2UZ5A

Solution structure of the fkbp-domain of legionella pneumophila mip
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
137
structure length
137
Chain Sequence
FNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords MACROPHAGE INFECTIVITY POTENTIATOR
publication title Domain Motions of the Mip Protein from Legionella Pneumophila
pubmed doi rcsb
total genus 22
structure length 137
sequence length 137
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2uz5A02
5HKGA 1JNSA 1JVWA 3EY6A 2XPBA 3KCEA 1FAPA 2PV3A 1F8AB 2L2SA 2XP8A 1QPFA 2PV1A 2XP6A 1L1PA 2KE0A 2LPVA 4DRQA 1JNTA 1YATA 4G50A 3KACA 2VCDA 5DIUA 5I98A 1F40A 3O5EA 4IQCA 3GPKA 2RUQA 1J6YA 3PRDA 4G2PA 4TW7A 3VAWA 1P5QA 1FKKA 2DG3A 3IKDA 2FKEA 2RQSA 3IKGA 4FAPA 3KABA 1FJDA 4QIBA 2ZQVA 1A7XA 1FKSA 2M08A 2ZR6A 3FAPA 4GGQA 4ODKA 2ZR4A 1YW5A 3TCZA 4DRHA 4LAXA 3TC5A 3NRKA 4JFMA 3UI4A 1J4IA 3H9RB 2PPOA 2ZR5A 1ZK6A 4ODLA 4DZ3A 1QPLA 4DT4A 3KAFA 3O5GA 1NMWA 2FAPA 2KGJA 1ROUA 2AWGA 1J4RA 3KADA 2OFNA 4DRIA 3PRBA 2MPHA 1FKIA 3KAIA 4TNSA 4U85A 4FN2A 3UQBA 3UF8A 4DH0A 4LAYA 4JFKA 3O5JA 4TYOA 3UQAA 4ODOA 2PPNA 3NTPA 4ODNA 4DRKA 2ZQTA 3KZ7A 3O5MA 2MLXA 4W9PA 4JFIA 1KT1A 3CGMA 1N1AA 3O5RA 4MSPA 2JZVA 2KR7A 5HWBA 1Q6UA 1QZ2A 1T11A 4LAVA 3UQIA 4DRNA 1EYMA 4JFLA 2RUDA 3MDYB 5HWCA 4DZ2A 4MGVA 1EQ3A 2ZQUA 4TX0A 2N87A 2Q5AA 2RUCA 2XP5A 4IPXA 3I6CA 1B6CA 4C02B 4BF8A 2VN1A 2UZ5A 5HW6A 1Q6IA 5HW7A 2M2AA 4TW6A 4GIVA 4QT2A 3O5FA 1W26A 3JYJA 3O5QA 5HTGA 2XP7A 1U79A 2PBCA 4JFJA 1HXVA 3TDBA 4LAWA 4DIPA 4R0XA 2F2DA 2PV2A 2MLYA 1D7JA 1FKBA 3UI6A 1ZCNA 4TW8A 4JYSA 2MF9A 1NMVA 3O5KA 4U86A 1C9HA 2DG4A 2MNTA 2ZQSA 1ROTA 2RURA 2LGOA 3CGNA 4J4NA 1PINA 4QT3A 1Q1CA 4DROA 1FKTA 4ODQA 2M1IA 3WH0A 3JYMA 2MLZA 2KFWA 1FKFA 4DRJA 4J4OA 3O5DA 5GPGA 2Y78A 1D7IA 2F21A 4IQ2A 3B7XA 1BL4A 1TCOC 2RSEA 4NNRA 3JXVA 1FKDA 4DRMA 2D9FA 3OOBA 1D6OA 3PA7A 1FKRA 3O5OA 2DG9A 3KAGA 1FD9A 3ODKA 1J4HA 2ITKA 5DITA 5B8IC 1BKFA 4W9QA 1R9HA 5J6EA 5HW8A 3KAHA 2IF4A 1KT0A 4U84A 5HUAA 5BXJA 1PBKA 2XP4A 1D7HA 3O5LA 4ODRA 5HT1A 3LUOA 4O2TA 5D75A 3IK8A 1FKLA 4W9OA 2KI3A 1FKGA 2PPPA 1FKJA 4ODMA 5DIVA 2K8IA 2KO7A 3O5IA 4ODPA 3RFWA 1M5YA 1NSGA 3RGCA 2XP3A 4ITZA 4N19A 3IHZA 1FKHA 1Q6HA 2XPAA 2XP9A 3UI5A 3NI6A 3O5PA 4DRPA 2LJ4A 2F4EA 1Y0OA 2LKNA
chains in the Genus database with same CATH superfamily
2ETNA 3FXYA 1JNSA 1JVWA 2XPBA 3QOKA 1HKMA 3B9DA 2LPVA 4DRQA 1W1YA 3VAWA 4G2PA 4TW7A 3CHCA 1RD6A 1XRVA 3IKGA 4FAPA 4ZPVR 1FKSA 3TCZA 2ZR6A 4GGQA 4ODKA 2ZR4A 3RM4A 4WKHA 4LAXA 1X6LA 3NRKA 1E6NA 4MAVA 3H9RB 1ZK6A 1X6NA 2YBUA 1OGBA 1NMWA 2FAPA 4URIA 1ROUA 4ZPTR 2AWGA 4LGXA 1J4RA 2PI6A 2OFNA 4DRIA 1H0IA 3AS1A 4U85A 1LJYA 4WK9A 4DH0A 4LAYA 2AOSA 4DRKA 3O5MA 3KZ7A 2MLXA 3AS0A 1N1AA 2A3CA 2A3BA 2JZVA 4DRNA 3OA5A 4JFLA 1HKIA 2B31A 2RUDA 1XHGA 3MDYB 1IX5A 5HWCA 4NZCA 1LL4A 3ARSA 1ZL1A 2N87A 1HJXA 2Q5AA 2RUCA 2WLYA 4TX0A 4UDMA 2XP5A 1EDQA 4P8XA 2UZ5A 3WD0A 2G41A 1Q6IA 2M2AA 4TW6A 4GIVA 4QT2A 4IT4A 1LG1A 3O5QA 2PBCA 4R0XA 4JYSA 1NMVA 2DPEA 4Z2LA 1ROTA 2LGOA 4QT3A 4J4NA 4DWSA 4ODQA 2M1IA 2KFWA 1ITXA 2A3AA 5GPGA 4S3KA 2F21A 2P4VA 4IQ2A 3B7XA 1K9TA 1BL4A 1E6ZA 4NNRA 3PA7A 3O5OA 3KAGA 1E6RA 3ODKA 1J4HA 3WD1A 4W9QA 4P8UA 1KT0A 4U84A 3ALGA 3RM9A 4XAKA 2DT3A 1TFVA 3LUOA 2YBTA 5D75A 3IK8A 4Z2KA 1FKGA 3AQUA 2DSUA 5DEZA 2KO7A 3ARVA 3O5IA 1M5YA 2XP3A 1ZBKA 3O5PA 1Y0OA 1FAPA 1F8AB 2DSVA 2XP8A 2XP6A 2PV1A 1NH6A 1L1PA 2KE0A 4WIWA 3KACA 2VCDA 4PTMA 1J6YA 3PR9A 4Z2GA 1FKKA 2DG3A 2O92A 2RQSA 1JNEA 3WKZA 1ZU8A 3B8SA 3TC5A 3BXWA 3UI4A 2PPOA 3GU0A 3ARYA 2PN0A 4DZ3A 3ARUA 1H0GA 1FKIA 4FN2A 3UQBA 3UF8A 3UQAA 4TYOA 3EIPA 3GTYX 3NTPA 4ODNA 4DWSC 2DT2A 5HBFA 1T11A 1ZBCA 1EYMA 1E6PA 3ARXA 1KFWA 2ZQUA 3RMEA 3W4RA 4AY1A 5HW7A 2DSWA 4DWSD 2XP7A 1W1TA 3TDBA 3ARRA 2PV2A 3AS3A 1FKBA 3UI6A 1JNDA 3FY1A 1NWSA 4MTVA 2ZQSA 4DROA 4NSBA 1ZB5A 3JYMA 1FKFA 2WK2A 2A3EA 3O5DA 4J4OA 1E15A 1HKKA 2RSEA 3JXVA 4DRMA 2D9FA 3OOBA 1D6OA 4P8VA 1W9UA 2DG9A 1W1PA 4WKFA 1FFRA 2ITKA 1GOIA 1R9HA 4Z2JA 5HUAA 2QF8A 4ODRA 1SR0A 3CHFA 5DO2A 1ZBWA 2KI3A 1FKJA 5DIVA 4ODPA 3B9AA 5DF0A 4ITZA 3IHZA 1FKHA 2XP9A 4QZVB 4Z2IA 3KCEA 2PV3A 2L2SA 1QPFA 2F23A 1HKJA 1JNTA 1YATA 4G50A 4Z2HA 5I98A 3AROA 1F40A 1EIBA 4IQCA 1NWUA 5GQBA 3KABA 1FJDA 4QIBA 1A7XA 1OWQA 2M08A 1YW5A 4DRHA 4DWSB 1J4IA 2IUZA 4ODLA 3WL1A 4DT4A 1WB0A 3ARPA 3ARZA 4TNSA 2MPHA 1HJWA 1LG2A 4JFKA 4ODOA 2ZQTA 1WNOA 3BMBA 1KT1A 3CGMA 1WAWA 3O5RA 4MSPA 2KR7A 4ZS6A 5HWBA 3ARQA 3WQVA 4DZ2A 3AS2A 1EQ3A 3RM8A 4ML4A 4IPXA 3I6CA 1B6CA 4BF8A 4MNLA 1W26A 3JYJA 5HTGA 1U79A 1HXVA 4LAWA 4DIPA 2MLYA 1D7JA 4HARA 1O6IA 4WKAA 1ZCNA 2DT0A 2MF9A 2ESCA 4P8WA 2DG4A 1GPFA 1UR8A 2RURA 3CGNA 1PINA 1Q1CA 1FKTA 1W1VA 3WH0A 2MLZA 4KR0B 4DRJA 1W9VA 1D7IA 1LL6A 1FKDA 1LQ0A 4MNJA 3WD3A 1D2KA 5DITA 4L72B 3WIJA 5HW8A 3KAHA 5BXJA 1PBKA 3PRAA 3O5LA 1FKLA 1UR9A 5GPRA 3CHDA 2PPPA 3RFWA 2K8IA 3B9EA 3ALFA 3RGCA 3CHEA 4N19A 3UI5A 2XPAA 2FDMA 3CH9A 2DSZA 1W9PA 3ARWA 4DRPA 2LJ4A 3WQWA 1ZBVA 2WM0A 5HKGA 3EY6A 1HJVA 5DIUA 3O5EA 3GPKA 2RUQA 1VF8A 3PRDA 1P5QA 3IKDA 4ZPWR 2FKEA 4HBOA 2ZQVA 3FAPA 1FFQA 4JFMA 1GUVA 4Q22A 2ZR5A 1JCHB 1QPLA 3KAFA 3O5GA 2KGJA 3WD2A 3WL0A 3KADA 3PRBA 3KAIA 2G8ZA 3O5JA 2PPNA 4W9PA 4JFIA 1Q6UA 1QZ2A 3G6LA 2EULA 4LAVA 1GRJA 3UQIA 2O9OA 1CTNA 4MGVA 1E44A 1NWTA 1EHNA 4C02B 2VN1A 5HW6A 3O5FA 2DT1A 5JH8A 4KQZA 4JFJA 2B5UB 4MNMA 2F2DA 4TW8A 3O5KA 4U86A 1C9HA 2MNTA 2OLHA 4S3JA 3CZ8A 2Y78A 4WJXA 3G6MA 1NWRA 1TCOC 1LL7A 4MNKA 4MPKA 1FKRA 4W5UA 1FD9A 1OGGA 5B8IC 1BKFA 5J6EA 2IF4A 4Q7NA 2XP4A 1D7HA 4HBEA 5HT1A 1E9LA 2WLZA 4O2TA 1SYTA 3ARTA 4W9OA 4IT6A 4L3NA 4ODMA 1NSGA 3WD4A 1Q6HA 3NI6A 4R5EA 2F4EA 2LKNA
chains in the Genus database with same CATH topology
3FXYA 1JNSA 1JVWA 2XPBA 3QOKA 1HKMA 3B9DA 2LPVA 4DRQA 1W1YA 3VAWA 4G2PA 4TW7A 3CHCA 1RD6A 1XRVA 3IKGA 4FAPA 4ZPVR 1FKSA 3TCZA 2ZR6A 4GGQA 4ODKA 2ZR4A 3RM4A 4WKHA 4LAXA 1X6LA 3NRKA 1E6NA 4MAVA 3H9RB 1ZK6A 1X6NA 2YBUA 1OGBA 1NMWA 2FAPA 4URIA 1ROUA 4ZPTR 2AWGA 4LGXA 1J4RA 2PI6A 2OFNA 4DRIA 1H0IA 3AS1A 4U85A 1LJYA 4WK9A 4DH0A 4LAYA 2AOSA 4DRKA 3O5MA 3KZ7A 2MLXA 3AS0A 1N1AA 2A3CA 2A3BA 2JZVA 4DRNA 3OA5A 4JFLA 1HKIA 2B31A 2RUDA 1XHGA 3MDYB 1IX5A 5HWCA 4NZCA 1LL4A 3ARSA 1ZL1A 2N87A 1HJXA 2Q5AA 2RUCA 2WLYA 4TX0A 2XP5A 1EDQA 4P8XA 2UZ5A 3WD0A 2G41A 1Q6IA 2M2AA 4TW6A 4GIVA 4QT2A 4IT4A 1LG1A 3O5QA 2PBCA 4R0XA 4JYSA 1NMVA 2DPEA 4Z2LA 1ROTA 2LGOA 4QT3A 4J4NA 4DWSA 4ODQA 2M1IA 2KFWA 1ITXA 2A3AA 5GPGA 4S3KA 2F21A 4IQ2A 3B7XA 1K9TA 1BL4A 1E6ZA 4NNRA 3PA7A 3O5OA 3KAGA 1E6RA 3ODKA 1J4HA 3WD1A 4W9QA 4P8UA 1KT0A 4U84A 3ALGA 3RM9A 4XAKA 2DT3A 1TFVA 3LUOA 2YBTA 5D75A 3IK8A 4Z2KA 1FKGA 3AQUA 2DSUA 5DEZA 2KO7A 3ARVA 3O5IA 1M5YA 2XP3A 1ZBKA 3O5PA 1Y0OA 1FAPA 1F8AB 2DSVA 2XP8A 2XP6A 2PV1A 1NH6A 1L1PA 2KE0A 4WIWA 3KACA 2VCDA 4PTMA 1J6YA 3PR9A 4Z2GA 1FKKA 2DG3A 2O92A 2RQSA 1JNEA 3WKZA 1ZU8A 3B8SA 3TC5A 3BXWA 3UI4A 2PPOA 3ARYA 4DZ3A 3ARUA 1H0GA 1FKIA 4FN2A 3UQBA 3UF8A 3UQAA 4TYOA 3NTPA 4ODNA 4DWSC 2DT2A 5HBFA 1T11A 1ZBCA 1EYMA 1E6PA 3ARXA 1KFWA 2ZQUA 3RMEA 3W4RA 4AY1A 5HW7A 2DSWA 4DWSD 2XP7A 1W1TA 3TDBA 3ARRA 2PV2A 3AS3A 1FKBA 3UI6A 1JNDA 3FY1A 1NWSA 4MTVA 2ZQSA 4DROA 4NSBA 1ZB5A 3JYMA 1FKFA 2WK2A 2A3EA 3O5DA 4J4OA 1E15A 1HKKA 2RSEA 3JXVA 4DRMA 2D9FA 3OOBA 1D6OA 4P8VA 1W9UA 2DG9A 1W1PA 4WKFA 1FFRA 2ITKA 1GOIA 1R9HA 4Z2JA 5HUAA 2QF8A 4ODRA 1SR0A 3CHFA 5DO2A 1ZBWA 2KI3A 1FKJA 5DIVA 4ODPA 3B9AA 5DF0A 4ITZA 3IHZA 1FKHA 2XP9A 4QZVB 4Z2IA 3KCEA 2PV3A 2L2SA 1QPFA 1HKJA 1JNTA 1YATA 4G50A 4Z2HA 5I98A 3AROA 1F40A 1EIBA 4IQCA 1NWUA 5GQBA 3KABA 1FJDA 4QIBA 1A7XA 1OWQA 2M08A 1YW5A 4DRHA 4DWSB 1J4IA 2IUZA 4ODLA 3WL1A 4DT4A 1WB0A 3ARPA 3ARZA 4TNSA 2MPHA 1HJWA 1LG2A 4JFKA 4ODOA 2ZQTA 1WNOA 1KT1A 3CGMA 1WAWA 3O5RA 4MSPA 2KR7A 4ZS6A 5HWBA 3ARQA 3WQVA 4DZ2A 3AS2A 1EQ3A 3RM8A 4ML4A 4IPXA 3I6CA 1B6CA 4BF8A 4MNLA 1W26A 3JYJA 5HTGA 1U79A 1HXVA 4LAWA 4DIPA 2MLYA 1D7JA 4HARA 1O6IA 4WKAA 1ZCNA 2DT0A 2MF9A 2ESCA 4P8WA 2DG4A 1GPFA 1UR8A 2RURA 3CGNA 1PINA 1Q1CA 1FKTA 1W1VA 3WH0A 2MLZA 4KR0B 4DRJA 1W9VA 1D7IA 1LL6A 1FKDA 1LQ0A 4MNJA 3WD3A 1D2KA 5DITA 4L72B 3WIJA 5HW8A 3KAHA 5BXJA 1PBKA 3PRAA 3O5LA 1FKLA 1UR9A 5GPRA 3CHDA 2PPPA 3RFWA 2K8IA 3B9EA 3ALFA 3RGCA 3CHEA 4N19A 3UI5A 2XPAA 2FDMA 3CH9A 2DSZA 1W9PA 3ARWA 4DRPA 2LJ4A 3WQWA 1ZBVA 2WM0A 5HKGA 3EY6A 1HJVA 5DIUA 3O5EA 3GPKA 2RUQA 1VF8A 3PRDA 1P5QA 3IKDA 4ZPWR 2FKEA 4HBOA 2ZQVA 3FAPA 1FFQA 4JFMA 1GUVA 4Q22A 2ZR5A 1QPLA 3KAFA 3O5GA 2KGJA 3WD2A 3WL0A 3KADA 3PRBA 3KAIA 2G8ZA 3O5JA 2PPNA 4W9PA 4JFIA 1Q6UA 1QZ2A 3G6LA 4LAVA 3UQIA 2O9OA 1CTNA 4MGVA 1NWTA 1EHNA 4C02B 2VN1A 5HW6A 3O5FA 2DT1A 5JH8A 4KQZA 4JFJA 4MNMA 2F2DA 4TW8A 3O5KA 4U86A 1C9HA 2MNTA 2OLHA 4S3JA 3CZ8A 2Y78A 4WJXA 3G6MA 1NWRA 1TCOC 1LL7A 4MNKA 4MPKA 1FKRA 4W5UA 1FD9A 1OGGA 5B8IC 1BKFA 5J6EA 2IF4A 4Q7NA 2XP4A 1D7HA 4HBEA 5HT1A 1E9LA 2WLZA 4O2TA 1SYTA 3ARTA 4W9OA 4IT6A 4L3NA 4ODMA 1NSGA 3WD4A 1Q6HA 3NI6A 4R5EA 2F4EA 2LKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKG A;  1JNS A;  1JVW A;  3EY6 A;  2XPB A;  3KCE A;  1FAP A;  2PV3 A;  1F8A B;  2L2S A;  2XP8 A;  1QPF A;  2PV1 A;  2XP6 A;  1L1P A;  2KE0 A;  2LPV A;  4DRQ A;  1JNT A;  1YAT A;  4G50 A;  3KAC A;  2VCD A;  5DIU A;  5I98 A;  1F40 A;  3O5E A;  4IQC A;  3GPK A;  2RUQ A;  1J6Y A;  3PRD A;  4G2P A;  4TW7 A;  3VAW A;  1P5Q A;  1FKK A;  2DG3 A;  3IKD A;  2FKE A;  2RQS A;  3IKG A;  4FAP A;  3KAB A;  1FJD A;  4QIB A;  2ZQV A;  1A7X A;  1FKS A;  2M08 A;  2ZR6 A;  3FAP A;  4GGQ A;  4ODK A;  2ZR4 A;  1YW5 A;  3TCZ A;  4DRH A;  4LAX A;  3TC5 A;  3NRK A;  4JFM A;  3UI4 A;  1J4I A;  3H9R B;  2PPO A;  2ZR5 A;  1ZK6 A;  4ODL A;  4DZ3 A;  1QPL A;  4DT4 A;  3KAF A;  3O5G A;  1NMW A;  2FAP A;  2KGJ A;  1ROU A;  2AWG A;  1J4R A;  3KAD A;  2OFN A;  4DRI A;  3PRB A;  2MPH A;  1FKI A;  3KAI A;  4TNS A;  4U85 A;  4FN2 A;  3UQB A;  3UF8 A;  4DH0 A;  4LAY A;  4JFK A;  3O5J A;  4TYO A;  3UQA A;  4ODO A;  2PPN A;  3NTP A;  4ODN A;  4DRK A;  2ZQT A;  3KZ7 A;  3O5M A;  2MLX A;  4W9P A;  4JFI A;  1KT1 A;  3CGM A;  1N1A A;  3O5R A;  4MSP A;  2JZV A;  2KR7 A;  5HWB A;  1Q6U A;  1QZ2 A;  1T11 A;  4LAV A;  3UQI A;  4DRN A;  1EYM A;  4JFL A;  2RUD A;  3MDY B;  5HWC A;  4DZ2 A;  4MGV A;  1EQ3 A;  2ZQU A;  4TX0 A;  2N87 A;  2Q5A A;  2RUC A;  2XP5 A;  4IPX A;  3I6C A;  1B6C A;  4C02 B;  4BF8 A;  2VN1 A;  2UZ5 A;  5HW6 A;  1Q6I A;  5HW7 A;  2M2A A;  4TW6 A;  4GIV A;  4QT2 A;  3O5F A;  1W26 A;  3JYJ A;  3O5Q A;  5HTG A;  2XP7 A;  1U79 A;  2PBC A;  4JFJ A;  1HXV A;  3TDB A;  4LAW A;  4DIP A;  4R0X A;  2F2D A;  2PV2 A;  2MLY A;  1D7J A;  1FKB A;  3UI6 A;  1ZCN A;  4TW8 A;  4JYS A;  2MF9 A;  1NMV A;  3O5K A;  4U86 A;  1C9H A;  2DG4 A;  2MNT A;  2ZQS A;  1ROT A;  2RUR A;  2LGO A;  3CGN A;  4J4N A;  1PIN A;  4QT3 A;  1Q1C A;  4DRO A;  1FKT A;  4ODQ A;  2M1I A;  3WH0 A;  3JYM A;  2MLZ A;  2KFW A;  1FKF A;  4DRJ A;  4J4O A;  3O5D A;  5GPG A;  2Y78 A;  1D7I A;  2F21 A;  4IQ2 A;  3B7X A;  1BL4 A;  1TCO C;  2RSE A;  4NNR A;  3JXV A;  1FKD A;  4DRM A;  2D9F A;  3OOB A;  1D6O A;  3PA7 A;  1FKR A;  3O5O A;  2DG9 A;  3KAG A;  1FD9 A;  3ODK A;  1J4H A;  2ITK A;  5DIT A;  5B8I C;  1BKF A;  4W9Q A;  1R9H A;  5J6E A;  5HW8 A;  3KAH A;  2IF4 A;  1KT0 A;  4U84 A;  5HUA A;  5BXJ A;  1PBK A;  2XP4 A;  1D7H A;  3O5L A;  4ODR A;  5HT1 A;  3LUO A;  4O2T A;  5D75 A;  3IK8 A;  1FKL A;  4W9O A;  2KI3 A;  1FKG A;  2PPP A;  1FKJ A;  4ODM A;  5DIV A;  2K8I A;  2KO7 A;  3O5I A;  4ODP A;  3RFW A;  1M5Y A;  1NSG A;  3RGC A;  2XP3 A;  4ITZ A;  4N19 A;  3IHZ A;  1FKH A;  1Q6H A;  2XPA A;  2XP9 A;  3UI5 A;  3NI6 A;  3O5P A;  4DRP A;  2LJ4 A;  2F4E A;  1Y0O A;  2LKN A; 
#chains in the Genus database with same CATH topology
 2ETN A;  3FXY A;  1JNS A;  1JVW A;  2XPB A;  3QOK A;  1HKM A;  3B9D A;  2LPV A;  4DRQ A;  1W1Y A;  3VAW A;  4G2P A;  4TW7 A;  3CHC A;  1RD6 A;  1XRV A;  3IKG A;  4FAP A;  4ZPV R;  1FKS A;  3TCZ A;  2ZR6 A;  4GGQ A;  4ODK A;  2ZR4 A;  3RM4 A;  4WKH A;  4LAX A;  1X6L A;  3NRK A;  1E6N A;  4MAV A;  3H9R B;  1ZK6 A;  1X6N A;  2YBU A;  1OGB A;  1NMW A;  2FAP A;  4URI A;  1ROU A;  4ZPT R;  2AWG A;  4LGX A;  1J4R A;  2PI6 A;  2OFN A;  4DRI A;  1H0I A;  3AS1 A;  4U85 A;  1LJY A;  4WK9 A;  4DH0 A;  4LAY A;  2AOS A;  4DRK A;  3O5M A;  3KZ7 A;  2MLX A;  3AS0 A;  1N1A A;  2A3C A;  2A3B A;  2JZV A;  4DRN A;  3OA5 A;  4JFL A;  1HKI A;  2B31 A;  2RUD A;  1XHG A;  3MDY B;  1IX5 A;  5HWC A;  4NZC A;  1LL4 A;  3ARS A;  1ZL1 A;  2N87 A;  1HJX A;  2Q5A A;  2RUC A;  2WLY A;  4TX0 A;  4UDM A;  2XP5 A;  1EDQ A;  4P8X A;  2UZ5 A;  3WD0 A;  2G41 A;  1Q6I A;  2M2A A;  4TW6 A;  4GIV A;  4QT2 A;  4IT4 A;  1LG1 A;  3O5Q A;  2PBC A;  4R0X A;  4JYS A;  1NMV A;  2DPE A;  4Z2L A;  1ROT A;  2LGO A;  4QT3 A;  4J4N A;  4DWS A;  4ODQ A;  2M1I A;  2KFW A;  1ITX A;  2A3A A;  5GPG A;  4S3K A;  2F21 A;  2P4V A;  4IQ2 A;  3B7X A;  1K9T A;  1BL4 A;  1E6Z A;  4NNR A;  3PA7 A;  3O5O A;  3KAG A;  1E6R A;  3ODK A;  1J4H A;  3WD1 A;  4W9Q A;  4P8U A;  1KT0 A;  4U84 A;  3ALG A;  3RM9 A;  4XAK A;  2DT3 A;  1TFV A;  3LUO A;  2YBT A;  5D75 A;  3IK8 A;  4Z2K A;  1FKG A;  3AQU A;  2DSU A;  5DEZ A;  2KO7 A;  3ARV A;  3O5I A;  1M5Y A;  2XP3 A;  1ZBK A;  3O5P A;  1Y0O A;  1FAP A;  1F8A B;  2DSV A;  2XP8 A;  2XP6 A;  2PV1 A;  1NH6 A;  1L1P A;  2KE0 A;  4WIW A;  3KAC A;  2VCD A;  4PTM A;  1J6Y A;  3PR9 A;  4Z2G A;  1FKK A;  2DG3 A;  2O92 A;  2RQS A;  1JNE A;  3WKZ A;  1ZU8 A;  3B8S A;  3TC5 A;  3BXW A;  3UI4 A;  2PPO A;  3GU0 A;  3ARY A;  2PN0 A;  4DZ3 A;  3ARU A;  1H0G A;  1FKI A;  4FN2 A;  3UQB A;  3UF8 A;  3UQA A;  4TYO A;  3EIP A;  3GTY X;  3NTP A;  4ODN A;  4DWS C;  2DT2 A;  5HBF A;  1T11 A;  1ZBC A;  1EYM A;  1E6P A;  3ARX A;  1KFW A;  2ZQU A;  3RME A;  3W4R A;  4AY1 A;  5HW7 A;  2DSW A;  4DWS D;  2XP7 A;  1W1T A;  3TDB A;  3ARR A;  2PV2 A;  3AS3 A;  1FKB A;  3UI6 A;  1JND A;  3FY1 A;  1NWS A;  4MTV A;  2ZQS A;  4DRO A;  4NSB A;  1ZB5 A;  3JYM A;  1FKF A;  2WK2 A;  2A3E A;  3O5D A;  4J4O A;  1E15 A;  1HKK A;  2RSE A;  3JXV A;  4DRM A;  2D9F A;  3OOB A;  1D6O A;  4P8V A;  1W9U A;  2DG9 A;  1W1P A;  4WKF A;  1FFR A;  2ITK A;  1GOI A;  1R9H A;  4Z2J A;  5HUA A;  2QF8 A;  4ODR A;  1SR0 A;  3CHF A;  5DO2 A;  1ZBW A;  2KI3 A;  1FKJ A;  5DIV A;  4ODP A;  3B9A A;  5DF0 A;  4ITZ A;  3IHZ A;  1FKH A;  2XP9 A;  4QZV B;  4Z2I A;  3KCE A;  2PV3 A;  2L2S A;  1QPF A;  2F23 A;  1HKJ A;  1JNT A;  1YAT A;  4G50 A;  4Z2H A;  5I98 A;  3ARO A;  1F40 A;  1EIB A;  4IQC A;  1NWU A;  5GQB A;  3KAB A;  1FJD A;  4QIB A;  1A7X A;  1OWQ A;  2M08 A;  1YW5 A;  4DRH A;  4DWS B;  1J4I A;  2IUZ A;  4ODL A;  3WL1 A;  4DT4 A;  1WB0 A;  3ARP A;  3ARZ A;  4TNS A;  2MPH A;  1HJW A;  1LG2 A;  4JFK A;  4ODO A;  2ZQT A;  1WNO A;  3BMB A;  1KT1 A;  3CGM A;  1WAW A;  3O5R A;  4MSP A;  2KR7 A;  4ZS6 A;  5HWB A;  3ARQ A;  3WQV A;  4DZ2 A;  3AS2 A;  1EQ3 A;  3RM8 A;  4ML4 A;  4IPX A;  3I6C A;  1B6C A;  4BF8 A;  4MNL A;  1W26 A;  3JYJ A;  5HTG A;  1U79 A;  1HXV A;  4LAW A;  4DIP A;  2MLY A;  1D7J A;  4HAR A;  1O6I A;  4WKA A;  1ZCN A;  2DT0 A;  2MF9 A;  2ESC A;  4P8W A;  2DG4 A;  1GPF A;  1UR8 A;  2RUR A;  3CGN A;  1PIN A;  1Q1C A;  1FKT A;  1W1V A;  3WH0 A;  2MLZ A;  4KR0 B;  4DRJ A;  1W9V A;  1D7I A;  1LL6 A;  1FKD A;  1LQ0 A;  4MNJ A;  3WD3 A;  1D2K A;  5DIT A;  4L72 B;  3WIJ A;  5HW8 A;  3KAH A;  5BXJ A;  1PBK A;  3PRA A;  3O5L A;  1FKL A;  1UR9 A;  5GPR A;  3CHD A;  2PPP A;  3RFW A;  2K8I A;  3B9E A;  3ALF A;  3RGC A;  3CHE A;  4N19 A;  3UI5 A;  2XPA A;  2FDM A;  3CH9 A;  2DSZ A;  1W9P A;  3ARW A;  4DRP A;  2LJ4 A;  3WQW A;  1ZBV A;  2WM0 A;  5HKG A;  3EY6 A;  1HJV A;  5DIU A;  3O5E A;  3GPK A;  2RUQ A;  1VF8 A;  3PRD A;  1P5Q A;  3IKD A;  4ZPW R;  2FKE A;  4HBO A;  2ZQV A;  3FAP A;  1FFQ A;  4JFM A;  1GUV A;  4Q22 A;  2ZR5 A;  1JCH B;  1QPL A;  3KAF A;  3O5G A;  2KGJ A;  3WD2 A;  3WL0 A;  3KAD A;  3PRB A;  3KAI A;  2G8Z A;  3O5J A;  2PPN A;  4W9P A;  4JFI A;  1Q6U A;  1QZ2 A;  3G6L A;  2EUL A;  4LAV A;  1GRJ A;  3UQI A;  2O9O A;  1CTN A;  4MGV A;  1E44 A;  1NWT A;  1EHN A;  4C02 B;  2VN1 A;  5HW6 A;  3O5F A;  2DT1 A;  5JH8 A;  4KQZ A;  4JFJ A;  2B5U B;  4MNM A;  2F2D A;  4TW8 A;  3O5K A;  4U86 A;  1C9H A;  2MNT A;  2OLH A;  4S3J A;  3CZ8 A;  2Y78 A;  4WJX A;  3G6M A;  1NWR A;  1TCO C;  1LL7 A;  4MNK A;  4MPK A;  1FKR A;  4W5U A;  1FD9 A;  1OGG A;  5B8I C;  1BKF A;  5J6E A;  2IF4 A;  4Q7N A;  2XP4 A;  1D7H A;  4HBE A;  5HT1 A;  1E9L A;  2WLZ A;  4O2T A;  1SYT A;  3ART A;  4W9O A;  4IT6 A;  4L3N A;  4ODM A;  1NSG A;  3WD4 A;  1Q6H A;  3NI6 A;  4R5E A;  2F4E A;  2LKN A; 
#chains in the Genus database with same CATH homology
 3FXY A;  1JNS A;  1JVW A;  2XPB A;  3QOK A;  1HKM A;  3B9D A;  2LPV A;  4DRQ A;  1W1Y A;  3VAW A;  4G2P A;  4TW7 A;  3CHC A;  1RD6 A;  1XRV A;  3IKG A;  4FAP A;  4ZPV R;  1FKS A;  3TCZ A;  2ZR6 A;  4GGQ A;  4ODK A;  2ZR4 A;  3RM4 A;  4WKH A;  4LAX A;  1X6L A;  3NRK A;  1E6N A;  4MAV A;  3H9R B;  1ZK6 A;  1X6N A;  2YBU A;  1OGB A;  1NMW A;  2FAP A;  4URI A;  1ROU A;  4ZPT R;  2AWG A;  4LGX A;  1J4R A;  2PI6 A;  2OFN A;  4DRI A;  1H0I A;  3AS1 A;  4U85 A;  1LJY A;  4WK9 A;  4DH0 A;  4LAY A;  2AOS A;  4DRK A;  3O5M A;  3KZ7 A;  2MLX A;  3AS0 A;  1N1A A;  2A3C A;  2A3B A;  2JZV A;  4DRN A;  3OA5 A;  4JFL A;  1HKI A;  2B31 A;  2RUD A;  1XHG A;  3MDY B;  1IX5 A;  5HWC A;  4NZC A;  1LL4 A;  3ARS A;  1ZL1 A;  2N87 A;  1HJX A;  2Q5A A;  2RUC A;  2WLY A;  4TX0 A;  2XP5 A;  1EDQ A;  4P8X A;  2UZ5 A;  3WD0 A;  2G41 A;  1Q6I A;  2M2A A;  4TW6 A;  4GIV A;  4QT2 A;  4IT4 A;  1LG1 A;  3O5Q A;  2PBC A;  4R0X A;  4JYS A;  1NMV A;  2DPE A;  4Z2L A;  1ROT A;  2LGO A;  4QT3 A;  4J4N A;  4DWS A;  4ODQ A;  2M1I A;  2KFW A;  1ITX A;  2A3A A;  5GPG A;  4S3K A;  2F21 A;  4IQ2 A;  3B7X A;  1K9T A;  1BL4 A;  1E6Z A;  4NNR A;  3PA7 A;  3O5O A;  3KAG A;  1E6R A;  3ODK A;  1J4H A;  3WD1 A;  4W9Q A;  4P8U A;  1KT0 A;  4U84 A;  3ALG A;  3RM9 A;  4XAK A;  2DT3 A;  1TFV A;  3LUO A;  2YBT A;  5D75 A;  3IK8 A;  4Z2K A;  1FKG A;  3AQU A;  2DSU A;  5DEZ A;  2KO7 A;  3ARV A;  3O5I A;  1M5Y A;  2XP3 A;  1ZBK A;  3O5P A;  1Y0O A;  1FAP A;  1F8A B;  2DSV A;  2XP8 A;  2XP6 A;  2PV1 A;  1NH6 A;  1L1P A;  2KE0 A;  4WIW A;  3KAC A;  2VCD A;  4PTM A;  1J6Y A;  3PR9 A;  4Z2G A;  1FKK A;  2DG3 A;  2O92 A;  2RQS A;  1JNE A;  3WKZ A;  1ZU8 A;  3B8S A;  3TC5 A;  3BXW A;  3UI4 A;  2PPO A;  3ARY A;  4DZ3 A;  3ARU A;  1H0G A;  1FKI A;  4FN2 A;  3UQB A;  3UF8 A;  3UQA A;  4TYO A;  3NTP A;  4ODN A;  4DWS C;  2DT2 A;  5HBF A;  1T11 A;  1ZBC A;  1EYM A;  1E6P A;  3ARX A;  1KFW A;  2ZQU A;  3RME A;  3W4R A;  4AY1 A;  5HW7 A;  2DSW A;  4DWS D;  2XP7 A;  1W1T A;  3TDB A;  3ARR A;  2PV2 A;  3AS3 A;  1FKB A;  3UI6 A;  1JND A;  3FY1 A;  1NWS A;  4MTV A;  2ZQS A;  4DRO A;  4NSB A;  1ZB5 A;  3JYM A;  1FKF A;  2WK2 A;  2A3E A;  3O5D A;  4J4O A;  1E15 A;  1HKK A;  2RSE A;  3JXV A;  4DRM A;  2D9F A;  3OOB A;  1D6O A;  4P8V A;  1W9U A;  2DG9 A;  1W1P A;  4WKF A;  1FFR A;  2ITK A;  1GOI A;  1R9H A;  4Z2J A;  5HUA A;  2QF8 A;  4ODR A;  1SR0 A;  3CHF A;  5DO2 A;  1ZBW A;  2KI3 A;  1FKJ A;  5DIV A;  4ODP A;  3B9A A;  5DF0 A;  4ITZ A;  3IHZ A;  1FKH A;  2XP9 A;  4QZV B;  4Z2I A;  3KCE A;  2PV3 A;  2L2S A;  1QPF A;  1HKJ A;  1JNT A;  1YAT A;  4G50 A;  4Z2H A;  5I98 A;  3ARO A;  1F40 A;  1EIB A;  4IQC A;  1NWU A;  5GQB A;  3KAB A;  1FJD A;  4QIB A;  1A7X A;  1OWQ A;  2M08 A;  1YW5 A;  4DRH A;  4DWS B;  1J4I A;  2IUZ A;  4ODL A;  3WL1 A;  4DT4 A;  1WB0 A;  3ARP A;  3ARZ A;  4TNS A;  2MPH A;  1HJW A;  1LG2 A;  4JFK A;  4ODO A;  2ZQT A;  1WNO A;  1KT1 A;  3CGM A;  1WAW A;  3O5R A;  4MSP A;  2KR7 A;  4ZS6 A;  5HWB A;  3ARQ A;  3WQV A;  4DZ2 A;  3AS2 A;  1EQ3 A;  3RM8 A;  4ML4 A;  4IPX A;  3I6C A;  1B6C A;  4BF8 A;  4MNL A;  1W26 A;  3JYJ A;  5HTG A;  1U79 A;  1HXV A;  4LAW A;  4DIP A;  2MLY A;  1D7J A;  4HAR A;  1O6I A;  4WKA A;  1ZCN A;  2DT0 A;  2MF9 A;  2ESC A;  4P8W A;  2DG4 A;  1GPF A;  1UR8 A;  2RUR A;  3CGN A;  1PIN A;  1Q1C A;  1FKT A;  1W1V A;  3WH0 A;  2MLZ A;  4KR0 B;  4DRJ A;  1W9V A;  1D7I A;  1LL6 A;  1FKD A;  1LQ0 A;  4MNJ A;  3WD3 A;  1D2K A;  5DIT A;  4L72 B;  3WIJ A;  5HW8 A;  3KAH A;  5BXJ A;  1PBK A;  3PRA A;  3O5L A;  1FKL A;  1UR9 A;  5GPR A;  3CHD A;  2PPP A;  3RFW A;  2K8I A;  3B9E A;  3ALF A;  3RGC A;  3CHE A;  4N19 A;  3UI5 A;  2XPA A;  2FDM A;  3CH9 A;  2DSZ A;  1W9P A;  3ARW A;  4DRP A;  2LJ4 A;  3WQW A;  1ZBV A;  2WM0 A;  5HKG A;  3EY6 A;  1HJV A;  5DIU A;  3O5E A;  3GPK A;  2RUQ A;  1VF8 A;  3PRD A;  1P5Q A;  3IKD A;  4ZPW R;  2FKE A;  4HBO A;  2ZQV A;  3FAP A;  1FFQ A;  4JFM A;  1GUV A;  4Q22 A;  2ZR5 A;  1QPL A;  3KAF A;  3O5G A;  2KGJ A;  3WD2 A;  3WL0 A;  3KAD A;  3PRB A;  3KAI A;  2G8Z A;  3O5J A;  2PPN A;  4W9P A;  4JFI A;  1Q6U A;  1QZ2 A;  3G6L A;  4LAV A;  3UQI A;  2O9O A;  1CTN A;  4MGV A;  1NWT A;  1EHN A;  4C02 B;  2VN1 A;  5HW6 A;  3O5F A;  2DT1 A;  5JH8 A;  4KQZ A;  4JFJ A;  4MNM A;  2F2D A;  4TW8 A;  3O5K A;  4U86 A;  1C9H A;  2MNT A;  2OLH A;  4S3J A;  3CZ8 A;  2Y78 A;  4WJX A;  3G6M A;  1NWR A;  1TCO C;  1LL7 A;  4MNK A;  4MPK A;  1FKR A;  4W5U A;  1FD9 A;  1OGG A;  5B8I C;  1BKF A;  5J6E A;  2IF4 A;  4Q7N A;  2XP4 A;  1D7H A;  4HBE A;  5HT1 A;  1E9L A;  2WLZ A;  4O2T A;  1SYT A;  3ART A;  4W9O A;  4IT6 A;  4L3N A;  4ODM A;  1NSG A;  3WD4 A;  1Q6H A;  3NI6 A;  4R5E A;  2F4E A;  2LKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...