1J4RA

Fk506 binding protein complexed with fkb-001
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2-Aryl-2,2-difluoroacetamide FKBP12 ligands: synthesis and X-ray structural studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506-BINDING PROTEIN
total genus 25
structure length 107
sequence length 107
chains with identical sequence B, D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1j4rA00
1R9HA 2D9FA 2LGOA 3JXVA 4DRNA 1KT0A 1J4RA 1QPLA 4TW7A 4QT3A 3O5PA 3KCEA 2K8IA 2PBCA 3FAPA 1JNTA 4U84A 2KO7A 1NMVA 3GPKA 4ODOA 5HW7A 2VCDA 4LAXA 1HXVA 1PINA 4QT2A 2L2SA 4IPXA 3IKDA 1Y0OA 2KR7A 2XP5A 4J4OA 4DRJA 1L1PA 2KE0A 3CGNA 3TC5A 1FKGA 1C9HA 2PPPA 2RUCA 4IQCA 2DG3A 1ROUA 1FKTA 1FKSA 2LKNA 3B7XA 3OOBA 4IQ2A 2RSEA 1W26A 1EQ3A 4JFKA 1FKRA 5HTGA 2RUDA 3NTPA 2ZQUA 1D7IA 2ZR6A 1M5YA 2ZR4A 3KAIA 3O5GA 3O5DA 3UI4A 4LAYA 2PV2A 3LUOA 4FN2A 1A7XA 3O5OA 1JVWA 2ZQVA 1NMWA 1ROTA 4LAVA 3UF8A 3KADA 1Q1CA 2MF9A 2RURA 3UI6A 3O5RA 2PPOA 1ZCNA 2N87A 4DH0A 4TX0A 4DRHA 2XP7A 2FAPA 4GIVA 3O5KA 1J4IA 2AWGA 3JYMA 5J6EA 3NRKA 2VN1A 5B8IC 2Y78A 2ZQSA 1EYMA 3RGCA 4LAWA 3UQBA 3JYJA 4MGVA 4DRQA 1D6OA 4JFJA 5HW6A 2DG4A 3O5IA 2PPNA 3IK8A 3WH0A 3PRBA 2MLYA 4BF8A 1J6YA 5BXJA 4J4NA 4C02B 4TW6A 3KAGA 3PRDA 1FKDA 3IKGA 1J4HA 2M1IA 3TCZA 3MDYB 5DIUA 2F21A 1FKIA 4O2TA 4JFMA 1QZ2A 3UI5A 1YATA 2KGJA 2MNTA 4W9PA 1FKLA 3KAFA 2MLZA 5DITA 2ZR5A 2F4EA 1FAPA 2UZ5A 4QIBA 4U85A 5HW8A 1Q6HA 3H9RB 3VAWA 2MLXA 3UQAA 2ZQTA 1FKJA 2MPHA 5HT1A 2M2AA 2LPVA 1BL4A 3NI6A 4ODNA 1U79A 4R0XA 2FKEA 2RUQA 3I6CA 3RFWA 2ITKA 4TW8A 4N19A 1FKBA 4DRKA 3KZ7A 4NNRA 4ODMA 4JFLA 1KT1A 3UQIA 1P5QA 3O5QA 1FD9A 1FKKA 4GGQA 2XP6A 3CGMA 4DIPA 1Q6UA 4ODLA 1Q6IA 1QPFA 3O5EA 5GPGA 1FJDA 3TDBA 4ODPA 1FKFA 1TCOC 4TNSA 4DROA 5DIVA 1B6CA 1PBKA 1F8AB 2PV1A 4DZ3A 3IHZA 2F2DA 4MSPA 1D7HA 1NSGA 4ODRA 1T11A 3PA7A 4DT4A 3KAHA 4G2PA 2M08A 4JYSA 1BKFA 4ODKA 4TYOA 5D75A 1FKHA 3ODKA 3O5MA 3O5FA 2XP3A 2RQSA 5HUAA 4DZ2A 2XPAA 3KABA 4W9QA 2XP4A 2KFWA 1F40A 1JNSA 2XP8A 2IF4A 5HWBA 5I98A 5HWCA 3EY6A 2XPBA 4DRPA 2DG9A 2PV3A 4FAPA 2KI3A 2LJ4A 3O5JA 2OFNA 3O5LA 1N1AA 4DRMA 4ITZA 4JFIA 4U86A 3KACA 4W9OA 5HKGA 2JZVA 2XP9A 1YW5A 4DRIA 1ZK6A 2Q5AA 4G50A 4ODQA 1D7JA
chains in the Genus database with same CATH superfamily
1R9HA 2LGOA 2ESCA 1J4RA 4Q7NA 3O5PA 2K8IA 2PBCA 4Z2KA 4ZS6A 4LAXA 1NWTA 2XP5A 1GRJA 3CGNA 2RUCA 4DWSA 1WB0A 3B7XA 3ARZA 3CHCA 1EQ3A 3G6LA 3B8SA 4MNKA 1E44A 1ZU8A 1JVWA 1ROTA 2MF9A 3O5RA 4S3JA 4DRHA 2FAPA 3AS0A 2AWGA 3JYMA 2DT0A 5J6EA 2Y78A 4DRQA 3IK8A 1WNOA 1J6YA 1HKMA 4J4NA 1LL7A 3TCZA 4P8XA 2F21A 3ARPA 4W9PA 2MLZA 1SYTA 3PR9A 2M2AA 1BL4A 1U79A 1ZBKA 4DRKA 3KZ7A 4NSBA 4NNRA 1KT1A 4Z2GA 3UQIA 1P5QA 3O5QA 1Q6UA 4ZPTR 1FJDA 1TCOC 4DZ3A 1F8AB 4URIA 1D7HA 1HJVA 1T11A 4DT4A 3KAHA 4JYSA 1BKFA 1FKHA 2WK2A 2WLYA 1UR9A 3O5MA 4L3NA 3QOKA 4KQZA 4DZ2A 3KABA 2DPEA 1F40A 4S3KA 1FFQA 2IF4A 3ARVA 4DRPA 2DG9A 2A3AA 4MPKA 2LJ4A 1N1AA 4IT6A 4U86A 4W9OA 3GTYX 2G41A 2JZVA 4Z2HA 1YW5A 1LJYA 3CZ8A 3ALGA 3JXVA 1GOIA 4WKAA 1EHNA 1NH6A 4ML4A 4U84A 3FAPA 1JNDA 3GPKA 1NMVA 4ODOA 5HW7A 1W1YA 1PINA 4MNJA 1H0GA 3B9DA 4DWSD 2DSUA 4J4OA 1LL4A 2KE0A 4WIWA 3TC5A 2PPPA 2FDMA 1ROUA 2WLZA 1FKTA 4Z2IA 2RSEA 1IX5A 3NTPA 2ZQUA 2ZR4A 3O5DA 4LAYA 2PV2A 2F23A 1NMWA 1ZBVA 3ARRA 4Z2JA 4DH0A 4P8UA 4TX0A 2XP7A 4GIVA 4W5UA 4WKFA 3NRKA 5DEZA 4DWSC 1LG2A 3UQBA 3JYJA 4JFJA 3O5IA 3WD1A 1CTNA 3OA5A 3PRBA 4BF8A 4TW6A 1FKDA 1J4HA 2M1IA 1OGBA 3MDYB 1FKIA 1QZ2A 3ARYA 4LGXA 1FKLA 1UR8A 2WM0A 3KAFA 5DITA 3RM9A 5HW8A 2A3BA 3ARWA 4U85A 1Q6HA 5HT1A 2LPVA 3NI6A 1E6NA 4R0XA 2RUQA 3RFWA 3PRAA 1SR0A 1FKBA 3WD3A 3RMEA 4IT4A 3WKZA 4GGQA 2XP6A 5GQBA 3CGMA 4DIPA 1JCHB 1Q6IA 1HKIA 3ARQA 1FKFA 4ODPA 4TNSA 3TDBA 4MAVA 4WKHA 1B6CA 4DWSB 2F2DA 4MSPA 4AY1A 1K9TA 2M08A 4TYOA 4UDMA 3FXYA 1EDQA 1E6PA 1NWUA 4W9QA 1E6ZA 2XP4A 1X6LA 5HWBA 2G8ZA 4HBEA 2PV3A 2KI3A 2OFNA 4DRMA 5HKGA 1LL6A 3CHFA 2Q5AA 3AS1A 2O9OA 1KFWA 3ARXA 3AS2A 2A3CA 1QPLA 2IUZA 4TW7A 2A3EA 4QT3A 2KO7A 1W9VA 2VCDA 2L2SA 1ZBWA 2KR7A 4QZVB 1L1PA 1FKGA 4IQCA 1OWQA 2DSWA 1FKSA 3OOBA 3G6MA 4IQ2A 2DSZA 1W1TA 2RUDA 4HBOA 1WAWA 1D7IA 3AS3A 2ZR6A 1GUVA 3UI4A 1ITXA 3LUOA 4FN2A 3O5OA 2ZQVA 4Z2LA 1VF8A 3EIPA 1Q1CA 2PPOA 1ZCNA 2N87A 3ARSA 1ZB5A 1J4IA 1ZBCA 2VN1A 1TFVA 3WL1A 1EYMA 4LAWA 4MGVA 1D6OA 3CHDA 5HW6A 2PPNA 2EULA 4XAKA 2MLYA 5BXJA 4Q22A 3IKGA 4MTVA 3B9EA 2ZR5A 2MLXA 2ZQTA 1XRVA 4ODNA 1E15A 1W9UA 1X6NA 2FKEA 3BXWA 4TW8A 2AOSA 4N19A 3B9AA 1D2KA 4ODMA 4JFLA 1FD9A 1FKKA 1NWSA 4ODLA 5GPGA 4P8WA 3AROA 5DIVA 1EIBA 1NWRA 1NSGA 1H0IA 5DF0A 3PA7A 3ARUA 4G2PA 1HKJA 4KR0B 3FY1A 1W9PA 2P4VA 5D75A 2O92A 3O5FA 2RQSA 2YBTA 3BMBA 2XPAA 1JNSA 5HBFA 2XP8A 1OGGA 5I98A 5HWCA 3EY6A 1E9LA 4FAPA 1GPFA 3O5JA 4P8VA 2DSVA 3O5LA 4ITZA 4JFIA 1W1VA 1O6IA 1E6RA 2PN0A 1ZK6A 4DRIA 4ODQA 1D7JA 2D9FA 4DRNA 1KT0A 1LG1A 3KCEA 3GU0A 1JNTA 3CH9A 1HXVA 4QT2A 4PTMA 4IPXA 3IKDA 1Y0OA 4DRJA 1C9HA 3WIJA 2DG3A 1JNEA 2LKNA 4NZCA 1XHGA 1W26A 4JFKA 1FKRA 5HTGA 1M5YA 2DT2A 3KAIA 3O5GA 3WQVA 1A7XA 1FFRA 4LAVA 3UF8A 3KADA 2RURA 3UI6A 4ZPVR 3RM4A 2YBUA 4HARA 3O5KA 1LQ0A 5B8IC 2ZQSA 3RGCA 2DG4A 4MNMA 3WH0A 4C02B 3KAGA 3WD2A 3PRDA 1W1PA 5DO2A 5DIUA 4O2TA 2DT3A 4JFMA 3UI5A 1YATA 2KGJA 2MNTA 4WK9A 4L72B 3WL0A 4QIBA 2F4EA 1FAPA 2UZ5A 3H9RB 3VAWA 3UQAA 1FKJA 2MPHA 1ZL1A 5GPRA 3WQWA 3ALFA 3I6CA 2ITKA 2QF8A 3W4RA 2DT1A 4R5EA 1RD6A 4ZPWR 3CHEA 3RM8A 1QPFA 1HJWA 3O5EA 2PI6A 4DROA 3AQUA 3WD0A 1PBKA 2PV1A 3IHZA 2ETNA 4ODRA 4ODKA 4MNLA 4WJXA 5JH8A 3ODKA 2XP3A 5HUAA 3WD4A 1HKKA 2B5UB 2KFWA 2OLHA 2XPBA 3ARTA 2B31A 3KACA 2XP9A 4G50A 1HJXA
chains in the Genus database with same CATH topology
1R9HA 2LGOA 2ESCA 1J4RA 4Q7NA 3O5PA 2K8IA 2PBCA 4Z2KA 4ZS6A 4LAXA 1NWTA 2XP5A 3CGNA 2RUCA 4DWSA 1WB0A 3B7XA 3ARZA 3CHCA 1EQ3A 3G6LA 3B8SA 4MNKA 1ZU8A 1JVWA 1ROTA 2MF9A 3O5RA 4S3JA 4DRHA 2FAPA 4G50A 3AS0A 2AWGA 3JYMA 2DT0A 5J6EA 2Y78A 4DRQA 3IK8A 1WNOA 1J6YA 1HKMA 4J4NA 1LL7A 3TCZA 4P8XA 2F21A 3ARPA 4W9PA 2MLZA 1SYTA 3PR9A 2M2AA 1BL4A 1U79A 1ZBKA 4DRKA 3KZ7A 4NSBA 4NNRA 1KT1A 4Z2GA 3UQIA 1P5QA 3O5QA 1Q6UA 4ZPTR 1FJDA 1TCOC 4DZ3A 1F8AB 4URIA 1D7HA 1HJVA 1T11A 4DT4A 3KAHA 4JYSA 1BKFA 1FKHA 2WK2A 2WLYA 1UR9A 3O5MA 4L3NA 3QOKA 4KQZA 4DZ2A 3KABA 2DPEA 1F40A 4S3KA 1FFQA 2IF4A 3ARVA 4DRPA 2DG9A 2A3AA 4MPKA 2LJ4A 1N1AA 4IT6A 4U86A 4W9OA 2G41A 2JZVA 4Z2HA 1YW5A 1LJYA 3CZ8A 3ALGA 3JXVA 1GOIA 4WKAA 1EHNA 1NH6A 4ML4A 4U84A 3FAPA 1JNDA 3GPKA 1NMVA 4ODOA 5HW7A 1W1YA 1PINA 4MNJA 1H0GA 3B9DA 4DWSD 2DSUA 4J4OA 1LL4A 2KE0A 4WIWA 3TC5A 2PPPA 2FDMA 1ROUA 2WLZA 1FKTA 4Z2IA 2RSEA 1IX5A 3NTPA 2ZQUA 2ZR4A 3O5DA 4LAYA 2PV2A 1NMWA 1ZBVA 3ARRA 4Z2JA 4DH0A 4P8UA 4TX0A 2XP7A 4GIVA 4W5UA 4WKFA 3NRKA 5DEZA 4DWSC 1LG2A 3UQBA 3JYJA 4JFJA 3O5IA 3WD1A 1CTNA 3OA5A 3PRBA 4BF8A 4TW6A 1FKDA 1J4HA 2M1IA 1OGBA 3MDYB 1FKIA 1QZ2A 3ARYA 4LGXA 1FKLA 1UR8A 2WM0A 3KAFA 5DITA 3RM9A 5HW8A 2A3BA 3ARWA 4U85A 1Q6HA 5HT1A 2LPVA 3NI6A 1E6NA 4R0XA 2RUQA 3RFWA 3PRAA 1SR0A 1FKBA 3WD3A 3RMEA 4IT4A 3WKZA 4GGQA 2XP6A 5GQBA 3CGMA 4DIPA 1Q6IA 1HKIA 3ARQA 1FKFA 4ODPA 4TNSA 3TDBA 4MAVA 4WKHA 1B6CA 4DWSB 2F2DA 4MSPA 4AY1A 1K9TA 2M08A 4TYOA 3FXYA 1EDQA 1E6PA 1NWUA 4W9QA 1E6ZA 2XP4A 1X6LA 5HWBA 2G8ZA 4HBEA 2PV3A 2KI3A 2OFNA 4DRMA 5HKGA 1LL6A 3CHFA 2Q5AA 3AS1A 2O9OA 1KFWA 3ARXA 3AS2A 2A3CA 1QPLA 2IUZA 4TW7A 2A3EA 4QT3A 2KO7A 1W9VA 2VCDA 2L2SA 1ZBWA 2KR7A 4QZVB 1L1PA 1FKGA 4IQCA 1OWQA 2DSWA 1FKSA 3OOBA 3G6MA 4IQ2A 2DSZA 1W1TA 2RUDA 4HBOA 1WAWA 1D7IA 3AS3A 2ZR6A 1GUVA 3UI4A 1ITXA 3LUOA 4FN2A 3O5OA 2ZQVA 4Z2LA 1VF8A 1Q1CA 2PPOA 1ZCNA 2N87A 3ARSA 1ZB5A 1J4IA 1ZBCA 2VN1A 1TFVA 3WL1A 1EYMA 4LAWA 4MGVA 1D6OA 3CHDA 5HW6A 2PPNA 4XAKA 2MLYA 5BXJA 4Q22A 3IKGA 4MTVA 3B9EA 2ZR5A 2MLXA 2ZQTA 1XRVA 4ODNA 1E15A 1W9UA 1X6NA 2FKEA 3BXWA 4TW8A 2AOSA 4N19A 3B9AA 1D2KA 4ODMA 4JFLA 1FD9A 1FKKA 1NWSA 4ODLA 5GPGA 4P8WA 3AROA 5DIVA 1EIBA 1NWRA 1NSGA 1H0IA 5DF0A 3PA7A 3ARUA 4G2PA 1HKJA 4KR0B 3FY1A 1W9PA 5D75A 2O92A 3O5FA 2RQSA 2YBTA 2XPAA 1JNSA 5HBFA 2XP8A 1OGGA 5I98A 5HWCA 3EY6A 1E9LA 4FAPA 1GPFA 3O5JA 4P8VA 2DSVA 3O5LA 4ITZA 1W1VA 1O6IA 1E6RA 4DRIA 1ZK6A 4ODQA 1D7JA 2D9FA 4DRNA 1KT0A 1LG1A 3KCEA 1JNTA 3CH9A 1HXVA 4QT2A 4PTMA 4IPXA 3IKDA 1Y0OA 4DRJA 1C9HA 3WIJA 2DG3A 1JNEA 2LKNA 4NZCA 1XHGA 1W26A 4JFKA 1FKRA 5HTGA 1M5YA 2DT2A 3KAIA 3O5GA 3WQVA 1A7XA 1FFRA 4LAVA 3UF8A 3KADA 2RURA 3UI6A 4ZPVR 3RM4A 2YBUA 4HARA 3O5KA 1LQ0A 5B8IC 2ZQSA 3RGCA 2DG4A 4MNMA 3WH0A 4C02B 3KAGA 3WD2A 3PRDA 1W1PA 5DO2A 5DIUA 4O2TA 2DT3A 4JFMA 3UI5A 1YATA 2KGJA 2MNTA 4WK9A 4L72B 3WL0A 4QIBA 2F4EA 1FAPA 2UZ5A 3H9RB 3VAWA 3UQAA 1FKJA 2MPHA 1ZL1A 5GPRA 3WQWA 3ALFA 3I6CA 2ITKA 2QF8A 3W4RA 2DT1A 4R5EA 1RD6A 4ZPWR 3CHEA 3RM8A 1QPFA 1HJWA 3O5EA 2PI6A 4DROA 3AQUA 3WD0A 1PBKA 2PV1A 3IHZA 4ODRA 4ODKA 4MNLA 4WJXA 5JH8A 3ODKA 2XP3A 5HUAA 3WD4A 1HKKA 2KFWA 2OLHA 2XPBA 3ARTA 2B31A 3KACA 2XP9A 4JFIA 1HJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R9H A;  2D9F A;  2LGO A;  3JXV A;  4DRN A;  1KT0 A;  1J4R A;  1QPL A;  4TW7 A;  4QT3 A;  3O5P A;  3KCE A;  2K8I A;  2PBC A;  3FAP A;  1JNT A;  4U84 A;  2KO7 A;  1NMV A;  3GPK A;  4ODO A;  5HW7 A;  2VCD A;  4LAX A;  1HXV A;  1PIN A;  4QT2 A;  2L2S A;  4IPX A;  3IKD A;  1Y0O A;  2KR7 A;  2XP5 A;  4J4O A;  4DRJ A;  1L1P A;  2KE0 A;  3CGN A;  3TC5 A;  1FKG A;  1C9H A;  2PPP A;  2RUC A;  4IQC A;  2DG3 A;  1ROU A;  1FKT A;  1FKS A;  2LKN A;  3B7X A;  3OOB A;  4IQ2 A;  2RSE A;  1W26 A;  1EQ3 A;  4JFK A;  1FKR A;  5HTG A;  2RUD A;  3NTP A;  2ZQU A;  1D7I A;  2ZR6 A;  1M5Y A;  2ZR4 A;  3KAI A;  3O5G A;  3O5D A;  3UI4 A;  4LAY A;  2PV2 A;  3LUO A;  4FN2 A;  1A7X A;  3O5O A;  1JVW A;  2ZQV A;  1NMW A;  1ROT A;  4LAV A;  3UF8 A;  3KAD A;  1Q1C A;  2MF9 A;  2RUR A;  3UI6 A;  3O5R A;  2PPO A;  1ZCN A;  2N87 A;  4DH0 A;  4TX0 A;  4DRH A;  2XP7 A;  2FAP A;  4GIV A;  3O5K A;  1J4I A;  2AWG A;  3JYM A;  5J6E A;  3NRK A;  2VN1 A;  5B8I C;  2Y78 A;  2ZQS A;  1EYM A;  3RGC A;  4LAW A;  3UQB A;  3JYJ A;  4MGV A;  4DRQ A;  1D6O A;  4JFJ A;  5HW6 A;  2DG4 A;  3O5I A;  2PPN A;  3IK8 A;  3WH0 A;  3PRB A;  2MLY A;  4BF8 A;  1J6Y A;  5BXJ A;  4J4N A;  4C02 B;  4TW6 A;  3KAG A;  3PRD A;  1FKD A;  3IKG A;  1J4H A;  2M1I A;  3TCZ A;  3MDY B;  5DIU A;  2F21 A;  1FKI A;  4O2T A;  4JFM A;  1QZ2 A;  3UI5 A;  1YAT A;  2KGJ A;  2MNT A;  4W9P A;  1FKL A;  3KAF A;  2MLZ A;  5DIT A;  2ZR5 A;  2F4E A;  1FAP A;  2UZ5 A;  4QIB A;  4U85 A;  5HW8 A;  1Q6H A;  3H9R B;  3VAW A;  2MLX A;  3UQA A;  2ZQT A;  1FKJ A;  2MPH A;  5HT1 A;  2M2A A;  2LPV A;  1BL4 A;  3NI6 A;  4ODN A;  1U79 A;  4R0X A;  2FKE A;  2RUQ A;  3I6C A;  3RFW A;  2ITK A;  4TW8 A;  4N19 A;  1FKB A;  4DRK A;  3KZ7 A;  4NNR A;  4ODM A;  4JFL A;  1KT1 A;  3UQI A;  1P5Q A;  3O5Q A;  1FD9 A;  1FKK A;  4GGQ A;  2XP6 A;  3CGM A;  4DIP A;  1Q6U A;  4ODL A;  1Q6I A;  1QPF A;  3O5E A;  5GPG A;  1FJD A;  3TDB A;  4ODP A;  1FKF A;  1TCO C;  4TNS A;  4DRO A;  5DIV A;  1B6C A;  1PBK A;  1F8A B;  2PV1 A;  4DZ3 A;  3IHZ A;  2F2D A;  4MSP A;  1D7H A;  1NSG A;  4ODR A;  1T11 A;  3PA7 A;  4DT4 A;  3KAH A;  4G2P A;  2M08 A;  4JYS A;  1BKF A;  4ODK A;  4TYO A;  5D75 A;  1FKH A;  3ODK A;  3O5M A;  3O5F A;  2XP3 A;  2RQS A;  5HUA A;  4DZ2 A;  2XPA A;  3KAB A;  4W9Q A;  2XP4 A;  2KFW A;  1F40 A;  1JNS A;  2XP8 A;  2IF4 A;  5HWB A;  5I98 A;  5HWC A;  3EY6 A;  2XPB A;  4DRP A;  2DG9 A;  2PV3 A;  4FAP A;  2KI3 A;  2LJ4 A;  3O5J A;  2OFN A;  3O5L A;  1N1A A;  4DRM A;  4ITZ A;  4JFI A;  4U86 A;  3KAC A;  4W9O A;  5HKG A;  2JZV A;  2XP9 A;  1YW5 A;  4DRI A;  1ZK6 A;  2Q5A A;  4G50 A;  4ODQ A;  1D7J A; 
#chains in the Genus database with same CATH topology
 1R9H A;  2LGO A;  2ESC A;  1J4R A;  4Q7N A;  3O5P A;  2K8I A;  2PBC A;  4Z2K A;  4ZS6 A;  4LAX A;  1NWT A;  2XP5 A;  1GRJ A;  3CGN A;  2RUC A;  4DWS A;  1WB0 A;  3B7X A;  3ARZ A;  3CHC A;  1EQ3 A;  3G6L A;  3B8S A;  4MNK A;  1E44 A;  1ZU8 A;  1JVW A;  1ROT A;  2MF9 A;  3O5R A;  4S3J A;  4DRH A;  2FAP A;  3AS0 A;  2AWG A;  3JYM A;  2DT0 A;  5J6E A;  2Y78 A;  4DRQ A;  3IK8 A;  1WNO A;  1J6Y A;  1HKM A;  4J4N A;  1LL7 A;  3TCZ A;  4P8X A;  2F21 A;  3ARP A;  4W9P A;  2MLZ A;  1SYT A;  3PR9 A;  2M2A A;  1BL4 A;  1U79 A;  1ZBK A;  4DRK A;  3KZ7 A;  4NSB A;  4NNR A;  1KT1 A;  4Z2G A;  3UQI A;  1P5Q A;  3O5Q A;  1Q6U A;  4ZPT R;  1FJD A;  1TCO C;  4DZ3 A;  1F8A B;  4URI A;  1D7H A;  1HJV A;  1T11 A;  4DT4 A;  3KAH A;  4JYS A;  1BKF A;  1FKH A;  2WK2 A;  2WLY A;  1UR9 A;  3O5M A;  4L3N A;  3QOK A;  4KQZ A;  4DZ2 A;  3KAB A;  2DPE A;  1F40 A;  4S3K A;  1FFQ A;  2IF4 A;  3ARV A;  4DRP A;  2DG9 A;  2A3A A;  4MPK A;  2LJ4 A;  1N1A A;  4IT6 A;  4U86 A;  4W9O A;  3GTY X;  2G41 A;  2JZV A;  4Z2H A;  1YW5 A;  1LJY A;  3CZ8 A;  3ALG A;  3JXV A;  1GOI A;  4WKA A;  1EHN A;  1NH6 A;  4ML4 A;  4U84 A;  3FAP A;  1JND A;  3GPK A;  1NMV A;  4ODO A;  5HW7 A;  1W1Y A;  1PIN A;  4MNJ A;  1H0G A;  3B9D A;  4DWS D;  2DSU A;  4J4O A;  1LL4 A;  2KE0 A;  4WIW A;  3TC5 A;  2PPP A;  2FDM A;  1ROU A;  2WLZ A;  1FKT A;  4Z2I A;  2RSE A;  1IX5 A;  3NTP A;  2ZQU A;  2ZR4 A;  3O5D A;  4LAY A;  2PV2 A;  2F23 A;  1NMW A;  1ZBV A;  3ARR A;  4Z2J A;  4DH0 A;  4P8U A;  4TX0 A;  2XP7 A;  4GIV A;  4W5U A;  4WKF A;  3NRK A;  5DEZ A;  4DWS C;  1LG2 A;  3UQB A;  3JYJ A;  4JFJ A;  3O5I A;  3WD1 A;  1CTN A;  3OA5 A;  3PRB A;  4BF8 A;  4TW6 A;  1FKD A;  1J4H A;  2M1I A;  1OGB A;  3MDY B;  1FKI A;  1QZ2 A;  3ARY A;  4LGX A;  1FKL A;  1UR8 A;  2WM0 A;  3KAF A;  5DIT A;  3RM9 A;  5HW8 A;  2A3B A;  3ARW A;  4U85 A;  1Q6H A;  5HT1 A;  2LPV A;  3NI6 A;  1E6N A;  4R0X A;  2RUQ A;  3RFW A;  3PRA A;  1SR0 A;  1FKB A;  3WD3 A;  3RME A;  4IT4 A;  3WKZ A;  4GGQ A;  2XP6 A;  5GQB A;  3CGM A;  4DIP A;  1JCH B;  1Q6I A;  1HKI A;  3ARQ A;  1FKF A;  4ODP A;  4TNS A;  3TDB A;  4MAV A;  4WKH A;  1B6C A;  4DWS B;  2F2D A;  4MSP A;  4AY1 A;  1K9T A;  2M08 A;  4TYO A;  4UDM A;  3FXY A;  1EDQ A;  1E6P A;  1NWU A;  4W9Q A;  1E6Z A;  2XP4 A;  1X6L A;  5HWB A;  2G8Z A;  4HBE A;  2PV3 A;  2KI3 A;  2OFN A;  4DRM A;  5HKG A;  1LL6 A;  3CHF A;  2Q5A A;  3AS1 A;  2O9O A;  1KFW A;  3ARX A;  3AS2 A;  2A3C A;  1QPL A;  2IUZ A;  4TW7 A;  2A3E A;  4QT3 A;  2KO7 A;  1W9V A;  2VCD A;  2L2S A;  1ZBW A;  2KR7 A;  4QZV B;  1L1P A;  1FKG A;  4IQC A;  1OWQ A;  2DSW A;  1FKS A;  3OOB A;  3G6M A;  4IQ2 A;  2DSZ A;  1W1T A;  2RUD A;  4HBO A;  1WAW A;  1D7I A;  3AS3 A;  2ZR6 A;  1GUV A;  3UI4 A;  1ITX A;  3LUO A;  4FN2 A;  3O5O A;  2ZQV A;  4Z2L A;  1VF8 A;  3EIP A;  1Q1C A;  2PPO A;  1ZCN A;  2N87 A;  3ARS A;  1ZB5 A;  1J4I A;  1ZBC A;  2VN1 A;  1TFV A;  3WL1 A;  1EYM A;  4LAW A;  4MGV A;  1D6O A;  3CHD A;  5HW6 A;  2PPN A;  2EUL A;  4XAK A;  2MLY A;  5BXJ A;  4Q22 A;  3IKG A;  4MTV A;  3B9E A;  2ZR5 A;  2MLX A;  2ZQT A;  1XRV A;  4ODN A;  1E15 A;  1W9U A;  1X6N A;  2FKE A;  3BXW A;  4TW8 A;  2AOS A;  4N19 A;  3B9A A;  1D2K A;  4ODM A;  4JFL A;  1FD9 A;  1FKK A;  1NWS A;  4ODL A;  5GPG A;  4P8W A;  3ARO A;  5DIV A;  1EIB A;  1NWR A;  1NSG A;  1H0I A;  5DF0 A;  3PA7 A;  3ARU A;  4G2P A;  1HKJ A;  4KR0 B;  3FY1 A;  1W9P A;  2P4V A;  5D75 A;  2O92 A;  3O5F A;  2RQS A;  2YBT A;  3BMB A;  2XPA A;  1JNS A;  5HBF A;  2XP8 A;  1OGG A;  5I98 A;  5HWC A;  3EY6 A;  1E9L A;  4FAP A;  1GPF A;  3O5J A;  4P8V A;  2DSV A;  3O5L A;  4ITZ A;  4JFI A;  1W1V A;  1O6I A;  1E6R A;  2PN0 A;  1ZK6 A;  4DRI A;  4ODQ A;  1D7J A;  2D9F A;  4DRN A;  1KT0 A;  1LG1 A;  3KCE A;  3GU0 A;  1JNT A;  3CH9 A;  1HXV A;  4QT2 A;  4PTM A;  4IPX A;  3IKD A;  1Y0O A;  4DRJ A;  1C9H A;  3WIJ A;  2DG3 A;  1JNE A;  2LKN A;  4NZC A;  1XHG A;  1W26 A;  4JFK A;  1FKR A;  5HTG A;  1M5Y A;  2DT2 A;  3KAI A;  3O5G A;  3WQV A;  1A7X A;  1FFR A;  4LAV A;  3UF8 A;  3KAD A;  2RUR A;  3UI6 A;  4ZPV R;  3RM4 A;  2YBU A;  4HAR A;  3O5K A;  1LQ0 A;  5B8I C;  2ZQS A;  3RGC A;  2DG4 A;  4MNM A;  3WH0 A;  4C02 B;  3KAG A;  3WD2 A;  3PRD A;  1W1P A;  5DO2 A;  5DIU A;  4O2T A;  2DT3 A;  4JFM A;  3UI5 A;  1YAT A;  2KGJ A;  2MNT A;  4WK9 A;  4L72 B;  3WL0 A;  4QIB A;  2F4E A;  1FAP A;  2UZ5 A;  3H9R B;  3VAW A;  3UQA A;  1FKJ A;  2MPH A;  1ZL1 A;  5GPR A;  3WQW A;  3ALF A;  3I6C A;  2ITK A;  2QF8 A;  3W4R A;  2DT1 A;  4R5E A;  1RD6 A;  4ZPW R;  3CHE A;  3RM8 A;  1QPF A;  1HJW A;  3O5E A;  2PI6 A;  4DRO A;  3AQU A;  3WD0 A;  1PBK A;  2PV1 A;  3IHZ A;  2ETN A;  4ODR A;  4ODK A;  4MNL A;  4WJX A;  5JH8 A;  3ODK A;  2XP3 A;  5HUA A;  3WD4 A;  1HKK A;  2B5U B;  2KFW A;  2OLH A;  2XPB A;  3ART A;  2B31 A;  3KAC A;  2XP9 A;  4G50 A;  1HJX A; 
#chains in the Genus database with same CATH homology
 1R9H A;  2LGO A;  2ESC A;  1J4R A;  4Q7N A;  3O5P A;  2K8I A;  2PBC A;  4Z2K A;  4ZS6 A;  4LAX A;  1NWT A;  2XP5 A;  3CGN A;  2RUC A;  4DWS A;  1WB0 A;  3B7X A;  3ARZ A;  3CHC A;  1EQ3 A;  3G6L A;  3B8S A;  4MNK A;  1ZU8 A;  1JVW A;  1ROT A;  2MF9 A;  3O5R A;  4S3J A;  4DRH A;  2FAP A;  4G50 A;  3AS0 A;  2AWG A;  3JYM A;  2DT0 A;  5J6E A;  2Y78 A;  4DRQ A;  3IK8 A;  1WNO A;  1J6Y A;  1HKM A;  4J4N A;  1LL7 A;  3TCZ A;  4P8X A;  2F21 A;  3ARP A;  4W9P A;  2MLZ A;  1SYT A;  3PR9 A;  2M2A A;  1BL4 A;  1U79 A;  1ZBK A;  4DRK A;  3KZ7 A;  4NSB A;  4NNR A;  1KT1 A;  4Z2G A;  3UQI A;  1P5Q A;  3O5Q A;  1Q6U A;  4ZPT R;  1FJD A;  1TCO C;  4DZ3 A;  1F8A B;  4URI A;  1D7H A;  1HJV A;  1T11 A;  4DT4 A;  3KAH A;  4JYS A;  1BKF A;  1FKH A;  2WK2 A;  2WLY A;  1UR9 A;  3O5M A;  4L3N A;  3QOK A;  4KQZ A;  4DZ2 A;  3KAB A;  2DPE A;  1F40 A;  4S3K A;  1FFQ A;  2IF4 A;  3ARV A;  4DRP A;  2DG9 A;  2A3A A;  4MPK A;  2LJ4 A;  1N1A A;  4IT6 A;  4U86 A;  4W9O A;  2G41 A;  2JZV A;  4Z2H A;  1YW5 A;  1LJY A;  3CZ8 A;  3ALG A;  3JXV A;  1GOI A;  4WKA A;  1EHN A;  1NH6 A;  4ML4 A;  4U84 A;  3FAP A;  1JND A;  3GPK A;  1NMV A;  4ODO A;  5HW7 A;  1W1Y A;  1PIN A;  4MNJ A;  1H0G A;  3B9D A;  4DWS D;  2DSU A;  4J4O A;  1LL4 A;  2KE0 A;  4WIW A;  3TC5 A;  2PPP A;  2FDM A;  1ROU A;  2WLZ A;  1FKT A;  4Z2I A;  2RSE A;  1IX5 A;  3NTP A;  2ZQU A;  2ZR4 A;  3O5D A;  4LAY A;  2PV2 A;  1NMW A;  1ZBV A;  3ARR A;  4Z2J A;  4DH0 A;  4P8U A;  4TX0 A;  2XP7 A;  4GIV A;  4W5U A;  4WKF A;  3NRK A;  5DEZ A;  4DWS C;  1LG2 A;  3UQB A;  3JYJ A;  4JFJ A;  3O5I A;  3WD1 A;  1CTN A;  3OA5 A;  3PRB A;  4BF8 A;  4TW6 A;  1FKD A;  1J4H A;  2M1I A;  1OGB A;  3MDY B;  1FKI A;  1QZ2 A;  3ARY A;  4LGX A;  1FKL A;  1UR8 A;  2WM0 A;  3KAF A;  5DIT A;  3RM9 A;  5HW8 A;  2A3B A;  3ARW A;  4U85 A;  1Q6H A;  5HT1 A;  2LPV A;  3NI6 A;  1E6N A;  4R0X A;  2RUQ A;  3RFW A;  3PRA A;  1SR0 A;  1FKB A;  3WD3 A;  3RME A;  4IT4 A;  3WKZ A;  4GGQ A;  2XP6 A;  5GQB A;  3CGM A;  4DIP A;  1Q6I A;  1HKI A;  3ARQ A;  1FKF A;  4ODP A;  4TNS A;  3TDB A;  4MAV A;  4WKH A;  1B6C A;  4DWS B;  2F2D A;  4MSP A;  4AY1 A;  1K9T A;  2M08 A;  4TYO A;  3FXY A;  1EDQ A;  1E6P A;  1NWU A;  4W9Q A;  1E6Z A;  2XP4 A;  1X6L A;  5HWB A;  2G8Z A;  4HBE A;  2PV3 A;  2KI3 A;  2OFN A;  4DRM A;  5HKG A;  1LL6 A;  3CHF A;  2Q5A A;  3AS1 A;  2O9O A;  1KFW A;  3ARX A;  3AS2 A;  2A3C A;  1QPL A;  2IUZ A;  4TW7 A;  2A3E A;  4QT3 A;  2KO7 A;  1W9V A;  2VCD A;  2L2S A;  1ZBW A;  2KR7 A;  4QZV B;  1L1P A;  1FKG A;  4IQC A;  1OWQ A;  2DSW A;  1FKS A;  3OOB A;  3G6M A;  4IQ2 A;  2DSZ A;  1W1T A;  2RUD A;  4HBO A;  1WAW A;  1D7I A;  3AS3 A;  2ZR6 A;  1GUV A;  3UI4 A;  1ITX A;  3LUO A;  4FN2 A;  3O5O A;  2ZQV A;  4Z2L A;  1VF8 A;  1Q1C A;  2PPO A;  1ZCN A;  2N87 A;  3ARS A;  1ZB5 A;  1J4I A;  1ZBC A;  2VN1 A;  1TFV A;  3WL1 A;  1EYM A;  4LAW A;  4MGV A;  1D6O A;  3CHD A;  5HW6 A;  2PPN A;  4XAK A;  2MLY A;  5BXJ A;  4Q22 A;  3IKG A;  4MTV A;  3B9E A;  2ZR5 A;  2MLX A;  2ZQT A;  1XRV A;  4ODN A;  1E15 A;  1W9U A;  1X6N A;  2FKE A;  3BXW A;  4TW8 A;  2AOS A;  4N19 A;  3B9A A;  1D2K A;  4ODM A;  4JFL A;  1FD9 A;  1FKK A;  1NWS A;  4ODL A;  5GPG A;  4P8W A;  3ARO A;  5DIV A;  1EIB A;  1NWR A;  1NSG A;  1H0I A;  5DF0 A;  3PA7 A;  3ARU A;  4G2P A;  1HKJ A;  4KR0 B;  3FY1 A;  1W9P A;  5D75 A;  2O92 A;  3O5F A;  2RQS A;  2YBT A;  2XPA A;  1JNS A;  5HBF A;  2XP8 A;  1OGG A;  5I98 A;  5HWC A;  3EY6 A;  1E9L A;  4FAP A;  1GPF A;  3O5J A;  4P8V A;  2DSV A;  3O5L A;  4ITZ A;  1W1V A;  1O6I A;  1E6R A;  4DRI A;  1ZK6 A;  4ODQ A;  1D7J A;  2D9F A;  4DRN A;  1KT0 A;  1LG1 A;  3KCE A;  1JNT A;  3CH9 A;  1HXV A;  4QT2 A;  4PTM A;  4IPX A;  3IKD A;  1Y0O A;  4DRJ A;  1C9H A;  3WIJ A;  2DG3 A;  1JNE A;  2LKN A;  4NZC A;  1XHG A;  1W26 A;  4JFK A;  1FKR A;  5HTG A;  1M5Y A;  2DT2 A;  3KAI A;  3O5G A;  3WQV A;  1A7X A;  1FFR A;  4LAV A;  3UF8 A;  3KAD A;  2RUR A;  3UI6 A;  4ZPV R;  3RM4 A;  2YBU A;  4HAR A;  3O5K A;  1LQ0 A;  5B8I C;  2ZQS A;  3RGC A;  2DG4 A;  4MNM A;  3WH0 A;  4C02 B;  3KAG A;  3WD2 A;  3PRD A;  1W1P A;  5DO2 A;  5DIU A;  4O2T A;  2DT3 A;  4JFM A;  3UI5 A;  1YAT A;  2KGJ A;  2MNT A;  4WK9 A;  4L72 B;  3WL0 A;  4QIB A;  2F4E A;  1FAP A;  2UZ5 A;  3H9R B;  3VAW A;  3UQA A;  1FKJ A;  2MPH A;  1ZL1 A;  5GPR A;  3WQW A;  3ALF A;  3I6C A;  2ITK A;  2QF8 A;  3W4R A;  2DT1 A;  4R5E A;  1RD6 A;  4ZPW R;  3CHE A;  3RM8 A;  1QPF A;  1HJW A;  3O5E A;  2PI6 A;  4DRO A;  3AQU A;  3WD0 A;  1PBK A;  2PV1 A;  3IHZ A;  4ODR A;  4ODK A;  4MNL A;  4WJX A;  5JH8 A;  3ODK A;  2XP3 A;  5HUA A;  3WD4 A;  1HKK A;  2KFW A;  2OLH A;  2XPB A;  3ART A;  2B31 A;  3KAC A;  2XP9 A;  4JFI A;  1HJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...