1J4RA

Fk506 binding protein complexed with fkb-001
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-BINDING PROTEIN
publication title 2-Aryl-2,2-difluoroacetamide FKBP12 ligands: synthesis and X-ray structural studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 25
structure length 107
sequence length 107
chains with identical sequence B, D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1j4rA00
4DRMA 2XPBA 1FKKA 2OFNA 3O5KA 5GPGA 5DITA 2RUQA 2IF4A 1ZCNA 2KGJA 3KAGA 3KZ7A 1FKLA 3O5GA 4QT3A 2FAPA 2XP5A 2KO7A 2M1IA 3PRDA 5DIVA 1J4RA 3LUOA 4FN2A 4QT2A 2JZVA 3IK8A 4DRHA 2LJ4A 5HWBA 2MPHA 3IHZA 4TW6A 4IQ2A 1FKHA 1FKFA 4ODNA 3O5IA 2N87A 4JFMA 3VAWA 3O5DA 5HT1A 1Y0OA 4U85A 3UI5A 2PV3A 3B7XA 4LAVA 3KABA 4TX0A 5HTGA 2MLYA 3KAHA 1JVWA 1Q6HA 3PRBA 4N19A 3JYMA 4IPXA 2ZQTA 4G2PA 2XP3A 1Q6UA 4JFKA 3TCZA 2ZR4A 3O5MA 4ODQA 5B8IC 5HW6A 2M08A 2M2AA 5D75A 2ITKA 3O5FA 4TNSA 1D6OA 1R9HA 1QPFA 4C02B 2L2SA 3IKGA 4ODLA 3RFWA 5I98A 1YATA 1ZK6A 3CGMA 1BL4A 1M5YA 3NRKA 4U84A 3RGCA 1D7HA 4DRNA 4GIVA 4ODRA 4ODMA 4DIPA 3I6CA 2Q5AA 4JFIA 4ODPA 1PINA 1FKRA 2K8IA 2ZQSA 1Q1CA 3TC5A 1T11A 4BF8A 3UQBA 3CGNA 1QPLA 1ROUA 2MLXA 4JFJA 4MGVA 4JFLA 2RQSA 3KCEA 1ROTA 1NMVA 4DRQA 3O5RA 3NTPA 1B6CA 2PBCA 1D7IA 2UZ5A 4DRIA 1YW5A 2MNTA 2KR7A 4DH0A 1FKDA 4QIBA 2VCDA 5DIUA 4W9QA 2XP6A 1C9HA 2KE0A 1FKJA 1J6YA 1J4HA 4FAPA 4ODKA 3O5JA 1NSGA 1FKGA 3NI6A 4ODOA 3GPKA 4J4OA 3KADA 1KT1A 3JXVA 1FKBA 3IKDA 3ODKA 1W26A 3FAPA 1L1PA 2RUDA 2RURA 5J6EA 1QZ2A 1N1AA 2MLZA 2PPNA 2PPPA 2XP7A 2KFWA 3EY6A 2AWGA 3KAFA 4GGQA 3UI4A 2XP4A 1JNSA 2F21A 5HKGA 2ZR5A 3UF8A 4LAXA 1P5QA 3O5PA 1FD9A 2DG3A 2Y78A 4G50A 1D7JA 2ZR6A 1EQ3A 1JNTA 1KT0A 4JYSA 4NNRA 1BKFA 1PBKA 2DG9A 2LGOA 2RUCA 2XP8A 4O2TA 5BXJA 1FKSA 1F40A 1A7XA 3WH0A 2PV2A 5HW7A 2VN1A 2MF9A 2LKNA 3KACA 1FKTA 2RSEA 4TW8A 3MDYB 2F4EA 2LPVA 4W9OA 4DROA 4ITZA 4J4NA 4W9PA 3OOBA 4DRJA 1HXVA 2FKEA 1FKIA 4TYOA 2D9FA 1TCOC 3O5LA 4DRKA 1F8AB 1FAPA 1Q6IA 2PV1A 3PA7A 1J4IA 3O5OA 4U86A 3UQAA 3H9RB 4IQCA 5HW8A 3UQIA 4LAWA 1FJDA 4LAYA 3UI6A 4DT4A 2DG4A 4DRPA 4DZ2A 2XPAA 1EYMA 3TDBA 3KAIA 2XP9A 2F2DA 2ZQVA 4MSPA 1NMWA 2ZQUA 3JYJA 4DZ3A 4TW7A 2PPOA 2KI3A 3O5EA 5HUAA 3O5QA 5HWCA 4R0XA 1U79A
chains in the Genus database with same CATH superfamily
4Z2LA 1E6RA 2XPBA 3WQWA 1FKKA 1FFRA 4IT6A 2OFNA 1WNOA 2IF4A 3KAGA 4WK9A 1XRVA 4QT2A 3CH9A 1WB0A 5HWBA 4TW6A 3VAWA 4ODNA 1FKFA 3O5IA 2YBUA 1TFVA 4MAVA 1Y0OA 4P8WA 3ARRA 3UI5A 3ARQA 3KABA 4TX0A 5HTGA 3ALFA 1JVWA 3JYMA 4MPKA 1GOIA 4LGXA 2XP3A 4WJXA 3WD0A 5B8IC 4TNSA 1D6OA 2DT0A 3OA5A 3WD1A 3RFWA 1HJVA 3CGMA 3RGCA 2ETNA 1D7HA 1NWSA 2PN0A 4MTVA 4GIVA 4S3KA 4JFIA 4ODPA 1JCHB 1Q1CA 3RM8A 1T11A 3WL1A 4BF8A 1QPLA 3ARPA 2A3CA 3CHCA 4JFJA 2DSUA 5GPRA 1ROTA 3NTPA 2PBCA 1D7IA 3B9DA 3WD3A 1UR8A 4W9QA 2XP6A 1FKJA 3O5JA 1NSGA 1FKGA 2G8ZA 1E6ZA 1KT1A 3JXVA 1LL4A 1FKBA 1W26A 1L1PA 3BXWA 2WM0A 5J6EA 2XP7A 1QZ2A 1W1YA 3KAFA 1SYTA 2AWGA 2DSZA 3CHDA 3UI4A 2F21A 1P5QA 4HBEA 1OWQA 3AQUA 2Y78A 1ZBVA 2OLHA 1D7JA 2ZR6A 1JNTA 4FAPA 4O2TA 2DG9A 4MNLA 4URIA 5BXJA 1LQ0A 4Q22A 3WH0A 5HW7A 1W1PA 2MF9A 1SR0A 2LKNA 4P8VA 4TW8A 1LG2A 4W9OA 2P4VA 4DRJA 2FKEA 4TYOA 1OGBA 3AROA 5JH8A 1FAPA 1Q6IA 3AS2A 3PA7A 4U86A 4LAWA 4DT4A 4DZ2A 3W4RA 2XP9A 1E44A 1GRJA 2PPOA 2KI3A 5HUAA 3O5QA 1LG1A 4KQZA 1JNDA 3KZ7A 5DITA 2KGJA 2FAPA 2KO7A 2M1IA 3AS1A 1J4RA 4IT4A 1GUVA 2DPEA 2LJ4A 4IQ2A 4JFMA 3O5DA 4DWSD 3ARVA 4N19A 3PRBA 1ZBCA 1Q6UA 4JFKA 3O5MA 4HARA 5HW6A 5D75A 4ZS6A 1W1VA 1GPFA 3IKGA 3GTYX 1YATA 1BL4A 4QZVB 4Z2JA 1HJXA 2A3EA 1HKKA 3PRAA 1O6IA 3B9AA 2MLXA 4MGVA 5DEZA 4DWSC 2RQSA 3KCEA 3O5RA 4Z2IA 3ARYA 4ZPTR 3RM4A 3AS0A 4MNMA 2RUDA 2PPPA 3FY1A 3ALGA 1LL7A 3UF8A 4UDMA 1W9UA 5DF0A 1BKFA 2LGOA 2RUCA 3ARZA 1F40A 1A7XA 3GU0A 2PV2A 1NWRA 1X6NA 4DROA 4ITZA 4J4NA 4W9PA 3WD2A 2D9FA 1H0IA 3O5LA 1K9TA 1F8AB 4S3JA 2DT2A 3H9RB 2YBTA 1FFQA 1EYMA 3KAIA 4XAKA 3AS3A 2ZQUA 4WKFA 4DZ3A 2G41A 4DRMA 3G6LA 3ARWA 3O5KA 2F23A 4QT3A 1FKLA 4Z2HA 4DWSA 3FXYA 4FN2A 4WIWA 3IK8A 5HBFA 4DRHA 2MPHA 1FKHA 4DWSB 1E15A 3CHFA 5HT1A 4WKHA 4NSBA 4U85A 2PV3A 1OGGA 1Q6HA 2ZQTA 4G2PA 2ZR4A 2DSVA 1HJWA 4ODQA 1R9HA 1QPFA 2L2SA 4ODLA 5I98A 1LL6A 1ZK6A 1H0GA 3B9EA 1HKJA 1UR9A 4ODRA 4ODMA 1RD6A 1ZBKA 1PINA 2ZQSA 3TC5A 1W1TA 3UQBA 1ROUA 4JFLA 4P8UA 2FDMA 3WL0A 3CHEA 3RMEA 1NMVA 4ZPWR 4DRQA 2A3BA 1B6CA 2UZ5A 1YW5A 2MNTA 4DH0A 2WK2A 4QIBA 1HKMA 1C9HA 1J6YA 2DSWA 4ML4A 3GPKA 3IKDA 5GQBA 2RURA 2MLZA 2PPNA 2KFWA 1X6LA 4GGQA 4PTMA 2XP4A 3WD4A 2ZR5A 4LAXA 3QOKA 1NWTA 1FD9A 1E6PA 2DG3A 3BMBA 1PBKA 2XP8A 4L72B 1FKSA 1KFWA 4Q7NA 2VN1A 1EIBA 4R5EA 2RSEA 3MDYB 2LPVA 3OOBA 1HXVA 1E6NA 3CZ8A 1JNEA 3UQAA 1D2KA 1W9PA 5HW8A 1FJDA 4LAYA 3WKZA 2DG4A 2O92A 2DT3A 3TDBA 2ZQVA 2F2DA 1WAWA 3WQVA 5HWCA 1NH6A 1EHNA 4NZCA 4WKAA 1ZBWA 1E9LA 2IUZA 4ZPVR 3ARUA 5GPGA 2RUQA 3EIPA 1ZCNA 3O5GA 5DIVA 2XP5A 3PRDA 3LUOA 2JZVA 4KR0B 3IHZA 2AOSA 2N87A 1ZU8A 3B7XA 4LAVA 2MLYA 3KAHA 4Z2GA 1HKIA 4IPXA 3TCZA 3WIJA 2M08A 2M2AA 2ITKA 3O5FA 4C02B 3ARTA 2EULA 1IX5A 1M5YA 3NRKA 4U84A 4DRNA 2PI6A 4DIPA 4L3NA 3I6CA 2Q5AA 3RM9A 1FKRA 2K8IA 4HBOA 1ZB5A 4P8XA 2O9OA 2QF8A 1VF8A 3CGNA 1EDQA 3ARXA 2B31A 3B8SA 4DRIA 2KR7A 1FKDA 2VCDA 3ARSA 5DIUA 2KE0A 1J4HA 4W5UA 4ODKA 3NI6A 4ODOA 4J4OA 3KADA 3ODKA 3FAPA 1CTNA 4AY1A 3EY6A 1N1AA 2A3AA 2WLYA 3PR9A 1JNSA 5HKGA 2ESCA 1ITXA 3O5PA 1LJYA 4G50A 1EQ3A 4JYSA 1KT0A 4NNRA 4Z2KA 1XHGA 2DT1A 3KACA 1FKTA 2F4EA 1W9VA 1FKIA 1TCOC 4DRKA 2PV1A 1J4IA 2B5UB 1ZL1A 3O5OA 4MNKA 4IQCA 3G6MA 5DO2A 3UQIA 3UI6A 4DRPA 1NWUA 2XPAA 4MSPA 1NMWA 3JYJA 4MNJA 4TW7A 2WLZA 3O5EA 4R0XA 1U79A
chains in the Genus database with same CATH topology
4Z2LA 1E6RA 2XPBA 3WQWA 1FKKA 1FFRA 4IT6A 2OFNA 1WNOA 2IF4A 3KAGA 4WK9A 1XRVA 4QT2A 3CH9A 1WB0A 5HWBA 4TW6A 3VAWA 4ODNA 1FKFA 3O5IA 2YBUA 1TFVA 4MAVA 1Y0OA 4P8WA 3ARRA 3UI5A 3ARQA 3KABA 4TX0A 5HTGA 3ALFA 1JVWA 3JYMA 4MPKA 1GOIA 4LGXA 2XP3A 4WJXA 3WD0A 5B8IC 4TNSA 1D6OA 2DT0A 3OA5A 3WD1A 3RFWA 1HJVA 3CGMA 3RGCA 1D7HA 1NWSA 4S3KA 4MTVA 4GIVA 4JFIA 4ODPA 1Q1CA 3RM8A 1T11A 3WL1A 4BF8A 1QPLA 3ARPA 2A3CA 3CHCA 4JFJA 2DSUA 5GPRA 1ROTA 3NTPA 2PBCA 1D7IA 3B9DA 3WD3A 1UR8A 4W9QA 2XP6A 1FKJA 3O5JA 1NSGA 1FKGA 2G8ZA 1E6ZA 1KT1A 3JXVA 1LL4A 1FKBA 1W26A 1L1PA 3BXWA 2WM0A 5J6EA 2XP7A 1QZ2A 1W1YA 3KAFA 1SYTA 2AWGA 2DSZA 3CHDA 3UI4A 2F21A 1P5QA 4HBEA 1OWQA 3AQUA 2Y78A 1ZBVA 2OLHA 1D7JA 2ZR6A 1JNTA 4FAPA 4O2TA 2DG9A 4MNLA 4URIA 5BXJA 1LQ0A 4Q22A 3WH0A 5HW7A 1W1PA 2MF9A 1SR0A 2LKNA 4P8VA 4TW8A 1LG2A 4W9OA 4DRJA 2FKEA 4TYOA 1OGBA 3AROA 5JH8A 1FAPA 1Q6IA 3AS2A 3PA7A 4U86A 4LAWA 4DT4A 4DZ2A 3W4RA 2XP9A 2PPOA 2KI3A 5HUAA 3O5QA 1LG1A 4KQZA 1JNDA 3KZ7A 5DITA 2KGJA 2FAPA 2KO7A 2M1IA 3AS1A 1J4RA 4IT4A 1GUVA 2DPEA 2LJ4A 4IQ2A 4JFMA 3O5DA 4DWSD 3ARVA 4N19A 3PRBA 1ZBCA 1Q6UA 4JFKA 3O5MA 4HARA 5HW6A 5D75A 4ZS6A 1W1VA 1GPFA 3IKGA 1YATA 1BL4A 4QZVB 4Z2JA 1HJXA 2A3EA 1HKKA 3PRAA 1O6IA 3B9AA 2MLXA 4MGVA 5DEZA 4DWSC 2RQSA 3KCEA 3O5RA 4Z2IA 3ARYA 4ZPTR 3RM4A 3AS0A 4MNMA 2RUDA 2PPPA 3FY1A 3ALGA 1LL7A 3UF8A 1W9UA 5DF0A 1BKFA 2LGOA 2RUCA 3ARZA 1F40A 1A7XA 2PV2A 1NWRA 1X6NA 4DROA 4ITZA 4J4NA 4W9PA 3WD2A 2D9FA 1H0IA 3O5LA 1K9TA 1F8AB 4S3JA 2DT2A 3H9RB 2YBTA 1FFQA 1EYMA 3KAIA 4XAKA 3AS3A 2ZQUA 4WKFA 4DZ3A 2G41A 4DRMA 3G6LA 3ARWA 3O5KA 4QT3A 1FKLA 4Z2HA 4DWSA 3FXYA 4FN2A 4WIWA 3IK8A 5HBFA 4DRHA 2MPHA 1FKHA 4DWSB 1E15A 3CHFA 5HT1A 4WKHA 4NSBA 4U85A 2PV3A 1OGGA 1Q6HA 2ZQTA 4G2PA 2ZR4A 2DSVA 1HJWA 4ODQA 1R9HA 1QPFA 2L2SA 4ODLA 5I98A 1LL6A 1ZK6A 1H0GA 3B9EA 1HKJA 1UR9A 4ODRA 4ODMA 1RD6A 1ZBKA 1PINA 2ZQSA 3TC5A 1W1TA 3UQBA 1ROUA 4JFLA 4P8UA 2FDMA 3WL0A 3CHEA 3RMEA 1NMVA 4ZPWR 4DRQA 2A3BA 1B6CA 2UZ5A 1YW5A 2MNTA 4DH0A 2WK2A 4QIBA 1HKMA 1C9HA 1J6YA 2DSWA 4ML4A 3GPKA 3IKDA 5GQBA 2RURA 2MLZA 2PPNA 2KFWA 1X6LA 4GGQA 4PTMA 2XP4A 3WD4A 2ZR5A 4LAXA 3QOKA 1NWTA 1FD9A 1E6PA 2DG3A 1PBKA 2XP8A 4L72B 1FKSA 1KFWA 4Q7NA 2VN1A 1EIBA 4R5EA 2RSEA 3MDYB 2LPVA 3OOBA 1HXVA 1E6NA 3CZ8A 1JNEA 3UQAA 1D2KA 1W9PA 5HW8A 1FJDA 4LAYA 3WKZA 2DG4A 2O92A 2DT3A 3TDBA 2ZQVA 2F2DA 1WAWA 3WQVA 5HWCA 1NH6A 1EHNA 4NZCA 4WKAA 1ZBWA 1E9LA 2IUZA 4ZPVR 3ARUA 5GPGA 2RUQA 3O5GA 1ZCNA 5DIVA 2XP5A 3PRDA 3LUOA 2JZVA 4KR0B 3IHZA 2AOSA 2N87A 1ZU8A 3B7XA 4LAVA 2MLYA 3KAHA 4Z2GA 1HKIA 4IPXA 3TCZA 3WIJA 2M08A 2M2AA 2ITKA 3O5FA 4C02B 3ARTA 1IX5A 1M5YA 3NRKA 4U84A 4DRNA 2PI6A 4DIPA 4L3NA 3I6CA 2Q5AA 3RM9A 1FKRA 2K8IA 4HBOA 1ZB5A 4P8XA 2O9OA 2QF8A 1VF8A 3CGNA 1EDQA 3ARXA 2B31A 3B8SA 4DRIA 2KR7A 1FKDA 2VCDA 3ARSA 5DIUA 2KE0A 1J4HA 4W5UA 4ODKA 3NI6A 4ODOA 4J4OA 3KADA 3ODKA 3FAPA 1CTNA 4AY1A 3EY6A 1N1AA 2A3AA 2WLYA 3PR9A 1JNSA 5HKGA 2ESCA 1ITXA 3O5PA 1LJYA 4G50A 1EQ3A 4JYSA 1KT0A 4NNRA 4Z2KA 1XHGA 2DT1A 3KACA 1FKTA 2F4EA 1W9VA 1FKIA 1TCOC 4DRKA 2PV1A 1J4IA 1ZL1A 3O5OA 4MNKA 4IQCA 3G6MA 5DO2A 3UQIA 3UI6A 4DRPA 1NWUA 2XPAA 4MSPA 1NMWA 3JYJA 4MNJA 4TW7A 2WLZA 3O5EA 4R0XA 1U79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRM A;  2XPB A;  1FKK A;  2OFN A;  3O5K A;  5GPG A;  5DIT A;  2RUQ A;  2IF4 A;  1ZCN A;  2KGJ A;  3KAG A;  3KZ7 A;  1FKL A;  3O5G A;  4QT3 A;  2FAP A;  2XP5 A;  2KO7 A;  2M1I A;  3PRD A;  5DIV A;  1J4R A;  3LUO A;  4FN2 A;  4QT2 A;  2JZV A;  3IK8 A;  4DRH A;  2LJ4 A;  5HWB A;  2MPH A;  3IHZ A;  4TW6 A;  4IQ2 A;  1FKH A;  1FKF A;  4ODN A;  3O5I A;  2N87 A;  4JFM A;  3VAW A;  3O5D A;  5HT1 A;  1Y0O A;  4U85 A;  3UI5 A;  2PV3 A;  3B7X A;  4LAV A;  3KAB A;  4TX0 A;  5HTG A;  2MLY A;  3KAH A;  1JVW A;  1Q6H A;  3PRB A;  4N19 A;  3JYM A;  4IPX A;  2ZQT A;  4G2P A;  2XP3 A;  1Q6U A;  4JFK A;  3TCZ A;  2ZR4 A;  3O5M A;  4ODQ A;  5B8I C;  5HW6 A;  2M08 A;  2M2A A;  5D75 A;  2ITK A;  3O5F A;  4TNS A;  1D6O A;  1R9H A;  1QPF A;  4C02 B;  2L2S A;  3IKG A;  4ODL A;  3RFW A;  5I98 A;  1YAT A;  1ZK6 A;  3CGM A;  1BL4 A;  1M5Y A;  3NRK A;  4U84 A;  3RGC A;  1D7H A;  4DRN A;  4GIV A;  4ODR A;  4ODM A;  4DIP A;  3I6C A;  2Q5A A;  4JFI A;  4ODP A;  1PIN A;  1FKR A;  2K8I A;  2ZQS A;  1Q1C A;  3TC5 A;  1T11 A;  4BF8 A;  3UQB A;  3CGN A;  1QPL A;  1ROU A;  2MLX A;  4JFJ A;  4MGV A;  4JFL A;  2RQS A;  3KCE A;  1ROT A;  1NMV A;  4DRQ A;  3O5R A;  3NTP A;  1B6C A;  2PBC A;  1D7I A;  2UZ5 A;  4DRI A;  1YW5 A;  2MNT A;  2KR7 A;  4DH0 A;  1FKD A;  4QIB A;  2VCD A;  5DIU A;  4W9Q A;  2XP6 A;  1C9H A;  2KE0 A;  1FKJ A;  1J6Y A;  1J4H A;  4FAP A;  4ODK A;  3O5J A;  1NSG A;  1FKG A;  3NI6 A;  4ODO A;  3GPK A;  4J4O A;  3KAD A;  1KT1 A;  3JXV A;  1FKB A;  3IKD A;  3ODK A;  1W26 A;  3FAP A;  1L1P A;  2RUD A;  2RUR A;  5J6E A;  1QZ2 A;  1N1A A;  2MLZ A;  2PPN A;  2PPP A;  2XP7 A;  2KFW A;  3EY6 A;  2AWG A;  3KAF A;  4GGQ A;  3UI4 A;  2XP4 A;  1JNS A;  2F21 A;  5HKG A;  2ZR5 A;  3UF8 A;  4LAX A;  1P5Q A;  3O5P A;  1FD9 A;  2DG3 A;  2Y78 A;  4G50 A;  1D7J A;  2ZR6 A;  1EQ3 A;  1JNT A;  1KT0 A;  4JYS A;  4NNR A;  1BKF A;  1PBK A;  2DG9 A;  2LGO A;  2RUC A;  2XP8 A;  4O2T A;  5BXJ A;  1FKS A;  1F40 A;  1A7X A;  3WH0 A;  2PV2 A;  5HW7 A;  2VN1 A;  2MF9 A;  2LKN A;  3KAC A;  1FKT A;  2RSE A;  4TW8 A;  3MDY B;  2F4E A;  2LPV A;  4W9O A;  4DRO A;  4ITZ A;  4J4N A;  4W9P A;  3OOB A;  4DRJ A;  1HXV A;  2FKE A;  1FKI A;  4TYO A;  2D9F A;  1TCO C;  3O5L A;  4DRK A;  1F8A B;  1FAP A;  1Q6I A;  2PV1 A;  3PA7 A;  1J4I A;  3O5O A;  4U86 A;  3UQA A;  3H9R B;  4IQC A;  5HW8 A;  3UQI A;  4LAW A;  1FJD A;  4LAY A;  3UI6 A;  4DT4 A;  2DG4 A;  4DRP A;  4DZ2 A;  2XPA A;  1EYM A;  3TDB A;  3KAI A;  2XP9 A;  2F2D A;  2ZQV A;  4MSP A;  1NMW A;  2ZQU A;  3JYJ A;  4DZ3 A;  4TW7 A;  2PPO A;  2KI3 A;  3O5E A;  5HUA A;  3O5Q A;  5HWC A;  4R0X A;  1U79 A; 
#chains in the Genus database with same CATH topology
 4Z2L A;  1E6R A;  2XPB A;  3WQW A;  1FKK A;  1FFR A;  4IT6 A;  2OFN A;  1WNO A;  2IF4 A;  3KAG A;  4WK9 A;  1XRV A;  4QT2 A;  3CH9 A;  1WB0 A;  5HWB A;  4TW6 A;  3VAW A;  4ODN A;  1FKF A;  3O5I A;  2YBU A;  1TFV A;  4MAV A;  1Y0O A;  4P8W A;  3ARR A;  3UI5 A;  3ARQ A;  3KAB A;  4TX0 A;  5HTG A;  3ALF A;  1JVW A;  3JYM A;  4MPK A;  1GOI A;  4LGX A;  2XP3 A;  4WJX A;  3WD0 A;  5B8I C;  4TNS A;  1D6O A;  2DT0 A;  3OA5 A;  3WD1 A;  3RFW A;  1HJV A;  3CGM A;  3RGC A;  2ETN A;  1D7H A;  1NWS A;  2PN0 A;  4MTV A;  4GIV A;  4S3K A;  4JFI A;  4ODP A;  1JCH B;  1Q1C A;  3RM8 A;  1T11 A;  3WL1 A;  4BF8 A;  1QPL A;  3ARP A;  2A3C A;  3CHC A;  4JFJ A;  2DSU A;  5GPR A;  1ROT A;  3NTP A;  2PBC A;  1D7I A;  3B9D A;  3WD3 A;  1UR8 A;  4W9Q A;  2XP6 A;  1FKJ A;  3O5J A;  1NSG A;  1FKG A;  2G8Z A;  1E6Z A;  1KT1 A;  3JXV A;  1LL4 A;  1FKB A;  1W26 A;  1L1P A;  3BXW A;  2WM0 A;  5J6E A;  2XP7 A;  1QZ2 A;  1W1Y A;  3KAF A;  1SYT A;  2AWG A;  2DSZ A;  3CHD A;  3UI4 A;  2F21 A;  1P5Q A;  4HBE A;  1OWQ A;  3AQU A;  2Y78 A;  1ZBV A;  2OLH A;  1D7J A;  2ZR6 A;  1JNT A;  4FAP A;  4O2T A;  2DG9 A;  4MNL A;  4URI A;  5BXJ A;  1LQ0 A;  4Q22 A;  3WH0 A;  5HW7 A;  1W1P A;  2MF9 A;  1SR0 A;  2LKN A;  4P8V A;  4TW8 A;  1LG2 A;  4W9O A;  2P4V A;  4DRJ A;  2FKE A;  4TYO A;  1OGB A;  3ARO A;  5JH8 A;  1FAP A;  1Q6I A;  3AS2 A;  3PA7 A;  4U86 A;  4LAW A;  4DT4 A;  4DZ2 A;  3W4R A;  2XP9 A;  1E44 A;  1GRJ A;  2PPO A;  2KI3 A;  5HUA A;  3O5Q A;  1LG1 A;  4KQZ A;  1JND A;  3KZ7 A;  5DIT A;  2KGJ A;  2FAP A;  2KO7 A;  2M1I A;  3AS1 A;  1J4R A;  4IT4 A;  1GUV A;  2DPE A;  2LJ4 A;  4IQ2 A;  4JFM A;  3O5D A;  4DWS D;  3ARV A;  4N19 A;  3PRB A;  1ZBC A;  1Q6U A;  4JFK A;  3O5M A;  4HAR A;  5HW6 A;  5D75 A;  4ZS6 A;  1W1V A;  1GPF A;  3IKG A;  3GTY X;  1YAT A;  1BL4 A;  4QZV B;  4Z2J A;  1HJX A;  2A3E A;  1HKK A;  3PRA A;  1O6I A;  3B9A A;  2MLX A;  4MGV A;  5DEZ A;  4DWS C;  2RQS A;  3KCE A;  3O5R A;  4Z2I A;  3ARY A;  4ZPT R;  3RM4 A;  3AS0 A;  4MNM A;  2RUD A;  2PPP A;  3FY1 A;  3ALG A;  1LL7 A;  3UF8 A;  4UDM A;  1W9U A;  5DF0 A;  1BKF A;  2LGO A;  2RUC A;  3ARZ A;  1F40 A;  1A7X A;  3GU0 A;  2PV2 A;  1NWR A;  1X6N A;  4DRO A;  4ITZ A;  4J4N A;  4W9P A;  3WD2 A;  2D9F A;  1H0I A;  3O5L A;  1K9T A;  1F8A B;  4S3J A;  2DT2 A;  3H9R B;  2YBT A;  1FFQ A;  1EYM A;  3KAI A;  4XAK A;  3AS3 A;  2ZQU A;  4WKF A;  4DZ3 A;  2G41 A;  4DRM A;  3G6L A;  3ARW A;  3O5K A;  2F23 A;  4QT3 A;  1FKL A;  4Z2H A;  4DWS A;  3FXY A;  4FN2 A;  4WIW A;  3IK8 A;  5HBF A;  4DRH A;  2MPH A;  1FKH A;  4DWS B;  1E15 A;  3CHF A;  5HT1 A;  4WKH A;  4NSB A;  4U85 A;  2PV3 A;  1OGG A;  1Q6H A;  2ZQT A;  4G2P A;  2ZR4 A;  2DSV A;  1HJW A;  4ODQ A;  1R9H A;  1QPF A;  2L2S A;  4ODL A;  5I98 A;  1LL6 A;  1ZK6 A;  1H0G A;  3B9E A;  1HKJ A;  1UR9 A;  4ODR A;  4ODM A;  1RD6 A;  1ZBK A;  1PIN A;  2ZQS A;  3TC5 A;  1W1T A;  3UQB A;  1ROU A;  4JFL A;  4P8U A;  2FDM A;  3WL0 A;  3CHE A;  3RME A;  1NMV A;  4ZPW R;  4DRQ A;  2A3B A;  1B6C A;  2UZ5 A;  1YW5 A;  2MNT A;  4DH0 A;  2WK2 A;  4QIB A;  1HKM A;  1C9H A;  1J6Y A;  2DSW A;  4ML4 A;  3GPK A;  3IKD A;  5GQB A;  2RUR A;  2MLZ A;  2PPN A;  2KFW A;  1X6L A;  4GGQ A;  4PTM A;  2XP4 A;  3WD4 A;  2ZR5 A;  4LAX A;  3QOK A;  1NWT A;  1FD9 A;  1E6P A;  2DG3 A;  3BMB A;  1PBK A;  2XP8 A;  4L72 B;  1FKS A;  1KFW A;  4Q7N A;  2VN1 A;  1EIB A;  4R5E A;  2RSE A;  3MDY B;  2LPV A;  3OOB A;  1HXV A;  1E6N A;  3CZ8 A;  1JNE A;  3UQA A;  1D2K A;  1W9P A;  5HW8 A;  1FJD A;  4LAY A;  3WKZ A;  2DG4 A;  2O92 A;  2DT3 A;  3TDB A;  2ZQV A;  2F2D A;  1WAW A;  3WQV A;  5HWC A;  1NH6 A;  1EHN A;  4NZC A;  4WKA A;  1ZBW A;  1E9L A;  2IUZ A;  4ZPV R;  3ARU A;  5GPG A;  2RUQ A;  3EIP A;  1ZCN A;  3O5G A;  5DIV A;  2XP5 A;  3PRD A;  3LUO A;  2JZV A;  4KR0 B;  3IHZ A;  2AOS A;  2N87 A;  1ZU8 A;  3B7X A;  4LAV A;  2MLY A;  3KAH A;  4Z2G A;  1HKI A;  4IPX A;  3TCZ A;  3WIJ A;  2M08 A;  2M2A A;  2ITK A;  3O5F A;  4C02 B;  3ART A;  2EUL A;  1IX5 A;  1M5Y A;  3NRK A;  4U84 A;  4DRN A;  2PI6 A;  4DIP A;  4L3N A;  3I6C A;  2Q5A A;  3RM9 A;  1FKR A;  2K8I A;  4HBO A;  1ZB5 A;  4P8X A;  2O9O A;  2QF8 A;  1VF8 A;  3CGN A;  1EDQ A;  3ARX A;  2B31 A;  3B8S A;  4DRI A;  2KR7 A;  1FKD A;  2VCD A;  3ARS A;  5DIU A;  2KE0 A;  1J4H A;  4W5U A;  4ODK A;  3NI6 A;  4ODO A;  4J4O A;  3KAD A;  3ODK A;  3FAP A;  1CTN A;  4AY1 A;  3EY6 A;  1N1A A;  2A3A A;  2WLY A;  3PR9 A;  1JNS A;  5HKG A;  2ESC A;  1ITX A;  3O5P A;  1LJY A;  4G50 A;  1EQ3 A;  4JYS A;  1KT0 A;  4NNR A;  4Z2K A;  1XHG A;  2DT1 A;  3KAC A;  1FKT A;  2F4E A;  1W9V A;  1FKI A;  1TCO C;  4DRK A;  2PV1 A;  1J4I A;  2B5U B;  1ZL1 A;  3O5O A;  4MNK A;  4IQC A;  3G6M A;  5DO2 A;  3UQI A;  3UI6 A;  4DRP A;  1NWU A;  2XPA A;  4MSP A;  1NMW A;  3JYJ A;  4MNJ A;  4TW7 A;  2WLZ A;  3O5E A;  4R0X A;  1U79 A; 
#chains in the Genus database with same CATH homology
 4Z2L A;  1E6R A;  2XPB A;  3WQW A;  1FKK A;  1FFR A;  4IT6 A;  2OFN A;  1WNO A;  2IF4 A;  3KAG A;  4WK9 A;  1XRV A;  4QT2 A;  3CH9 A;  1WB0 A;  5HWB A;  4TW6 A;  3VAW A;  4ODN A;  1FKF A;  3O5I A;  2YBU A;  1TFV A;  4MAV A;  1Y0O A;  4P8W A;  3ARR A;  3UI5 A;  3ARQ A;  3KAB A;  4TX0 A;  5HTG A;  3ALF A;  1JVW A;  3JYM A;  4MPK A;  1GOI A;  4LGX A;  2XP3 A;  4WJX A;  3WD0 A;  5B8I C;  4TNS A;  1D6O A;  2DT0 A;  3OA5 A;  3WD1 A;  3RFW A;  1HJV A;  3CGM A;  3RGC A;  1D7H A;  1NWS A;  4S3K A;  4MTV A;  4GIV A;  4JFI A;  4ODP A;  1Q1C A;  3RM8 A;  1T11 A;  3WL1 A;  4BF8 A;  1QPL A;  3ARP A;  2A3C A;  3CHC A;  4JFJ A;  2DSU A;  5GPR A;  1ROT A;  3NTP A;  2PBC A;  1D7I A;  3B9D A;  3WD3 A;  1UR8 A;  4W9Q A;  2XP6 A;  1FKJ A;  3O5J A;  1NSG A;  1FKG A;  2G8Z A;  1E6Z A;  1KT1 A;  3JXV A;  1LL4 A;  1FKB A;  1W26 A;  1L1P A;  3BXW A;  2WM0 A;  5J6E A;  2XP7 A;  1QZ2 A;  1W1Y A;  3KAF A;  1SYT A;  2AWG A;  2DSZ A;  3CHD A;  3UI4 A;  2F21 A;  1P5Q A;  4HBE A;  1OWQ A;  3AQU A;  2Y78 A;  1ZBV A;  2OLH A;  1D7J A;  2ZR6 A;  1JNT A;  4FAP A;  4O2T A;  2DG9 A;  4MNL A;  4URI A;  5BXJ A;  1LQ0 A;  4Q22 A;  3WH0 A;  5HW7 A;  1W1P A;  2MF9 A;  1SR0 A;  2LKN A;  4P8V A;  4TW8 A;  1LG2 A;  4W9O A;  4DRJ A;  2FKE A;  4TYO A;  1OGB A;  3ARO A;  5JH8 A;  1FAP A;  1Q6I A;  3AS2 A;  3PA7 A;  4U86 A;  4LAW A;  4DT4 A;  4DZ2 A;  3W4R A;  2XP9 A;  2PPO A;  2KI3 A;  5HUA A;  3O5Q A;  1LG1 A;  4KQZ A;  1JND A;  3KZ7 A;  5DIT A;  2KGJ A;  2FAP A;  2KO7 A;  2M1I A;  3AS1 A;  1J4R A;  4IT4 A;  1GUV A;  2DPE A;  2LJ4 A;  4IQ2 A;  4JFM A;  3O5D A;  4DWS D;  3ARV A;  4N19 A;  3PRB A;  1ZBC A;  1Q6U A;  4JFK A;  3O5M A;  4HAR A;  5HW6 A;  5D75 A;  4ZS6 A;  1W1V A;  1GPF A;  3IKG A;  1YAT A;  1BL4 A;  4QZV B;  4Z2J A;  1HJX A;  2A3E A;  1HKK A;  3PRA A;  1O6I A;  3B9A A;  2MLX A;  4MGV A;  5DEZ A;  4DWS C;  2RQS A;  3KCE A;  3O5R A;  4Z2I A;  3ARY A;  4ZPT R;  3RM4 A;  3AS0 A;  4MNM A;  2RUD A;  2PPP A;  3FY1 A;  3ALG A;  1LL7 A;  3UF8 A;  1W9U A;  5DF0 A;  1BKF A;  2LGO A;  2RUC A;  3ARZ A;  1F40 A;  1A7X A;  2PV2 A;  1NWR A;  1X6N A;  4DRO A;  4ITZ A;  4J4N A;  4W9P A;  3WD2 A;  2D9F A;  1H0I A;  3O5L A;  1K9T A;  1F8A B;  4S3J A;  2DT2 A;  3H9R B;  2YBT A;  1FFQ A;  1EYM A;  3KAI A;  4XAK A;  3AS3 A;  2ZQU A;  4WKF A;  4DZ3 A;  2G41 A;  4DRM A;  3G6L A;  3ARW A;  3O5K A;  4QT3 A;  1FKL A;  4Z2H A;  4DWS A;  3FXY A;  4FN2 A;  4WIW A;  3IK8 A;  5HBF A;  4DRH A;  2MPH A;  1FKH A;  4DWS B;  1E15 A;  3CHF A;  5HT1 A;  4WKH A;  4NSB A;  4U85 A;  2PV3 A;  1OGG A;  1Q6H A;  2ZQT A;  4G2P A;  2ZR4 A;  2DSV A;  1HJW A;  4ODQ A;  1R9H A;  1QPF A;  2L2S A;  4ODL A;  5I98 A;  1LL6 A;  1ZK6 A;  1H0G A;  3B9E A;  1HKJ A;  1UR9 A;  4ODR A;  4ODM A;  1RD6 A;  1ZBK A;  1PIN A;  2ZQS A;  3TC5 A;  1W1T A;  3UQB A;  1ROU A;  4JFL A;  4P8U A;  2FDM A;  3WL0 A;  3CHE A;  3RME A;  1NMV A;  4ZPW R;  4DRQ A;  2A3B A;  1B6C A;  2UZ5 A;  1YW5 A;  2MNT A;  4DH0 A;  2WK2 A;  4QIB A;  1HKM A;  1C9H A;  1J6Y A;  2DSW A;  4ML4 A;  3GPK A;  3IKD A;  5GQB A;  2RUR A;  2MLZ A;  2PPN A;  2KFW A;  1X6L A;  4GGQ A;  4PTM A;  2XP4 A;  3WD4 A;  2ZR5 A;  4LAX A;  3QOK A;  1NWT A;  1FD9 A;  1E6P A;  2DG3 A;  1PBK A;  2XP8 A;  4L72 B;  1FKS A;  1KFW A;  4Q7N A;  2VN1 A;  1EIB A;  4R5E A;  2RSE A;  3MDY B;  2LPV A;  3OOB A;  1HXV A;  1E6N A;  3CZ8 A;  1JNE A;  3UQA A;  1D2K A;  1W9P A;  5HW8 A;  1FJD A;  4LAY A;  3WKZ A;  2DG4 A;  2O92 A;  2DT3 A;  3TDB A;  2ZQV A;  2F2D A;  1WAW A;  3WQV A;  5HWC A;  1NH6 A;  1EHN A;  4NZC A;  4WKA A;  1ZBW A;  1E9L A;  2IUZ A;  4ZPV R;  3ARU A;  5GPG A;  2RUQ A;  3O5G A;  1ZCN A;  5DIV A;  2XP5 A;  3PRD A;  3LUO A;  2JZV A;  4KR0 B;  3IHZ A;  2AOS A;  2N87 A;  1ZU8 A;  3B7X A;  4LAV A;  2MLY A;  3KAH A;  4Z2G A;  1HKI A;  4IPX A;  3TCZ A;  3WIJ A;  2M08 A;  2M2A A;  2ITK A;  3O5F A;  4C02 B;  3ART A;  1IX5 A;  1M5Y A;  3NRK A;  4U84 A;  4DRN A;  2PI6 A;  4DIP A;  4L3N A;  3I6C A;  2Q5A A;  3RM9 A;  1FKR A;  2K8I A;  4HBO A;  1ZB5 A;  4P8X A;  2O9O A;  2QF8 A;  1VF8 A;  3CGN A;  1EDQ A;  3ARX A;  2B31 A;  3B8S A;  4DRI A;  2KR7 A;  1FKD A;  2VCD A;  3ARS A;  5DIU A;  2KE0 A;  1J4H A;  4W5U A;  4ODK A;  3NI6 A;  4ODO A;  4J4O A;  3KAD A;  3ODK A;  3FAP A;  1CTN A;  4AY1 A;  3EY6 A;  1N1A A;  2A3A A;  2WLY A;  3PR9 A;  1JNS A;  5HKG A;  2ESC A;  1ITX A;  3O5P A;  1LJY A;  4G50 A;  1EQ3 A;  4JYS A;  1KT0 A;  4NNR A;  4Z2K A;  1XHG A;  2DT1 A;  3KAC A;  1FKT A;  2F4E A;  1W9V A;  1FKI A;  1TCO C;  4DRK A;  2PV1 A;  1J4I A;  1ZL1 A;  3O5O A;  4MNK A;  4IQC A;  3G6M A;  5DO2 A;  3UQI A;  3UI6 A;  4DRP A;  1NWU A;  2XPA A;  4MSP A;  1NMW A;  3JYJ A;  4MNJ A;  4TW7 A;  2WLZ A;  3O5E A;  4R0X A;  1U79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...