2UZ5A

Solution structure of the fkbp-domain of legionella pneumophila mip
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
137
structure length
137
Chain Sequence
FNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain Motions of the Mip Protein from Legionella Pneumophila
pubmed doi rcsb
molecule tags Isomerase
molecule keywords MACROPHAGE INFECTIVITY POTENTIATOR
total genus 22
structure length 137
sequence length 137
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2uz5A02
4QT2A 1ZK6A 3NRKA 3UQAA 3O5IA 2RUDA 4U84A 3CGMA 4TW7A 1YW5A 5DITA 2PV2A 4DRPA 2XPAA 3I6CA 3O5JA 4U86A 5HKGA 1U79A 2PPNA 1PINA 3IKDA 3UI5A 1NMWA 3GPKA 4DZ3A 2F2DA 3UF8A 1JVWA 4IPXA 4O2TA 1FKDA 4TX0A 2PV3A 4NNRA 5HTGA 4ITZA 4ODLA 4J4NA 4ODPA 4MSPA 1QZ2A 2KR7A 3ODKA 4GGQA 4IQ2A 1C9HA 1FKLA 4MGVA 2ZR4A 5DIUA 2JZVA 3O5PA 3KAHA 1BL4A 2VCDA 2K8IA 1YATA 2PPOA 5HW6A 5HUAA 3O5RA 1JNTA 3CGNA 1EQ3A 3KAIA 1J6YA 4FN2A 2FKEA 2XP7A 4LAVA 2RUQA 4JFIA 3LUOA 3JYMA 3O5FA 4ODKA 1KT0A 1B6CA 4QIBA 3WH0A 2MLZA 3O5DA 4TW8A 4BF8A 4DZ2A 1QPFA 3KADA 3O5KA 2ZR6A 2M08A 4DRIA 1L1PA 2M2AA 1D7HA 1Q6IA 2KE0A 5B8IC 5BXJA 5HW8A 2RSEA 4JFKA 1J4IA 2PPPA 1F8AB 4U85A 3UQIA 2ZQUA 3KZ7A 2M1IA 4TYOA 3O5LA 2XP3A 4DRJA 2F21A 2KGJA 2AWGA 2ITKA 3TC5A 2LKNA 2RQSA 1P5QA 1FKIA 3FAPA 4DRNA 5DIVA 2MLYA 4JFLA 4G2PA 4JFJA 2D9FA 4DRQA 2XP5A 1Q1CA 2Y78A 5GPGA 1FKTA 3KABA 3O5OA 5HT1A 2DG3A 3KAFA 3RFWA 2KFWA 1PBKA 1M5YA 1FKKA 1Y0OA 2ZR5A 1J4RA 1KT1A 4C02B 3JYJA 5HWCA 1JNSA 3KCEA 1FD9A 1D6OA 4ODRA 2RUCA 3O5EA 3PRDA 3IK8A 3TDBA 1FKGA 2XP9A 1QPLA 4DRMA 4ODMA 2PBCA 1N1AA 3KACA 4GIVA 3IKGA 4W9QA 4W9OA 2N87A 1ROTA 1D7IA 4G50A 4DRHA 2DG4A 3KAGA 1BKFA 2ZQVA 1F40A 1TCOC 1J4HA 2LPVA 3NTPA 5D75A 3IHZA 2LJ4A 4JYSA 4N19A 1NMVA 2L2SA 4LAWA 4ODNA 1HXVA 1FKBA 3B7XA 2MPHA 4LAXA 3RGCA 1ROUA 2PV1A 2MF9A 2XPBA 3PA7A 3O5MA 2XP4A 3TCZA 4TW6A 4IQCA 4DIPA 5J6EA 5I98A 1A7XA 4FAPA 3NI6A 2KI3A 1FKFA 2OFNA 1FKRA 4LAYA 2FAPA 2DG9A 4DROA 2IF4A 4J4OA 3UI6A 1FJDA 2UZ5A 4R0XA 1NSGA 3OOBA 2VN1A 2ZQTA 3JXVA 4DT4A 2MLXA 1D7JA 1FAPA 2MNTA 4JFMA 4W9PA 3UI4A 1ZCNA 2KO7A 2RURA 2XP8A 4DRKA 3PRBA 3UQBA 1Q6HA 4ODOA 1R9HA 1FKSA 4ODQA 2XP6A 2ZQSA 1FKHA 3EY6A 3O5QA 3VAWA 1T11A 1FKJA 4QT3A 4DH0A 3MDYB 3O5GA 5HWBA 2F4EA 1W26A 3H9RB 4TNSA 2LGOA 1EYMA 1Q6UA 2Q5AA 5HW7A
chains in the Genus database with same CATH superfamily
4QT2A 3B9DA 3UQAA 4U84A 2AOSA 3CGMA 2DT0A 4ZS6A 4ML4A 1H0IA 4DZ3A 4O2TA 3GU0A 4ODLA 4ODPA 1QZ2A 1C9HA 2DT2A 2JZVA 4P8UA 3KAHA 2VCDA 5HW6A 3BMBA 1EQ3A 1XHGA 2IUZA 4XAKA 1J6YA 1X6NA 4MNLA 4LAVA 2RUQA 4ODKA 2A3EA 1KT0A 4Z2IA 2MLZA 4TW8A 4DRIA 2M2AA 3GTYX 1HKKA 5HW8A 4JFKA 1F8AB 3KZ7A 2AWGA 2LKNA 2RQSA 1P5QA 3FAPA 5DIVA 2D9FA 2XP5A 1Q1CA 4DT4A 5GPGA 5HT1A 1PBKA 1NWSA 1M5YA 1FKKA 1W1PA 1JNSA 3JYJA 2EULA 1FD9A 1D6OA 1W1TA 4ODRA 4PTMA 3B9EA 2RUCA 4ZPVR 3PRDA 3TDBA 1FKGA 1GRJA 4W5UA 1N1AA 2N87A 2ESCA 1OGBA 2DG4A 3CHFA 3KAGA 1BKFA 1E6NA 1F40A 1TCOC 3WIJA 3AS1A 3IHZA 4DWSD 5JH8A 1ITXA 4N19A 2L2SA 4ODNA 2PV1A 2MF9A 1JNEA 2DPEA 4AY1A 1LL7A 5J6EA 3NI6A 1FKFA 1FKRA 5GPRA 1ZBVA 4DROA 1NH6A 4J4OA 1ZB5A 4R0XA 4WJXA 2VN1A 3BXWA 2MLXA 2DT3A 4MNMA 4ZPWR 4ODQA 2XP6A 3ARZA 4MAVA 2DT1A 3FXYA 5HBFA 1FKJA 3O5GA 5HWBA 1W1YA 4NZCA 3PR9A 2LGOA 3CHCA 1Q6UA 2Q5AA 5HW7A 4URIA 1ZBCA 4QZVB 1LJYA 1RD6A 4DRPA 2A3BA 2O92A 3IKDA 1NMWA 3GPKA 3CHEA 1VF8A 1JVWA 4IPXA 4TX0A 1FKDA 4NNRA 4ITZA 4J4NA 1LL4A 4MSPA 2KR7A 4MGVA 3AQUA 4DWSC 3O5PA 3ARSA 1BL4A 4Z2GA 2K8IA 5HUAA 3KAIA 1WAWA 3ARYA 4JFIA 2O9OA 3JYMA 4DZ2A 1L1PA 4S3JA 5BXJA 1GOIA 4U85A 1W1VA 4UDMA 4TYOA 1ZL1A 2F21A 2ITKA 3RM4A 3WL1A 1FKIA 1HKJA 4JFLA 4G2PA 1UR8A 4C02B 1E6PA 2DG3A 3OA5A 2ZR5A 1Y0OA 2YBUA 3KCEA 4P8VA 1IX5A 3IK8A 2XP9A 1QPLA 1K9TA 4W9QA 3IKGA 4DRHA 2B5UB 2ZQVA 5DEZA 1OGGA 4R5EA 2LJ4A 4JYSA 3RGCA 4LAXA 2MPHA 3WD2A 5DO2A 1ROUA 2WLZA 3TCZA 4IQCA 4DIPA 3QOKA 5I98A 4HBOA 4FAPA 3ARTA 2FAPA 2DG9A 1CTNA 1SR0A 3UI6A 2UZ5A 2ZQTA 4JFMA 1EIBA 1ZCNA 3WD3A 4DRKA 3B8SA 4IT6A 1FKSA 2A3AA 2ZQSA 3CZ8A 3VAWA 1T11A 4DH0A 2WLYA 1HJVA 1W26A 3H9RB 1EYMA 1HJXA 1HKMA 1LG1A 3WD4A 2PN0A 1ZK6A 1JCHB 2RUDA 1E6ZA 1YW5A 2XPAA 4NSBA 4U86A 1U79A 3UI5A 5DF0A 2F2DA 1HJWA 5HTGA 4WKHA 4GGQA 1EDQA 5DIUA 2ZR4A 1W9UA 2YBTA 2OLHA 4DWSB 1GPFA 1H0GA 1EHNA 2DSWA 2FKEA 3ARRA 3FY1A 4WKAA 3LUOA 2DSZA 3O5FA 4QIBA 4MNJA 3KADA 3O5KA 2M08A 4Z2KA 2KE0A 1E15A 2RSEA 2ZQUA 3O5LA 2XP3A 2KGJA 4DRNA 1WNOA 4KQZA 3RFWA 4WKFA 2ETNA 3KAFA 1ZBKA 3ARXA 2QF8A 1E44A 2PBCA 4Q22A 4GIVA 1OWQA 1ROTA 1D7IA 4G50A 1J4HA 1XRVA 2LPVA 3NTPA 3ARQA 5D75A 1LQ0A 4ZPTR 4L72B 3WQVA 1NMVA 3PRAA 1HXVA 1LL6A 3PA7A 3O5MA 1SYTA 4LGXA 4WIWA 4HBEA 5GQBA 2OFNA 4LAYA 2IF4A 3OOBA 1ZBWA 1NWTA 1D7JA 1FAPA 2MNTA 4W9PA 3UI4A 1GUVA 4DWSA 2KO7A 1X6LA 2RURA 3UQBA 3PRBA 3EY6A 3AS0A 1HKIA 4Z2HA 4Z2JA 1W9VA 4QT3A 3MDYB 4TNSA 2WM0A 3AS2A 1WB0A 3NRKA 3O5IA 2A3CA 3WKZA 4TW7A 5DITA 2PV2A 3W4RA 3O5JA 3B9AA 3I6CA 5HKGA 2PPNA 1PINA 1UR9A 3UF8A 1E9LA 2PV3A 4KR0B 4Q7NA 3ODKA 4IQ2A 1FKLA 2G41A 2PPOA 1YATA 1KFWA 3O5RA 1JNTA 3CGNA 2P4VA 4FN2A 2XP7A 1TFVA 1B6CA 3G6LA 3WH0A 3O5DA 4L3NA 4BF8A 1QPFA 3ALFA 2ZR6A 4P8XA 1JNDA 2PI6A 1D7HA 1Q6IA 5B8IC 1J4IA 2G8ZA 2PPPA 3UQIA 3CHDA 2M1IA 3EIPA 2WK2A 4DRJA 3TC5A 2MLYA 4JFJA 4DRQA 4IT4A 2Y78A 1FKTA 3KABA 3O5OA 3ARUA 2KFWA 1O6IA 3ALGA 1J4RA 1KT1A 5HWCA 1FFQA 3ARPA 3O5EA 1LG2A 4DRMA 4ODMA 3KACA 2B31A 4W9OA 3AROA 3ARWA 3WD1A 1NWUA 4LAWA 1FKBA 3B7XA 1D2KA 1FFRA 3ARVA 2XPBA 2XP4A 4TW6A 1A7XA 2KI3A 3AS3A 4MTVA 3G6MA 1E6RA 1ZU8A 3RMEA 3WD0A 1FJDA 3RM8A 1NSGA 4Z2LA 3JXVA 4HARA 1NWRA 4S3KA 2XP8A 1Q6HA 4ODOA 3RM9A 1R9HA 1FKHA 2DSUA 4WK9A 3O5QA 3WQWA 4MNKA 4MPKA 2FDMA 1W9PA 2F4EA 3WL0A 2DSVA 3CH9A 4P8WA 2F23A
chains in the Genus database with same CATH topology
4QT2A 3B9DA 3UQAA 4U84A 2AOSA 3CGMA 2DT0A 4ZS6A 4ML4A 1H0IA 4DZ3A 4O2TA 4ODLA 4ODPA 1QZ2A 1C9HA 2DT2A 2JZVA 4P8UA 3KAHA 2VCDA 5HW6A 1EQ3A 1XHGA 2IUZA 4XAKA 1J6YA 1X6NA 4MNLA 4LAVA 2RUQA 4ODKA 2A3EA 1KT0A 4Z2IA 2MLZA 4TW8A 4DRIA 2M2AA 1HKKA 5HW8A 4JFKA 1F8AB 3KZ7A 2AWGA 2LKNA 2RQSA 1P5QA 3FAPA 5DIVA 2D9FA 2XP5A 1Q1CA 4DT4A 5GPGA 5HT1A 1PBKA 1NWSA 1M5YA 1FKKA 1W1PA 1JNSA 3JYJA 1FD9A 1D6OA 1W1TA 4ODRA 4PTMA 3B9EA 2RUCA 4ZPVR 3PRDA 3TDBA 1FKGA 4W5UA 1N1AA 2N87A 2ESCA 1OGBA 2DG4A 3CHFA 3KAGA 1BKFA 1E6NA 1F40A 1TCOC 3WIJA 3AS1A 3IHZA 4DWSD 5JH8A 1ITXA 4N19A 2L2SA 4ODNA 2PV1A 2MF9A 1JNEA 2DPEA 4AY1A 1LL7A 5J6EA 3NI6A 1FKFA 1FKRA 5GPRA 1ZBVA 4DROA 1NH6A 4J4OA 1ZB5A 4R0XA 4WJXA 2VN1A 3BXWA 2MLXA 2DT3A 4MNMA 4ZPWR 4ODQA 2XP6A 3ARZA 4MAVA 2DT1A 3FXYA 5HBFA 1FKJA 3O5GA 5HWBA 1W1YA 4NZCA 3PR9A 2LGOA 3CHCA 1Q6UA 2Q5AA 5HW7A 4URIA 1ZBCA 4QZVB 1LJYA 1RD6A 4DRPA 2A3BA 2O92A 3IKDA 1NMWA 3GPKA 3CHEA 1VF8A 1JVWA 4IPXA 4TX0A 1FKDA 4NNRA 4ITZA 4J4NA 1LL4A 4MSPA 2KR7A 4MGVA 3AQUA 4DWSC 3O5PA 3ARSA 1BL4A 4Z2GA 2K8IA 5HUAA 3KAIA 1WAWA 3ARYA 4JFIA 2O9OA 3JYMA 4DZ2A 1L1PA 4S3JA 5BXJA 1GOIA 4U85A 1W1VA 4TYOA 1ZL1A 2F21A 2ITKA 3RM4A 3WL1A 1FKIA 1HKJA 4JFLA 4G2PA 1UR8A 4C02B 1E6PA 2DG3A 3OA5A 2ZR5A 1Y0OA 2YBUA 3KCEA 4P8VA 1IX5A 3IK8A 2XP9A 1QPLA 1K9TA 4W9QA 3IKGA 4DRHA 2ZQVA 5DEZA 1OGGA 4R5EA 2LJ4A 4JYSA 3RGCA 4LAXA 2MPHA 3WD2A 5DO2A 1ROUA 2WLZA 3TCZA 4IQCA 4DIPA 3QOKA 5I98A 4HBOA 4FAPA 3ARTA 2FAPA 2DG9A 1CTNA 1SR0A 3UI6A 2UZ5A 2ZQTA 4JFMA 1EIBA 1ZCNA 3WD3A 4DRKA 3B8SA 4IT6A 1FKSA 2A3AA 2ZQSA 3CZ8A 3VAWA 1T11A 4DH0A 2WLYA 1HJVA 1W26A 3H9RB 1EYMA 1HJXA 1HKMA 1LG1A 3WD4A 1ZK6A 2RUDA 1E6ZA 1YW5A 2XPAA 4NSBA 4U86A 1U79A 3UI5A 5DF0A 2F2DA 1HJWA 5HTGA 4WKHA 4GGQA 1EDQA 5DIUA 2ZR4A 1W9UA 2YBTA 2OLHA 4DWSB 1GPFA 1H0GA 1EHNA 2DSWA 2FKEA 3ARRA 3FY1A 4WKAA 3LUOA 2DSZA 3O5FA 4QIBA 4MNJA 3KADA 3O5KA 2M08A 4Z2KA 2KE0A 1E15A 2RSEA 2ZQUA 3O5LA 2XP3A 2KGJA 4DRNA 1WNOA 4KQZA 3RFWA 4WKFA 3KAFA 1ZBKA 3ARXA 2QF8A 2PBCA 4Q22A 4GIVA 1OWQA 1ROTA 1D7IA 4G50A 1J4HA 1XRVA 2LPVA 3NTPA 3ARQA 5D75A 1LQ0A 4ZPTR 4L72B 3WQVA 1NMVA 3PRAA 1HXVA 1LL6A 3PA7A 3O5MA 1SYTA 4LGXA 4WIWA 4HBEA 5GQBA 2OFNA 4LAYA 2IF4A 3OOBA 1ZBWA 1NWTA 1D7JA 1FAPA 2MNTA 4W9PA 3UI4A 1GUVA 4DWSA 2KO7A 1X6LA 2RURA 3UQBA 3PRBA 3EY6A 3AS0A 1HKIA 4Z2HA 4Z2JA 1W9VA 4QT3A 3MDYB 4TNSA 2WM0A 3AS2A 1WB0A 3NRKA 3O5IA 2A3CA 3WKZA 4TW7A 5DITA 2PV2A 3W4RA 3O5JA 3B9AA 3I6CA 5HKGA 2PPNA 1PINA 1UR9A 3UF8A 1E9LA 2PV3A 4KR0B 4Q7NA 3ODKA 4IQ2A 1FKLA 2G41A 2PPOA 1YATA 1KFWA 3O5RA 1JNTA 3CGNA 4FN2A 2XP7A 1TFVA 1B6CA 3G6LA 3WH0A 3O5DA 4L3NA 4BF8A 1QPFA 3ALFA 2ZR6A 4P8XA 1JNDA 2PI6A 1D7HA 1Q6IA 5B8IC 1J4IA 2G8ZA 2PPPA 3UQIA 3CHDA 2M1IA 2WK2A 4DRJA 3TC5A 2MLYA 4JFJA 4DRQA 4IT4A 2Y78A 1FKTA 3KABA 3O5OA 3ARUA 2KFWA 1O6IA 3ALGA 1J4RA 1KT1A 5HWCA 1FFQA 3ARPA 3O5EA 1LG2A 4DRMA 4ODMA 3KACA 2B31A 4W9OA 3AROA 3ARWA 3WD1A 1NWUA 4LAWA 1FKBA 3B7XA 1D2KA 1FFRA 3ARVA 2XPBA 2XP4A 4TW6A 1A7XA 2KI3A 3AS3A 4MTVA 3G6MA 1E6RA 1ZU8A 3RMEA 3WD0A 1FJDA 3RM8A 1NSGA 4Z2LA 3JXVA 4HARA 1NWRA 4S3KA 2XP8A 1Q6HA 4ODOA 3RM9A 1R9HA 1FKHA 2DSUA 4WK9A 3O5QA 3WQWA 4MNKA 4MPKA 2FDMA 1W9PA 2F4EA 3WL0A 2DSVA 3CH9A 4P8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QT2 A;  1ZK6 A;  3NRK A;  3UQA A;  3O5I A;  2RUD A;  4U84 A;  3CGM A;  4TW7 A;  1YW5 A;  5DIT A;  2PV2 A;  4DRP A;  2XPA A;  3I6C A;  3O5J A;  4U86 A;  5HKG A;  1U79 A;  2PPN A;  1PIN A;  3IKD A;  3UI5 A;  1NMW A;  3GPK A;  4DZ3 A;  2F2D A;  3UF8 A;  1JVW A;  4IPX A;  4O2T A;  1FKD A;  4TX0 A;  2PV3 A;  4NNR A;  5HTG A;  4ITZ A;  4ODL A;  4J4N A;  4ODP A;  4MSP A;  1QZ2 A;  2KR7 A;  3ODK A;  4GGQ A;  4IQ2 A;  1C9H A;  1FKL A;  4MGV A;  2ZR4 A;  5DIU A;  2JZV A;  3O5P A;  3KAH A;  1BL4 A;  2VCD A;  2K8I A;  1YAT A;  2PPO A;  5HW6 A;  5HUA A;  3O5R A;  1JNT A;  3CGN A;  1EQ3 A;  3KAI A;  1J6Y A;  4FN2 A;  2FKE A;  2XP7 A;  4LAV A;  2RUQ A;  4JFI A;  3LUO A;  3JYM A;  3O5F A;  4ODK A;  1KT0 A;  1B6C A;  4QIB A;  3WH0 A;  2MLZ A;  3O5D A;  4TW8 A;  4BF8 A;  4DZ2 A;  1QPF A;  3KAD A;  3O5K A;  2ZR6 A;  2M08 A;  4DRI A;  1L1P A;  2M2A A;  1D7H A;  1Q6I A;  2KE0 A;  5B8I C;  5BXJ A;  5HW8 A;  2RSE A;  4JFK A;  1J4I A;  2PPP A;  1F8A B;  4U85 A;  3UQI A;  2ZQU A;  3KZ7 A;  2M1I A;  4TYO A;  3O5L A;  2XP3 A;  4DRJ A;  2F21 A;  2KGJ A;  2AWG A;  2ITK A;  3TC5 A;  2LKN A;  2RQS A;  1P5Q A;  1FKI A;  3FAP A;  4DRN A;  5DIV A;  2MLY A;  4JFL A;  4G2P A;  4JFJ A;  2D9F A;  4DRQ A;  2XP5 A;  1Q1C A;  2Y78 A;  5GPG A;  1FKT A;  3KAB A;  3O5O A;  5HT1 A;  2DG3 A;  3KAF A;  3RFW A;  2KFW A;  1PBK A;  1M5Y A;  1FKK A;  1Y0O A;  2ZR5 A;  1J4R A;  1KT1 A;  4C02 B;  3JYJ A;  5HWC A;  1JNS A;  3KCE A;  1FD9 A;  1D6O A;  4ODR A;  2RUC A;  3O5E A;  3PRD A;  3IK8 A;  3TDB A;  1FKG A;  2XP9 A;  1QPL A;  4DRM A;  4ODM A;  2PBC A;  1N1A A;  3KAC A;  4GIV A;  3IKG A;  4W9Q A;  4W9O A;  2N87 A;  1ROT A;  1D7I A;  4G50 A;  4DRH A;  2DG4 A;  3KAG A;  1BKF A;  2ZQV A;  1F40 A;  1TCO C;  1J4H A;  2LPV A;  3NTP A;  5D75 A;  3IHZ A;  2LJ4 A;  4JYS A;  4N19 A;  1NMV A;  2L2S A;  4LAW A;  4ODN A;  1HXV A;  1FKB A;  3B7X A;  2MPH A;  4LAX A;  3RGC A;  1ROU A;  2PV1 A;  2MF9 A;  2XPB A;  3PA7 A;  3O5M A;  2XP4 A;  3TCZ A;  4TW6 A;  4IQC A;  4DIP A;  5J6E A;  5I98 A;  1A7X A;  4FAP A;  3NI6 A;  2KI3 A;  1FKF A;  2OFN A;  1FKR A;  4LAY A;  2FAP A;  2DG9 A;  4DRO A;  2IF4 A;  4J4O A;  3UI6 A;  1FJD A;  2UZ5 A;  4R0X A;  1NSG A;  3OOB A;  2VN1 A;  2ZQT A;  3JXV A;  4DT4 A;  2MLX A;  1D7J A;  1FAP A;  2MNT A;  4JFM A;  4W9P A;  3UI4 A;  1ZCN A;  2KO7 A;  2RUR A;  2XP8 A;  4DRK A;  3PRB A;  3UQB A;  1Q6H A;  4ODO A;  1R9H A;  1FKS A;  4ODQ A;  2XP6 A;  2ZQS A;  1FKH A;  3EY6 A;  3O5Q A;  3VAW A;  1T11 A;  1FKJ A;  4QT3 A;  4DH0 A;  3MDY B;  3O5G A;  5HWB A;  2F4E A;  1W26 A;  3H9R B;  4TNS A;  2LGO A;  1EYM A;  1Q6U A;  2Q5A A;  5HW7 A; 
#chains in the Genus database with same CATH topology
 4QT2 A;  3B9D A;  3UQA A;  4U84 A;  2AOS A;  3CGM A;  2DT0 A;  4ZS6 A;  4ML4 A;  1H0I A;  4DZ3 A;  4O2T A;  3GU0 A;  4ODL A;  4ODP A;  1QZ2 A;  1C9H A;  2DT2 A;  2JZV A;  4P8U A;  3KAH A;  2VCD A;  5HW6 A;  3BMB A;  1EQ3 A;  1XHG A;  2IUZ A;  4XAK A;  1J6Y A;  1X6N A;  4MNL A;  4LAV A;  2RUQ A;  4ODK A;  2A3E A;  1KT0 A;  4Z2I A;  2MLZ A;  4TW8 A;  4DRI A;  2M2A A;  3GTY X;  1HKK A;  5HW8 A;  4JFK A;  1F8A B;  3KZ7 A;  2AWG A;  2LKN A;  2RQS A;  1P5Q A;  3FAP A;  5DIV A;  2D9F A;  2XP5 A;  1Q1C A;  4DT4 A;  5GPG A;  5HT1 A;  1PBK A;  1NWS A;  1M5Y A;  1FKK A;  1W1P A;  1JNS A;  3JYJ A;  2EUL A;  1FD9 A;  1D6O A;  1W1T A;  4ODR A;  4PTM A;  3B9E A;  2RUC A;  4ZPV R;  3PRD A;  3TDB A;  1FKG A;  1GRJ A;  4W5U A;  1N1A A;  2N87 A;  2ESC A;  1OGB A;  2DG4 A;  3CHF A;  3KAG A;  1BKF A;  1E6N A;  1F40 A;  1TCO C;  3WIJ A;  3AS1 A;  3IHZ A;  4DWS D;  5JH8 A;  1ITX A;  4N19 A;  2L2S A;  4ODN A;  2PV1 A;  2MF9 A;  1JNE A;  2DPE A;  4AY1 A;  1LL7 A;  5J6E A;  3NI6 A;  1FKF A;  1FKR A;  5GPR A;  1ZBV A;  4DRO A;  1NH6 A;  4J4O A;  1ZB5 A;  4R0X A;  4WJX A;  2VN1 A;  3BXW A;  2MLX A;  2DT3 A;  4MNM A;  4ZPW R;  4ODQ A;  2XP6 A;  3ARZ A;  4MAV A;  2DT1 A;  3FXY A;  5HBF A;  1FKJ A;  3O5G A;  5HWB A;  1W1Y A;  4NZC A;  3PR9 A;  2LGO A;  3CHC A;  1Q6U A;  2Q5A A;  5HW7 A;  4URI A;  1ZBC A;  4QZV B;  1LJY A;  1RD6 A;  4DRP A;  2A3B A;  2O92 A;  3IKD A;  1NMW A;  3GPK A;  3CHE A;  1VF8 A;  1JVW A;  4IPX A;  4TX0 A;  1FKD A;  4NNR A;  4ITZ A;  4J4N A;  1LL4 A;  4MSP A;  2KR7 A;  4MGV A;  3AQU A;  4DWS C;  3O5P A;  3ARS A;  1BL4 A;  4Z2G A;  2K8I A;  5HUA A;  3KAI A;  1WAW A;  3ARY A;  4JFI A;  2O9O A;  3JYM A;  4DZ2 A;  1L1P A;  4S3J A;  5BXJ A;  1GOI A;  4U85 A;  1W1V A;  4UDM A;  4TYO A;  1ZL1 A;  2F21 A;  2ITK A;  3RM4 A;  3WL1 A;  1FKI A;  1HKJ A;  4JFL A;  4G2P A;  1UR8 A;  4C02 B;  1E6P A;  2DG3 A;  3OA5 A;  2ZR5 A;  1Y0O A;  2YBU A;  3KCE A;  4P8V A;  1IX5 A;  3IK8 A;  2XP9 A;  1QPL A;  1K9T A;  4W9Q A;  3IKG A;  4DRH A;  2B5U B;  2ZQV A;  5DEZ A;  1OGG A;  4R5E A;  2LJ4 A;  4JYS A;  3RGC A;  4LAX A;  2MPH A;  3WD2 A;  5DO2 A;  1ROU A;  2WLZ A;  3TCZ A;  4IQC A;  4DIP A;  3QOK A;  5I98 A;  4HBO A;  4FAP A;  3ART A;  2FAP A;  2DG9 A;  1CTN A;  1SR0 A;  3UI6 A;  2UZ5 A;  2ZQT A;  4JFM A;  1EIB A;  1ZCN A;  3WD3 A;  4DRK A;  3B8S A;  4IT6 A;  1FKS A;  2A3A A;  2ZQS A;  3CZ8 A;  3VAW A;  1T11 A;  4DH0 A;  2WLY A;  1HJV A;  1W26 A;  3H9R B;  1EYM A;  1HJX A;  1HKM A;  1LG1 A;  3WD4 A;  2PN0 A;  1ZK6 A;  1JCH B;  2RUD A;  1E6Z A;  1YW5 A;  2XPA A;  4NSB A;  4U86 A;  1U79 A;  3UI5 A;  5DF0 A;  2F2D A;  1HJW A;  5HTG A;  4WKH A;  4GGQ A;  1EDQ A;  5DIU A;  2ZR4 A;  1W9U A;  2YBT A;  2OLH A;  4DWS B;  1GPF A;  1H0G A;  1EHN A;  2DSW A;  2FKE A;  3ARR A;  3FY1 A;  4WKA A;  3LUO A;  2DSZ A;  3O5F A;  4QIB A;  4MNJ A;  3KAD A;  3O5K A;  2M08 A;  4Z2K A;  2KE0 A;  1E15 A;  2RSE A;  2ZQU A;  3O5L A;  2XP3 A;  2KGJ A;  4DRN A;  1WNO A;  4KQZ A;  3RFW A;  4WKF A;  2ETN A;  3KAF A;  1ZBK A;  3ARX A;  2QF8 A;  1E44 A;  2PBC A;  4Q22 A;  4GIV A;  1OWQ A;  1ROT A;  1D7I A;  4G50 A;  1J4H A;  1XRV A;  2LPV A;  3NTP A;  3ARQ A;  5D75 A;  1LQ0 A;  4ZPT R;  4L72 B;  3WQV A;  1NMV A;  3PRA A;  1HXV A;  1LL6 A;  3PA7 A;  3O5M A;  1SYT A;  4LGX A;  4WIW A;  4HBE A;  5GQB A;  2OFN A;  4LAY A;  2IF4 A;  3OOB A;  1ZBW A;  1NWT A;  1D7J A;  1FAP A;  2MNT A;  4W9P A;  3UI4 A;  1GUV A;  4DWS A;  2KO7 A;  1X6L A;  2RUR A;  3UQB A;  3PRB A;  3EY6 A;  3AS0 A;  1HKI A;  4Z2H A;  4Z2J A;  1W9V A;  4QT3 A;  3MDY B;  4TNS A;  2WM0 A;  3AS2 A;  1WB0 A;  3NRK A;  3O5I A;  2A3C A;  3WKZ A;  4TW7 A;  5DIT A;  2PV2 A;  3W4R A;  3O5J A;  3B9A A;  3I6C A;  5HKG A;  2PPN A;  1PIN A;  1UR9 A;  3UF8 A;  1E9L A;  2PV3 A;  4KR0 B;  4Q7N A;  3ODK A;  4IQ2 A;  1FKL A;  2G41 A;  2PPO A;  1YAT A;  1KFW A;  3O5R A;  1JNT A;  3CGN A;  2P4V A;  4FN2 A;  2XP7 A;  1TFV A;  1B6C A;  3G6L A;  3WH0 A;  3O5D A;  4L3N A;  4BF8 A;  1QPF A;  3ALF A;  2ZR6 A;  4P8X A;  1JND A;  2PI6 A;  1D7H A;  1Q6I A;  5B8I C;  1J4I A;  2G8Z A;  2PPP A;  3UQI A;  3CHD A;  2M1I A;  3EIP A;  2WK2 A;  4DRJ A;  3TC5 A;  2MLY A;  4JFJ A;  4DRQ A;  4IT4 A;  2Y78 A;  1FKT A;  3KAB A;  3O5O A;  3ARU A;  2KFW A;  1O6I A;  3ALG A;  1J4R A;  1KT1 A;  5HWC A;  1FFQ A;  3ARP A;  3O5E A;  1LG2 A;  4DRM A;  4ODM A;  3KAC A;  2B31 A;  4W9O A;  3ARO A;  3ARW A;  3WD1 A;  1NWU A;  4LAW A;  1FKB A;  3B7X A;  1D2K A;  1FFR A;  3ARV A;  2XPB A;  2XP4 A;  4TW6 A;  1A7X A;  2KI3 A;  3AS3 A;  4MTV A;  3G6M A;  1E6R A;  1ZU8 A;  3RME A;  3WD0 A;  1FJD A;  3RM8 A;  1NSG A;  4Z2L A;  3JXV A;  4HAR A;  1NWR A;  4S3K A;  2XP8 A;  1Q6H A;  4ODO A;  3RM9 A;  1R9H A;  1FKH A;  2DSU A;  4WK9 A;  3O5Q A;  3WQW A;  4MNK A;  4MPK A;  2FDM A;  1W9P A;  2F4E A;  3WL0 A;  2DSV A;  3CH9 A;  4P8W A;  2F23 A; 
#chains in the Genus database with same CATH homology
 4QT2 A;  3B9D A;  3UQA A;  4U84 A;  2AOS A;  3CGM A;  2DT0 A;  4ZS6 A;  4ML4 A;  1H0I A;  4DZ3 A;  4O2T A;  4ODL A;  4ODP A;  1QZ2 A;  1C9H A;  2DT2 A;  2JZV A;  4P8U A;  3KAH A;  2VCD A;  5HW6 A;  1EQ3 A;  1XHG A;  2IUZ A;  4XAK A;  1J6Y A;  1X6N A;  4MNL A;  4LAV A;  2RUQ A;  4ODK A;  2A3E A;  1KT0 A;  4Z2I A;  2MLZ A;  4TW8 A;  4DRI A;  2M2A A;  1HKK A;  5HW8 A;  4JFK A;  1F8A B;  3KZ7 A;  2AWG A;  2LKN A;  2RQS A;  1P5Q A;  3FAP A;  5DIV A;  2D9F A;  2XP5 A;  1Q1C A;  4DT4 A;  5GPG A;  5HT1 A;  1PBK A;  1NWS A;  1M5Y A;  1FKK A;  1W1P A;  1JNS A;  3JYJ A;  1FD9 A;  1D6O A;  1W1T A;  4ODR A;  4PTM A;  3B9E A;  2RUC A;  4ZPV R;  3PRD A;  3TDB A;  1FKG A;  4W5U A;  1N1A A;  2N87 A;  2ESC A;  1OGB A;  2DG4 A;  3CHF A;  3KAG A;  1BKF A;  1E6N A;  1F40 A;  1TCO C;  3WIJ A;  3AS1 A;  3IHZ A;  4DWS D;  5JH8 A;  1ITX A;  4N19 A;  2L2S A;  4ODN A;  2PV1 A;  2MF9 A;  1JNE A;  2DPE A;  4AY1 A;  1LL7 A;  5J6E A;  3NI6 A;  1FKF A;  1FKR A;  5GPR A;  1ZBV A;  4DRO A;  1NH6 A;  4J4O A;  1ZB5 A;  4R0X A;  4WJX A;  2VN1 A;  3BXW A;  2MLX A;  2DT3 A;  4MNM A;  4ZPW R;  4ODQ A;  2XP6 A;  3ARZ A;  4MAV A;  2DT1 A;  3FXY A;  5HBF A;  1FKJ A;  3O5G A;  5HWB A;  1W1Y A;  4NZC A;  3PR9 A;  2LGO A;  3CHC A;  1Q6U A;  2Q5A A;  5HW7 A;  4URI A;  1ZBC A;  4QZV B;  1LJY A;  1RD6 A;  4DRP A;  2A3B A;  2O92 A;  3IKD A;  1NMW A;  3GPK A;  3CHE A;  1VF8 A;  1JVW A;  4IPX A;  4TX0 A;  1FKD A;  4NNR A;  4ITZ A;  4J4N A;  1LL4 A;  4MSP A;  2KR7 A;  4MGV A;  3AQU A;  4DWS C;  3O5P A;  3ARS A;  1BL4 A;  4Z2G A;  2K8I A;  5HUA A;  3KAI A;  1WAW A;  3ARY A;  4JFI A;  2O9O A;  3JYM A;  4DZ2 A;  1L1P A;  4S3J A;  5BXJ A;  1GOI A;  4U85 A;  1W1V A;  4TYO A;  1ZL1 A;  2F21 A;  2ITK A;  3RM4 A;  3WL1 A;  1FKI A;  1HKJ A;  4JFL A;  4G2P A;  1UR8 A;  4C02 B;  1E6P A;  2DG3 A;  3OA5 A;  2ZR5 A;  1Y0O A;  2YBU A;  3KCE A;  4P8V A;  1IX5 A;  3IK8 A;  2XP9 A;  1QPL A;  1K9T A;  4W9Q A;  3IKG A;  4DRH A;  2ZQV A;  5DEZ A;  1OGG A;  4R5E A;  2LJ4 A;  4JYS A;  3RGC A;  4LAX A;  2MPH A;  3WD2 A;  5DO2 A;  1ROU A;  2WLZ A;  3TCZ A;  4IQC A;  4DIP A;  3QOK A;  5I98 A;  4HBO A;  4FAP A;  3ART A;  2FAP A;  2DG9 A;  1CTN A;  1SR0 A;  3UI6 A;  2UZ5 A;  2ZQT A;  4JFM A;  1EIB A;  1ZCN A;  3WD3 A;  4DRK A;  3B8S A;  4IT6 A;  1FKS A;  2A3A A;  2ZQS A;  3CZ8 A;  3VAW A;  1T11 A;  4DH0 A;  2WLY A;  1HJV A;  1W26 A;  3H9R B;  1EYM A;  1HJX A;  1HKM A;  1LG1 A;  3WD4 A;  1ZK6 A;  2RUD A;  1E6Z A;  1YW5 A;  2XPA A;  4NSB A;  4U86 A;  1U79 A;  3UI5 A;  5DF0 A;  2F2D A;  1HJW A;  5HTG A;  4WKH A;  4GGQ A;  1EDQ A;  5DIU A;  2ZR4 A;  1W9U A;  2YBT A;  2OLH A;  4DWS B;  1GPF A;  1H0G A;  1EHN A;  2DSW A;  2FKE A;  3ARR A;  3FY1 A;  4WKA A;  3LUO A;  2DSZ A;  3O5F A;  4QIB A;  4MNJ A;  3KAD A;  3O5K A;  2M08 A;  4Z2K A;  2KE0 A;  1E15 A;  2RSE A;  2ZQU A;  3O5L A;  2XP3 A;  2KGJ A;  4DRN A;  1WNO A;  4KQZ A;  3RFW A;  4WKF A;  3KAF A;  1ZBK A;  3ARX A;  2QF8 A;  2PBC A;  4Q22 A;  4GIV A;  1OWQ A;  1ROT A;  1D7I A;  4G50 A;  1J4H A;  1XRV A;  2LPV A;  3NTP A;  3ARQ A;  5D75 A;  1LQ0 A;  4ZPT R;  4L72 B;  3WQV A;  1NMV A;  3PRA A;  1HXV A;  1LL6 A;  3PA7 A;  3O5M A;  1SYT A;  4LGX A;  4WIW A;  4HBE A;  5GQB A;  2OFN A;  4LAY A;  2IF4 A;  3OOB A;  1ZBW A;  1NWT A;  1D7J A;  1FAP A;  2MNT A;  4W9P A;  3UI4 A;  1GUV A;  4DWS A;  2KO7 A;  1X6L A;  2RUR A;  3UQB A;  3PRB A;  3EY6 A;  3AS0 A;  1HKI A;  4Z2H A;  4Z2J A;  1W9V A;  4QT3 A;  3MDY B;  4TNS A;  2WM0 A;  3AS2 A;  1WB0 A;  3NRK A;  3O5I A;  2A3C A;  3WKZ A;  4TW7 A;  5DIT A;  2PV2 A;  3W4R A;  3O5J A;  3B9A A;  3I6C A;  5HKG A;  2PPN A;  1PIN A;  1UR9 A;  3UF8 A;  1E9L A;  2PV3 A;  4KR0 B;  4Q7N A;  3ODK A;  4IQ2 A;  1FKL A;  2G41 A;  2PPO A;  1YAT A;  1KFW A;  3O5R A;  1JNT A;  3CGN A;  4FN2 A;  2XP7 A;  1TFV A;  1B6C A;  3G6L A;  3WH0 A;  3O5D A;  4L3N A;  4BF8 A;  1QPF A;  3ALF A;  2ZR6 A;  4P8X A;  1JND A;  2PI6 A;  1D7H A;  1Q6I A;  5B8I C;  1J4I A;  2G8Z A;  2PPP A;  3UQI A;  3CHD A;  2M1I A;  2WK2 A;  4DRJ A;  3TC5 A;  2MLY A;  4JFJ A;  4DRQ A;  4IT4 A;  2Y78 A;  1FKT A;  3KAB A;  3O5O A;  3ARU A;  2KFW A;  1O6I A;  3ALG A;  1J4R A;  1KT1 A;  5HWC A;  1FFQ A;  3ARP A;  3O5E A;  1LG2 A;  4DRM A;  4ODM A;  3KAC A;  2B31 A;  4W9O A;  3ARO A;  3ARW A;  3WD1 A;  1NWU A;  4LAW A;  1FKB A;  3B7X A;  1D2K A;  1FFR A;  3ARV A;  2XPB A;  2XP4 A;  4TW6 A;  1A7X A;  2KI3 A;  3AS3 A;  4MTV A;  3G6M A;  1E6R A;  1ZU8 A;  3RME A;  3WD0 A;  1FJD A;  3RM8 A;  1NSG A;  4Z2L A;  3JXV A;  4HAR A;  1NWR A;  4S3K A;  2XP8 A;  1Q6H A;  4ODO A;  3RM9 A;  1R9H A;  1FKH A;  2DSU A;  4WK9 A;  3O5Q A;  3WQW A;  4MNK A;  4MPK A;  2FDM A;  1W9P A;  2F4E A;  3WL0 A;  2DSV A;  3CH9 A;  4P8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...