1J4RA

Fk506 binding protein complexed with fkb-001
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-BINDING PROTEIN
publication title 2-Aryl-2,2-difluoroacetamide FKBP12 ligands: synthesis and X-ray structural studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 25
structure length 107
sequence length 107
chains with identical sequence B, D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1j4rA00
4IQCA 4R0XA 2KI3A 2KE0A 2VCDA 1W26A 4QT2A 1FKGA 1YW5A 3KABA 3UI6A 2XP7A 1JVWA 3KAIA 5DIVA 3IKGA 2XP9A 5HT1A 2KFWA 2ZQTA 3O5EA 3O5MA 2MLXA 3KADA 4U84A 3TCZA 3VAWA 1FAPA 5HUAA 3UI4A 1L1PA 1D6OA 1FKLA 3JYJA 4QT3A 5HW7A 1BKFA 3MDYB 4MSPA 2ZR4A 2FKEA 4W9QA 3UQIA 2PV2A 2F4EA 2XP8A 1J4HA 2L2SA 4N19A 2LJ4A 3I6CA 3TC5A 5HW8A 1U79A 5I98A 2RUCA 2FAPA 4JFLA 2MPHA 2ITKA 3O5GA 1TCOC 4C02B 4DRHA 1YATA 4DRJA 4JFIA 4QIBA 2DG3A 1BL4A 2MF9A 2MLZA 3UI5A 1C9HA 2RSEA 1KT1A 4DH0A 4DZ3A 4TX0A 1FKSA 1D7IA 3O5OA 4G50A 2MNTA 2XP6A 3O5JA 2XPBA 4LAWA 4MGVA 5B8IC 1B6CA 1FKBA 3RGCA 2KO7A 1Q6UA 4TW8A 5D75A 2XPAA 4BF8A 3O5PA 4JFKA 1NMVA 3CGMA 1D7JA 2RURA 1QZ2A 4DROA 1FKRA 3PRDA 2Y78A 3B7XA 1NSGA 3NI6A 1T11A 3RFWA 4G2PA 1JNTA 2PBCA 2RUDA 4TW6A 2OFNA 2F2DA 3FAPA 1EQ3A 1ROTA 3PA7A 4O2TA 5HW6A 2M2AA 3O5KA 2MLYA 1A7XA 2DG4A 1Q6HA 4U86A 4DT4A 4DIPA 4U85A 3H9RB 3O5QA 3UQAA 5DIUA 2IF4A 2UZ5A 4LAYA 4DZ2A 4GGQA 3O5RA 5DITA 1FKFA 4ODKA 2F21A 1NMWA 1QPFA 2LGOA 2KR7A 2ZQUA 4DRMA 1Q1CA 1Y0OA 3KAHA 4JFJA 4ODQA 2M1IA 3JYMA 3UF8A 4DRPA 1HXVA 2K8IA 1D7HA 2XP4A 2AWGA 2RUQA 2PPOA 2ZR5A 1ROUA 2DG9A 1FKHA 2PV1A 1FKIA 2ZQVA 3KZ7A 4GIVA 1F8AB 3O5LA 2PPNA 4JFMA 1R9HA 3O5IA 2N87A 4TYOA 3EY6A 1J6YA 1FKJA 2LKNA 3O5DA 2VN1A 3OOBA 1N1AA 1FKTA 1FKKA 4ODLA 3O5FA 1P5QA 3NRKA 2M08A 3PRBA 4JYSA 3IHZA 2RQSA 2JZVA 1FJDA 1ZK6A 2XP3A 3KAFA 4FAPA 2XP5A 4W9OA 3GPKA 1F40A 4DRIA 1QPLA 3CGNA 3ODKA 2ZQSA 2PV3A 4IQ2A 3IK8A 4DRKA 1M5YA 3KAGA 3LUOA 4ODPA 1KT0A 4LAXA 5BXJA 3KACA 4IPXA 1J4IA 4FN2A 1Q6IA 1ZCNA 3IKDA 5HTGA 2ZR6A 3UQBA 4ITZA 1FD9A 4J4OA 4ODNA 4ODMA 4W9PA 3NTPA 5GPGA 3TDBA 3WH0A 4NNRA 5HWBA 2LPVA 2D9FA 4DRNA 2Q5AA 2PPPA 5HKGA 1J4RA 1PINA 4LAVA 4TW7A 4DRQA 2KGJA 4J4NA 1EYMA 4ODRA 5J6EA 1FKDA 3KCEA 4TNSA 5HWCA 4ODOA 3JXVA 1PBKA 1JNSA
chains in the Genus database with same CATH superfamily
3G6MA 3CHCA 1H0GA 4L3NA 4S3JA 2PN0A 3W4RA 4Q22A 3UI6A 3BXWA 3AS1A 2G8ZA 3ARXA 1ZL1A 2MLXA 3KADA 3VAWA 4S3KA 4W9QA 2FKEA 4L72B 4Z2HA 1CTNA 2O9OA 1OWQA 4NZCA 1JNEA 2ETNA 1HKMA 4W5UA 2FAPA 1W1TA 3ARVA 2MF9A 2MLZA 3RM9A 3CHDA 3O5OA 2XPBA 1B6CA 5D75A 5GQBA 1QZ2A 2A3AA 4DROA 1JNDA 4Z2JA 2FDMA 2RUDA 3FAPA 2F2DA 1HJWA 4R5EA 3PA7A 5HW6A 2F23A 4AY1A 2M2AA 3O5KA 1A7XA 2DG4A 1X6LA 3O5QA 3UQAA 2DT2A 2DT3A 4ZS6A 1E15A 2F21A 1NMWA 3ARRA 2ZQUA 4JFJA 1W1VA 2RUQA 2DG9A 2A3BA 1FKHA 1JCHB 4GIVA 1F8AB 3O5LA 4JFMA 3O5IA 1FKJA 3OOBA 4MPKA 2AOSA 3O5FA 4MNMA 3NRKA 4KQZA 1FJDA 2WLZA 2XP3A 1F40A 4W9OA 3GPKA 4Z2KA 1LJYA 3ODKA 1OGBA 1M5YA 3ARZA 1KT0A 3WQVA 4IPXA 5JH8A 4FN2A 4HARA 2O92A 1Q6IA 4NSBA 4ITZA 1FD9A 4MNJA 1NWRA 4ODMA 1FFRA 5GPGA 4WKAA 5HKGA 1HJVA 3GU0A 1EYMA 1FKDA 4TNSA 4QZVB 1ZBKA 4ML4A 4R0XA 2KI3A 2KE0A 2VCDA 1W26A 1FKGA 1ZBVA 2WLYA 4KR0B 1YW5A 3KABA 3WD1A 3WD3A 2XP7A 5DIVA 2ZQTA 3O5MA 1GUVA 4WKHA 3RMEA 2DSZA 3MDYB 4IT6A 4HBEA 1J4HA 2L2SA 1HKIA 2LJ4A 1U79A 4DRHA 4C02B 4QIBA 2DG3A 3UI5A 4DH0A 4WK9A 1ITXA 1FKSA 2DPEA 1KFWA 1D7IA 4G50A 2MNTA 3O5JA 4LAWA 3WD0A 4MGVA 5B8IC 3RGCA 2KO7A 1Q6UA 3QOKA 4MNKA 1ZBWA 3ARPA 4BF8A 1LL7A 3EIPA 3PRDA 1NSGA 1T11A 3WL1A 2OFNA 1LL6A 1EQ3A 1ROTA 5DEZA 1UR8A 1NWTA 1Q6HA 5DIUA 4LAYA 1FKFA 4MTVA 2LGOA 4DRPA 1Q1CA 1Y0OA 3KAHA 1HXVA 1D7HA 1EDQA 2XP4A 2ZR5A 1ROUA 3ARUA 2PV1A 1NH6A 3ARWA 3KZ7A 3AS0A 2PPNA 3WKZA 1E6RA 1FKKA 4ODLA 1P5QA 3PRBA 1LG2A 1EIBA 3AS3A 1ZK6A 4P8WA 3KAFA 3WIJA 4DRIA 3CH9A 2QF8A 5DO2A 2PV3A 3IK8A 2DSUA 3AQUA 3LUOA 1GOIA 1IX5A 4LAXA 1LQ0A 1WB0A 1ZB5A 2D9FA 4DRNA 1UR9A 1PINA 4TW7A 1TFVA 2KGJA 4J4NA 4ODRA 2P4VA 4XAKA 2DT0A 1H0IA 5HWCA 4P8XA 4IQCA 5DF0A 3BMBA 1LG1A 1WAWA 4WJXA 3IKGA 4MAVA 2XP9A 3O5EA 3RM8A 2DSVA 1FAPA 5HUAA 3UI4A 1GPFA 1FKLA 1L1PA 3JYJA 4QT3A 5HW7A 3UQIA 2XP8A 1EHNA 3RM4A 5I98A 3I6CA 2WM0A 2RUCA 3FY1A 2IUZA 2MPHA 2ITKA 3OA5A 1TCOC 4JFLA 4DZ3A 4DRJA 4JFIA 1BL4A 4ZPWR 1C9HA 2RSEA 1KT1A 1OGGA 4JFKA 1NMVA 1FFQA 3CGMA 2RURA 1W9PA 1FKRA 2Y78A 3RFWA 4G2PA 1JNTA 4TW6A 3ARSA 4Z2GA 4O2TA 2PI6A 1W9VA 3AS2A 4U86A 4DT4A 4U85A 3H9RB 3WL0A 1W1YA 3B9AA 1VF8A 2UZ5A 4DZ2A 3O5RA 5DITA 4ZPVR 5GPRA 2KR7A 4DRMA 3B9EA 4ODQA 3JYMA 2K8IA 1FKIA 3PR9A 2ZQVA 2B5UB 1R9HA 4TYOA 2N87A 2A3CA 4Q7NA 3O5DA 1NWSA 2VN1A 4PTMA 4JYSA 3IHZA 4UDMA 2RQSA 2JZVA 3WD4A 4WIWA 2OLHA 2XP5A 3ARYA 1X6NA 4WKFA 4MNLA 2ZQSA 4IQ2A 1ZU8A 1LL4A 3PRAA 4LGXA 3KAGA 4HBOA 4ODPA 3KACA 5HBFA 3ARQA 1ZCNA 5HTGA 4DWSB 4Z2LA 4J4OA 4W9PA 3WH0A 3UQBA 1JNSA 5HWBA 4NNRA 2YBTA 1J4RA 4LAVA 4DRQA 2EULA 1SR0A 3KCEA 3ALGA 4P8VA 1K9TA 4Z2IA 4QT2A 4DWSA 3WD2A 3KAIA 1JVWA 5HT1A 1HJXA 2KFWA 3TCZA 4U84A 1D6OA 3ALFA 2WK2A 1BKFA 4MSPA 4URIA 2ZR4A 3WQWA 2PV2A 2YBUA 2F4EA 1E6NA 4N19A 5HW8A 3CZ8A 3O5GA 1YATA 5J6EA 1HKKA 1W9UA 1D2KA 4TX0A 3ARTA 2XP6A 1FKBA 1RD6A 4TW8A 2XPAA 3O5PA 1D7JA 2G41A 3B7XA 3NI6A 2B31A 1SYTA 2PBCA 3AROA 1ZBCA 3B8SA 2ESCA 2DSWA 1E6ZA 1E6PA 2MLYA 1HKJA 4DIPA 3G6LA 2IF4A 4GGQA 4IT4A 4ODKA 1QPFA 4ZPTR 3CHFA 2M1IA 3UF8A 4DWSC 3TC5A 2AWGA 2PPOA 4DWSD 1E9LA 1J6YA 3EY6A 2LKNA 1N1AA 1NWUA 3B9DA 1FKTA 1GRJA 2M08A 4FAPA 3CHEA 1QPLA 3CGNA 3GTYX 4DRKA 2DT1A 2A3EA 5BXJA 1O6IA 1XHGA 1J4IA 1W1PA 3IKDA 1WNOA 1XRVA 2ZR6A 4ODNA 3NTPA 3FXYA 3TDBA 2LPVA 2Q5AA 2PPPA 4P8UA 1E44A 4ODOA 3JXVA 1PBKA
chains in the Genus database with same CATH topology
3G6MA 3CHCA 1H0GA 4L3NA 4S3JA 3W4RA 4Q22A 3UI6A 3BXWA 3AS1A 2G8ZA 3ARXA 1ZL1A 2MLXA 3KADA 3VAWA 4S3KA 4W9QA 2FKEA 4L72B 4Z2HA 1CTNA 2O9OA 1OWQA 4NZCA 1JNEA 4W5UA 1HKMA 2FAPA 1W1TA 3ARVA 2MF9A 2MLZA 3RM9A 3CHDA 3O5OA 2XPBA 1B6CA 5D75A 5GQBA 1QZ2A 2A3AA 4DROA 1JNDA 4Z2JA 2FDMA 2RUDA 3FAPA 2F2DA 1HJWA 4R5EA 3PA7A 5HW6A 4AY1A 2M2AA 3O5KA 1A7XA 2DG4A 1X6LA 3O5QA 3UQAA 2DT2A 2DT3A 4ZS6A 1E15A 2F21A 1NMWA 3ARRA 2ZQUA 4JFJA 1W1VA 2RUQA 2DG9A 2A3BA 1FKHA 4GIVA 1F8AB 3O5LA 4JFMA 3O5IA 1FKJA 3OOBA 4MPKA 2AOSA 3O5FA 4MNMA 3NRKA 4KQZA 1FJDA 2WLZA 2XP3A 1F40A 4W9OA 3GPKA 4Z2KA 1LJYA 3ODKA 1OGBA 1M5YA 3ARZA 1KT0A 3WQVA 4IPXA 5JH8A 4FN2A 4HARA 2O92A 1Q6IA 4NSBA 4ITZA 1FD9A 4MNJA 1NWRA 4ODMA 1FFRA 5GPGA 4WKAA 5HKGA 1HJVA 1EYMA 1FKDA 4TNSA 4QZVB 1ZBKA 4ML4A 4R0XA 2KI3A 2KE0A 2VCDA 1W26A 1FKGA 1ZBVA 2WLYA 4KR0B 1YW5A 3KABA 3WD1A 3WD3A 2XP7A 5DIVA 2ZQTA 3O5MA 1GUVA 4WKHA 3RMEA 2DSZA 3MDYB 4IT6A 4HBEA 1J4HA 2L2SA 1HKIA 2LJ4A 1U79A 4DRHA 4C02B 4QIBA 2DG3A 3UI5A 4DH0A 4WK9A 1ITXA 1FKSA 2DPEA 1KFWA 1D7IA 4G50A 2MNTA 3O5JA 4LAWA 3WD0A 4MGVA 5B8IC 3RGCA 2KO7A 1Q6UA 3QOKA 4MNKA 1ZBWA 3ARPA 4BF8A 1LL7A 3PRDA 1NSGA 1T11A 3WL1A 2OFNA 1LL6A 1EQ3A 1ROTA 5DEZA 1UR8A 1NWTA 1Q6HA 5DIUA 4LAYA 1FKFA 4MTVA 2LGOA 4DRPA 1Q1CA 1Y0OA 3KAHA 1HXVA 1D7HA 1EDQA 2XP4A 2ZR5A 1ROUA 3ARUA 2PV1A 1NH6A 3ARWA 3KZ7A 3AS0A 2PPNA 3WKZA 1E6RA 1FKKA 4ODLA 1P5QA 3PRBA 1LG2A 1EIBA 3AS3A 1ZK6A 4P8WA 3KAFA 3WIJA 4DRIA 3CH9A 2QF8A 5DO2A 2PV3A 3IK8A 2DSUA 3AQUA 3LUOA 1GOIA 1IX5A 4LAXA 1LQ0A 1WB0A 1ZB5A 2D9FA 4DRNA 1UR9A 1PINA 4TW7A 1TFVA 2KGJA 4J4NA 4ODRA 4XAKA 2DT0A 1H0IA 5HWCA 4P8XA 4IQCA 5DF0A 1LG1A 1WAWA 4WJXA 3IKGA 4MAVA 2XP9A 3O5EA 3RM8A 2DSVA 1FAPA 5HUAA 3UI4A 1GPFA 1FKLA 1L1PA 3JYJA 4QT3A 5HW7A 3UQIA 2XP8A 1EHNA 3RM4A 5I98A 3I6CA 2WM0A 2RUCA 3FY1A 2IUZA 2MPHA 2ITKA 3OA5A 1TCOC 4JFLA 4DZ3A 4DRJA 4JFIA 1BL4A 4ZPWR 1C9HA 2RSEA 1KT1A 1OGGA 4JFKA 1NMVA 1FFQA 3CGMA 2RURA 1W9PA 1FKRA 2Y78A 3RFWA 4G2PA 1JNTA 4TW6A 3ARSA 4Z2GA 4O2TA 2PI6A 1W9VA 3AS2A 4U86A 4DT4A 4U85A 3H9RB 3WL0A 1W1YA 3B9AA 1VF8A 2UZ5A 4DZ2A 3O5RA 5DITA 4ZPVR 5GPRA 2KR7A 4DRMA 3B9EA 4ODQA 3JYMA 2K8IA 1FKIA 3PR9A 2ZQVA 1R9HA 4TYOA 2N87A 2A3CA 4Q7NA 3O5DA 1NWSA 2VN1A 4PTMA 4JYSA 3IHZA 2RQSA 2JZVA 3WD4A 4WIWA 2OLHA 2XP5A 3ARYA 1X6NA 4WKFA 4MNLA 2ZQSA 4IQ2A 1ZU8A 1LL4A 3PRAA 4LGXA 3KAGA 4HBOA 4ODPA 3KACA 5HBFA 3ARQA 1ZCNA 5HTGA 4DWSB 4Z2LA 4J4OA 4W9PA 3WH0A 3UQBA 1JNSA 5HWBA 4NNRA 2YBTA 1J4RA 4LAVA 4DRQA 1SR0A 3KCEA 3ALGA 4P8VA 1K9TA 4Z2IA 4QT2A 4DWSA 3WD2A 3KAIA 1JVWA 5HT1A 1HJXA 2KFWA 3TCZA 4U84A 1D6OA 3ALFA 2WK2A 1BKFA 4MSPA 4URIA 2ZR4A 3WQWA 2PV2A 2YBUA 2F4EA 1E6NA 4N19A 5HW8A 3CZ8A 3O5GA 1YATA 5J6EA 1HKKA 1W9UA 1D2KA 4TX0A 3ARTA 2XP6A 1FKBA 1RD6A 4TW8A 2XPAA 3O5PA 1D7JA 2G41A 3B7XA 3NI6A 2B31A 1SYTA 2PBCA 3AROA 1ZBCA 3B8SA 2ESCA 2DSWA 1E6ZA 1E6PA 2MLYA 1HKJA 4DIPA 3G6LA 2IF4A 4GGQA 4IT4A 4ODKA 1QPFA 4ZPTR 3CHFA 2M1IA 3UF8A 4DWSC 3TC5A 2AWGA 2PPOA 4DWSD 1E9LA 1J6YA 3EY6A 2LKNA 1N1AA 1NWUA 3B9DA 1FKTA 2M08A 4FAPA 3CHEA 1QPLA 3CGNA 4DRKA 2DT1A 2A3EA 5BXJA 1O6IA 1XHGA 1J4IA 1W1PA 3IKDA 1WNOA 1XRVA 2ZR6A 4ODNA 3NTPA 3FXYA 3TDBA 2LPVA 2Q5AA 2PPPA 4P8UA 4ODOA 3JXVA 1PBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQC A;  4R0X A;  2KI3 A;  2KE0 A;  2VCD A;  1W26 A;  4QT2 A;  1FKG A;  1YW5 A;  3KAB A;  3UI6 A;  2XP7 A;  1JVW A;  3KAI A;  5DIV A;  3IKG A;  2XP9 A;  5HT1 A;  2KFW A;  2ZQT A;  3O5E A;  3O5M A;  2MLX A;  3KAD A;  4U84 A;  3TCZ A;  3VAW A;  1FAP A;  5HUA A;  3UI4 A;  1L1P A;  1D6O A;  1FKL A;  3JYJ A;  4QT3 A;  5HW7 A;  1BKF A;  3MDY B;  4MSP A;  2ZR4 A;  2FKE A;  4W9Q A;  3UQI A;  2PV2 A;  2F4E A;  2XP8 A;  1J4H A;  2L2S A;  4N19 A;  2LJ4 A;  3I6C A;  3TC5 A;  5HW8 A;  1U79 A;  5I98 A;  2RUC A;  2FAP A;  4JFL A;  2MPH A;  2ITK A;  3O5G A;  1TCO C;  4C02 B;  4DRH A;  1YAT A;  4DRJ A;  4JFI A;  4QIB A;  2DG3 A;  1BL4 A;  2MF9 A;  2MLZ A;  3UI5 A;  1C9H A;  2RSE A;  1KT1 A;  4DH0 A;  4DZ3 A;  4TX0 A;  1FKS A;  1D7I A;  3O5O A;  4G50 A;  2MNT A;  2XP6 A;  3O5J A;  2XPB A;  4LAW A;  4MGV A;  5B8I C;  1B6C A;  1FKB A;  3RGC A;  2KO7 A;  1Q6U A;  4TW8 A;  5D75 A;  2XPA A;  4BF8 A;  3O5P A;  4JFK A;  1NMV A;  3CGM A;  1D7J A;  2RUR A;  1QZ2 A;  4DRO A;  1FKR A;  3PRD A;  2Y78 A;  3B7X A;  1NSG A;  3NI6 A;  1T11 A;  3RFW A;  4G2P A;  1JNT A;  2PBC A;  2RUD A;  4TW6 A;  2OFN A;  2F2D A;  3FAP A;  1EQ3 A;  1ROT A;  3PA7 A;  4O2T A;  5HW6 A;  2M2A A;  3O5K A;  2MLY A;  1A7X A;  2DG4 A;  1Q6H A;  4U86 A;  4DT4 A;  4DIP A;  4U85 A;  3H9R B;  3O5Q A;  3UQA A;  5DIU A;  2IF4 A;  2UZ5 A;  4LAY A;  4DZ2 A;  4GGQ A;  3O5R A;  5DIT A;  1FKF A;  4ODK A;  2F21 A;  1NMW A;  1QPF A;  2LGO A;  2KR7 A;  2ZQU A;  4DRM A;  1Q1C A;  1Y0O A;  3KAH A;  4JFJ A;  4ODQ A;  2M1I A;  3JYM A;  3UF8 A;  4DRP A;  1HXV A;  2K8I A;  1D7H A;  2XP4 A;  2AWG A;  2RUQ A;  2PPO A;  2ZR5 A;  1ROU A;  2DG9 A;  1FKH A;  2PV1 A;  1FKI A;  2ZQV A;  3KZ7 A;  4GIV A;  1F8A B;  3O5L A;  2PPN A;  4JFM A;  1R9H A;  3O5I A;  2N87 A;  4TYO A;  3EY6 A;  1J6Y A;  1FKJ A;  2LKN A;  3O5D A;  2VN1 A;  3OOB A;  1N1A A;  1FKT A;  1FKK A;  4ODL A;  3O5F A;  1P5Q A;  3NRK A;  2M08 A;  3PRB A;  4JYS A;  3IHZ A;  2RQS A;  2JZV A;  1FJD A;  1ZK6 A;  2XP3 A;  3KAF A;  4FAP A;  2XP5 A;  4W9O A;  3GPK A;  1F40 A;  4DRI A;  1QPL A;  3CGN A;  3ODK A;  2ZQS A;  2PV3 A;  4IQ2 A;  3IK8 A;  4DRK A;  1M5Y A;  3KAG A;  3LUO A;  4ODP A;  1KT0 A;  4LAX A;  5BXJ A;  3KAC A;  4IPX A;  1J4I A;  4FN2 A;  1Q6I A;  1ZCN A;  3IKD A;  5HTG A;  2ZR6 A;  3UQB A;  4ITZ A;  1FD9 A;  4J4O A;  4ODN A;  4ODM A;  4W9P A;  3NTP A;  5GPG A;  3TDB A;  3WH0 A;  4NNR A;  5HWB A;  2LPV A;  2D9F A;  4DRN A;  2Q5A A;  2PPP A;  5HKG A;  1J4R A;  1PIN A;  4LAV A;  4TW7 A;  4DRQ A;  2KGJ A;  4J4N A;  1EYM A;  4ODR A;  5J6E A;  1FKD A;  3KCE A;  4TNS A;  5HWC A;  4ODO A;  3JXV A;  1PBK A;  1JNS A; 
#chains in the Genus database with same CATH topology
 3G6M A;  3CHC A;  1H0G A;  4L3N A;  4S3J A;  2PN0 A;  3W4R A;  4Q22 A;  3UI6 A;  3BXW A;  3AS1 A;  2G8Z A;  3ARX A;  1ZL1 A;  2MLX A;  3KAD A;  3VAW A;  4S3K A;  4W9Q A;  2FKE A;  4L72 B;  4Z2H A;  1CTN A;  2O9O A;  1OWQ A;  4NZC A;  1JNE A;  2ETN A;  1HKM A;  4W5U A;  2FAP A;  1W1T A;  3ARV A;  2MF9 A;  2MLZ A;  3RM9 A;  3CHD A;  3O5O A;  2XPB A;  1B6C A;  5D75 A;  5GQB A;  1QZ2 A;  2A3A A;  4DRO A;  1JND A;  4Z2J A;  2FDM A;  2RUD A;  3FAP A;  2F2D A;  1HJW A;  4R5E A;  3PA7 A;  5HW6 A;  2F23 A;  4AY1 A;  2M2A A;  3O5K A;  1A7X A;  2DG4 A;  1X6L A;  3O5Q A;  3UQA A;  2DT2 A;  2DT3 A;  4ZS6 A;  1E15 A;  2F21 A;  1NMW A;  3ARR A;  2ZQU A;  4JFJ A;  1W1V A;  2RUQ A;  2DG9 A;  2A3B A;  1FKH A;  1JCH B;  4GIV A;  1F8A B;  3O5L A;  4JFM A;  3O5I A;  1FKJ A;  3OOB A;  4MPK A;  2AOS A;  3O5F A;  4MNM A;  3NRK A;  4KQZ A;  1FJD A;  2WLZ A;  2XP3 A;  1F40 A;  4W9O A;  3GPK A;  4Z2K A;  1LJY A;  3ODK A;  1OGB A;  1M5Y A;  3ARZ A;  1KT0 A;  3WQV A;  4IPX A;  5JH8 A;  4FN2 A;  4HAR A;  2O92 A;  1Q6I A;  4NSB A;  4ITZ A;  1FD9 A;  4MNJ A;  1NWR A;  4ODM A;  1FFR A;  5GPG A;  4WKA A;  5HKG A;  1HJV A;  3GU0 A;  1EYM A;  1FKD A;  4TNS A;  4QZV B;  1ZBK A;  4ML4 A;  4R0X A;  2KI3 A;  2KE0 A;  2VCD A;  1W26 A;  1FKG A;  1ZBV A;  2WLY A;  4KR0 B;  1YW5 A;  3KAB A;  3WD1 A;  3WD3 A;  2XP7 A;  5DIV A;  2ZQT A;  3O5M A;  1GUV A;  4WKH A;  3RME A;  2DSZ A;  3MDY B;  4IT6 A;  4HBE A;  1J4H A;  2L2S A;  1HKI A;  2LJ4 A;  1U79 A;  4DRH A;  4C02 B;  4QIB A;  2DG3 A;  3UI5 A;  4DH0 A;  4WK9 A;  1ITX A;  1FKS A;  2DPE A;  1KFW A;  1D7I A;  4G50 A;  2MNT A;  3O5J A;  4LAW A;  3WD0 A;  4MGV A;  5B8I C;  3RGC A;  2KO7 A;  1Q6U A;  3QOK A;  4MNK A;  1ZBW A;  3ARP A;  4BF8 A;  1LL7 A;  3EIP A;  3PRD A;  1NSG A;  1T11 A;  3WL1 A;  2OFN A;  1LL6 A;  1EQ3 A;  1ROT A;  5DEZ A;  1UR8 A;  1NWT A;  1Q6H A;  5DIU A;  4LAY A;  1FKF A;  4MTV A;  2LGO A;  4DRP A;  1Q1C A;  1Y0O A;  3KAH A;  1HXV A;  1D7H A;  1EDQ A;  2XP4 A;  2ZR5 A;  1ROU A;  3ARU A;  2PV1 A;  1NH6 A;  3ARW A;  3KZ7 A;  3AS0 A;  2PPN A;  3WKZ A;  1E6R A;  1FKK A;  4ODL A;  1P5Q A;  3PRB A;  1LG2 A;  1EIB A;  3AS3 A;  1ZK6 A;  4P8W A;  3KAF A;  3WIJ A;  4DRI A;  3CH9 A;  2QF8 A;  5DO2 A;  2PV3 A;  3IK8 A;  2DSU A;  3AQU A;  3LUO A;  1GOI A;  1IX5 A;  4LAX A;  1LQ0 A;  1WB0 A;  1ZB5 A;  2D9F A;  4DRN A;  1UR9 A;  1PIN A;  4TW7 A;  1TFV A;  2KGJ A;  4J4N A;  4ODR A;  2P4V A;  4XAK A;  2DT0 A;  1H0I A;  5HWC A;  4P8X A;  4IQC A;  5DF0 A;  3BMB A;  1LG1 A;  1WAW A;  4WJX A;  3IKG A;  4MAV A;  2XP9 A;  3O5E A;  3RM8 A;  2DSV A;  1FAP A;  5HUA A;  3UI4 A;  1GPF A;  1FKL A;  1L1P A;  3JYJ A;  4QT3 A;  5HW7 A;  3UQI A;  2XP8 A;  1EHN A;  3RM4 A;  5I98 A;  3I6C A;  2WM0 A;  2RUC A;  3FY1 A;  2IUZ A;  2MPH A;  2ITK A;  3OA5 A;  1TCO C;  4JFL A;  4DZ3 A;  4DRJ A;  4JFI A;  1BL4 A;  4ZPW R;  1C9H A;  2RSE A;  1KT1 A;  1OGG A;  4JFK A;  1NMV A;  1FFQ A;  3CGM A;  2RUR A;  1W9P A;  1FKR A;  2Y78 A;  3RFW A;  4G2P A;  1JNT A;  4TW6 A;  3ARS A;  4Z2G A;  4O2T A;  2PI6 A;  1W9V A;  3AS2 A;  4U86 A;  4DT4 A;  4U85 A;  3H9R B;  3WL0 A;  1W1Y A;  3B9A A;  1VF8 A;  2UZ5 A;  4DZ2 A;  3O5R A;  5DIT A;  4ZPV R;  5GPR A;  2KR7 A;  4DRM A;  3B9E A;  4ODQ A;  3JYM A;  2K8I A;  1FKI A;  3PR9 A;  2ZQV A;  2B5U B;  1R9H A;  4TYO A;  2N87 A;  2A3C A;  4Q7N A;  3O5D A;  1NWS A;  2VN1 A;  4PTM A;  4JYS A;  3IHZ A;  4UDM A;  2RQS A;  2JZV A;  3WD4 A;  4WIW A;  2OLH A;  2XP5 A;  3ARY A;  1X6N A;  4WKF A;  4MNL A;  2ZQS A;  4IQ2 A;  1ZU8 A;  1LL4 A;  3PRA A;  4LGX A;  3KAG A;  4HBO A;  4ODP A;  3KAC A;  5HBF A;  3ARQ A;  1ZCN A;  5HTG A;  4DWS B;  4Z2L A;  4J4O A;  4W9P A;  3WH0 A;  3UQB A;  1JNS A;  5HWB A;  4NNR A;  2YBT A;  1J4R A;  4LAV A;  4DRQ A;  2EUL A;  1SR0 A;  3KCE A;  3ALG A;  4P8V A;  1K9T A;  4Z2I A;  4QT2 A;  4DWS A;  3WD2 A;  3KAI A;  1JVW A;  5HT1 A;  1HJX A;  2KFW A;  3TCZ A;  4U84 A;  1D6O A;  3ALF A;  2WK2 A;  1BKF A;  4MSP A;  4URI A;  2ZR4 A;  3WQW A;  2PV2 A;  2YBU A;  2F4E A;  1E6N A;  4N19 A;  5HW8 A;  3CZ8 A;  3O5G A;  1YAT A;  5J6E A;  1HKK A;  1W9U A;  1D2K A;  4TX0 A;  3ART A;  2XP6 A;  1FKB A;  1RD6 A;  4TW8 A;  2XPA A;  3O5P A;  1D7J A;  2G41 A;  3B7X A;  3NI6 A;  2B31 A;  1SYT A;  2PBC A;  3ARO A;  1ZBC A;  3B8S A;  2ESC A;  2DSW A;  1E6Z A;  1E6P A;  2MLY A;  1HKJ A;  4DIP A;  3G6L A;  2IF4 A;  4GGQ A;  4IT4 A;  4ODK A;  1QPF A;  4ZPT R;  3CHF A;  2M1I A;  3UF8 A;  4DWS C;  3TC5 A;  2AWG A;  2PPO A;  4DWS D;  1E9L A;  1J6Y A;  3EY6 A;  2LKN A;  1N1A A;  1NWU A;  3B9D A;  1FKT A;  1GRJ A;  2M08 A;  4FAP A;  3CHE A;  1QPL A;  3CGN A;  3GTY X;  4DRK A;  2DT1 A;  2A3E A;  5BXJ A;  1O6I A;  1XHG A;  1J4I A;  1W1P A;  3IKD A;  1WNO A;  1XRV A;  2ZR6 A;  4ODN A;  3NTP A;  3FXY A;  3TDB A;  2LPV A;  2Q5A A;  2PPP A;  4P8U A;  1E44 A;  4ODO A;  3JXV A;  1PBK A; 
#chains in the Genus database with same CATH homology
 3G6M A;  3CHC A;  1H0G A;  4L3N A;  4S3J A;  3W4R A;  4Q22 A;  3UI6 A;  3BXW A;  3AS1 A;  2G8Z A;  3ARX A;  1ZL1 A;  2MLX A;  3KAD A;  3VAW A;  4S3K A;  4W9Q A;  2FKE A;  4L72 B;  4Z2H A;  1CTN A;  2O9O A;  1OWQ A;  4NZC A;  1JNE A;  4W5U A;  1HKM A;  2FAP A;  1W1T A;  3ARV A;  2MF9 A;  2MLZ A;  3RM9 A;  3CHD A;  3O5O A;  2XPB A;  1B6C A;  5D75 A;  5GQB A;  1QZ2 A;  2A3A A;  4DRO A;  1JND A;  4Z2J A;  2FDM A;  2RUD A;  3FAP A;  2F2D A;  1HJW A;  4R5E A;  3PA7 A;  5HW6 A;  4AY1 A;  2M2A A;  3O5K A;  1A7X A;  2DG4 A;  1X6L A;  3O5Q A;  3UQA A;  2DT2 A;  2DT3 A;  4ZS6 A;  1E15 A;  2F21 A;  1NMW A;  3ARR A;  2ZQU A;  4JFJ A;  1W1V A;  2RUQ A;  2DG9 A;  2A3B A;  1FKH A;  4GIV A;  1F8A B;  3O5L A;  4JFM A;  3O5I A;  1FKJ A;  3OOB A;  4MPK A;  2AOS A;  3O5F A;  4MNM A;  3NRK A;  4KQZ A;  1FJD A;  2WLZ A;  2XP3 A;  1F40 A;  4W9O A;  3GPK A;  4Z2K A;  1LJY A;  3ODK A;  1OGB A;  1M5Y A;  3ARZ A;  1KT0 A;  3WQV A;  4IPX A;  5JH8 A;  4FN2 A;  4HAR A;  2O92 A;  1Q6I A;  4NSB A;  4ITZ A;  1FD9 A;  4MNJ A;  1NWR A;  4ODM A;  1FFR A;  5GPG A;  4WKA A;  5HKG A;  1HJV A;  1EYM A;  1FKD A;  4TNS A;  4QZV B;  1ZBK A;  4ML4 A;  4R0X A;  2KI3 A;  2KE0 A;  2VCD A;  1W26 A;  1FKG A;  1ZBV A;  2WLY A;  4KR0 B;  1YW5 A;  3KAB A;  3WD1 A;  3WD3 A;  2XP7 A;  5DIV A;  2ZQT A;  3O5M A;  1GUV A;  4WKH A;  3RME A;  2DSZ A;  3MDY B;  4IT6 A;  4HBE A;  1J4H A;  2L2S A;  1HKI A;  2LJ4 A;  1U79 A;  4DRH A;  4C02 B;  4QIB A;  2DG3 A;  3UI5 A;  4DH0 A;  4WK9 A;  1ITX A;  1FKS A;  2DPE A;  1KFW A;  1D7I A;  4G50 A;  2MNT A;  3O5J A;  4LAW A;  3WD0 A;  4MGV A;  5B8I C;  3RGC A;  2KO7 A;  1Q6U A;  3QOK A;  4MNK A;  1ZBW A;  3ARP A;  4BF8 A;  1LL7 A;  3PRD A;  1NSG A;  1T11 A;  3WL1 A;  2OFN A;  1LL6 A;  1EQ3 A;  1ROT A;  5DEZ A;  1UR8 A;  1NWT A;  1Q6H A;  5DIU A;  4LAY A;  1FKF A;  4MTV A;  2LGO A;  4DRP A;  1Q1C A;  1Y0O A;  3KAH A;  1HXV A;  1D7H A;  1EDQ A;  2XP4 A;  2ZR5 A;  1ROU A;  3ARU A;  2PV1 A;  1NH6 A;  3ARW A;  3KZ7 A;  3AS0 A;  2PPN A;  3WKZ A;  1E6R A;  1FKK A;  4ODL A;  1P5Q A;  3PRB A;  1LG2 A;  1EIB A;  3AS3 A;  1ZK6 A;  4P8W A;  3KAF A;  3WIJ A;  4DRI A;  3CH9 A;  2QF8 A;  5DO2 A;  2PV3 A;  3IK8 A;  2DSU A;  3AQU A;  3LUO A;  1GOI A;  1IX5 A;  4LAX A;  1LQ0 A;  1WB0 A;  1ZB5 A;  2D9F A;  4DRN A;  1UR9 A;  1PIN A;  4TW7 A;  1TFV A;  2KGJ A;  4J4N A;  4ODR A;  4XAK A;  2DT0 A;  1H0I A;  5HWC A;  4P8X A;  4IQC A;  5DF0 A;  1LG1 A;  1WAW A;  4WJX A;  3IKG A;  4MAV A;  2XP9 A;  3O5E A;  3RM8 A;  2DSV A;  1FAP A;  5HUA A;  3UI4 A;  1GPF A;  1FKL A;  1L1P A;  3JYJ A;  4QT3 A;  5HW7 A;  3UQI A;  2XP8 A;  1EHN A;  3RM4 A;  5I98 A;  3I6C A;  2WM0 A;  2RUC A;  3FY1 A;  2IUZ A;  2MPH A;  2ITK A;  3OA5 A;  1TCO C;  4JFL A;  4DZ3 A;  4DRJ A;  4JFI A;  1BL4 A;  4ZPW R;  1C9H A;  2RSE A;  1KT1 A;  1OGG A;  4JFK A;  1NMV A;  1FFQ A;  3CGM A;  2RUR A;  1W9P A;  1FKR A;  2Y78 A;  3RFW A;  4G2P A;  1JNT A;  4TW6 A;  3ARS A;  4Z2G A;  4O2T A;  2PI6 A;  1W9V A;  3AS2 A;  4U86 A;  4DT4 A;  4U85 A;  3H9R B;  3WL0 A;  1W1Y A;  3B9A A;  1VF8 A;  2UZ5 A;  4DZ2 A;  3O5R A;  5DIT A;  4ZPV R;  5GPR A;  2KR7 A;  4DRM A;  3B9E A;  4ODQ A;  3JYM A;  2K8I A;  1FKI A;  3PR9 A;  2ZQV A;  1R9H A;  4TYO A;  2N87 A;  2A3C A;  4Q7N A;  3O5D A;  1NWS A;  2VN1 A;  4PTM A;  4JYS A;  3IHZ A;  2RQS A;  2JZV A;  3WD4 A;  4WIW A;  2OLH A;  2XP5 A;  3ARY A;  1X6N A;  4WKF A;  4MNL A;  2ZQS A;  4IQ2 A;  1ZU8 A;  1LL4 A;  3PRA A;  4LGX A;  3KAG A;  4HBO A;  4ODP A;  3KAC A;  5HBF A;  3ARQ A;  1ZCN A;  5HTG A;  4DWS B;  4Z2L A;  4J4O A;  4W9P A;  3WH0 A;  3UQB A;  1JNS A;  5HWB A;  4NNR A;  2YBT A;  1J4R A;  4LAV A;  4DRQ A;  1SR0 A;  3KCE A;  3ALG A;  4P8V A;  1K9T A;  4Z2I A;  4QT2 A;  4DWS A;  3WD2 A;  3KAI A;  1JVW A;  5HT1 A;  1HJX A;  2KFW A;  3TCZ A;  4U84 A;  1D6O A;  3ALF A;  2WK2 A;  1BKF A;  4MSP A;  4URI A;  2ZR4 A;  3WQW A;  2PV2 A;  2YBU A;  2F4E A;  1E6N A;  4N19 A;  5HW8 A;  3CZ8 A;  3O5G A;  1YAT A;  5J6E A;  1HKK A;  1W9U A;  1D2K A;  4TX0 A;  3ART A;  2XP6 A;  1FKB A;  1RD6 A;  4TW8 A;  2XPA A;  3O5P A;  1D7J A;  2G41 A;  3B7X A;  3NI6 A;  2B31 A;  1SYT A;  2PBC A;  3ARO A;  1ZBC A;  3B8S A;  2ESC A;  2DSW A;  1E6Z A;  1E6P A;  2MLY A;  1HKJ A;  4DIP A;  3G6L A;  2IF4 A;  4GGQ A;  4IT4 A;  4ODK A;  1QPF A;  4ZPT R;  3CHF A;  2M1I A;  3UF8 A;  4DWS C;  3TC5 A;  2AWG A;  2PPO A;  4DWS D;  1E9L A;  1J6Y A;  3EY6 A;  2LKN A;  1N1A A;  1NWU A;  3B9D A;  1FKT A;  2M08 A;  4FAP A;  3CHE A;  1QPL A;  3CGN A;  4DRK A;  2DT1 A;  2A3E A;  5BXJ A;  1O6I A;  1XHG A;  1J4I A;  1W1P A;  3IKD A;  1WNO A;  1XRV A;  2ZR6 A;  4ODN A;  3NTP A;  3FXY A;  3TDB A;  2LPV A;  2Q5A A;  2PPP A;  4P8U A;  4ODO A;  3JXV A;  1PBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...