVKA 4QX8B 3RM9A 5FY7A 3N2GE 4IE7A 2VKDA 4JI2T 2KSRA 4S3JA 2KNDA 5LBMA 2HH7A 2W00A 1FKRA 3EUHA 3FZHB 1OEDB 5DITA 3NZQA 2LEHA 3RM8A 3LDQB 4ODQA 2LSGA 5GPRA 1XMOT 2Q9QC 4F8HA 4DV2T 4AI6A 4LAWA 3E0ZA 1MNDA 4DV1T 2NW8A 2AOSA 3ARPA 2XP6A 1HKKA 2A3AA 4JFIA 3EIPA 4DRPA 1S35A 2B76A 2PJQA 5JR9A 3PUVF 3UQAA 3NBXX 3LK2B 3MXZA 3CHFA 3TLUA 3GA8A 4DV5T 2CLYB 4ZOLE 3O5QA 2XM1A 5EK4A 4JI4T 5LBQB 5I98A 2V5DA 2AE9A 3EI0A 5HYAA 4LMKA 2CXLA 4DRMA 3G06A 1CHUA 3KCEA 1GQEA 3ZC1A 2J62A 3RKGA 3RM4A 2LKHA 4UR9A 4IHJE 5FNVE 4QX7B 2FUPA 3ZMVB 2JPFA 5HXEA 1YATA 4KI0F 1CUNA 1YD8G 4LF7T 1T11A 1FIOA 5AQTB 4P0AA 3RLFF 4H9NC 1BKFA 4TZ4C 2A3BA 3AE6A 4YSYA 2QVAA 3I1AA 2CXFA 2Q9QB 3RHWA 3RKOA 5JDMA 1BR1A 5L47A 3O5RA 2IDOB 4G50A 3NTPA 1HJWA 5HWYA 3IHZA 4IQCA 1OEDE 3NKZA 2X9HA 5HXHA 3KABA 2W2UA 4DIDB 3WIJA 2VKHA 3PU8A 4CXXA 4HFBA 3JC6C 1FD9A 2UUCT 4DH0A 2E5VA 2YN6A 1HX1B 1U4QA 2FDMA 2YKSA 1FKLA 2RPAA 4UV9B 2FBWA 4B3MT 1RD6A 2LGOA 2DLRA 1NAFA 1JNSA 5JREA 5AQFB 5AQRB 4H9OC 2ZM6T 5LMUT 4NUVA 4DWSB 3FXEB 5JRCA 1QPFA 2FJDA 4FAPA 2XHEB 5B8IC 2WK2A 4Z2HA 5L2LA 3C64A 3U78A 3I6CA 4O2TA 2XSAA 3LK3B 2UZ5A 2D9DA 4KMCA 1D0XA 5JTGA 4AXPA 4DVDA 1J5WA 1UK5A 1O6IA 3AXJB 4L9IA 3VRAA 4BF8A 4PFPA 2DI4A 4DRJA 4EXTA 5ABEA 2SPCA 3R84B 1MMNA 2DSUA 1HR0T 4H9SE 2PI6A 3E08A 3IKDA 2J4GA 4EYYR 3IEEA 3B7XA 3ARXA 4HFIA 3ALGA 4L5GA 3LK42 2W0GA 2I6HA 2CXDA 3ZEFB 5JDQA 1FKTA 2DG9A 2XP7A 3ARRA 4JEHB 1FMVA 4LAXA 4UVCB 2PV3A 4KHPT 3KBUA 3JC6D 2CM0A 2ZQTA 4EEDA 2X66A 2HPJA 3PUQA 2LM9A 4YY3T 1PBKA 5ETWA 3UULA 1UUSA 1ITXA 3KVAA 5F3JA 4ZI2C 4JI5T 3EDUA 3ODKA 3OKQA 3OYZA 4ZHQE 2RSEA 2I59A 2DG3A 5L3DB 1MMAA 3FBZA 4PFOA 2W61A 4LF5T 5ADXL 1HKIA 3WAJA 2ODVA 1D0YA 2Q9QA 3ONXA 2MPKA 1TFVA 3A7MA 3FAPA 3L09A 2WY2A 2A72A 5ABGA 1Y64B 1OWQA 3PUYF 4ISTA 4AQFC 2CMRA 4EV6A 2XP4A 5HCJA 3VAWA 3PUGA 4ZPTR 4DRKA 2BBHA 4TNWA 1IAPA 1NWSA 4MNJA 3FXYA 1Z0PA 3IBPA 3L3PA 1XZYA 4O4HE 5HEOA 1N32T 1GRJA 3FXDB 2UUBT 1MIYA 1UCUA 3CHCA 2V1DB 4JYSA 2MLYA 4ISSA 1N34T 1KF6A 2XJ7A 4U3CA 2JQHA 3HKBE 3P50A 2KWHA 3UI4A 3UI5A 4LAYA 4DWSA 3N9QA 2VVNA 4J4NA 3NRYA 3AE7A 4CN6A 3WI3A 2JMHA 2V6XA 3AEEA 2WB5A 5AQSB 3CVRA 2X9XA 2ZQSA 4ZI2D 3AXJA 4GYRA 2LHRA 3HKDE 4MHCA 3UU8A 4Z90A 3VRBA 1WR0A 5L4HA 1NWTA 2F2DA 2MNTA 4UF0B 2D0UA 2VB6A 3UQ4A 2LOPA 2PN0A 1H7CA 4B3TT 5J2TE 2ETNA 5FKYA 2CCQA 4NPPA 3I0QA 2ZM8A 1HNZT 3MACA 3Q5WA 5JQGE 3F31A 2A3DA 5HW6A 1ZKEA 1US7B 3WL1A 4BAYB 2BS2A 3HKEE 4QKNA 3TLVA 3FB2A 5LHHB 2ESCA 5LGTB 1FFRA 1WB0A 3AVRA 2V7IA 4EYUA 2YBUA 3B9EA 5LXTE 4Q25A 4KUMB 3AE1A 4QH1A 5KX5E 3MK7C 5ABFB 2F4EA 3O1IA 4CXYA 4AKIA 2PFVA 4IE0A 4HEAA 3FZKB 2DSWA 3AS1A 3KDSE 2WU5A 2VASA 2LSKA 2EULA 3N2OA 2LSYA 1HG5A 1IZNB 4NXNT 3AQUA 5D75A 5HXSA 3CX8B 3PUWF 4LAVA 3OJAA 2PV1A 1X9BA 5DIUA 5AQVB 5DQWA 4NUUA 5AQMB 4ASKA 4HWCA 1D1AA 2A2FX 1M5YA 4MGVA 2EHOC 5DO2A 4YT0A 1XMQT 4ZPWR 3AB3B 1D7IA 2YEVC 3ONLC 4UDMA 3AA6B 3DJBA 4ADZA 2DSZA 3IKGA 5JDNA 4AKRB 1I94T 4ILAA 3NRXA 2Z6EA 3FZFB 5EK2A 4DNDA 1WFDA 4OYKA 2DNXA 4ODMA 4YJ2E 1ZOYA 4IE5A 2Q5AA 4DT4A 3TLSA 3UU6A 1NWRA 2YU2A 4WBNE 2DPEA 2VWAA 2HN1A 4IDQA 4QXBB 1K9TA 3SFEA 2XAJB 4DV0T 2JJ9A 3TKLB 4B3RT 3GU0A 1MIVA 4U84A 3AA0B 4GKKT 4CI3B 4WIWA 4AQFA 4UF0A 2KMFA 3EHZA 3P4WA 4P09A 3B9AA 2LOSA 1QZ2A 2ZR6A 4IPXA 3UUMA 2VQFT 1LJYA 2LSIA 4NXMT 5J1GA 4TWDA 3AS2A 3KADA 2LJLA 4X1YE 4HWDA 2EHOD 4XZCA 2K48A 3SS1A 4MAVA 4ODNA 3K3OA 4DV3T 2K3WA 4IT6A 4AQGA 3QB5K 1WYBA 2WDQA 1TCOC 5LG3A 4ITZA 5ABFA 2W62A 4MPKA 3ZMZB 4H9PC 3ZT6A 3TLWA 2I0MA 3O5PA 3O4XE 1BR0A 3BQIA 2E2AA 2KWIB 2LRLA 1LL6A 2PV2A 4P1NA 2MTQA 4PJJA 2JMKA 3ZCJA 4KBMB 4U7YA 1E6RA 4EGWA 1M62A 3CK6A 2YDQA 1M7KA 3ZJ1A 3PRBA 2L3LA 5HW7A 1YKEB 5AQNB 2Y48B 4ZI7E 5C3JA 1XRVA 4JI0T 3T8OA 5HCMA 3ARSA 4QH5A 1NSGA 4O8SA 2BG9C 4WYVA 1OGGA 2MLZA 3CHEA 2IMLA 3I9WA 1J4RA 4K0KT 4UIGA 4EEBA 1L0VA 2LT3A 1CTNA 3K1SA 4JFJA 4LF6T 1Q6IA 4H63H 5FP3A 2P9BA 3UU4A 5HAXA 3JAEA 2KR7A 5HWXA 3ETVA 1HNXT 3H3MA 3TC5A 1FKDA 4GGQA 1LRZA 4X66T 4ZXLA 1LKXA 3UI6A 2DWGA 2DWKA 4YSXA 3AAIA 1D6OA 2KINB 1YQ3A 2C0SA 2WSSV 1XDPA 2VCDA 1WR6A 4V1Av 3HA4A 3RQWA 1EQ3A 2A9UA 1D2KA 2CRBA 3N9PA 1HXVA 5LYJE 2IC6A 2PTFA 4AKGA 4HFHA 3RIFA 1WNOA 4UVBB 1E6NA 3RFWA 4ZS2A 3O5EA 1KT0A 1SE7A 5FXZA 4TX5A 4EZHA 3WD0A 3WD1A 4HFCA 3ARTA 4LF9T 1Z8UA 3VHLA 1JNEA 1ZU8A 2LKGA 2XM2A 3AE3A 3GN5B 2F4VT 4QIBA 2XPKA 3O5DA 1G8XA 2X0LB 2V8SV 3MDYB 1HCIA 3RGCA 2G41A 4NIQA 5LCYA 3ZN0B 2XAHB 2XSBA 3EDVA 3N5LA 3VR8A 4DZ3A 3IHRA 3AEBA 3ARZA 1WRDA 4BJMA 4CXWA 1ZP0A 4X1KE 2QYWA 1D1CA 2WBLA 5C8YE 2VL0A 4YTMA 4A97A 2WQYA 3EY6A 1D1BA 2RUDA 2KLQA 2IF4A 5JH7E 1W0AA 1IBMT 3PV0F 1F40A 2H3RA 4KQZA 4N78D 3N2KE 4GK0E 4DR5T 4U31A 1BR4A 4IIJE 3N9LA 4ERRA 2BBJA 3RYHE 2BS4A 2XAGB 3F2EA 1KNRA 1FKKA 4L3NA 2BS3A 3AROA 3RRWA 4ODLA 3MA9A 2UXCT 4U74A 5GQBA 4AKLA 2Y6XA 2PPOA 4JBWF 1OEDA 2BG9E 5HT1A 2RQSA 2KO7A 4FI5A 4DR1T 4P0BA 4HBOA 3G6MA 2ACXA 4WZXA 2F23A 3QNUA 3PU3A 2V7MA 4IL4A 5L3FB 5CJ5A 5CGMA 2XPBA 1QLBA 2KXPB 5LGUB 1P5QA 4DRIA 4ILCA 4IT4A 5LGNB 4TW7A 3NI6A 3C4XA 3UUXB 2N1GA 5IYZE 3JADA 3QUJA 4IDNA 1KNZA 4DRQA 3BK9A 5LP6E 3T1YT 3QOKA 4Z2JA 1J1JA 3WAKA 1QUUA 4O4IE 4I55E 2J47A 2MYSA 4C91A 3JYJA 4W9PA 1B7TA 2D2SA 2V7LA 2O92A 3GN5A 5H6RB 4L0RA 1VOMA 4ZI3D 3ARQA 4KP3C 3AE9A 4ML4A 2X9YA 4QXHB 5EK3A 4TWFA 4U72A 2YDRA 4JYAT 2CWOA 4E7SA 3ONJA 4S3KA 1XNRT 2O9OA 2FJBA 4IQ2A 2WMOA 3AS3A 3RI5A 2IHR1 3IF8B 5DIVA 3A5XA 1VRBA 3AAAB 3B5MA 3BQLA 3V5SA 2UXDT 3AEDA 4X64T 3H37A 1WAWA 3ABVA 2H89A 5JVDE 4Q7NA 2IUZA 3HL6A 4A98A 3OVUA 4PAGA 1AJ3A 4IDOA 2JQ9A 5AQOB 2IIUA 4TNVA 1XHGA 2OLHA 4WJXA 5LA6E 2H7VC 2XQ5A 5KXJA 2VKOA 2VURA 2UXXB 5FY1A 5CA0E 4DUYT 3WL0A 2XP9A 4JI3T 2KE0A 3W15B 3ZT5A 4DV4T 3FZLB 1FEWA 3K8PC 4BJNA 5JDGA 1T98A 3WD2A 4PW8A 1HTJF 5IHYA 3IA3A 4PTMA 4TX0A 4NZCA 4P8VA 3PUXF 5FVLA 4ODOA 4PJMA 3M65A 5BMVE 2LJ4A 4AKHA 4I4TE 4TYOA 3P8CD 3P4QA 3PJAA 4QWNB 4TWHA 2NW9A 1X6NA 4DO0A 3CQCB 3IK8A 1W9PA 5AQKB 2WM9A 2ZQVA 1ROTA 1XNQT 2XQ6A 2ACZA 2WS3A 4H9RC 3QB5A 4JLEA 2NTXA 4Z8XA 3J7Yq 2AXDS 5LJMA 4IDZA 3UFEA 3FHNA 1FMWA 4LGXA 1HJXA 4JI7T 3NZPA 4YJ3E 5DJQC 2MBGA 3KV6A 2YK0A 5FXXA 1H0GA 2WP9A 3WD4A 2IUBA 3O5KA 3AS0A 3BXWA 3LG7A 1W26A 3EVYA 1B6CA 1E6PA 4QXCB 2XY8B 1HS7A 3PUSA 3RIAA 3AEAA 5CB4E 2NR4A 5FYMA 3PTRB 2BKNA 3BQKA 2KFWA 1KFWA 5AQPB 3P4PA 3UU5A 1JVWA 4UVAB 2IW5B 2MOZA 5HBFA 3ZMTB 5LG4A 3WD3A 2JRKA 4B6XA 4AISA 3LBXB 1LVFA 1UR9A 3FY1A 4W5UA 3UT5E 2QF8A 3CMLA 3A8YC 2D9FA 3NWIA 2XQAA 2OFNA 2CA5A 3AECA 5AFUL 1FAPA 3NVOA 3RYIE 4OHFA 4EIWA 2KI3A 2F21A 2N87A 1C9HA 4P8UA 3LFMA 1T72A 3C4ZA 1D0ZA 2E9XD 2M2AA 3B9DA 3C51A 3RMEA 4HN9A 5JR9C 4HFDA 4LF8T 3KAIA 2ODUA 3VU7H 2XQ3A 5DQVA 1N36T 2LM2A 5HEHA 2P4VA 4UEMA 3O5LA 2VVSA 2NWBA 2PBIA 4WW0A 4HE8A 2WLZA 3P4SA 4GKJT 4YHHT 5BR8T 4IDPA 1J4IA 3UQ7A 5GONE 4GK5E 2X0YA 4TV9E 3OPCA 1MMGA 3Q5XA 3CH9A 1KFYA 2ZR4A 1JNZA 3O1HA 1NMVA 3SWHA 4LMLA 4H63V 4R5EA 4BA9A 4MLKA 2LKNA 2CPTA 1LQ0A 1UGOA 3RYCE 2NW7A 2G8ZA 2A3EA 4B3ST 4U85A 4KX6A 4KHZF 4AY1A 2D5UA 5HKGA 4PNIA 4GIWA 1W1PA 1ZBKA 3ARUA 4PK6A 2G0UA 2EHOB 5AQLB 2VN1A 4QT3A 3CX7B 2LHNA 3KV4A 5L3GB 3UFGA 3GMIA 4E7ZA 1MNEA 2ZQUA 4F6RC 1W1TA 5DF0A 4DR3T 5HXCA 4DMWA 2C5IT 3OBVE 1FKHA 2DSVA 3B57A 4XAXB 4WKFA 5FXWA 3SOLA 4PK5A 1SUMB 5TAOA 3AA1B 1DU2A 1LL4A 1ZBCA 1N1AA 2V7KA 3CKDA 1L1PA 5KMGP 3O5JA 4DIPA 2E5LT 2DHRA 1KT1A 3DTOA 2MPHA 3MJXA 2YU1A 2JZVA 4YTPA 5GPGA 3LBXA 3ZT7A 3LUOA 3Q2MA 5JDLA 4FN2A 2RUCA 5A1LA 3F57A 2RP4A 5E0OA 3CIRA 4CQIA 2KGJA 4P8WA 1S94A 4U86A 2VL8A 1SA0E 2ZLYA 2YDSA 1SHZC 1Q6UA 3ALFA 2ES0A 3TCZA 3SFDA 3M3ZB 3RX6A 4A56A 2WU2A 4LMJA 1EHNA 3QOFA 3WQVA 4G2AA 3AVSA 3JXVA 3KINB 4YFSA 2XP3A 3O1JA 1Q1CA 4P8XA 2V7JA 1F8AB 2X68A 1MIWA 5EZYE 2DT2A 3Q5DA 3HR0A 1YW5A 2HN2A 3ANWB 3ZYMA 1BL4A 4QZVB 3TDBA 5J0ZA 1JNRA 1EZ3A 2XUEA 4CI1B 4MNMA 3H3AA 4HGAA 1J5ET 3PUZF 4IE4A 3ARVA 3UUBA 3QK6A 1T7SA 3RYFE 4YHJA 4WBOA 2W67A 1FJDA 2E8IA 2DG4A 2C5KT 4XAKA 3ARWA 1UURA 2K9AA 5JRCB 1W0BA 2CWYA 2M1IA 3O5FA 2EHOA 1H0IA 4TUYE 4LF4T 5FY0A 1E6ZA 4C02B 4X1IE 4UELA 3K3QC 3ZMUB 1BR2A 3UQIA 2LE8A 2DL1A 2BG9B 4HWFA 3VR9A 4KR0B 2N2NA 3CGMA 3D0TA 3LSVA 1ZL1A 4DZ2A 3HKCE 1FKJA 1VF8A 4IGUA 1IJ6A 4Z91A 5BXJA 2KZ7B 4G63A 4DMVA 3KACA 3FZMB 2DT0A 1HG2A 1N33T 1IBKT 1X6LA 5ABHA 2MLXA 5HWCA 2NP9A 4ZS3A 5HWBA 4EOZB 1Q6HA 1EYMA 1JNTA 4IE6A 1W1YA 2H88A 4DBRA 2K8IA 1FKGA 4DWSC 3AEFA 2W4XA 5LJNA 2QA7A 2XZEA 3UQBA 4O2AE 2MF9A 1HF8A 4IREA 1GUVA 3AAEB 4DR7T 4QH4A 4OFZA 2YOEA 2X0HA 2B31A 4HWIB 1V9DA 1LG2A 4TW6A 3L8RA 3DP7A 4ZI3C 4TV8E 1NH6A 4ILBA 5L3EB 1HJVA 1ZBVA 4JFKA 3EABA 4JI1T 3UF8A 4O4JE 4L72B 5DEZA 4HTEA 1ZEEA 2Q9QD 1Y0OA 3KV5A 4YLHA 4X62T 5F8PA 3ANWA 5LOVE 4TN7B 5L4EA 4J4OA 3G6LA 3PA7A 1ZK6A 3RC3A 2XTLA 2OLTA 3EAMA 4R0XA 1O3XA 4ODKA 3PR9A 2D0TA 3JYMA 3VKGA 5LMNT 4EB6E 4CN1A 2IC9A 3RIUC 3AE2A 5CA1E 5M4YA 4K0UA 2RURA 4DBQA 3PE0A 2M6IA 4ZS6A 4U7IA 5J2UE 2Y78A 5JH8A 4CN4A 3PRDA 4J2CA 2M08A 4DWSD 5L3CB 1EIBA 4Z2KA 3PURA 2V5CA 1IJ5A 4I43B 3ZSSA 4ANJA 2BG9A 2GK9A 4A5XA 4ZEYA 2BZBA 4YTNA 1A7XA 4LFAT 3W4RA 4X65T 2WWUA 4ZPVR 4Z2LA 3OOBA 3C98B 3FBLA 1JNDA 3CZ8A 2VK9A 4DROA 5LNKA 2DT1A 1QPLA 2VQET 3WKZA 5HTGA 1NWMX 4HWHA 3RH3A 3V5UA 4HARA 4QT2A 5FL1A 4DV6T 5HUAA 2IAKA 4PJNA 5AQGB 1E44A 1W9RA 2M67A 1U79A 2XAQB 4OX9T 1ZHCA 1R8IA 5FXVA 1E1HB 2OA5A 2LPVA 2L2SA 2UXNB 5H6QB 3ZJ2A 1PINA 2ZMAA 3CHDA 1HX8A 3JCFA 3UUNA 2WCAA 2ZM0A 4ODRA 2CE7A 3OTOT 2V6YB 4GYSA 4U2YA 5CFBA 2C5JA 1FKIA 2CBJA 3WQWA 1LVKA 3Q5EA 2X67A 4WKAA 4W9OA 1EDQA 5JDFA 3TLTA 4U2ZA 3RGLA 2XQ7A 2OV9A 1FFQA 2NOXA 5HW8A 3KAFA 1YKHB 4JEUB 4DRHA 2BVMA 1HNWT 2FJEA 2RUQA 5AQJB 4COFA 3MKDA 4I0UA 4WK9A 3ZN1B 3RQUA 4QHOA 3L39A 2HHHT 3AA7B 1NENA 3ETUA 3KAHA 2VKJA 1YQ4A 2B5UB 2PBCA 3N9MA 5IWAT 3MZKB 3KV9A 4DR6T 3GWHA 4GOUA 4MSPA 1OGBA 3CQXC 1KEYA 2XP8A 2E9XC 3KZ7A 3ZCIA 2BKOA 4G2PA 2XQYA 3ZSTA 4ZZCA 3ZYKA 4X20E 2PPNA 1YXRA 2DT3A 5IUXA 4EZ4A 2L9QA 1UX5A 2XQ9A 2FJAA 2LSJA 2XPAA 2ZR5A 2Y8DA 3U3IA 2CEAA 4O2BE 4C90A 5HEJA 4GIVA 3PDYA 2YINA 1HFAA 2X51A 3O5IA 5F5WA 4M1PA 1ZB5A 1J6YA 1D7JA 3UU3A 1T8BA 2YBTA 4DUZT 2HPLA 2CHOA 3QC9A 1WCRA 2WM0A 3B8SA 3RRCA 4JV5T 2BKPA 4JFMA 4MNKA 3K3NA 1XDOA 3B13A 4W9QA 3X1DA 4JI6T 3RPUA 1HKMA 3O5OA 4TW8A 3JAFA 2L8KA 3AE8A 2UUAT 3RC8A 3ZYLA 3P7IA 5C2TA 1LL7A 3RIUA 3ZC0A 1QSDA 2CHNA 1UR8A 5JDHA 1KNPA 2WMNA 1NWUA 4N19A 2XAFB 1W09A 4FJOA 4HFEA 2E9XB 1MMDA 5AQIB 3OYXA 5AQHB 1GOIA 3T1HT 1FKSA 2XASB 3E22E 5FL0A 2RA1A 3ZKRA 2JQKA 2V6YA 2BDEA 4UXNB 5DABA 2W63A 1ZCNA 1I6ZA 2XQ8A 3AEGA 3HI2A 4MFRA 3CWZB 1Y01A 3LJCA 1XWMA 2LLYA 1WYCA 2UXBT 3PJAJ 3SRZA 1GPFA 1X79A 2QGSA 4DV7T 4O4LE 3CPZA 4NNRA 4ZZBA 3J9X1 2WZIA 5L3BB 4OK0A 3PRAA 1NMWA 1E15A 2PG8A 4CZZB 4PK4A 2DCFA 4IL9A 2B1EA 2FKEA 3CX6B 4DR4T 3P4RA 4LFCT 4LFBT 3ZLIA 2QRXA 3O9XA 2BVLA 1KK7A 4YSZA 3PUAA 3GTYX 4EAHA 3I0OA 3GPKA 3CGNA 1IX5A 1J4HA 4NSBA 5KDMC 2JQQA 3KAGA 4MBQA 4JFLA 1R9HA 1W9VA 3Q9DA 2LRKA 4MTVA 2N9DA 3ZMSB 2ZM2A 2MAWA 4U33A 2CBIA 1W1VA 3AE4A 3NRKA 2J1DG 1U5PA 4X5TA 2R6GF 1G73A 1UX4A 4OYJA 5JR9B 4AIUA
chains in the Genus database with same CATH topology
4KR0B 4W9PA 3O5MA 3CGMA 2WWVA 1ZL1A 4DZ2A 2O92A 1FKJA 1FKBA 1VF8A 5HW6A 3OA5A 2AWGA 5BXJA 3WL1A 3ARQA 4ML4A 4WKHA 1W9UA 3KACA 2FAPA 2DT0A 5J6EA 2XP5A 2ESCA 1FFRA 1WB0A 1X6LA 1ROUA 2MLXA 5HWCA 2YBUA 3B9EA 4DRNA 1FKFA 5HWBA 1SR0A 1SYTA 4S3KA 1Q6HA 1EYMA 2O9OA 4IQ2A 1JNTA 2F4EA 3AS3A 1W1YA 2ITKA 4Q22A 5DIVA 2K8IA 1FKGA 3O5GA 4Z2GA 4URIA 4DWSC 2WLYA 3AS1A 2DSWA 1WAWA 4Q7NA 2IUZA 2XZEA 3UQBA 4TNSA 2MF9A 3AQUA 2JQ9A 1XHGA 1GUVA 2OLHA 4WJXA 5D75A 4MNLA 4LAVA 2PV1A 2B31A 1LG2A 4TW6A 5DIUA 3WL0A 2XP9A 2KE0A 3ZT5A 1M5YA 1E9LA 4MGVA 3ARYA 4ODPA 1NH6A 5DO2A 1ZBWA 1HJVA 1ZBVA 4JFKA 3EABA 4ZPWR 3UF8A 1D7IA 4L72B 5DEZA 2A3CA 3WD2A 2PPPA 1Y0OA 4PTMA 1LG1A 4TX0A 2DSZA 4NZCA 4P8VA 3IKGA 5FVLA 1D7HA 4ODOA 3WH0A 4HBEA 2LJ4A 4J4OA 4TYOA 1HKJA 3H9RB 5LB7B 3G6LA 3PA7A 1ZK6A 1WFDA 4ODMA 4Z2IA 5FVKA 1X6NA 4R0XA 3IK8A 1W9PA 3RM9A 4ODKA 2Q5AA 2ZQVA 4DT4A 3PR9A 1ROTA 1NWRA 3JYMA 2DPEA 4S3JA 4CN1A 1K9TA 1FKRA 2RURA 5DITA 3RM8A 4ZS6A 4U7IA 4ODQA 5GPRA 2Y78A 4U84A 5JH8A 4CN4A 4LAWA 3PRDA 4LGXA 2M08A 4DWSD 4WIWA 1EIBA 1HJXA 2AOSA 4Z2KA 3ARPA 2XP6A 1HKKA 2A3AA 4JFIA 4DRPA 3ZSSA 4A5XA 3B9AA 4ZEYA 1A7XA 1QZ2A 3UQAA 2ZR6A 4IPXA 1H0GA 3WD4A 3W4RA 3CHFA 1LJYA 3O5KA 3AS0A 3BXWA 3O5QA 1W26A 5I98A 4ZPVR 4Z2LA 3AS2A 3KADA 1B6CA 3OOBA 1JNDA 3CZ8A 1E6PA 4DROA 2DT1A 4MAVA 1QPLA 4ODNA 3WKZA 5HTGA 4DRMA 2K3WA 4IT6A 3KCEA 4HARA 1TCOC 4ITZA 3RM4A 2KFWA 4MPKA 1KFWA 4QT2A 5HUAA 3ZT6A 1JVWA 3O5PA 5HBFA 1YATA 3WD3A 1U79A 2LRLA 1UR9A 1LL6A 3FY1A 1T11A 2PV2A 4W5UA 2QF8A 4P1NA 2LPVA 2L2SA 1BKFA 4U7YA 2A3BA 1E6RA 1PINA 2D9FA 3CHDA 3PRBA 2OFNA 5HW7A 1FAPA 3O5RA 4G50A 3NTPA 2KI3A 2F21A 2N87A 1XRVA 1C9HA 1HJWA 3IHZA 4ODRA 4IQCA 2V6YB 4P8UA 4U2YA 1FKIA 2M2AA 3B9DA 3ARSA 3KABA 2W2UA 1OGGA 1NSGA 3WQWA 3RMEA 3WIJA 2MLZA 3CHEA 3KAIA 4WKAA 4W9OA 1EDQA 1J4RA 1FD9A 4U2ZA 4DH0A 1FFQA 5HW8A 3O5LA 3KAFA 2FDMA 1FKLA 2RPAA 1CTNA 3K1SA 4DRHA 4JFJA 1RD6A 2WLZA 2LGOA 2RUQA 1Q6IA 1JNSA 4WK9A 1J4IA 2KR7A 3KAHA 2PBCA 4DWSB 3TC5A 3CH9A 1FKDA 4GGQA 2ZR4A 1QPFA 4FAPA 1NMVA 2WK2A 4Z2HA 5B8IC 4R5EA 4MSPA 3UI6A 1OGBA 2LKNA 2CPTA 1LQ0A 2XP8A 3KZ7A 4G2PA 3I6CA 2G8ZA 2A3EA 4O2TA 4U85A 3ZSTA 2UZ5A 1D6OA 4AY1A 2PPNA 1YXRA 2DT3A 5HKGA 1W1PA 1ZBKA 2VCDA 3ARUA 1O6IA 4BF8A 4DRJA 1EQ3A 2A9UA 1D2KA 2VN1A 4QT3A 2CRBA 1HXVA 2DSUA 2XPAA 1WNOA 2ZR5A 1E6NA 2PI6A 2ZQUA 3RFWA 3IKDA 3O5EA 1KT0A 1W1TA 5DF0A 4GIVA 1FKHA 2DSVA 3B7XA 3WD0A 3ARXA 3WD1A 3ALGA 3O5IA 4WKFA 3ARTA 2DG9A 3ARRA 1FKTA 1JNEA 1ZU8A 1ZB5A 2XP7A 1J6YA 1D7JA 4QIBA 2YBTA 4LAXA 3O5DA 1ZBCA 1WCRA 1LL4A 2WM0A 1N1AA 2PV3A 3B8SA 3MDYB 3RGCA 2G41A 4NIQA 1L1PA 2ZQTA 3O5JA 4MNKA 4JFMA 4DIPA 4W9QA 1KT1A 1HKMA 2MPHA 3O5OA 4TW8A 1PBKA 4DZ3A 3ARZA 2JZVA 1ITXA 5GPGA 3ZT7A 3LUOA 1LL7A 3ODKA 4FN2A 2RSEA 1UR8A 2RUCA 2DG3A 3EY6A 1NWUA 4N19A 2RUDA 2IF4A 1HKIA 2KGJA 4P8WA 2MPKA 1TFVA 4U86A 3FAPA 1GOIA 1FKSA 2WY2A 1F40A 1OWQA 1Q6UA 2XP4A 4KQZA 2JQKA 2V6YA 3ALFA 3TCZA 3VAWA 1ZCNA 4U31A 4ZPTR 4DRKA 4MNJA 1EHNA 1NWSA 3WQVA 3FXYA 3JXVA 2XP3A 1Q1CA 4P8XA 1GPFA 4L3NA 1FKKA 1F8AB 4ODLA 2DT2A 4NNRA 3CHCA 1YW5A 4JYSA 2MLYA 5GQBA 1BL4A 4QZVB 3PRAA 3TDBA 2PPOA 4U3CA 1NMWA 2JQHA 1E15A 4MNMA 3UI4A 3UI5A 4LAYA 4DWSA 5HT1A 2RQSA 3ARVA 2KO7A 4HBOA 4J4NA 2FKEA 3G6MA 4WZXA 4CN6A 1FJDA 2DG4A 2V6XA 4XAKA 3ARWA 5CJ5A 5CGMA 2XPBA 2ZQSA 1P5QA 4DRIA 3GPKA 1IX5A 3CGNA 1J4HA 4NSBA 4IT4A 3KAGA 2M1IA 4TW7A 3O5FA 4JFLA 1H0IA 3NI6A 1R9HA 1W9VA 2LRKA 1WR0A 1NWTA 1E6ZA 1W1VA 2F2DA 4U33A 4MTVA 4C02B 4DRQA 3NRKA 4Z2JA 3QOKA 2MNTA 3UQIA 2DL1A 3JYJA 3AROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZSS A;  4P1N A;  3ZT7 A;  2W2U A;  4U31 A;  4A5X A;  4CN1 A;  4ZEY A;  5CJ5 A;  5CGM A;  4U7Y A;  5FVL A;  2WWV A;  4U3C A;  2JQH A;  4IT4 A;  2A9U A;  4U2Z A;  3ZT5 A;  1WCR A;  2K3W A;  2CRB A;  5LB7 B;  4U7I A;  4NIQ A;  3ZT6 A;  2MPK A;  2LRK A;  1WR0 A;  1WFD A;  3EAB A;  4CN4 A;  4U33 A;  2RPA A;  2WY2 A;  2XZE A;  3K1S A;  4IT6 A;  2CPT A;  5FVK A;  4WZX A;  4CN6 A;  2V6Y B;  2JQ9 A;  4U2Y A;  2JQK A;  2V6Y A;  3ZST A;  2LRL A;  2DL1 A;  2V6X A;  1YXR A; 
#chains in the Genus database with same CATH topology
 2W66 A;  3O5M A;  3N9O A;  3R6N A;  2WWV A;  3VKH A;  4HKA A;  5LHG B;  2XQ4 A;  3I9Y A;  1FKB A;  5HXR A;  3OA5 A;  2AWG A;  3BMB A;  4WKH A;  1W9U A;  2KT9 A;  2FAP A;  2H7O A;  5J6E A;  2XP5 A;  1OWA A;  3C50 A;  1VCS A;  2WAU A;  4JI8 T;  3AE5 A;  1ROU A;  1FJG T;  4DRN A;  4JUY A;  1FKF A;  1SR0 A;  1SYT A;  5AQU B;  3S4U A;  2ITK A;  2UU9 T;  4Q22 A;  5LHI B;  5HEG A;  4WNK A;  3O5G A;  4Z2G A;  5AQQ B;  4URI A;  1OED C;  2WLY A;  2K5B B;  2E9X A;  3KVB A;  4H9Q C;  2NTY A;  2M6B A;  3ESL A;  4UV8 B;  4TNS A;  2WZH A;  2WDV A;  4ILU A;  4DR2 T;  3N9N A;  3RF1 A;  1IBL T;  2X9W A;  4YXD A;  1ZV4 X;  4MNL A;  4I50 E;  1E7P A;  4AQY T;  3KBT A;  2WDR A;  2V26 A;  3KFW X;  4MAL A;  1E9L A;  3ARY A;  4ODP A;  5FMN A;  2JIW A;  4HFV A;  1ZBW A;  1E2A A;  2CLY C;  1VCT A;  2A3C A;  2PPP A;  3C4W A;  4CI2 B;  4PJL A;  1LG1 A;  1NEK A;  5HEU A;  4XBF B;  1D7H A;  1WLX A;  3CQG B;  3ZPO A;  3WH0 A;  4HBE A;  1HKJ A;  3H9R B;  5LB7 B;  2K24 A;  1YW0 A;  1OXZ A;  1JCH B;  4Z2I A;  3UTK A;  5FVK A;  4QX8 B;  3RM9 A;  5FY7 A;  3N2G E;  4IE7 A;  2VKD A;  4JI2 T;  2KSR A;  4S3J A;  2KND A;  5LBM A;  2HH7 A;  2W00 A;  1FKR A;  3EUH A;  3FZH B;  1OED B;  5DIT A;  3NZQ A;  2LEH A;  3RM8 A;  3LDQ B;  4ODQ A;  2LSG A;  5GPR A;  1XMO T;  2Q9Q C;  4F8H A;  4DV2 T;  4AI6 A;  4LAW A;  3E0Z A;  1MND A;  4DV1 T;  2NW8 A;  2AOS A;  3ARP A;  2XP6 A;  1HKK A;  2A3A A;  4JFI A;  3EIP A;  4DRP A;  1S35 A;  2B76 A;  2PJQ A;  5JR9 A;  3PUV F;  3UQA A;  3NBX X;  3LK2 B;  3MXZ A;  3CHF A;  3TLU A;  3GA8 A;  4DV5 T;  2CLY B;  4ZOL E;  3O5Q A;  2XM1 A;  5EK4 A;  4JI4 T;  5LBQ B;  5I98 A;  2V5D A;  2AE9 A;  3EI0 A;  5HYA A;  4LMK A;  2CXL A;  4DRM A;  3G06 A;  1CHU A;  3KCE A;  1GQE A;  3ZC1 A;  2J62 A;  3RKG A;  3RM4 A;  2LKH A;  4UR9 A;  4IHJ E;  5FNV E;  4QX7 B;  2FUP A;  3ZMV B;  2JPF A;  5HXE A;  1YAT A;  4KI0 F;  1CUN A;  1YD8 G;  4LF7 T;  1T11 A;  1FIO A;  5AQT B;  4P0A A;  3RLF F;  4H9N C;  1BKF A;  4TZ4 C;  2A3B A;  3AE6 A;  4YSY A;  2QVA A;  3I1A A;  2CXF A;  2Q9Q B;  3RHW A;  3RKO A;  5JDM A;  1BR1 A;  5L47 A;  3O5R A;  2IDO B;  4G50 A;  3NTP A;  1HJW A;  5HWY A;  3IHZ A;  4IQC A;  1OED E;  3NKZ A;  2X9H A;  5HXH A;  3KAB A;  2W2U A;  4DID B;  3WIJ A;  2VKH A;  3PU8 A;  4CXX A;  4HFB A;  3JC6 C;  1FD9 A;  2UUC T;  4DH0 A;  2E5V A;  2YN6 A;  1HX1 B;  1U4Q A;  2FDM A;  2YKS A;  1FKL A;  2RPA A;  4UV9 B;  2FBW A;  4B3M T;  1RD6 A;  2LGO A;  2DLR A;  1NAF A;  1JNS A;  5JRE A;  5AQF B;  5AQR B;  4H9O C;  2ZM6 T;  5LMU T;  4NUV A;  4DWS B;  3FXE B;  5JRC A;  1QPF A;  2FJD A;  4FAP A;  2XHE B;  5B8I C;  2WK2 A;  4Z2H A;  5L2L A;  3C64 A;  3U78 A;  3I6C A;  4O2T A;  2XSA A;  3LK3 B;  2UZ5 A;  2D9D A;  4KMC A;  1D0X A;  5JTG A;  4AXP A;  4DVD A;  1J5W A;  1UK5 A;  1O6I A;  3AXJ B;  4L9I A;  3VRA A;  4BF8 A;  4PFP A;  2DI4 A;  4DRJ A;  4EXT A;  5ABE A;  2SPC A;  3R84 B;  1MMN A;  2DSU A;  1HR0 T;  4H9S E;  2PI6 A;  3E08 A;  3IKD A;  2J4G A;  4EYY R;  3IEE A;  3B7X A;  3ARX A;  4HFI A;  3ALG A;  4L5G A;  3LK4 2;  2W0G A;  2I6H A;  2CXD A;  3ZEF B;  5JDQ A;  1FKT A;  2DG9 A;  2XP7 A;  3ARR A;  4JEH B;  1FMV A;  4LAX A;  4UVC B;  2PV3 A;  4KHP T;  3KBU A;  3JC6 D;  2CM0 A;  2ZQT A;  4EED A;  2X66 A;  2HPJ A;  3PUQ A;  2LM9 A;  4YY3 T;  1PBK A;  5ETW A;  3UUL A;  1UUS A;  1ITX A;  3KVA A;  5F3J A;  4ZI2 C;  4JI5 T;  3EDU A;  3ODK A;  3OKQ A;  3OYZ A;  4ZHQ E;  2RSE A;  2I59 A;  2DG3 A;  5L3D B;  1MMA A;  3FBZ A;  4PFO A;  2W61 A;  4LF5 T;  5ADX L;  1HKI A;  3WAJ A;  2ODV A;  1D0Y A;  2Q9Q A;  3ONX A;  2MPK A;  1TFV A;  3A7M A;  3FAP A;  3L09 A;  2WY2 A;  2A72 A;  5ABG A;  1Y64 B;  1OWQ A;  3PUY F;  4IST A;  4AQF C;  2CMR A;  4EV6 A;  2XP4 A;  5HCJ A;  3VAW A;  3PUG A;  4ZPT R;  4DRK A;  2BBH A;  4TNW A;  1IAP A;  1NWS A;  4MNJ A;  3FXY A;  1Z0P A;  3IBP A;  3L3P A;  1XZY A;  4O4H E;  5HEO A;  1N32 T;  1GRJ A;  3FXD B;  2UUB T;  1MIY A;  1UCU A;  3CHC A;  2V1D B;  4JYS A;  2MLY A;  4ISS A;  1N34 T;  1KF6 A;  2XJ7 A;  4U3C A;  2JQH A;  3HKB E;  3P50 A;  2KWH A;  3UI4 A;  3UI5 A;  4LAY A;  4DWS A;  3N9Q A;  2VVN A;  4J4N A;  3NRY A;  3AE7 A;  4CN6 A;  3WI3 A;  2JMH A;  2V6X A;  3AEE A;  2WB5 A;  5AQS B;  3CVR A;  2X9X A;  2ZQS A;  4ZI2 D;  3AXJ A;  4GYR A;  2LHR A;  3HKD E;  4MHC A;  3UU8 A;  4Z90 A;  3VRB A;  1WR0 A;  5L4H A;  1NWT A;  2F2D A;  2MNT A;  4UF0 B;  2D0U A;  2VB6 A;  3UQ4 A;  2LOP A;  2PN0 A;  1H7C A;  4B3T T;  5J2T E;  2ETN A;  5FKY A;  2CCQ A;  4NPP A;  3I0Q A;  2ZM8 A;  1HNZ T;  3MAC A;  3Q5W A;  5JQG E;  3F31 A;  2A3D A;  5HW6 A;  1ZKE A;  1US7 B;  3WL1 A;  4BAY B;  2BS2 A;  3HKE E;  4QKN A;  3TLV A;  3FB2 A;  5LHH B;  2ESC A;  5LGT B;  1FFR A;  1WB0 A;  3AVR A;  2V7I A;  4EYU A;  2YBU A;  3B9E A;  5LXT E;  4Q25 A;  4KUM B;  3AE1 A;  4QH1 A;  5KX5 E;  3MK7 C;  5ABF B;  2F4E A;  3O1I A;  4CXY A;  4AKI A;  2PFV A;  4IE0 A;  4HEA A;  3FZK B;  2DSW A;  3AS1 A;  3KDS E;  2WU5 A;  2VAS A;  2LSK A;  2EUL A;  3N2O A;  2LSY A;  1HG5 A;  1IZN B;  4NXN T;  3AQU A;  5D75 A;  5HXS A;  3CX8 B;  3PUW F;  4LAV A;  3OJA A;  2PV1 A;  1X9B A;  5DIU A;  5AQV B;  5DQW A;  4NUU A;  5AQM B;  4ASK A;  4HWC A;  1D1A A;  2A2F X;  1M5Y A;  4MGV A;  2EHO C;  5DO2 A;  4YT0 A;  1XMQ T;  4ZPW R;  3AB3 B;  1D7I A;  2YEV C;  3ONL C;  4UDM A;  3AA6 B;  3DJB A;  4ADZ A;  2DSZ A;  3IKG A;  5JDN A;  4AKR B;  1I94 T;  4ILA A;  3NRX A;  2Z6E A;  3FZF B;  5EK2 A;  4DND A;  1WFD A;  4OYK A;  2DNX A;  4ODM A;  4YJ2 E;  1ZOY A;  4IE5 A;  2Q5A A;  4DT4 A;  3TLS A;  3UU6 A;  1NWR A;  2YU2 A;  4WBN E;  2DPE A;  2VWA A;  2HN1 A;  4IDQ A;  4QXB B;  1K9T A;  3SFE A;  2XAJ B;  4DV0 T;  2JJ9 A;  3TKL B;  4B3R T;  3GU0 A;  1MIV A;  4U84 A;  3AA0 B;  4GKK T;  4CI3 B;  4WIW A;  4AQF A;  4UF0 A;  2KMF A;  3EHZ A;  3P4W A;  4P09 A;  3B9A A;  2LOS A;  1QZ2 A;  2ZR6 A;  4IPX A;  3UUM A;  2VQF T;  1LJY A;  2LSI A;  4NXM T;  5J1G A;  4TWD A;  3AS2 A;  3KAD A;  2LJL A;  4X1Y E;  4HWD A;  2EHO D;  4XZC A;  2K48 A;  3SS1 A;  4MAV A;  4ODN A;  3K3O A;  4DV3 T;  2K3W A;  4IT6 A;  4AQG A;  3QB5 K;  1WYB A;  2WDQ A;  1TCO C;  5LG3 A;  4ITZ A;  5ABF A;  2W62 A;  4MPK A;  3ZMZ B;  4H9P C;  3ZT6 A;  3TLW A;  2I0M A;  3O5P A;  3O4X E;  1BR0 A;  3BQI A;  2E2A A;  2KWI B;  2LRL A;  1LL6 A;  2PV2 A;  4P1N A;  2MTQ A;  4PJJ A;  2JMK A;  3ZCJ A;  4KBM B;  4U7Y A;  1E6R A;  4EGW A;  1M62 A;  3CK6 A;  2YDQ A;  1M7K A;  3ZJ1 A;  3PRB A;  2L3L A;  5HW7 A;  1YKE B;  5AQN B;  2Y48 B;  4ZI7 E;  5C3J A;  1XRV A;  4JI0 T;  3T8O A;  5HCM A;  3ARS A;  4QH5 A;  1NSG A;  4O8S A;  2BG9 C;  4WYV A;  1OGG A;  2MLZ A;  3CHE A;  2IML A;  3I9W A;  1J4R A;  4K0K T;  4UIG A;  4EEB A;  1L0V A;  2LT3 A;  1CTN A;  3K1S A;  4JFJ A;  4LF6 T;  1Q6I A;  4H63 H;  5FP3 A;  2P9B A;  3UU4 A;  5HAX A;  3JAE A;  2KR7 A;  5HWX A;  3ETV A;  1HNX T;  3H3M A;  3TC5 A;  1FKD A;  4GGQ A;  1LRZ A;  4X66 T;  4ZXL A;  1LKX A;  3UI6 A;  2DWG A;  2DWK A;  4YSX A;  3AAI A;  1D6O A;  2KIN B;  1YQ3 A;  2C0S A;  2WSS V;  1XDP A;  2VCD A;  1WR6 A;  4V1A v;  3HA4 A;  3RQW A;  1EQ3 A;  2A9U A;  1D2K A;  2CRB A;  3N9P A;  1HXV A;  5LYJ E;  2IC6 A;  2PTF A;  4AKG A;  4HFH A;  3RIF A;  1WNO A;  4UVB B;  1E6N A;  3RFW A;  4ZS2 A;  3O5E A;  1KT0 A;  1SE7 A;  5FXZ A;  4TX5 A;  4EZH A;  3WD0 A;  3WD1 A;  4HFC A;  3ART A;  4LF9 T;  1Z8U A;  3VHL A;  1JNE A;  1ZU8 A;  2LKG A;  2XM2 A;  3AE3 A;  3GN5 B;  2F4V T;  4QIB A;  2XPK A;  3O5D A;  1G8X A;  2X0L B;  2V8S V;  3MDY B;  1HCI A;  3RGC A;  2G41 A;  4NIQ A;  5LCY A;  3ZN0 B;  2XAH B;  2XSB A;  3EDV A;  3N5L A;  3VR8 A;  4DZ3 A;  3IHR A;  3AEB A;  3ARZ A;  1WRD A;  4BJM A;  4CXW A;  1ZP0 A;  4X1K E;  2QYW A;  1D1C A;  2WBL A;  5C8Y E;  2VL0 A;  4YTM A;  4A97 A;  2WQY A;  3EY6 A;  1D1B A;  2RUD A;  2KLQ A;  2IF4 A;  5JH7 E;  1W0A A;  1IBM T;  3PV0 F;  1F40 A;  2H3R A;  4KQZ A;  4N78 D;  3N2K E;  4GK0 E;  4DR5 T;  4U31 A;  1BR4 A;  4IIJ E;  3N9L A;  4ERR A;  2BBJ A;  3RYH E;  2BS4 A;  2XAG B;  3F2E A;  1KNR A;  1FKK A;  4L3N A;  2BS3 A;  3ARO A;  3RRW A;  4ODL A;  3MA9 A;  2UXC T;  4U74 A;  5GQB A;  4AKL A;  2Y6X A;  2PPO A;  4JBW F;  1OED A;  2BG9 E;  5HT1 A;  2RQS A;  2KO7 A;  4FI5 A;  4DR1 T;  4P0B A;  4HBO A;  3G6M A;  2ACX A;  4WZX A;  2F23 A;  3QNU A;  3PU3 A;  2V7M A;  4IL4 A;  5L3F B;  5CJ5 A;  5CGM A;  2XPB A;  1QLB A;  2KXP B;  5LGU B;  1P5Q A;  4DRI A;  4ILC A;  4IT4 A;  5LGN B;  4TW7 A;  3NI6 A;  3C4X A;  3UUX B;  2N1G A;  5IYZ E;  3JAD A;  3QUJ A;  4IDN A;  1KNZ A;  4DRQ A;  3BK9 A;  5LP6 E;  3T1Y T;  3QOK A;  4Z2J A;  1J1J A;  3WAK A;  1QUU A;  4O4I E;  4I55 E;  2J47 A;  2MYS A;  4C91 A;  3JYJ A;  4W9P A;  1B7T A;  2D2S A;  2V7L A;  2O92 A;  3GN5 A;  5H6R B;  4L0R A;  1VOM A;  4ZI3 D;  3ARQ A;  4KP3 C;  3AE9 A;  4ML4 A;  2X9Y A;  4QXH B;  5EK3 A;  4TWF A;  4U72 A;  2YDR A;  4JYA T;  2CWO A;  4E7S A;  3ONJ A;  4S3K A;  1XNR T;  2O9O A;  2FJB A;  4IQ2 A;  2WMO A;  3AS3 A;  3RI5 A;  2IHR 1;  3IF8 B;  5DIV A;  3A5X A;  1VRB A;  3AAA B;  3B5M A;  3BQL A;  3V5S A;  2UXD T;  3AED A;  4X64 T;  3H37 A;  1WAW A;  3ABV A;  2H89 A;  5JVD E;  4Q7N A;  2IUZ A;  3HL6 A;  4A98 A;  3OVU A;  4PAG A;  1AJ3 A;  4IDO A;  2JQ9 A;  5AQO B;  2IIU A;  4TNV A;  1XHG A;  2OLH A;  4WJX A;  5LA6 E;  2H7V C;  2XQ5 A;  5KXJ A;  2VKO A;  2VUR A;  2UXX B;  5FY1 A;  5CA0 E;  4DUY T;  3WL0 A;  2XP9 A;  4JI3 T;  2KE0 A;  3W15 B;  3ZT5 A;  4DV4 T;  3FZL B;  1FEW A;  3K8P C;  4BJN A;  5JDG A;  1T98 A;  3WD2 A;  4PW8 A;  1HTJ F;  5IHY A;  3IA3 A;  4PTM A;  4TX0 A;  4NZC A;  4P8V A;  3PUX F;  5FVL A;  4ODO A;  4PJM A;  3M65 A;  5BMV E;  2LJ4 A;  4AKH A;  4I4T E;  4TYO A;  3P8C D;  3P4Q A;  3PJA A;  4QWN B;  4TWH A;  2NW9 A;  1X6N A;  4DO0 A;  3CQC B;  3IK8 A;  1W9P A;  5AQK B;  2WM9 A;  2ZQV A;  1ROT A;  1XNQ T;  2XQ6 A;  2ACZ A;  2WS3 A;  4H9R C;  3QB5 A;  4JLE A;  2NTX A;  4Z8X A;  3J7Y q;  2AXD S;  5LJM A;  4IDZ A;  3UFE A;  3FHN A;  1FMW A;  4LGX A;  1HJX A;  4JI7 T;  3NZP A;  4YJ3 E;  5DJQ C;  2MBG A;  3KV6 A;  2YK0 A;  5FXX A;  1H0G A;  2WP9 A;  3WD4 A;  2IUB A;  3O5K A;  3AS0 A;  3BXW A;  3LG7 A;  1W26 A;  3EVY A;  1B6C A;  1E6P A;  4QXC B;  2XY8 B;  1HS7 A;  3PUS A;  3RIA A;  3AEA A;  5CB4 E;  2NR4 A;  5FYM A;  3PTR B;  2BKN A;  3BQK A;  2KFW A;  1KFW A;  5AQP B;  3P4P A;  3UU5 A;  1JVW A;  4UVA B;  2IW5 B;  2MOZ A;  5HBF A;  3ZMT B;  5LG4 A;  3WD3 A;  2JRK A;  4B6X A;  4AIS A;  3LBX B;  1LVF A;  1UR9 A;  3FY1 A;  4W5U A;  3UT5 E;  2QF8 A;  3CML A;  3A8Y C;  2D9F A;  3NWI A;  2XQA A;  2OFN A;  2CA5 A;  3AEC A;  5AFU L;  1FAP A;  3NVO A;  3RYI E;  4OHF A;  4EIW A;  2KI3 A;  2F21 A;  2N87 A;  1C9H A;  4P8U A;  3LFM A;  1T72 A;  3C4Z A;  1D0Z A;  2E9X D;  2M2A A;  3B9D A;  3C51 A;  3RME A;  4HN9 A;  5JR9 C;  4HFD A;  4LF8 T;  3KAI A;  2ODU A;  3VU7 H;  2XQ3 A;  5DQV A;  1N36 T;  2LM2 A;  5HEH A;  2P4V A;  4UEM A;  3O5L A;  2VVS A;  2NWB A;  2PBI A;  4WW0 A;  4HE8 A;  2WLZ A;  3P4S A;  4GKJ T;  4YHH T;  5BR8 T;  4IDP A;  1J4I A;  3UQ7 A;  5GON E;  4GK5 E;  2X0Y A;  4TV9 E;  3OPC A;  1MMG A;  3Q5X A;  3CH9 A;  1KFY A;  2ZR4 A;  1JNZ A;  3O1H A;  1NMV A;  3SWH A;  4LML A;  4H63 V;  4R5E A;  4BA9 A;  4MLK A;  2LKN A;  2CPT A;  1LQ0 A;  1UGO A;  3RYC E;  2NW7 A;  2G8Z A;  2A3E A;  4B3S T;  4U85 A;  4KX6 A;  4KHZ F;  4AY1 A;  2D5U A;  5HKG A;  4PNI A;  4GIW A;  1W1P A;  1ZBK A;  3ARU A;  4PK6 A;  2G0U A;  2EHO B;  5AQL B;  2VN1 A;  4QT3 A;  3CX7 B;  2LHN A;  3KV4 A;  5L3G B;  3UFG A;  3GMI A;  4E7Z A;  1MNE A;  2ZQU A;  4F6R C;  1W1T A;  5DF0 A;  4DR3 T;  5HXC A;  4DMW A;  2C5I T;  3OBV E;  1FKH A;  2DSV A;  3B57 A;  4XAX B;  4WKF A;  5FXW A;  3SOL A;  4PK5 A;  1SUM B;  5TAO A;  3AA1 B;  1DU2 A;  1LL4 A;  1ZBC A;  1N1A A;  2V7K A;  3CKD A;  1L1P A;  5KMG P;  3O5J A;  4DIP A;  2E5L T;  2DHR A;  1KT1 A;  3DTO A;  2MPH A;  3MJX A;  2YU1 A;  2JZV A;  4YTP A;  5GPG A;  3LBX A;  3ZT7 A;  3LUO A;  3Q2M A;  5JDL A;  4FN2 A;  2RUC A;  5A1L A;  3F57 A;  2RP4 A;  5E0O A;  3CIR A;  4CQI A;  2KGJ A;  4P8W A;  1S94 A;  4U86 A;  2VL8 A;  1SA0 E;  2ZLY A;  2YDS A;  1SHZ C;  1Q6U A;  3ALF A;  2ES0 A;  3TCZ A;  3SFD A;  3M3Z B;  3RX6 A;  4A56 A;  2WU2 A;  4LMJ A;  1EHN A;  3QOF A;  3WQV A;  4G2A A;  3AVS A;  3JXV A;  3KIN B;  4YFS A;  2XP3 A;  3O1J A;  1Q1C A;  4P8X A;  2V7J A;  1F8A B;  2X68 A;  1MIW A;  5EZY E;  2DT2 A;  3Q5D A;  3HR0 A;  1YW5 A;  2HN2 A;  3ANW B;  3ZYM A;  1BL4 A;  4QZV B;  3TDB A;  5J0Z A;  1JNR A;  1EZ3 A;  2XUE A;  4CI1 B;  4MNM A;  3H3A A;  4HGA A;  1J5E T;  3PUZ F;  4IE4 A;  3ARV A;  3UUB A;  3QK6 A;  1T7S A;  3RYF E;  4YHJ A;  4WBO A;  2W67 A;  1FJD A;  2E8I A;  2DG4 A;  2C5K T;  4XAK A;  3ARW A;  1UUR A;  2K9A A;  5JRC B;  1W0B A;  2CWY A;  2M1I A;  3O5F A;  2EHO A;  1H0I A;  4TUY E;  4LF4 T;  5FY0 A;  1E6Z A;  4C02 B;  4X1I E;  4UEL A;  3K3Q C;  3ZMU B;  1BR2 A;  3UQI A;  2LE8 A;  2DL1 A;  2BG9 B;  4HWF A;  3VR9 A;  4KR0 B;  2N2N A;  3CGM A;  3D0T A;  3LSV A;  1ZL1 A;  4DZ2 A;  3HKC E;  1FKJ A;  1VF8 A;  4IGU A;  1IJ6 A;  4Z91 A;  5BXJ A;  2KZ7 B;  4G63 A;  4DMV A;  3KAC A;  3FZM B;  2DT0 A;  1HG2 A;  1N33 T;  1IBK T;  1X6L A;  5ABH A;  2MLX A;  5HWC A;  2NP9 A;  4ZS3 A;  5HWB A;  4EOZ B;  1Q6H A;  1EYM A;  1JNT A;  4IE6 A;  1W1Y A;  2H88 A;  4DBR A;  2K8I A;  1FKG A;  4DWS C;  3AEF A;  2W4X A;  5LJN A;  2QA7 A;  2XZE A;  3UQB A;  4O2A E;  2MF9 A;  1HF8 A;  4IRE A;  1GUV A;  3AAE B;  4DR7 T;  4QH4 A;  4OFZ A;  2YOE A;  2X0H A;  2B31 A;  4HWI B;  1V9D A;  1LG2 A;  4TW6 A;  3L8R A;  3DP7 A;  4ZI3 C;  4TV8 E;  1NH6 A;  4ILB A;  5L3E B;  1HJV A;  1ZBV A;  4JFK A;  3EAB A;  4JI1 T;  3UF8 A;  4O4J E;  4L72 B;  5DEZ A;  4HTE A;  1ZEE A;  2Q9Q D;  1Y0O A;  3KV5 A;  4YLH A;  4X62 T;  5F8P A;  3ANW A;  5LOV E;  4TN7 B;  5L4E A;  4J4O A;  3G6L A;  3PA7 A;  1ZK6 A;  3RC3 A;  2XTL A;  2OLT A;  3EAM A;  4R0X A;  1O3X A;  4ODK A;  3PR9 A;  2D0T A;  3JYM A;  3VKG A;  5LMN T;  4EB6 E;  4CN1 A;  2IC9 A;  3RIU C;  3AE2 A;  5CA1 E;  5M4Y A;  4K0U A;  2RUR A;  4DBQ A;  3PE0 A;  2M6I A;  4ZS6 A;  4U7I A;  5J2U E;  2Y78 A;  5JH8 A;  4CN4 A;  3PRD A;  4J2C A;  2M08 A;  4DWS D;  5L3C B;  1EIB A;  4Z2K A;  3PUR A;  2V5C A;  1IJ5 A;  4I43 B;  3ZSS A;  4ANJ A;  2BG9 A;  2GK9 A;  4A5X A;  4ZEY A;  2BZB A;  4YTN A;  1A7X A;  4LFA T;  3W4R A;  4X65 T;  2WWU A;  4ZPV R;  4Z2L A;  3OOB A;  3C98 B;  3FBL A;  1JND A;  3CZ8 A;  2VK9 A;  4DRO A;  5LNK A;  2DT1 A;  1QPL A;  2VQE T;  3WKZ A;  5HTG A;  1NWM X;  4HWH A;  3RH3 A;  3V5U A;  4HAR A;  4QT2 A;  5FL1 A;  4DV6 T;  5HUA A;  2IAK A;  4PJN A;  5AQG B;  1E44 A;  1W9R A;  2M67 A;  1U79 A;  2XAQ B;  4OX9 T;  1ZHC A;  1R8I A;  5FXV A;  1E1H B;  2OA5 A;  2LPV A;  2L2S A;  2UXN B;  5H6Q B;  3ZJ2 A;  1PIN A;  2ZMA A;  3CHD A;  1HX8 A;  3JCF A;  3UUN A;  2WCA A;  2ZM0 A;  4ODR A;  2CE7 A;  3OTO T;  2V6Y B;  4GYS A;  4U2Y A;  5CFB A;  2C5J A;  1FKI A;  2CBJ A;  3WQW A;  1LVK A;  3Q5E A;  2X67 A;  4WKA A;  4W9O A;  1EDQ A;  5JDF A;  3TLT A;  4U2Z A;  3RGL A;  2XQ7 A;  2OV9 A;  1FFQ A;  2NOX A;  5HW8 A;  3KAF A;  1YKH B;  4JEU B;  4DRH A;  2BVM A;  1HNW T;  2FJE A;  2RUQ A;  5AQJ B;  4COF A;  3MKD A;  4I0U A;  4WK9 A;  3ZN1 B;  3RQU A;  4QHO A;  3L39 A;  2HHH T;  3AA7 B;  1NEN A;  3ETU A;  3KAH A;  2VKJ A;  1YQ4 A;  2B5U B;  2PBC A;  3N9M A;  5IWA T;  3MZK B;  3KV9 A;  4DR6 T;  3GWH A;  4GOU A;  4MSP A;  1OGB A;  3CQX C;  1KEY A;  2XP8 A;  2E9X C;  3KZ7 A;  3ZCI A;  2BKO A;  4G2P A;  2XQY A;  3ZST A;  4ZZC A;  3ZYK A;  4X20 E;  2PPN A;  1YXR A;  2DT3 A;  5IUX A;  4EZ4 A;  2L9Q A;  1UX5 A;  2XQ9 A;  2FJA A;  2LSJ A;  2XPA A;  2ZR5 A;  2Y8D A;  3U3I A;  2CEA A;  4O2B E;  4C90 A;  5HEJ A;  4GIV A;  3PDY A;  2YIN A;  1HFA A;  2X51 A;  3O5I A;  5F5W A;  4M1P A;  1ZB5 A;  1J6Y A;  1D7J A;  3UU3 A;  1T8B A;  2YBT A;  4DUZ T;  2HPL A;  2CHO A;  3QC9 A;  1WCR A;  2WM0 A;  3B8S A;  3RRC A;  4JV5 T;  2BKP A;  4JFM A;  4MNK A;  3K3N A;  1XDO A;  3B13 A;  4W9Q A;  3X1D A;  4JI6 T;  3RPU A;  1HKM A;  3O5O A;  4TW8 A;  3JAF A;  2L8K A;  3AE8 A;  2UUA T;  3RC8 A;  3ZYL A;  3P7I A;  5C2T A;  1LL7 A;  3RIU A;  3ZC0 A;  1QSD A;  2CHN A;  1UR8 A;  5JDH A;  1KNP A;  2WMN A;  1NWU A;  4N19 A;  2XAF B;  1W09 A;  4FJO A;  4HFE A;  2E9X B;  1MMD A;  5AQI B;  3OYX A;  5AQH B;  1GOI A;  3T1H T;  1FKS A;  2XAS B;  3E22 E;  5FL0 A;  2RA1 A;  3ZKR A;  2JQK A;  2V6Y A;  2BDE A;  4UXN B;  5DAB A;  2W63 A;  1ZCN A;  1I6Z A;  2XQ8 A;  3AEG A;  3HI2 A;  4MFR A;  3CWZ B;  1Y01 A;  3LJC A;  1XWM A;  2LLY A;  1WYC A;  2UXB T;  3PJA J;  3SRZ A;  1GPF A;  1X79 A;  2QGS A;  4DV7 T;  4O4L E;  3CPZ A;  4NNR A;  4ZZB A;  3J9X 1;  2WZI A;  5L3B B;  4OK0 A;  3PRA A;  1NMW A;  1E15 A;  2PG8 A;  4CZZ B;  4PK4 A;  2DCF A;  4IL9 A;  2B1E A;  2FKE A;  3CX6 B;  4DR4 T;  3P4R A;  4LFC T;  4LFB T;  3ZLI A;  2QRX A;  3O9X A;  2BVL A;  1KK7 A;  4YSZ A;  3PUA A;  3GTY X;  4EAH A;  3I0O A;  3GPK A;  3CGN A;  1IX5 A;  1J4H A;  4NSB A;  5KDM C;  2JQQ A;  3KAG A;  4MBQ A;  4JFL A;  1R9H A;  1W9V A;  3Q9D A;  2LRK A;  4MTV A;  2N9D A;  3ZMS B;  2ZM2 A;  2MAW A;  4U33 A;  2CBI A;  1W1V A;  3AE4 A;  3NRK A;  2J1D G;  1U5P A;  4X5T A;  2R6G F;  1G73 A;  1UX4 A;  4OYJ A;  5JR9 B;  4AIU A; 
#chains in the Genus database with same CATH homology
 4KR0 B;  4W9P A;  3O5M A;  3CGM A;  2WWV A;  1ZL1 A;  4DZ2 A;  2O92 A;  1FKJ A;  1FKB A;  1VF8 A;  5HW6 A;  3OA5 A;  2AWG A;  5BXJ A;  3WL1 A;  3ARQ A;  4ML4 A;  4WKH A;  1W9U A;  3KAC A;  2FAP A;  2DT0 A;  5J6E A;  2XP5 A;  2ESC A;  1FFR A;  1WB0 A;  1X6L A;  1ROU A;  2MLX A;  5HWC A;  2YBU A;  3B9E A;  4DRN A;  1FKF A;  5HWB A;  1SR0 A;  1SYT A;  4S3K A;  1Q6H A;  1EYM A;  2O9O A;  4IQ2 A;  1JNT A;  2F4E A;  3AS3 A;  1W1Y A;  2ITK A;  4Q22 A;  5DIV A;  2K8I A;  1FKG A;  3O5G A;  4Z2G A;  4URI A;  4DWS C;  2WLY A;  3AS1 A;  2DSW A;  1WAW A;  4Q7N A;  2IUZ A;  2XZE A;  3UQB A;  4TNS A;  2MF9 A;  3AQU A;  2JQ9 A;  1XHG A;  1GUV A;  2OLH A;  4WJX A;  5D75 A;  4MNL A;  4LAV A;  2PV1 A;  2B31 A;  1LG2 A;  4TW6 A;  5DIU A;  3WL0 A;  2XP9 A;  2KE0 A;  3ZT5 A;  1M5Y A;  1E9L A;  4MGV A;  3ARY A;  4ODP A;  1NH6 A;  5DO2 A;  1ZBW A;  1HJV A;  1ZBV A;  4JFK A;  3EAB A;  4ZPW R;  3UF8 A;  1D7I A;  4L72 B;  5DEZ A;  2A3C A;  3WD2 A;  2PPP A;  1Y0O A;  4PTM A;  1LG1 A;  4TX0 A;  2DSZ A;  4NZC A;  4P8V A;  3IKG A;  5FVL A;  1D7H A;  4ODO A;  3WH0 A;  4HBE A;  2LJ4 A;  4J4O A;  4TYO A;  1HKJ A;  3H9R B;  5LB7 B;  3G6L A;  3PA7 A;  1ZK6 A;  1WFD A;  4ODM A;  4Z2I A;  5FVK A;  1X6N A;  4R0X A;  3IK8 A;  1W9P A;  3RM9 A;  4ODK A;  2Q5A A;  2ZQV A;  4DT4 A;  3PR9 A;  1ROT A;  1NWR A;  3JYM A;  2DPE A;  4S3J A;  4CN1 A;  1K9T A;  1FKR A;  2RUR A;  5DIT A;  3RM8 A;  4ZS6 A;  4U7I A;  4ODQ A;  5GPR A;  2Y78 A;  4U84 A;  5JH8 A;  4CN4 A;  4LAW A;  3PRD A;  4LGX A;  2M08 A;  4DWS D;  4WIW A;  1EIB A;  1HJX A;  2AOS A;  4Z2K A;  3ARP A;  2XP6 A;  1HKK A;  2A3A A;  4JFI A;  4DRP A;  3ZSS A;  4A5X A;  3B9A A;  4ZEY A;  1A7X A;  1QZ2 A;  3UQA A;  2ZR6 A;  4IPX A;  1H0G A;  3WD4 A;  3W4R A;  3CHF A;  1LJY A;  3O5K A;  3AS0 A;  3BXW A;  3O5Q A;  1W26 A;  5I98 A;  4ZPV R;  4Z2L A;  3AS2 A;  3KAD A;  1B6C A;  3OOB A;  1JND A;  3CZ8 A;  1E6P A;  4DRO A;  2DT1 A;  4MAV A;  1QPL A;  4ODN A;  3WKZ A;  5HTG A;  4DRM A;  2K3W A;  4IT6 A;  3KCE A;  4HAR A;  1TCO C;  4ITZ A;  3RM4 A;  2KFW A;  4MPK A;  1KFW A;  4QT2 A;  5HUA A;  3ZT6 A;  1JVW A;  3O5P A;  5HBF A;  1YAT A;  3WD3 A;  1U79 A;  2LRL A;  1UR9 A;  1LL6 A;  3FY1 A;  1T11 A;  2PV2 A;  4W5U A;  2QF8 A;  4P1N A;  2LPV A;  2L2S A;  1BKF A;  4U7Y A;  2A3B A;  1E6R A;  1PIN A;  2D9F A;  3CHD A;  3PRB A;  2OFN A;  5HW7 A;  1FAP A;  3O5R A;  4G50 A;  3NTP A;  2KI3 A;  2F21 A;  2N87 A;  1XRV A;  1C9H A;  1HJW A;  3IHZ A;  4ODR A;  4IQC A;  2V6Y B;  4P8U A;  4U2Y A;  1FKI A;  2M2A A;  3B9D A;  3ARS A;  3KAB A;  2W2U A;  1OGG A;  1NSG A;  3WQW A;  3RME A;  3WIJ A;  2MLZ A;  3CHE A;  3KAI A;  4WKA A;  4W9O A;  1EDQ A;  1J4R A;  1FD9 A;  4U2Z A;  4DH0 A;  1FFQ A;  5HW8 A;  3O5L A;  3KAF A;  2FDM A;  1FKL A;  2RPA A;  1CTN A;  3K1S A;  4DRH A;  4JFJ A;  1RD6 A;  2WLZ A;  2LGO A;  2RUQ A;  1Q6I A;  1JNS A;  4WK9 A;  1J4I A;  2KR7 A;  3KAH A;  2PBC A;  4DWS B;  3TC5 A;  3CH9 A;  1FKD A;  4GGQ A;  2ZR4 A;  1QPF A;  4FAP A;  1NMV A;  2WK2 A;  4Z2H A;  5B8I C;  4R5E A;  4MSP A;  3UI6 A;  1OGB A;  2LKN A;  2CPT A;  1LQ0 A;  2XP8 A;  3KZ7 A;  4G2P A;  3I6C A;  2G8Z A;  2A3E A;  4O2T A;  4U85 A;  3ZST A;  2UZ5 A;  1D6O A;  4AY1 A;  2PPN A;  1YXR A;  2DT3 A;  5HKG A;  1W1P A;  1ZBK A;  2VCD A;  3ARU A;  1O6I A;  4BF8 A;  4DRJ A;  1EQ3 A;  2A9U A;  1D2K A;  2VN1 A;  4QT3 A;  2CRB A;  1HXV A;  2DSU A;  2XPA A;  1WNO A;  2ZR5 A;  1E6N A;  2PI6 A;  2ZQU A;  3RFW A;  3IKD A;  3O5E A;  1KT0 A;  1W1T A;  5DF0 A;  4GIV A;  1FKH A;  2DSV A;  3B7X A;  3WD0 A;  3ARX A;  3WD1 A;  3ALG A;  3O5I A;  4WKF A;  3ART A;  2DG9 A;  3ARR A;  1FKT A;  1JNE A;  1ZU8 A;  1ZB5 A;  2XP7 A;  1J6Y A;  1D7J A;  4QIB A;  2YBT A;  4LAX A;  3O5D A;  1ZBC A;  1WCR A;  1LL4 A;  2WM0 A;  1N1A A;  2PV3 A;  3B8S A;  3MDY B;  3RGC A;  2G41 A;  4NIQ A;  1L1P A;  2ZQT A;  3O5J A;  4MNK A;  4JFM A;  4DIP A;  4W9Q A;  1KT1 A;  1HKM A;  2MPH A;  3O5O A;  4TW8 A;  1PBK A;  4DZ3 A;  3ARZ A;  2JZV A;  1ITX A;  5GPG A;  3ZT7 A;  3LUO A;  1LL7 A;  3ODK A;  4FN2 A;  2RSE A;  1UR8 A;  2RUC A;  2DG3 A;  3EY6 A;  1NWU A;  4N19 A;  2RUD A;  2IF4 A;  1HKI A;  2KGJ A;  4P8W A;  2MPK A;  1TFV A;  4U86 A;  3FAP A;  1GOI A;  1FKS A;  2WY2 A;  1F40 A;  1OWQ A;  1Q6U A;  2XP4 A;  4KQZ A;  2JQK A;  2V6Y A;  3ALF A;  3TCZ A;  3VAW A;  1ZCN A;  4U31 A;  4ZPT R;  4DRK A;  4MNJ A;  1EHN A;  1NWS A;  3WQV A;  3FXY A;  3JXV A;  2XP3 A;  1Q1C A;  4P8X A;  1GPF A;  4L3N A;  1FKK A;  1F8A B;  4ODL A;  2DT2 A;  4NNR A;  3CHC A;  1YW5 A;  4JYS A;  2MLY A;  5GQB A;  1BL4 A;  4QZV B;  3PRA A;  3TDB A;  2PPO A;  4U3C A;  1NMW A;  2JQH A;  1E15 A;  4MNM A;  3UI4 A;  3UI5 A;  4LAY A;  4DWS A;  5HT1 A;  2RQS A;  3ARV A;  2KO7 A;  4HBO A;  4J4N A;  2FKE A;  3G6M A;  4WZX A;  4CN6 A;  1FJD A;  2DG4 A;  2V6X A;  4XAK A;  3ARW A;  5CJ5 A;  5CGM A;  2XPB A;  2ZQS A;  1P5Q A;  4DRI A;  3GPK A;  1IX5 A;  3CGN A;  1J4H A;  4NSB A;  4IT4 A;  3KAG A;  2M1I A;  4TW7 A;  3O5F A;  4JFL A;  1H0I A;  3NI6 A;  1R9H A;  1W9V A;  2LRK A;  1WR0 A;  1NWT A;  1E6Z A;  1W1V A;  2F2D A;  4U33 A;  4MTV A;  4C02 B;  4DRQ A;  3NRK A;  4Z2J A;  3QOK A;  2MNT A;  3UQI A;  2DL1 A;  3JYJ A;  3ARO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...