4IT4A

Crystal structure of residues 1-211 of cg17282
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
207
Chain Sequence
DWYVGTEWEDKNRGLAKKVIGLQFTEMDKPTIISTVEFSVNKKATNLGGRPSKYLVSDTYPQKHSLEMGTSLTAVDCYLELLLQQFVPGETAACSITTKTGERIEFELKLEKIVKNTQVEKLSAAEIYEVALRLKESGVATFKTFPKFAFDYFVRAAKLLITYKPFDKLTKKTNGINGQAVEELFIQIQTNLAACLLQEKRYEHVIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Noncanonical FK506-Binding Protein BDBT Binds DBT to Enhance Its Circadian Function and Forms Foci at Night.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Unknown function
molecule keywords CG17282
total genus 59
structure length 207
sequence length 210
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18023 FKBP_N_2 BDBT FKBP like N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4it4A02
3.10.50.60 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4it4A01
2XZEA 2JQ9A 3ZSSA 4A5XA 2A9UA 2K3WA 4CN6A 5CJ5A 2JQKA 3ZT6A 3ZT5A 2RPAA 4CN4A 4WZXA 3K1SA 4IT6A 1WFDA 4U31A 1WR0A 4ZEYA 2LRKA 4NIQA 2CRBA 5FVLA 2V6XA 4U7YA 4CN1A 3ZSTA 1YXRA 5LB7B 2V6YA 2W2UA 4U7IA 5CGMA 4U2YA 4U3CA 4IT4A 2MPKA 2LRLA 1WCRA 3ZT7A 4U33A 2CPTA 2WWVA 2JQHA 2V6YB 4P1NA 5FVKA 2WY2A 2DL1A 3EABA 4U2ZA
chains in the Genus database with same CATH superfamily
4ZXLA 3F57A 2V7IA 5BMVE 4AKIA 4LGXA 1HNWT 2A3DA 2BKOA 4EXTA 4DV2T 3BQKA 1JNEA 1MIVA 2VL8A 1EYMA 1IAPA 3RQUA 5FL0A 4ZEYA 4Z2LA 2DPEA 3O9XA 1Y01A 4CQIA 3VR9A 3GN5B 2OV9A 2WWVA 2ETNA 4TWDA 5JR9C 3CX7B 4EB6E 4P1NA 3NRKA 1YQ3A 4LF9T 2RURA 1D0XA 1MIYA 4W5UA 4MLKA 4UF0B 1YD8G 4PK6A 3FB2A 3AE8A 1ZV4X 4Z2HA 3VKHA 3RFWA 4JI7T 1L1PA 3CMLA 4A56A 3KV4A 3AE1A 2PPPA 1I6ZA 3CK6A 2AE9A 3HKCE 2C5IT 5J6EA 4OHFA 4TW7A 3AQUA 2CM0A 3LG7A 3HR0A 1OEDE 5FXZA 3VKGA 4PFPA 4YXDA 3ZSTA 2WDQA 2DT1A 1XMOT 1VRBA 2XPAA 4O2TA 3AE5A 5DABA 3M65A 2C5JA 2DHRA 4XZCA 2RSEA 3O5PA 4JI8T 2LKGA 1JVWA 4IE0A 2VB6A 4IT6A 2XQ8A 2N9DA 2YU1A 1XDOA 3O5GA 4ZI2D 1ZB5A 1H7CA 3WD0A 2LM9A 1B6CA 5EK3A 3GTYX 4MNKA 3ARPA 3DP7A 5LCYA 3WL0A 3LK2B 2KI3A 2DNXA 1KT1A 3G6LA 2XP4A 1T98A 3QB5K 3TKLB 2WB5A 4Z2GA 1XNRT 2A3EA 5AQHB 3UFEA 2CLYC 1ZL1A 3RH3A 1J4IA 1KF6A 1SA0E 4JBWF 3IF8B 1ZOYA 3I9WA 4A98A 3JYMA 2ES0A 2EULA 5CJ5A 4ILCA 5HEGA 2W61A 3AE4A 3GN5A 1E6NA 2F21A 1EHNA 5IYZE 4H9PC 2UUBT 3A8YC 5AQPB 5GPRA 4JV5T 4LF6T 5DF0A 3S4UA 5J1GA 4HWHA 2WMOA 3AAIA 2UXNB 1G8XA 3V5UA 1ZBKA 4HGAA 1Y64B 4YSXA 4X1YE 3T1HT 5EK4A 2PFVA 1VCTA 5LB7B 1E15A 3CX8B 2X9YA 2CE7A 3ZYKA 2CBJA 2CCQA 5F8PA 1U5PA 2H88A 3N9NA 2FUPA 3CHCA 3WD1A 2JQ9A 5LGUB 2WSSV 5IHYA 5FL1A 1FKDA 4IHJE 4DBQA 2LSGA 1FKGA 3EIPA 5JDGA 4KQZA 3KV5A 2PN0A 4DRJA 3ZYLA 1N36T 3JC6C 2NTXA 5HXCA 2WDVA 2HN1A 2LSKA 3EDUA 3PUYF 2CHOA 3PUAA 1G73A 4HFHA 3AECA 3UQ7A 1IBMT 3O5DA 3ANWB 4CI2B 1Y0OA 2L9QA 1FMWA 2VKJA 4EYUA 5FY0A 2HN2A 2LEHA 1UCUA 4X65T 3PUWF 2V5CA 3UQIA 4GGQA 1XWMA 3P4RA 3ODKA 2ZM2A 1WAWA 4DVDA 4U3CA 4IT4A 2PPOA 1MNDA 4U72A 3MXZA 1EIBA 3AEGA 4HKAA 1FKKA 2DG4A 3O4XE 1X6NA 2XAQB 2UUCT 5HW7A 3AS1A 2CEAA 3KADA 4WIWA 1XZYA 5KMGP 4JFIA 4CN1A 2WZIA 3UT5E 1HNXT 2X68A 4S3JA 1BR1A 2XQYA 2WCAA 1M62A 4IE4A 2CMRA 5LMNT 3GU0A 5HCJA 2CBIA 3MKDA 2A2FX 2VCDA 4GOUA 3NZQA 4N78D 1XMQT 2KO7A 4ZPVR 2HH7A 3UULA 3IKGA 2V6YA 4I55E 2F4VT 3RKOA 1OGBA 3K3NA 3QUJA 4EZHA 1UX4A 1HFAA 1J5ET 3ARWA 2LT3A 1LRZA 4ZI7E 2DG9A 2XM2A 2KINB 2PI6A 5DQVA 2PBIA 4H63H 4L5GA 4WK9A 3N9LA 4XAKA 5HXEA 2V6XA 4I4TE 3ARUA 2M08A 2C0SA 5DQWA 4GKKT 3T1YT 2NTYA 2Q5AA 3ZMSB 4DRPA 3E08A 2WZHA 4TX0A 1OXZA 3AAEB 4BJMA 5L3GB 2LKNA 3AEFA 4WKHA 2X0LB 4P8VA 3PTRB 3PU8A 2ZM0A 2DT0A 2Y48B 1JNTA 4ODQA 2VWAA 4H9SE 5C3JA 3ARSA 4MNLA 4ODKA 4IL9A 5E0OA 3KAFA 3NBXX 4HEAA 5KX5E 3J7Yq 5FXXA 2BG9B 1FKLA 4LMKA 2CLYB 4ODOA 1KNRA 4KHZF 4UVCB 4UF0A 1J5WA 2ZR4A 4WKAA 2MBGA 4HN9A 1NMVA 5DJQC 1R8IA 3FXDB 3OBVE 3OA5A 3LK3B 3EABA 4JFJA 3ABVA 3UUBA 2XP7A 1JNRA 2WBLA 5AQJB 4YTPA 2P9BA 1S94A 3G6MA 3NI6A 2OFNA 5HEJA 3B5MA 3TLVA 2VN1A 4ZS3A 3ZCIA 1Q6HA 5JDMA 4CI3B 3PA7A 2IF4A 1OEDC 3PUVF 3IKDA 1BR0A 1GQEA 3IBPA 2KE0A 2MPHA 2JIWA 4WZXA 2ZLYA 2LOPA 4MPKA 1GRJA 3N9PA 4GK0E 5JR9A 2L8KA 3AROA 3JAFA 2NR4A 2XQ3A 2HHHT 4LAVA 2CPTA 2PTFA 3K3OA 5LYJE 3N9MA 4CN4A 4JFLA 2BG9E 2BKNA 3RQWA 1A7XA 4HARA 1X79A 3T8OA 1WR6A 4DNDA 3UU8A 2IC6A 2PBCA 2KSRA 4HFBA 3RI5A 4ZHQE 2VKDA 3MZKB 1H0IA 1ZEEA 5HW6A 2IC9A 4UIGA 3L8RA 3UUXB 5GONE 5JTGA 2K3WA 5HCMA 3C50A 2VASA 2JMHA 1KFWA 1US7B 3C64A 5L4EA 2DWGA 2ESCA 5KXJA 4AKRB 1OEDB 4QT3A 2G0UA 3P50A 3LFMA 2OLTA 1T72A 4O2BE 1OGGA 1N1AA 2FJBA 3O5LA 3RIFA 4PTMA 3A5XA 5J2TE 5HYAA 4IE6A 1E6RA 1UGOA 2XPBA 4N19A 1GUVA 2D9DA 2X51A 4QXBB 1FJDA 2IHR1 4QH4A 2CXFA 2Q9QD 1UK5A 4NNRA 4W9QA 3RX6A 2ZQTA 3AEEA 2YDSA 4DROA 3M3ZB 2CXDA 3WH0A 1Z0PA 5CFBA 4JI2T 1FKTA 2WK2A 1L0VA 1HTJF 1W1YA 4OFZA 3ARXA 4G2PA 2WU2A 3B7XA 1NWRA 2VK9A 2V5DA 3HKBE 2RP4A 4TNVA 3JYJA 3CHFA 5CB4E 3OTOT 4YTMA 3FY1A 2AOSA 5L2LA 4HE8A 4IDZA 1KT0A 5BXJA 1LVKA 3U78A 3ZJ2A 5JH8A 4JUYA 4V1Av 3RLFF 3ALGA 2XQ4A 4EZ4A 2FBWA 4PJNA 2ZQSA 4AQFA 2B5UB 4Q7NA 1HJXA 4QIBA 4DV3T 2FAPA 2RA1A 3KACA 3RIUA 2ODUA 4ISTA 4XBFB 2PV3A 4UVAB 4IL4A 4JFKA 3KAIA 3RGLA 3AE6A 4CXXA 1NWMX 5CA0E 4WKFA 4HFVA 5LHGB 3SRZA 2LLYA 1LVFA 5C2TA 1GPFA 1HF8A 3ZPOA 1NH6A 4YFSA 5JVDE 5L47A 4JYSA 4ISSA 4P0AA 2IUBA 4PNIA 4HBOA 1HG2A 1IX5A 5AQNB 4BA9A 1LJYA 3QB5A 4U7IA 2O92A 3CGNA 3UI5A 4LAWA 4IGUA 2YEVC 4EEDA 3WL1A 4DWSD 3K8PC 2E9XA 3Q2MA 3TDBA 2BZBA 2MF9A 5AQSB 3RGCA 1BR2A 4YHJA 4DUZT 3KVBA 2V8SV 2W2UA 1UX5A 3NRYA 4ADZA 3B8SA 5HW8A 2JPFA 2YN6A 3DTOA 4DWSB 5HXSA 3JXVA 4NXMT 3KABA 4XAXB 4X66T 1XHGA 3FZMB 4ODMA 1D0YA 3TLWA 3ETUA 4DIDB 1YKHB 4MAVA 5DIUA 2LHNA 4MHCA 4LFCT 1WR0A 2DSWA 2OA5A 4HWDA 1FMVA 2RQSA 4ODNA 4NPPA 2O9OA 3JCFA 2N1GA 3AE3A 1W1PA 3OYXA 4TW6A 3AVSA 1SUMB 3VRAA 1FKJA 2X9HA 4ZI3D 2KMFA 2SPCA 3RPUA 2GK9A 3AS0A 4AQGA 4TN7B 1FJGT 1OWAA 3KZ7A 4IQ2A 4OX9T 3NWIA 1J6YA 2R6GF 3O1HA 2A72A 5FYMA 3UQAA 1LKXA 4YHHT 2FJEA 3P4PA 2E2AA 2PJQA 2Y78A 5FP3A 4DWSC 2M6IA 3N2GE 3ZSSA 2D0UA 4HFDA 3UQBA 3MDYB 1ZBVA 2ITKA 4ZPTR 4U85A 5HEOA 1XDPA 2W62A 2VVNA 5LOVE 5HWXA 2VKHA 3QOFA 1T7SA 3UU6A 1Q6UA 1IBKT 2VURA 2CWOA 4CXWA 3X1DA 5LXTE 4HTEA 5LBMA 4Z2KA 3A7MA 3LUOA 4DV0T 3IEEA 2LKHA 2UXCT 3PV0F 1FKFA 4U7YA 3I1AA 5HWCA 4L72B 3HL6A 4LFAT 4J2CA 3FBLA 2KR7A 5FXVA 4WBOA 1FKRA 4EGWA 5JQGE 3C4ZA 3RC8A 2W63A 1Z8UA 3AE9A 3Q5XA 2XQ6A 5ABFA 5EZYE 3AAAB 3WQWA 3PUQA 4TUYE 4MTVA 4ILBA 1KEYA 2F23A 2BBJA 2X9XA 2XP3A 1FAPA 2K24A 5AQUB 3RM9A 2DSZA 2WM9A 5L4HA 5LMUT 3QOKA 5ABFB 3RIAA 4GYSA 4TNWA 5HEHA 3WAKA 5AQKB 2I0MA 2M67A 2XPKA 4FI5A 3TLTA 3LSVA 1WFDA 1WRDA 2VQET 3FHNA 2DG3A 3ZMUB 1ZP0A 1LG2A 3OPCA 1Q1CA 4DRQA 4L3NA 4UV8B 2JRKA 3B9EA 3P8CD 3KAGA 2N2NA 3MACA 1J4HA 4Q22A 4C02B 2CXLA 2WU5A 4ZZCA 2LPVA 2NW9A 1YKEB 2ZQVA 2LSIA 2MNTA 2YDRA 4ZS6A 2XAFB 3ONLC 4I50E 5LNKA 1UR9A 4H63V 4KR0B 3PE0A 4U2ZA 1FFRA 4EOZB 3L39A 2XQAA 2B1EA 1ZU8A 4YY3T 4DO0A 4UV9B 2G41A 3ARTA 2RPAA 3I6CA 1U4QA 4EV6A 5CA1E 5LGNB 4U31A 4B6XA 5LA6E 3ZCJA 3WAJA 1MNEA 2YBUA 3UFGA 3AEAA 2FJAA 1D0ZA 4O4LE 5JRCA 2EHOA 3CZ8A 3ARRA 1HR0T 4CI1B 2H7OA 4WJXA 3AEDA 3E0ZA 3EVYA 4P8UA 2XP8A 2G8ZA 4AQFC 4ODRA 3F2EA 4Z2IA 3ARVA 4GIVA 4O4JE 3FZFB 3ZN0B 4TV8E 1D7JA 1EZ3A 2D5UA 4B3RT 2NW8A 2PPNA 4IDNA 2MAWA 2XASB 2WY2A 3RM4A 4DR2T 2XAHB 4ZZBA 4MBQA 2H89A 3RYIE 4X1KE 3PJAJ 2FDMA 3AS3A 2MLZA 3NKZA 4YT0A 2J4GA 1D7HA 3KV6A 1FKSA 2WLZA 2XSBA 5AQLB 3FBZA 3WIJA 1FIOA 5AQQB 5JR9B 1KFYA 2LSJA 2K9AA 1WYBA 3PRDA 5LJNA 3ZMZB 5EK2A 1SYTA 5JDHA 1X6LA 2VQFT 3PRAA 1C9HA 3ZT5A 2WAUA 1O6IA 4FAPA 3OVUA 4F8HA 2NP9A 4QZVB 4DMVA 2QVAA 3EDVA 1MMGA 4KMCA 5H6QB 1HKJA 4MNJA 3IHRA 3SWHA 2X9WA 1WLXA 3H3MA 1M5YA 2XAGB 4L9IA 4DUYT 4UELA 4O4HE 3CPZA 1HCIA 3PUXF 3SFEA 3IA3A 2IUZA 3G06A 4IE5A 2V1DB 1HX8A 2LJLA 3KFWX 3PUSA 4B3ST 2V7JA 4LMJA 1QPLA 4BAYB 2XQ7A 4W9OA 4AQYT 1D7IA 3KCEA 4TZ4C 4UR9A 1HKKA 3CIRA 3IK8A 5L3BB 4DR5T 4KI0F 3WI3A 2VKOA 3C4WA 1SHZC 3HI2A 3UI6A 3CX6B 3VHLA 3K1SA 4HWIB 2E9XB 2Q9QC 3N2OA 3ZN1B 3OJAA 5C8YE 4B3TT 4JI6T 1UUSA 2DLRA 2X0YA 2IDOB 4H9RC 3F31A 4ZPWR 3AA1B 2A3BA 4JI5T 1NAFA 4X5TA 5BR8T 2XY8B 2DSUA 3NVOA 3PDYA 1IJ6A 2C5KT 1CHUA 1W1TA 3TLUA 4LF4T 1K9TA 2CWYA 4HWCA 4H9OC 2EHOD 3CQXC 1SR0A 2KGJA 4C90A 5FMNA 1NEKA 1VCSA 4NSBA 4ML4A 1FFQA 1WB0A 4TNSA 3UUMA 3JADA 2ZQUA 4WNKA 2XUEA 3UI4A 2QYWA 4IDPA 4EEBA 4DT4A 5AQMB 2DI4A 3EY6A 3BQLA 5J2UE 1QSDA 5FXWA 4YLHA 2LSYA 4U86A 2LM2A 1Q6IA 1D6OA 3ZMTB 2IIUA 1KNPA 3V5SA 5TAOA 2ZMAA 4JI4T 2KXPB 4Z8XA 4EAHA 2IW5B 4ILUA 2UXXB 4DV5T 2BS3A 5AQRB 1UR8A 4DV7T 2K5BB 3KV9A 2E5VA 4Q25A 4HFEA 2M1IA 3WKZA 5DEZA 4URIA 2I59A 3BQIA 1NWUA 4F6RC 1IBLT 1W09A 3O5RA 2CA5A 2YOEA 4CN6A 4JLEA 3PUGA 3UF8A 1W0BA 3SS1A 3PR9A 5AQOB 1F8AB 1BR4A 1VOMA 5ADXL 2JMKA 3VR8A 4HWFA 1W1VA 3ONXA 4PW8A 2W4XA 3UUNA 1HJWA 1T8BA 3NZPA 2WM0A 3AA6B 2KWHA 2WP9A 4X1IE 5IUXA 1BKFA 1N34T 5F3JA 3RHWA 4NIQA 1MMDA 2MYSA 1BL4A 3FZHB 2XAJB 4HBEA 4DWSA 2OLHA 2BS2A 4DH0A 3FXYA 4DMWA 3RKGA 1DU2A 5FVKA 3AEBA 1W9PA 3ALFA 5L3DB 4DV6T 1FD9A 4QXHB 1JNSA 3CHDA 3Q5WA 2W66A 4JI0T 5HXHA 1TFVA 1LG1A 2X66A 2ACZA 4A97A 2B31A 3ZKRA 2KZ7B 2D2SA 2YBTA 3PU3A 3FZKB 1ZKEA 4I0UA 3ONJA 4PK5A 2LGOA 4FJOA 3TCZA 1FEWA 3KDSE 4IPXA 1HNZT 4KHPT 5LP6E 2EHOC 5JDNA 2X0HA 1W0AA 3O5IA 1OEDA 4ZI3C 5H6RB 1EQ3A 4S3KA 2NWBA 4LF8T 2V6YB 2LOSA 3RM8A 3PURA 3WD2A 4IREA 2RUQA 5A1LA 1ZK6A 3P4SA 4DR1T 3FAPA 3JAEA 3VU7H 4LFBT 1P5QA 4O4IE 4UDMA 2QGSA 5AQVB 1HXVA 3Q5EA 4QHOA 3BK9A 1PINA 3CHEA 2J62A 4PJJA 4X20E 2XZEA 1QZ2A 1E9LA 1ITXA 4NXNT 1CUNA 1TCOC 1LL7A 3N9QA 3RYFE 1WNOA 3CVRA 4DR4T 3P4QA 5CGMA 4LMLA 4I43B 5HEUA 4JEHB 4DZ2A 1O3XA 4BF8A 3MK7C 4E7SA 3GMIA 5ETWA 1E1HB 3KVAA 5L3CB 2WQYA 2KFWA 2KLQA 1YW5A 3C51A 4DR7T 2I6HA 4B3MT 2QA7A 1MMAA 5HXRA 1W9VA 1N33T 2XQ9A 2YDQA 5AFUL 3KBUA 4J4NA 4TWFA 1PBKA 3AVRA 4PJLA 5LHIB 4P8WA 3I9YA 4IQCA 2W00A 3RYCE 5AQTB 3O5FA 1QUUA 3E22E 5FY7A 5JRCB 5J0ZA 4LAXA 5AQIB 4MALA 3GA8A 4FN2A 1ZBWA 5HAXA 4G63A 4IDOA 2V26A 3QNUA 1W9UA 3AS2A 2IMLA 5FKYA 4R5EA 3W4RA 1CTNA 2DT3A 4DRMA 3TLSA 1YQ4A 3C98B 2ZM6T 5FVLA 5LG4A 2K48A 3MA9A 4DRNA 2V7MA 4IE7A 2BBHA 3AXJB 3EHZA 1J4RA 5AQFB 3KINB 4QH5A 4J4OA 2DT2A 4DRKA 4UEMA 2A9UA 2YKSA 3PJAA 5JDLA 3ZMVB 1I94T 2BVLA 5HUAA 4H9NC 4AISA 3LDQB 4AKHA 2YINA 5LGTB 2KWIB 1JNDA 5LBQB 3KBTA 2F2DA 3ZC1A 3SFDA 2M2AA 4LF5T 1IJ5A 3RC3A 2H3RA 2MTQA 2NW7A 4QXCB 4O2AE 5DO2A 4GK5E 2X67A 4WW0A 3H9RB 1QPFA 2LHRA 3Q5DA 4JEUB 4DIPA 2AXDS 3BMBA 2H7VC 4TYOA 3OOBA 2QF8A 2E9XD 5FY1A 4QX8B 1ZCNA 3EUHA 1S35A 2YK0A 3J9X1 1N32T 1W9RA 5D75A 4H9QC 2Y8DA 3O1JA 2F4EA 3TC5A 5HBFA 4DZ3A 3IHZA 4X62T 1YATA 3RMEA 1GOIA 3I0OA 4Z90A 4JYAT 3DJBA 4G50A 1YW0A 1SE7A 2P4VA 2FJDA 2FKEA 1E44A 1NMWA 4DR6T 2BG9C 2D0TA 2XTLA 3ARYA 1X9BA 2Q9QA 2K8IA 3EI0A 1NWSA 2DL1A 4PK4A 5JDQA 5L3EB 4MNMA 5IWAT 3OYZA 3UTKA 4COFA 5LG3A 4QT2A 4AKLA 1LQ0A 5DITA 3Q9DA 3O5OA 4BJNA 1T11A 3EAMA 4ZI2C 1V9DA 2BS4A 1NENA 2UUAT 3B57A 3HKEE 3ZT7A 2ZR5A 2Z6EA 3UQ4A 4OYKA 4YJ2E 4ODPA 1LL6A 3L3PA 2XP5A 2VL0A 4GKJT 3AA0B 1R9HA 2JQKA 3ZT6A 4ANJA 2PV2A 2ZR6A 2J1DG 4UVBB 3UU4A 2YU2A 1HX1B 2XQ5A 3ZLIA 2Y6XA 2XSAA 3SOLA 3AE7A 3O5JA 3B13A 1FKIA 2WS3A 2WMNA 1MMNA 3NRXA 4ASKA 4DV1T 3B9AA 3N9OA 2XHEB 3LK42 5HKGA 1NSGA 2WDRA 4YSZA 5KDMC 2LRKA 4QH1A 3PUZF 5LJMA 2IAKA 1WCRA 4DRIA 4TX5A 2D9FA 2M6BA 1H0GA 2J47A 1W26A 2RUDA 4P09A 3H37A 5ABGA 2WWUA 3C4XA 2MLXA 5LHHB 4MGVA 5B8IC 3HA4A 5GPGA 2NOXA 2XM1A 1NWTA 3R6NA 4HFIA 3UU3A 3CKDA 3P4WA 2EHOB 3ARZA 2JZVA 5L3FB 4DV4T 1KK7A 3O5KA 3CGMA 1ROTA 1HS7A 1FKBA 2L3LA 5ABEA 4DRHA 2PG8A 3RYHE 3QC9A 3ZYMA 2XP9A 1E6ZA 4OYJA 4Z2JA 4X64T 5AQGB 2XJ7A 1FKHA 3L09A 1EDQA 2CRBA 2LJ4A 4QWNB 1YXRA 3PRBA 4JFMA 1XNQT 3HKDE 1ZHCA 3RRWA 5I98A 5HWYA 4E7ZA 3ZC0A 4NUUA 4P8XA 2E8IA 3K3QC 4A5XA 3KAHA 5JH7E 4JI1T 4AKGA 4KBMB 2LE8A 1ROUA 4M1PA 2XP6A 4AXPA 4Z91A 3AE2A 3WQVA 3RIUC 4DBRA 3D0TA 2AWGA 3FXEB 2BKPA 5HTGA 4NZCA 5JREA 3GPKA 4AI6A 5ABHA 2ZM8A 5HWBA 4OK0A 3WD3A 3GWHA 2UXDT 2VVSA 3P7IA 4W9PA 4P0BA 4K0KT 2UU9T 2DWKA 3ETVA 2MPKA 3FZLB 1OWQA 3ANWA 2BVMA 2DSVA 4ERRA 2JQQA 3O5QA 5GQBA 4U84A 2UXBT 2V7KA 4G2AA 4QKNA 2CHNA 3VRBA 4IDQA 1MIWA 2ODVA 4MFRA 3NTPA 2PV1A 3CH9A 4AY1A 4MSPA 2HPLA 1D1AA 3N5LA 4K0UA 2WLYA 2E9XC 2Q9QB 4YTNA 5FNVE 3O5MA 4UXNB 4YSYA 4CXYA 4HFCA 3LBXA 1E6PA 2JQHA 2B76A 1WYCA 1B7TA 2A3CA 2QRXA 5JDFA 3ZJ1A 4YJ3E 4R0XA 4EYYR 3WD4A 2DCFA 3JC6D 1D2KA 4KX6A 3AXJA 2JJ9A 4QX7B 2V7LA 4KUMB 1F40A 1HKIA 1D1CA 3UU5A 3CQGB 4LF7T 1U79A 4LAYA 2N87A 2KNDA 3ESLA 4WBNE 3VAWA 2RUCA 2W0GA 2UZ5A 2KT9A 4IIJE 4ZOLE 5HT1A 1JNZA 4PJMA 4NUVA 3LJCA 1RD6A 4JI3T 1KNZA 3BXWA 4WYVA 4TW8A 1QLBA 4TV9E 4PFOA 3O1IA 2MLYA 1HG5A 1ZBCA 4GYRA 2W67A 3I0QA 4ILAA 3QK6A 1E2AA 4ITZA 3AB3B 3W15B 4ODLA 1UURA 2E5LT 1E7PA 4U2YA 1HKMA 3CWZB 5DIVA 1IZNB 4C91A 1D1BA 1AJ3A 2L2SA 4TWHA 4U33A 3CQCB 3R84B 1M7KA 4GIWA 4L0RA 3MJXA 3O5EA 1JCHB 4KP3C 3B9DA 3U3IA 3ARQA 5F5WA 2BG9A 4O8SA 1LL4A 4ZS2A 3AA7B 3RF1A 2BDEA 3N2KE 3H3AA 3LBXB 3OKQA 3ZEFB 2HPJA 2LRLA 4AIUA 1J1JA 4CZZB 2MOZA 5M4YA 1XRVA 1HJVA 3RRCA 2A3AA 1VF8A 2ACXA 4PAGA 4U74A 4DR3T 4EIWA
chains in the Genus database with same CATH topology
3PA7A 1W9UA 2IF4A 3ARRA 3AS2A 3CZ8A 3IKDA 4WJXA 4LGXA 4R5EA 2KE0A 1CTNA 3W4RA 2MPHA 2DT3A 4WZXA 2XP8A 1JNEA 4MPKA 4P8UA 4DRMA 1EYMA 2G8ZA 4ODRA 4Z2LA 4ZEYA 4Z2IA 2DPEA 5FVLA 3ARVA 4GIVA 3AROA 4DRNA 1J4RA 4LAVA 2CPTA 2WWVA 1D7JA 2PPNA 4P1NA 2WY2A 3NRKA 3RM4A 4J4OA 2DT2A 4DRKA 2RURA 4W5UA 2A9UA 2FDMA 3AS3A 2MLZA 4CN4A 4JFLA 1D7HA 1FKSA 4Z2HA 2WLZA 5HUAA 1A7XA 3RFWA 4HARA 3WIJA 1L1PA 2PBCA 2PPPA 1JNDA 2F2DA 2M2AA 3PRDA 1H0IA 5HW6A 5J6EA 1SYTA 4TW7A 3AQUA 5DO2A 3H9RB 1QPFA 1X6LA 2K3WA 3PRAA 1C9HA 3ZT5A 1KFWA 1O6IA 4DIPA 4FAPA 4TYOA 2ESCA 3OOBA 4QT3A 2QF8A 4QZVB 3ZSTA 2DT1A 1OGGA 1ZCNA 1HKJA 1N1AA 2XPAA 4MNJA 4O2TA 3O5LA 5D75A 4PTMA 2F4EA 3TC5A 5HBFA 1M5YA 3IHZA 4DZ3A 1YATA 3RMEA 1E6RA 2XPBA 4N19A 1GUVA 1GOIA 2RSEA 3O5PA 1FJDA 1JVWA 4NNRA 2IUZA 4W9QA 4G50A 2ZQTA 4IT6A 4DROA 1QPLA 4W9OA 3O5GA 3WH0A 1ZB5A 2FKEA 3WD0A 1B6CA 1D7IA 1NMWA 4MNKA 1FKTA 2WK2A 3ARPA 3KCEA 3ARYA 1HKKA 1W1YA 3IK8A 3WL0A 2K8IA 3ARXA 2KI3A 1NWSA 4G2PA 1KT1A 2DL1A 3B7XA 3G6LA 2XP4A 1NWRA 4MNMA 3UI6A 3JYJA 4Z2GA 3CHFA 4QT2A 3K1SA 2A3EA 1LQ0A 5DITA 3FY1A 3O5OA 2AOSA 5BXJA 1KT0A 1ZL1A 1T11A 1J4IA 5JH8A 3ALGA 3ZT7A 2ZR5A 2ZQSA 4ZPWR 4Q7NA 3JYMA 4ODPA 2A3BA 1LL6A 2XP5A 1HJXA 4QIBA 2FAPA 3KACA 5CJ5A 1R9HA 2JQKA 3ZT6A 2DSUA 2PV2A 2ZR6A 2PV3A 4JFKA 1E6NA 1W1TA 2F21A 1EHNA 3KAIA 1K9TA 4WKFA 1SR0A 2KGJA 5GPRA 3O5JA 5DF0A 4NSBA 4ML4A 1FFQA 1WB0A 1FKIA 4TNSA 1GPFA 2ZQUA 1ZBKA 3B9AA 3UI4A 1NH6A 5HKGA 1NSGA 4JYSA 2LRKA 4HBOA 4DT4A 1IX5A 3EY6A 5LB7B 1LJYA 4U7IA 1E15A 2O92A 3CGNA 3UI5A 4LAWA 1WCRA 4DRIA 2D9FA 1H0GA 3CHCA 3WD1A 1W26A 3WL1A 4U86A 4DWSD 2RUDA 1Q6IA 1D6OA 2JQ9A 2MLXA 1FKDA 3TDBA 2MF9A 4MGVA 5B8IC 3RGCA 5GPGA 1NWTA 2W2UA 1FKGA 3ARZA 3B8SA 2JZVA 5HW8A 1UR8A 4DWSB 4KQZA 3JXVA 3O5KA 3CGMA 2M1IA 3KABA 1ROTA 3WKZA 5DEZA 4URIA 4DRJA 1XHGA 1NWUA 1FKBA 3O5RA 4ODMA 4DRHA 4CN6A 2XP9A 1E6ZA 4MAVA 5DIUA 3UF8A 4Z2JA 1FKHA 1WR0A 2DSWA 1EDQA 2RQSA 2CRBA 4ODNA 3PR9A 2LJ4A 2O9OA 1YXRA 1F8AB 3O5DA 1W1PA 3PRBA 4JFMA 4TW6A 1W1VA 1FKJA 1Y0OA 1HJWA 5I98A 3AS0A 2WM0A 4P8XA 3KZ7A 4A5XA 4IQ2A 3KAHA 1J6YA 3UQIA 1BKFA 4GGQA 3UQAA 4NIQA 3ODKA 1BL4A 1ROUA 2XP6A 4HBEA 4DWSA 1WAWA 3WQVA 2OLHA 2AWGA 4U3CA 4IT4A 2PPOA 4DH0A 3FXYA 5HTGA 1EIBA 4NZCA 3GPKA 2Y78A 5FVKA 1W9PA 3ALFA 4DWSC 1FD9A 1FKKA 2DG4A 1X6NA 5HWBA 1JNSA 3ZSSA 3WD3A 3CHDA 5HW7A 3UQBA 3MDYB 1ZBVA 3AS1A 4WIWA 3KADA 1TFVA 4W9PA 2ITKA 4JFIA 4CN1A 1LG1A 4ZPTR 2B31A 4U85A 4S3JA 2MPKA 2YBTA 1OWQA 2DSVA 1Q6UA 3TCZA 2LGOA 3O5QA 5GQBA 4U84A 4IPXA 2VCDA 4Z2KA 2KO7A 3NTPA 3LUOA 2PV1A 3CH9A 4ZPVR 4AY1A 1FKFA 4U7YA 4MSPA 5HWCA 3IKGA 4L72B 2V6YA 1OGBA 2WLYA 2KR7A 3O5IA 3O5MA 1EQ3A 1FKRA 4S3KA 1E6PA 2JQHA 2V6YB 3RM8A 2A3CA 3ARWA 3WD2A 2RUQA 2DG9A 1ZK6A 2PI6A 4R0XA 3WQWA 4WK9A 4XAKA 3FAPA 3WD4A 2V6XA 1D2KA 4MTVA 3ARUA 2M08A 1P5QA 1F40A 1HKIA 2XP3A 2Q5AA 1FAPA 1HXVA 4DRPA 1U79A 4LAYA 3RM9A 2DSZA 2N87A 1PINA 3CHEA 3QOKA 4TX0A 3VAWA 2RUCA 2XZEA 2UZ5A 1QZ2A 2LKNA 5HT1A 1E9LA 1ITXA 4WKHA 4P8VA 1TCOC 1WFDA 1LL7A 2DT0A 1JNTA 4ODQA 1WNOA 1RD6A 2DG3A 5CGMA 1LG2A 3ARSA 4MNLA 3BXWA 1Q1CA 4DRQA 4ODKA 4L3NA 4TW8A 3KAFA 3B9EA 3KAGA 4DZ2A 1FKLA 2MLYA 1ZBCA 4BF8A 1J4HA 4ODOA 4Q22A 4C02B 4ITZA 2LPVA 4ODLA 2ZR4A 2ZQVA 4WKAA 2MNTA 2KFWA 1NMVA 1YW5A 4ZS6A 4U2YA 1HKMA 5DIVA 1UR9A 2L2SA 3OA5A 4KR0B 1W9VA 4U33A 3EABA 4U2ZA 1FFRA 4JFJA 4J4NA 1ZU8A 3O5EA 2XP7A 2G41A 3ARTA 1PBKA 3B9DA 2RPAA 3ARQA 3I6CA 4U31A 4P8WA 1LL4A 4IQCA 3O5FA 3G6MA 3NI6A 2OFNA 2VN1A 2YBUA 4LAXA 2LRLA 4FN2A 1ZBWA 1XRVA 1Q6HA 1HJVA 2A3AA 1VF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZE A;  2JQ9 A;  3ZSS A;  4A5X A;  2A9U A;  2K3W A;  4CN6 A;  5CJ5 A;  2JQK A;  3ZT6 A;  3ZT5 A;  2RPA A;  4CN4 A;  4WZX A;  3K1S A;  4IT6 A;  1WFD A;  4U31 A;  1WR0 A;  4ZEY A;  2LRK A;  4NIQ A;  2CRB A;  5FVL A;  2V6X A;  4U7Y A;  4CN1 A;  3ZST A;  1YXR A;  5LB7 B;  2V6Y A;  2W2U A;  4U7I A;  5CGM A;  4U2Y A;  4U3C A;  4IT4 A;  2MPK A;  2LRL A;  1WCR A;  3ZT7 A;  4U33 A;  2CPT A;  2WWV A;  2JQH A;  2V6Y B;  4P1N A;  5FVK A;  2WY2 A;  2DL1 A;  3EAB A;  4U2Z A; 
#chains in the Genus database with same CATH topology
 4ZXL A;  3F57 A;  2V7I A;  5BMV E;  4AKI A;  4LGX A;  1HNW T;  2A3D A;  2BKO A;  4EXT A;  4DV2 T;  3BQK A;  1JNE A;  1MIV A;  2VL8 A;  1EYM A;  1IAP A;  3RQU A;  5FL0 A;  4ZEY A;  4Z2L A;  2DPE A;  3O9X A;  1Y01 A;  4CQI A;  3VR9 A;  3GN5 B;  2OV9 A;  2WWV A;  2ETN A;  4TWD A;  5JR9 C;  3CX7 B;  4EB6 E;  4P1N A;  3NRK A;  1YQ3 A;  4LF9 T;  2RUR A;  1D0X A;  1MIY A;  4W5U A;  4MLK A;  4UF0 B;  1YD8 G;  4PK6 A;  3FB2 A;  3AE8 A;  1ZV4 X;  4Z2H A;  3VKH A;  3RFW A;  4JI7 T;  1L1P A;  3CML A;  4A56 A;  3KV4 A;  3AE1 A;  2PPP A;  1I6Z A;  3CK6 A;  2AE9 A;  3HKC E;  2C5I T;  5J6E A;  4OHF A;  4TW7 A;  3AQU A;  2CM0 A;  3LG7 A;  3HR0 A;  1OED E;  5FXZ A;  3VKG A;  4PFP A;  4YXD A;  3ZST A;  2WDQ A;  2DT1 A;  1XMO T;  1VRB A;  2XPA A;  4O2T A;  3AE5 A;  5DAB A;  3M65 A;  2C5J A;  2DHR A;  4XZC A;  2RSE A;  3O5P A;  4JI8 T;  2LKG A;  1JVW A;  4IE0 A;  2VB6 A;  4IT6 A;  2XQ8 A;  2N9D A;  2YU1 A;  1XDO A;  3O5G A;  4ZI2 D;  1ZB5 A;  1H7C A;  3WD0 A;  2LM9 A;  1B6C A;  5EK3 A;  3GTY X;  4MNK A;  3ARP A;  3DP7 A;  5LCY A;  3WL0 A;  3LK2 B;  2KI3 A;  2DNX A;  1KT1 A;  3G6L A;  2XP4 A;  1T98 A;  3QB5 K;  3TKL B;  2WB5 A;  4Z2G A;  1XNR T;  2A3E A;  5AQH B;  3UFE A;  2CLY C;  1ZL1 A;  3RH3 A;  1J4I A;  1KF6 A;  1SA0 E;  4JBW F;  3IF8 B;  1ZOY A;  3I9W A;  4A98 A;  3JYM A;  2ES0 A;  2EUL A;  5CJ5 A;  4ILC A;  5HEG A;  2W61 A;  3AE4 A;  3GN5 A;  1E6N A;  2F21 A;  1EHN A;  5IYZ E;  4H9P C;  2UUB T;  3A8Y C;  5AQP B;  5GPR A;  4JV5 T;  4LF6 T;  5DF0 A;  3S4U A;  5J1G A;  4HWH A;  2WMO A;  3AAI A;  2UXN B;  1G8X A;  3V5U A;  1ZBK A;  4HGA A;  1Y64 B;  4YSX A;  4X1Y E;  3T1H T;  5EK4 A;  2PFV A;  1VCT A;  5LB7 B;  1E15 A;  3CX8 B;  2X9Y A;  2CE7 A;  3ZYK A;  2CBJ A;  2CCQ A;  5F8P A;  1U5P A;  2H88 A;  3N9N A;  2FUP A;  3CHC A;  3WD1 A;  2JQ9 A;  5LGU B;  2WSS V;  5IHY A;  5FL1 A;  1FKD A;  4IHJ E;  4DBQ A;  2LSG A;  1FKG A;  3EIP A;  5JDG A;  4KQZ A;  3KV5 A;  2PN0 A;  4DRJ A;  3ZYL A;  1N36 T;  3JC6 C;  2NTX A;  5HXC A;  2WDV A;  2HN1 A;  2LSK A;  3EDU A;  3PUY F;  2CHO A;  3PUA A;  1G73 A;  4HFH A;  3AEC A;  3UQ7 A;  1IBM T;  3O5D A;  3ANW B;  4CI2 B;  1Y0O A;  2L9Q A;  1FMW A;  2VKJ A;  4EYU A;  5FY0 A;  2HN2 A;  2LEH A;  1UCU A;  4X65 T;  3PUW F;  2V5C A;  3UQI A;  4GGQ A;  1XWM A;  3P4R A;  3ODK A;  2ZM2 A;  1WAW A;  4DVD A;  4U3C A;  4IT4 A;  2PPO A;  1MND A;  4U72 A;  3MXZ A;  1EIB A;  3AEG A;  4HKA A;  1FKK A;  2DG4 A;  3O4X E;  1X6N A;  2XAQ B;  2UUC T;  5HW7 A;  3AS1 A;  2CEA A;  3KAD A;  4WIW A;  1XZY A;  5KMG P;  4JFI A;  4CN1 A;  2WZI A;  3UT5 E;  1HNX T;  2X68 A;  4S3J A;  1BR1 A;  2XQY A;  2WCA A;  1M62 A;  4IE4 A;  2CMR A;  5LMN T;  3GU0 A;  5HCJ A;  2CBI A;  3MKD A;  2A2F X;  2VCD A;  4GOU A;  3NZQ A;  4N78 D;  1XMQ T;  2KO7 A;  4ZPV R;  2HH7 A;  3UUL A;  3IKG A;  2V6Y A;  4I55 E;  2F4V T;  3RKO A;  1OGB A;  3K3N A;  3QUJ A;  4EZH A;  1UX4 A;  1HFA A;  1J5E T;  3ARW A;  2LT3 A;  1LRZ A;  4ZI7 E;  2DG9 A;  2XM2 A;  2KIN B;  2PI6 A;  5DQV A;  2PBI A;  4H63 H;  4L5G A;  4WK9 A;  3N9L A;  4XAK A;  5HXE A;  2V6X A;  4I4T E;  3ARU A;  2M08 A;  2C0S A;  5DQW A;  4GKK T;  3T1Y T;  2NTY A;  2Q5A A;  3ZMS B;  4DRP A;  3E08 A;  2WZH A;  4TX0 A;  1OXZ A;  3AAE B;  4BJM A;  5L3G B;  2LKN A;  3AEF A;  4WKH A;  2X0L B;  4P8V A;  3PTR B;  3PU8 A;  2ZM0 A;  2DT0 A;  2Y48 B;  1JNT A;  4ODQ A;  2VWA A;  4H9S E;  5C3J A;  3ARS A;  4MNL A;  4ODK A;  4IL9 A;  5E0O A;  3KAF A;  3NBX X;  4HEA A;  5KX5 E;  3J7Y q;  5FXX A;  2BG9 B;  1FKL A;  4LMK A;  2CLY B;  4ODO A;  1KNR A;  4KHZ F;  4UVC B;  4UF0 A;  1J5W A;  2ZR4 A;  4WKA A;  2MBG A;  4HN9 A;  1NMV A;  5DJQ C;  1R8I A;  3FXD B;  3OBV E;  3OA5 A;  3LK3 B;  3EAB A;  4JFJ A;  3ABV A;  3UUB A;  2XP7 A;  1JNR A;  2WBL A;  5AQJ B;  4YTP A;  2P9B A;  1S94 A;  3G6M A;  3NI6 A;  2OFN A;  5HEJ A;  3B5M A;  3TLV A;  2VN1 A;  4ZS3 A;  3ZCI A;  1Q6H A;  5JDM A;  4CI3 B;  3PA7 A;  2IF4 A;  1OED C;  3PUV F;  3IKD A;  1BR0 A;  1GQE A;  3IBP A;  2KE0 A;  2MPH A;  2JIW A;  4WZX A;  2ZLY A;  2LOP A;  4MPK A;  1GRJ A;  3N9P A;  4GK0 E;  5JR9 A;  2L8K A;  3ARO A;  3JAF A;  2NR4 A;  2XQ3 A;  2HHH T;  4LAV A;  2CPT A;  2PTF A;  3K3O A;  5LYJ E;  3N9M A;  4CN4 A;  4JFL A;  2BG9 E;  2BKN A;  3RQW A;  1A7X A;  4HAR A;  1X79 A;  3T8O A;  1WR6 A;  4DND A;  3UU8 A;  2IC6 A;  2PBC A;  2KSR A;  4HFB A;  3RI5 A;  4ZHQ E;  2VKD A;  3MZK B;  1H0I A;  1ZEE A;  5HW6 A;  2IC9 A;  4UIG A;  3L8R A;  3UUX B;  5GON E;  5JTG A;  2K3W A;  5HCM A;  3C50 A;  2VAS A;  2JMH A;  1KFW A;  1US7 B;  3C64 A;  5L4E A;  2DWG A;  2ESC A;  5KXJ A;  4AKR B;  1OED B;  4QT3 A;  2G0U A;  3P50 A;  3LFM A;  2OLT A;  1T72 A;  4O2B E;  1OGG A;  1N1A A;  2FJB A;  3O5L A;  3RIF A;  4PTM A;  3A5X A;  5J2T E;  5HYA A;  4IE6 A;  1E6R A;  1UGO A;  2XPB A;  4N19 A;  1GUV A;  2D9D A;  2X51 A;  4QXB B;  1FJD A;  2IHR 1;  4QH4 A;  2CXF A;  2Q9Q D;  1UK5 A;  4NNR A;  4W9Q A;  3RX6 A;  2ZQT A;  3AEE A;  2YDS A;  4DRO A;  3M3Z B;  2CXD A;  3WH0 A;  1Z0P A;  5CFB A;  4JI2 T;  1FKT A;  2WK2 A;  1L0V A;  1HTJ F;  1W1Y A;  4OFZ A;  3ARX A;  4G2P A;  2WU2 A;  3B7X A;  1NWR A;  2VK9 A;  2V5D A;  3HKB E;  2RP4 A;  4TNV A;  3JYJ A;  3CHF A;  5CB4 E;  3OTO T;  4YTM A;  3FY1 A;  2AOS A;  5L2L A;  4HE8 A;  4IDZ A;  1KT0 A;  5BXJ A;  1LVK A;  3U78 A;  3ZJ2 A;  5JH8 A;  4JUY A;  4V1A v;  3RLF F;  3ALG A;  2XQ4 A;  4EZ4 A;  2FBW A;  4PJN A;  2ZQS A;  4AQF A;  2B5U B;  4Q7N A;  1HJX A;  4QIB A;  4DV3 T;  2FAP A;  2RA1 A;  3KAC A;  3RIU A;  2ODU A;  4IST A;  4XBF B;  2PV3 A;  4UVA B;  4IL4 A;  4JFK A;  3KAI A;  3RGL A;  3AE6 A;  4CXX A;  1NWM X;  5CA0 E;  4WKF A;  4HFV A;  5LHG B;  3SRZ A;  2LLY A;  1LVF A;  5C2T A;  1GPF A;  1HF8 A;  3ZPO A;  1NH6 A;  4YFS A;  5JVD E;  5L47 A;  4JYS A;  4ISS A;  4P0A A;  2IUB A;  4PNI A;  4HBO A;  1HG2 A;  1IX5 A;  5AQN B;  4BA9 A;  1LJY A;  3QB5 A;  4U7I A;  2O92 A;  3CGN A;  3UI5 A;  4LAW A;  4IGU A;  2YEV C;  4EED A;  3WL1 A;  4DWS D;  3K8P C;  2E9X A;  3Q2M A;  3TDB A;  2BZB A;  2MF9 A;  5AQS B;  3RGC A;  1BR2 A;  4YHJ A;  4DUZ T;  3KVB A;  2V8S V;  2W2U A;  1UX5 A;  3NRY A;  4ADZ A;  3B8S A;  5HW8 A;  2JPF A;  2YN6 A;  3DTO A;  4DWS B;  5HXS A;  3JXV A;  4NXM T;  3KAB A;  4XAX B;  4X66 T;  1XHG A;  3FZM B;  4ODM A;  1D0Y A;  3TLW A;  3ETU A;  4DID B;  1YKH B;  4MAV A;  5DIU A;  2LHN A;  4MHC A;  4LFC T;  1WR0 A;  2DSW A;  2OA5 A;  4HWD A;  1FMV A;  2RQS A;  4ODN A;  4NPP A;  2O9O A;  3JCF A;  2N1G A;  3AE3 A;  1W1P A;  3OYX A;  4TW6 A;  3AVS A;  1SUM B;  3VRA A;  1FKJ A;  2X9H A;  4ZI3 D;  2KMF A;  2SPC A;  3RPU A;  2GK9 A;  3AS0 A;  4AQG A;  4TN7 B;  1FJG T;  1OWA A;  3KZ7 A;  4IQ2 A;  4OX9 T;  3NWI A;  1J6Y A;  2R6G F;  3O1H A;  2A72 A;  5FYM A;  3UQA A;  1LKX A;  4YHH T;  2FJE A;  3P4P A;  2E2A A;  2PJQ A;  2Y78 A;  5FP3 A;  4DWS C;  2M6I A;  3N2G E;  3ZSS A;  2D0U A;  4HFD A;  3UQB A;  3MDY B;  1ZBV A;  2ITK A;  4ZPT R;  4U85 A;  5HEO A;  1XDP A;  2W62 A;  2VVN A;  5LOV E;  5HWX A;  2VKH A;  3QOF A;  1T7S A;  3UU6 A;  1Q6U A;  1IBK T;  2VUR A;  2CWO A;  4CXW A;  3X1D A;  5LXT E;  4HTE A;  5LBM A;  4Z2K A;  3A7M A;  3LUO A;  4DV0 T;  3IEE A;  2LKH A;  2UXC T;  3PV0 F;  1FKF A;  4U7Y A;  3I1A A;  5HWC A;  4L72 B;  3HL6 A;  4LFA T;  4J2C A;  3FBL A;  2KR7 A;  5FXV A;  4WBO A;  1FKR A;  4EGW A;  5JQG E;  3C4Z A;  3RC8 A;  2W63 A;  1Z8U A;  3AE9 A;  3Q5X A;  2XQ6 A;  5ABF A;  5EZY E;  3AAA B;  3WQW A;  3PUQ A;  4TUY E;  4MTV A;  4ILB A;  1KEY A;  2F23 A;  2BBJ A;  2X9X A;  2XP3 A;  1FAP A;  2K24 A;  5AQU B;  3RM9 A;  2DSZ A;  2WM9 A;  5L4H A;  5LMU T;  3QOK A;  5ABF B;  3RIA A;  4GYS A;  4TNW A;  5HEH A;  3WAK A;  5AQK B;  2I0M A;  2M67 A;  2XPK A;  4FI5 A;  3TLT A;  3LSV A;  1WFD A;  1WRD A;  2VQE T;  3FHN A;  2DG3 A;  3ZMU B;  1ZP0 A;  1LG2 A;  3OPC A;  1Q1C A;  4DRQ A;  4L3N A;  4UV8 B;  2JRK A;  3B9E A;  3P8C D;  3KAG A;  2N2N A;  3MAC A;  1J4H A;  4Q22 A;  4C02 B;  2CXL A;  2WU5 A;  4ZZC A;  2LPV A;  2NW9 A;  1YKE B;  2ZQV A;  2LSI A;  2MNT A;  2YDR A;  4ZS6 A;  2XAF B;  3ONL C;  4I50 E;  5LNK A;  1UR9 A;  4H63 V;  4KR0 B;  3PE0 A;  4U2Z A;  1FFR A;  4EOZ B;  3L39 A;  2XQA A;  2B1E A;  1ZU8 A;  4YY3 T;  4DO0 A;  4UV9 B;  2G41 A;  3ART A;  2RPA A;  3I6C A;  1U4Q A;  4EV6 A;  5CA1 E;  5LGN B;  4U31 A;  4B6X A;  5LA6 E;  3ZCJ A;  3WAJ A;  1MNE A;  2YBU A;  3UFG A;  3AEA A;  2FJA A;  1D0Z A;  4O4L E;  5JRC A;  2EHO A;  3CZ8 A;  3ARR A;  1HR0 T;  4CI1 B;  2H7O A;  4WJX A;  3AED A;  3E0Z A;  3EVY A;  4P8U A;  2XP8 A;  2G8Z A;  4AQF C;  4ODR A;  3F2E A;  4Z2I A;  3ARV A;  4GIV A;  4O4J E;  3FZF B;  3ZN0 B;  4TV8 E;  1D7J A;  1EZ3 A;  2D5U A;  4B3R T;  2NW8 A;  2PPN A;  4IDN A;  2MAW A;  2XAS B;  2WY2 A;  3RM4 A;  4DR2 T;  2XAH B;  4ZZB A;  4MBQ A;  2H89 A;  3RYI E;  4X1K E;  3PJA J;  2FDM A;  3AS3 A;  2MLZ A;  3NKZ A;  4YT0 A;  2J4G A;  1D7H A;  3KV6 A;  1FKS A;  2WLZ A;  2XSB A;  5AQL B;  3FBZ A;  3WIJ A;  1FIO A;  5AQQ B;  5JR9 B;  1KFY A;  2LSJ A;  2K9A A;  1WYB A;  3PRD A;  5LJN A;  3ZMZ B;  5EK2 A;  1SYT A;  5JDH A;  1X6L A;  2VQF T;  3PRA A;  1C9H A;  3ZT5 A;  2WAU A;  1O6I A;  4FAP A;  3OVU A;  4F8H A;  2NP9 A;  4QZV B;  4DMV A;  2QVA A;  3EDV A;  1MMG A;  4KMC A;  5H6Q B;  1HKJ A;  4MNJ A;  3IHR A;  3SWH A;  2X9W A;  1WLX A;  3H3M A;  1M5Y A;  2XAG B;  4L9I A;  4DUY T;  4UEL A;  4O4H E;  3CPZ A;  1HCI A;  3PUX F;  3SFE A;  3IA3 A;  2IUZ A;  3G06 A;  4IE5 A;  2V1D B;  1HX8 A;  2LJL A;  3KFW X;  3PUS A;  4B3S T;  2V7J A;  4LMJ A;  1QPL A;  4BAY B;  2XQ7 A;  4W9O A;  4AQY T;  1D7I A;  3KCE A;  4TZ4 C;  4UR9 A;  1HKK A;  3CIR A;  3IK8 A;  5L3B B;  4DR5 T;  4KI0 F;  3WI3 A;  2VKO A;  3C4W A;  1SHZ C;  3HI2 A;  3UI6 A;  3CX6 B;  3VHL A;  3K1S A;  4HWI B;  2E9X B;  2Q9Q C;  3N2O A;  3ZN1 B;  3OJA A;  5C8Y E;  4B3T T;  4JI6 T;  1UUS A;  2DLR A;  2X0Y A;  2IDO B;  4H9R C;  3F31 A;  4ZPW R;  3AA1 B;  2A3B A;  4JI5 T;  1NAF A;  4X5T A;  5BR8 T;  2XY8 B;  2DSU A;  3NVO A;  3PDY A;  1IJ6 A;  2C5K T;  1CHU A;  1W1T A;  3TLU A;  4LF4 T;  1K9T A;  2CWY A;  4HWC A;  4H9O C;  2EHO D;  3CQX C;  1SR0 A;  2KGJ A;  4C90 A;  5FMN A;  1NEK A;  1VCS A;  4NSB A;  4ML4 A;  1FFQ A;  1WB0 A;  4TNS A;  3UUM A;  3JAD A;  2ZQU A;  4WNK A;  2XUE A;  3UI4 A;  2QYW A;  4IDP A;  4EEB A;  4DT4 A;  5AQM B;  2DI4 A;  3EY6 A;  3BQL A;  5J2U E;  1QSD A;  5FXW A;  4YLH A;  2LSY A;  4U86 A;  2LM2 A;  1Q6I A;  1D6O A;  3ZMT B;  2IIU A;  1KNP A;  3V5S A;  5TAO A;  2ZMA A;  4JI4 T;  2KXP B;  4Z8X A;  4EAH A;  2IW5 B;  4ILU A;  2UXX B;  4DV5 T;  2BS3 A;  5AQR B;  1UR8 A;  4DV7 T;  2K5B B;  3KV9 A;  2E5V A;  4Q25 A;  4HFE A;  2M1I A;  3WKZ A;  5DEZ A;  4URI A;  2I59 A;  3BQI A;  1NWU A;  4F6R C;  1IBL T;  1W09 A;  3O5R A;  2CA5 A;  2YOE A;  4CN6 A;  4JLE A;  3PUG A;  3UF8 A;  1W0B A;  3SS1 A;  3PR9 A;  5AQO B;  1F8A B;  1BR4 A;  1VOM A;  5ADX L;  2JMK A;  3VR8 A;  4HWF A;  1W1V A;  3ONX A;  4PW8 A;  2W4X A;  3UUN A;  1HJW A;  1T8B A;  3NZP A;  2WM0 A;  3AA6 B;  2KWH A;  2WP9 A;  4X1I E;  5IUX A;  1BKF A;  1N34 T;  5F3J A;  3RHW A;  4NIQ A;  1MMD A;  2MYS A;  1BL4 A;  3FZH B;  2XAJ B;  4HBE A;  4DWS A;  2OLH A;  2BS2 A;  4DH0 A;  3FXY A;  4DMW A;  3RKG A;  1DU2 A;  5FVK A;  3AEB A;  1W9P A;  3ALF A;  5L3D B;  4DV6 T;  1FD9 A;  4QXH B;  1JNS A;  3CHD A;  3Q5W A;  2W66 A;  4JI0 T;  5HXH A;  1TFV A;  1LG1 A;  2X66 A;  2ACZ A;  4A97 A;  2B31 A;  3ZKR A;  2KZ7 B;  2D2S A;  2YBT A;  3PU3 A;  3FZK B;  1ZKE A;  4I0U A;  3ONJ A;  4PK5 A;  2LGO A;  4FJO A;  3TCZ A;  1FEW A;  3KDS E;  4IPX A;  1HNZ T;  4KHP T;  5LP6 E;  2EHO C;  5JDN A;  2X0H A;  1W0A A;  3O5I A;  1OED A;  4ZI3 C;  5H6R B;  1EQ3 A;  4S3K A;  2NWB A;  4LF8 T;  2V6Y B;  2LOS A;  3RM8 A;  3PUR A;  3WD2 A;  4IRE A;  2RUQ A;  5A1L A;  1ZK6 A;  3P4S A;  4DR1 T;  3FAP A;  3JAE A;  3VU7 H;  4LFB T;  1P5Q A;  4O4I E;  4UDM A;  2QGS A;  5AQV B;  1HXV A;  3Q5E A;  4QHO A;  3BK9 A;  1PIN A;  3CHE A;  2J62 A;  4PJJ A;  4X20 E;  2XZE A;  1QZ2 A;  1E9L A;  1ITX A;  4NXN T;  1CUN A;  1TCO C;  1LL7 A;  3N9Q A;  3RYF E;  1WNO A;  3CVR A;  4DR4 T;  3P4Q A;  5CGM A;  4LML A;  4I43 B;  5HEU A;  4JEH B;  4DZ2 A;  1O3X A;  4BF8 A;  3MK7 C;  4E7S A;  3GMI A;  5ETW A;  1E1H B;  3KVA A;  5L3C B;  2WQY A;  2KFW A;  2KLQ A;  1YW5 A;  3C51 A;  4DR7 T;  2I6H A;  4B3M T;  2QA7 A;  1MMA A;  5HXR A;  1W9V A;  1N33 T;  2XQ9 A;  2YDQ A;  5AFU L;  3KBU A;  4J4N A;  4TWF A;  1PBK A;  3AVR A;  4PJL A;  5LHI B;  4P8W A;  3I9Y A;  4IQC A;  2W00 A;  3RYC E;  5AQT B;  3O5F A;  1QUU A;  3E22 E;  5FY7 A;  5JRC B;  5J0Z A;  4LAX A;  5AQI B;  4MAL A;  3GA8 A;  4FN2 A;  1ZBW A;  5HAX A;  4G63 A;  4IDO A;  2V26 A;  3QNU A;  1W9U A;  3AS2 A;  2IML A;  5FKY A;  4R5E A;  3W4R A;  1CTN A;  2DT3 A;  4DRM A;  3TLS A;  1YQ4 A;  3C98 B;  2ZM6 T;  5FVL A;  5LG4 A;  2K48 A;  3MA9 A;  4DRN A;  2V7M A;  4IE7 A;  2BBH A;  3AXJ B;  3EHZ A;  1J4R A;  5AQF B;  3KIN B;  4QH5 A;  4J4O A;  2DT2 A;  4DRK A;  4UEM A;  2A9U A;  2YKS A;  3PJA A;  5JDL A;  3ZMV B;  1I94 T;  2BVL A;  5HUA A;  4H9N C;  4AIS A;  3LDQ B;  4AKH A;  2YIN A;  5LGT B;  2KWI B;  1JND A;  5LBQ B;  3KBT A;  2F2D A;  3ZC1 A;  3SFD A;  2M2A A;  4LF5 T;  1IJ5 A;  3RC3 A;  2H3R A;  2MTQ A;  2NW7 A;  4QXC B;  4O2A E;  5DO2 A;  4GK5 E;  2X67 A;  4WW0 A;  3H9R B;  1QPF A;  2LHR A;  3Q5D A;  4JEU B;  4DIP A;  2AXD S;  3BMB A;  2H7V C;  4TYO A;  3OOB A;  2QF8 A;  2E9X D;  5FY1 A;  4QX8 B;  1ZCN A;  3EUH A;  1S35 A;  2YK0 A;  3J9X 1;  1N32 T;  1W9R A;  5D75 A;  4H9Q C;  2Y8D A;  3O1J A;  2F4E A;  3TC5 A;  5HBF A;  4DZ3 A;  3IHZ A;  4X62 T;  1YAT A;  3RME A;  1GOI A;  3I0O A;  4Z90 A;  4JYA T;  3DJB A;  4G50 A;  1YW0 A;  1SE7 A;  2P4V A;  2FJD A;  2FKE A;  1E44 A;  1NMW A;  4DR6 T;  2BG9 C;  2D0T A;  2XTL A;  3ARY A;  1X9B A;  2Q9Q A;  2K8I A;  3EI0 A;  1NWS A;  2DL1 A;  4PK4 A;  5JDQ A;  5L3E B;  4MNM A;  5IWA T;  3OYZ A;  3UTK A;  4COF A;  5LG3 A;  4QT2 A;  4AKL A;  1LQ0 A;  5DIT A;  3Q9D A;  3O5O A;  4BJN A;  1T11 A;  3EAM A;  4ZI2 C;  1V9D A;  2BS4 A;  1NEN A;  2UUA T;  3B57 A;  3HKE E;  3ZT7 A;  2ZR5 A;  2Z6E A;  3UQ4 A;  4OYK A;  4YJ2 E;  4ODP A;  1LL6 A;  3L3P A;  2XP5 A;  2VL0 A;  4GKJ T;  3AA0 B;  1R9H A;  2JQK A;  3ZT6 A;  4ANJ A;  2PV2 A;  2ZR6 A;  2J1D G;  4UVB B;  3UU4 A;  2YU2 A;  1HX1 B;  2XQ5 A;  3ZLI A;  2Y6X A;  2XSA A;  3SOL A;  3AE7 A;  3O5J A;  3B13 A;  1FKI A;  2WS3 A;  2WMN A;  1MMN A;  3NRX A;  4ASK A;  4DV1 T;  3B9A A;  3N9O A;  2XHE B;  3LK4 2;  5HKG A;  1NSG A;  2WDR A;  4YSZ A;  5KDM C;  2LRK A;  4QH1 A;  3PUZ F;  5LJM A;  2IAK A;  1WCR A;  4DRI A;  4TX5 A;  2D9F A;  2M6B A;  1H0G A;  2J47 A;  1W26 A;  2RUD A;  4P09 A;  3H37 A;  5ABG A;  2WWU A;  3C4X A;  2MLX A;  5LHH B;  4MGV A;  5B8I C;  3HA4 A;  5GPG A;  2NOX A;  2XM1 A;  1NWT A;  3R6N A;  4HFI A;  3UU3 A;  3CKD A;  3P4W A;  2EHO B;  3ARZ A;  2JZV A;  5L3F B;  4DV4 T;  1KK7 A;  3O5K A;  3CGM A;  1ROT A;  1HS7 A;  1FKB A;  2L3L A;  5ABE A;  4DRH A;  2PG8 A;  3RYH E;  3QC9 A;  3ZYM A;  2XP9 A;  1E6Z A;  4OYJ A;  4Z2J A;  4X64 T;  5AQG B;  2XJ7 A;  1FKH A;  3L09 A;  1EDQ A;  2CRB A;  2LJ4 A;  4QWN B;  1YXR A;  3PRB A;  4JFM A;  1XNQ T;  3HKD E;  1ZHC A;  3RRW A;  5I98 A;  5HWY A;  4E7Z A;  3ZC0 A;  4NUU A;  4P8X A;  2E8I A;  3K3Q C;  4A5X A;  3KAH A;  5JH7 E;  4JI1 T;  4AKG A;  4KBM B;  2LE8 A;  1ROU A;  4M1P A;  2XP6 A;  4AXP A;  4Z91 A;  3AE2 A;  3WQV A;  3RIU C;  4DBR A;  3D0T A;  2AWG A;  3FXE B;  2BKP A;  5HTG A;  4NZC A;  5JRE A;  3GPK A;  4AI6 A;  5ABH A;  2ZM8 A;  5HWB A;  4OK0 A;  3WD3 A;  3GWH A;  2UXD T;  2VVS A;  3P7I A;  4W9P A;  4P0B A;  4K0K T;  2UU9 T;  2DWK A;  3ETV A;  2MPK A;  3FZL B;  1OWQ A;  3ANW A;  2BVM A;  2DSV A;  4ERR A;  2JQQ A;  3O5Q A;  5GQB A;  4U84 A;  2UXB T;  2V7K A;  4G2A A;  4QKN A;  2CHN A;  3VRB A;  4IDQ A;  1MIW A;  2ODV A;  4MFR A;  3NTP A;  2PV1 A;  3CH9 A;  4AY1 A;  4MSP A;  2HPL A;  1D1A A;  3N5L A;  4K0U A;  2WLY A;  2E9X C;  2Q9Q B;  4YTN A;  5FNV E;  3O5M A;  4UXN B;  4YSY A;  4CXY A;  4HFC A;  3LBX A;  1E6P A;  2JQH A;  2B76 A;  1WYC A;  1B7T A;  2A3C A;  2QRX A;  5JDF A;  3ZJ1 A;  4YJ3 E;  4R0X A;  4EYY R;  3WD4 A;  2DCF A;  3JC6 D;  1D2K A;  4KX6 A;  3AXJ A;  2JJ9 A;  4QX7 B;  2V7L A;  4KUM B;  1F40 A;  1HKI A;  1D1C A;  3UU5 A;  3CQG B;  4LF7 T;  1U79 A;  4LAY A;  2N87 A;  2KND A;  3ESL A;  4WBN E;  3VAW A;  2RUC A;  2W0G A;  2UZ5 A;  2KT9 A;  4IIJ E;  4ZOL E;  5HT1 A;  1JNZ A;  4PJM A;  4NUV A;  3LJC A;  1RD6 A;  4JI3 T;  1KNZ A;  3BXW A;  4WYV A;  4TW8 A;  1QLB A;  4TV9 E;  4PFO A;  3O1I A;  2MLY A;  1HG5 A;  1ZBC A;  4GYR A;  2W67 A;  3I0Q A;  4ILA A;  3QK6 A;  1E2A A;  4ITZ A;  3AB3 B;  3W15 B;  4ODL A;  1UUR A;  2E5L T;  1E7P A;  4U2Y A;  1HKM A;  3CWZ B;  5DIV A;  1IZN B;  4C91 A;  1D1B A;  1AJ3 A;  2L2S A;  4TWH A;  4U33 A;  3CQC B;  3R84 B;  1M7K A;  4GIW A;  4L0R A;  3MJX A;  3O5E A;  1JCH B;  4KP3 C;  3B9D A;  3U3I A;  3ARQ A;  5F5W A;  2BG9 A;  4O8S A;  1LL4 A;  4ZS2 A;  3AA7 B;  3RF1 A;  2BDE A;  3N2K E;  3H3A A;  3LBX B;  3OKQ A;  3ZEF B;  2HPJ A;  2LRL A;  4AIU A;  1J1J A;  4CZZ B;  2MOZ A;  5M4Y A;  1XRV A;  1HJV A;  3RRC A;  2A3A A;  1VF8 A;  2ACX A;  4PAG A;  4U74 A;  4DR3 T;  4EIW A; 
#chains in the Genus database with same CATH homology
 3PA7 A;  1W9U A;  2IF4 A;  3ARR A;  3AS2 A;  3CZ8 A;  3IKD A;  4WJX A;  4LGX A;  4R5E A;  2KE0 A;  1CTN A;  3W4R A;  2MPH A;  2DT3 A;  4WZX A;  2XP8 A;  1JNE A;  4MPK A;  4P8U A;  4DRM A;  1EYM A;  2G8Z A;  4ODR A;  4Z2L A;  4ZEY A;  4Z2I A;  2DPE A;  5FVL A;  3ARV A;  4GIV A;  3ARO A;  4DRN A;  1J4R A;  4LAV A;  2CPT A;  2WWV A;  1D7J A;  2PPN A;  4P1N A;  2WY2 A;  3NRK A;  3RM4 A;  4J4O A;  2DT2 A;  4DRK A;  2RUR A;  4W5U A;  2A9U A;  2FDM A;  3AS3 A;  2MLZ A;  4CN4 A;  4JFL A;  1D7H A;  1FKS A;  4Z2H A;  2WLZ A;  5HUA A;  1A7X A;  3RFW A;  4HAR A;  3WIJ A;  1L1P A;  2PBC A;  2PPP A;  1JND A;  2F2D A;  2M2A A;  3PRD A;  1H0I A;  5HW6 A;  5J6E A;  1SYT A;  4TW7 A;  3AQU A;  5DO2 A;  3H9R B;  1QPF A;  1X6L A;  2K3W A;  3PRA A;  1C9H A;  3ZT5 A;  1KFW A;  1O6I A;  4DIP A;  4FAP A;  4TYO A;  2ESC A;  3OOB A;  4QT3 A;  2QF8 A;  4QZV B;  3ZST A;  2DT1 A;  1OGG A;  1ZCN A;  1HKJ A;  1N1A A;  2XPA A;  4MNJ A;  4O2T A;  3O5L A;  5D75 A;  4PTM A;  2F4E A;  3TC5 A;  5HBF A;  1M5Y A;  3IHZ A;  4DZ3 A;  1YAT A;  3RME A;  1E6R A;  2XPB A;  4N19 A;  1GUV A;  1GOI A;  2RSE A;  3O5P A;  1FJD A;  1JVW A;  4NNR A;  2IUZ A;  4W9Q A;  4G50 A;  2ZQT A;  4IT6 A;  4DRO A;  1QPL A;  4W9O A;  3O5G A;  3WH0 A;  1ZB5 A;  2FKE A;  3WD0 A;  1B6C A;  1D7I A;  1NMW A;  4MNK A;  1FKT A;  2WK2 A;  3ARP A;  3KCE A;  3ARY A;  1HKK A;  1W1Y A;  3IK8 A;  3WL0 A;  2K8I A;  3ARX A;  2KI3 A;  1NWS A;  4G2P A;  1KT1 A;  2DL1 A;  3B7X A;  3G6L A;  2XP4 A;  1NWR A;  4MNM A;  3UI6 A;  3JYJ A;  4Z2G A;  3CHF A;  4QT2 A;  3K1S A;  2A3E A;  1LQ0 A;  5DIT A;  3FY1 A;  3O5O A;  2AOS A;  5BXJ A;  1KT0 A;  1ZL1 A;  1T11 A;  1J4I A;  5JH8 A;  3ALG A;  3ZT7 A;  2ZR5 A;  2ZQS A;  4ZPW R;  4Q7N A;  3JYM A;  4ODP A;  2A3B A;  1LL6 A;  2XP5 A;  1HJX A;  4QIB A;  2FAP A;  3KAC A;  5CJ5 A;  1R9H A;  2JQK A;  3ZT6 A;  2DSU A;  2PV2 A;  2ZR6 A;  2PV3 A;  4JFK A;  1E6N A;  1W1T A;  2F21 A;  1EHN A;  3KAI A;  1K9T A;  4WKF A;  1SR0 A;  2KGJ A;  5GPR A;  3O5J A;  5DF0 A;  4NSB A;  4ML4 A;  1FFQ A;  1WB0 A;  1FKI A;  4TNS A;  1GPF A;  2ZQU A;  1ZBK A;  3B9A A;  3UI4 A;  1NH6 A;  5HKG A;  1NSG A;  4JYS A;  2LRK A;  4HBO A;  4DT4 A;  1IX5 A;  3EY6 A;  5LB7 B;  1LJY A;  4U7I A;  1E15 A;  2O92 A;  3CGN A;  3UI5 A;  4LAW A;  1WCR A;  4DRI A;  2D9F A;  1H0G A;  3CHC A;  3WD1 A;  1W26 A;  3WL1 A;  4U86 A;  4DWS D;  2RUD A;  1Q6I A;  1D6O A;  2JQ9 A;  2MLX A;  1FKD A;  3TDB A;  2MF9 A;  4MGV A;  5B8I C;  3RGC A;  5GPG A;  1NWT A;  2W2U A;  1FKG A;  3ARZ A;  3B8S A;  2JZV A;  5HW8 A;  1UR8 A;  4DWS B;  4KQZ A;  3JXV A;  3O5K A;  3CGM A;  2M1I A;  3KAB A;  1ROT A;  3WKZ A;  5DEZ A;  4URI A;  4DRJ A;  1XHG A;  1NWU A;  1FKB A;  3O5R A;  4ODM A;  4DRH A;  4CN6 A;  2XP9 A;  1E6Z A;  4MAV A;  5DIU A;  3UF8 A;  4Z2J A;  1FKH A;  1WR0 A;  2DSW A;  1EDQ A;  2RQS A;  2CRB A;  4ODN A;  3PR9 A;  2LJ4 A;  2O9O A;  1YXR A;  1F8A B;  3O5D A;  1W1P A;  3PRB A;  4JFM A;  4TW6 A;  1W1V A;  1FKJ A;  1Y0O A;  1HJW A;  5I98 A;  3AS0 A;  2WM0 A;  4P8X A;  3KZ7 A;  4A5X A;  4IQ2 A;  3KAH A;  1J6Y A;  3UQI A;  1BKF A;  4GGQ A;  3UQA A;  4NIQ A;  3ODK A;  1BL4 A;  1ROU A;  2XP6 A;  4HBE A;  4DWS A;  1WAW A;  3WQV A;  2OLH A;  2AWG A;  4U3C A;  4IT4 A;  2PPO A;  4DH0 A;  3FXY A;  5HTG A;  1EIB A;  4NZC A;  3GPK A;  2Y78 A;  5FVK A;  1W9P A;  3ALF A;  4DWS C;  1FD9 A;  1FKK A;  2DG4 A;  1X6N A;  5HWB A;  1JNS A;  3ZSS A;  3WD3 A;  3CHD A;  5HW7 A;  3UQB A;  3MDY B;  1ZBV A;  3AS1 A;  4WIW A;  3KAD A;  1TFV A;  4W9P A;  2ITK A;  4JFI A;  4CN1 A;  1LG1 A;  4ZPT R;  2B31 A;  4U85 A;  4S3J A;  2MPK A;  2YBT A;  1OWQ A;  2DSV A;  1Q6U A;  3TCZ A;  2LGO A;  3O5Q A;  5GQB A;  4U84 A;  4IPX A;  2VCD A;  4Z2K A;  2KO7 A;  3NTP A;  3LUO A;  2PV1 A;  3CH9 A;  4ZPV R;  4AY1 A;  1FKF A;  4U7Y A;  4MSP A;  5HWC A;  3IKG A;  4L72 B;  2V6Y A;  1OGB A;  2WLY A;  2KR7 A;  3O5I A;  3O5M A;  1EQ3 A;  1FKR A;  4S3K A;  1E6P A;  2JQH A;  2V6Y B;  3RM8 A;  2A3C A;  3ARW A;  3WD2 A;  2RUQ A;  2DG9 A;  1ZK6 A;  2PI6 A;  4R0X A;  3WQW A;  4WK9 A;  4XAK A;  3FAP A;  3WD4 A;  2V6X A;  1D2K A;  4MTV A;  3ARU A;  2M08 A;  1P5Q A;  1F40 A;  1HKI A;  2XP3 A;  2Q5A A;  1FAP A;  1HXV A;  4DRP A;  1U79 A;  4LAY A;  3RM9 A;  2DSZ A;  2N87 A;  1PIN A;  3CHE A;  3QOK A;  4TX0 A;  3VAW A;  2RUC A;  2XZE A;  2UZ5 A;  1QZ2 A;  2LKN A;  5HT1 A;  1E9L A;  1ITX A;  4WKH A;  4P8V A;  1TCO C;  1WFD A;  1LL7 A;  2DT0 A;  1JNT A;  4ODQ A;  1WNO A;  1RD6 A;  2DG3 A;  5CGM A;  1LG2 A;  3ARS A;  4MNL A;  3BXW A;  1Q1C A;  4DRQ A;  4ODK A;  4L3N A;  4TW8 A;  3KAF A;  3B9E A;  3KAG A;  4DZ2 A;  1FKL A;  2MLY A;  1ZBC A;  4BF8 A;  1J4H A;  4ODO A;  4Q22 A;  4C02 B;  4ITZ A;  2LPV A;  4ODL A;  2ZR4 A;  2ZQV A;  4WKA A;  2MNT A;  2KFW A;  1NMV A;  1YW5 A;  4ZS6 A;  4U2Y A;  1HKM A;  5DIV A;  1UR9 A;  2L2S A;  3OA5 A;  4KR0 B;  1W9V A;  4U33 A;  3EAB A;  4U2Z A;  1FFR A;  4JFJ A;  4J4N A;  1ZU8 A;  3O5E A;  2XP7 A;  2G41 A;  3ART A;  1PBK A;  3B9D A;  2RPA A;  3ARQ A;  3I6C A;  4U31 A;  4P8W A;  1LL4 A;  4IQC A;  3O5F A;  3G6M A;  3NI6 A;  2OFN A;  2VN1 A;  2YBU A;  4LAX A;  2LRL A;  4FN2 A;  1ZBW A;  1XRV A;  1Q6H A;  1HJV A;  2A3A A;  1VF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...