2UZ5A

Solution structure of the fkbp-domain of legionella pneumophila mip
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
137
structure length
137
Chain Sequence
FNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain Motions of the Mip Protein from Legionella Pneumophila
pubmed doi rcsb
molecule tags Isomerase
molecule keywords MACROPHAGE INFECTIVITY POTENTIATOR
total genus 22
structure length 137
sequence length 137
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2uz5A02
1FKIA 3O5QA 2KR7A 2RUDA 1N1AA 1ZCNA 2DG3A 2XP9A 1J4IA 4IQCA 4DT4A 4TNSA 4GGQA 4LAWA 3IKGA 3NTPA 2LPVA 4ODRA 4JFIA 3O5MA 2PV3A 4G2PA 2PV2A 1Q6HA 2F21A 4TW8A 4NNRA 1B6CA 3PA7A 2VCDA 5DITA 1W26A 3O5JA 1FD9A 2KE0A 1FKDA 4W9OA 1T11A 4DRIA 1F40A 1EYMA 2ITKA 3JYJA 4J4OA 2MLZA 1YW5A 3JYMA 4J4NA 3RFWA 2OFNA 3KZ7A 4FN2A 3UI6A 3VAWA 4DROA 1QPFA 4BF8A 1D7IA 1BL4A 4JFLA 3KACA 4TX0A 2AWGA 1L1PA 3TCZA 3O5DA 1FKSA 1FKTA 4LAXA 4FAPA 3KAIA 2ZQSA 4DRPA 4DRKA 2PPOA 4MSPA 5I98A 3KAHA 4GIVA 3O5EA 5BXJA 2FAPA 1NMWA 3WH0A 1Q1CA 2KO7A 4DRQA 2XPBA 3KADA 4DIPA 1F8AB 1QPLA 5DIUA 1Y0OA 4N19A 4DH0A 1BKFA 3O5PA 2LGOA 2MF9A 4ODQA 1R9HA 3JXVA 2ZQVA 3KCEA 3ODKA 1FKLA 1FKKA 3NI6A 4TW7A 4W9PA 3O5OA 3EY6A 4TYOA 5HUAA 3IK8A 3LUOA 1JNTA 5B8IC 4C02B 3KAGA 2MLYA 4LAYA 4MGVA 4U84A 2XP6A 2RUCA 5HWCA 1YATA 1HXVA 3KAFA 2DG9A 2RQSA 4W9QA 3TDBA 2JZVA 4ODLA 2XP4A 3CGNA 1KT0A 5D75A 2LKNA 3MDYB 2UZ5A 1QZ2A 2XP7A 4ODOA 3UQIA 1M5YA 1FKHA 2VN1A 2FKEA 2MLXA 3UI4A 1FKJA 5HT1A 2RSEA 4TW6A 5HW7A 1EQ3A 4ODPA 2XPAA 3O5LA 3O5RA 3KABA 2L2SA 5HKGA 5DIVA 3UQBA 5J6EA 2D9FA 2PBCA 2KFWA 2PPPA 4IPXA 1D7JA 1PBKA 4ITZA 4ODNA 4QT2A 1KT1A 1J6YA 4DZ3A 1FKRA 1J4HA 3TC5A 3OOBA 2DG4A 1PINA 3RGCA 4QIBA 1J4RA 1NMVA 2KGJA 1C9HA 1FKBA 1FKGA 3O5GA 4JYSA 3O5IA 1D7HA 4JFJA 2Y78A 4U85A 2XP3A 1FAPA 2ZR4A 1FJDA 3PRDA 3UQAA 1JNSA 4IQ2A 2ZR5A 3H9RB 2IF4A 3I6CA 1ROUA 1U79A 2MNTA 1Q6UA 4ODKA 4DRJA 2F4EA 2XP5A 2RURA 3O5KA 3B7XA 2Q5AA 1NSGA 4R0XA 2K8IA 4U86A 4DRMA 4DRHA 2PV1A 2ZQUA 3IKDA 4ODMA 2KI3A 2XP8A 3NRKA 1ZK6A 2M1IA 3PRBA 4QT3A 4DRNA 5HW8A 2MPHA 1TCOC 1Q6IA 2RUQA 3CGMA 3O5FA 5GPGA 1D6OA 1JVWA 2ZR6A 3FAPA 2N87A 3UF8A 3UI5A 4DZ2A 5HW6A 3IHZA 1A7XA 2M2AA 4LAVA 4JFMA 1FKFA 3GPKA 1ROTA 2PPNA 2ZQTA 1P5QA 2M08A 4G50A 4JFKA 4O2TA 5HWBA 2F2DA 2LJ4A 5HTGA
chains in the Genus database with same CATH superfamily
2G41A 1ZBKA 4DT4A 4ODRA 2PV3A 3B9DA 4MNMA 1B6CA 1NWTA 5DITA 4MNLA 4DWSD 1EHNA 1F40A 1EYMA 2ITKA 4J4OA 2MLZA 4J4NA 3UI6A 3VAWA 1OWQA 3WIJA 4Z2IA 3O5DA 4DRPA 4DRKA 5I98A 3KAHA 4GIVA 3O5EA 3AROA 3WH0A 3KADA 5DIUA 1W1VA 4AY1A 4TW7A 4WKAA 4W9PA 4TYOA 1ZBWA 4DWSC 3WD1A 2PN0A 4MGVA 3B9EA 3RM9A 4L72B 1YATA 1HXVA 3TDBA 1H0GA 4HBOA 3UI4A 5HW7A 1EQ3A 4TW6A 4Z2GA 1W9VA 4P8VA 5HKGA 3EIPA 2D9FA 2PBCA 2PPPA 1D7JA 2YBUA 4ITZA 1KT1A 1J6YA 2DPEA 1HJXA 1ZBVA 2DG4A 1NMVA 1LG2A 3O5GA 4JYSA 1FFQA 4WK9A 1D7HA 4L3NA 4U85A 2AOSA 1HJWA 3WD2A 5DO2A 1Q6UA 4MNKA 4ODKA 2WK2A 4URIA 1ITXA 3G6MA 3O5KA 1HKKA 3B7XA 3WD0A 2K8IA 1LG1A 1JNEA 2KI3A 3PRBA 4ZPTR 4QT3A 1Q6IA 5GPGA 3FAPA 3UF8A 2N87A 3UI5A 1W9UA 5HW6A 1A7XA 2M2AA 3GPKA 1ROTA 2PPNA 4G50A 5HWBA 4O2TA 3IK8A 2LJ4A 2G8ZA 1LQ0A 3ALFA 4IQCA 4TNSA 4GGQA 4LAWA 3NTPA 4JFIA 4G2PA 1WNOA 2F21A 3RM8A 4Z2LA 1W1TA 1W26A 1FD9A 4DRIA 1X6NA 4W9OA 1LL6A 4DROA 3JYMA 3CHDA 3KZ7A 3RFWA 4TX0A 3KACA 2AWGA 4NZCA 4P8UA 1L1PA 3QOKA 2PPOA 4WJXA 2FAPA 1NMWA 2O9OA 2OLHA 1E15A 1SYTA 1F8AB 4DIPA 1Y0OA 4N19A 3O5PA 2MF9A 1R9HA 3JXVA 4LGXA 3ODKA 1FKLA 3NI6A 1EIBA 3AS2A 5HWCA 3KAFA 4W9QA 2XP4A 3CGNA 5GPRA 3UQAA 3UQIA 2VN1A 1FKHA 2FKEA 2MLXA 1NWSA 3GTYX 2A3AA 3O5LA 3O5RA 1E44A 2DT3A 1GRJA 4Z2HA 2KFWA 4DZ3A 1J4HA 4S3JA 3G6LA 3RGCA 1C9HA 4JFJA 2XP3A 1FFRA 4W5UA 4R5EA 1JNSA 1LL4A 2ESCA 4DWSA 3ARWA 2O92A 3BXWA 3W4RA 3RM4A 4DRJA 2RURA 4MAVA 3ARSA 2A3CA 1ZU8A 3CHEA 3CH9A 4R0XA 1W1PA 2PV1A 2ZQUA 3ARUA 1ZK6A 2RUQA 3AS1A 2ZR6A 1GPFA 3AQUA 1VF8A 2DSZA 3IHZA 4Q7NA 3ARYA 4LAVA 1RD6A 4JFKA 1P5QA 2M08A 4XAKA 3CHCA 5GQBA 1E6ZA 4KR0B 1N1AA 1ZCNA 2P4VA 4ML4A 5HBFA 2LPVA 1Q6HA 4TW8A 3PA7A 1EDQA 3O5JA 3JYJA 1X6LA 4FN2A 1LL7A 1E6RA 1LJYA 1W1YA 1NWRA 1FKTA 4FAPA 4MSPA 4DWSB 4QZVB 5BXJA 2PI6A 4MTVA 1Q1CA 2KO7A 4DRQA 2XPBA 3ARVA 4UDMA 4DH0A 3WD4A 1SR0A 2WLYA 2FDMA 1FKKA 4WIWA 3O5OA 3AS3A 4ZS6A 5DEZA 1NH6A 3LUOA 1JNTA 5B8IC 3KAGA 3B9AA 1NWUA 4NSBA 4U84A 3PRAA 1K9TA 2RQSA 1IX5A 2JZVA 2LKNA 2UZ5A 1QZ2A 2XP7A 4ODOA 1M5YA 2DT2A 3B8SA 1FKJA 4P8XA 4ODPA 2XPAA 2L2SA 1GOIA 5JH8A 5J6EA 4Z2JA 4IPXA 4ODNA 4QT2A 1FKRA 3GU0A 3TC5A 4QIBA 1E6PA 2DT0A 4Z2KA 1FKBA 2IUZA 3WQVA 1FAPA 2ZR4A 1FJDA 4IT4A 3PRDA 1ZBCA 1XRVA 2F23A 3H9RB 2IF4A 3I6CA 1U79A 3FY1A 2F4EA 2XP5A 2Q5AA 1HJVA 1HKMA 3WL1A 2EULA 4ODMA 1OGGA 2XP8A 3NRKA 1JNDA 1TCOC 4P8WA 1D6OA 1XHGA 4KQZA 4WKFA 1WAWA 5HTGA 1FKIA 3BMBA 2KR7A 2RUDA 3O5QA 2DG3A 2XP9A 1J4IA 1WB0A 3IKGA 2DSUA 3O5MA 2PV2A 2DT1A 4NNRA 2VCDA 2ETNA 3ARQA 2KE0A 1FKDA 1T11A 1YW5A 3WL0A 2OFNA 1QPFA 4BF8A 1D7IA 1BL4A 4JFLA 2DSWA 3TCZA 1FKSA 2YBTA 4LAXA 3KAIA 2ZQSA 3OA5A 2A3EA 1OGBA 1QPLA 1BKFA 4WKHA 2LGOA 4ODQA 2ZQVA 3KCEA 2WLZA 3EY6A 5HUAA 4HARA 1HKIA 4C02B 2MLYA 4LAYA 2XP6A 2RUCA 1UR9A 2DG9A 4ODLA 1KT0A 5D75A 1H0IA 3MDYB 5HT1A 2RSEA 1ZB5A 2B31A 3CHFA 1D2KA 2A3BA 1UR8A 3KABA 1E9LA 1KFWA 5DIVA 3ARRA 3UQBA 1CTNA 1PBKA 3ARPA 2B5UB 3OOBA 1PINA 1J4RA 2KGJA 1FKGA 4Q22A 3O5IA 2Y78A 1HKJA 3ALGA 2DSVA 3PR9A 4IQ2A 4S3KA 2ZR5A 3FXYA 3ARZA 1ROUA 4IT6A 4MPKA 1E6NA 2MNTA 1GUVA 1ZL1A 4PTMA 3WQWA 4ZPWR 1W9PA 1NSGA 3AS0A 4U86A 4DRMA 4DRHA 4HBEA 4MNJA 3IKDA 5DF0A 4ZPVR 3ARXA 2M1IA 4DRNA 2QF8A 5HW8A 2MPHA 3WD3A 3CGMA 3O5FA 1JVWA 4DZ2A 2WM0A 1JCHB 3WKZA 1TFVA 4JFMA 3ARTA 1FKFA 1O6IA 2ZQTA 3CZ8A 3RMEA 2F2DA
chains in the Genus database with same CATH topology
2G41A 1ZBKA 4DT4A 4ODRA 2PV3A 3B9DA 4MNMA 1B6CA 1NWTA 5DITA 4MNLA 4DWSD 1EHNA 1F40A 1EYMA 2ITKA 4J4OA 2MLZA 4J4NA 3UI6A 3VAWA 1OWQA 3WIJA 4Z2IA 3O5DA 4DRPA 4DRKA 5I98A 3KAHA 4GIVA 3O5EA 3AROA 3WH0A 3KADA 5DIUA 1W1VA 4AY1A 4TW7A 4WKAA 4W9PA 4TYOA 1ZBWA 4DWSC 3WD1A 4MGVA 3B9EA 3RM9A 4L72B 1YATA 1HXVA 3TDBA 1H0GA 4HBOA 3UI4A 5HW7A 1EQ3A 4TW6A 4Z2GA 1W9VA 4P8VA 5HKGA 2D9FA 2PBCA 2PPPA 1D7JA 2YBUA 4ITZA 1KT1A 1J6YA 2DPEA 1HJXA 1ZBVA 2DG4A 1NMVA 1LG2A 3O5GA 4JYSA 1FFQA 4WK9A 1D7HA 4L3NA 4U85A 2AOSA 1HJWA 3WD2A 5DO2A 1Q6UA 4MNKA 4ODKA 2WK2A 4URIA 1ITXA 3G6MA 3O5KA 1HKKA 3B7XA 3WD0A 2K8IA 1LG1A 1JNEA 2KI3A 3PRBA 4ZPTR 4QT3A 1Q6IA 5GPGA 3FAPA 3UF8A 2N87A 3UI5A 1W9UA 5HW6A 1A7XA 2M2AA 3GPKA 1ROTA 2PPNA 4G50A 5HWBA 4O2TA 3IK8A 2LJ4A 2G8ZA 1LQ0A 3ALFA 4IQCA 4TNSA 4GGQA 4LAWA 3NTPA 4JFIA 4G2PA 1WNOA 2F21A 3RM8A 4Z2LA 1W1TA 1W26A 1FD9A 4DRIA 1X6NA 4W9OA 1LL6A 4DROA 3JYMA 3CHDA 3KZ7A 3RFWA 4TX0A 3KACA 2AWGA 4NZCA 4P8UA 1L1PA 3QOKA 2PPOA 4WJXA 2FAPA 1NMWA 2O9OA 2OLHA 1E15A 1SYTA 1F8AB 4DIPA 1Y0OA 4N19A 3O5PA 2MF9A 1R9HA 3JXVA 4LGXA 3ODKA 1FKLA 3NI6A 1EIBA 3AS2A 5HWCA 3KAFA 4W9QA 2XP4A 3CGNA 5GPRA 3UQAA 3UQIA 2VN1A 1FKHA 2FKEA 2MLXA 1NWSA 2A3AA 3O5LA 3O5RA 2DT3A 4Z2HA 2KFWA 4DZ3A 1J4HA 4S3JA 3G6LA 3RGCA 1C9HA 4JFJA 2XP3A 1FFRA 4W5UA 4R5EA 1JNSA 1LL4A 2ESCA 4DWSA 3ARWA 2O92A 3BXWA 3W4RA 3RM4A 4DRJA 2RURA 4MAVA 3ARSA 2A3CA 1ZU8A 3CHEA 3CH9A 4R0XA 1W1PA 2PV1A 2ZQUA 3ARUA 1ZK6A 2RUQA 3AS1A 2ZR6A 1GPFA 3AQUA 1VF8A 2DSZA 3IHZA 4Q7NA 3ARYA 4LAVA 1RD6A 4JFKA 1P5QA 2M08A 4XAKA 3CHCA 5GQBA 1E6ZA 4KR0B 1N1AA 1ZCNA 4ML4A 5HBFA 2LPVA 1Q6HA 4TW8A 3PA7A 1EDQA 3O5JA 3JYJA 1X6LA 4FN2A 1LL7A 1E6RA 1LJYA 1W1YA 1FKTA 1NWRA 4FAPA 4MSPA 4DWSB 4QZVB 5BXJA 2PI6A 4MTVA 1Q1CA 2KO7A 4DRQA 2XPBA 3ARVA 4DH0A 3WD4A 1SR0A 2WLYA 2FDMA 1FKKA 4WIWA 3O5OA 3AS3A 4ZS6A 5DEZA 1NH6A 3LUOA 1JNTA 5B8IC 3KAGA 3B9AA 1NWUA 4NSBA 4U84A 3PRAA 1K9TA 2RQSA 1IX5A 2JZVA 2LKNA 2UZ5A 1QZ2A 2XP7A 4ODOA 1M5YA 2DT2A 3B8SA 1FKJA 4P8XA 4ODPA 2XPAA 2L2SA 1GOIA 5JH8A 5J6EA 4Z2JA 4IPXA 4ODNA 4QT2A 1FKRA 3TC5A 4QIBA 1E6PA 2DT0A 4Z2KA 1FKBA 2IUZA 3WQVA 1FAPA 2ZR4A 1FJDA 4IT4A 3PRDA 1ZBCA 1XRVA 3H9RB 2IF4A 3I6CA 1U79A 3FY1A 2F4EA 2XP5A 2Q5AA 1HJVA 1HKMA 3WL1A 4ODMA 1OGGA 2XP8A 3NRKA 1JNDA 1TCOC 4P8WA 1D6OA 4KQZA 1XHGA 4WKFA 1WAWA 5HTGA 1FKIA 3O5QA 2KR7A 2RUDA 2DG3A 2XP9A 1J4IA 1WB0A 3IKGA 2DSUA 3O5MA 2PV2A 2DT1A 4NNRA 2VCDA 3ARQA 2KE0A 1FKDA 1T11A 1YW5A 3WL0A 2OFNA 1QPFA 4BF8A 1D7IA 1BL4A 4JFLA 2DSWA 3TCZA 1FKSA 2YBTA 4LAXA 3KAIA 2ZQSA 3OA5A 2A3EA 1OGBA 1QPLA 1BKFA 4WKHA 2LGOA 4ODQA 2ZQVA 3KCEA 2WLZA 3EY6A 5HUAA 4HARA 1HKIA 4C02B 2MLYA 4LAYA 2XP6A 2RUCA 1UR9A 2DG9A 4ODLA 1KT0A 5D75A 1H0IA 3MDYB 5HT1A 2RSEA 1ZB5A 2B31A 3CHFA 1D2KA 2A3BA 1UR8A 3KABA 1E9LA 1KFWA 5DIVA 3ARRA 3UQBA 1CTNA 1PBKA 3ARPA 3OOBA 1PINA 1J4RA 2KGJA 1FKGA 4Q22A 3O5IA 2Y78A 1HKJA 3ALGA 2DSVA 3PR9A 4IQ2A 4S3KA 2ZR5A 3FXYA 3ARZA 1ROUA 4IT6A 4MPKA 1E6NA 2MNTA 1GUVA 1ZL1A 4PTMA 3WQWA 4ZPWR 1W9PA 1NSGA 3AS0A 4U86A 4DRMA 4DRHA 4HBEA 4MNJA 3IKDA 5DF0A 4ZPVR 3ARXA 2M1IA 4DRNA 2QF8A 5HW8A 2MPHA 3WD3A 3CGMA 3O5FA 1JVWA 4DZ2A 2WM0A 3WKZA 1TFVA 4JFMA 3ARTA 1FKFA 1O6IA 2ZQTA 3CZ8A 3RMEA 2F2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKI A;  3O5Q A;  2KR7 A;  2RUD A;  1N1A A;  1ZCN A;  2DG3 A;  2XP9 A;  1J4I A;  4IQC A;  4DT4 A;  4TNS A;  4GGQ A;  4LAW A;  3IKG A;  3NTP A;  2LPV A;  4ODR A;  4JFI A;  3O5M A;  2PV3 A;  4G2P A;  2PV2 A;  1Q6H A;  2F21 A;  4TW8 A;  4NNR A;  1B6C A;  3PA7 A;  2VCD A;  5DIT A;  1W26 A;  3O5J A;  1FD9 A;  2KE0 A;  1FKD A;  4W9O A;  1T11 A;  4DRI A;  1F40 A;  1EYM A;  2ITK A;  3JYJ A;  4J4O A;  2MLZ A;  1YW5 A;  3JYM A;  4J4N A;  3RFW A;  2OFN A;  3KZ7 A;  4FN2 A;  3UI6 A;  3VAW A;  4DRO A;  1QPF A;  4BF8 A;  1D7I A;  1BL4 A;  4JFL A;  3KAC A;  4TX0 A;  2AWG A;  1L1P A;  3TCZ A;  3O5D A;  1FKS A;  1FKT A;  4LAX A;  4FAP A;  3KAI A;  2ZQS A;  4DRP A;  4DRK A;  2PPO A;  4MSP A;  5I98 A;  3KAH A;  4GIV A;  3O5E A;  5BXJ A;  2FAP A;  1NMW A;  3WH0 A;  1Q1C A;  2KO7 A;  4DRQ A;  2XPB A;  3KAD A;  4DIP A;  1F8A B;  1QPL A;  5DIU A;  1Y0O A;  4N19 A;  4DH0 A;  1BKF A;  3O5P A;  2LGO A;  2MF9 A;  4ODQ A;  1R9H A;  3JXV A;  2ZQV A;  3KCE A;  3ODK A;  1FKL A;  1FKK A;  3NI6 A;  4TW7 A;  4W9P A;  3O5O A;  3EY6 A;  4TYO A;  5HUA A;  3IK8 A;  3LUO A;  1JNT A;  5B8I C;  4C02 B;  3KAG A;  2MLY A;  4LAY A;  4MGV A;  4U84 A;  2XP6 A;  2RUC A;  5HWC A;  1YAT A;  1HXV A;  3KAF A;  2DG9 A;  2RQS A;  4W9Q A;  3TDB A;  2JZV A;  4ODL A;  2XP4 A;  3CGN A;  1KT0 A;  5D75 A;  2LKN A;  3MDY B;  2UZ5 A;  1QZ2 A;  2XP7 A;  4ODO A;  3UQI A;  1M5Y A;  1FKH A;  2VN1 A;  2FKE A;  2MLX A;  3UI4 A;  1FKJ A;  5HT1 A;  2RSE A;  4TW6 A;  5HW7 A;  1EQ3 A;  4ODP A;  2XPA A;  3O5L A;  3O5R A;  3KAB A;  2L2S A;  5HKG A;  5DIV A;  3UQB A;  5J6E A;  2D9F A;  2PBC A;  2KFW A;  2PPP A;  4IPX A;  1D7J A;  1PBK A;  4ITZ A;  4ODN A;  4QT2 A;  1KT1 A;  1J6Y A;  4DZ3 A;  1FKR A;  1J4H A;  3TC5 A;  3OOB A;  2DG4 A;  1PIN A;  3RGC A;  4QIB A;  1J4R A;  1NMV A;  2KGJ A;  1C9H A;  1FKB A;  1FKG A;  3O5G A;  4JYS A;  3O5I A;  1D7H A;  4JFJ A;  2Y78 A;  4U85 A;  2XP3 A;  1FAP A;  2ZR4 A;  1FJD A;  3PRD A;  3UQA A;  1JNS A;  4IQ2 A;  2ZR5 A;  3H9R B;  2IF4 A;  3I6C A;  1ROU A;  1U79 A;  2MNT A;  1Q6U A;  4ODK A;  4DRJ A;  2F4E A;  2XP5 A;  2RUR A;  3O5K A;  3B7X A;  2Q5A A;  1NSG A;  4R0X A;  2K8I A;  4U86 A;  4DRM A;  4DRH A;  2PV1 A;  2ZQU A;  3IKD A;  4ODM A;  2KI3 A;  2XP8 A;  3NRK A;  1ZK6 A;  2M1I A;  3PRB A;  4QT3 A;  4DRN A;  5HW8 A;  2MPH A;  1TCO C;  1Q6I A;  2RUQ A;  3CGM A;  3O5F A;  5GPG A;  1D6O A;  1JVW A;  2ZR6 A;  3FAP A;  2N87 A;  3UF8 A;  3UI5 A;  4DZ2 A;  5HW6 A;  3IHZ A;  1A7X A;  2M2A A;  4LAV A;  4JFM A;  1FKF A;  3GPK A;  1ROT A;  2PPN A;  2ZQT A;  1P5Q A;  2M08 A;  4G50 A;  4JFK A;  4O2T A;  5HWB A;  2F2D A;  2LJ4 A;  5HTG A; 
#chains in the Genus database with same CATH topology
 2G41 A;  1ZBK A;  4DT4 A;  4ODR A;  2PV3 A;  3B9D A;  4MNM A;  1B6C A;  1NWT A;  5DIT A;  4MNL A;  4DWS D;  1EHN A;  1F40 A;  1EYM A;  2ITK A;  4J4O A;  2MLZ A;  4J4N A;  3UI6 A;  3VAW A;  1OWQ A;  3WIJ A;  4Z2I A;  3O5D A;  4DRP A;  4DRK A;  5I98 A;  3KAH A;  4GIV A;  3O5E A;  3ARO A;  3WH0 A;  3KAD A;  5DIU A;  1W1V A;  4AY1 A;  4TW7 A;  4WKA A;  4W9P A;  4TYO A;  1ZBW A;  4DWS C;  3WD1 A;  2PN0 A;  4MGV A;  3B9E A;  3RM9 A;  4L72 B;  1YAT A;  1HXV A;  3TDB A;  1H0G A;  4HBO A;  3UI4 A;  5HW7 A;  1EQ3 A;  4TW6 A;  4Z2G A;  1W9V A;  4P8V A;  5HKG A;  3EIP A;  2D9F A;  2PBC A;  2PPP A;  1D7J A;  2YBU A;  4ITZ A;  1KT1 A;  1J6Y A;  2DPE A;  1HJX A;  1ZBV A;  2DG4 A;  1NMV A;  1LG2 A;  3O5G A;  4JYS A;  1FFQ A;  4WK9 A;  1D7H A;  4L3N A;  4U85 A;  2AOS A;  1HJW A;  3WD2 A;  5DO2 A;  1Q6U A;  4MNK A;  4ODK A;  2WK2 A;  4URI A;  1ITX A;  3G6M A;  3O5K A;  1HKK A;  3B7X A;  3WD0 A;  2K8I A;  1LG1 A;  1JNE A;  2KI3 A;  3PRB A;  4ZPT R;  4QT3 A;  1Q6I A;  5GPG A;  3FAP A;  3UF8 A;  2N87 A;  3UI5 A;  1W9U A;  5HW6 A;  1A7X A;  2M2A A;  3GPK A;  1ROT A;  2PPN A;  4G50 A;  5HWB A;  4O2T A;  3IK8 A;  2LJ4 A;  2G8Z A;  1LQ0 A;  3ALF A;  4IQC A;  4TNS A;  4GGQ A;  4LAW A;  3NTP A;  4JFI A;  4G2P A;  1WNO A;  2F21 A;  3RM8 A;  4Z2L A;  1W1T A;  1W26 A;  1FD9 A;  4DRI A;  1X6N A;  4W9O A;  1LL6 A;  4DRO A;  3JYM A;  3CHD A;  3KZ7 A;  3RFW A;  4TX0 A;  3KAC A;  2AWG A;  4NZC A;  4P8U A;  1L1P A;  3QOK A;  2PPO A;  4WJX A;  2FAP A;  1NMW A;  2O9O A;  2OLH A;  1E15 A;  1SYT A;  1F8A B;  4DIP A;  1Y0O A;  4N19 A;  3O5P A;  2MF9 A;  1R9H A;  3JXV A;  4LGX A;  3ODK A;  1FKL A;  3NI6 A;  1EIB A;  3AS2 A;  5HWC A;  3KAF A;  4W9Q A;  2XP4 A;  3CGN A;  5GPR A;  3UQA A;  3UQI A;  2VN1 A;  1FKH A;  2FKE A;  2MLX A;  1NWS A;  3GTY X;  2A3A A;  3O5L A;  3O5R A;  1E44 A;  2DT3 A;  1GRJ A;  4Z2H A;  2KFW A;  4DZ3 A;  1J4H A;  4S3J A;  3G6L A;  3RGC A;  1C9H A;  4JFJ A;  2XP3 A;  1FFR A;  4W5U A;  4R5E A;  1JNS A;  1LL4 A;  2ESC A;  4DWS A;  3ARW A;  2O92 A;  3BXW A;  3W4R A;  3RM4 A;  4DRJ A;  2RUR A;  4MAV A;  3ARS A;  2A3C A;  1ZU8 A;  3CHE A;  3CH9 A;  4R0X A;  1W1P A;  2PV1 A;  2ZQU A;  3ARU A;  1ZK6 A;  2RUQ A;  3AS1 A;  2ZR6 A;  1GPF A;  3AQU A;  1VF8 A;  2DSZ A;  3IHZ A;  4Q7N A;  3ARY A;  4LAV A;  1RD6 A;  4JFK A;  1P5Q A;  2M08 A;  4XAK A;  3CHC A;  5GQB A;  1E6Z A;  4KR0 B;  1N1A A;  1ZCN A;  2P4V A;  4ML4 A;  5HBF A;  2LPV A;  1Q6H A;  4TW8 A;  3PA7 A;  1EDQ A;  3O5J A;  3JYJ A;  1X6L A;  4FN2 A;  1LL7 A;  1E6R A;  1LJY A;  1W1Y A;  1NWR A;  1FKT A;  4FAP A;  4MSP A;  4DWS B;  4QZV B;  5BXJ A;  2PI6 A;  4MTV A;  1Q1C A;  2KO7 A;  4DRQ A;  2XPB A;  3ARV A;  4UDM A;  4DH0 A;  3WD4 A;  1SR0 A;  2WLY A;  2FDM A;  1FKK A;  4WIW A;  3O5O A;  3AS3 A;  4ZS6 A;  5DEZ A;  1NH6 A;  3LUO A;  1JNT A;  5B8I C;  3KAG A;  3B9A A;  1NWU A;  4NSB A;  4U84 A;  3PRA A;  1K9T A;  2RQS A;  1IX5 A;  2JZV A;  2LKN A;  2UZ5 A;  1QZ2 A;  2XP7 A;  4ODO A;  1M5Y A;  2DT2 A;  3B8S A;  1FKJ A;  4P8X A;  4ODP A;  2XPA A;  2L2S A;  1GOI A;  5JH8 A;  5J6E A;  4Z2J A;  4IPX A;  4ODN A;  4QT2 A;  1FKR A;  3GU0 A;  3TC5 A;  4QIB A;  1E6P A;  2DT0 A;  4Z2K A;  1FKB A;  2IUZ A;  3WQV A;  1FAP A;  2ZR4 A;  1FJD A;  4IT4 A;  3PRD A;  1ZBC A;  1XRV A;  2F23 A;  3H9R B;  2IF4 A;  3I6C A;  1U79 A;  3FY1 A;  2F4E A;  2XP5 A;  2Q5A A;  1HJV A;  1HKM A;  3WL1 A;  2EUL A;  4ODM A;  1OGG A;  2XP8 A;  3NRK A;  1JND A;  1TCO C;  4P8W A;  1D6O A;  1XHG A;  4KQZ A;  4WKF A;  1WAW A;  5HTG A;  1FKI A;  3BMB A;  2KR7 A;  2RUD A;  3O5Q A;  2DG3 A;  2XP9 A;  1J4I A;  1WB0 A;  3IKG A;  2DSU A;  3O5M A;  2PV2 A;  2DT1 A;  4NNR A;  2VCD A;  2ETN A;  3ARQ A;  2KE0 A;  1FKD A;  1T11 A;  1YW5 A;  3WL0 A;  2OFN A;  1QPF A;  4BF8 A;  1D7I A;  1BL4 A;  4JFL A;  2DSW A;  3TCZ A;  1FKS A;  2YBT A;  4LAX A;  3KAI A;  2ZQS A;  3OA5 A;  2A3E A;  1OGB A;  1QPL A;  1BKF A;  4WKH A;  2LGO A;  4ODQ A;  2ZQV A;  3KCE A;  2WLZ A;  3EY6 A;  5HUA A;  4HAR A;  1HKI A;  4C02 B;  2MLY A;  4LAY A;  2XP6 A;  2RUC A;  1UR9 A;  2DG9 A;  4ODL A;  1KT0 A;  5D75 A;  1H0I A;  3MDY B;  5HT1 A;  2RSE A;  1ZB5 A;  2B31 A;  3CHF A;  1D2K A;  2A3B A;  1UR8 A;  3KAB A;  1E9L A;  1KFW A;  5DIV A;  3ARR A;  3UQB A;  1CTN A;  1PBK A;  3ARP A;  2B5U B;  3OOB A;  1PIN A;  1J4R A;  2KGJ A;  1FKG A;  4Q22 A;  3O5I A;  2Y78 A;  1HKJ A;  3ALG A;  2DSV A;  3PR9 A;  4IQ2 A;  4S3K A;  2ZR5 A;  3FXY A;  3ARZ A;  1ROU A;  4IT6 A;  4MPK A;  1E6N A;  2MNT A;  1GUV A;  1ZL1 A;  4PTM A;  3WQW A;  4ZPW R;  1W9P A;  1NSG A;  3AS0 A;  4U86 A;  4DRM A;  4DRH A;  4HBE A;  4MNJ A;  3IKD A;  5DF0 A;  4ZPV R;  3ARX A;  2M1I A;  4DRN A;  2QF8 A;  5HW8 A;  2MPH A;  3WD3 A;  3CGM A;  3O5F A;  1JVW A;  4DZ2 A;  2WM0 A;  1JCH B;  3WKZ A;  1TFV A;  4JFM A;  3ART A;  1FKF A;  1O6I A;  2ZQT A;  3CZ8 A;  3RME A;  2F2D A; 
#chains in the Genus database with same CATH homology
 2G41 A;  1ZBK A;  4DT4 A;  4ODR A;  2PV3 A;  3B9D A;  4MNM A;  1B6C A;  1NWT A;  5DIT A;  4MNL A;  4DWS D;  1EHN A;  1F40 A;  1EYM A;  2ITK A;  4J4O A;  2MLZ A;  4J4N A;  3UI6 A;  3VAW A;  1OWQ A;  3WIJ A;  4Z2I A;  3O5D A;  4DRP A;  4DRK A;  5I98 A;  3KAH A;  4GIV A;  3O5E A;  3ARO A;  3WH0 A;  3KAD A;  5DIU A;  1W1V A;  4AY1 A;  4TW7 A;  4WKA A;  4W9P A;  4TYO A;  1ZBW A;  4DWS C;  3WD1 A;  4MGV A;  3B9E A;  3RM9 A;  4L72 B;  1YAT A;  1HXV A;  3TDB A;  1H0G A;  4HBO A;  3UI4 A;  5HW7 A;  1EQ3 A;  4TW6 A;  4Z2G A;  1W9V A;  4P8V A;  5HKG A;  2D9F A;  2PBC A;  2PPP A;  1D7J A;  2YBU A;  4ITZ A;  1KT1 A;  1J6Y A;  2DPE A;  1HJX A;  1ZBV A;  2DG4 A;  1NMV A;  1LG2 A;  3O5G A;  4JYS A;  1FFQ A;  4WK9 A;  1D7H A;  4L3N A;  4U85 A;  2AOS A;  1HJW A;  3WD2 A;  5DO2 A;  1Q6U A;  4MNK A;  4ODK A;  2WK2 A;  4URI A;  1ITX A;  3G6M A;  3O5K A;  1HKK A;  3B7X A;  3WD0 A;  2K8I A;  1LG1 A;  1JNE A;  2KI3 A;  3PRB A;  4ZPT R;  4QT3 A;  1Q6I A;  5GPG A;  3FAP A;  3UF8 A;  2N87 A;  3UI5 A;  1W9U A;  5HW6 A;  1A7X A;  2M2A A;  3GPK A;  1ROT A;  2PPN A;  4G50 A;  5HWB A;  4O2T A;  3IK8 A;  2LJ4 A;  2G8Z A;  1LQ0 A;  3ALF A;  4IQC A;  4TNS A;  4GGQ A;  4LAW A;  3NTP A;  4JFI A;  4G2P A;  1WNO A;  2F21 A;  3RM8 A;  4Z2L A;  1W1T A;  1W26 A;  1FD9 A;  4DRI A;  1X6N A;  4W9O A;  1LL6 A;  4DRO A;  3JYM A;  3CHD A;  3KZ7 A;  3RFW A;  4TX0 A;  3KAC A;  2AWG A;  4NZC A;  4P8U A;  1L1P A;  3QOK A;  2PPO A;  4WJX A;  2FAP A;  1NMW A;  2O9O A;  2OLH A;  1E15 A;  1SYT A;  1F8A B;  4DIP A;  1Y0O A;  4N19 A;  3O5P A;  2MF9 A;  1R9H A;  3JXV A;  4LGX A;  3ODK A;  1FKL A;  3NI6 A;  1EIB A;  3AS2 A;  5HWC A;  3KAF A;  4W9Q A;  2XP4 A;  3CGN A;  5GPR A;  3UQA A;  3UQI A;  2VN1 A;  1FKH A;  2FKE A;  2MLX A;  1NWS A;  2A3A A;  3O5L A;  3O5R A;  2DT3 A;  4Z2H A;  2KFW A;  4DZ3 A;  1J4H A;  4S3J A;  3G6L A;  3RGC A;  1C9H A;  4JFJ A;  2XP3 A;  1FFR A;  4W5U A;  4R5E A;  1JNS A;  1LL4 A;  2ESC A;  4DWS A;  3ARW A;  2O92 A;  3BXW A;  3W4R A;  3RM4 A;  4DRJ A;  2RUR A;  4MAV A;  3ARS A;  2A3C A;  1ZU8 A;  3CHE A;  3CH9 A;  4R0X A;  1W1P A;  2PV1 A;  2ZQU A;  3ARU A;  1ZK6 A;  2RUQ A;  3AS1 A;  2ZR6 A;  1GPF A;  3AQU A;  1VF8 A;  2DSZ A;  3IHZ A;  4Q7N A;  3ARY A;  4LAV A;  1RD6 A;  4JFK A;  1P5Q A;  2M08 A;  4XAK A;  3CHC A;  5GQB A;  1E6Z A;  4KR0 B;  1N1A A;  1ZCN A;  4ML4 A;  5HBF A;  2LPV A;  1Q6H A;  4TW8 A;  3PA7 A;  1EDQ A;  3O5J A;  3JYJ A;  1X6L A;  4FN2 A;  1LL7 A;  1E6R A;  1LJY A;  1W1Y A;  1FKT A;  1NWR A;  4FAP A;  4MSP A;  4DWS B;  4QZV B;  5BXJ A;  2PI6 A;  4MTV A;  1Q1C A;  2KO7 A;  4DRQ A;  2XPB A;  3ARV A;  4DH0 A;  3WD4 A;  1SR0 A;  2WLY A;  2FDM A;  1FKK A;  4WIW A;  3O5O A;  3AS3 A;  4ZS6 A;  5DEZ A;  1NH6 A;  3LUO A;  1JNT A;  5B8I C;  3KAG A;  3B9A A;  1NWU A;  4NSB A;  4U84 A;  3PRA A;  1K9T A;  2RQS A;  1IX5 A;  2JZV A;  2LKN A;  2UZ5 A;  1QZ2 A;  2XP7 A;  4ODO A;  1M5Y A;  2DT2 A;  3B8S A;  1FKJ A;  4P8X A;  4ODP A;  2XPA A;  2L2S A;  1GOI A;  5JH8 A;  5J6E A;  4Z2J A;  4IPX A;  4ODN A;  4QT2 A;  1FKR A;  3TC5 A;  4QIB A;  1E6P A;  2DT0 A;  4Z2K A;  1FKB A;  2IUZ A;  3WQV A;  1FAP A;  2ZR4 A;  1FJD A;  4IT4 A;  3PRD A;  1ZBC A;  1XRV A;  3H9R B;  2IF4 A;  3I6C A;  1U79 A;  3FY1 A;  2F4E A;  2XP5 A;  2Q5A A;  1HJV A;  1HKM A;  3WL1 A;  4ODM A;  1OGG A;  2XP8 A;  3NRK A;  1JND A;  1TCO C;  4P8W A;  1D6O A;  4KQZ A;  1XHG A;  4WKF A;  1WAW A;  5HTG A;  1FKI A;  3O5Q A;  2KR7 A;  2RUD A;  2DG3 A;  2XP9 A;  1J4I A;  1WB0 A;  3IKG A;  2DSU A;  3O5M A;  2PV2 A;  2DT1 A;  4NNR A;  2VCD A;  3ARQ A;  2KE0 A;  1FKD A;  1T11 A;  1YW5 A;  3WL0 A;  2OFN A;  1QPF A;  4BF8 A;  1D7I A;  1BL4 A;  4JFL A;  2DSW A;  3TCZ A;  1FKS A;  2YBT A;  4LAX A;  3KAI A;  2ZQS A;  3OA5 A;  2A3E A;  1OGB A;  1QPL A;  1BKF A;  4WKH A;  2LGO A;  4ODQ A;  2ZQV A;  3KCE A;  2WLZ A;  3EY6 A;  5HUA A;  4HAR A;  1HKI A;  4C02 B;  2MLY A;  4LAY A;  2XP6 A;  2RUC A;  1UR9 A;  2DG9 A;  4ODL A;  1KT0 A;  5D75 A;  1H0I A;  3MDY B;  5HT1 A;  2RSE A;  1ZB5 A;  2B31 A;  3CHF A;  1D2K A;  2A3B A;  1UR8 A;  3KAB A;  1E9L A;  1KFW A;  5DIV A;  3ARR A;  3UQB A;  1CTN A;  1PBK A;  3ARP A;  3OOB A;  1PIN A;  1J4R A;  2KGJ A;  1FKG A;  4Q22 A;  3O5I A;  2Y78 A;  1HKJ A;  3ALG A;  2DSV A;  3PR9 A;  4IQ2 A;  4S3K A;  2ZR5 A;  3FXY A;  3ARZ A;  1ROU A;  4IT6 A;  4MPK A;  1E6N A;  2MNT A;  1GUV A;  1ZL1 A;  4PTM A;  3WQW A;  4ZPW R;  1W9P A;  1NSG A;  3AS0 A;  4U86 A;  4DRM A;  4DRH A;  4HBE A;  4MNJ A;  3IKD A;  5DF0 A;  4ZPV R;  3ARX A;  2M1I A;  4DRN A;  2QF8 A;  5HW8 A;  2MPH A;  3WD3 A;  3CGM A;  3O5F A;  1JVW A;  4DZ2 A;  2WM0 A;  3WKZ A;  1TFV A;  4JFM A;  3ART A;  1FKF A;  1O6I A;  2ZQT A;  3CZ8 A;  3RME A;  2F2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...