4WK9A

Crystal structure of human chitotriosidase-1 catalytic domain in complex with chitobiose (0.3mm) at 1.10 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
369
structure length
368
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTENDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chitotriosidase-1
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM.
pubmed doi rcsb
source organism Homo sapiens
total genus 132
structure length 368
sequence length 369
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wk9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wk9A01
4E2OA 3PZUA 1UR9A 1RPKA 5CG0A 5A6BA 2JF6A 2BHUA 4QLLA 5E6YA 1W3HA 2JIEA 3U7BA 3VINA 1GJWA 4QDMA 1V02E 4AXNA 1U2YA 1TG7A 4Z2HA 4OOZA 1EDGA 1MQQA 1QHZA 1V08A 3VDHA 4PCTA 3W26A 3WEMA 1JNEA 3UR7A 4GQRA 3VNYA 4CU6A 1MYRA 4U5IA 5HBFA 1LWJA 3O6AA 4TVUA 4UFJA 2IXUA 2A3BA 3CHCA 3KL5A 2VOTA 1HXJA 2G3IA 4YHEA 2WMGA 4WIWA 1V3KA 1D2KA 5HPOA 4W7UA 5I78A 1BYBA 4BQ2A 4JL1A 5D8WA 4M1RA 2WSKA 2NSXA 4C7FA 3NSNA 1EH9A 4H8HA 4ATWA 2V3DA 3WD0A 4HPGA 1NH6A 4CGTA 1Q6EA 2UY4A 4F8XA 3WQWA 3U7VA 2W62A 1EQCA 1WB0A 4UZUA 1PJ9A 4W5UA 2DGAA 1WZLA 3S2CA 3PBGA 5I0DA 3W24A 4FF5A 8A3HA 3ZJ6A 1GJUA 2VURA 2XFYA 2YDQA 4B9ZA 4PMYA 1MVYA 1HJXA 1W9BM 5DT5A 4DM2A 1K6AA 1UHVA 3W82A 1GUVA 1JFXA 1FOBA 1QHPA 1E4LA 4OBSA 1UD6A 4UFIA 3ARWA 3RM4A 4EK7A 2OWCA 3GNRA 1BYAA 2ZXBA 4IPNB 3J7HA 1KXHA 2MANA 5FKYA 1NOUA 3VGGA 1KBKA 1UKPA 2BFGA 4B3LA 1W9DM 2W5FA 2WVSA 3HN3A 3GDBA 4IM4A 1V6VA 2D0GA 1UA7A 2NT1A 1XH2A 1E4IA 5ABHA 2VI0A 2VX6A 4HMCA 4AD5A 5I24A 4GPNA 4PBGA 3BLKA 5CPTA 2ZX8A 2Z1SA 3PZIA 2BHYA 3VIPA 5GPRA 4TTUA 1QBBA 3BAKA 1KXVA 1W1PA 1JGIA 4BZYA 3BMVA 4WSJA 1UQYA 1J0ZA 2J7FA 3VD4A 1UWIA 2FGZA 2UY3A 1AQ0A 1JZ3A 2WLZA 1UKOA 2YLAA 2BS9A 2Y4SA 3GH7A 2G3NA 1HVXA 2WKGA 3WDHA 1LJYA 2C7FA 2CHOA 4D72A 2J4GA 1CLXA 1GOMA 5A8PA 3WMBA 1E0VA 1O7AA 3RPMA 3WD3A 1C8XA 1VENA 3L2LA 3O2LA 1C3FA 3U5UA 2BVTA 4JCMA 1B9ZA 4B9YA 3SCVA 3VDBA 2E9LA 1VFMA 4QCFA 2WLYA 2WXDM 1ESWA 4MJ2A 5ECUA 1EOKA 3BCDA 2J7BA 1NARA 3MU7A 3W6MA 4Z2GA 1C8QA 1ZB5A 4QLJA 1JAEA 3ARXA 1E56A 2PBGA 1ISZA 9CGTA 1FA2A 5DT7A 1G5AA 1V0KA 1QNOA 2XIBA 4CD6A 1ITCA 2D0FA 2F61A 3WQ8A 1XSKA 3VGBA 3L4TA 4U2YA 4CN1A 3BH4A 3W37A 2VJXA 3AXIA 1WCGA 1OWQA 1JXKA 1TFVA 3WL1A 2CKSA 4ZE4A 1MXDA 4D6EA 1LL6A 1LQ0A 3CH9A 4XX6A 3OLEA 1CNVA 2OYMA 3FNDA 4IISA 1B3XA 2VRJA 4W84A 3WQ4A 2YBUA 3JUGA 2ZUVA 2FH6A 1ZBKA 3W25A 5ABGA 3QHNA 5CXPA 1IT0A 3MV11 4HU8A 2V38A 1CWYA 1ZU8A 1XHGA 1B90A 2BVYA 3WH5A 3VIKA 2E9BA 1BVZA 4JAWA 4Z2KA 3K46A 4QAWA 4AZ7A 2WW5A 2FH8A 3T08A 2DDXA 1V6XA 1QI2A 3LPPA 2FHFA 3ZR5A 1DWJM 5GNYA 2GDVA 2QLYA 5TD4A 3CPUA 1GOQA 2D20A 1V3MA 2ZUNA 3LPOA 3AMCA 4NI3A 4PSPA 1JYXA 2GJPA 1EXPA 3OGRA 5M03A 3B8SA 4NZCA 1CGWA 3IANA 4XZWA 3SIMA 2FHBA 3EMZA 1TVPA 3TTQA 3EDKA 4R27A 4WSKA 1KCKA 1N82A 1H41A 4PCSA 1B2YA 1NWUA 4ZENA 3AS3A 2BXZA 2JF7A 3IAPA 1R87A 4B3KA 3HMCA 3WNNA 2EXOA 5C71A 4P8UA 2W66A 1GHSA 1BHGA 1CIUA 1M7XA 3AIRA 1EHAA 1JFHA 2BXYA 4AIEA 4PMRA 2Z1KA 3RDKA 5A2BA 4CCCA 3ARPA 4X0VA 4UQEA 1GQIA 1JYVA 1JI2A 4UR9A 4J3TA 2IUZA 2J75A 4WK9A 3WQVA 3NYDA 3VVGA 2WCSA 2UY2A 4AISA 3MMWA 3T0AA 4HMEA 2A3EA 4CD7A 1I75A 1E6SM 4RE3A 1OT1A 2F8QA 3AROA 1I1XA 2VQTA 1Z32X 1HJVA 1E3XA 3EBVA 5IDIA 1E5NA 3AHYA 1X1NA 3W81A 2WK2A 3WDJA 1NQ6A 2VC9A 4LYPA 5E70A 3QR3A 2WC3A 4JFSA 3AIUA 4U33A 1UOKA 2OLHA 4UQAA 5DO8A 2JFEX 2V5DA 2GDUA 2Y8VA 1FFRA 1C90A 4PUEA 3SCOA 2EBNA 5BROA 2GVYA 5DMYA 1KR0A 1OINA 2PBOA 4M81A 4PTMA 5CLTA 1G1YA 3VIOA 5CPQA 3RO8A 4DUWA 1US2A 1NWRA 1GNXA 3W27A 5KEZA 2VX7A 2CNCA 5E0FA 2GJRA 4GZJA 1ISVA 2YL8A 3WIJA 4TUFA 2XVNA 2X0YA 5I77A 4WKFA 3T0DA 3CZ8A 5I79A 3A4AA 1JDDA 1CDGA 1J12A 1H3GA 4AD3A 4LGXA 4MB3A 1DWFM 2WC7A 4MJ4A 3DYOA 5IHRA 2HISA 1EDQA 4W7WA 2Y5EA 1JIBA 3F4VA 1VB9A 1J0JA 1VJSA 1B3YA 2RGMA 1UR0A 1JNDA 4KRTA 4H41A 3ZSTA 2EPOA 4KWUA 5EBAA 2WMFA 1FP8A 1US3A 2BY2A 3OZPA 2EPMX 3CUGA 5BWFA 2WMHA 2J74A 3VGHA 1OBAA 1KQYA 1WP6A 1DTUA 4GI6A 3CZJA 5I6SA 4TTGA 1BTCA 4U2ZA 2DIJA 5D4YA 2D0HA 4ATDA 1B3ZA 2QPUA 2V3GA 4K68A 3HJEA 2WHLA 2UY5A 1OD0A 1BG9A 1VEOA 3VD9A 4DUVA 2XUCA 1HP4A 2E8YA 4ACZB 1E4NA 3N15A 1VF8A 1HT6A 1DP0A 3TA9A 2W61A 3WFLA 4Q22A 1E6ZA 5IXEA 1XH0A 1U30A 1OIFA 3WKZA 3ZJKA 3N18A 1KGUA 4TVDA 2YBTA 1ZL1A 2CCRA 4R5EA 1R86A 2PWEA 1JAKA 4HTYA 1XSIA 4A3HA 4CD8A 2J47A 4C7GA 1CXEA 1JF6A 5A6LA 1BYCA 5A1AA 5CJ5A 2AOSA 1SFSA 4BQ4A 3CZGA 3WNPA 4MADA 1NOFA 1CGYA 1A3HA 1W32A 1QI5A 3AYRA 1DHKA 3WQ6A 3AI0A 5AC5A 1H0IA 2YL9A 1UWQA 4UNIA 3THDA 2YIHA 1ECEA 2OWXA 2E40A 3L4UA 1W1TA 5CGTA 2E9MA 3VMNA 1SMAA 3MO4A 4UQCA 5CSYA 1BFNA 3M46A 5HOSA 3IJ9A 3VD7A 1ODZA 1WO2A 3OGVA 2W92A 4CKQA 1UWUA 5HXMA 1OSEA 1R8LA 2JEPA 1VEMA 3VPLA 2D3NA 1HJUA 1OGSA 5C8BB 1ISWA 4W7VA 2C0HA 1CXIA 1E55A 2ZUTA 3AMLA 1TUXA 1XYFA 1M01A 3KWXA 3WBAA 3FW6A 3WSUA 3VU2A 2CKRA 4P8XA 3AS2A 2BVDA 2FHCA 4LX4A 3AISA 3BXWA 5D9NA 3L4WA 3WNKA 4HZ8A 3SEPA 4TX8A 4D6IA 4CN6A 2XM2A 5A6JA 3T2QA 1HKIA 4NRRA 2WVUA 3WDIA 3GXFA 2YKKA 1W9VA 2YA2A 3OZOA 1JYNA 1MQPA 3AICA 1OD8A 1E6XM 1UG6A 4D1IA 3M7SA 4LQ1A 4EE9A 5DFAA 1E0XA 7A3HA 4GKLA 1K9TA 5JBFA 5A6KA 1GONA 2ZUWA 2QMKA 3LPFA 4H8UA 4J27A 3WMSA 4MDPA 3CLWA 4L4OA 1KXTA 4MB5A 4U3CA 4F9JA 2WNWA 3SCUA 2F2HA 1DWHM 3D3AA 3O9NA 2E4TA 1GZJA 1M04A 3B9AA 4CUCA 5GNZA 2YJQA 4HMDA 3SCRA 2DH3A 5LYRA 1MFUA 2XJ7A 2EPNA 5I23A 3VIIA 1UZ1A 1CGXA 1QBAA 1ISXA 3ALFA 1E1FA 1GOWA 3T0BA 4D6GA 1GVIA 1NP0A 3GNPA 4YHGA 3MMUA 1QI3A 2OWWA 1WDRA 1W9PA 3W6LA 4F9DA 3PZMA 4HU0A 5C70A 4UZSA 2XYLA 1QHOA 3BSHA 1RH9A 4OJYA 3VGEA 1MW1A 4W8BA 1W9XA 2VUYA 3VM7A 3M6DA 1K9FA 3L2MA 1TCMA 1ISYA 4S3JA 2DSWA 3ZJ7A 1MW3A 3W38A 4D6DA 4DWSB 2XIIA 4AWEA 1UR1A 3WELA 2WVVB 1VAHA 4GQQA 1EO5A 4X0NA 3UR8A 3OLDA 3PHAA 3CUFA 3VNZA 4JFVA 4P8VA 1GCYA 1E1EA 3QHOA 1VFOA 3NIYA 3CMGA 1F4HA 1ZBWA 3PN8A 2WC4A 3AIQA 7CGTA 2XVLA 5FD0A 1WDQA 5I3DA 2J8GA 3GZAA 1E73M 3BAYA 7TAAA 1GPFA 4M24A 3D5HA 4NF7A 4CCEA 1XCWA 2EPLX 1LG1A 1TA3B 1UKTA 2WVVA 3DHUA 3RILA 1DWIM 3AXXA 4J3WA 1V3HA 4TVCA 2CXGA 2VMFA 2DQXA 3B9DA 5A6SA 5FL0A 3VD3A 2CEQA 1UKQA 2ZIDA 1Q4NX 4GIAA 2EJ1A 3L4XA 3L4ZA 4JIEA 4L4PA 4HPHA 1NP2A 1JXJA 3EDFA 1QW8A 2PC8A 4P7OA 4D6FA 3WH7A 4D1JA 3WH8A 2G41A 3CHDA 1W1VA 3RCNA 1UR4A 3WDQA 4CVWA 2XFRA 3APGA 3EMCA 2VQUA 3AZTA 1ZJBA 2VZOA 1W3LA 1EDTA 3DHPA 4F79A 2DPEA 2OSWA 3ZJ8A 1YHTA 1PAMA 3WNOA 4JHOA 2PWHA 1TA3A 2CBUA 1C93A 2XVKA 4M56A 1JL8A 3DC0A 4M82A 1HKKA 1KCLA 1KB3A 4JHZA 3UG5A 2XGIA 1UD8A 3WUBA 1CZ1A 2XFFA 2CBVA 1VRXA 1K9DA 2XWEA 4W86A 2DT1A 4P7NA 4HZ6A 2TAAA 2Y2WA 3W53A 5BRQA 3WUGA 4PMVA 4Z2LA 1G94A 4CCDA 4ZEPA 2W67A 1XGZA 3GTNA 1HL9A 3E1F1 2QV4A 3A47A 3AMKA 1CPUA 3WF0A 2VCAA 3ALGA 3AMGA 2BNJA 1CGUA 4UFHA 2G8ZA 3OLIA 4KMQA 2OYLA 2YA1A 1AVAA 1QVBA 4DWSC 5GQBA 2E0PA 2JIWA 3WUEA 3EDJA 3ARVA 3TTYA 1KWGA 2X05A 4J3XA 1CXKA 3PZGA 1E0WA 5HPCA 2YL6A 1KR1A 4JKKA 5E0CA 3TTOA 1JDCA 1QPKA 2PI6A 4DM1A 2X09A 1V0NA 4MNMA 1L8NA 1M53A 1Q6FA 3WY1A 4DWSD 3NDYA 2CHNA 1WDPA 5CGMA 3MUZ1 3SCPA 2C8NA 2ZXQA 3VDAA 1PZ3A 2DIEA 2VCCA 3U5YA 4AZHA 4S3KA 3SURA 4RE4A 3ECQA 1SR0A 3WD1A 5KZ6A 1CLVA 3G6LA 1OB0A 3BLPX 2DT0A 1SYTA 3IAQA 8CGTA 1C92A 2CERA 1PIFA 4AZ5A 4W8AA 2G3JA 5AYIA 3N12A 5FOOA 2O9OA 2ZWZA 4UCFA 4WKHA 4W93A 1UWTA 3GXMA 3ARUA 1V0LA 2J7EA 1UA3A 1HL8A 2V3EA 2XSAA 3VX0A 3W4RA 4J3SA 3WH6A 5A2AA 1E71M 1HP5A 1CXFA 1E6QM 5CZKA 3VMPA 2ZXDA 1V6YA 2RGLA 3B9EA 1QI4A 3MUAA 4KGLA 2ESCA 3ZR6A 3QOKA 2PWGA 3CHFA 4Y7EA 3MUY1 4HA3A 3VIFA 1HJSA 1CGVA 1AQMA 4W8LA 4P7LA 1G01A 1XH1A 4GO9A 2J7GA 1WNOA 1LWHA 2XVPA 4PTWA 2V5CA 2VR5A 3NSMA 4IPLA 1E6NA 2CPUA 3CUIA 5FCZA 3T2PA 3RJYA 5D9MA 4MTVA 5AYBA 4IUGA 4A4AA 1UH4A 4HP5A 4CU8A 2XHYA 1EGZA 2PB1A 3GH5A 2VZTA 3MKKA 1TE1A 4E8CA 1XCXA 1WZMA 3OB8A 1HVQA 2E8ZA 3II1A 2J62A 2WHMA 2V3FA 4D6HA 3BMWA 3IJ7A 3NSXA 2WYSA 3I3EA 1P6WA 2X8RA 2CIPA 3FN9A 4PEEA 1V0MA 1CECA 4KRUA 1HJWA 3GBDA 3CHEA 4EANA 4B15A 3QHMA 1V6WA 4BA0A 2WKLA 4JFWA 4AZ6A 3VGFA 1H4PA 2D3LA 2VRKA 4J7RA 4PMUA 4FK9A 1EQPA 3AS1A 3VX1A 5A8OA 3RIKA 2HVMA 3FHAA 3MV01 4ZE5A 4AD4A 3AHZA 3GM8A 4W88A 1KFWA 3ARQA 2XM1A 4EKJA 3WUFA 4C7DA 1HKJA 1AQHA 1B1YA 2BHZA 5F7UA 1BVNP 1JZ6A 1VFFA 3DECA 4JZ5A 4M8UA 1E15A 5FIPA 1S46A 1EHNA 4FMVA 5EFFA 2JE8A 3N1AA 3PZOA 1JZ7A 3U57A 2J78A 3PZTA 1H2JA 2WAGA 3RJXA 2VRQA 2EO7A 5M17A 1OGGA 1V3JA 4PMZA 3L4VA 2GJXB 4FLSA 4MNJA 3GNOA 2O9PA 2VNCA 4GI9A 4GXPA 3IK2A 2D22A 1MFVA 2J79A 3TP4A 3K4AA 1OM0A 4PYSA 5A6AA 5D9PA 1UKSA 4JKLA 3W29A 1H11A 1GORA 3ZMRA 3WMCA 4MAVA 4OKDA 4LXFA 3BCFA 4P8WA 2OSYA 1KXQA 2ZE0A 4BF7A 4CD5A 3K8KA 3L4YA 2O9TA 2WHJA 3OG2A 4GI8A 5A95A 1QNSA 3VGDA 1E3ZA 4HOWA 2ZX9A 2PWFA 1R7OA 1GOKA 3M07A 5BYWA 2ZUUA 2EPKX 4XUYA 4BS0A 1C91A 2EEXA 2NW0A 2JEQA 3NDZA 5A8NA 2DH2A 1JF5A 4JFTA 3SCWA 2DT3A 2GJXA 3VOCA 3MSGA 2FDMA 3FAXA 1B31A 3OBAA 4TOQA 1WPCA 1GQKA 1CEOA 4ZFMA 4ACZA 4YPJA 1FH7A 4KH2A 1J10A 4LYQA 5EMYA 4J3VA 3ARTA 4ZXLA 3ZT5A 3BAWA 1PBGA 4M80A 1H1NA 4V28A 1V03A 3SCNA 4AD1A 3I3DA 1LL7A 2ZX7A 3BSGA 4JFUA 2WBGA 3PZQA 4AZIA 1K9EA 1E43A 2J8FA 1J0YA 1V6UA 1PZ2A 1GVYA 2VZVA 3ZT7A 1RP9A 3SCQA 3ZM8A 2FGLA 1CYGA 1FP9A 1PIGA 5AY7A 5LA2A 3WF1A 3AIBA 4MNKA 1RP8A 2VT0A 4PMDA 1MQRA 1J18A 4UOJA 4MPKA 3CZEA 3UEQA 2W4XA 1YQ2A 1J0KA 3CIVA 4E8DA 3VIMA 1KGWA 3AS0A 4XZBA 1CXLA 2X0HA 1B0IA 1ODUA 2CESA 2DT2A 1R85A 4LYRA 1UR2A 1LG2A 3UESA 2XWDA 1UWSA 3ZIZA 4URIA 1MW0A 4EAMA 2CBJA 1J0IA 5LA1A 3N17A 3ZO9A 2B31A 2WZIA 3WNLA 4U5KA 4QLKA 3CZLA 1BYDA 1GQJA 2PWDA 3EYPA 1UH3A 3ARYA 4CN4A 2WPGA 3KZSA 1JZ2A 4H2CA 1QNPA 3ARZA 1ZBVA 4F66A 2DSKA 6TAAA 1ZJAA 3WD4A 2YA0A 4FLQA 3CGTA 1FH9A 1IZJA 3PTMA 2VR4A 2VZSA 3TONA 1D3CA 1JYWA 4WLCA 4JCLA 2D24A 1H0GA 1CXHA 4W89A 1UWRA 3OLGA 2Y24A 5A69A 2X1IA 3MMDA 2W91A 2D2OA 1CENA 3BAXA 4OUEA 2WB5A 3VTRA 3KE0A 1A47A 1BF2A 2WANA 3KL0A 1XRVA 1UQZA 3GH4A 3VO0A 1DWAM 1UD2A 2GSJA 3N11A 4HZ7A 1W1YA 2WSPA 5CLWA 3CUJA 2OSXA 4UQDA 3TTSA 4UFMA 4X9YA 2Q8XA 5GNXA 4N42A 2J7CA 1TZ7A 2XGBA 5I2UA 1UH2A 4PMXA 1XYZA 3A6OA 1E6RA 3AIEA 3G6MA 3CUHA 4D6CA 1HKMA 2GUYA 3SUTA 1UZ4A 4H7VA 3T2OA 1U33A 3AHVA 1GOOA 4J3UA 1W3KA 5M3WA 5CSUA 3ZSSA 4Q7NA 3N13A 5LA0A 1JZ8A 2ZUSA 1ZBCA 1PX8A 2D23A 4PTVA 3UG4A 2JALA 4GZIA 3CTTA 4V2XA 2WZHA 4A3YA 5EB8A 3CO4A 3UERA 3VUPA 5BXTA 4YN5A 3A4XA 1JDAA 4W5ZA 1NM9A 2CBIA 3K8MA 2VVNA 4W87A 1LLOA 5A6BD 1BLIA 3F5LA 1W3JA 1B30A 2EQDA 2J25A 4XV0A 2OYKA 3F5JA 3TOPA 4AZGA 3RMEA 3AZSA 3OGSA 3GXIA 1XD1A 4AZCB 1WE5A 4CD4A 4AD2A 4DWSA 4XB3A 1BSIA 1JZ4A 5HDRA 2QPSA 2IXVA 2E3ZA 2VTFA 2YDSA 5A94A 3GXDA 3AHTA 3VD5A 5JBDA 1LL4A 1E40A 1MWOA 1HN1A 2AAAA 1OIMA 3AJ7A 4UTFA 3UG3A 3QGVA 3KL3A 1FH8A 5A8MA 3WEZA 4ML4A 2YL5A 3PZNA 4W85A 4TX6A 4AZBA 2W63A 1UD5A 1XD0A 1NWTA 3WH9A 4BQ5A 4OOUA 2CITA 3NCOA 3SCSA 4CU7A 2YDRA 4P7QA 3WN6A 4AZCA 5E9AA 3FY1A 2DSZA 2WBKA 2BV9A 4PN2A 4HOXA 3WNMA 4N0RA 4WJXA 5I5RA 1TVNA 4RL3A 1E4MM 2A3AA 5ABFB 3WENA 1FFQA 3AIVA 1WKYA 2XVGA 1WZAA 3CZKA 4QCEA 4NSBA 5IHSA 2GK1B 3THCA 2ZX6A 5A2CA 4WF7A 5E6ZA 3F5KA 3POCA 2VCBA 2BY0A 3ARRA 2BY1A 6A3HA 3GBEA 3VDCA 1UUQA 3SCTA 1CTNA 5DEZA 1KWKA 4M29A 3N04A 3AFBA 1CBGA 3W0KA 5BXRA 5JH8A 4HOZA 5JIWA 3SUSA 4DUXA 3BGAA 3N9KA 2VX5A 5A8QA 2YLLA 3QOMA 1VJZA 1D7FA 1QNRA 3FAWA 2WWCA 5ABFA 5JUVA 2ZUMA 2WCGA 3LMYA 3WD2A 3MS8A 2A3CA 3AYSA 4UFLA 2GK1A 1O6IA 1VEPA 2J7HA 3WBEA 2XSBA 1GHRA 3UETA 2QMJA 4PTXA 3WDRA 2O92A 4MB4A 2O9RA 3NUKA 1TR1A 1KBBA 1V02A 3AXHA 5HNNA 4JL2A 2VX4A 3PTQA 3MUIA 1E72M 3VIJA 3AHXA 1RD6A 1DWGM 5BRPA 2GFTA 4GZEA 1VBRA 4PMNA 1BPLB 3WF3A 3AZRA 4AMCA 2ZWYA 4QFUA 3WFZA 1G0CA 4D6JA 1V3LA 4OIFA 3VKKA 3EMQA 2WM0A 1PX3A 3WL0A 2ZOXA 5FL1A 1EOMA 3W28A 1FHDA 2Y8KA 4BCEA 4NRSA 1X6NA 1I1WA 3PZVA 1C8YA 1OCQA 3OA5A 1QOXA 3WEOA 4MDOA 5DF0A 4H8VA 4AIOA 2ZICA 5M5DA 4AC1X 2XG9A 1BGGA 2YOCA 3S6TA 1J9YA 3VILA 4QP0A 1B3WA 3I3BA 1HF6A 4OZOA 3OIHA 1NOWA 4AEFA 4AIUA 3BAJA 5IFTA 4UOQA 1J0HA 2DSVA 4E4PA 4WKAA 1L0PA 1EA9C 2ZX5A 1C7SA 1E5JA 5A3HA 3UCQA 3T09A 5EFDA 2UWFA 2J77A 4PMQA 2ZXAA 1VIWA 2WHKA 3KEHA 1PPIA 4OBRA 5JBEA 1GOIA 1SMDA 3PTKA 4UQBA 4AY1A 1HJQA 2WZEA 4Z2IA 2G4FA 1Q6CA 2PF0A 2X2YA 4U31A 3VIHA 2J7DA 4UFKA 1KGXA 1B3VA 1G9HA 4PMOA 2DEPA 3ZT6A 1UD3A 1VBUA 4GINA 2QHAA 4FLOA 1TMQA 3EDEA 1JI1A 1DEDA 4J28A 1JG9A 4MB1A 4ATLA 1UR8A 1QI0A 6CGTA 1QW9A 1AMYA 2VO5A 5CPSA 4FLRA 2A3HA 4MNLA 1NWSA 2VZUA 1E9LA 1OT2A 3BAIA 1ITXA 1H09A 5ABEA 5A6MA 5AC4A 4BQ3A 2WMJA 3K4DA 1HNYA 5BXSA 3RM8A 1FHLA 1W91A 3POHA 4ZXOA 4D71A 1KQZA 4AD0A 4TXEA 3A4WA 1LF1A 4JKMA 1PEZA 4V27A 5IFPA 3FHQA 1J11A 3A3HA 2QF8A 1R7AA 4CVUA 3K8LA 1JD9A 3BC9A 4LPCA 1EO7A 3HU7A 2WWDA 3RM9A 2G3MA 3IJ8A 1JZ5A 1MXGA 4UQ9A 4AYSA 1HX0A 3K1DA 3SUVA 1VFUA 4ACYA 1EIBA 4GO8A 4Z2JA 3VM5A 1W2VA 3AIWA 5JIPA 2WMKA 3WF4A 3DYPA 1UYQA 4HA4A 3CBWA 1M03A 2XPKA 3WQ5A 4HA1A 3AQUA 1CGTA 1OGBA 1BGAA 4AEEA 1ZS2A 1BQCA 3ZQ9A 1WZKA 1XSJA 5D8ZA 3FXYA 5D9OA 1J01A 1HIZA 3LPGA 3VIGA 4MAZA 1IV8A 2D1ZA 1H49A 2WCAA 1WDSA 1E70M 3MANA 4KGJA 5BXPA 4B16A 2NT0A 1UD4A 3GYCA 5E09A 1W2PA 1MW2A 2XTKA 3DYMA 1Y7VA 5CQ1A 3AMDA 1E6PA 2WMIB 1F4AA 1BAGA 2VL4A 1PX4A 1WAWA 2BY3A 3NJ3A 3PZ9A 2CYGA 1X6LA 3AOFA 1BG4A 1C7TA 2CETA 4PSRA 3WF2A 3CMJA 3MSDA 3EDDA 1Q6DA 1XC6A 1JD7A 4P7RA 1IZKA 2WVTA 3SUWA 2DSUA 1GQLA 4H04A 4PRWA 3VMOA 3WDPP 2VVSA 4RE2A 1GW1A 3ZOAA 4U3AA 4PUDA 2WMIA 1W9UA 4AW7A 3ARSA 1V3IA 2AMGA 5BCAA 1H5VA 1Q6GA 3SUUA 4UOZA 1QNQA 1XV8A
chains in the Genus database with same CATH superfamily
1ZY9A 4LUSA 3QYQA 5A6BA 1FUYA 4DRQA 3KABA 3UI6A 2BHUA 3A3XA 3MKCA 5B8IC 4ZB2A 2JIEA 3VINA 4QDMA 1V02E 4OOZA 5HTGA 5D2VA 1JEZA 1V08A 4GXMA 5G2HA 4PCTA 4JR5A 4GQRA 5REQB 3VNYA 3VOIA 4CU6A 1XDMA 3MP4A 1LWJA 2IXUA 3P74A 4DJFD 4XZMX 4Y9NA 2V2HA 2EJAA 2ZZ3A 4ICMA 3SBFA 4BQ2A 2IQ0A 3A4JA 1FCVA 4LWWA 2F84A 3KOFA 2V3DA 1WBJA 1JPHA 3TAOA 2QUNA 2ZQUA 1WXYA 2A85A 3WLJA 1SZGA 1EQCA 2QW5A 3QRHA 1JRCA 2PTXA 3W24A 3ZJ6A 1RPXA 4FEZA 4N9CA 3MZ2A 1W9BM 5DT5A 1GOXA 1AZ1A 3KBMA 4NZJA 2TPSA 3IJQA 3KADA 1JUEA 4FNRA 4F0LA 5LXEA 1JFXA 4PULA 1RJRA 4LVDA 2ZTKA 3J7HA 4IFOA 3PRBA 1A4MA 3EY6A 1UKPA 3DEQA 5I3JA 1S2VA 3GTIA 1KKRA 1EF3A 2W5FA 3HN3A 3GDBA 2Y63A 1XH2A 4I3GA 4HMCA 2FVMA 2QKFA 3G24A 3BLKA 2YYUA 2ZX8A 1S2TA 2BHYA 5ECVA 3VIPA 4TTUA 2Z0IA 1W1PA 3BMVA 3H9RB 4UTMA 4TMBA 3TN4A 2PDWA 1QR7A 3PK7A 2ZRZA 5C55A 2YB4A 2ZFAA 4PGLA 2YLAA 1L2QA 1EFZA 3U9IA 5K4ZA 1Y65A 2WKGA 2JBMA 1LJYA 4D72A 4DZIA 2J4GA 5CKSA 2FPVA 1E0VA 2YPIA 3BL3A 1FD9A 3L2LA 1KD0A 3O2LA 1C3FA 3NM3A 6PTDA 1HL2A 2R1LA 7TIMA 2WLYA 1W3NA 1ESWA 3CH0A 4MJ2A 3BCDA 4G56A 5LHFA 3W6MA 4Z2GA 1X96A 4I8YA 3P5YA 1Z7AA 5LIWX 4WDUA 1FA2A 1R2TA 2XIBA 3LHYA 5PTDA 4O1DA 3GUGA 1XSKA 4EPEC 1A0EA 5FJPA 5DELA 2R14A 2B7NA 4CN1A 4EWND 2G0WA 1TPB1 1ZCCA 2VJXA 3AXIA 3QH2A 3N2OA 2YXXA 2Q01A 1TFVA 4E4UA 3W75A 4MKNA 4ZE4A 2QAPA 3FLUA 4BWLC 4BY3A 3UZJA 3FNDA 3LBMA 1B3XA 2VRJA 4W84A 4ADTA 3JUGA 4X22A 3LY0A 2VFDA 3IKGA 3P8IA 3W1PA 3PTDA 3B0VC 2RDUA 1WA3A 3FKRA 5CXPA 4DPQA 3SRFA 4QG8A 1W5NA 3C2VA 5L6UA 1U5HA 2V38A 1CWYA 1ZU8A 3WH5A 4ZBCA 1KT1A 3I68A 4OU1A 3DUGA 2ZDRA 1HGYA 1T99A 3K46A 2C13A 5EMKA 1XQKA 2DDXA 1V6XA 3M0ZA 2FIQA 3AALA 1Y5VA 5CBBA 1DWJM 3UY8A 3QMSA 3D3FA 1RBAA 3LNMA 4ICCX 1NY1A 2VELA 3LB0A 2GJPA 2A4AA 1EXPA 2B7OA 2BOEX 2A21A 3G8EA 4NZCA 2NUWA 3EMZA 3QBUA 4K1GA 5HK4A 3NXFA 3TQ0A 1PCWA 1VYSX 4ERIA 1H41A 4AIBA 2JGYA 4PCSA 1J2WA 4S2BA 3H54A 1B2YA 3AS3A 1SJDA 2IF4A 5BOOA 4IQJA 1P5QA 3UPMA 3WNNA 1MSSA 2EXOA 4P8UA 2WZTA 3O5GA 1G4SA 1CIUA 3GIQA 1JFHA 3RDKA 4CCCA 1EZ2A 4DF0A 1O12A 3NM1A 4NL1A 4Q7IA 3C2YA 4NHVA 1JYVA 1OABA 1OG0A 4J3TA 1POJA 3H55A 2J75A 1ZFJA 4AISA 3C0SA 3T0AA 3KRUA 1I75A 1E6SM 3PR9A 4RE3A 1OADA 4HT3A 1OT1A 2F8QA 4AU0A 3AROA 3G1SA 3GNNA 1DQXA 1P5BA 1IWBA 1Z32X 3KP1A 1HJVA 3EBVA 5IDIA 1XG4A 3A5FA 5AZ0A 1X1NA 4KQZA 3K5XA 3EKLA 4BK9A 2W27A 7ODCA 1MRAA 4ZOBA 1TWDA 2VC9A 3I7QA 4FXFA 5LGZA 4A8RA 4ZL1A 1UOKA 1R47A 2ACUA 4UQAA 2JFEX 1T11A 4G6CA 4L6DA 4AX6A 1C90A 2AGTA 3BLIA 1BWLA 2GOKA 4AHQA 5BROA 2GVYA 5DMYA 3M0MA 3KBVA 4PTMA 3BQ5A 4LAKA 4DBEA 4XZIA 1NWRA 1LBFA 1P0NA 3INPA 4K38A 4IIEA 4KRZA 2ZZ6A 4GH1A 4DRJA 2XVNA 2RDWA 3T0DA 3CZ8A 3VNJA 3H26A 4F2BA 2ISSA 2OB3A 1R3SA 1H1ZA 3I6CA 2OQHA 2WC7A 1J79A 3MVIA 1NU5A 3KTCA 3BK0A 3W7CA 2G96A 3S1UA 1UR0A 4UTTA 3O5LA 2ALRA 2QUTA 3BLDA 4GUJA 3OZPA 2EPMX 4H8NA 3RITA 4ES4A 5BWFA 5HW6A 2J74A 4MMWA 3CASA 3ZXWA 3UJSA 2W3ZA 1DTUA 3FA5A 3UWEA 4YIWA 3DFSA 1KM6A 1AZ2A 4NAEB 4DJFA 3W1RA 1BG9A 4AVOA 3VD9A 1AODA 5FJJA 5B7ZA 3B3DA 3RMJA 4UMAA 4Z17A 1E4NA 3N15A 3A13A 4KQNA 4M0XA 1W31A 3B9NA 4GVFA 3FK4A 4ZQRA 1XI3A 2HJPA 2W61A 3PPCA 4Q22A 5FA5A 1E6ZA 3CAKA 3WFLA 2PD9A 3DOPA 3QLLA 5C9RA 5IXEA 1OIFA 3C2EA 3C2RA 4Q8WA 3N18A 1KGUA 5G2IA 3S42A 3STFA 3P61A 4HTYA 1FKJA 2OG9A 3GZ3A 3QW4B 2PTDA 1WKEA 4R7WA 5CJ5A 3NXLA 3CS2A 3PB0A 1NOFA 3G0XA 2E1WA 3MC5A 1H61A 1W32A 4PE8A 3WQ6A 3IRDA 2YL9A 2PDKA 4IPJA 1UWQA 2CZFA 3BLFA 3THDA 3GS6A 4YJ5A 4Q4KA 3TXVA 5CGTA 4JTKA 3CWNA 1SMAA 2PSNA 1Q1CA 1BFNA 1M7JA 4JXCA 4X61A 3FJ6A 3VD7A 1WO2A 3FOKA 3TN5A 3W1MA 1DE5A 1OGSA 3CYJA 1BKFA 3NPUA 3DH7A 1JCHB 4XQ6A 5C8BB 3N2CA 3OEXA 4J5NA 1YDYA 1TUXA 3WQOA 3IV8A 3U0HA 3VU2A 2EPHA 3GIPA 1GEHA 4P8XA 4F0MA 3AISA 2ISFA 1GJPA 1OFEA 3PUEA 4TX8A 2E6YA 4D6IA 3GVWA 3CAQA 2VGFA 3RX2A 3C8FA 4C6FA 1X98A 2WVUA 2YA2A 1JYNA 1LWIA 3BO9A 1CCWB 3SN4A 5G4HC 4DEFA 4EE9A 1TPH1 1E0XA 2ACRA 4XZ9A 7A3HA 2P53A 1GONA 2ZUWA 1A4LA 2QMKA 4A2SA 3LPFA 4GQBA 4H8UA 3WMSA 3SR7A 3OIXA 2MLXA 2WSRA 4L4OA 3NL2A 2WNWA 3SCUA 3D3AA 3TN6A 2QT3A 1WXZA 4X3ZA 4I7VA 2D69A 2EPNA 3VCRA 4GYPA 5I23A 3ICJA 2KX9A 1GVRA 3BLOA 4IWWA 2DV0A 4MZ1A 3STCA 2PV3A 3CO8A 3ANYA 2O7SA 1L9WA 1N8WA 3T0BA 2XDFA 4YTTA 2CLEA 1NP0A 3TJXA 4YHGA 2OWWA 1FWEC 1ZJIA 1WDRA 3O0FA 4HB7A 3CT7A 4HU0A 5C70A 2A3LA 3BSHA 5C0QA 2NQ5A 2V9DA 4OJYA 1LQAA 4IP4A 1ADOA 4H00A 2VUYA 3VM7A 1JDEA 1K9FA 1XLKA 1TCMA 1ISYA 3GXTA 3BWWA 3TW7A 1FHVA 1DJIA 1I2NA 3W1QA 3H22A 3P14A 1UR1A 2WVVB 4XZNX 3C86A 4C91A 3QHOA 2HBVA 1NJJA 3WLTA 3AIQA 2VDGA 5FD0A 4JQ4A 2ZE3A 4PUJA 1WDQA 5I3DA 3G5EA 1TZ9A 2CU0A 2HDJA 4Y8FA 2FJUB 5CC6A 4Q8TA 3EKZA 1P7TA 2ON3A 3W1LA 3Q67A 7TAAA 2VC7A 1TYGA 4DBUA 2Z6JA 1A3XA 3G3MA 4CCEA 4MWAA 3G1AA 4MSPA 1LG1A 4XVDA 4C02B 1UKTA 5CPMA 1DWIM 1MRQA 3AXXA 4IT6A 3BOXA 4R85A 3GDRA 1U83A 3H8AA 2BB0A 2CEQA 1UKQA 3U48A 4L4PA 2O4QA 3URAA 5D04C 1NP2A 4C65A 1QW8A 4N9BA 4O28A 4P7OA 5T9CE 4IL0A 1RK6A 3EOLA 1S2AA 4PUKA 3R4IA 1ZP4A 5HQLA 3APGA 1L2UA 3EMCA 3MYPA 3FEQA 1ZJBA 3DHPA 4F79A 3ZJ8A 2GQ3A 2PWHA 3M0KA 4ZQCA 3DCPA 4TQTA 3DC0A 3GRIA 3W2NA 1UBPC 3UG5A 2ZC8A 2FB2A 2ISWA 1CZ1A 2CBVA 1RR2A 2BVWA 4GG9A 3C0LA 4PMJA 4W86A 5BW6A 4P7NA 4WSHA 1FKKA 4U10A 5AVNA 3I6EA 1GEQA 2Y2WA 3W53A 1QPOA 3KVKA 3WUGA 1SW7A 4ZEPA 4IFKB 3QN3A 3IV3A 1PWLA 2OEMA 1CPUA 2VCAA 4S3BA 2BNJA 5TIMA 1VIZA 2WQDA 1CGUA 2E7FA 3O6DA 4I90A 4IHCA 3OU8A 2AL2B 4JTAA 1GG0A 2YA1A 3WCZA 5RUBA 1QT1A 2YW3A 1TR9A 3TTYA 3UZWA 2FGBA 2X05A 3HURA 1CXKA 1HG3A 1DBTA 2YL6A 3NTPA 5H1WA 5H91A 2OGYA 3TTOA 1YPFA 2PI6A 3FVDA 1ROTA 1M53A 1Q6FA 3WY1A 2J6VA 4AQLA 4ZS6A 2OLAA 3MUZ1 5FF3A 2QF7A 3LSBA 4AZHA 4S3KA 3ECQA 3V1PA 1DE6A 3UT0A 4L6HA 1Z48A 2DT0A 4KWSA 1C92A 2PDQA 3N12A 3IIZA 4J35A 2O9OA 3EX3A 3GXMA 2PDJA 3IUIA 4C6KA 3ARUA 5K9CA 4FA3A 2QJIA 5IBXA 2DVTA 4J3SA 3WH6A 1S1PA 1F7BA 3LOTA 3VMPA 3MZNA 2Y5JA 2ZXDA 5DMMA 1V6YA 4TW7A 4PB4A 3CC1A 4I7WA 4JICA 3V0TA 4AHPA 4W9QA 3Q58A 5AHMA 3ZR6A 3MUXA 4Y7EA 3H70A 3VIFA 1HJSA 2H9AB 3E38A 3WLSA 3TFCA 3LDVA 3CB3A 1MEHA 2V5CA 5EMUA 4TW8A 2NV2A 2PTYA 3CUIA 1KM3A 3T2PA 2PN0A 3W1AA 2XN0A 2UZ5A 5BMXA 4RLIA 4A4AA 1UH4A 3SDOA 4HP5A 2XN1A 2VZTA 1DJGA 1LDCA 1TE1A 2DUZA 4E8CA 3FJNA 2J13A 5E93A 3U2OA 3TYAA 3GG7A 4D6HA 5I03A 3BMWA 3NSXA 3EPNA 2WYSA 2CIPA 1ML1A 4LF2A 1X1ZA 3W7RA 1CECA 3PANA 3CIWA 3GBDA 4NNBA 1FBAA 4B15A 2L5HA 4BA0A 2WKLA 2D3LA 4J7RA 2HE5A 4PMUA 5C7VA 4FK9A 3RIKA 2HVMA 3MV01 2VEKA 1YTKA 4ZE5A 3BANA 3GM8A 3PY2A 1WUFA 2XM1A 4EKJA 2WKJA 2BHZA 2YGYA 1O94A 3FXGA 5FIPA 3N1AA 3PZOA 1N8IA 3VKCA 3U57A 1WDDA 2YR1A 1H2JA 4YMZA 2PDCA 1K03A 4OECA 2HBXA 4G2PA 4PMZA 3L4VA 3VKDA 4C6NA 3N6HA 1IGWA 2BGNE 1HQTA 3RG6A 4N6FA 4LRTA 1MFVA 2J79A 3BLLA 3C52A 4PYSA 3HIJA 1OFQA 1UKSA 4G2DA 1BXNA 2VM8A 2E5CA 1XICA 1TJRA 4PFHA 4OKDA 4H9XA 1JR1A 3SRDA 4P8WA 1KXQA 2HEJA 3K8KA 2XP6A 3L4YA 3OVGA 1T6MA 1OFDA 4GI8A 1QNSA 5G2WA 1EEXA 4JX4A 2F6UA 3F4DA 1SR9A 1FXPA 1GOKA 4TYOA 3M07A 3R0UA 2ZUUA 1FWNA 2EPKX 1A5UA 2G3FA 2H6RA 1C91A 1FCUA 4I5XA 4RK8A 2DT3A 3GKAA 3MSGA 3RX4A 1OFAA 1B31A 3HPSA 4TOQA 1DIEA 2PPPA 1CEOA 1JDFA 4LSBA 2RJGA 4ZFMA 2TMDA 3TC7A 3S9YA 1FH7A 3I4KA 1J10A 5U7SA 1JCNA 3TR9A 4LYQA 4PCFA 2XP5A 4J3VA 3QY6A 4XTIA 3QLDA 1YBQA 3ZT5A 1NQKA 2NX3A 5DRCA 1PBGA 4M80A 1ONEA 1V03A 3SCNA 3ITOA 2YW4A 1LL7A 4JFUA 4BEUA 1M41A 1VR6A 5LNRA 4HCHA 1OX4A 4C6EA 1US0A 4PRTA 1GVYA 1L6FA 1O1ZA 1ZPTA 2NV1A 2FFCA 3HG5A 1YTDA 2C14A 4LNYA 1CYGA 1FP9A 1PIGA 3LHTA 4QNEA 2ISVA 5DCDA 4TU1A 3MCNA 4XIAA 2GWGA 3CIVA 3MSRA 2PCQA 1XUZA 2IMRA 5SWUA 5EU9A 1B4KA 1ITUA 1ZTVA 3NPVA 2YFNA 1ODUA 2CESA 3UCDA 5DMLA 3UESA 4E38A 1F5ZA 3GVQA 2WZIA 1F73A 2NZLA 4G7EB 1R9ZA 4UXDA 2VGGA 3W83A 3LN3A 3ARYA 4CN4A 3RU8X 1W5QA 4F66A 2RSEA 9XIAA 4O0QA 3T42A 2PP1A 3WH0A 1XYLA 4HA0A 1FWWA 1D3CA 2F21A 3CGMA 3Q2DA 3TMLA 3PJTA 4JCLA 2C19A 4FNPA 1ICPA 4M6PA 2Y24A 3DC8A 5FF0A 1XBXA 1T40A 2PD5A 4F2UA 4JTFA 1W54A 3KWSA 4LYKA 4YLWA 1BF2A 3MO7A 4JPGA 1EJRC 1UD2A 1EB3A 2HNHA 1W8GA 3LHVA 1S5NA 4HZ7A 1P0EA 2WSPA 3CUJA 4HVXA 1IIHA 2OSXA 2DZPA 4IH3A 4U4MA 5GNXA 2QCEA 5I2UA 1UH2A 1REQA 3AIEA 3G6MA 4D6CA 2Q71A 1Z44A 1ONRA 2QIIA 4A8NA 3BVJA 3T2OA 2QDDA 4DLFA 1RLCL 3AHVA 3DBPA 4IXXA 4J3UA 3MCOA 1W3KA 3IVSA 2ZZ4A 1JZ8A 3KZPA 5CZTA 2KGJA 3MJYA 4OQVA 3UG4A 3UERA 3MHGA 3TX9A 3VUPA 2ZRVA 4YN5A 5JH1A 3G8RA 3A4XA 4GK8A 1JDAA 1LLOA 1H7RA 3TKFA 2EQDA 1GQNA 1OFPA 3OVQA 2MNTA 4XV0A 5ENLA 2QCFA 1DL3A 4L61A 1Y5XA 3XINA 1XD1A 5KITA 3EEZA 3FYPA 4RZ5A 1BSIA 3LGEA 1JZ4A 4ZPTR 1GT8A 1J5SA 2E3ZA 2VTFA 4HJFA 2BODX 2HXUA 3VOJA 1BWVA 1ZALA 4UIOA 1MWOA 1QXLA 1L8PA 2I9UA 3LYEA 1F74A 1OIMA 2RKXA 3RF9A 4DZHA 1UIOA 4QNWA 4B5SA 1DQUA 4C6DA 5I00A 5DLCA 3F2CA 4O4WA 3D47A 2Y6ZA 3VZZA 3IWPA 4AZBA 1TIWA 2QGYA 3A23A 4CU7A 1TE6A 3L65A 2DSZA 1W3TA 4PN2A 3LI0A 4GBUA 3TTEA 1I60A 5I5RA 3M6YA 1FWBC 3CYVA 4M6UA 4IJRA 2XVGA 5IHSA 5A2CA 3F5KA 4CNTA 4FX8A 4IMAA 2BY1A 3DGBA 2XIMA 6A3HA 4US5D 3GBEA 4L9ZA 2E1DA 4L1GA 1G69A 1UUQA 4NT0A 3SCTA 4NUWA 1O5XA 5DEZA 3WQPA 4XD5A 3AFBA 7PTDA 1CBGA 5AC8A 1S39A 4JTSA 4WY0A 3LXAA 1NF7A 1XIHA 1A5OC 5A5WA 2RJHA 3SUSA 4DUXA 3BGAA 4BR1A 1TO3A 4JGDA 4L9XA 1RV8A 2BZNA 3OP2A 4ADUA 1YXYA 2ZUMA 2WCGA 3LMYA 3WD2A 4KEUA 3MS8A 3P7YA 4Z0JA 1SO3A 1O6IA 3AO0A 1UZHA 2XSBA 3UETA 2QMJA 1UP2A 1XYMA 3LHUA 1LORA 3O8AA 1JJKA 2O92A 1QPQA 4MB4A 3WMLA 1V02A 4X9SA 4NKCA 4Y6GA 4REQA 4HHHA 5BRPA 2GFTA 4GZEA 1OK6A 4LCRA 4GUFA 3P0XA 3RO6A 4AMCA 3HFTA 2AQWA 1G0CA 3EMQA 1PX3A 1NSJA 2NUYA 3W28A 1FHDA 3B03A 4MHBA 3L0KA 3WZ0E 3GW0A 1OCQA 3GU9A 4O15A 3O1NA 3ITXA 4AIOA 2ZICA 4XD6A 3G1HA 1J9YA 4LW7A 1C9WA 3PPGA 1U1HA 2ZC1A 1HF6A 1FKGA 3H7UA 1NOWA 3RHGA 3H2FA 3BAJA 1TKKA 3GX9A 4WR3A 2BSLA 2Y88A 5GVJA 4GLEA 1XFBA 3T09A 3MWAA 4IMCA 2UWFA 1LCOA 4AWSA 3NDOA 2WHKA 3ERPA 4B5WA 1S38A 4TV6A 5FF7A 1XF0A 5A8GA 5DY3A 3W02A 1L6YA 3TV8A 1GOIA 2PV1A 3SY1A 3PTKA 5HMSA 3UR5A 1O5RA 4ZB5A 1VBJA 3AC0A 4U31A 3VIHA 4MGGA 2XZ7A 2Y61A 3PSWA 3C3NA 2QZRA 3EWBX 4L3NA 3QKZA 1EPXA 4Q8UA 1G9HA 3RPDA 3RU6A 5LGXA 3KDOA 1FHUA 4M19A 3S46A 3U2ZA 1GKQA 4J28A 4JS3A 1JG9A 3NZ1A 3OHMB 1U22A 4MB1A 4ATLA 2ETNA 3EWYA 1QW9A 1LUCB 2VO5A 4E3TA 4ZQNA 2A3HA 1XL9A 1KC7A 1K4HA 4A6GA 1TTJA 5ABEA 1E1CA 1HNYA 3W2UA 1AK5A 1FHLA 4ICNA 4DBWA 3S5NA 1OC5A 4UNLA 1XYCA 3I7SA 4V27A 1IYXA 5IFPA 3A3HA 2QF8A 3GK0A 1R7AA 4XTDA 3TCZA 3G0UA 3BC9A 1FKLA 1FTXA 1KRAC 3PJXA 4O1AA 3EWDA 4LPCA 3SGZA 6REQA 1EP1A 1FWDC 2H8XA 4UQ9A 3K1DA 3SUVA 1VFUA 2OGJA 2DFAA 3G1VA 1DPMA 5BOFA 1SJBA 3VM5A 2Q3OA 1XBVA 5JIPA 1UYQA 5FAJA 2XPKA 4PR4A 2Z7GA 3W7NA 2O56A 3AQUA 2I5GA 2BX7A 1SVDA 1WDWA 1A5NC 4AY8A 5DMNA 1GTEA 1YE4A 4QS5A 3MMTA 1UASA 2ZCGA 1FVPA 4QEEA 1J01A 3W7PA 3LPGA 5LNVA 4MAZA 1XLDA 2FFIA 2WCAA 3LGGA 4MYAA 3MANA 4JYDA 2INFA 3VNMA 1R3WA 2P8BA 4RZ4A 4FI4A 5E09A 1OFRA 1M9HA 1TV2A 1W1A1 3KOYA 1Y7VA 4FAMA 1XIDA 3S2LA 2MUCA 3EEGA 5G1TA 5HULA 1PSCA 1F4AA 3LLXA 1PX4A 5CEWA 3PZ9A 4J4NA 4E2BA 4CNOA 4DJEC 5E1QA 2PZ0A 3SM0A 3AOFA 2FZDA 1A5KC 2J6XA 1M7OA 2C18A 4PSRA 4MLRA 2CZVA 2XH4A 3CMJA 2AMXA 4EX4A 7ENLA 1R3RA 1L1PA 1D7JA 4GJIA 4P7RA 5F2GA 3GFYA 3CQIA 4H9VA 2DG9A 1SO5A 1UUMA 4ZA0A 3SUWA 4E0CA 4MSSA 3UPWA 3QQ1A 3LCIA 4OHQA 5LNSA 1IXNA 1N55A 4PUDA 3C5QA 1VQTA 3D46A 4AF0B 3KCOA 3UWWA 1PKLA 2NXHA 5BCAA 1WBHA 1Q6GA 3TVAA 1A5MC 3K4WA 1QNQA 3CL6A 4B4FA 4HNOA 3PZUA 1HKWA 1PL9A 5CG0A 5D09A 2GSEA 3UR2A 2YXOA 4QLLA 5E6YA 4HNVA 4C6CA 4AXNA 1U2YA 1EDGA 1MQQA 2QJHA 2ZDSA 3UR7A 3R79A 4GYJA 3E0FA 4UFJA 5TF0A 2V8ZA 2JKAA 4I8DA 4DN1A 1MNSA 3NL5A 3ITCA 2G3IA 2WMGA 4WIWA 2D2JA 4JX5A 5HPOA 4GIRA 3H7RA 4RW3A 4TMCA 3ONCA 1EH9A 2VEPA 4JFKA 3UBPC 4G7FA 3VZYA 1VHCA 4MYXA 2IS7A 3WQWA 4UZUA 4MY8A 2DGAA 2GWNA 3JS3A 1P6CA 4FF5A 2EG6A 5HNUA 3SJNA 1GJUA 2XFYA 1HGWA 2J24A 4NI8A 5GJMA 4FNTA 4DM2A 1K6AA 1UHVA 3W82A 1GUVA 4LAZA 2YZRA 1QHPA 3O5IA 4UFIA 2PUZA 4NNCA 5CGQA 4LH8A 2OWCA 1IEVA 3GNRA 1BYAA 2YB1A 2ZXBA 4H4IA 4IPNB 4O1EA 3AXMA 3PUDA 1XIFA 1I2RA 1GVQA 1W9DM 2ACSA 3MKVA 2Z29A 1H50A 1TIMA 1PZ1A 2D0GA 1UA7A 2NT1A 2TRSA 4O14A 1E4IA 5ABHA 1EC8A 1TRIA 3CNYA 4UCGA 3KM8A 5CPTA 3B8UA 3UNDA 4GVHA 5GPRA 1H63A 3BAKA 1KXVA 4BZYA 1JGIA 4XAKA 1J0ZA 2KR7A 3QPZA 1GVSA 3ORWA 3T81A 3RLVA 2WLZA 1YEYA 3GH7A 3GWQA 3B0UX 2G3NA 4DRSA 4GC4A 3NZQA 3WDHA 2FZ9A 1GOMA 5A8PA 3RPMA 3WD3A 3W73A 1AQFA 3CU2A 5HWCA 2DVXA 1X38A 2ZRWA 1L6WA 4S1FA 2E9LA 4GY0A 2C6QA 3GSMA 1TMHA 1HKVA 5A6TC 4JNZA 4IMDA 3AUOA 5ECUA 2VUNA 1NARA 3MU7A 2E67A 1C8QA 3APYA 1JAEA 1IHIA 2PBGA 3W71A 1LOQA 5DITA 4JTGA 1OHLA 5DT7A 1G5AA 3M0LA 2Y7EA 3GKFA 1P4CA 1OJXA 2GZXA 3VGBA 9RUBA 1W5OA 1K77A 5MKGB 3TU9A 3BH4A 3W37A 3TCEA 1W0MA 1W26A 1WCGA 1OWQA 1JXKA 3GTHA 5H2ZA 1PUDA 1OYBA 3CH9A 4R0XA 1NFGA 3NURA 5FF2A 1M5YA 3ME3A 3WQ4A 1UMLA 4AY7A 2X1TA 2DZUA 4O13A 3GR7A 3W1TA 4PZVA 1ZP3A 3JZUA 4HU4A 4BF5A 5ABGA 1ONWA 3VXGA 5I3HA 3HG4A 1B3OA 1ME8A 2VD8A 4ODLA 2OO6A 4Z0SA 3H12A 1EEPA 1EJUC 2VEIA 2AGKA 3RX3A 3SGGA 2HWGA 4JAWA 3UF8A 4QAWA 2FH8A 3GG8A 1YKWA 1VKFA 1ZAIA 1KA9F 5GNYA 2GDVA 4FALA 2D20A 2ZUNA 5E0KA 4PSPA 3LEPA 4DYEA 1MZHA 3LLFA 3ITYA 2C1IA 3B8SA 2D73A 3KBJA 3LXCA 1CGWA 2EG8A 2Q5AA 3UW6A 1EPVA 3S8HA 1UROA 3B06A 4PL1A 3CL7A 3HBLA 5E9XA 1PWMA 3LV6A 5D02A 4GABA 4Z1CA 1OCBA 1NWUA 3TYBA 3U8GA 2BXZA 3V0UA 1UPPA 1FRBA 4JBRA 3UI4A 4IX2A 1DJXA 4J40A 3HMCA 4Q4RA 5C71A 2GGJA 5KTLA 1ICSA 2CLFA 1GHSA 1M7XA 3AIRA 3EWWA 2NV9A 2BXYA 3SQSA 4AIEA 2Z1KA 1XLJA 4X0VA 4ZO9A 3ZLFA 1GQIA 5EKYA 3TLQA 1M1BA 4WK9A 3VYLA 3W7LA 4ODQA 3PS7A 1GK8A 2R82A 2WCSA 3V0SA 1OCNA 1D7KA 1W5PA 1H7NA 2VP8A 1ZZMA 4ENLA 1I1XA 3ZFHA 4LCQA 2VQTA 1KM0A 1E5NA 3LCWA 2B4GA 3MP3A 1GVFA 2VOMA 1IGSA 3A9BA 3CGNA 3M0IA 3MCMA 4O17A 3W81A 5D32A 2FTPA 1XIEA 4CNUA 1NQ6A 1N1AA 1VRDA 1W56A 3OOBA 4JFSA 3W1UA 3NAVA 2CLKA 3QSRA 2OZTA 5CBIA 2V5DA 4CEXC 3DENA 2GVEA 1FFRA 1LM1A 3SCOA 1UP3A 4FO4A 2EBNA 1KR0A 1OINA 3B9OA 2X7WA 4M81A 3SQLA 3MUCA 1K8XA 4DUWA 1T41A 1IZCA 1US2A 5T9BG 1X8CA 2VX7A 8XIMA 3MDWA 1VD6A 2OLSA 3RLGA 2BTMA 4Z1DA 2XP9A 4O0ZA 2PDMA 4N9DA 5I79A 3VI2A 3ABZA 2OOFA 1TV3A 4UTKA 4YS1A 1NIUA 4MJ4A 3DYOA 3QSTA 1A53A 3GFXA 1TQJA 2Y5EA 4MKVA 3F4VA 1VB9A 1SPQA 3KAOA 3HA1A 3IK8A 1B3YA 2RGMA 3LTYA 4DYJA 3W1NA 1O4UA 4RW5A 1L6SA 3WLNA 1PHWA 2EHHA 3EWZA 4D8LA 4Y8EA 1FP8A 1DORA 2BY2A 3R8RA 3PG8A 1S5WA 1EC7A 3CUGA 3VGHA 2HVOA 4KCWA 1KQYA 4ROPA 1WP6A 4GI6A 3OG3A 3P0WA 5I6SA 3UVIA 4JD4A 5D75A 3PVFA 1DJYA 4ATDA 3VOHA 1MO0A 4K68A 4OV9A 3HJEA 2WHLA 3KFTA 1JQXA 1OD0A 2A79A 4TW6A 2GYIA 3QFWA 4KF1A 5GPGA 2XGZA 5U4NA 2XUCA 1HP4A 3EXSA 3WQEA 1DP0A 3TA9A 4FX6M 1NDZA 4K37A 4XKYB 2NLIA 3P82A 1I2PA 1Q2SA 5K9DA 4HGXA 1S2CA 3QFEA 2DZXA 1IXPA 4DZAA 1ZL1A 4IP5A 4R5EA 5AYYA 2PWEA 4NZ3A 2PPNA 1XSIA 3SAZA 4A3HA 2J27A 2J47A 4C7GA 4LUJA 3U3HA 3WBYA 1BYCA 1ZGDA 4NAEA 4HNCA 1SFSA 4BQ4A 3WNPA 1A3HA 3H24A 4QSFA 1H7OA 1QI5A 4H83A 3AI0A 5AC5A 4O4VA 2QJGA 3ITLA 4BF8A 4GGBA 5JU6A 4YU1A 4UTTC 1YRRA 1KLZA 4KCUA 2E40A 3L4UA 1U1UA 1W1TA 1ZAJA 4JFIA 2E9MA 3VMNA 2VD9A 5C9ZA 4JN6A 2YDAA 4Q3MA 5HOSA 4IIBA 3IJ9A 3OBEA 3CM4A 3W72A 1VP5A 4G50A 1OSEA 1TQXA 3HQNA 2JEPA 1VEMA 3VPLA 3UA4A 1Q8AA 3OTRA 1ISWA 2C0HA 3LRMA 1CXIA 2PCEA 3BMXA 3KWXA 3WSUA 1JPIA 2POZA 2CKRA 3AS2A 3TQKA 3BXWA 1ZAHA 4DX3A 4HN8A 3WNKA 2XU2A 1R0MA 1VZWA 4CN6A 3F2BA 4TO8A 3DBNA 3T2QA 3WDIA 1WKFA 1ELSA 1W9VA 4C6JA 2F9RA 3ANVA 3S5ZA 3UQNA 3FJLA 5C54A 3L5LA 1KKOA 5I3IA 1Y8BA 3UQIA 5K4XA 5D05A 3OBKA 5DFAA 2FJKA 4J1OA 3ES7A 3GYEA 3YPIA 3FA4A 5JBFA 5A6KA 4HYWA 3KAHA 4J27A 1V93A 4U85A 2C0AA 4K8GA 3EA3A 4U3CA 1REQB 2F2HA 2WM1A 2B5UB 3XISA 1KTNA 1OX5A 2FDSA 3HPFA 5GNZA 1H60A 3SCRA 2XJ7A 5AECA 1UZ1A 1CGXA 2A6NA 3SSJA 3S1XA 1GOWA 3VFLA 1GVIA 1T0OA 3LTSA 4L64A 3FV9A 1F8IA 1DOSA 3DN5A 3GNPA 3HB9A 4O18A 4B5VA 3DERA 3ITGA 3S47A 3PZMA 4F9DA 2Q8ZA 3HG2A 5FJRA 1LRNA 4JIIX 1RH9A 3OW1A 3B04A 3VGEA 1RA5A 3MHUA 5J5RA 3IGSA 4CQ9A 1SZEA 3N2TA 4FHAA 8XIAA 3MWCA 1MW3A 4KEVA 3HV8A 1EGVA 1PTGA 4JQAA 2XIIA 3C6CA 3RR4A 4GQQA 4X0NA 4DHGA 3PHAA 3VNZA 4GGQA 2E6DA 2YX0A 4O1FA 1S1RA 4P8VA 1GCYA 1GTHA 3H2MA 3CMGA 3PN8A 2XVLA 4LS2A 3K2GA 3BMBA 2ATSA 4PUWA 4C6OA 4ZCWA 3BAYA 5D2WA 4HPJA 4M24A 4MIMA 3IJDA 3W7DA 1Q6QA 1VLWA 4DO5A 2WVVA 4IZGA 1AFSA 1F6PA 3H4WA 3RILA 1Q4WA 4DBSA 4AFYA 3M5XA 1YIXA 2PP3A 1V3HA 2CXGA 3RGTA 3B9DA 4GYPC 4QE4A 4HHLA 3VD3A 1Q4NX 2RURA 4GIAA 2N87A 2EJ1A 3EDFA 2Y0FA 3CEPA 3CHDA 4X60A 3E96A 1UR4A 3MI6A 1LOSA 1Q7MA 4LB4A 3UU0A 4O12A 5AHEA 1EDTA 2W6RA 1PAMA 3WQDA 2CBUA 3HPAA 2P4VA 5AOUA 4K8EA 1KCLA 1UJQA 4JHZA 3L2IA 4R9XA 4JTCA 3WUBA 1RQHA 2DY3A 4EAYA 2POTA 2XFFA 1KBLA 1LRTA 4B90A 3FYYA 2XWEA 4Q4SA 2FMNA 4HZ6A 2R9RA 4LOCA 1TMLA 2HK1A 4DRKA 1IEWA 4DI8A 5BRQA 3V5OA 4REQB 1VFSA 2RHGA 3HJZA 4NJKA 4TX9A 2QV4A 4ERGA 3AMKA 4W9OA 3WF0A 4F0SA 1Z42A 2G8ZA 3OLIA 2I5IA 5GJPA 1F05A 4GX8A 2F7FA 1FKHA 1AVAA 1QVBA 2MF9A 1YDNA 4DWSC 4MWAC 2Q8LA 2E0PA 4PTNA 3GG0A 4PTDA 1KWGA 4J3XA 3RUBL 3PZGA 1XM3A 1E0WA 3EX2A 5LNUA 3NOEA 3EPOA 4DM1A 1XINA 2BG5A 4EXAA 3NEVA 1V0NA 3M0HA 4HHMA 4IFKA 3NDYA 4HPXA 3UWVA 1CX9A 4HSOA 2HRWA 2DIEA 3JW7A 4RE4A 1QTWA 2AL2A 1TUFA 3G6LA 1R6WA 4LC6A 1I2OA 3BLPX 3IAQA 2CERA 4S3DA 3H2CA 4W8AA 4IIGA 2G3JA 5AYIA 5FOOA 3CQHA 5EMMA 4UCFA 3USZA 2HPIA 4W93A 2O55A 1V0LA 2J7EA 1HL8A 2XSAA 3UXAA 4DO7A 3VX0A 1HP5A 3UWQA 1CXFA 1E6QM 5CZKA 1DQWA 3OYXA 3FVMA 3B9EA 3CAVA 3HV9A 4JDBA 4CNSA 4KGLA 2P8CA 1EF2A 5JMUA 4UNKA 4W8LA 3DX5A 1C8VA 1JULA 1XH1A 4DIPA 2QCHA 2VEFA 4HKPA 4ZTYA 1YE6A 2VGBA 4TX0A 3O5FA 2PDFA 2VR5A 1E6NA 4M1BA 5LIKX 3WLHA 3E02A 1R9YA 1DJWA 1H51A 4LY4A 2TODA 1UR3M 3ZVIA 1VCFA 1WZMA 1KTBA 2O7QA 5KETA 2G37A 2J62A 3GLCA 2WHMA 1H5YA 3IJ7A 4LC8A 3O5RA 3M0XA 3PFMA 4R88A 2H9AA 1Q6RA 4PEEA 1V0MA 3H4GA 4DUOA 2NLYA 1QWGA 3M0JA 3KS5A 5DO2A 1HJWA 4YVVA 1EJ7L 1TZZA 4DO6A 3QHMA 5C9XA 4RUBA 3FA3A 4N9EA 1H4PA 3S83A 5A8OA 1EL3A 2F4EA 3KRSA 5CPNA 3AU6A 4QTGA 4QITA 3AHZA 1EJTC 3WUFA 3GDKA 1PZ0A 2J66A 1HKJA 3G18A 3OQEA 4KIRA 2WJDA 1TCDA 1JZ6A 2I17A 3DECA 3K13A 4H19A 1E15A 1YDOA 1XKJA 2B7PA 1EKOA 2HZGA 2HXTA 5AN7A 1AUSL 3R8GA 2J78A 3LRKA 1IR2A 5DIVA 3URBA 1OFBA 2ATMA 1TPEA 1OGGA 3KZ7A 3BJSA 3MT1A 1BRLB 3GU1A 3GNDA 5HINA 4GI9A 3HO8A 2D22A 2WJEA 3TP4A 1OM0A 5A6AA 3B8IA 4P5UA 1THFD 4GUGA 3ZMRA 4RPPA 1YPXA 1ECQA 5BXJA 5HKGA 1I0DA 2OSYA 2P3EA 2O9TA 2DW7A 3QMRA 2NSOA 4JTHA 3V36A 1PDZA 5BYWA 2E6AA 3KVJA 4XUYA 4BS0A 3A64A 3NDZA 3S6DA 5A8NA 3CQKA 4JFTA 3P80A 2FDMA 2Z7KA 2CC0A 3DFOA 4ROQA 1TTQA 1GQKA 3QV6A 2RUSA 3M47A 5H8UA 1ZHAA 4NZ5A 4ACZA 1K7XA 3BJTA 5EMYA 4HBOA 3O5EA 4G5DA 2V6AA 4H9ZA 1NF0A 3UWYA 4IQEA 3IGHX 3L5AA 1Z9AA 2ZR5A 1KFJA 4AD1A 3I3DA 3PNUA 2WBGA 4ONVA 3PZQA 2E5DA 1TB3A 1J0YA 1V6UA 2BWGA 1EX5A 1D7HA 1A49A 4K7YA 3HQPA 3F4CA 1RP9A 2PDYA 3VUSA 3TC3A 2FGLA 2RDTA 4FF7A 1K8CA 2PGRA 3WF1A 1OQFA 3KAFA 3AIBA 3EB3A 1CI1A 2VFEA 3TE9A 4UOJA 1I6NA 1KBJA 2FTYA 3UEQA 1YQ2A 2FKPA 1K7EA 4E8DA 3VIMA 4Y90A 1YNYA 2E28A 1KGWA 1Q7ZA 3RRAA 4XZBA 4DAFA 2X0HA 1XBYA 3QW3A 1TPVA 4DBDA 4WRHA 1UR2A 1LG2A 1YXDA 3TNOA 2AAMA 4JEQA 3M9YA 3T55A 4EAMA 5LA1A 3CL8A 5FEZA 3N17A 5G1YA 3ZO9A 2B31A 4MY1A 5C2XA 4FB7A 3CZLA 1YLVA 1QPLA 2RAGA 4Z08A 1UH3A 4RV3A 3RR1A 2A1YA 2OTDA 3KZSA 4Q8VA 1JZ2A 4H2CA 2FTWA 1KCZA 3ARZA 1PO9A 4WZHA 3WK2A 2E6FA 6TAAA 4NYYA 4LAXA 4FLQA 4K39A 3XIMA 4DVOA 3CGTA 4R7JA 4LAYA 2FZBA 3PTMA 4GY7A 3TONA 1M3UA 4ITZA 2REQB 3L23A 4AVFA 4ZOEA 1CXHA 4LALA 4JN7A 1SFJA 2LGOA 1UWRA 4DRMA 5DX7A 2ZZ2A 3AYVA 2OFNA 1CENA 4G7EA 4OUEA 3W7QA 4E3VA 4ECLA 1A47A 1D7IA 1F8MA 2I5QA 2WANA 4B5UA 4EACA 1UQZA 2GUBA 2XN2A 3R43A 3N11A 1W1YA 3CT2A 5CLWA 1W3IA 1RD5A 3FIGA 1A5BA 4UFMA 4FP1A 2Q8XA 3M16A 4N42A 2J7CA 3DFHA 4QR6A 1K4GA 2XGBA 2DZBA 1E6RA 4O57A 4HNLA 4WHBA 1J4IA 1K1DA 3H4XA 3THAA 1TCOC 1HKMA 2DZWA 3EIPA 3SUTA 1JQVA 1YYAA 2BGQA 2IKJA 5BU6A 1NSGA 1M6JA 1RSCA 5M3WA 2M1IA 4IIDA 5KSWA 1QO2A 1IEXA 2ZUSA 3PUOA 1VPXA 1PX8A 2D23A 1B4EA 2CXEA 4GZIA 2ZKMX 2WZHA 2YZ5A 3GE7A 1MI3A 5BXTA 1KT0A 3LU2A 4KCTA 3TN3A 4WEVX 5F1UA 4QDWA 2VVNA 3GDTA 1KRMA 3HGOA 1B30A 2QNEA 3NWRA 3EWXA 3MW7A 3TOPA 4PC8A 4AZGA 3RMEA 3AZSA 4RDVA 2PLKA 1J8VA 4AD2A 4XB3A 3OOQA 5LIUX 5HDRA 1RUSA 1TJ1A 3C56A 4XVEA 3GXDA 4AX7A 1W17A 3TLLA 4J4OA 3KXQA 5BOEA 1LL4A 2KE0A 3G22A 5DXYA 5IM51 4LANA 3AJ7A 3HG3A 1FH8A 5FJIA 3FGCB 4ML4A 3PZNA 4W85A 4TX6A 2W63A 1FKTA 1PINA 1XD0A 3R6IA 4BQ5A 1Q6OA 3TOYA 3E74A 2YDRA 4R9OA 3E0WA 2WBKA 2BV9A 3KHDA 4HOXA 5XINA 2OODA 4WJXA 2B0MA 1TVNA 4PUMA 4RL3A 3R0KA 1XLGA 4JYFA 4QCEA 4NSBA 2GK1B 2ZX6A 2DU2A 3RLHA 4WF7A 4A21A 1TX2A 3SN0A 1D9EA 3NQFA 3W84A 2C71A 1QZ2A 1FAPA 1U79A 3QM3A 4EOUA 4M29A 3VC6A 3JYJA 2QIWA 4IGSA 1K3UA 4W9PA 3NGFA 4RCXA 2QQ6A 1WX0A 5I98A 4HSNA 5JIWA 1RY8A 3L9CA 4H2HA 3RRXA 2FQIA 3FAWA 1QNRA 1HUVA 2A3CA 1Y0EA 2PPGA 4UFLA 2F38A 2DG4A 1VEPA 1AL8A 1GHRA 1OC7A 2PWVA 3BW2A 4JQ3A 2OJPA 3WDRA 3NUKA 3HPZA 4FOKA 3QV9A 4RJEA 5HNNA 2VX4A 3PTQA 1E72M 5J6EA 3O5OA 3ITTA 1RD6A 1DWGM 5I3KA 3B8WA 1BPLB 1EWDA 3AZRA 1F6YA 4QFUA 4LVGA 3WFZA 1PHQA 3S1WA 1XIGA 3WL0A 3VNKA 2ZOXA 2X7VA 1J6OA 2Y8UA 2HTMA 2R1MA 1X6NA 1I1WA 1UB3A 4PL2A 3OA5A 1T8QA 4MDOA 4KWOA 2UV8G 4GQ0A 5M5DA 4AC1X 2XG9A 4KR0B 4H9MA 3SQMA 3VILA 4QP0A 3N2MA 1GVEA 4OZOA 5HNRA 3UWUA 2DQWA 2OZ8A 5IFTA 3LZ3A 4UOQA 3E2RA 4GA8A 2DSVA 4E4PA 1L0PA 1EA9C 2VHLA 2DW6A 3GXNA 3LK6A 5EFDA 4LAVA 1XISA 1XYBA 2VC5A 4FZIA 1VIWA 4XAFA 3VA8A 5JBEA 1SMDA 4AHOA 5AKQA 1HJQA 3S3GA 4LVBA 6ENLA 2PF0A 1NAL1 4HIBA 2J7DA 4NYUA 3IS4A 3EOOA 1B3VA 2DVUA 1FKWA 3TFXA 4QG9A 1BTMA 3ZT6A 3CWHA 1UD3A 1VBUA 3TROA 3WJWA 3QTPA 2Y85A 1TJPA 3GIYA 3EDEA 4L65A 3B40A 4H3DA 3DFNA 3O05A 3P8JA 1IEIA 2E68A 5CPSA 3UCCA 5TBOA 4K7VA 3NPXA 3GR4A 2VENA 1VJIA 3NO3A 3W07A 3KLLA 5BNKA 2WMJA 3B05A 4LNCA 1EJVC 1S5MA 1W91A 3I65A 3POHA 5HQEA 1KQZA 3NI6A 2OMAA 4JTQA 3PJUA 3A4WA 5CC3A 4UR7A 1FXQA 1L6GA 1VBGA 2PDBA 3H2OA 4IPXA 3V1HA 3HZ3A 3UI5A 4XSMA 3IVUA 4V15A 1LUCA 3A3WA 1EYMA 1G6CA 2WWDA 3PF3A 4A05A 1JZ5A 3S9ZA 1MXGA 1U5VA 1IT8A 3W2JA 4D2JA 4GO8A 1ZJHA 4KFNA 2XP4A 3EAUA 2WMKA 3WF4A 5BRBA 2OQYA 1QW7A 3CBWA 4KPLA 4BHYA 1BGAA 3HFYA 4AEEA 5C5YA 3ZQ9A 1XSJA 3T6CA 2HNEA 1XLMA 5HW7A 1HIZA 1VS1A 1HO1A 2ZZ1A 1A0DA 2DZAA 3FAPA 3RGCA 2YCLB 3GG1A 3G1RA 4JNYA 1WDSA 3BZGA 3R89A 4E2VA 5BZAA 3VKBA 3MBFA 1SJAA 3DG6A 1UD4A 1FWFC 3GYCA 3UXKA 1RA0A 3LQGA 2XTKA 1TTIA 3AU2A 4JFMA 1ZQ5A 3I10A 5KZDA 1GWJA 2ZTJA 1NMWA 3N19B 5HAOA 5MF5A 3OQ8A 3OO2A 2ACQA 1VBHA 1WAWA 2H3BA 2CYGA 1VFTA 4Q4OA 1F40A 2ZQTA 2JKPA 3F03K 1PS9A 1VC4A 3QQWA 4LU0A 4MOZA 3TJLA 3WLLA 1V4YA 1KRCC 4O8AA 2D2GA 3KP0A 1S2WA 4HHPA 1Q6DA 4DJDC 3H7VA 4FS9A 4Y9MA 2O4MA 2DSUA 4H04A 4DJED 5JH2A 1F3WA 4OBTA 1ZUAX 3ARSA 4F4RA 2AMGA 2A7RA 2VKZG 4GUIA 2KFWA 4F0HA 3JU2A 5CPLA 1FKBA 4E2OA 1UR9A 2ZQSA 5F4XA 1FWIC 2JF6A 3ABOA 1TG7A 3CV6A 4KS0A 4S3GA 5XIAA 3W26A 2Q09A 3WEMA 1JNEA 4RV8A 1BF6A 1MYRA 4ADSA 3O6AA 2PZNA 3CHCA 4L56A 3KL5A 3LRLA 4YCPA 2VYOA 1HXJA 5HR6A 4L9YA 2P0OA 1V3KA 3H6OA 4AF0A 2NWSA 1K7FA 4GCXA 4QIUA 3GO2A 3P2VA 3GTYX 1RK5A 1RXOB 1C9DA 2WSKA 3UQAA 1K8ZA 4IGHA 4GVGA 4H8HA 7REQB 2WJZA 3LCHA 3SSZA 4UC5A 1NH6A 2PC4A 4HK6A 1AJZA 3BGJA 2UY4A 4F8XA 1W1IE 4QROA 2W62A 2B7QA 1T7LA 4H9TA 4AAJA 4XAYA 2X30A 1TJ2A 8A3HA 1XIJA 4JY8A 4B9ZA 1GKRA 2WOQA 3CXOA 3F2DA 1TRDA 1MVYA 2OX1A 4JTIA 1TWZA 1FOBA 4OBSA 5EL1A 3UJRA 2YCIX 3IACA 4RZBA 3QR1A 2MANA 5FKYA 3VGGA 2BFGA 3CIXA 3G3DA 3DHDA 4BKNA 2MPHA 4LEQA 1ROUA 2WVSA 4B2DD 3ZVHB 3O5QA 4IM4A 3GU0A 2PGFA 4R33A 1DJZA 5I24A 4PBGA 3UPBA 1SSGA 2Z1SA 1AD4A 3PR2A 4Y96A 2OPJA 1QBBA 5D2TA 3QQ0A 4WSJA 3KBNA 6TIMA 1UQYA 3BDKA 2J7FA 5EYWA 2FGZA 5F4SA 2UY3A 5CH9A 1JZ3A 3H21A 1IF2A 2BS9A 2Y4SA 4KIEA 3UYIA 2CHOA 1CLXA 3UVAA 3E2VA 3S4TA 3WMBA 3TDFA 2R91A 5EPDA 1VENA 3U5UA 2BVTA 3VDBA 1EA0A 3CV1A 4X2PA 4NNRA 4GNJA 2BXVA 2JK2A 3OJGA 2J7BA 1KO0A 3N3MA 4QLJA 2PMQA 9CGTA 2Z1BA 1AH4A 4ZPVR 3NQVA 3LA4A 1TV8A 1QNOA 3PAJA 3IIXA 1WOAA 1ITCA 2D0FA 1EBHA 3L4TA 3CWOX 4U2YA 2CLOA 1F07A 1XGEA 3O63A 3OZYA 4GX9A 3S2NA 1JCTA 4DZ2A 3UQBA 3USBA 3WL1A 1AW1A 2CKSA 2XH0A 5HA7A 1H62A 1LL6A 1LQ0A 2NQHA 4KEZA 4Q4MA 4XX6A 3OLEA 4CLMA 1CNVA 2OYMA 1XIBA 5D33A 3KVMA 3MVTA 1XLBA 5D03A 3HF3A 1Y5WA 1QOQA 2YBUA 5I3GA 3DU0A 5CAKA 1D6OA 2FH6A 3SFKA 2CLLA 1ZBKA 2WSYA 1F76A 4RKAA 2NVAA 4Q8QA 3MY9A 3R11A 1IT0A 3W70A 5MKGA 4UTJA 3MV11 3V16A 1XHGA 1B90A 1EP2A 2BVYA 3VIKA 4IGMA 3T4CA 3CTLA 1YX1A 1QMLA 3ABQA 1TELA 4Z2KA 3S5OA 4AC7C 3T08A 5JQ9A 4H9YA 3LPPA 2FHFA 2QLYA 3RXZA 1O60A 2CZEA 5TD4A 1GOQA 1V3MA 4O54A 1B9BA 2OX4A 5E5CA 4GWEA 4DXVA 3LHWA 3FYOA 3OGRA 5M03A 4Z1BA 3IANA 1DJNA 4XZWA 3SIMA 1TVPA 3TTQA 4GHRA 2X16A 3SY8A 6XIAA 4R27A 2YXGA 3T05A 2GJNA 3VNIA 4I9TA 4ZENA 3EPMA 2X0SA 1R87A 2OT1A 2Y1HA 3RK8A 1RZMA 1P48A 3R94A 3BGGA 2W66A 1UC5A 1BHGA 3N14A 1S2UA 1SFTA 1V8EA 3W85A 1EHAA 3P81A 4PMRA 5A2BA 4UTWA 3ARPA 3QVQA 4LUIA 1JI2A 3MI3A 3AYTA 2IUZA 2P1FA 3WQVA 3NYDA 4LUYA 1NVMA 1UWAA 2PRLA 2XIJA 4GOAA 3MMWA 4Q8OA 4HYRA 1GG1A 5EA9A 3TYZA 4IL2A 3JRKA 2ODOA 3N3TA 4BJHA 4DY1A 3AHYA 3NZRA 1LBMA 2GGEA 3IKDA 2WK2A 2ZZ5A 3GTFA 4JTJA 3CMFA 3KTXA 4MPQA 3WDJA 3S2MA 4LYPA 4LAMA 2WC3A 4U33A 5DBUA 3LCXA 3O5DA 2OLHA 4NIRA 5DO8A 4N19A 3FKKA 4C5ZA 4HBKA 4CQBA 5DBTA 1LTDA 5HUAA 1NEYA 5CLTA 1EWEA 1X7IA 4ODKA 1G1YA 2KZHA 3LUTA 1GNXA 3ENLA 3W27A 4H7CA 3MB9A 2CNCA 5KEZA 1R9XA 4M6QA 5E0FA 3GC2A 1ZK6A 1WKDA 4GZJA 3NQAA 1ISVA 1XC4A 4HTBA 5I77A 1H3GA 4LGXA 4MB3A 5F1VA 1DWFM 3HQOA 2R6OA 1CB7B 4DPPA 1O95A 5IHRA 2WNZA 5M1TA 2HISA 3A22A 1M68A 4W7WA 3TXZA 1XFCA 1JIBA 1OEPA 1J0JA 5K9XA 3TYUA 1XRFA 2RUQA 4M6VA 3LUOA 2PDHA 3QV8A 2FLIA 3ZSTA 1BWKA 2EPOA 4KWUA 3TCSA 5LHEA 3NO5A 1RQEA 4K3ZA 1ZSXA 2GSHA 3WBWA 2NX9A 2WMHA 4NXSA 2PRMA 1OBAA 2HVNA 3CZJA 1SZNA 2ZR6A 4TTGA 2W79A 1BTCA 1LBLA 5D4YA 2PURA 2PDIA 2OXNA 3W7IA 2QUUA 2V3GA 1CLKA 1R9HA 8RUCA 5CG7A 3W7JA 4DQWA 1VEOA 4RXFA 3NYZA 1TREA 1KM2A 1AMKA 4DRPA 2E8YA 4ACZB 3ZYZA 3O06A 1Q6IA 3E2QA 4K36A 5LIXX 4ODPA 3KOXA 4MZYA 3R5EA 4ZQOA 2P76A 3G1YA 4AEOA 1FCBA 4WGHA 1U30A 3DFTA 1WYIA 4ZODA 4UR8A 4N2YA 3WKZA 5C7HA 1I8JA 4TVDA 2YBTA 1VFHA 1R86A 1ENUA 1JAKA 3OZMA 4CD8A 4OUIA 1JF6A 5A6LA 3WJZA 3E12A 4O11A 4WXZA 4HARA 3CZGA 4FR1A 4DNMA 4IJCA 4MADA 1ONXA 1CGYA 2EF9A 3AYRA 4QXIA 1DHKA 4A22A 4IX0A 4UNIA 3FCPA 3IJIA 3IEBA 3G1XA 4ORIA 4GVIA 1J4EA 1EUNA 2YIHA 4JQ2A 1AH3A 4XKYA 5T8GA 1ECEA 1U5JA 2OWXA 5FJTA 2E09A 3ATZA 4J2MA 1FKFA 4ODNA 2WNNA 3IGXA 2FAPA 5TNVA 3R2GA 3MO4A 1J4RA 2X41A 4DF1A 2QCGA 3DESA 1R5YA 3M46A 1V7YA 3EOSA 1ODZA 1QATA 3OGVA 1FKIA 1UWUA 1RJQA 2D3NA 1HJUA 3GHSA 4DELA 2NXIA 3E0VA 2RQSA 1E0TA 4QJ3B 3M1ZA 2V5KA 2JGQA 1R46A 4NU7A 2ZUTA 2FVLA 2BASA 3N4FA 2P10A 3R10A 1XYFA 1M01A 2ZRYA 1G67A 1VYPX 1AL7A 2FHCA 3G77A 3P62A 5D9NA 4BI5A 4YYFA 1DTNA 1X1OA 3L4WA 1I45A 4HNNA 4JTLA 3MPGA 4HZ8A 2BBFA 1ZCNA 2XM2A 1HKIA 2E5BA 3GHRA 5CCZA 4HU3A 4LBSA 2YKKA 1MQPA 4MVAA 4DXKA 1UG6A 4D1IA 1RHCA 2YYTA 3A21A 3M7SA 3BOLA 1WV2A 4GKLA 1K9TA 4OWGA 3KTSA 4ZR8A 2Z1WA 3NZPA 4UDMA 5DCEA 2IPFA 1BSLA 4AB4A 4MDPA 3CLWA 1KXTA 4L5ZA 3AUJA 5G4EA 4UTUA 4XO6A 5I06A 2E4TA 4PBFA 1M04A 1OK4A 4L72B 2YJQA 3WJYA 1MFUA 3DHFA 3VIIA 1QBAA 3N6QA 2YBVA 2C3ZA 5D30A 1CB2A 1O68A 4IT4A 5AHNA 1M65A 2ZADA 4K6AA 4D6GA 3R1ZA 3APTA 2A0NA 1QI3A 3GD6A 3UY7A 2OKOA 2NVCA 2XYLA 1UCWA 1DKWA 4IICA 2XZ9A 1MW1A 3O0KA 4W8BA 1W9XA 1MDLA 4ML9A 1FWAC 2NQ9A 4S3JA 1YTEA 4L6OA 2DSWA 4ILSA 2ABAA 2PDXA 4RX0A 4GNVA 2QJMA 1AW2A 4D6DA 1QFEA 4RXGA 2A7PA 1XP3A 4GZ7A 4AWEA 1Q65A 3WELA 3ONBA 1VAHA 4FX7A 3NQCA 1EO5A 3UR8A 3Q65A 3DKLA 5LSMA 2X40A 3CUFA 4K1WA 2X2GA 4JFVA 1GW9A 2QR6A 1E1EA 4E6MA 1VFOA 3NIYA 1F4HA 2CWXA 2J8TA 3W22A 4PBEA 3ZZ1A 2GUUA 4H9UA 4Z1YA 1SO4A 2J8GA 5HATA 2FVKA 3FS2A 4EF9A 4WXYA 3W23A 1K6WA 2PTWA 3GZAA 1E73M 1XUUA 4PCPA 1GPFA 2EG7A 3W3OA 1XX1A 2V30A 4CEUC 3W7OA 1TSIA 1XCWA 1J5TA 3ELFA 2RDXA 3EB4A 1TA3B 3DHUA 4NP7A 4C1NB 4BI7A 2VMFA 2DQXA 5J5DA 3DFYA 5A6SA 1UC4A 2P5NA 2ZIDA 4ZOAA 3WLPA 1LT8A 1SZFA 1T5AA 4CQCA 1XQLA 3O07A 1VPYA 4JIEA 4N7QA 3MDUA 1IT7A 1YADA 4DI9A 1JXJA 4D6FA 3WH7A 3WH8A 3DI1A 2G41A 3G1FA 3RCNA 3URNA 2HSAA 2XFRA 1F8AB 4KFOA 2VQUA 2YFOA 3AZTA 3LXBA 5FAGA 3L66A 3N73A 5HR7A 3NQMA