1J4RA

Fk506 binding protein complexed with fkb-001
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-BINDING PROTEIN
publication title 2-Aryl-2,2-difluoroacetamide FKBP12 ligands: synthesis and X-ray structural studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 25
structure length 107
sequence length 107
chains with identical sequence B, D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1j4rA00
2RQSA 3IK8A 2PV2A 1Q1CA 2XP8A 1F8AB 2DG4A 4DRQA 3RFWA 4W9QA 3O5IA 2PPPA 4O2TA 2FKEA 4ODPA 4ODLA 4ITZA 4TW7A 4DROA 2VCDA 2KGJA 1FKRA 2ZQTA 1PINA 2PPNA 1J4RA 3KADA 4TX0A 2ZQUA 5DIUA 1D7HA 1YW5A 2PV3A 1FKBA 1Q6IA 3UI6A 2JZVA 4DZ3A 3O5RA 3RGCA 2KO7A 2F21A 3PA7A 3KAFA 1NMVA 3CGMA 3WH0A 3MDYB 3CGNA 4JFIA 5B8IC 3O5QA 3O5EA 1ROUA 2L2SA 2XPBA 2N87A 4G2PA 4DH0A 1J4HA 1ROTA 2DG3A 2KR7A 2MLYA 4BF8A 3EY6A 3KZ7A 4W9OA 1Q6UA 4IQCA 3TC5A 1T11A 2UZ5A 4DIPA 4JFLA 5J6EA 1C9HA 4IQ2A 1JVWA 5DITA 3KABA 3FAPA 3KCEA 2KE0A 2FAPA 3H9RB 3O5GA 2Y78A 1HXVA 2KI3A 2LJ4A 4DRIA 1TCOC 4LAXA 5HWCA 2OFNA 5D75A 4LAYA 2IF4A 1Q6HA 1FKTA 4FN2A 1J6YA 4ODKA 3O5JA 4JFJA 1NSGA 1FKSA 2PBCA 1FKHA 3O5DA 1QPFA 3O5OA 4JFKA 4NNRA 3UI4A 4IPXA 4DRJA 5HW6A 2RURA 4J4OA 5GPGA 4TYOA 4W9PA 4U85A 5HW7A 1FKJA 4DRNA 4DZ2A 3NTPA 4C02B 3TCZA 4DRPA 3O5FA 4ODMA 3I6CA 1FD9A 3O5MA 4U84A 3UQIA 5HUAA 2KFWA 3TDBA 1JNTA 1FKGA 2RUDA 2DG9A 3O5KA 2F2DA 3JYJA 4N19A 2LPVA 4DRHA 5I98A 1KT0A 3LUOA 4GIVA 2XP7A 1FAPA 3GPKA 4ODNA 3JYMA 4ODRA 4GGQA 3KAIA 2LGOA 1BKFA 1ZK6A 5HKGA 1FJDA 5BXJA 2F4EA 3IHZA 1W26A 2MPHA 1QZ2A 1ZCNA 3UQAA 2LKNA 3O5PA 4TW6A 3KACA 3IKDA 4QT3A 4TW8A 5DIVA 1M5YA 2MNTA 2XPAA 3B7XA 3ODKA 4R0XA 1F40A 1U79A 2XP5A 3UI5A 2M1IA 1R9HA 4LAVA 4DRKA 3KAHA 3PRBA 1B6CA 3UQBA 1L1PA 3JXVA 2ZR6A 3NI6A 1BL4A 1JNSA 3NRKA 2VN1A 1FKIA 2XP9A 1A7XA 1D6OA 2Q5AA 5HTGA 1EYMA 1J4IA 2RUQA 2ZQVA 1Y0OA 2RUCA 2XP6A 4LAWA 3O5LA 1D7JA 1N1AA 2AWGA 4JYSA 2MLXA 3UF8A 1QPLA 4U86A 1D7IA 2XP3A 4QT2A 2MF9A 3OOBA 1FKFA 4DRMA 2D9FA 1FKKA 2MLZA 2RSEA 4TNSA 2XP4A 2K8IA 2ZR4A 2PV1A 2M2AA 3KAGA 1KT1A 2PPOA 4JFMA 4DT4A 1EQ3A 2ITKA 4QIBA 1YATA 2ZR5A 3VAWA 4G50A 2M08A 1P5QA 1NMWA 2ZQSA 1FKLA 3IKGA 5HW8A 1PBKA 4ODQA 5HT1A 4J4NA 5HWBA 1FKDA 4ODOA 4MGVA 4MSPA 3PRDA 4FAPA
chains in the Genus database with same CATH superfamily
1Q1CA 1LL6A 4DWSA 4W9QA 3O5IA 2PPPA 4O2TA 4ODPA 4ML4A 4P8WA 4S3KA 3CHDA 1HKIA 3WD3A 4TX0A 1GRJA 1YW5A 2A3AA 2PV3A 3UI6A 1NMVA 3WH0A 1ZBKA 4JFIA 3WD4A 2EULA 3O5QA 3O5EA 2XPBA 2N87A 4DH0A 2G41A 1E6ZA 1HJVA 1Q6UA 3AS0A 4WJXA 1C9HA 4IQ2A 3KABA 1HJXA 1GUVA 3KCEA 3H9RB 4DRIA 1WNOA 4LAXA 3FY1A 4ODKA 3ALFA 4JFJA 5HW8A 3UI4A 1CTNA 4IPXA 5DEZA 2RURA 4TYOA 4DWSD 4DZ2A 3RM8A 1W1VA 1EDQA 3O5FA 1LG2A 3ALGA 4U84A 3UQIA 3CZ8A 3G6MA 4Z2LA 2RUDA 3O5KA 2WK2A 1GPFA 3LUOA 2A3BA 4GIVA 4HARA 3B9AA 4ODRA 1BKFA 1ZK6A 2DPEA 1VF8A 4Z2GA 4HBOA 2LKNA 5JH8A 4KR0B 4QT3A 4MPKA 1M5YA 3ODKA 3B7XA 4P8XA 1F40A 1U79A 2M1IA 1R9HA 4LAVA 4NSBA 2O92A 3WL1A 3NRKA 2VN1A 3B9DA 4WKHA 2F23A 1Y0OA 2RUCA 1HJWA 1D7JA 1X6LA 1QPLA 4U86A 1D7IA 5DO2A 1OGGA 1SYTA 4PTMA 5GQBA 4TNSA 4UDMA 2IUZA 3ARUA 1KT1A 2PPOA 4JFMA 1EQ3A 4QIBA 3VAWA 1NH6A 1P5QA 3IKGA 4ODQA 1LL7A 5HWBA 1KFWA 3PR9A 3PRDA 3IK8A 1F8AB 2DG4A 2ETNA 2ZQTA 4Z2IA 4LGXA 1PINA 3GU0A 4P8UA 2WLZA 3B8SA 2ZQUA 1FKBA 4IT6A 4DZ3A 2JZVA 3O5RA 3KAFA 1E6RA 1ROUA 2L2SA 1E15A 1ROTA 3G6LA 2DG3A 2MLYA 1W1YA 4W9OA 4IQCA 1T11A 4DIPA 4JFLA 1JVWA 4L3NA 2KE0A 4S3JA 2KI3A 4R5EA 5HWCA 2DSVA 2IF4A 1HKMA 3EIPA 4FN2A 1J6YA 3O5JA 1NSGA 1FKSA 2PBCA 1QPFA 3WD0A 5HW6A 5GPGA 4U85A 1W9PA 1TFVA 3WQWA 1FKJA 4DRNA 3ARTA 3NTPA 3ARYA 2P4VA 1RD6A 2DT0A 4ODMA 1FD9A 1IX5A 3WIJA 2A3EA 2A3CA 2F2DA 3CHCA 3GPKA 3ARZA 4ODNA 2LGOA 5HKGA 1FJDA 5BXJA 4MNLA 2MPHA 3WD1A 5DIVA 1WB0A 3IKDA 4WK9A 4R0XA 3UI5A 3UQBA 1B6CA 3JXVA 2WLYA 3WKZA 4DWSB 2XP9A 1FKIA 1A7XA 2Q5AA 5HTGA 2RUQA 2ZQVA 4LAWA 2DT2A 3O5LA 4JYSA 2MLXA 4WKFA 1E6PA 4QT2A 3AS2A 1FKKA 4ZPVR 2RSEA 1K9TA 3ARXA 2XP4A 3W4RA 3KAGA 2ZR5A 4DWSC 2M08A 1JCHB 1EIBA 1PBKA 5HT1A 1D2KA 1FKDA 2RQSA 2PV2A 2XP8A 4DRQA 3RFWA 4TW7A 2FKEA 4ITZA 4DROA 2VCDA 3FXYA 1FKRA 4P8VA 3KADA 1ITXA 5DIUA 1D7HA 2KO7A 2F21A 2QF8A 1ZB5A 3CGNA 3ARWA 5HBFA 4G2PA 1J4HA 5DF0A 2KR7A 4Z2HA 4BF8A 3KZ7A 2DSZA 3TC5A 1FFQA 3ARRA 2DT3A 3ARSA 4MNMA 5DITA 3AS3A 3FAPA 3O5GA 2Y78A 1HXVA 2LJ4A 4Q22A 5D75A 4LAYA 4Q7NA 1FKTA 4WKAA 4IT4A 1FKHA 4DRJA 2PN0A 3RMEA 3AS1A 1NWSA 4MAVA 1W1TA 4L72B 3TCZA 1XHGA 2KFWA 3TDBA 3WD2A 1FKGA 2DG9A 4DRHA 3JYJA 4W5UA 1ZBWA 4ZS6A 5I98A 2XP7A 4QZVB 3JYMA 4GGQA 3KAIA 3B9EA 1ZL1A 4TW6A 4WIWA 2MNTA 2XPAA 1NWUA 1ZBCA 1NWTA 3KAHA 1O6IA 3NI6A 1BL4A 1JNSA 4AY1A 1J4IA 1EYMA 1W1PA 2XP6A 3UF8A 2AWGA 4MNKA 2XP3A 2MF9A 1UR9A 1FKFA 4DRMA 2YBUA 2D9FA 4Z2KA 4ZPWR 3RM9A 3QOKA 2K8IA 1WAWA 2ITKA 1YATA 4G50A 1NMWA 1OGBA 1FKLA 1NWRA 2DSUA 2B5UB 1JNDA 4J4NA 4ODOA 3CHEA 3AQUA 4FAPA 2PI6A 1GOIA 4ODLA 3CH9A 3BXWA 2KGJA 2ESCA 2PPNA 1J4RA 1EHNA 1Q6IA 1H0IA 3RGCA 5GPRA 3PA7A 1ZBVA 3GTYX 3CGMA 2B31A 3MDYB 5B8IC 1JNEA 2DT1A 1LG1A 1SR0A 4MTVA 4MNJA 3EY6A 3RM4A 3WQVA 2O9OA 2UZ5A 5J6EA 1XRVA 1OWQA 1H0GA 2FAPA 2WM0A 2YBTA 1TCOC 3AROA 2OLHA 2OFNA 3BMBA 1Q6HA 4NNRA 3O5DA 3O5OA 4JFKA 4J4OA 4W9PA 5HW7A 3PRAA 1E6NA 4C02B 4DRPA 4XAKA 3I6CA 3O5MA 5HUAA 2FDMA 1X6NA 1JNTA 4N19A 1E9LA 2LPVA 3ARVA 3CHFA 1KT0A 3ARPA 4HBEA 1FAPA 1W9UA 2G8ZA 2F4EA 3IHZA 1W26A 1QZ2A 1HKJA 1ZCNA 3UQAA 3O5PA 1HKKA 3KACA 4TW8A 1LL4A 1ZU8A 2XP5A 2DSWA 4KQZA 4DRKA 3PRBA 3ARQA 1L1PA 2ZR6A 4URIA 1D6OA 1N1AA 3OOBA 4NZCA 4Z2JA 2MLZA 3OA5A 1FFRA 1LJYA 2ZR4A 2PV1A 2M2AA 4DT4A 2AOSA 1W9VA 2ZQSA 1UR8A 3WL0A 1LQ0A 1E44A 4MGVA 4MSPA 4ZPTR
chains in the Genus database with same CATH topology
1Q1CA 1LL6A 4DWSA 4W9QA 3O5IA 2PPPA 4O2TA 4ODPA 4ML4A 4P8WA 4S3KA 3CHDA 1HKIA 3WD3A 4TX0A 1YW5A 2A3AA 2PV3A 3UI6A 1NMVA 3WH0A 1ZBKA 4JFIA 3WD4A 3O5QA 3O5EA 2XPBA 2N87A 4DH0A 2G41A 1E6ZA 1HJVA 1Q6UA 3AS0A 4WJXA 1C9HA 4IQ2A 3KABA 1HJXA 1GUVA 3KCEA 3H9RB 4DRIA 1WNOA 4LAXA 3FY1A 4ODKA 3ALFA 4JFJA 5HW8A 3UI4A 1CTNA 4IPXA 5DEZA 2RURA 4TYOA 4DWSD 4DZ2A 3RM8A 1W1VA 1EDQA 3O5FA 1LG2A 3ALGA 4U84A 3UQIA 3CZ8A 3G6MA 4Z2LA 2RUDA 3O5KA 2WK2A 1GPFA 3LUOA 2A3BA 4GIVA 4HARA 3B9AA 4ODRA 1BKFA 1ZK6A 2DPEA 1VF8A 4Z2GA 4HBOA 2LKNA 5JH8A 4KR0B 4QT3A 4MPKA 1M5YA 3ODKA 3B7XA 4P8XA 1F40A 1U79A 2M1IA 1R9HA 4LAVA 4NSBA 2O92A 3WL1A 3NRKA 2VN1A 3B9DA 4WKHA 1Y0OA 2RUCA 1HJWA 1D7JA 1X6LA 1QPLA 4U86A 1D7IA 5DO2A 1OGGA 1SYTA 4PTMA 5GQBA 4TNSA 2IUZA 3ARUA 1KT1A 2PPOA 4JFMA 1EQ3A 4QIBA 3VAWA 1NH6A 1P5QA 3IKGA 4ODQA 1LL7A 5HWBA 1KFWA 3PR9A 3PRDA 3IK8A 1F8AB 2DG4A 2ZQTA 4Z2IA 4LGXA 1PINA 4P8UA 2WLZA 3B8SA 2ZQUA 1FKBA 4IT6A 4DZ3A 2JZVA 3O5RA 3KAFA 1E6RA 1ROUA 2L2SA 1E15A 1ROTA 3G6LA 2DG3A 2MLYA 1W1YA 4W9OA 4IQCA 1T11A 4DIPA 4JFLA 1JVWA 4L3NA 2KE0A 4S3JA 2KI3A 4R5EA 5HWCA 2DSVA 2IF4A 1HKMA 4FN2A 1J6YA 3O5JA 1NSGA 1FKSA 2PBCA 1QPFA 3WD0A 5HW6A 5GPGA 4U85A 1W9PA 1TFVA 3WQWA 1FKJA 4DRNA 3ARTA 3NTPA 3ARYA 1RD6A 2DT0A 4ODMA 1FD9A 1IX5A 3WIJA 2A3EA 2A3CA 2F2DA 3CHCA 3GPKA 3ARZA 4ODNA 2LGOA 5HKGA 1FJDA 5BXJA 4MNLA 2MPHA 3WD1A 5DIVA 1WB0A 3IKDA 4WK9A 4R0XA 3UI5A 3UQBA 1B6CA 3JXVA 2WLYA 3WKZA 4DWSB 2XP9A 1FKIA 1A7XA 2Q5AA 5HTGA 2RUQA 2ZQVA 4LAWA 2DT2A 3O5LA 4JYSA 2MLXA 4WKFA 1E6PA 4QT2A 3AS2A 1FKKA 4ZPVR 2RSEA 1K9TA 3ARXA 2XP4A 3W4RA 3KAGA 2ZR5A 4DWSC 2M08A 1EIBA 1PBKA 5HT1A 1D2KA 1FKDA 2RQSA 2PV2A 2XP8A 4DRQA 3RFWA 4TW7A 2FKEA 4ITZA 4DROA 2VCDA 3FXYA 1FKRA 4P8VA 3KADA 1ITXA 5DIUA 1D7HA 2KO7A 2F21A 2QF8A 1ZB5A 3CGNA 3ARWA 5HBFA 4G2PA 1J4HA 5DF0A 2KR7A 4Z2HA 4BF8A 3KZ7A 2DSZA 3TC5A 1FFQA 3ARRA 2DT3A 3ARSA 4MNMA 5DITA 3AS3A 3FAPA 3O5GA 2Y78A 1HXVA 2LJ4A 4Q22A 5D75A 4LAYA 4Q7NA 1FKTA 4WKAA 4IT4A 1FKHA 4DRJA 3RMEA 3AS1A 1NWSA 4MAVA 1W1TA 4L72B 3TCZA 1XHGA 2KFWA 3TDBA 3WD2A 1FKGA 2DG9A 4DRHA 3JYJA 4W5UA 1ZBWA 4ZS6A 5I98A 2XP7A 4QZVB 3JYMA 4GGQA 3KAIA 3B9EA 1ZL1A 4TW6A 4WIWA 2MNTA 2XPAA 1NWUA 1ZBCA 1NWTA 3KAHA 1O6IA 3NI6A 1BL4A 1JNSA 4AY1A 1J4IA 1EYMA 1W1PA 2XP6A 3UF8A 2AWGA 4MNKA 2XP3A 2MF9A 1UR9A 1FKFA 4DRMA 2YBUA 2D9FA 4Z2KA 4ZPWR 3RM9A 3QOKA 2K8IA 1WAWA 2ITKA 1YATA 4G50A 1NMWA 1OGBA 1FKLA 1NWRA 2DSUA 1JNDA 4J4NA 4ODOA 3CHEA 3AQUA 4FAPA 2PI6A 1GOIA 4ODLA 3CH9A 3BXWA 2KGJA 2ESCA 2PPNA 1J4RA 1EHNA 1Q6IA 1H0IA 3RGCA 5GPRA 3PA7A 1ZBVA 3CGMA 2B31A 3MDYB 5B8IC 1JNEA 2DT1A 1LG1A 1SR0A 4MTVA 4MNJA 3EY6A 3RM4A 3WQVA 2O9OA 2UZ5A 5J6EA 1XRVA 1OWQA 1H0GA 2FAPA 2WM0A 2YBTA 1TCOC 3AROA 2OLHA 2OFNA 1Q6HA 4NNRA 3O5DA 3O5OA 4JFKA 4J4OA 4W9PA 5HW7A 3PRAA 1E6NA 4C02B 4DRPA 4XAKA 3I6CA 3O5MA 5HUAA 2FDMA 1X6NA 1JNTA 4N19A 1E9LA 2LPVA 3ARVA 3CHFA 1KT0A 3ARPA 4HBEA 1FAPA 1W9UA 2G8ZA 2F4EA 3IHZA 1W26A 1QZ2A 1HKJA 1ZCNA 3UQAA 3O5PA 1HKKA 3KACA 4TW8A 1LL4A 1ZU8A 2XP5A 2DSWA 4KQZA 4DRKA 3PRBA 3ARQA 1L1PA 2ZR6A 4URIA 1D6OA 1N1AA 3OOBA 4NZCA 4Z2JA 2MLZA 3OA5A 1FFRA 1LJYA 2ZR4A 2PV1A 2M2AA 4DT4A 2AOSA 1W9VA 2ZQSA 1UR8A 3WL0A 1LQ0A 4MGVA 4MSPA 4ZPTR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQS A;  3IK8 A;  2PV2 A;  1Q1C A;  2XP8 A;  1F8A B;  2DG4 A;  4DRQ A;  3RFW A;  4W9Q A;  3O5I A;  2PPP A;  4O2T A;  2FKE A;  4ODP A;  4ODL A;  4ITZ A;  4TW7 A;  4DRO A;  2VCD A;  2KGJ A;  1FKR A;  2ZQT A;  1PIN A;  2PPN A;  1J4R A;  3KAD A;  4TX0 A;  2ZQU A;  5DIU A;  1D7H A;  1YW5 A;  2PV3 A;  1FKB A;  1Q6I A;  3UI6 A;  2JZV A;  4DZ3 A;  3O5R A;  3RGC A;  2KO7 A;  2F21 A;  3PA7 A;  3KAF A;  1NMV A;  3CGM A;  3WH0 A;  3MDY B;  3CGN A;  4JFI A;  5B8I C;  3O5Q A;  3O5E A;  1ROU A;  2L2S A;  2XPB A;  2N87 A;  4G2P A;  4DH0 A;  1J4H A;  1ROT A;  2DG3 A;  2KR7 A;  2MLY A;  4BF8 A;  3EY6 A;  3KZ7 A;  4W9O A;  1Q6U A;  4IQC A;  3TC5 A;  1T11 A;  2UZ5 A;  4DIP A;  4JFL A;  5J6E A;  1C9H A;  4IQ2 A;  1JVW A;  5DIT A;  3KAB A;  3FAP A;  3KCE A;  2KE0 A;  2FAP A;  3H9R B;  3O5G A;  2Y78 A;  1HXV A;  2KI3 A;  2LJ4 A;  4DRI A;  1TCO C;  4LAX A;  5HWC A;  2OFN A;  5D75 A;  4LAY A;  2IF4 A;  1Q6H A;  1FKT A;  4FN2 A;  1J6Y A;  4ODK A;  3O5J A;  4JFJ A;  1NSG A;  1FKS A;  2PBC A;  1FKH A;  3O5D A;  1QPF A;  3O5O A;  4JFK A;  4NNR A;  3UI4 A;  4IPX A;  4DRJ A;  5HW6 A;  2RUR A;  4J4O A;  5GPG A;  4TYO A;  4W9P A;  4U85 A;  5HW7 A;  1FKJ A;  4DRN A;  4DZ2 A;  3NTP A;  4C02 B;  3TCZ A;  4DRP A;  3O5F A;  4ODM A;  3I6C A;  1FD9 A;  3O5M A;  4U84 A;  3UQI A;  5HUA A;  2KFW A;  3TDB A;  1JNT A;  1FKG A;  2RUD A;  2DG9 A;  3O5K A;  2F2D A;  3JYJ A;  4N19 A;  2LPV A;  4DRH A;  5I98 A;  1KT0 A;  3LUO A;  4GIV A;  2XP7 A;  1FAP A;  3GPK A;  4ODN A;  3JYM A;  4ODR A;  4GGQ A;  3KAI A;  2LGO A;  1BKF A;  1ZK6 A;  5HKG A;  1FJD A;  5BXJ A;  2F4E A;  3IHZ A;  1W26 A;  2MPH A;  1QZ2 A;  1ZCN A;  3UQA A;  2LKN A;  3O5P A;  4TW6 A;  3KAC A;  3IKD A;  4QT3 A;  4TW8 A;  5DIV A;  1M5Y A;  2MNT A;  2XPA A;  3B7X A;  3ODK A;  4R0X A;  1F40 A;  1U79 A;  2XP5 A;  3UI5 A;  2M1I A;  1R9H A;  4LAV A;  4DRK A;  3KAH A;  3PRB A;  1B6C A;  3UQB A;  1L1P A;  3JXV A;  2ZR6 A;  3NI6 A;  1BL4 A;  1JNS A;  3NRK A;  2VN1 A;  1FKI A;  2XP9 A;  1A7X A;  1D6O A;  2Q5A A;  5HTG A;  1EYM A;  1J4I A;  2RUQ A;  2ZQV A;  1Y0O A;  2RUC A;  2XP6 A;  4LAW A;  3O5L A;  1D7J A;  1N1A A;  2AWG A;  4JYS A;  2MLX A;  3UF8 A;  1QPL A;  4U86 A;  1D7I A;  2XP3 A;  4QT2 A;  2MF9 A;  3OOB A;  1FKF A;  4DRM A;  2D9F A;  1FKK A;  2MLZ A;  2RSE A;  4TNS A;  2XP4 A;  2K8I A;  2ZR4 A;  2PV1 A;  2M2A A;  3KAG A;  1KT1 A;  2PPO A;  4JFM A;  4DT4 A;  1EQ3 A;  2ITK A;  4QIB A;  1YAT A;  2ZR5 A;  3VAW A;  4G50 A;  2M08 A;  1P5Q A;  1NMW A;  2ZQS A;  1FKL A;  3IKG A;  5HW8 A;  1PBK A;  4ODQ A;  5HT1 A;  4J4N A;  5HWB A;  1FKD A;  4ODO A;  4MGV A;  4MSP A;  3PRD A;  4FAP A; 
#chains in the Genus database with same CATH topology
 1Q1C A;  1LL6 A;  4DWS A;  4W9Q A;  3O5I A;  2PPP A;  4O2T A;  4ODP A;  4ML4 A;  4P8W A;  4S3K A;  3CHD A;  1HKI A;  3WD3 A;  4TX0 A;  1GRJ A;  1YW5 A;  2A3A A;  2PV3 A;  3UI6 A;  1NMV A;  3WH0 A;  1ZBK A;  4JFI A;  3WD4 A;  2EUL A;  3O5Q A;  3O5E A;  2XPB A;  2N87 A;  4DH0 A;  2G41 A;  1E6Z A;  1HJV A;  1Q6U A;  3AS0 A;  4WJX A;  1C9H A;  4IQ2 A;  3KAB A;  1HJX A;  1GUV A;  3KCE A;  3H9R B;  4DRI A;  1WNO A;  4LAX A;  3FY1 A;  4ODK A;  3ALF A;  4JFJ A;  5HW8 A;  3UI4 A;  1CTN A;  4IPX A;  5DEZ A;  2RUR A;  4TYO A;  4DWS D;  4DZ2 A;  3RM8 A;  1W1V A;  1EDQ A;  3O5F A;  1LG2 A;  3ALG A;  4U84 A;  3UQI A;  3CZ8 A;  3G6M A;  4Z2L A;  2RUD A;  3O5K A;  2WK2 A;  1GPF A;  3LUO A;  2A3B A;  4GIV A;  4HAR A;  3B9A A;  4ODR A;  1BKF A;  1ZK6 A;  2DPE A;  1VF8 A;  4Z2G A;  4HBO A;  2LKN A;  5JH8 A;  4KR0 B;  4QT3 A;  4MPK A;  1M5Y A;  3ODK A;  3B7X A;  4P8X A;  1F40 A;  1U79 A;  2M1I A;  1R9H A;  4LAV A;  4NSB A;  2O92 A;  3WL1 A;  3NRK A;  2VN1 A;  3B9D A;  4WKH A;  2F23 A;  1Y0O A;  2RUC A;  1HJW A;  1D7J A;  1X6L A;  1QPL A;  4U86 A;  1D7I A;  5DO2 A;  1OGG A;  1SYT A;  4PTM A;  5GQB A;  4TNS A;  4UDM A;  2IUZ A;  3ARU A;  1KT1 A;  2PPO A;  4JFM A;  1EQ3 A;  4QIB A;  3VAW A;  1NH6 A;  1P5Q A;  3IKG A;  4ODQ A;  1LL7 A;  5HWB A;  1KFW A;  3PR9 A;  3PRD A;  3IK8 A;  1F8A B;  2DG4 A;  2ETN A;  2ZQT A;  4Z2I A;  4LGX A;  1PIN A;  3GU0 A;  4P8U A;  2WLZ A;  3B8S A;  2ZQU A;  1FKB A;  4IT6 A;  4DZ3 A;  2JZV A;  3O5R A;  3KAF A;  1E6R A;  1ROU A;  2L2S A;  1E15 A;  1ROT A;  3G6L A;  2DG3 A;  2MLY A;  1W1Y A;  4W9O A;  4IQC A;  1T11 A;  4DIP A;  4JFL A;  1JVW A;  4L3N A;  2KE0 A;  4S3J A;  2KI3 A;  4R5E A;  5HWC A;  2DSV A;  2IF4 A;  1HKM A;  3EIP A;  4FN2 A;  1J6Y A;  3O5J A;  1NSG A;  1FKS A;  2PBC A;  1QPF A;  3WD0 A;  5HW6 A;  5GPG A;  4U85 A;  1W9P A;  1TFV A;  3WQW A;  1FKJ A;  4DRN A;  3ART A;  3NTP A;  3ARY A;  2P4V A;  1RD6 A;  2DT0 A;  4ODM A;  1FD9 A;  1IX5 A;  3WIJ A;  2A3E A;  2A3C A;  2F2D A;  3CHC A;  3GPK A;  3ARZ A;  4ODN A;  2LGO A;  5HKG A;  1FJD A;  5BXJ A;  4MNL A;  2MPH A;  3WD1 A;  5DIV A;  1WB0 A;  3IKD A;  4WK9 A;  4R0X A;  3UI5 A;  3UQB A;  1B6C A;  3JXV A;  2WLY A;  3WKZ A;  4DWS B;  2XP9 A;  1FKI A;  1A7X A;  2Q5A A;  5HTG A;  2RUQ A;  2ZQV A;  4LAW A;  2DT2 A;  3O5L A;  4JYS A;  2MLX A;  4WKF A;  1E6P A;  4QT2 A;  3AS2 A;  1FKK A;  4ZPV R;  2RSE A;  1K9T A;  3ARX A;  2XP4 A;  3W4R A;  3KAG A;  2ZR5 A;  4DWS C;  2M08 A;  1JCH B;  1EIB A;  1PBK A;  5HT1 A;  1D2K A;  1FKD A;  2RQS A;  2PV2 A;  2XP8 A;  4DRQ A;  3RFW A;  4TW7 A;  2FKE A;  4ITZ A;  4DRO A;  2VCD A;  3FXY A;  1FKR A;  4P8V A;  3KAD A;  1ITX A;  5DIU A;  1D7H A;  2KO7 A;  2F21 A;  2QF8 A;  1ZB5 A;  3CGN A;  3ARW A;  5HBF A;  4G2P A;  1J4H A;  5DF0 A;  2KR7 A;  4Z2H A;  4BF8 A;  3KZ7 A;  2DSZ A;  3TC5 A;  1FFQ A;  3ARR A;  2DT3 A;  3ARS A;  4MNM A;  5DIT A;  3AS3 A;  3FAP A;  3O5G A;  2Y78 A;  1HXV A;  2LJ4 A;  4Q22 A;  5D75 A;  4LAY A;  4Q7N A;  1FKT A;  4WKA A;  4IT4 A;  1FKH A;  4DRJ A;  2PN0 A;  3RME A;  3AS1 A;  1NWS A;  4MAV A;  1W1T A;  4L72 B;  3TCZ A;  1XHG A;  2KFW A;  3TDB A;  3WD2 A;  1FKG A;  2DG9 A;  4DRH A;  3JYJ A;  4W5U A;  1ZBW A;  4ZS6 A;  5I98 A;  2XP7 A;  4QZV B;  3JYM A;  4GGQ A;  3KAI A;  3B9E A;  1ZL1 A;  4TW6 A;  4WIW A;  2MNT A;  2XPA A;  1NWU A;  1ZBC A;  1NWT A;  3KAH A;  1O6I A;  3NI6 A;  1BL4 A;  1JNS A;  4AY1 A;  1J4I A;  1EYM A;  1W1P A;  2XP6 A;  3UF8 A;  2AWG A;  4MNK A;  2XP3 A;  2MF9 A;  1UR9 A;  1FKF A;  4DRM A;  2YBU A;  2D9F A;  4Z2K A;  4ZPW R;  3RM9 A;  3QOK A;  2K8I A;  1WAW A;  2ITK A;  1YAT A;  4G50 A;  1NMW A;  1OGB A;  1FKL A;  1NWR A;  2DSU A;  2B5U B;  1JND A;  4J4N A;  4ODO A;  3CHE A;  3AQU A;  4FAP A;  2PI6 A;  1GOI A;  4ODL A;  3CH9 A;  3BXW A;  2KGJ A;  2ESC A;  2PPN A;  1J4R A;  1EHN A;  1Q6I A;  1H0I A;  3RGC A;  5GPR A;  3PA7 A;  1ZBV A;  3GTY X;  3CGM A;  2B31 A;  3MDY B;  5B8I C;  1JNE A;  2DT1 A;  1LG1 A;  1SR0 A;  4MTV A;  4MNJ A;  3EY6 A;  3RM4 A;  3WQV A;  2O9O A;  2UZ5 A;  5J6E A;  1XRV A;  1OWQ A;  1H0G A;  2FAP A;  2WM0 A;  2YBT A;  1TCO C;  3ARO A;  2OLH A;  2OFN A;  3BMB A;  1Q6H A;  4NNR A;  3O5D A;  3O5O A;  4JFK A;  4J4O A;  4W9P A;  5HW7 A;  3PRA A;  1E6N A;  4C02 B;  4DRP A;  4XAK A;  3I6C A;  3O5M A;  5HUA A;  2FDM A;  1X6N A;  1JNT A;  4N19 A;  1E9L A;  2LPV A;  3ARV A;  3CHF A;  1KT0 A;  3ARP A;  4HBE A;  1FAP A;  1W9U A;  2G8Z A;  2F4E A;  3IHZ A;  1W26 A;  1QZ2 A;  1HKJ A;  1ZCN A;  3UQA A;  3O5P A;  1HKK A;  3KAC A;  4TW8 A;  1LL4 A;  1ZU8 A;  2XP5 A;  2DSW A;  4KQZ A;  4DRK A;  3PRB A;  3ARQ A;  1L1P A;  2ZR6 A;  4URI A;  1D6O A;  1N1A A;  3OOB A;  4NZC A;  4Z2J A;  2MLZ A;  3OA5 A;  1FFR A;  1LJY A;  2ZR4 A;  2PV1 A;  2M2A A;  4DT4 A;  2AOS A;  1W9V A;  2ZQS A;  1UR8 A;  3WL0 A;  1LQ0 A;  1E44 A;  4MGV A;  4MSP A;  4ZPT R; 
#chains in the Genus database with same CATH homology
 1Q1C A;  1LL6 A;  4DWS A;  4W9Q A;  3O5I A;  2PPP A;  4O2T A;  4ODP A;  4ML4 A;  4P8W A;  4S3K A;  3CHD A;  1HKI A;  3WD3 A;  4TX0 A;  1YW5 A;  2A3A A;  2PV3 A;  3UI6 A;  1NMV A;  3WH0 A;  1ZBK A;  4JFI A;  3WD4 A;  3O5Q A;  3O5E A;  2XPB A;  2N87 A;  4DH0 A;  2G41 A;  1E6Z A;  1HJV A;  1Q6U A;  3AS0 A;  4WJX A;  1C9H A;  4IQ2 A;  3KAB A;  1HJX A;  1GUV A;  3KCE A;  3H9R B;  4DRI A;  1WNO A;  4LAX A;  3FY1 A;  4ODK A;  3ALF A;  4JFJ A;  5HW8 A;  3UI4 A;  1CTN A;  4IPX A;  5DEZ A;  2RUR A;  4TYO A;  4DWS D;  4DZ2 A;  3RM8 A;  1W1V A;  1EDQ A;  3O5F A;  1LG2 A;  3ALG A;  4U84 A;  3UQI A;  3CZ8 A;  3G6M A;  4Z2L A;  2RUD A;  3O5K A;  2WK2 A;  1GPF A;  3LUO A;  2A3B A;  4GIV A;  4HAR A;  3B9A A;  4ODR A;  1BKF A;  1ZK6 A;  2DPE A;  1VF8 A;  4Z2G A;  4HBO A;  2LKN A;  5JH8 A;  4KR0 B;  4QT3 A;  4MPK A;  1M5Y A;  3ODK A;  3B7X A;  4P8X A;  1F40 A;  1U79 A;  2M1I A;  1R9H A;  4LAV A;  4NSB A;  2O92 A;  3WL1 A;  3NRK A;  2VN1 A;  3B9D A;  4WKH A;  1Y0O A;  2RUC A;  1HJW A;  1D7J A;  1X6L A;  1QPL A;  4U86 A;  1D7I A;  5DO2 A;  1OGG A;  1SYT A;  4PTM A;  5GQB A;  4TNS A;  2IUZ A;  3ARU A;  1KT1 A;  2PPO A;  4JFM A;  1EQ3 A;  4QIB A;  3VAW A;  1NH6 A;  1P5Q A;  3IKG A;  4ODQ A;  1LL7 A;  5HWB A;  1KFW A;  3PR9 A;  3PRD A;  3IK8 A;  1F8A B;  2DG4 A;  2ZQT A;  4Z2I A;  4LGX A;  1PIN A;  4P8U A;  2WLZ A;  3B8S A;  2ZQU A;  1FKB A;  4IT6 A;  4DZ3 A;  2JZV A;  3O5R A;  3KAF A;  1E6R A;  1ROU A;  2L2S A;  1E15 A;  1ROT A;  3G6L A;  2DG3 A;  2MLY A;  1W1Y A;  4W9O A;  4IQC A;  1T11 A;  4DIP A;  4JFL A;  1JVW A;  4L3N A;  2KE0 A;  4S3J A;  2KI3 A;  4R5E A;  5HWC A;  2DSV A;  2IF4 A;  1HKM A;  4FN2 A;  1J6Y A;  3O5J A;  1NSG A;  1FKS A;  2PBC A;  1QPF A;  3WD0 A;  5HW6 A;  5GPG A;  4U85 A;  1W9P A;  1TFV A;  3WQW A;  1FKJ A;  4DRN A;  3ART A;  3NTP A;  3ARY A;  1RD6 A;  2DT0 A;  4ODM A;  1FD9 A;  1IX5 A;  3WIJ A;  2A3E A;  2A3C A;  2F2D A;  3CHC A;  3GPK A;  3ARZ A;  4ODN A;  2LGO A;  5HKG A;  1FJD A;  5BXJ A;  4MNL A;  2MPH A;  3WD1 A;  5DIV A;  1WB0 A;  3IKD A;  4WK9 A;  4R0X A;  3UI5 A;  3UQB A;  1B6C A;  3JXV A;  2WLY A;  3WKZ A;  4DWS B;  2XP9 A;  1FKI A;  1A7X A;  2Q5A A;  5HTG A;  2RUQ A;  2ZQV A;  4LAW A;  2DT2 A;  3O5L A;  4JYS A;  2MLX A;  4WKF A;  1E6P A;  4QT2 A;  3AS2 A;  1FKK A;  4ZPV R;  2RSE A;  1K9T A;  3ARX A;  2XP4 A;  3W4R A;  3KAG A;  2ZR5 A;  4DWS C;  2M08 A;  1EIB A;  1PBK A;  5HT1 A;  1D2K A;  1FKD A;  2RQS A;  2PV2 A;  2XP8 A;  4DRQ A;  3RFW A;  4TW7 A;  2FKE A;  4ITZ A;  4DRO A;  2VCD A;  3FXY A;  1FKR A;  4P8V A;  3KAD A;  1ITX A;  5DIU A;  1D7H A;  2KO7 A;  2F21 A;  2QF8 A;  1ZB5 A;  3CGN A;  3ARW A;  5HBF A;  4G2P A;  1J4H A;  5DF0 A;  2KR7 A;  4Z2H A;  4BF8 A;  3KZ7 A;  2DSZ A;  3TC5 A;  1FFQ A;  3ARR A;  2DT3 A;  3ARS A;  4MNM A;  5DIT A;  3AS3 A;  3FAP A;  3O5G A;  2Y78 A;  1HXV A;  2LJ4 A;  4Q22 A;  5D75 A;  4LAY A;  4Q7N A;  1FKT A;  4WKA A;  4IT4 A;  1FKH A;  4DRJ A;  3RME A;  3AS1 A;  1NWS A;  4MAV A;  1W1T A;  4L72 B;  3TCZ A;  1XHG A;  2KFW A;  3TDB A;  3WD2 A;  1FKG A;  2DG9 A;  4DRH A;  3JYJ A;  4W5U A;  1ZBW A;  4ZS6 A;  5I98 A;  2XP7 A;  4QZV B;  3JYM A;  4GGQ A;  3KAI A;  3B9E A;  1ZL1 A;  4TW6 A;  4WIW A;  2MNT A;  2XPA A;  1NWU A;  1ZBC A;  1NWT A;  3KAH A;  1O6I A;  3NI6 A;  1BL4 A;  1JNS A;  4AY1 A;  1J4I A;  1EYM A;  1W1P A;  2XP6 A;  3UF8 A;  2AWG A;  4MNK A;  2XP3 A;  2MF9 A;  1UR9 A;  1FKF A;  4DRM A;  2YBU A;  2D9F A;  4Z2K A;  4ZPW R;  3RM9 A;  3QOK A;  2K8I A;  1WAW A;  2ITK A;  1YAT A;  4G50 A;  1NMW A;  1OGB A;  1FKL A;  1NWR A;  2DSU A;  1JND A;  4J4N A;  4ODO A;  3CHE A;  3AQU A;  4FAP A;  2PI6 A;  1GOI A;  4ODL A;  3CH9 A;  3BXW A;  2KGJ A;  2ESC A;  2PPN A;  1J4R A;  1EHN A;  1Q6I A;  1H0I A;  3RGC A;  5GPR A;  3PA7 A;  1ZBV A;  3CGM A;  2B31 A;  3MDY B;  5B8I C;  1JNE A;  2DT1 A;  1LG1 A;  1SR0 A;  4MTV A;  4MNJ A;  3EY6 A;  3RM4 A;  3WQV A;  2O9O A;  2UZ5 A;  5J6E A;  1XRV A;  1OWQ A;  1H0G A;  2FAP A;  2WM0 A;  2YBT A;  1TCO C;  3ARO A;  2OLH A;  2OFN A;  1Q6H A;  4NNR A;  3O5D A;  3O5O A;  4JFK A;  4J4O A;  4W9P A;  5HW7 A;  3PRA A;  1E6N A;  4C02 B;  4DRP A;  4XAK A;  3I6C A;  3O5M A;  5HUA A;  2FDM A;  1X6N A;  1JNT A;  4N19 A;  1E9L A;  2LPV A;  3ARV A;  3CHF A;  1KT0 A;  3ARP A;  4HBE A;  1FAP A;  1W9U A;  2G8Z A;  2F4E A;  3IHZ A;  1W26 A;  1QZ2 A;  1HKJ A;  1ZCN A;  3UQA A;  3O5P A;  1HKK A;  3KAC A;  4TW8 A;  1LL4 A;  1ZU8 A;  2XP5 A;  2DSW A;  4KQZ A;  4DRK A;  3PRB A;  3ARQ A;  1L1P A;  2ZR6 A;  4URI A;  1D6O A;  1N1A A;  3OOB A;  4NZC A;  4Z2J A;  2MLZ A;  3OA5 A;  1FFR A;  1LJY A;  2ZR4 A;  2PV1 A;  2M2A A;  4DT4 A;  2AOS A;  1W9V A;  2ZQS A;  1UR8 A;  3WL0 A;  1LQ0 A;  4MGV A;  4MSP A;  4ZPT R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...