1J4RA

Fk506 binding protein complexed with fkb-001
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-BINDING PROTEIN
publication title 2-Aryl-2,2-difluoroacetamide FKBP12 ligands: synthesis and X-ray structural studies.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 107
sequence length 107
chains with identical sequence B, D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1j4rA00
4TYOA 3GPKA 4MGVA 3TDBA 1KT1A 1J4RA 1QPLA 3IKDA 5I98A 1D7HA 5DIVA 4C02B 4G2PA 3KAHA 4R0XA 1FKJA 3JYJA 3KAGA 3O5FA 2F4EA 4QT2A 2PBCA 5DIUA 3NTPA 4JYSA 3FAPA 2ZR6A 4LAYA 1ZK6A 2MLZA 2Y78A 2RQSA 3O5OA 3O5GA 4TX0A 5HKGA 1EQ3A 3IKGA 2LPVA 3I6CA 4J4NA 2PPNA 3RFWA 2MLYA 2MF9A 2KE0A 2XP3A 5GPGA 2PPOA 1PINA 3B7XA 2OFNA 1FKBA 1FKLA 1Q1CA 2UZ5A 2K8IA 4W9QA 5BXJA 4IQCA 5HW6A 1Y0OA 4DRJA 2XP4A 3TC5A 1FKFA 2Q5AA 1W26A 4W9PA 1T11A 2PV1A 4FN2A 1TCOC 3CGMA 4ODKA 1FD9A 1NSGA 3O5JA 3O5KA 3PA7A 1C9HA 1NMVA 4TNSA 5DITA 3RGCA 2D9FA 2KGJA 3O5EA 1J4IA 1KT0A 3KADA 2DG9A 2XPAA 2ZR4A 1FKIA 3NI6A 3JYMA 4JFJA 4LAVA 1FKKA 2MPHA 4DZ3A 2PPPA 1L1PA 2KO7A 5HTGA 2DG4A 2FKEA 1U79A 3OOBA 4G50A 2AWGA 2F2DA 4TW7A 2IF4A 1YATA 2LKNA 1A7XA 2XPBA 5HWCA 2ITKA 1FJDA 3EY6A 3UI6A 3O5PA 1P5QA 2KR7A 2MNTA 4BF8A 4ODOA 1BKFA 2LJ4A 3CGNA 2MLXA 2DG3A 3MDYB 1YW5A 3O5DA 3TCZA 4DRQA 4DRKA 1FKHA 5HW7A 4MSPA 2N87A 2XP7A 3O5QA 4IQ2A 4DIPA 2ZR5A 3O5RA 3KZ7A 3UQBA 2PV3A 3LUOA 1F8AB 2LGOA 2ZQTA 4U86A 3O5LA 5J6EA 5B8IC 4JFIA 1FKDA 2XP9A 1ROTA 4ODPA 2F21A 4GGQA 5HT1A 1Q6IA 2RUQA 2KI3A 4DH0A 4DRPA 3WH0A 2M1IA 4LAWA 4NNRA 4DRMA 5HWBA 2FAPA 1D7IA 1PBKA 4U84A 4U85A 1BL4A 4DT4A 4DRIA 3UF8A 4JFMA 4DZ2A 5HUAA 2VN1A 3O5MA 4J4OA 4ODQA 2JZVA 4LAXA 2XP5A 4ODLA 4W9OA 3UQIA 5HW8A 4QIBA 1B6CA 3PRBA 4FAPA 1F40A 3KABA 1EYMA 2KFWA 3KACA 1QPFA 4GIVA 2M08A 3UQAA 3O5IA 3PRDA 4ODMA 2RUCA 2L2SA 2ZQVA 3NRKA 1ROUA 1R9HA 2ZQSA 3KAFA 3KCEA 3IHZA 4DRNA 4DROA 4ODRA 2RSEA 4O2TA 4ODNA 1JVWA 2ZQUA 3JXVA 1JNTA 2M2AA 3IK8A 3ODKA 3VAWA 1D7JA 3KAIA 4DRHA 4TW6A 1Q6UA 1HXVA 1J4HA 1FKTA 2PV2A 2VCDA 1D6OA 1J6YA 4N19A 4JFLA 1FAPA 5D75A 1FKSA 1N1AA 4ITZA 2XP6A 1NMWA 1FKRA 4JFKA 2RUDA 1FKGA 1JNSA 1ZCNA 4QT3A 3UI4A 2RURA 4IPXA 2XP8A 4TW8A 3UI5A 1Q6HA 1QZ2A 1M5YA 3H9RB
chains in the Genus database with same CATH superfamily
3GPKA 1QPLA 3IKDA 2DT3A 1D7HA 4Z2GA 1JCHB 5HBFA 3JYJA 1LG1A 1ITXA 2Y78A 4TX0A 3O5GA 5DEZA 3I6CA 3RFWA 2MF9A 2A3EA 2KE0A 1EIBA 5DF0A 1W1PA 1FKLA 1SR0A 2K8IA 2Q5AA 1T11A 4Q7NA 2PV1A 4FN2A 3AS3A 4Z2HA 3O5JA 3ARYA 4NSBA 3ARUA 3UI5A 1KT0A 1W9VA 3KADA 3ARQA 1XRVA 4TW7A 4LGXA 2B31A 3B8SA 4ZPWR 1FJDA 1WB0A 1UR8A 3O5PA 1P5QA 4Z2LA 4ZPTR 3MDYB 1ZL1A 2DG3A 1NWRA 4Z2KA 1E6ZA 2N87A 3WL1A 4IQ2A 4W5UA 3CHCA 1F8AB 2LGOA 3FY1A 1ZBCA 4DWSA 4GGQA 1Q6IA 3RM8A 2KI3A 3WH0A 1LL4A 1HKKA 3AS2A 4NNRA 2DSWA 2YBUA 2FAPA 4S3KA 1BL4A 4DRIA 3ARZA 3WD3A 4ODQA 2XP5A 4W9OA 1B6CA 2DT1A 1JNDA 1OWQA 2KFWA 4P8WA 1QPFA 2M08A 3PRDA 3RMEA 4WKHA 3WQVA 1EDQA 1HJXA 3WD0A 1ZU8A 1HXVA 4MNJA 2DSZA 1J4HA 1J6YA 1D6OA 4N19A 1FAPA 3WD1A 3QOKA 2A3CA 2RUDA 1FKGA 4TW8A 1HKMA 4ZPVR 4TYOA 3ARSA 5DIVA 4C02B 3KAHA 1W1TA 4QT2A 2F4EA 3NTPA 1WNOA 3EIPA 3FAPA 2ZR6A 4NZCA 3ARWA 3IKGA 2AOSA 4J4NA 1H0GA 5GPGA 2DSUA 1KFWA 1FKBA 1Q1CA 4W9QA 1GUVA 3B9EA 1E15A 1E44A 1CTNA 1K9TA 4TNSA 2KGJA 3O5EA 3NI6A 2DPEA 1FKIA 2MPHA 2DT2A 2PPPA 3WD2A 3OOBA 4G50A 1U79A 4PTMA 2AWGA 4P8XA 4Z2JA 2IF4A 5HWCA 2LKNA 1A7XA 1D2KA 2ITKA 1GOIA 3EY6A 3AS1A 3AROA 1HKJA 2KR7A 4WKAA 3ARTA 2MNTA 1LG2A 1BKFA 2LJ4A 4DRQA 1FKHA 1X6NA 2WLZA 4MTVA 2XP7A 3O5QA 1HKIA 2G41A 3UQBA 4HBEA 5DO2A 1FFQA 2ZQTA 4U86A 3O5LA 1NWUA 1ROTA 1W1YA 4MNLA 1NWTA 4LAWA 4URIA 1PBKA 3AS0A 4U84A 3AQUA 1E9LA 2G8ZA 2PI6A 3UF8A 1E6NA 4DWSC 4QIBA 4WJXA 2FDMA 1F40A 3KABA 2OLHA 1SYTA 3UQAA 3G6LA 3W4RA 4MAVA 2ZQVA 3WQWA 3NRKA 2ZQSA 3KAFA 4DROA 4ODRA 4O2TA 4ODNA 1JVWA 4DWSB 2M2AA 4L72B 4DRHA 1Q6UA 2DSVA 4JFLA 5D75A 1N1AA 4ITZA 1FKRA 4JFKA 1ZCNA 4QT3A 1ZBVA 2XP8A 1QZ2A 1M5YA 3H9RB 2IUZA 3TDBA 4KR0B 5I98A 1J4RA 2O9OA 1WAWA 4R0XA 4MNKA 2PBCA 4UDMA 4JYSA 1ZK6A 3O5OA 2RQSA 2LPVA 4WK9A 2PPNA 3B7XA 2OFNA 2UZ5A 5BXJA 4IQCA 5HW6A 1HJWA 1Y0OA 3TC5A 3PR9A 4W9PA 5JH8A 1GRJA 1TCOC 3CGMA 1C9HA 5DITA 3RGCA 2D9FA 2DG9A 4JFJA 3JYMA 3WKZA 1XHGA 4DZ3A 1LL6A 1L1PA 2KO7A 5HTGA 4L3NA 2FKEA 4ZS6A 3ALFA 2A3AA 4XAKA 1YATA 2WLYA 2PN0A 1GPFA 3UI6A 1W9PA 4BF8A 3GU0A 4IT6A 5HW7A 4DRKA 3BMBA 1TFVA 2ZR5A 3O5RA 4QZVB 4JFIA 1FKDA 2XP9A 4ODPA 2F21A 4MNMA 2RUQA 4DH0A 1ZBWA 3WD4A 4DRPA 4DWSD 4R5EA 3RM9A 1IX5A 4DT4A 1E6PA 1HJVA 2VN1A 3O5MA 3PRAA 5HW8A 4ODLA 4LAXA 3FXYA 3ALGA 3B9DA 2WK2A 3PRBA 4FAPA 1NWSA 2L2SA 3CH9A 1E6RA 3ARVA 3KCEA 4Z2IA 1UR9A 2ZQUA 3VAWA 1D7JA 1JNEA 1LL7A 4TW6A 2PV2A 2VCDA 1FKSA 1JNSA 4HARA 2ESCA 1RD6A 4IPXA 3RM4A 3O5FA 1OGGA 4MGVA 1KT1A 4G2PA 3CZ8A 1FKJA 5DIUA 3KAGA 3CHEA 4LAYA 3B9AA 4KQZA 2MLZA 5HKGA 2QF8A 1EQ3A 2A3BA 1EHNA 1O6IA 2WM0A 2MLYA 1ZB5A 2YBTA 2XP3A 1W1VA 2PPOA 1PINA 4AY1A 4WIWA 4MPKA 4DRJA 2XP4A 1FFRA 1FKFA 1W26A 4ODKA 2O92A 1FD9A 1H0IA 1NSGA 3O5KA 3PA7A 1X6LA 2B5UB 1NMVA 4P8UA 1J4IA 4LAVA 2ZR4A 2XPAA 1FKKA 3WIJA 2DG4A 2F2DA 2XPBA 4WKFA 3ARRA 4ODOA 3CGNA 2MLXA 1YW5A 3O5DA 3TCZA 4MSPA 1ZBKA 4DIPA 2DT0A 4P8VA 3KZ7A 2PV3A 3LUOA 5J6EA 5B8IC 4ML4A 5GQBA 5HT1A 2F23A 4DRMA 1W9UA 2M1IA 5HWBA 4Q22A 3ARPA 1D7IA 4U85A 1NH6A 3BXWA 4JFMA 5GPRA 4DZ2A 5HUAA 3CHDA 4J4OA 2JZVA 3OA5A 3UQIA 1OGBA 3CHFA 1EYMA 4GIVA 3KACA 3O5IA 1LJYA 4ODMA 2RUCA 2EULA 1ROUA 1R9HA 3WL0A 3IHZA 4DRNA 2RSEA 3ARXA 3JXVA 3ODKA 1JNTA 3IK8A 4S3JA 3KAIA 1FKTA 1VF8A 4HBOA 2XP6A 4IT4A 1NMWA 2ETNA 3GTYX 3UI4A 2P4VA 2RURA 3G6MA 1Q6HA 1LQ0A
chains in the Genus database with same CATH topology
3GPKA 1QPLA 3IKDA 2DT3A 1D7HA 4Z2GA 5HBFA 3JYJA 1LG1A 1ITXA 2Y78A 4TX0A 3O5GA 5DEZA 3I6CA 3RFWA 2MF9A 2A3EA 2KE0A 1EIBA 5DF0A 1W1PA 1FKLA 1SR0A 2K8IA 2Q5AA 1T11A 4Q7NA 2PV1A 4FN2A 3AS3A 4Z2HA 3O5JA 3ARYA 4NSBA 3ARUA 3UI5A 1KT0A 1W9VA 3KADA 3ARQA 1XRVA 4TW7A 4LGXA 2B31A 3B8SA 4ZPWR 1FJDA 1WB0A 1UR8A 3O5PA 1P5QA 4Z2LA 4ZPTR 3MDYB 1ZL1A 2DG3A 1NWRA 4Z2KA 1E6ZA 2N87A 3WL1A 4IQ2A 4W5UA 3CHCA 1F8AB 2LGOA 3FY1A 1ZBCA 4DWSA 4GGQA 1Q6IA 3RM8A 2KI3A 3WH0A 1LL4A 1HKKA 3AS2A 4NNRA 2DSWA 2YBUA 2FAPA 4S3KA 1BL4A 4DRIA 3ARZA 3WD3A 4ODQA 2XP5A 4W9OA 1B6CA 2DT1A 1JNDA 1OWQA 2KFWA 4P8WA 1QPFA 2M08A 3PRDA 3RMEA 4WKHA 3WQVA 1EDQA 1HJXA 3WD0A 1ZU8A 1HXVA 4MNJA 2DSZA 1J4HA 1J6YA 1D6OA 4N19A 1FAPA 3WD1A 3QOKA 2A3CA 2RUDA 1FKGA 4TW8A 1HKMA 4ZPVR 4TYOA 3ARSA 5DIVA 4C02B 3KAHA 1W1TA 4QT2A 2F4EA 3NTPA 1WNOA 3FAPA 4NZCA 2ZR6A 3ARWA 3IKGA 2AOSA 4J4NA 1H0GA 5GPGA 2DSUA 1KFWA 1FKBA 1Q1CA 4W9QA 1GUVA 3B9EA 1E15A 1CTNA 1K9TA 4TNSA 2KGJA 3O5EA 3NI6A 2DPEA 1FKIA 2MPHA 2DT2A 2PPPA 3WD2A 3OOBA 4G50A 1U79A 4PTMA 2AWGA 4P8XA 4Z2JA 2IF4A 5HWCA 2LKNA 1A7XA 1D2KA 2ITKA 1GOIA 3EY6A 3AS1A 3AROA 1HKJA 2KR7A 4WKAA 3ARTA 2MNTA 1LG2A 1BKFA 2LJ4A 4DRQA 1FKHA 1X6NA 2WLZA 4MTVA 2XP7A 3O5QA 1HKIA 2G41A 3UQBA 4HBEA 5DO2A 1FFQA 2ZQTA 4U86A 3O5LA 1NWUA 1ROTA 1W1YA 4MNLA 1NWTA 4LAWA 4URIA 1PBKA 3AS0A 4U84A 3AQUA 1E9LA 2G8ZA 2PI6A 3UF8A 1E6NA 4DWSC 4QIBA 4WJXA 2FDMA 1F40A 3KABA 2OLHA 1SYTA 3UQAA 3G6LA 3W4RA 4MAVA 2ZQVA 3WQWA 3NRKA 2ZQSA 3KAFA 4DROA 4ODRA 4O2TA 4ODNA 1JVWA 4DWSB 2M2AA 4L72B 4DRHA 1Q6UA 2DSVA 4JFLA 5D75A 1N1AA 4ITZA 1FKRA 4JFKA 1ZCNA 4QT3A 1ZBVA 2XP8A 1QZ2A 1M5YA 3H9RB 2IUZA 3TDBA 4KR0B 5I98A 1J4RA 2O9OA 1WAWA 4R0XA 4MNKA 2PBCA 4JYSA 1ZK6A 3O5OA 2RQSA 2LPVA 4WK9A 2PPNA 3B7XA 2OFNA 2UZ5A 5BXJA 4IQCA 5HW6A 1HJWA 1Y0OA 3TC5A 3PR9A 4W9PA 5JH8A 1TCOC 3CGMA 1C9HA 5DITA 3RGCA 2D9FA 2DG9A 4JFJA 3JYMA 3WKZA 1XHGA 4DZ3A 1LL6A 1L1PA 2KO7A 5HTGA 4L3NA 2FKEA 4ZS6A 3ALFA 2A3AA 4XAKA 1YATA 2WLYA 1GPFA 3UI6A 1W9PA 4BF8A 4IT6A 5HW7A 4DRKA 1TFVA 2ZR5A 3O5RA 4QZVB 4JFIA 1FKDA 2XP9A 4ODPA 2F21A 4MNMA 2RUQA 4DH0A 1ZBWA 3WD4A 4DRPA 4DWSD 4R5EA 3RM9A 1IX5A 4DT4A 1E6PA 1HJVA 2VN1A 3O5MA 3PRAA 5HW8A 4ODLA 4LAXA 3FXYA 3ALGA 3B9DA 2WK2A 3PRBA 4FAPA 1NWSA 2L2SA 3CH9A 1E6RA 3ARVA 3KCEA 4Z2IA 1UR9A 2ZQUA 3VAWA 1D7JA 1JNEA 1LL7A 4TW6A 2PV2A 2VCDA 1FKSA 1JNSA 4HARA 2ESCA 1RD6A 4IPXA 3RM4A 3O5FA 1OGGA 4MGVA 1KT1A 4G2PA 3CZ8A 1FKJA 5DIUA 3KAGA 3CHEA 4LAYA 3B9AA 4KQZA 2MLZA 5HKGA 2QF8A 1EQ3A 2A3BA 1EHNA 1O6IA 2WM0A 2MLYA 1ZB5A 2YBTA 2XP3A 1W1VA 2PPOA 1PINA 4AY1A 4WIWA 4MPKA 4DRJA 2XP4A 1FFRA 1FKFA 1W26A 4ODKA 2O92A 1FD9A 1H0IA 1NSGA 3O5KA 3PA7A 1X6LA 1NMVA 4P8UA 1J4IA 4LAVA 2ZR4A 2XPAA 1FKKA 3WIJA 2DG4A 2F2DA 2XPBA 4WKFA 3ARRA 4ODOA 3CGNA 2MLXA 1YW5A 3O5DA 3TCZA 4MSPA 1ZBKA 4DIPA 2DT0A 4P8VA 3KZ7A 2PV3A 3LUOA 5J6EA 5B8IC 4ML4A 5GQBA 5HT1A 4DRMA 1W9UA 2M1IA 5HWBA 4Q22A 3ARPA 1D7IA 4U85A 1NH6A 3BXWA 4JFMA 5GPRA 4DZ2A 5HUAA 3CHDA 4J4OA 2JZVA 3OA5A 3UQIA 1OGBA 3CHFA 1EYMA 4GIVA 3KACA 3O5IA 1LJYA 4ODMA 2RUCA 1ROUA 1R9HA 3WL0A 3IHZA 4DRNA 2RSEA 3ARXA 3JXVA 3ODKA 1JNTA 3IK8A 4S3JA 3KAIA 1FKTA 1VF8A 4HBOA 2XP6A 4IT4A 1NMWA 3UI4A 3G6MA 2RURA 1Q6HA 1LQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TYO A;  3GPK A;  4MGV A;  3TDB A;  1KT1 A;  1J4R A;  1QPL A;  3IKD A;  5I98 A;  1D7H A;  5DIV A;  4C02 B;  4G2P A;  3KAH A;  4R0X A;  1FKJ A;  3JYJ A;  3KAG A;  3O5F A;  2F4E A;  4QT2 A;  2PBC A;  5DIU A;  3NTP A;  4JYS A;  3FAP A;  2ZR6 A;  4LAY A;  1ZK6 A;  2MLZ A;  2Y78 A;  2RQS A;  3O5O A;  3O5G A;  4TX0 A;  5HKG A;  1EQ3 A;  3IKG A;  2LPV A;  3I6C A;  4J4N A;  2PPN A;  3RFW A;  2MLY A;  2MF9 A;  2KE0 A;  2XP3 A;  5GPG A;  2PPO A;  1PIN A;  3B7X A;  2OFN A;  1FKB A;  1FKL A;  1Q1C A;  2UZ5 A;  2K8I A;  4W9Q A;  5BXJ A;  4IQC A;  5HW6 A;  1Y0O A;  4DRJ A;  2XP4 A;  3TC5 A;  1FKF A;  2Q5A A;  1W26 A;  4W9P A;  1T11 A;  2PV1 A;  4FN2 A;  1TCO C;  3CGM A;  4ODK A;  1FD9 A;  1NSG A;  3O5J A;  3O5K A;  3PA7 A;  1C9H A;  1NMV A;  4TNS A;  5DIT A;  3RGC A;  2D9F A;  2KGJ A;  3O5E A;  1J4I A;  1KT0 A;  3KAD A;  2DG9 A;  2XPA A;  2ZR4 A;  1FKI A;  3NI6 A;  3JYM A;  4JFJ A;  4LAV A;  1FKK A;  2MPH A;  4DZ3 A;  2PPP A;  1L1P A;  2KO7 A;  5HTG A;  2DG4 A;  2FKE A;  1U79 A;  3OOB A;  4G50 A;  2AWG A;  2F2D A;  4TW7 A;  2IF4 A;  1YAT A;  2LKN A;  1A7X A;  2XPB A;  5HWC A;  2ITK A;  1FJD A;  3EY6 A;  3UI6 A;  3O5P A;  1P5Q A;  2KR7 A;  2MNT A;  4BF8 A;  4ODO A;  1BKF A;  2LJ4 A;  3CGN A;  2MLX A;  2DG3 A;  3MDY B;  1YW5 A;  3O5D A;  3TCZ A;  4DRQ A;  4DRK A;  1FKH A;  5HW7 A;  4MSP A;  2N87 A;  2XP7 A;  3O5Q A;  4IQ2 A;  4DIP A;  2ZR5 A;  3O5R A;  3KZ7 A;  3UQB A;  2PV3 A;  3LUO A;  1F8A B;  2LGO A;  2ZQT A;  4U86 A;  3O5L A;  5J6E A;  5B8I C;  4JFI A;  1FKD A;  2XP9 A;  1ROT A;  4ODP A;  2F21 A;  4GGQ A;  5HT1 A;  1Q6I A;  2RUQ A;  2KI3 A;  4DH0 A;  4DRP A;  3WH0 A;  2M1I A;  4LAW A;  4NNR A;  4DRM A;  5HWB A;  2FAP A;  1D7I A;  1PBK A;  4U84 A;  4U85 A;  1BL4 A;  4DT4 A;  4DRI A;  3UF8 A;  4JFM A;  4DZ2 A;  5HUA A;  2VN1 A;  3O5M A;  4J4O A;  4ODQ A;  2JZV A;  4LAX A;  2XP5 A;  4ODL A;  4W9O A;  3UQI A;  5HW8 A;  4QIB A;  1B6C A;  3PRB A;  4FAP A;  1F40 A;  3KAB A;  1EYM A;  2KFW A;  3KAC A;  1QPF A;  4GIV A;  2M08 A;  3UQA A;  3O5I A;  3PRD A;  4ODM A;  2RUC A;  2L2S A;  2ZQV A;  3NRK A;  1ROU A;  1R9H A;  2ZQS A;  3KAF A;  3KCE A;  3IHZ A;  4DRN A;  4DRO A;  4ODR A;  2RSE A;  4O2T A;  4ODN A;  1JVW A;  2ZQU A;  3JXV A;  1JNT A;  2M2A A;  3IK8 A;  3ODK A;  3VAW A;  1D7J A;  3KAI A;  4DRH A;  4TW6 A;  1Q6U A;  1HXV A;  1J4H A;  1FKT A;  2PV2 A;  2VCD A;  1D6O A;  1J6Y A;  4N19 A;  4JFL A;  1FAP A;  5D75 A;  1FKS A;  1N1A A;  4ITZ A;  2XP6 A;  1NMW A;  1FKR A;  4JFK A;  2RUD A;  1FKG A;  1JNS A;  1ZCN A;  4QT3 A;  3UI4 A;  2RUR A;  4IPX A;  2XP8 A;  4TW8 A;  3UI5 A;  1Q6H A;  1QZ2 A;  1M5Y A;  3H9R B; 
#chains in the Genus database with same CATH topology
 3GPK A;  1QPL A;  3IKD A;  2DT3 A;  1D7H A;  4Z2G A;  1JCH B;  5HBF A;  3JYJ A;  1LG1 A;  1ITX A;  2Y78 A;  4TX0 A;  3O5G A;  5DEZ A;  3I6C A;  3RFW A;  2MF9 A;  2A3E A;  2KE0 A;  1EIB A;  5DF0 A;  1W1P A;  1FKL A;  1SR0 A;  2K8I A;  2Q5A A;  1T11 A;  4Q7N A;  2PV1 A;  4FN2 A;  3AS3 A;  4Z2H A;  3O5J A;  3ARY A;  4NSB A;  3ARU A;  3UI5 A;  1KT0 A;  1W9V A;  3KAD A;  3ARQ A;  1XRV A;  4TW7 A;  4LGX A;  2B31 A;  3B8S A;  4ZPW R;  1FJD A;  1WB0 A;  1UR8 A;  3O5P A;  1P5Q A;  4Z2L A;  4ZPT R;  3MDY B;  1ZL1 A;  2DG3 A;  1NWR A;  4Z2K A;  1E6Z A;  2N87 A;  3WL1 A;  4IQ2 A;  4W5U A;  3CHC A;  1F8A B;  2LGO A;  3FY1 A;  1ZBC A;  4DWS A;  4GGQ A;  1Q6I A;  3RM8 A;  2KI3 A;  3WH0 A;  1LL4 A;  1HKK A;  3AS2 A;  4NNR A;  2DSW A;  2YBU A;  2FAP A;  4S3K A;  1BL4 A;  4DRI A;  3ARZ A;  3WD3 A;  4ODQ A;  2XP5 A;  4W9O A;  1B6C A;  2DT1 A;  1JND A;  1OWQ A;  2KFW A;  4P8W A;  1QPF A;  2M08 A;  3PRD A;  3RME A;  4WKH A;  3WQV A;  1EDQ A;  1HJX A;  3WD0 A;  1ZU8 A;  1HXV A;  4MNJ A;  2DSZ A;  1J4H A;  1J6Y A;  1D6O A;  4N19 A;  1FAP A;  3WD1 A;  3QOK A;  2A3C A;  2RUD A;  1FKG A;  4TW8 A;  1HKM A;  4ZPV R;  4TYO A;  3ARS A;  5DIV A;  4C02 B;  3KAH A;  1W1T A;  4QT2 A;  2F4E A;  3NTP A;  1WNO A;  3EIP A;  3FAP A;  2ZR6 A;  4NZC A;  3ARW A;  3IKG A;  2AOS A;  4J4N A;  1H0G A;  5GPG A;  2DSU A;  1KFW A;  1FKB A;  1Q1C A;  4W9Q A;  1GUV A;  3B9E A;  1E15 A;  1E44 A;  1CTN A;  1K9T A;  4TNS A;  2KGJ A;  3O5E A;  3NI6 A;  2DPE A;  1FKI A;  2MPH A;  2DT2 A;  2PPP A;  3WD2 A;  3OOB A;  4G50 A;  1U79 A;  4PTM A;  2AWG A;  4P8X A;  4Z2J A;  2IF4 A;  5HWC A;  2LKN A;  1A7X A;  1D2K A;  2ITK A;  1GOI A;  3EY6 A;  3AS1 A;  3ARO A;  1HKJ A;  2KR7 A;  4WKA A;  3ART A;  2MNT A;  1LG2 A;  1BKF A;  2LJ4 A;  4DRQ A;  1FKH A;  1X6N A;  2WLZ A;  4MTV A;  2XP7 A;  3O5Q A;  1HKI A;  2G41 A;  3UQB A;  4HBE A;  5DO2 A;  1FFQ A;  2ZQT A;  4U86 A;  3O5L A;  1NWU A;  1ROT A;  1W1Y A;  4MNL A;  1NWT A;  4LAW A;  4URI A;  1PBK A;  3AS0 A;  4U84 A;  3AQU A;  1E9L A;  2G8Z A;  2PI6 A;  3UF8 A;  1E6N A;  4DWS C;  4QIB A;  4WJX A;  2FDM A;  1F40 A;  3KAB A;  2OLH A;  1SYT A;  3UQA A;  3G6L A;  3W4R A;  4MAV A;  2ZQV A;  3WQW A;  3NRK A;  2ZQS A;  3KAF A;  4DRO A;  4ODR A;  4O2T A;  4ODN A;  1JVW A;  4DWS B;  2M2A A;  4L72 B;  4DRH A;  1Q6U A;  2DSV A;  4JFL A;  5D75 A;  1N1A A;  4ITZ A;  1FKR A;  4JFK A;  1ZCN A;  4QT3 A;  1ZBV A;  2XP8 A;  1QZ2 A;  1M5Y A;  3H9R B;  2IUZ A;  3TDB A;  4KR0 B;  5I98 A;  1J4R A;  2O9O A;  1WAW A;  4R0X A;  4MNK A;  2PBC A;  4UDM A;  4JYS A;  1ZK6 A;  3O5O A;  2RQS A;  2LPV A;  4WK9 A;  2PPN A;  3B7X A;  2OFN A;  2UZ5 A;  5BXJ A;  4IQC A;  5HW6 A;  1HJW A;  1Y0O A;  3TC5 A;  3PR9 A;  4W9P A;  5JH8 A;  1GRJ A;  1TCO C;  3CGM A;  1C9H A;  5DIT A;  3RGC A;  2D9F A;  2DG9 A;  4JFJ A;  3JYM A;  3WKZ A;  1XHG A;  4DZ3 A;  1LL6 A;  1L1P A;  2KO7 A;  5HTG A;  4L3N A;  2FKE A;  4ZS6 A;  3ALF A;  2A3A A;  4XAK A;  1YAT A;  2WLY A;  2PN0 A;  1GPF A;  3UI6 A;  1W9P A;  4BF8 A;  3GU0 A;  4IT6 A;  5HW7 A;  4DRK A;  3BMB A;  1TFV A;  2ZR5 A;  3O5R A;  4QZV B;  4JFI A;  1FKD A;  2XP9 A;  4ODP A;  2F21 A;  4MNM A;  2RUQ A;  4DH0 A;  1ZBW A;  3WD4 A;  4DRP A;  4DWS D;  4R5E A;  3RM9 A;  1IX5 A;  4DT4 A;  1E6P A;  1HJV A;  2VN1 A;  3O5M A;  3PRA A;  5HW8 A;  4ODL A;  4LAX A;  3FXY A;  3ALG A;  3B9D A;  2WK2 A;  3PRB A;  4FAP A;  1NWS A;  2L2S A;  3CH9 A;  1E6R A;  3ARV A;  3KCE A;  4Z2I A;  1UR9 A;  2ZQU A;  3VAW A;  1D7J A;  1JNE A;  1LL7 A;  4TW6 A;  2PV2 A;  2VCD A;  1FKS A;  1JNS A;  4HAR A;  2ESC A;  1RD6 A;  4IPX A;  3RM4 A;  3O5F A;  1OGG A;  4MGV A;  1KT1 A;  4G2P A;  3CZ8 A;  1FKJ A;  5DIU A;  3KAG A;  3CHE A;  4LAY A;  3B9A A;  4KQZ A;  2MLZ A;  5HKG A;  2QF8 A;  1EQ3 A;  2A3B A;  1EHN A;  1O6I A;  2WM0 A;  2MLY A;  1ZB5 A;  2YBT A;  2XP3 A;  1W1V A;  2PPO A;  1PIN A;  4AY1 A;  4WIW A;  4MPK A;  4DRJ A;  2XP4 A;  1FFR A;  1FKF A;  1W26 A;  4ODK A;  2O92 A;  1FD9 A;  1H0I A;  1NSG A;  3O5K A;  3PA7 A;  1X6L A;  2B5U B;  1NMV A;  4P8U A;  1J4I A;  4LAV A;  2ZR4 A;  2XPA A;  1FKK A;  3WIJ A;  2DG4 A;  2F2D A;  2XPB A;  4WKF A;  3ARR A;  4ODO A;  3CGN A;  2MLX A;  1YW5 A;  3O5D A;  3TCZ A;  4MSP A;  1ZBK A;  4DIP A;  2DT0 A;  4P8V A;  3KZ7 A;  2PV3 A;  3LUO A;  5J6E A;  5B8I C;  4ML4 A;  5GQB A;  5HT1 A;  2F23 A;  4DRM A;  1W9U A;  2M1I A;  5HWB A;  4Q22 A;  3ARP A;  1D7I A;  4U85 A;  1NH6 A;  3BXW A;  4JFM A;  5GPR A;  4DZ2 A;  5HUA A;  3CHD A;  4J4O A;  2JZV A;  3OA5 A;  3UQI A;  1OGB A;  3CHF A;  1EYM A;  4GIV A;  3KAC A;  3O5I A;  1LJY A;  4ODM A;  2RUC A;  2EUL A;  1ROU A;  1R9H A;  3WL0 A;  3IHZ A;  4DRN A;  2RSE A;  3ARX A;  3JXV A;  3ODK A;  1JNT A;  3IK8 A;  4S3J A;  3KAI A;  1FKT A;  1VF8 A;  4HBO A;  2XP6 A;  4IT4 A;  1NMW A;  2ETN A;  3GTY X;  3UI4 A;  2P4V A;  2RUR A;  3G6M A;  1Q6H A;  1LQ0 A; 
#chains in the Genus database with same CATH homology
 3GPK A;  1QPL A;  3IKD A;  2DT3 A;  1D7H A;  4Z2G A;  5HBF A;  3JYJ A;  1LG1 A;  1ITX A;  2Y78 A;  4TX0 A;  3O5G A;  5DEZ A;  3I6C A;  3RFW A;  2MF9 A;  2A3E A;  2KE0 A;  1EIB A;  5DF0 A;  1W1P A;  1FKL A;  1SR0 A;  2K8I A;  2Q5A A;  1T11 A;  4Q7N A;  2PV1 A;  4FN2 A;  3AS3 A;  4Z2H A;  3O5J A;  3ARY A;  4NSB A;  3ARU A;  3UI5 A;  1KT0 A;  1W9V A;  3KAD A;  3ARQ A;  1XRV A;  4TW7 A;  4LGX A;  2B31 A;  3B8S A;  4ZPW R;  1FJD A;  1WB0 A;  1UR8 A;  3O5P A;  1P5Q A;  4Z2L A;  4ZPT R;  3MDY B;  1ZL1 A;  2DG3 A;  1NWR A;  4Z2K A;  1E6Z A;  2N87 A;  3WL1 A;  4IQ2 A;  4W5U A;  3CHC A;  1F8A B;  2LGO A;  3FY1 A;  1ZBC A;  4DWS A;  4GGQ A;  1Q6I A;  3RM8 A;  2KI3 A;  3WH0 A;  1LL4 A;  1HKK A;  3AS2 A;  4NNR A;  2DSW A;  2YBU A;  2FAP A;  4S3K A;  1BL4 A;  4DRI A;  3ARZ A;  3WD3 A;  4ODQ A;  2XP5 A;  4W9O A;  1B6C A;  2DT1 A;  1JND A;  1OWQ A;  2KFW A;  4P8W A;  1QPF A;  2M08 A;  3PRD A;  3RME A;  4WKH A;  3WQV A;  1EDQ A;  1HJX A;  3WD0 A;  1ZU8 A;  1HXV A;  4MNJ A;  2DSZ A;  1J4H A;  1J6Y A;  1D6O A;  4N19 A;  1FAP A;  3WD1 A;  3QOK A;  2A3C A;  2RUD A;  1FKG A;  4TW8 A;  1HKM A;  4ZPV R;  4TYO A;  3ARS A;  5DIV A;  4C02 B;  3KAH A;  1W1T A;  4QT2 A;  2F4E A;  3NTP A;  1WNO A;  3FAP A;  4NZC A;  2ZR6 A;  3ARW A;  3IKG A;  2AOS A;  4J4N A;  1H0G A;  5GPG A;  2DSU A;  1KFW A;  1FKB A;  1Q1C A;  4W9Q A;  1GUV A;  3B9E A;  1E15 A;  1CTN A;  1K9T A;  4TNS A;  2KGJ A;  3O5E A;  3NI6 A;  2DPE A;  1FKI A;  2MPH A;  2DT2 A;  2PPP A;  3WD2 A;  3OOB A;  4G50 A;  1U79 A;  4PTM A;  2AWG A;  4P8X A;  4Z2J A;  2IF4 A;  5HWC A;  2LKN A;  1A7X A;  1D2K A;  2ITK A;  1GOI A;  3EY6 A;  3AS1 A;  3ARO A;  1HKJ A;  2KR7 A;  4WKA A;  3ART A;  2MNT A;  1LG2 A;  1BKF A;  2LJ4 A;  4DRQ A;  1FKH A;  1X6N A;  2WLZ A;  4MTV A;  2XP7 A;  3O5Q A;  1HKI A;  2G41 A;  3UQB A;  4HBE A;  5DO2 A;  1FFQ A;  2ZQT A;  4U86 A;  3O5L A;  1NWU A;  1ROT A;  1W1Y A;  4MNL A;  1NWT A;  4LAW A;  4URI A;  1PBK A;  3AS0 A;  4U84 A;  3AQU A;  1E9L A;  2G8Z A;  2PI6 A;  3UF8 A;  1E6N A;  4DWS C;  4QIB A;  4WJX A;  2FDM A;  1F40 A;  3KAB A;  2OLH A;  1SYT A;  3UQA A;  3G6L A;  3W4R A;  4MAV A;  2ZQV A;  3WQW A;  3NRK A;  2ZQS A;  3KAF A;  4DRO A;  4ODR A;  4O2T A;  4ODN A;  1JVW A;  4DWS B;  2M2A A;  4L72 B;  4DRH A;  1Q6U A;  2DSV A;  4JFL A;  5D75 A;  1N1A A;  4ITZ A;  1FKR A;  4JFK A;  1ZCN A;  4QT3 A;  1ZBV A;  2XP8 A;  1QZ2 A;  1M5Y A;  3H9R B;  2IUZ A;  3TDB A;  4KR0 B;  5I98 A;  1J4R A;  2O9O A;  1WAW A;  4R0X A;  4MNK A;  2PBC A;  4JYS A;  1ZK6 A;  3O5O A;  2RQS A;  2LPV A;  4WK9 A;  2PPN A;  3B7X A;  2OFN A;  2UZ5 A;  5BXJ A;  4IQC A;  5HW6 A;  1HJW A;  1Y0O A;  3TC5 A;  3PR9 A;  4W9P A;  5JH8 A;  1TCO C;  3CGM A;  1C9H A;  5DIT A;  3RGC A;  2D9F A;  2DG9 A;  4JFJ A;  3JYM A;  3WKZ A;  1XHG A;  4DZ3 A;  1LL6 A;  1L1P A;  2KO7 A;  5HTG A;  4L3N A;  2FKE A;  4ZS6 A;  3ALF A;  2A3A A;  4XAK A;  1YAT A;  2WLY A;  1GPF A;  3UI6 A;  1W9P A;  4BF8 A;  4IT6 A;  5HW7 A;  4DRK A;  1TFV A;  2ZR5 A;  3O5R A;  4QZV B;  4JFI A;  1FKD A;  2XP9 A;  4ODP A;  2F21 A;  4MNM A;  2RUQ A;  4DH0 A;  1ZBW A;  3WD4 A;  4DRP A;  4DWS D;  4R5E A;  3RM9 A;  1IX5 A;  4DT4 A;  1E6P A;  1HJV A;  2VN1 A;  3O5M A;  3PRA A;  5HW8 A;  4ODL A;  4LAX A;  3FXY A;  3ALG A;  3B9D A;  2WK2 A;  3PRB A;  4FAP A;  1NWS A;  2L2S A;  3CH9 A;  1E6R A;  3ARV A;  3KCE A;  4Z2I A;  1UR9 A;  2ZQU A;  3VAW A;  1D7J A;  1JNE A;  1LL7 A;  4TW6 A;  2PV2 A;  2VCD A;  1FKS A;  1JNS A;  4HAR A;  2ESC A;  1RD6 A;  4IPX A;  3RM4 A;  3O5F A;  1OGG A;  4MGV A;  1KT1 A;  4G2P A;  3CZ8 A;  1FKJ A;  5DIU A;  3KAG A;  3CHE A;  4LAY A;  3B9A A;  4KQZ A;  2MLZ A;  5HKG A;  2QF8 A;  1EQ3 A;  2A3B A;  1EHN A;  1O6I A;  2WM0 A;  2MLY A;  1ZB5 A;  2YBT A;  2XP3 A;  1W1V A;  2PPO A;  1PIN A;  4AY1 A;  4WIW A;  4MPK A;  4DRJ A;  2XP4 A;  1FFR A;  1FKF A;  1W26 A;  4ODK A;  2O92 A;  1FD9 A;  1H0I A;  1NSG A;  3O5K A;  3PA7 A;  1X6L A;  1NMV A;  4P8U A;  1J4I A;  4LAV A;  2ZR4 A;  2XPA A;  1FKK A;  3WIJ A;  2DG4 A;  2F2D A;  2XPB A;  4WKF A;  3ARR A;  4ODO A;  3CGN A;  2MLX A;  1YW5 A;  3O5D A;  3TCZ A;  4MSP A;  1ZBK A;  4DIP A;  2DT0 A;  4P8V A;  3KZ7 A;  2PV3 A;  3LUO A;  5J6E A;  5B8I C;  4ML4 A;  5GQB A;  5HT1 A;  4DRM A;  1W9U A;  2M1I A;  5HWB A;  4Q22 A;  3ARP A;  1D7I A;  4U85 A;  1NH6 A;  3BXW A;  4JFM A;  5GPR A;  4DZ2 A;  5HUA A;  3CHD A;  4J4O A;  2JZV A;  3OA5 A;  3UQI A;  1OGB A;  3CHF A;  1EYM A;  4GIV A;  3KAC A;  3O5I A;  1LJY A;  4ODM A;  2RUC A;  1ROU A;  1R9H A;  3WL0 A;  3IHZ A;  4DRN A;  2RSE A;  3ARX A;  3JXV A;  3ODK A;  1JNT A;  3IK8 A;  4S3J A;  3KAI A;  1FKT A;  1VF8 A;  4HBO A;  2XP6 A;  4IT4 A;  1NMW A;  3UI4 A;  3G6M A;  2RUR A;  1Q6H A;  1LQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...