2UZ5A

Solution structure of the fkbp-domain of legionella pneumophila mip
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
137
structure length
137
Chain Sequence
FNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MACROPHAGE INFECTIVITY POTENTIATOR
publication title Domain Motions of the Mip Protein from Legionella Pneumophila
pubmed doi rcsb
molecule tags Isomerase
total genus 22
structure length 137
sequence length 137
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2uz5A02
2PPOA 1JNTA 1BKFA 2ZR5A 3O5RA 3I6CA 3PRBA 3TCZA 2MLYA 2KE0A 2PPNA 4IQ2A 3EY6A 3B7XA 2XP6A 3PRDA 5HW6A 4JFJA 4TW6A 5B8IC 1YATA 1B6CA 3O5LA 5DIVA 4JFKA 2N87A 1Q6UA 1JVWA 5I98A 3O5MA 2L2SA 3PA7A 4IQCA 4J4OA 4ODNA 4DH0A 5HUAA 3KAHA 1M5YA 4TX0A 2MLXA 2DG9A 1NMVA 2LGOA 2M08A 2RUCA 4R0XA 4DRMA 4DZ2A 4ODPA 3GPKA 2MNTA 5HKGA 3MDYB 4G2PA 2KFWA 3KADA 1QPFA 4TW8A 5HW7A 3CGNA 2XP7A 1F8AB 4W9OA 1P5QA 4FN2A 3TC5A 1D7JA 4U85A 2F4EA 5HT1A 1D7IA 3UF8A 3IHZA 2AWGA 1FKHA 2XP5A 3KAIA 3O5KA 3UI5A 2KO7A 1FKLA 2XP8A 4J4NA 3KAGA 3IKDA 1L1PA 1FKSA 2VN1A 4W9QA 4U84A 2LPVA 4LAYA 1Q6HA 4O2TA 1FD9A 1FKIA 4QIBA 1J4RA 2KR7A 1FKGA 2XPBA 4GGQA 2M2AA 5J6EA 2F21A 1J4HA 1D7HA 2XP9A 1EYMA 3O5JA 4DROA 1FKFA 2PV2A 1QPLA 3UI4A 1PINA 4C02B 3O5GA 4MGVA 3FAPA 5DIUA 2ZR4A 1Q1CA 1TCOC 4JFIA 2Y78A 5D75A 1C9HA 1FKTA 2ZQTA 2FAPA 5GPGA 2Q5AA 2JZVA 1N1AA 4TNSA 2ZR6A 3UI6A 3NI6A 3RGCA 2FKEA 2RSEA 2ZQUA 1J4IA 3NRKA 4QT3A 3VAWA 5DITA 5HTGA 2PV1A 2LJ4A 1R9HA 1FKBA 1KT0A 1FKDA 1JNSA 2KGJA 2VCDA 4G50A 1PBKA 2MLZA 2PPPA 3O5IA 4ODOA 2ZQVA 2DG3A 4ODQA 2RUDA 4W9PA 3JYJA 4DRQA 3O5QA 1Q6IA 3KAFA 1KT1A 3TDBA 4DRNA 1D6OA 1FAPA 3IK8A 1FJDA 5BXJA 2ITKA 3WH0A 2F2DA 2ZQSA 3CGMA 1Y0OA 3IKGA 3LUOA 4TW7A 4DRHA 4IPXA 1A7XA 1ROTA 2PBCA 2RUQA 2KI3A 3O5EA 4DRKA 5HW8A 4N19A 4QT2A 4GIVA 2XP4A 4DZ3A 2OFNA 2MPHA 4LAXA 1HXVA 4BF8A 3JYMA 3O5PA 3RFWA 2M1IA 3O5OA 2IF4A 3OOBA 1FKKA 3O5DA 1YW5A 2D9FA 3H9RB 1ZCNA 4DRIA 1NMWA 4DRJA 3KABA 1ROUA 2RQSA 4MSPA 4ODRA 3UQAA 2XP3A 1QZ2A 4ODMA 3UQIA 2LKNA 4JFLA 2K8IA 1U79A 1FKJA 1NSGA 3KCEA 4ODLA 3O5FA 4ODKA 4JYSA 2RURA 1J6YA 2XPAA 4TYOA 1T11A 4LAWA 4FAPA 4LAVA 4ITZA 1BL4A 3NTPA 1W26A 2PV3A 4DRPA 1FKRA 1ZK6A 4JFMA 3UQBA 3JXVA 4NNRA 1EQ3A 3KACA 4DT4A 1F40A 4U86A 2UZ5A 3ODKA 5HWCA 4DIPA 2MF9A 3KZ7A 2DG4A 5HWBA
chains in the Genus database with same CATH superfamily
2PPOA 3AS3A 1WNOA 3I6CA 4KR0B 3EY6A 5HW6A 1HJXA 3ARRA 1SYTA 3AS0A 5DIVA 4JFKA 2L2SA 2WLYA 4WK9A 3KAHA 4PTMA 2DG9A 2LGOA 2RUCA 4DZ2A 1GRJA 4Q22A 3MDYB 4G2PA 3AS1A 1HKKA 2XP7A 1F8AB 3TC5A 3EIPA 3ARVA 3ARPA 2F4EA 1D7IA 3CHEA 3UF8A 3IHZA 3WD0A 2XP5A 1FKHA 3ALFA 2XP8A 1XHGA 1H0GA 2FDMA 1CTNA 1FKIA 1FKGA 1ITXA 2XPBA 4GGQA 2ETNA 1J4HA 1D7HA 1EYMA 4C02B 2OLHA 4QZVB 5DIUA 4JFIA 2AOSA 4S3KA 1C9HA 1FKTA 5HBFA 4TNSA 4KQZA 1E6PA 2ZQUA 3NRKA 1XRVA 3VAWA 1E6ZA 5HTGA 1KT0A 1FKDA 2DSVA 3O5IA 2G41A 4ODQA 3O5QA 3WD3A 2WK2A 1FAPA 1FJDA 5BXJA 1LG1A 1KFWA 3LUOA 4DRHA 1ROTA 3O5EA 1RD6A 4QT2A 2DT3A 2XP4A 4IT6A 3O5OA 1NMWA 1ROUA 3B9AA 3UQAA 2XP3A 1QZ2A 3ARZA 1ZBWA 1U79A 4ODLA 2DT2A 2RURA 4TYOA 4FAPA 4ITZA 1FKRA 1W26A 1H0IA 1EQ3A 3UQBA 1O6IA 3JXVA 2YBTA 4DT4A 1HKIA 4HBEA 2A3CA 5HWBA 1NH6A 4ZPWR 3TCZA 1GPFA 2KE0A 3B7XA 3PRAA 2XP6A 1NWSA 4LGXA 1B6CA 1UR8A 3O5LA 3O5MA 3PA7A 4J4OA 4Z2KA 5HUAA 1M5YA 1FFRA 2MLXA 1NMVA 2KFWA 1QPFA 4W9OA 1E6NA 1EHNA 5HT1A 3O5KA 2KO7A 3KAGA 3WD1A 1D2KA 3BXWA 1FKSA 2O92A 4W9QA 2DSUA 1Q6HA 2ESCA 1EIBA 4QIBA 2DT1A 4L72B 2M2AA 4DROA 1FKFA 4UDMA 3FAPA 4NSBA 2DSWA 1TCOC 1TFVA 5D75A 2ZQTA 2IUZA 1N1AA 3NI6A 2FKEA 4QT3A 1ZL1A 5GPRA 5DITA 2KGJA 2MLZA 1X6NA 1JNEA 4DRQA 3KAFA 1LL6A 3B9EA 5DEZA 1E9LA 4Z2GA 2F2DA 3CGMA 1Y0OA 3IKGA 5DF0A 4IPXA 1A7XA 2RUQA 4DRKA 4N19A 1K9TA 3ARSA 1HKMA 2MPHA 4LAXA 1HXVA 1W1TA 3JYMA 4P8WA 4DRIA 2G8ZA 4DRJA 1WAWA 1E6RA 2RQSA 4ODMA 2K8IA 3ARYA 4JYSA 1J6YA 1UR9A 3PR9A 1T11A 4LAVA 1BL4A 2PV3A 4JFMA 2A3EA 3WD4A 4U86A 5HWCA 4DIPA 3GTYX 1W9PA 1LG2A 1BKFA 2ZR5A 3O5RA 4XAKA 4IQ2A 2PPNA 1HJWA 3QOKA 3W4RA 1LL4A 2N87A 2B5UB 5I98A 4ODNA 4DH0A 4TX0A 1OWQA 4DRMA 5HKGA 4P8XA 3GPKA 2A3BA 3CHCA 2WLZA 2DPEA 4FN2A 4U85A 4URIA 1W1YA 4MNJA 1W1PA 2AWGA 2B31A 4MAVA 1L1PA 2LPVA 3GU0A 4O2TA 2KR7A 4Z2HA 3ARXA 2P4VA 3WL0A 2F21A 4MNLA 1JNDA 1LQ0A 2XP9A 4NZCA 3O5JA 4HBOA 3UI4A 1PINA 2DSZA 4MGVA 3WQVA 1IX5A 2WM0A 2ZR4A 1Q1CA 3RM4A 5GPGA 2Q5AA 2ZR6A 3UI6A 3RGCA 1HKJA 2RSEA 1J4IA 2PN0A 2PV1A 1R9HA 3ARWA 1NWRA 3CHFA 1PBKA 3CHDA 2ZQVA 2DG3A 1HJVA 2RUDA 3B9DA 2DT0A 1Q6IA 1KT1A 1GUVA 3CH9A 3IK8A 3CZ8A 2ITKA 2ZQSA 5DO2A 1WB0A 4GIVA 2OFNA 1NWTA 4P8VA 4DWSB 4Z2JA 3RFWA 2M1IA 4W5UA 1FKKA 2D9FA 3KABA 3RM9A 5JH8A 1OGBA 4ODRA 3UQIA 2LKNA 4MNMA 3WD2A 1NSGA 3KCEA 4IT4A 2F23A 1OGGA 2XPAA 4LAWA 4DRPA 4HARA 1ZK6A 4MPKA 4NNRA 4R5EA 2PI6A 3ARQA 1E15A 3ODKA 3G6MA 3WL1A 4ZS6A 3KZ7A 2PV2A 2DG4A 4Z2LA 1FFQA 1JNTA 1ZBCA 4S3JA 1W9VA 1JCHB 3PRBA 1X6LA 2MLYA 3PRDA 4WKFA 4JFJA 4MTVA 4TW6A 5B8IC 1YATA 1Q6UA 1JVWA 3WIJA 4IQCA 3ALGA 4ZPVR 4R0XA 2M08A 4ODPA 2MNTA 1LJYA 1W9UA 3KADA 4TW8A 5HW7A 3CGNA 1P5QA 1D7JA 4DWSC 3OA5A 3KAIA 3UI5A 1FKLA 3WQWA 4J4NA 1SR0A 3IKDA 4WJXA 4L3NA 2VN1A 3ARUA 3WKZA 4U84A 4LAYA 1FD9A 1J4RA 4AY1A 5J6EA 1W1VA 3AQUA 2QF8A 1QPLA 4WIWA 2Y78A 3BMBA 4DWSD 3ARTA 2FAPA 1ZBVA 2JZVA 1NWUA 2LJ4A 4WKAA 1FKBA 1JNSA 4Z2IA 1E44A 2VCDA 2EULA 4G50A 4ODOA 2PPPA 4W9PA 3JYJA 4WKHA 3TDBA 4DRNA 1D6OA 3WH0A 4Q7NA 4TW7A 1GOIA 2PBCA 2KI3A 5HW8A 2YBUA 4ZPTR 4DZ3A 2A3AA 4BF8A 3O5PA 3G6LA 3B8SA 4ML4A 3OOBA 2IF4A 3O5DA 5GQBA 1YW5A 3H9RB 1ZCNA 1ZB5A 4MSPA 1VF8A 1LL7A 1EDQA 4JFLA 4MNKA 3RMEA 1FKJA 3O5FA 4ODKA 3FXYA 2O9OA 3RM8A 3FY1A 3AROA 3NTPA 4P8UA 1ZU8A 3KACA 1F40A 1ZBKA 2UZ5A 3AS2A 2MF9A 3O5GA 4DWSA
chains in the Genus database with same CATH topology
2PPOA 3AS3A 1WNOA 3I6CA 4KR0B 3EY6A 5HW6A 1HJXA 3ARRA 1SYTA 3AS0A 5DIVA 4JFKA 2L2SA 2WLYA 4WK9A 3KAHA 4PTMA 2DG9A 2LGOA 2RUCA 4DZ2A 4Q22A 3MDYB 4G2PA 3AS1A 1HKKA 2XP7A 1F8AB 3TC5A 3ARVA 3ARPA 2F4EA 1D7IA 3CHEA 3UF8A 3IHZA 3WD0A 2XP5A 1FKHA 3ALFA 2XP8A 1XHGA 1H0GA 2FDMA 1CTNA 1FKIA 1FKGA 1ITXA 2XPBA 4GGQA 1J4HA 1D7HA 1EYMA 4C02B 2OLHA 4QZVB 5DIUA 4JFIA 2AOSA 4S3KA 1C9HA 1FKTA 5HBFA 4TNSA 4KQZA 1E6PA 2ZQUA 3NRKA 1XRVA 3VAWA 1E6ZA 5HTGA 1KT0A 1FKDA 2DSVA 3O5IA 2G41A 4ODQA 3O5QA 3WD3A 2WK2A 1FAPA 1FJDA 5BXJA 1LG1A 1KFWA 3LUOA 4DRHA 1ROTA 3O5EA 1RD6A 4QT2A 2DT3A 2XP4A 4IT6A 3O5OA 1NMWA 1ROUA 3B9AA 3UQAA 2XP3A 1QZ2A 3ARZA 1ZBWA 1U79A 4ODLA 2DT2A 2RURA 4TYOA 4FAPA 4ITZA 1FKRA 1W26A 1H0IA 1EQ3A 3UQBA 1O6IA 3JXVA 2YBTA 4DT4A 1HKIA 4HBEA 2A3CA 5HWBA 1NH6A 4ZPWR 3TCZA 1GPFA 2KE0A 3B7XA 3PRAA 2XP6A 1NWSA 4LGXA 1B6CA 1UR8A 3O5LA 3O5MA 3PA7A 4J4OA 4Z2KA 5HUAA 1M5YA 1FFRA 2MLXA 1NMVA 2KFWA 1QPFA 4W9OA 1E6NA 1EHNA 5HT1A 3O5KA 2KO7A 3KAGA 3WD1A 1D2KA 3BXWA 1FKSA 2O92A 4W9QA 2DSUA 1Q6HA 2ESCA 1EIBA 4QIBA 2DT1A 4L72B 2M2AA 4DROA 1FKFA 3FAPA 4NSBA 2DSWA 1TCOC 1TFVA 5D75A 2ZQTA 2IUZA 1N1AA 3NI6A 2FKEA 4QT3A 1ZL1A 5GPRA 5DITA 2KGJA 2MLZA 1X6NA 1JNEA 4DRQA 3KAFA 1LL6A 3B9EA 5DEZA 1E9LA 4Z2GA 2F2DA 3CGMA 1Y0OA 3IKGA 5DF0A 4IPXA 1A7XA 2RUQA 4DRKA 4N19A 1K9TA 3ARSA 1HKMA 2MPHA 4LAXA 1HXVA 1W1TA 3JYMA 4P8WA 4DRIA 2G8ZA 4DRJA 1WAWA 1E6RA 2RQSA 4ODMA 2K8IA 3ARYA 4JYSA 1J6YA 1UR9A 3PR9A 1T11A 4LAVA 1BL4A 2PV3A 4JFMA 2A3EA 3WD4A 4U86A 5HWCA 4DIPA 1W9PA 1LG2A 1BKFA 2ZR5A 3O5RA 4XAKA 4IQ2A 2PPNA 1HJWA 3QOKA 3W4RA 1LL4A 2N87A 5I98A 4ODNA 4DH0A 4TX0A 1OWQA 4DRMA 5HKGA 4P8XA 3GPKA 2A3BA 3CHCA 2WLZA 2DPEA 4FN2A 4U85A 4URIA 1W1YA 4MNJA 1W1PA 2AWGA 2B31A 4MAVA 1L1PA 2LPVA 4O2TA 2KR7A 4Z2HA 3ARXA 3WL0A 2F21A 4MNLA 1JNDA 1LQ0A 2XP9A 4NZCA 3O5JA 4HBOA 3UI4A 1PINA 2DSZA 4MGVA 3WQVA 1IX5A 2WM0A 2ZR4A 1Q1CA 3RM4A 5GPGA 2Q5AA 2ZR6A 3UI6A 3RGCA 1HKJA 2RSEA 1J4IA 2PV1A 1R9HA 3ARWA 1NWRA 3CHFA 1PBKA 3CHDA 2ZQVA 2DG3A 1HJVA 2RUDA 3B9DA 2DT0A 1Q6IA 1KT1A 1GUVA 3CH9A 3IK8A 3CZ8A 2ITKA 2ZQSA 5DO2A 1WB0A 4GIVA 2OFNA 1NWTA 4P8VA 4DWSB 4Z2JA 3RFWA 2M1IA 4W5UA 1FKKA 2D9FA 3KABA 3RM9A 5JH8A 1OGBA 4ODRA 3UQIA 2LKNA 4MNMA 3WD2A 1NSGA 3KCEA 4IT4A 1OGGA 2XPAA 4LAWA 4DRPA 4HARA 1ZK6A 4MPKA 4NNRA 4R5EA 2PI6A 3ARQA 1E15A 3ODKA 3G6MA 3WL1A 4ZS6A 3KZ7A 2PV2A 2DG4A 4Z2LA 1FFQA 1JNTA 1ZBCA 4S3JA 1W9VA 3PRBA 1X6LA 2MLYA 3PRDA 4WKFA 4JFJA 4MTVA 4TW6A 5B8IC 1YATA 1Q6UA 1JVWA 3WIJA 4IQCA 3ALGA 4ZPVR 4R0XA 2M08A 4ODPA 2MNTA 1LJYA 1W9UA 3KADA 4TW8A 5HW7A 3CGNA 1P5QA 1D7JA 4DWSC 3OA5A 3KAIA 3UI5A 1FKLA 3WQWA 4J4NA 1SR0A 3IKDA 4WJXA 4L3NA 2VN1A 3ARUA 3WKZA 4U84A 4LAYA 1FD9A 1J4RA 4AY1A 5J6EA 1W1VA 3AQUA 2QF8A 1QPLA 4WIWA 2Y78A 4DWSD 3ARTA 2FAPA 1ZBVA 2JZVA 1NWUA 2LJ4A 4WKAA 1FKBA 1JNSA 4Z2IA 2VCDA 4G50A 4ODOA 2PPPA 4W9PA 3JYJA 4WKHA 3TDBA 4DRNA 1D6OA 3WH0A 4Q7NA 4TW7A 1GOIA 2PBCA 2KI3A 5HW8A 2YBUA 4ZPTR 4DZ3A 2A3AA 4BF8A 3O5PA 3G6LA 3B8SA 4ML4A 3OOBA 2IF4A 3O5DA 5GQBA 1YW5A 3H9RB 1ZCNA 1ZB5A 4MSPA 1VF8A 1LL7A 1EDQA 4JFLA 4MNKA 3RMEA 1FKJA 3O5FA 4ODKA 3FXYA 2O9OA 3RM8A 3FY1A 3AROA 3NTPA 4P8UA 1ZU8A 3KACA 1F40A 1ZBKA 2UZ5A 3AS2A 2MF9A 3O5GA 4DWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPO A;  1JNT A;  1BKF A;  2ZR5 A;  3O5R A;  3I6C A;  3PRB A;  3TCZ A;  2MLY A;  2KE0 A;  2PPN A;  4IQ2 A;  3EY6 A;  3B7X A;  2XP6 A;  3PRD A;  5HW6 A;  4JFJ A;  4TW6 A;  5B8I C;  1YAT A;  1B6C A;  3O5L A;  5DIV A;  4JFK A;  2N87 A;  1Q6U A;  1JVW A;  5I98 A;  3O5M A;  2L2S A;  3PA7 A;  4IQC A;  4J4O A;  4ODN A;  4DH0 A;  5HUA A;  3KAH A;  1M5Y A;  4TX0 A;  2MLX A;  2DG9 A;  1NMV A;  2LGO A;  2M08 A;  2RUC A;  4R0X A;  4DRM A;  4DZ2 A;  4ODP A;  3GPK A;  2MNT A;  5HKG A;  3MDY B;  4G2P A;  2KFW A;  3KAD A;  1QPF A;  4TW8 A;  5HW7 A;  3CGN A;  2XP7 A;  1F8A B;  4W9O A;  1P5Q A;  4FN2 A;  3TC5 A;  1D7J A;  4U85 A;  2F4E A;  5HT1 A;  1D7I A;  3UF8 A;  3IHZ A;  2AWG A;  1FKH A;  2XP5 A;  3KAI A;  3O5K A;  3UI5 A;  2KO7 A;  1FKL A;  2XP8 A;  4J4N A;  3KAG A;  3IKD A;  1L1P A;  1FKS A;  2VN1 A;  4W9Q A;  4U84 A;  2LPV A;  4LAY A;  1Q6H A;  4O2T A;  1FD9 A;  1FKI A;  4QIB A;  1J4R A;  2KR7 A;  1FKG A;  2XPB A;  4GGQ A;  2M2A A;  5J6E A;  2F21 A;  1J4H A;  1D7H A;  2XP9 A;  1EYM A;  3O5J A;  4DRO A;  1FKF A;  2PV2 A;  1QPL A;  3UI4 A;  1PIN A;  4C02 B;  3O5G A;  4MGV A;  3FAP A;  5DIU A;  2ZR4 A;  1Q1C A;  1TCO C;  4JFI A;  2Y78 A;  5D75 A;  1C9H A;  1FKT A;  2ZQT A;  2FAP A;  5GPG A;  2Q5A A;  2JZV A;  1N1A A;  4TNS A;  2ZR6 A;  3UI6 A;  3NI6 A;  3RGC A;  2FKE A;  2RSE A;  2ZQU A;  1J4I A;  3NRK A;  4QT3 A;  3VAW A;  5DIT A;  5HTG A;  2PV1 A;  2LJ4 A;  1R9H A;  1FKB A;  1KT0 A;  1FKD A;  1JNS A;  2KGJ A;  2VCD A;  4G50 A;  1PBK A;  2MLZ A;  2PPP A;  3O5I A;  4ODO A;  2ZQV A;  2DG3 A;  4ODQ A;  2RUD A;  4W9P A;  3JYJ A;  4DRQ A;  3O5Q A;  1Q6I A;  3KAF A;  1KT1 A;  3TDB A;  4DRN A;  1D6O A;  1FAP A;  3IK8 A;  1FJD A;  5BXJ A;  2ITK A;  3WH0 A;  2F2D A;  2ZQS A;  3CGM A;  1Y0O A;  3IKG A;  3LUO A;  4TW7 A;  4DRH A;  4IPX A;  1A7X A;  1ROT A;  2PBC A;  2RUQ A;  2KI3 A;  3O5E A;  4DRK A;  5HW8 A;  4N19 A;  4QT2 A;  4GIV A;  2XP4 A;  4DZ3 A;  2OFN A;  2MPH A;  4LAX A;  1HXV A;  4BF8 A;  3JYM A;  3O5P A;  3RFW A;  2M1I A;  3O5O A;  2IF4 A;  3OOB A;  1FKK A;  3O5D A;  1YW5 A;  2D9F A;  3H9R B;  1ZCN A;  4DRI A;  1NMW A;  4DRJ A;  3KAB A;  1ROU A;  2RQS A;  4MSP A;  4ODR A;  3UQA A;  2XP3 A;  1QZ2 A;  4ODM A;  3UQI A;  2LKN A;  4JFL A;  2K8I A;  1U79 A;  1FKJ A;  1NSG A;  3KCE A;  4ODL A;  3O5F A;  4ODK A;  4JYS A;  2RUR A;  1J6Y A;  2XPA A;  4TYO A;  1T11 A;  4LAW A;  4FAP A;  4LAV A;  4ITZ A;  1BL4 A;  3NTP A;  1W26 A;  2PV3 A;  4DRP A;  1FKR A;  1ZK6 A;  4JFM A;  3UQB A;  3JXV A;  4NNR A;  1EQ3 A;  3KAC A;  4DT4 A;  1F40 A;  4U86 A;  2UZ5 A;  3ODK A;  5HWC A;  4DIP A;  2MF9 A;  3KZ7 A;  2DG4 A;  5HWB A; 
#chains in the Genus database with same CATH topology
 2PPO A;  3AS3 A;  1WNO A;  3I6C A;  4KR0 B;  3EY6 A;  5HW6 A;  1HJX A;  3ARR A;  1SYT A;  3AS0 A;  5DIV A;  4JFK A;  2L2S A;  2WLY A;  4WK9 A;  3KAH A;  4PTM A;  2DG9 A;  2LGO A;  2RUC A;  4DZ2 A;  1GRJ A;  4Q22 A;  3MDY B;  4G2P A;  3AS1 A;  1HKK A;  2XP7 A;  1F8A B;  3TC5 A;  3EIP A;  3ARV A;  3ARP A;  2F4E A;  1D7I A;  3CHE A;  3UF8 A;  3IHZ A;  3WD0 A;  2XP5 A;  1FKH A;  3ALF A;  2XP8 A;  1XHG A;  1H0G A;  2FDM A;  1CTN A;  1FKI A;  1FKG A;  1ITX A;  2XPB A;  4GGQ A;  2ETN A;  1J4H A;  1D7H A;  1EYM A;  4C02 B;  2OLH A;  4QZV B;  5DIU A;  4JFI A;  2AOS A;  4S3K A;  1C9H A;  1FKT A;  5HBF A;  4TNS A;  4KQZ A;  1E6P A;  2ZQU A;  3NRK A;  1XRV A;  3VAW A;  1E6Z A;  5HTG A;  1KT0 A;  1FKD A;  2DSV A;  3O5I A;  2G41 A;  4ODQ A;  3O5Q A;  3WD3 A;  2WK2 A;  1FAP A;  1FJD A;  5BXJ A;  1LG1 A;  1KFW A;  3LUO A;  4DRH A;  1ROT A;  3O5E A;  1RD6 A;  4QT2 A;  2DT3 A;  2XP4 A;  4IT6 A;  3O5O A;  1NMW A;  1ROU A;  3B9A A;  3UQA A;  2XP3 A;  1QZ2 A;  3ARZ A;  1ZBW A;  1U79 A;  4ODL A;  2DT2 A;  2RUR A;  4TYO A;  4FAP A;  4ITZ A;  1FKR A;  1W26 A;  1H0I A;  1EQ3 A;  3UQB A;  1O6I A;  3JXV A;  2YBT A;  4DT4 A;  1HKI A;  4HBE A;  2A3C A;  5HWB A;  1NH6 A;  4ZPW R;  3TCZ A;  1GPF A;  2KE0 A;  3B7X A;  3PRA A;  2XP6 A;  1NWS A;  4LGX A;  1B6C A;  1UR8 A;  3O5L A;  3O5M A;  3PA7 A;  4J4O A;  4Z2K A;  5HUA A;  1M5Y A;  1FFR A;  2MLX A;  1NMV A;  2KFW A;  1QPF A;  4W9O A;  1E6N A;  1EHN A;  5HT1 A;  3O5K A;  2KO7 A;  3KAG A;  3WD1 A;  1D2K A;  3BXW A;  1FKS A;  2O92 A;  4W9Q A;  2DSU A;  1Q6H A;  2ESC A;  1EIB A;  4QIB A;  2DT1 A;  4L72 B;  2M2A A;  4DRO A;  1FKF A;  4UDM A;  3FAP A;  4NSB A;  2DSW A;  1TCO C;  1TFV A;  5D75 A;  2ZQT A;  2IUZ A;  1N1A A;  3NI6 A;  2FKE A;  4QT3 A;  1ZL1 A;  5GPR A;  5DIT A;  2KGJ A;  2MLZ A;  1X6N A;  1JNE A;  4DRQ A;  3KAF A;  1LL6 A;  3B9E A;  5DEZ A;  1E9L A;  4Z2G A;  2F2D A;  3CGM A;  1Y0O A;  3IKG A;  5DF0 A;  4IPX A;  1A7X A;  2RUQ A;  4DRK A;  4N19 A;  1K9T A;  3ARS A;  1HKM A;  2MPH A;  4LAX A;  1HXV A;  1W1T A;  3JYM A;  4P8W A;  4DRI A;  2G8Z A;  4DRJ A;  1WAW A;  1E6R A;  2RQS A;  4ODM A;  2K8I A;  3ARY A;  4JYS A;  1J6Y A;  1UR9 A;  3PR9 A;  1T11 A;  4LAV A;  1BL4 A;  2PV3 A;  4JFM A;  2A3E A;  3WD4 A;  4U86 A;  5HWC A;  4DIP A;  3GTY X;  1W9P A;  1LG2 A;  1BKF A;  2ZR5 A;  3O5R A;  4XAK A;  4IQ2 A;  2PPN A;  1HJW A;  3QOK A;  3W4R A;  1LL4 A;  2N87 A;  2B5U B;  5I98 A;  4ODN A;  4DH0 A;  4TX0 A;  1OWQ A;  4DRM A;  5HKG A;  4P8X A;  3GPK A;  2A3B A;  3CHC A;  2WLZ A;  2DPE A;  4FN2 A;  4U85 A;  4URI A;  1W1Y A;  4MNJ A;  1W1P A;  2AWG A;  2B31 A;  4MAV A;  1L1P A;  2LPV A;  3GU0 A;  4O2T A;  2KR7 A;  4Z2H A;  3ARX A;  2P4V A;  3WL0 A;  2F21 A;  4MNL A;  1JND A;  1LQ0 A;  2XP9 A;  4NZC A;  3O5J A;  4HBO A;  3UI4 A;  1PIN A;  2DSZ A;  4MGV A;  3WQV A;  1IX5 A;  2WM0 A;  2ZR4 A;  1Q1C A;  3RM4 A;  5GPG A;  2Q5A A;  2ZR6 A;  3UI6 A;  3RGC A;  1HKJ A;  2RSE A;  1J4I A;  2PN0 A;  2PV1 A;  1R9H A;  3ARW A;  1NWR A;  3CHF A;  1PBK A;  3CHD A;  2ZQV A;  2DG3 A;  1HJV A;  2RUD A;  3B9D A;  2DT0 A;  1Q6I A;  1KT1 A;  1GUV A;  3CH9 A;  3IK8 A;  3CZ8 A;  2ITK A;  2ZQS A;  5DO2 A;  1WB0 A;  4GIV A;  2OFN A;  1NWT A;  4P8V A;  4DWS B;  4Z2J A;  3RFW A;  2M1I A;  4W5U A;  1FKK A;  2D9F A;  3KAB A;  3RM9 A;  5JH8 A;  1OGB A;  4ODR A;  3UQI A;  2LKN A;  4MNM A;  3WD2 A;  1NSG A;  3KCE A;  4IT4 A;  2F23 A;  1OGG A;  2XPA A;  4LAW A;  4DRP A;  4HAR A;  1ZK6 A;  4MPK A;  4NNR A;  4R5E A;  2PI6 A;  3ARQ A;  1E15 A;  3ODK A;  3G6M A;  3WL1 A;  4ZS6 A;  3KZ7 A;  2PV2 A;  2DG4 A;  4Z2L A;  1FFQ A;  1JNT A;  1ZBC A;  4S3J A;  1W9V A;  1JCH B;  3PRB A;  1X6L A;  2MLY A;  3PRD A;  4WKF A;  4JFJ A;  4MTV A;  4TW6 A;  5B8I C;  1YAT A;  1Q6U A;  1JVW A;  3WIJ A;  4IQC A;  3ALG A;  4ZPV R;  4R0X A;  2M08 A;  4ODP A;  2MNT A;  1LJY A;  1W9U A;  3KAD A;  4TW8 A;  5HW7 A;  3CGN A;  1P5Q A;  1D7J A;  4DWS C;  3OA5 A;  3KAI A;  3UI5 A;  1FKL A;  3WQW A;  4J4N A;  1SR0 A;  3IKD A;  4WJX A;  4L3N A;  2VN1 A;  3ARU A;  3WKZ A;  4U84 A;  4LAY A;  1FD9 A;  1J4R A;  4AY1 A;  5J6E A;  1W1V A;  3AQU A;  2QF8 A;  1QPL A;  4WIW A;  2Y78 A;  3BMB A;  4DWS D;  3ART A;  2FAP A;  1ZBV A;  2JZV A;  1NWU A;  2LJ4 A;  4WKA A;  1FKB A;  1JNS A;  4Z2I A;  1E44 A;  2VCD A;  2EUL A;  4G50 A;  4ODO A;  2PPP A;  4W9P A;  3JYJ A;  4WKH A;  3TDB A;  4DRN A;  1D6O A;  3WH0 A;  4Q7N A;  4TW7 A;  1GOI A;  2PBC A;  2KI3 A;  5HW8 A;  2YBU A;  4ZPT R;  4DZ3 A;  2A3A A;  4BF8 A;  3O5P A;  3G6L A;  3B8S A;  4ML4 A;  3OOB A;  2IF4 A;  3O5D A;  5GQB A;  1YW5 A;  3H9R B;  1ZCN A;  1ZB5 A;  4MSP A;  1VF8 A;  1LL7 A;  1EDQ A;  4JFL A;  4MNK A;  3RME A;  1FKJ A;  3O5F A;  4ODK A;  3FXY A;  2O9O A;  3RM8 A;  3FY1 A;  3ARO A;  3NTP A;  4P8U A;  1ZU8 A;  3KAC A;  1F40 A;  1ZBK A;  2UZ5 A;  3AS2 A;  2MF9 A;  3O5G A;  4DWS A; 
#chains in the Genus database with same CATH homology
 2PPO A;  3AS3 A;  1WNO A;  3I6C A;  4KR0 B;  3EY6 A;  5HW6 A;  1HJX A;  3ARR A;  1SYT A;  3AS0 A;  5DIV A;  4JFK A;  2L2S A;  2WLY A;  4WK9 A;  3KAH A;  4PTM A;  2DG9 A;  2LGO A;  2RUC A;  4DZ2 A;  4Q22 A;  3MDY B;  4G2P A;  3AS1 A;  1HKK A;  2XP7 A;  1F8A B;  3TC5 A;  3ARV A;  3ARP A;  2F4E A;  1D7I A;  3CHE A;  3UF8 A;  3IHZ A;  3WD0 A;  2XP5 A;  1FKH A;  3ALF A;  2XP8 A;  1XHG A;  1H0G A;  2FDM A;  1CTN A;  1FKI A;  1FKG A;  1ITX A;  2XPB A;  4GGQ A;  1J4H A;  1D7H A;  1EYM A;  4C02 B;  2OLH A;  4QZV B;  5DIU A;  4JFI A;  2AOS A;  4S3K A;  1C9H A;  1FKT A;  5HBF A;  4TNS A;  4KQZ A;  1E6P A;  2ZQU A;  3NRK A;  1XRV A;  3VAW A;  1E6Z A;  5HTG A;  1KT0 A;  1FKD A;  2DSV A;  3O5I A;  2G41 A;  4ODQ A;  3O5Q A;  3WD3 A;  2WK2 A;  1FAP A;  1FJD A;  5BXJ A;  1LG1 A;  1KFW A;  3LUO A;  4DRH A;  1ROT A;  3O5E A;  1RD6 A;  4QT2 A;  2DT3 A;  2XP4 A;  4IT6 A;  3O5O A;  1NMW A;  1ROU A;  3B9A A;  3UQA A;  2XP3 A;  1QZ2 A;  3ARZ A;  1ZBW A;  1U79 A;  4ODL A;  2DT2 A;  2RUR A;  4TYO A;  4FAP A;  4ITZ A;  1FKR A;  1W26 A;  1H0I A;  1EQ3 A;  3UQB A;  1O6I A;  3JXV A;  2YBT A;  4DT4 A;  1HKI A;  4HBE A;  2A3C A;  5HWB A;  1NH6 A;  4ZPW R;  3TCZ A;  1GPF A;  2KE0 A;  3B7X A;  3PRA A;  2XP6 A;  1NWS A;  4LGX A;  1B6C A;  1UR8 A;  3O5L A;  3O5M A;  3PA7 A;  4J4O A;  4Z2K A;  5HUA A;  1M5Y A;  1FFR A;  2MLX A;  1NMV A;  2KFW A;  1QPF A;  4W9O A;  1E6N A;  1EHN A;  5HT1 A;  3O5K A;  2KO7 A;  3KAG A;  3WD1 A;  1D2K A;  3BXW A;  1FKS A;  2O92 A;  4W9Q A;  2DSU A;  1Q6H A;  2ESC A;  1EIB A;  4QIB A;  2DT1 A;  4L72 B;  2M2A A;  4DRO A;  1FKF A;  3FAP A;  4NSB A;  2DSW A;  1TCO C;  1TFV A;  5D75 A;  2ZQT A;  2IUZ A;  1N1A A;  3NI6 A;  2FKE A;  4QT3 A;  1ZL1 A;  5GPR A;  5DIT A;  2KGJ A;  2MLZ A;  1X6N A;  1JNE A;  4DRQ A;  3KAF A;  1LL6 A;  3B9E A;  5DEZ A;  1E9L A;  4Z2G A;  2F2D A;  3CGM A;  1Y0O A;  3IKG A;  5DF0 A;  4IPX A;  1A7X A;  2RUQ A;  4DRK A;  4N19 A;  1K9T A;  3ARS A;  1HKM A;  2MPH A;  4LAX A;  1HXV A;  1W1T A;  3JYM A;  4P8W A;  4DRI A;  2G8Z A;  4DRJ A;  1WAW A;  1E6R A;  2RQS A;  4ODM A;  2K8I A;  3ARY A;  4JYS A;  1J6Y A;  1UR9 A;  3PR9 A;  1T11 A;  4LAV A;  1BL4 A;  2PV3 A;  4JFM A;  2A3E A;  3WD4 A;  4U86 A;  5HWC A;  4DIP A;  1W9P A;  1LG2 A;  1BKF A;  2ZR5 A;  3O5R A;  4XAK A;  4IQ2 A;  2PPN A;  1HJW A;  3QOK A;  3W4R A;  1LL4 A;  2N87 A;  5I98 A;  4ODN A;  4DH0 A;  4TX0 A;  1OWQ A;  4DRM A;  5HKG A;  4P8X A;  3GPK A;  2A3B A;  3CHC A;  2WLZ A;  2DPE A;  4FN2 A;  4U85 A;  4URI A;  1W1Y A;  4MNJ A;  1W1P A;  2AWG A;  2B31 A;  4MAV A;  1L1P A;  2LPV A;  4O2T A;  2KR7 A;  4Z2H A;  3ARX A;  3WL0 A;  2F21 A;  4MNL A;  1JND A;  1LQ0 A;  2XP9 A;  4NZC A;  3O5J A;  4HBO A;  3UI4 A;  1PIN A;  2DSZ A;  4MGV A;  3WQV A;  1IX5 A;  2WM0 A;  2ZR4 A;  1Q1C A;  3RM4 A;  5GPG A;  2Q5A A;  2ZR6 A;  3UI6 A;  3RGC A;  1HKJ A;  2RSE A;  1J4I A;  2PV1 A;  1R9H A;  3ARW A;  1NWR A;  3CHF A;  1PBK A;  3CHD A;  2ZQV A;  2DG3 A;  1HJV A;  2RUD A;  3B9D A;  2DT0 A;  1Q6I A;  1KT1 A;  1GUV A;  3CH9 A;  3IK8 A;  3CZ8 A;  2ITK A;  2ZQS A;  5DO2 A;  1WB0 A;  4GIV A;  2OFN A;  1NWT A;  4P8V A;  4DWS B;  4Z2J A;  3RFW A;  2M1I A;  4W5U A;  1FKK A;  2D9F A;  3KAB A;  3RM9 A;  5JH8 A;  1OGB A;  4ODR A;  3UQI A;  2LKN A;  4MNM A;  3WD2 A;  1NSG A;  3KCE A;  4IT4 A;  1OGG A;  2XPA A;  4LAW A;  4DRP A;  4HAR A;  1ZK6 A;  4MPK A;  4NNR A;  4R5E A;  2PI6 A;  3ARQ A;  1E15 A;  3ODK A;  3G6M A;  3WL1 A;  4ZS6 A;  3KZ7 A;  2PV2 A;  2DG4 A;  4Z2L A;  1FFQ A;  1JNT A;  1ZBC A;  4S3J A;  1W9V A;  3PRB A;  1X6L A;  2MLY A;  3PRD A;  4WKF A;  4JFJ A;  4MTV A;  4TW6 A;  5B8I C;  1YAT A;  1Q6U A;  1JVW A;  3WIJ A;  4IQC A;  3ALG A;  4ZPV R;  4R0X A;  2M08 A;  4ODP A;  2MNT A;  1LJY A;  1W9U A;  3KAD A;  4TW8 A;  5HW7 A;  3CGN A;  1P5Q A;  1D7J A;  4DWS C;  3OA5 A;  3KAI A;  3UI5 A;  1FKL A;  3WQW A;  4J4N A;  1SR0 A;  3IKD A;  4WJX A;  4L3N A;  2VN1 A;  3ARU A;  3WKZ A;  4U84 A;  4LAY A;  1FD9 A;  1J4R A;  4AY1 A;  5J6E A;  1W1V A;  3AQU A;  2QF8 A;  1QPL A;  4WIW A;  2Y78 A;  4DWS D;  3ART A;  2FAP A;  1ZBV A;  2JZV A;  1NWU A;  2LJ4 A;  4WKA A;  1FKB A;  1JNS A;  4Z2I A;  2VCD A;  4G50 A;  4ODO A;  2PPP A;  4W9P A;  3JYJ A;  4WKH A;  3TDB A;  4DRN A;  1D6O A;  3WH0 A;  4Q7N A;  4TW7 A;  1GOI A;  2PBC A;  2KI3 A;  5HW8 A;  2YBU A;  4ZPT R;  4DZ3 A;  2A3A A;  4BF8 A;  3O5P A;  3G6L A;  3B8S A;  4ML4 A;  3OOB A;  2IF4 A;  3O5D A;  5GQB A;  1YW5 A;  3H9R B;  1ZCN A;  1ZB5 A;  4MSP A;  1VF8 A;  1LL7 A;  1EDQ A;  4JFL A;  4MNK A;  3RME A;  1FKJ A;  3O5F A;  4ODK A;  3FXY A;  2O9O A;  3RM8 A;  3FY1 A;  3ARO A;  3NTP A;  4P8U A;  1ZU8 A;  3KAC A;  1F40 A;  1ZBK A;  2UZ5 A;  3AS2 A;  2MF9 A;  3O5G A;  4DWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...