2UZ5A

Solution structure of the fkbp-domain of legionella pneumophila mip
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
137
structure length
137
Chain Sequence
b'FNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MACROPHAGE INFECTIVITY POTENTIATOR
publication title Domain Motions of the Mip Protein from Legionella Pneumophila
pubmed doi rcsb
molecule tags Isomerase
total genus 22
structure length 137
sequence length 137
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2uz5A02
4LAVA 4ODKA 1Q6IA 2MLYA 1ZCNA 1NMVA 4IQ2A 4DRMA 5BXJA 4DRIA 2PBCA 1PINA 5D75A 4JFMA 2N87A 2F4EA 2PV2A 1FKHA 4DZ3A 5HKGA 3IKDA 1Q1CA 2XP3A 2IF4A 1J4HA 2M1IA 2JZVA 3ODKA 4LAYA 2FAPA 4IPXA 1Q6HA 2OFNA 3UF8A 3PRBA 2ITKA 3UQAA 5I98A 4FAPA 4ODQA 2UZ5A 2K8IA 4G50A 3UI5A 1J4RA 5HWBA 1B6CA 2DG4A 2D9FA 1Y0OA 2MLZA 2XP9A 3KACA 2RUCA 5HT1A 4ODLA 3CGMA 3UI6A 4BF8A 2M2AA 1A7XA 2ZR6A 3KAGA 4QT2A 4LAXA 3GPKA 3MDYB 4N19A 3O5KA 2KO7A 1T11A 2ZQUA 3KAFA 1QZ2A 3UI4A 2RSEA 2LGOA 2KFWA 3KABA 1FKKA 1M5YA 3KAHA 2VCDA 4TW8A 4JYSA 3TCZA 3WH0A 4ITZA 2DG3A 2Q5AA 4J4NA 4ODMA 4DROA 4R0XA 3PRDA 3UQBA 1TCOC 3OOBA 2MF9A 1BKFA 2PPOA 3NI6A 3O5RA 2LKNA 4GIVA 4U84A 5DIVA 5HUAA 1ROTA 3EY6A 1FKFA 2PV3A 1BL4A 1ROUA 1PBKA 3I6CA 4IQCA 1HXVA 2ZR4A 3O5DA 4DH0A 1FKSA 3IHZA 4NNRA 3FAPA 4TYOA 3IK8A 2AWGA 2MLXA 3JYJA 4JFLA 5HW6A 2PPNA 4W9QA 1L1PA 3VAWA 1FKGA 3O5PA 4ODNA 3O5QA 1C9HA 4LAWA 4W9PA 4DRPA 1FKLA 2LJ4A 1FKIA 1FKRA 2XP5A 4TNSA 1P5QA 2ZQVA 1FKJA 4QIBA 4QT3A 3CGNA 2RUQA 4JFJA 1W26A 3JYMA 3O5GA 1ZK6A 3O5IA 2XP6A 1F40A 5B8IC 1QPLA 4DRQA 1FAPA 4U86A 1R9HA 2VN1A 1D6OA 3JXVA 3KZ7A 5HW8A 2PV1A 4DRNA 1KT0A 2MPHA 4ODPA 1J4IA 1NMWA 3UQIA 4DT4A 2XP7A 1FD9A 4FN2A 3NTPA 3LUOA 5HWCA 3O5OA 2KE0A 3O5LA 1QPFA 2M08A 2RURA 3NRKA 5DITA 3O5EA 2MNTA 5HTGA 4G2PA 4JFKA 4W9OA 1JNSA 2FKEA 2XP8A 3H9RB 1U79A 1F8AB 4DRHA 3IKGA 4TX0A 3O5MA 4DIPA 2LPVA 2ZQTA 3B7XA 4ODOA 4MGVA 1EQ3A 3TDBA 1FKBA 4O2TA 3RGCA 1KT1A 5HW7A 3KADA 1Q6UA 4GGQA 4JFIA 3KCEA 2Y78A 1N1AA 2F21A 2KGJA 3RFWA 3O5FA 4C02B 2ZR5A 1YW5A 1JVWA 1YATA 2RUDA 5J6EA 4U85A 1J6YA 3PA7A 2XPBA 1FKDA 4DRKA 3O5JA 1NSGA 4TW6A 5DIUA 3TC5A 1FJDA 2ZQSA 2KR7A 2KI3A 2PPPA 1D7HA 2XPAA 4DRJA 1JNTA 4ODRA 3KAIA 1EYMA 1D7JA 2XP4A 2L2SA 2DG9A 2RQSA 5GPGA 2F2DA 4MSPA 4J4OA 1FKTA 1D7IA 4TW7A 4DZ2A
chains in the Genus database with same CATH superfamily
1LG2A 1Q6IA 5BXJA 4IQ2A 5D75A 3WQVA 4Z2IA 4MTVA 1WAWA 1FKHA 3BMBA 4DZ3A 4Z2GA 3IKDA 1Q1CA 1GUVA 2XP3A 1HJXA 4LAYA 3PRBA 2ITKA 4FAPA 4ODQA 2UZ5A 3UI5A 1NH6A 1B6CA 2DG4A 1Y0OA 2RUCA 5HT1A 4ZPWR 1E15A 1A7XA 2IUZA 3KAGA 3O5KA 1QZ2A 3UI4A 4DWSA 2LGOA 2KFWA 4KQZA 3ARXA 2VCDA 2G8ZA 3UQBA 1H0GA 4DH0A 3IK8A 2AWGA 4JFLA 4PTMA 2LJ4A 1FKRA 2WLZA 3ALGA 3GTYX 4QIBA 3CGNA 1EHNA 5B8IC 2EULA 4Z2LA 1FAPA 1X6LA 1D6OA 2DT3A 1KT0A 4MNJA 3UQIA 2WM0A 2XP7A 1ZL1A 3AS2A 4WIWA 1QPFA 3B9DA 2MNTA 4JFKA 4MNMA 1JNSA 3O5MA 4DIPA 4ODOA 2ZQTA 3ALFA 1EQ3A 3RGCA 4W5UA 4JFIA 3CZ8A 3O5FA 4C02B 1W1PA 1YW5A 1JVWA 2YBUA 5J6EA 3ARWA 1SR0A 4DRKA 3TC5A 3AS3A 1WNOA 2ZQSA 2PPPA 4S3JA 2A3BA 4ZS6A 4DRJA 1JCHB 5HBFA 2RQSA 5GPGA 1NWUA 5DO2A 1H0IA 3WD1A 4J4OA 4IT4A 3WIJA 4WKHA 3CHCA 3WQWA 2MLYA 1ZCNA 1NMVA 2A3EA 1PINA 1NWRA 1WB0A 2DT1A 4MPKA 4MNLA 5I98A 2K8IA 1EDQA 2YBTA 2G41A 3UI6A 4ODLA 1FFQA 1E44A 3RM4A 3G6MA 4QT2A 1HKMA 4N19A 2ZQUA 3KAFA 1FKKA 1LQ0A 4URIA 4JYSA 3CHFA 1ZBWA 4ODMA 1K9TA 4DROA 3WD0A 1GOIA 2MF9A 3QOKA 1BKFA 3NI6A 1FFRA 5HUAA 1XHGA 2ETNA 1W1YA 4U84A 1ROTA 1IX5A 4IT6A 2PV3A 4IQCA 3I6CA 1HXVA 3O5DA 1FKSA 1W1VA 1O6IA 1L1PA 2MLXA 5HW6A 4HARA 4W9QA 1UR9A 3VAWA 3O5PA 3O5QA 1C9HA 5DF0A 3ARUA 1FKLA 1FKIA 4Q7NA 4TNSA 2ZQVA 1FKJA 4DWSC 1W26A 3ARTA 1ZK6A 1JNDA 4QZVB 2XP6A 1F40A 4DRQA 3BXWA 1GRJA 3JXVA 3KZ7A 3RM8A 3PRAA 4ODPA 4WKFA 3WD2A 1FD9A 1NWSA 4MAVA 5HWCA 3LUOA 2B5UB 3ARSA 2RURA 3NRKA 5DITA 3O5EA 5JH8A 1F8AB 1W9VA 2LPVA 3B7XA 4O2TA 1W9UA 4GGQA 1OWQA 3RFWA 4LGXA 1YATA 2A3AA 3ARZA 2AOSA 4L3NA 2RUDA 1W1TA 2O92A 2KR7A 3PR9A 2DT0A 2F2DA 3ARYA 4MGVA 4ODKA 4DRMA 1NWTA 4Z2HA 4DRIA 2N87A 2F4EA 4S3KA 4Z2KA 5HKGA 2IF4A 2M1IA 2JZVA 3ODKA 2FAPA 1Q6HA 2WLYA 3AS0A 1LG1A 1LL7A 2MLZA 2QF8A 2XP9A 3CGMA 2M2AA 3ARQA 1RD6A 4MNKA 2ZR6A 4LAXA 3GPKA 5DEZA 1OGBA 2RSEA 1M5YA 3KAHA 4TW8A 3ARVA 1GPFA 3TCZA 4ITZA 4ZPVR 4HBEA 1E6ZA 4J4NA 1ZB5A 1TCOC 3O5RA 4GIVA 2FDMA 3EY6A 3AROA 1ROUA 1PBKA 2ZR4A 3FAPA 4TYOA 2PPNA 2PI6A 1FKGA 4LAWA 2WK2A 4R5EA 3WD4A 4ML4A 3AS1A 4KR0B 4JFJA 3O5GA 2PN0A 1E9LA 1QPLA 5GPRA 2MPHA 2F23A 4FN2A 1JNEA 3NTPA 2KE0A 3O5LA 3W4RA 5HTGA 3CHDA 2XP8A 1U79A 1X6NA 3IKGA 4L72B 4TX0A 3KADA 1Q6UA 3KCEA 2Y78A 2KGJA 4ZPTR 1HKIA 3AQUA 3ARRA 4P8UA 4U85A 2XPBA 1FKDA 2DT2A 4TW6A 1FJDA 1D7HA 1HKJA 2XPAA 4ODRA 4P8VA 2XP4A 2DG9A 3RM9A 4MSPA 4DZ2A 4LAVA 4DWSD 1W9PA 3RMEA 2PBCA 4JFMA 2PV2A 1CTNA 1HJWA 1ZBKA 4Z2JA 3FY1A 1HKKA 1ZBCA 1J4HA 3UF8A 4IPXA 2OFNA 3UQAA 1LJYA 4NZCA 1KFWA 4G50A 4HBOA 1J4RA 5HWBA 3KACA 2D9FA 4BF8A 2P4VA 3CHEA 3MDYB 1SYTA 2KO7A 1T11A 3EIPA 3G6LA 3KABA 3ARPA 4WJXA 3WH0A 4P8XA 2DG3A 2Q5AA 4R0XA 3PRDA 3OOBA 2PPOA 2LKNA 5DIVA 3B9AA 2B31A 3CH9A 1FKFA 1BL4A 1OGGA 3IHZA 4NNRA 1E6PA 3JYJA 3WL0A 4XAKA 1D2KA 3OA5A 4ODNA 4W9PA 3B9EA 1XRVA 4DRPA 2XP5A 1P5QA 1UR8A 2DSVA 1E6NA 4QT3A 2DSUA 2RUQA 3JYMA 2OLHA 3O5IA 3FXYA 4P8WA 4U86A 1R9HA 2VN1A 1ZU8A 3B8SA 4NSBA 5HW8A 2PV1A 4DRNA 1J4IA 1NMWA 4DT4A 3WKZA 3O5OA 2M08A 2O9OA 4AY1A 4G2PA 4W9OA 1LL4A 2FKEA 3H9RB 1VF8A 4Q22A 1LL6A 4DRHA 1ITXA 1HJVA 4WK9A 3TDBA 1FKBA 3WD3A 1KT1A 5HW7A 4UDMA 1N1AA 2F21A 2DPEA 3WL1A 2ZR5A 4WKAA 4DWSB 2A3CA 1J6YA 3PA7A 1ZBVA 1TFVA 1EIBA 1NSGA 3O5JA 5DIUA 2KI3A 1E6RA 1JNTA 3KAIA 1EYMA 1D7JA 2L2SA 3GU0A 1FKTA 5GQBA 2DSWA 2DSZA 1D7IA 4TW7A 2ESCA
chains in the Genus database with same CATH topology
1LG2A 1Q6IA 5BXJA 4IQ2A 5D75A 3WQVA 4Z2IA 4MTVA 1WAWA 1FKHA 4DZ3A 4Z2GA 3IKDA 1Q1CA 1GUVA 2XP3A 1HJXA 4LAYA 3PRBA 2ITKA 4FAPA 4ODQA 2UZ5A 3UI5A 1NH6A 1B6CA 2DG4A 1Y0OA 2RUCA 5HT1A 4ZPWR 1E15A 1A7XA 2IUZA 3KAGA 3O5KA 1QZ2A 3UI4A 4DWSA 2LGOA 2KFWA 4KQZA 3ARXA 2VCDA 2G8ZA 3UQBA 1H0GA 4DH0A 3IK8A 2AWGA 4JFLA 4PTMA 2LJ4A 1FKRA 2WLZA 3ALGA 4QIBA 3CGNA 1EHNA 5B8IC 4Z2LA 1FAPA 1X6LA 1D6OA 2DT3A 1KT0A 4MNJA 3UQIA 2WM0A 2XP7A 1ZL1A 3AS2A 4WIWA 1QPFA 3B9DA 2MNTA 4JFKA 4MNMA 1JNSA 3O5MA 4DIPA 4ODOA 2ZQTA 3ALFA 1EQ3A 3RGCA 4W5UA 4JFIA 3CZ8A 3O5FA 4C02B 1W1PA 1YW5A 1JVWA 2YBUA 5J6EA 3ARWA 1SR0A 4DRKA 3TC5A 3AS3A 1WNOA 2ZQSA 2PPPA 4S3JA 2A3BA 4ZS6A 4DRJA 5HBFA 2RQSA 5GPGA 1NWUA 5DO2A 1H0IA 3WD1A 4J4OA 4IT4A 3WIJA 4WKHA 3CHCA 3WQWA 2MLYA 1ZCNA 1NMVA 2A3EA 1PINA 1NWRA 1WB0A 2DT1A 4MPKA 4MNLA 5I98A 2K8IA 1EDQA 2YBTA 2G41A 3UI6A 4ODLA 1FFQA 3RM4A 3G6MA 4QT2A 1HKMA 4N19A 2ZQUA 3KAFA 1FKKA 1LQ0A 4URIA 4JYSA 3CHFA 1ZBWA 4ODMA 1K9TA 4DROA 3WD0A 1GOIA 2MF9A 3QOKA 1BKFA 3NI6A 1FFRA 5HUAA 1XHGA 4U84A 1W1YA 1ROTA 1IX5A 4IT6A 2PV3A 4IQCA 3I6CA 1HXVA 3O5DA 1FKSA 1W1VA 1O6IA 1L1PA 2MLXA 5HW6A 4HARA 4W9QA 1UR9A 3VAWA 3O5PA 3O5QA 1C9HA 5DF0A 3ARUA 1FKLA 1FKIA 4Q7NA 4TNSA 2ZQVA 1FKJA 4DWSC 1W26A 3ARTA 1ZK6A 1JNDA 4QZVB 2XP6A 1F40A 4DRQA 3BXWA 3JXVA 3KZ7A 3RM8A 3PRAA 4ODPA 4WKFA 3WD2A 1FD9A 1NWSA 4MAVA 5HWCA 3LUOA 3ARSA 2RURA 3NRKA 5DITA 3O5EA 5JH8A 1F8AB 1W9VA 2LPVA 3B7XA 4O2TA 1W9UA 4GGQA 1OWQA 3RFWA 4LGXA 1YATA 2A3AA 3ARZA 2AOSA 4L3NA 2RUDA 1W1TA 2O92A 2KR7A 3PR9A 2DT0A 2F2DA 3ARYA 4MGVA 4ODKA 4DRMA 1NWTA 4Z2HA 4DRIA 2N87A 2F4EA 4S3KA 4Z2KA 5HKGA 2IF4A 2M1IA 2JZVA 3ODKA 2FAPA 1Q6HA 2WLYA 3AS0A 1LG1A 1LL7A 2MLZA 2QF8A 2XP9A 3CGMA 2M2AA 3ARQA 1RD6A 4MNKA 2ZR6A 4LAXA 3GPKA 5DEZA 1OGBA 2RSEA 1M5YA 3KAHA 4TW8A 3ARVA 1GPFA 3TCZA 4ITZA 4ZPVR 4HBEA 1E6ZA 4J4NA 1ZB5A 1TCOC 3O5RA 4GIVA 2FDMA 3EY6A 3AROA 1ROUA 1PBKA 2ZR4A 3FAPA 4TYOA 2PPNA 2PI6A 1FKGA 4LAWA 2WK2A 4R5EA 3WD4A 4ML4A 3AS1A 4KR0B 4JFJA 3O5GA 1E9LA 1QPLA 5GPRA 2MPHA 4FN2A 1JNEA 3NTPA 2KE0A 3O5LA 3W4RA 5HTGA 3CHDA 2XP8A 1U79A 1X6NA 3IKGA 4L72B 4TX0A 3KADA 1Q6UA 3KCEA 2Y78A 2KGJA 4ZPTR 1HKIA 3AQUA 3ARRA 4P8UA 4U85A 2XPBA 1FKDA 2DT2A 4TW6A 1FJDA 1D7HA 1HKJA 2XPAA 4ODRA 4P8VA 2XP4A 2DG9A 3RM9A 4MSPA 4DZ2A 4LAVA 4DWSD 1W9PA 3RMEA 2PBCA 4JFMA 2PV2A 1CTNA 1HJWA 1ZBKA 4Z2JA 3FY1A 1HKKA 1ZBCA 1J4HA 3UF8A 4IPXA 2OFNA 3UQAA 1LJYA 4NZCA 1KFWA 4G50A 4HBOA 1J4RA 5HWBA 3KACA 2D9FA 4BF8A 3CHEA 3MDYB 1SYTA 2KO7A 1T11A 3G6LA 3KABA 3ARPA 4WJXA 3WH0A 4P8XA 2DG3A 2Q5AA 4R0XA 3PRDA 3OOBA 2PPOA 2LKNA 5DIVA 3B9AA 2B31A 3CH9A 1FKFA 1BL4A 1OGGA 3IHZA 4NNRA 1E6PA 3JYJA 3WL0A 4XAKA 1D2KA 3OA5A 4ODNA 4W9PA 3B9EA 1XRVA 4DRPA 2XP5A 1P5QA 1UR8A 2DSVA 1E6NA 4QT3A 2DSUA 2RUQA 3JYMA 2OLHA 3O5IA 3FXYA 4P8WA 4U86A 1R9HA 2VN1A 1ZU8A 3B8SA 4NSBA 5HW8A 2PV1A 4DRNA 1J4IA 1NMWA 4DT4A 3WKZA 3O5OA 2M08A 2O9OA 4AY1A 4G2PA 4W9OA 1LL4A 2FKEA 3H9RB 1VF8A 4Q22A 1LL6A 4DRHA 1ITXA 1HJVA 4WK9A 3TDBA 1FKBA 3WD3A 1KT1A 5HW7A 1N1AA 2F21A 2DPEA 3WL1A 2ZR5A 4WKAA 4DWSB 2A3CA 1J6YA 3PA7A 1ZBVA 1TFVA 1EIBA 1NSGA 3O5JA 5DIUA 2KI3A 1E6RA 1JNTA 3KAIA 1EYMA 1D7JA 2L2SA 1FKTA 5GQBA 2DSWA 2DSZA 1D7IA 4TW7A 2ESCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAV A;  4ODK A;  1Q6I A;  2MLY A;  1ZCN A;  1NMV A;  4IQ2 A;  4DRM A;  5BXJ A;  4DRI A;  2PBC A;  1PIN A;  5D75 A;  4JFM A;  2N87 A;  2F4E A;  2PV2 A;  1FKH A;  4DZ3 A;  5HKG A;  3IKD A;  1Q1C A;  2XP3 A;  2IF4 A;  1J4H A;  2M1I A;  2JZV A;  3ODK A;  4LAY A;  2FAP A;  4IPX A;  1Q6H A;  2OFN A;  3UF8 A;  3PRB A;  2ITK A;  3UQA A;  5I98 A;  4FAP A;  4ODQ A;  2UZ5 A;  2K8I A;  4G50 A;  3UI5 A;  1J4R A;  5HWB A;  1B6C A;  2DG4 A;  2D9F A;  1Y0O A;  2MLZ A;  2XP9 A;  3KAC A;  2RUC A;  5HT1 A;  4ODL A;  3CGM A;  3UI6 A;  4BF8 A;  2M2A A;  1A7X A;  2ZR6 A;  3KAG A;  4QT2 A;  4LAX A;  3GPK A;  3MDY B;  4N19 A;  3O5K A;  2KO7 A;  1T11 A;  2ZQU A;  3KAF A;  1QZ2 A;  3UI4 A;  2RSE A;  2LGO A;  2KFW A;  3KAB A;  1FKK A;  1M5Y A;  3KAH A;  2VCD A;  4TW8 A;  4JYS A;  3TCZ A;  3WH0 A;  4ITZ A;  2DG3 A;  2Q5A A;  4J4N A;  4ODM A;  4DRO A;  4R0X A;  3PRD A;  3UQB A;  1TCO C;  3OOB A;  2MF9 A;  1BKF A;  2PPO A;  3NI6 A;  3O5R A;  2LKN A;  4GIV A;  4U84 A;  5DIV A;  5HUA A;  1ROT A;  3EY6 A;  1FKF A;  2PV3 A;  1BL4 A;  1ROU A;  1PBK A;  3I6C A;  4IQC A;  1HXV A;  2ZR4 A;  3O5D A;  4DH0 A;  1FKS A;  3IHZ A;  4NNR A;  3FAP A;  4TYO A;  3IK8 A;  2AWG A;  2MLX A;  3JYJ A;  4JFL A;  5HW6 A;  2PPN A;  4W9Q A;  1L1P A;  3VAW A;  1FKG A;  3O5P A;  4ODN A;  3O5Q A;  1C9H A;  4LAW A;  4W9P A;  4DRP A;  1FKL A;  2LJ4 A;  1FKI A;  1FKR A;  2XP5 A;  4TNS A;  1P5Q A;  2ZQV A;  1FKJ A;  4QIB A;  4QT3 A;  3CGN A;  2RUQ A;  4JFJ A;  1W26 A;  3JYM A;  3O5G A;  1ZK6 A;  3O5I A;  2XP6 A;  1F40 A;  5B8I C;  1QPL A;  4DRQ A;  1FAP A;  4U86 A;  1R9H A;  2VN1 A;  1D6O A;  3JXV A;  3KZ7 A;  5HW8 A;  2PV1 A;  4DRN A;  1KT0 A;  2MPH A;  4ODP A;  1J4I A;  1NMW A;  3UQI A;  4DT4 A;  2XP7 A;  1FD9 A;  4FN2 A;  3NTP A;  3LUO A;  5HWC A;  3O5O A;  2KE0 A;  3O5L A;  1QPF A;  2M08 A;  2RUR A;  3NRK A;  5DIT A;  3O5E A;  2MNT A;  5HTG A;  4G2P A;  4JFK A;  4W9O A;  1JNS A;  2FKE A;  2XP8 A;  3H9R B;  1U79 A;  1F8A B;  4DRH A;  3IKG A;  4TX0 A;  3O5M A;  4DIP A;  2LPV A;  2ZQT A;  3B7X A;  4ODO A;  4MGV A;  1EQ3 A;  3TDB A;  1FKB A;  4O2T A;  3RGC A;  1KT1 A;  5HW7 A;  3KAD A;  1Q6U A;  4GGQ A;  4JFI A;  3KCE A;  2Y78 A;  1N1A A;  2F21 A;  2KGJ A;  3RFW A;  3O5F A;  4C02 B;  2ZR5 A;  1YW5 A;  1JVW A;  1YAT A;  2RUD A;  5J6E A;  4U85 A;  1J6Y A;  3PA7 A;  2XPB A;  1FKD A;  4DRK A;  3O5J A;  1NSG A;  4TW6 A;  5DIU A;  3TC5 A;  1FJD A;  2ZQS A;  2KR7 A;  2KI3 A;  2PPP A;  1D7H A;  2XPA A;  4DRJ A;  1JNT A;  4ODR A;  3KAI A;  1EYM A;  1D7J A;  2XP4 A;  2L2S A;  2DG9 A;  2RQS A;  5GPG A;  2F2D A;  4MSP A;  4J4O A;  1FKT A;  1D7I A;  4TW7 A;  4DZ2 A; 
#chains in the Genus database with same CATH topology
 1LG2 A;  1Q6I A;  5BXJ A;  4IQ2 A;  5D75 A;  3WQV A;  4Z2I A;  4MTV A;  1WAW A;  1FKH A;  3BMB A;  4DZ3 A;  4Z2G A;  3IKD A;  1Q1C A;  1GUV A;  2XP3 A;  1HJX A;  4LAY A;  3PRB A;  2ITK A;  4FAP A;  4ODQ A;  2UZ5 A;  3UI5 A;  1NH6 A;  1B6C A;  2DG4 A;  1Y0O A;  2RUC A;  5HT1 A;  4ZPW R;  1E15 A;  1A7X A;  2IUZ A;  3KAG A;  3O5K A;  1QZ2 A;  3UI4 A;  4DWS A;  2LGO A;  2KFW A;  4KQZ A;  3ARX A;  2VCD A;  2G8Z A;  3UQB A;  1H0G A;  4DH0 A;  3IK8 A;  2AWG A;  4JFL A;  4PTM A;  2LJ4 A;  1FKR A;  2WLZ A;  3ALG A;  3GTY X;  4QIB A;  3CGN A;  1EHN A;  5B8I C;  2EUL A;  4Z2L A;  1FAP A;  1X6L A;  1D6O A;  2DT3 A;  1KT0 A;  4MNJ A;  3UQI A;  2WM0 A;  2XP7 A;  1ZL1 A;  3AS2 A;  4WIW A;  1QPF A;  3B9D A;  2MNT A;  4JFK A;  4MNM A;  1JNS A;  3O5M A;  4DIP A;  4ODO A;  2ZQT A;  3ALF A;  1EQ3 A;  3RGC A;  4W5U A;  4JFI A;  3CZ8 A;  3O5F A;  4C02 B;  1W1P A;  1YW5 A;  1JVW A;  2YBU A;  5J6E A;  3ARW A;  1SR0 A;  4DRK A;  3TC5 A;  3AS3 A;  1WNO A;  2ZQS A;  2PPP A;  4S3J A;  2A3B A;  4ZS6 A;  4DRJ A;  1JCH B;  5HBF A;  2RQS A;  5GPG A;  1NWU A;  5DO2 A;  1H0I A;  3WD1 A;  4J4O A;  4IT4 A;  3WIJ A;  4WKH A;  3CHC A;  3WQW A;  2MLY A;  1ZCN A;  1NMV A;  2A3E A;  1PIN A;  1NWR A;  1WB0 A;  2DT1 A;  4MPK A;  4MNL A;  5I98 A;  2K8I A;  1EDQ A;  2YBT A;  2G41 A;  3UI6 A;  4ODL A;  1FFQ A;  1E44 A;  3RM4 A;  3G6M A;  4QT2 A;  1HKM A;  4N19 A;  2ZQU A;  3KAF A;  1FKK A;  1LQ0 A;  4URI A;  4JYS A;  3CHF A;  1ZBW A;  4ODM A;  1K9T A;  4DRO A;  3WD0 A;  1GOI A;  2MF9 A;  3QOK A;  1BKF A;  3NI6 A;  1FFR A;  5HUA A;  1XHG A;  2ETN A;  1W1Y A;  4U84 A;  1ROT A;  1IX5 A;  4IT6 A;  2PV3 A;  4IQC A;  3I6C A;  1HXV A;  3O5D A;  1FKS A;  1W1V A;  1O6I A;  1L1P A;  2MLX A;  5HW6 A;  4HAR A;  4W9Q A;  1UR9 A;  3VAW A;  3O5P A;  3O5Q A;  1C9H A;  5DF0 A;  3ARU A;  1FKL A;  1FKI A;  4Q7N A;  4TNS A;  2ZQV A;  1FKJ A;  4DWS C;  1W26 A;  3ART A;  1ZK6 A;  1JND A;  4QZV B;  2XP6 A;  1F40 A;  4DRQ A;  3BXW A;  1GRJ A;  3JXV A;  3KZ7 A;  3RM8 A;  3PRA A;  4ODP A;  4WKF A;  3WD2 A;  1FD9 A;  1NWS A;  4MAV A;  5HWC A;  3LUO A;  2B5U B;  3ARS A;  2RUR A;  3NRK A;  5DIT A;  3O5E A;  5JH8 A;  1F8A B;  1W9V A;  2LPV A;  3B7X A;  4O2T A;  1W9U A;  4GGQ A;  1OWQ A;  3RFW A;  4LGX A;  1YAT A;  2A3A A;  3ARZ A;  2AOS A;  4L3N A;  2RUD A;  1W1T A;  2O92 A;  2KR7 A;  3PR9 A;  2DT0 A;  2F2D A;  3ARY A;  4MGV A;  4ODK A;  4DRM A;  1NWT A;  4Z2H A;  4DRI A;  2N87 A;  2F4E A;  4S3K A;  4Z2K A;  5HKG A;  2IF4 A;  2M1I A;  2JZV A;  3ODK A;  2FAP A;  1Q6H A;  2WLY A;  3AS0 A;  1LG1 A;  1LL7 A;  2MLZ A;  2QF8 A;  2XP9 A;  3CGM A;  2M2A A;  3ARQ A;  1RD6 A;  4MNK A;  2ZR6 A;  4LAX A;  3GPK A;  5DEZ A;  1OGB A;  2RSE A;  1M5Y A;  3KAH A;  4TW8 A;  3ARV A;  1GPF A;  3TCZ A;  4ITZ A;  4ZPV R;  4HBE A;  1E6Z A;  4J4N A;  1ZB5 A;  1TCO C;  3O5R A;  4GIV A;  2FDM A;  3EY6 A;  3ARO A;  1ROU A;  1PBK A;  2ZR4 A;  3FAP A;  4TYO A;  2PPN A;  2PI6 A;  1FKG A;  4LAW A;  2WK2 A;  4R5E A;  3WD4 A;  4ML4 A;  3AS1 A;  4KR0 B;  4JFJ A;  3O5G A;  2PN0 A;  1E9L A;  1QPL A;  5GPR A;  2MPH A;  2F23 A;  4FN2 A;  1JNE A;  3NTP A;  2KE0 A;  3O5L A;  3W4R A;  5HTG A;  3CHD A;  2XP8 A;  1U79 A;  1X6N A;  3IKG A;  4L72 B;  4TX0 A;  3KAD A;  1Q6U A;  3KCE A;  2Y78 A;  2KGJ A;  4ZPT R;  1HKI A;  3AQU A;  3ARR A;  4P8U A;  4U85 A;  2XPB A;  1FKD A;  2DT2 A;  4TW6 A;  1FJD A;  1D7H A;  1HKJ A;  2XPA A;  4ODR A;  4P8V A;  2XP4 A;  2DG9 A;  3RM9 A;  4MSP A;  4DZ2 A;  4LAV A;  4DWS D;  1W9P A;  3RME A;  2PBC A;  4JFM A;  2PV2 A;  1CTN A;  1HJW A;  1ZBK A;  4Z2J A;  3FY1 A;  1HKK A;  1ZBC A;  1J4H A;  3UF8 A;  4IPX A;  2OFN A;  3UQA A;  1LJY A;  4NZC A;  1KFW A;  4G50 A;  4HBO A;  1J4R A;  5HWB A;  3KAC A;  2D9F A;  4BF8 A;  2P4V A;  3CHE A;  3MDY B;  1SYT A;  2KO7 A;  1T11 A;  3EIP A;  3G6L A;  3KAB A;  3ARP A;  4WJX A;  3WH0 A;  4P8X A;  2DG3 A;  2Q5A A;  4R0X A;  3PRD A;  3OOB A;  2PPO A;  2LKN A;  5DIV A;  3B9A A;  2B31 A;  3CH9 A;  1FKF A;  1BL4 A;  1OGG A;  3IHZ A;  4NNR A;  1E6P A;  3JYJ A;  3WL0 A;  4XAK A;  1D2K A;  3OA5 A;  4ODN A;  4W9P A;  3B9E A;  1XRV A;  4DRP A;  2XP5 A;  1P5Q A;  1UR8 A;  2DSV A;  1E6N A;  4QT3 A;  2DSU A;  2RUQ A;  3JYM A;  2OLH A;  3O5I A;  3FXY A;  4P8W A;  4U86 A;  1R9H A;  2VN1 A;  1ZU8 A;  3B8S A;  4NSB A;  5HW8 A;  2PV1 A;  4DRN A;  1J4I A;  1NMW A;  4DT4 A;  3WKZ A;  3O5O A;  2M08 A;  2O9O A;  4AY1 A;  4G2P A;  4W9O A;  1LL4 A;  2FKE A;  3H9R B;  1VF8 A;  4Q22 A;  1LL6 A;  4DRH A;  1ITX A;  1HJV A;  4WK9 A;  3TDB A;  1FKB A;  3WD3 A;  1KT1 A;  5HW7 A;  4UDM A;  1N1A A;  2F21 A;  2DPE A;  3WL1 A;  2ZR5 A;  4WKA A;  4DWS B;  2A3C A;  1J6Y A;  3PA7 A;  1ZBV A;  1TFV A;  1EIB A;  1NSG A;  3O5J A;  5DIU A;  2KI3 A;  1E6R A;  1JNT A;  3KAI A;  1EYM A;  1D7J A;  2L2S A;  3GU0 A;  1FKT A;  5GQB A;  2DSW A;  2DSZ A;  1D7I A;  4TW7 A;  2ESC A; 
#chains in the Genus database with same CATH homology
 1LG2 A;  1Q6I A;  5BXJ A;  4IQ2 A;  5D75 A;  3WQV A;  4Z2I A;  4MTV A;  1WAW A;  1FKH A;  4DZ3 A;  4Z2G A;  3IKD A;  1Q1C A;  1GUV A;  2XP3 A;  1HJX A;  4LAY A;  3PRB A;  2ITK A;  4FAP A;  4ODQ A;  2UZ5 A;  3UI5 A;  1NH6 A;  1B6C A;  2DG4 A;  1Y0O A;  2RUC A;  5HT1 A;  4ZPW R;  1E15 A;  1A7X A;  2IUZ A;  3KAG A;  3O5K A;  1QZ2 A;  3UI4 A;  4DWS A;  2LGO A;  2KFW A;  4KQZ A;  3ARX A;  2VCD A;  2G8Z A;  3UQB A;  1H0G A;  4DH0 A;  3IK8 A;  2AWG A;  4JFL A;  4PTM A;  2LJ4 A;  1FKR A;  2WLZ A;  3ALG A;  4QIB A;  3CGN A;  1EHN A;  5B8I C;  4Z2L A;  1FAP A;  1X6L A;  1D6O A;  2DT3 A;  1KT0 A;  4MNJ A;  3UQI A;  2WM0 A;  2XP7 A;  1ZL1 A;  3AS2 A;  4WIW A;  1QPF A;  3B9D A;  2MNT A;  4JFK A;  4MNM A;  1JNS A;  3O5M A;  4DIP A;  4ODO A;  2ZQT A;  3ALF A;  1EQ3 A;  3RGC A;  4W5U A;  4JFI A;  3CZ8 A;  3O5F A;  4C02 B;  1W1P A;  1YW5 A;  1JVW A;  2YBU A;  5J6E A;  3ARW A;  1SR0 A;  4DRK A;  3TC5 A;  3AS3 A;  1WNO A;  2ZQS A;  2PPP A;  4S3J A;  2A3B A;  4ZS6 A;  4DRJ A;  5HBF A;  2RQS A;  5GPG A;  1NWU A;  5DO2 A;  1H0I A;  3WD1 A;  4J4O A;  4IT4 A;  3WIJ A;  4WKH A;  3CHC A;  3WQW A;  2MLY A;  1ZCN A;  1NMV A;  2A3E A;  1PIN A;  1NWR A;  1WB0 A;  2DT1 A;  4MPK A;  4MNL A;  5I98 A;  2K8I A;  1EDQ A;  2YBT A;  2G41 A;  3UI6 A;  4ODL A;  1FFQ A;  3RM4 A;  3G6M A;  4QT2 A;  1HKM A;  4N19 A;  2ZQU A;  3KAF A;  1FKK A;  1LQ0 A;  4URI A;  4JYS A;  3CHF A;  1ZBW A;  4ODM A;  1K9T A;  4DRO A;  3WD0 A;  1GOI A;  2MF9 A;  3QOK A;  1BKF A;  3NI6 A;  1FFR A;  5HUA A;  1XHG A;  4U84 A;  1W1Y A;  1ROT A;  1IX5 A;  4IT6 A;  2PV3 A;  4IQC A;  3I6C A;  1HXV A;  3O5D A;  1FKS A;  1W1V A;  1O6I A;  1L1P A;  2MLX A;  5HW6 A;  4HAR A;  4W9Q A;  1UR9 A;  3VAW A;  3O5P A;  3O5Q A;  1C9H A;  5DF0 A;  3ARU A;  1FKL A;  1FKI A;  4Q7N A;  4TNS A;  2ZQV A;  1FKJ A;  4DWS C;  1W26 A;  3ART A;  1ZK6 A;  1JND A;  4QZV B;  2XP6 A;  1F40 A;  4DRQ A;  3BXW A;  3JXV A;  3KZ7 A;  3RM8 A;  3PRA A;  4ODP A;  4WKF A;  3WD2 A;  1FD9 A;  1NWS A;  4MAV A;  5HWC A;  3LUO A;  3ARS A;  2RUR A;  3NRK A;  5DIT A;  3O5E A;  5JH8 A;  1F8A B;  1W9V A;  2LPV A;  3B7X A;  4O2T A;  1W9U A;  4GGQ A;  1OWQ A;  3RFW A;  4LGX A;  1YAT A;  2A3A A;  3ARZ A;  2AOS A;  4L3N A;  2RUD A;  1W1T A;  2O92 A;  2KR7 A;  3PR9 A;  2DT0 A;  2F2D A;  3ARY A;  4MGV A;  4ODK A;  4DRM A;  1NWT A;  4Z2H A;  4DRI A;  2N87 A;  2F4E A;  4S3K A;  4Z2K A;  5HKG A;  2IF4 A;  2M1I A;  2JZV A;  3ODK A;  2FAP A;  1Q6H A;  2WLY A;  3AS0 A;  1LG1 A;  1LL7 A;  2MLZ A;  2QF8 A;  2XP9 A;  3CGM A;  2M2A A;  3ARQ A;  1RD6 A;  4MNK A;  2ZR6 A;  4LAX A;  3GPK A;  5DEZ A;  1OGB A;  2RSE A;  1M5Y A;  3KAH A;  4TW8 A;  3ARV A;  1GPF A;  3TCZ A;  4ITZ A;  4ZPV R;  4HBE A;  1E6Z A;  4J4N A;  1ZB5 A;  1TCO C;  3O5R A;  4GIV A;  2FDM A;  3EY6 A;  3ARO A;  1ROU A;  1PBK A;  2ZR4 A;  3FAP A;  4TYO A;  2PPN A;  2PI6 A;  1FKG A;  4LAW A;  2WK2 A;  4R5E A;  3WD4 A;  4ML4 A;  3AS1 A;  4KR0 B;  4JFJ A;  3O5G A;  1E9L A;  1QPL A;  5GPR A;  2MPH A;  4FN2 A;  1JNE A;  3NTP A;  2KE0 A;  3O5L A;  3W4R A;  5HTG A;  3CHD A;  2XP8 A;  1U79 A;  1X6N A;  3IKG A;  4L72 B;  4TX0 A;  3KAD A;  1Q6U A;  3KCE A;  2Y78 A;  2KGJ A;  4ZPT R;  1HKI A;  3AQU A;  3ARR A;  4P8U A;  4U85 A;  2XPB A;  1FKD A;  2DT2 A;  4TW6 A;  1FJD A;  1D7H A;  1HKJ A;  2XPA A;  4ODR A;  4P8V A;  2XP4 A;  2DG9 A;  3RM9 A;  4MSP A;  4DZ2 A;  4LAV A;  4DWS D;  1W9P A;  3RME A;  2PBC A;  4JFM A;  2PV2 A;  1CTN A;  1HJW A;  1ZBK A;  4Z2J A;  3FY1 A;  1HKK A;  1ZBC A;  1J4H A;  3UF8 A;  4IPX A;  2OFN A;  3UQA A;  1LJY A;  4NZC A;  1KFW A;  4G50 A;  4HBO A;  1J4R A;  5HWB A;  3KAC A;  2D9F A;  4BF8 A;  3CHE A;  3MDY B;  1SYT A;  2KO7 A;  1T11 A;  3G6L A;  3KAB A;  3ARP A;  4WJX A;  3WH0 A;  4P8X A;  2DG3 A;  2Q5A A;  4R0X A;  3PRD A;  3OOB A;  2PPO A;  2LKN A;  5DIV A;  3B9A A;  2B31 A;  3CH9 A;  1FKF A;  1BL4 A;  1OGG A;  3IHZ A;  4NNR A;  1E6P A;  3JYJ A;  3WL0 A;  4XAK A;  1D2K A;  3OA5 A;  4ODN A;  4W9P A;  3B9E A;  1XRV A;  4DRP A;  2XP5 A;  1P5Q A;  1UR8 A;  2DSV A;  1E6N A;  4QT3 A;  2DSU A;  2RUQ A;  3JYM A;  2OLH A;  3O5I A;  3FXY A;  4P8W A;  4U86 A;  1R9H A;  2VN1 A;  1ZU8 A;  3B8S A;  4NSB A;  5HW8 A;  2PV1 A;  4DRN A;  1J4I A;  1NMW A;  4DT4 A;  3WKZ A;  3O5O A;  2M08 A;  2O9O A;  4AY1 A;  4G2P A;  4W9O A;  1LL4 A;  2FKE A;  3H9R B;  1VF8 A;  4Q22 A;  1LL6 A;  4DRH A;  1ITX A;  1HJV A;  4WK9 A;  3TDB A;  1FKB A;  3WD3 A;  1KT1 A;  5HW7 A;  1N1A A;  2F21 A;  2DPE A;  3WL1 A;  2ZR5 A;  4WKA A;  4DWS B;  2A3C A;  1J6Y A;  3PA7 A;  1ZBV A;  1TFV A;  1EIB A;  1NSG A;  3O5J A;  5DIU A;  2KI3 A;  1E6R A;  1JNT A;  3KAI A;  1EYM A;  1D7J A;  2L2S A;  1FKT A;  5GQB A;  2DSW A;  2DSZ A;  1D7I A;  4TW7 A;  2ESC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...