4WK9A

Crystal structure of human chitotriosidase-1 catalytic domain in complex with chitobiose (0.3mm) at 1.10 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
369
structure length
368
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTENDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Chitotriosidase-1
total genus 132
structure length 368
sequence length 369
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wk9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wk9A01
1FFRA 3VIMA 1HXJA 2QLYA 5CPSA 4CVWA 1GORA 3VOCA 4LYPA 3CPUA 1LG2A 2WM0A 1JFHA 2F2HA 2BY1A 2X0HA 1YHTA 4CUCA 3B9DA 2E8ZA 1QHOA 1NWSA 2J25A 5I79A 1WDSA 1E6SM 1ZBCA 3A4WA 1NWRA 2YLAA 4Q7NA 1CLVA 4AY1A 3VIKA 2YA2A 5HPOA 5EFFA 4GQRA 4HMDA 2CHOA 5FD0A 1E72M 3VMOA 2CBUA 3AMKA 1J0JA 1WO2A 4HZ6A 2EXOA 3AZRA 3K4AA 1XSIA 3W25A 3ARRA 4W8BA 5BXTA 5FKYA 1UR2A 4M82A 3W38A 3W81A 2RGMA 3VIHA 4PMNA 4ACZB 1Y7VA 1JXKA 1SMDA 3HJEA 1UKPA 2PWDA 4UCFA 4M81A 3VGGA 3DYOA 2UY2A 2D3LA 3ZSTA 1UQYA 5HDRA 2WLYA 1HIZA 5DO8A 4IUGA 3WL1A 2D3NA 2XVGA 4HTYA 4W85A 4EKJA 1KWGA 3WF3A 4ML4A 2VX6A 2DT1A 1SFSA 2EPMX 4W87A 2EPKX 2WMIB 2UY3A 3PTMA 3AHTA 4OOUA 4X9YA 3WUGA 3NJ3A 3MV01 1B3WA 3OLDA 4U3AA 1W1VA 1KR0A 4JFUA 4JL1A 2ZUMA 3QHOA 2GDVA 4UFLA 1MQRA 2QF8A 5CPQA 3VX1A 1TR1A 3OA5A 1QW8A 3CZEA 4WSKA 1E6PA 2WBKA 4M56A 4NI3A 3WFZA 1JZ4A 2DIJA 2QMKA 1JD7A 1LG1A 5C71A 1CGVA 1CDGA 1CGTA 3PZVA 1V3LA 2C8NA 1JZ8A 2E9MA 3PZGA 2PB1A 4J27A 4TVUA 1SYTA 1JAKA 4MB1A 1K9DA 3NDZA 1E6NA 1OCQA 2VQUA 5I0DA 2WBGA 1VFOA 2CBVA 2X0YA 1VEPA 2BS9A 2NT1A 4AIUA 1JZ3A 1EQPA 3PZUA 5A6LA 3AJ7A 4WSJA 2WVSA 1CGWA 2J78A 4HP5A 4QLLA 2W4XA 2X09A 1O7AA 4NSBA 3SCSA 3WQ4A 1V0NA 5EFDA 2VOTA 1RD6A 1Q6CA 2A3CA 3VILA 1PIFA 5CGMA 2ZXBA 4R5EA 1KB3A 1IZKA 5D9NA 2EPLX 3BLKA 3SUUA 3GYCA 1MQPA 2ZWYA 3NUKA 1C8XA 9CGTA 2GDUA 1RP8A 4OIFA 1MW3A 2X2YA 1RPKA 2DSZA 2AOSA 3AIVA 1FP8A 1H2JA 1SMAA 3BAYA 4P7LA 3WH9A 3GXFA 2ZXDA 1GOOA 1U30A 3N15A 2XWEA 4BQ2A 3AIEA 3VD7A 3ZJKA 5EB8A 3AYRA 2CERA 1JG9A 4PMOA 1GVYA 1UR4A 5I24A 3PZ9A 1FH9A 1KR1A 2YL6A 1PJ9A 4MAVA 1KQZA 1J0YA 1VIWA 1JZ6A 5IDIA 1EOKA 5M3WA 1B2YA 1E40A 2EO7A 4J3TA 1V0KA 1MVYA 4HMCA 1KQYA 3WEOA 1E5NA 5KEZA 2V3DA 2WC4A 3N1AA 3WNLA 4CCDA 4KGLA 4UFHA 3FN9A 5GQBA 1UH4A 3U5YA 4XV0A 3N04A 4C7FA 4PEEA 3D3AA 4JFSA 4CN6A 1WAWA 1CPUA 1C91A 1QBAA 2XFYA 1GVIA 2OWCA 3FXYA 3WBEA 1B30A 2BFGA 4LQ1A 4J3XA 2J62A 1NP2A 4QFUA 3UESA 3ALFA 4H8VA 1QPKA 2UWFA 2ZXAA 1FP9A 1UD3A 1C7SA 3N11A 2CYGA 3W28A 1B1YA 4GI9A 3RJYA 2OSYA 4AZCA 2WXDM 5JH8A 4EE9A 1GQKA 1V3IA 5E9AA 1HJXA 5AYBA 4HOWA 1QBBA 1WZKA 2VC9A 2W67A 1GJUA 4J3WA 3BXWA 1LQ0A 3QOKA 4UQ9A 1H09A 3DHUA 5A94A 3IAPA 3AROA 2WSKA 1DHKA 1M01A 3DECA 1JAEA 3WKZA 1GOWA 1WZMA 4L4PA 2A3HA 3EDDA 1V3HA 3POCA 3RO8A 5F7UA 1AMYA 4UQDA 3MMWA 3LPPA 2GJXB 3CZGA 3WNMA 2CHNA 5D8ZA 3W29A 4AEEA 5A8OA 2ZIDA 3EDEA 1CXHA 3O2LA 1CECA 3UETA 5E6ZA 1V3KA 3N17A 4V28A 1EXPA 2E0PA 1BLIA 1JDCA 2JE8A 3ZIZA 3OLIA 4EAMA 3W6MA 1CTNA 1AQHA 5A95A 4AZ5A 1LWJA 2XM1A 1U2YA 1ZJBA 3CBWA 4AXNA 3AHZA 1GCYA 3WNOA 2BY0A 2VR4A 1GQJA 3WNNA 4AC1X 4XB3A 2V38A 1EOMA 3HMCA 1M53A 4AWEA 1GUVA 4GKLA 4DUWA 4D6EA 3CHEA 3APGA 3KL5A 5A6KA 4H8UA 3GH7A 1WZLA 3WQWA 1JZ2A 1B90A 4UFKA 2FDMA 1EA9C 3BAJA 3PZOA 4ATLA 1VJZA 1E70M 4D6IA 4ZFMA 2IXVA 3WBAA 1OIFA 4B15A 2EQDA 3AYSA 3PZMA 4D6GA 4CU8A 1BF2A 4KMQA 3LPFA 4D71A 4UNIA 4UR9A 1U33A 2DSWA 3EMQA 3L4XA 2F61A 4HZ7A 1JZ7A 1FA2A 4URIA 2XIBA 1AVAA 2WMIA 3OLGA 4FK9A 4GI8A 2VNCA 4CN1A 4W7WA 4OOZA 5ABHA 1G94A 1KCLA 4B3KA 1OINA 2B31A 3AHVA 4UOZA 4QDMA 4CU6A 5I77A 1WDRA 1CGUA 3U5UA 4W7UA 2PWEA 3WFLA 2BVYA 1E56A 5A6BA 4J3SA 3BAWA 2O9RA 3WSUA 2WCAA 1TCMA 1J11A 3ZM8A 1UOKA 1VEMA 2VQTA 5JBFA 3THDA 4MADA 2PC8A 4MDOA 3WQ8A 3ARWA 4CD5A 4Y7EA 1JIBA 3BSGA 3CO4A 5DMYA 2ZE0A 1VBUA 3T2OA 3AXIA 2WHMA 3ZJ8A 4AD0A 1HKIA 4AD4A 3TP4A 3LPOA 1JGIA 4WKFA 4HA4A 5BXPA 1W3LA 2WMFA 4ACYA 1J0KA 2EBNA 1VAHA 1DTUA 3TA9A 4BZYA 1OGSA 3L4TA 2W91A 4MNMA 1R86A 3GXMA 1TFVA 3ARUA 2DSKA 2ZUTA 3PBGA 4GXPA 1XD1A 4UQCA 4HOXA 1W3KA 3ARQA 1Q6DA 4PUDA 1RP9A 2VCBA 6CGTA 3AMLA 3ARYA 1B31A 1US3A 2EPOA 1BYAA 4DUVA 1GQLA 5AY7A 2CETA 1V3JA 2W92A 1UZ4A 4HOZA 3AXXA 1P6WA 3N13A 4PTXA 3VX0A 4DWSC 3F5JA 3AICA 3L4WA 2A3EA 3I3DA 1QI4A 1UR0A 4JAWA 4P8WA 1UWSA 1WP6A 3T2QA 1V08A 3CUIA 1UKQA 2D24A 4FMVA 1H49A 1V6XA 2VZOA 3I3EA 3W53A 1HJSA 3TTQA 3HU7A 2G3IA 5IFPA 3VDBA 3CMGA 3T0AA 5BROA 3L4ZA 1ITCA 2YKKA 3OGRA 4PN2A 2JF6A 2CXGA 4P7QA 5DT7A 1SR0A 4PRWA 2UY4A 3RCNA 2XYLA 2IUZA 4H2CA 5FOOA 4W7VA 1CXEA 1OD0A 1W1YA 1W9UA 1ZS2A 2WZEA 2XVLA 4U3CA 4B3LA 4JFWA 4WLCA 2D20A 2V3GA 1HNYA 2WMJA 1G9HA 3FHQA 1X1NA 5HBFA 3VDCA 3AFBA 4CGTA 1PIGA 3AIUA 1UKOA 1LWHA 1XYFA 2J8FA 1XV8A 3SCQA 2XM2A 3ZJ6A 3OLEA 1MXGA 3OZPA 2W63A 3CUGA 1B9ZA 4BQ3A 1HKKA 1VB9A 3EDFA 4M24A 1Q6GA 4WJXA 2WKLA 1BQCA 2Y8KA 3WH5A 5EMYA 1CBGA 5A8NA 1A3HA 5BXRA 1B3VA 1BGGA 2YBTA 1PX4A 4R27A 3UG5A 5I23A 3VD3A 1E6ZA 2VUYA 1KXVA 1NOWA 4WKAA 2YIHA 3QOMA 4ZEPA 1UWTA 1EDGA 1F4HA 1GOQA 3F5KA 4LGXA 2CESA 2BVTA 4PSRA 1G5AA 4RE2A 1H0GA 3AMGA 3TONA 3HN3A 1C8YA 1HJVA 3PN8A 3MANA 1UUQA 3RJXA 4OJYA 1KBBA 2XIIA 3WF4A 4JKLA 3VINA 3WUEA 2G4FA 3A3HA 1HL8A 4KWUA 2V5CA 3VIOA 4UTFA 4XZWA 4YHGA 2VTFA 2PBOA 3WDHA 1GOIA 4FLRA 4ATWA 1E73M 3IJ7A 2FHFA 2D2OA 4AZBA 2QHAA 3T09A 1WB0A 5A8MA 5AC5A 5I6SA 3KWXA 1I1WA 3F5LA 4CKQA 4MNKA 3GXDA 3MUIA 4E4PA 3OGSA 1TE1A 2DPEA 3ZJ7A 3AMDA 3B9EA 3DHPA 4AIEA 2VMFA 3A4XA 3WD4A 3AZSA 1BYDA 1Z32X 3VDHA 3W6LA 4QAWA 2EEXA 3AQUA 3UG4A 3VGHA 3GM8A 1AQMA 3VKKA 3OIHA 3SUSA 1UWQA 4HU8A 2ZWZA 3CHDA 1E0XA 2V3EA 2VZUA 2DT0A 1MFUA 1QNQA 2UY5A 4FLQA 1W3HA 3OG2A 2G3MA 1MW0A 3NSNA 3VGFA 3DYPA 5ECUA 4FLOA 3VGBA 3L2MA 2E8YA 7TAAA 1XD0A 2W62A 1DWAM 5ABFB 1E1EA 2E9BA 2GJRA 5D9PA 3VD5A 1R85A 3TOPA 3A4AA 1VENA 4D72A 3OZOA 1WNOA 1ZB5A 2FGZA 3WDRA 1C93A 4F8XA 3WIJA 4N0RA 3ARVA 4X0VA 4D6HA 2BXZA 4PMRA 2G3NA 2VZVA 2DSUA 4MDPA 1EIBA 4K68A 1DP0A 3JUGA 1UR1A 1E5JA 2ZUUA 3LPGA 4LYQA 1HN1A 1EGZA 1KBKA 3SEPA 2WW5A 3NSXA 3VNZA 3GXIA 3WMBA 3FAXA 6A3HA 3RDKA 4J7RA 2CKSA 1JI1A 3CHFA 3M46A 1BG4A 3W24A 2XPKA 3AI0A 1VRXA 4KH2A 3WELA 2WSPA 1LL7A 2WPGA 5D9MA 1W1TA 5C8BB 1Q6FA 4FLSA 3OGVA 2WYSA 3WD3A 1XHGA 1C3FA 1F4AA 4QLKA 1W9XA 3RIKA 4U31A 1LF1A 1QVBA 3T0BA 2XG9A 3K8MA 4DM2A 2NSXA 4H7VA 1UWRA 4V2XA 1KXQA 2X05A 3MS8A 1NQ6A 1OBAA 4H41A 3WQVA 1NOFA 2VURA 2VJXA 3L4YA 7CGTA 3SCUA 1DWHM 3N12A 1CENA 4MB3A 4UOJA 3S6TA 4P8UA 4OKDA 3BMWA 3SCOA 4W93A 5A6SA 2WCSA 2DIEA 2DGAA 3VMNA 4JHOA 2J4GA 1JXJA 5JIPA 4U2YA 3AXHA 3T0DA 1EQCA 4JL2A 2O9OA 2WZHA 2E4TA 3UR8A 4MAZA 3ZMRA 1UR9A 1KGUA 2OLHA 2O92A 2A3BA 4MB5A 3G6LA 1VBRA 3W37A 2EPNA 3KL0A 1ITXA 1J10A 3VM5A 3SCWA 1J18A 4UQBA 4WK9A 4TX6A 3WQ5A 1H11A 4WF7A 5E0FA 2AAAA 4B9YA 5GNZA 1J9YA 2XHYA 2ZX9A 2JALA 3M6DA 4C7DA 3AHXA 3TTSA 1NWTA 3LMYA 5CXPA 4Q22A 4H04A 5A2CA 4AISA 3QHNA 4NRSA 3VD4A 1LL6A 3S2CA 1V6UA 1EDQA 3AS0A 1DWFM 5LA0A 3WDIA 2XFRA 3CUFA 1AQ0A 2Y4SA 3VPLA 4BF7A 4TTUA 2GK1A 2ZICA 3BH4A 3VIPA 4PMDA 3VGEA 1UG6A 1TA3B 2Z1KA 1E4NA 4BQ5A 4AYSA 1CXFA 1J01A 5CSYA 2WK2A 2WZIA 2YA1A 1OB0A 4QLJA 1TUXA 3CZLA 1R87A 2WWDA 4PMQA 1GPFA 2FH6A 2VRKA 1QHPA 1EO5A 3SUWA 1XC6A 4E8CA 5KZ6A 1WDQA 3PTQA 2EJ1A 5FIPA 1JF6A 1OT2A 2WHLA 4HZ8A 1C7TA 3SCNA 2GSJA 3UR7A 3VIJA 4ACZA 4LYRA 4JHZA 1UKTA 4AZCB 3ECQA 6TAAA 4B9ZA 4XUYA 3SUVA 1E15A 2DH2A 5I3DA 2FGLA 1E1FA 1PZ3A 3K1DA 5TD4A 2GUYA 5D4YA 1W9DM 2ZUNA 3MMUA 2CEQA 1W9PA 1QI2A 1GW1A 1VFFA 1UA7A 2XTKA 8CGTA 4BQ4A 2VO5A 3WL0A 4D6CA 4GQQA 3AIBA 1H4PA 1JDDA 4X0NA 1FH7A 3SCTA 3RILA 2F8QA 4Z2KA 4OBRA 5CJ5A 3KL3A 5LA1A 3QR3A 2J75A 2OSWA 2GJXA 2WMKA 3BAXA 1A47A 4F66A 3ARTA 1I1XA 3ARSA 4PTWA 4UQAA 5GNXA 1VFMA 4LPCA 1ZBKA 4PMYA 1XH0A 2VX5A 3RM9A 3U57A 3AISA 2YDQA 3FHAA 1OSEA 1TMQA 3VIFA 4CU7A 3RMEA 1XCWA 3CZ8A 1ESWA 2YOCA 4TTGA 2Y8VA 4JKKA 2W5FA 2YDRA 1EHAA 3ARZA 2DQXA 1H5VA 1R7OA 3GBEA 1CXLA 5D9OA 5FCZA 4ATDA 2WVUA 3WNPA 1UD4A 3KEHA 2ZUWA 3ZOAA 3PHAA 1XH2A 1UYQA 3PZTA 1WDPA 1QOXA 4P7RA 4ZENA 4ZE5A 1QI5A 4HU0A 1DEDA 2XVKA 1UWIA 4CCEA 5ABFA 2X1IA 1V0LA 1JFXA 4D6JA 3OB8A 4D1IA 3M7SA 3WF0A 3WUFA 1CIUA 1MWOA 5A8PA 1MW1A 5ABGA 4F9JA 1UHVA 3VTRA 3T08A 1LLOA 1V3MA 3GNRA 4UOQA 2W61A 2Q8XA 1WE5A 4XZBA 1IT0A 4CCCA 3CUHA 3GNOA 1GHRA 4IM4A 1PX3A 5JBEA 2WAGA 1E0VA 5BRPA 5BYWA 4Z2JA 3VUPA 1HF6A 1FFQA 5CLWA 3BMVA 2JFEX 3WDQA 3W82A 3J7HA 3VM7A 5E70A 4DM1A 1QI0A 1W91A 3GNPA 2QPUA 3CMJA 3WF1A 3VNYA 2XGIA 1CYGA 3ZT6A 4S3KA 4YN5A 1JYNA 3BAKA 3EMCA 3K4DA 5CGTA 5HOSA 3SURA 3ALGA 4JFVA 1JNEA 5E09A 2J7DA 3WDJA 3AIWA 1ISYA 1UWUA 4PTMA 1CGXA 5M03A 5CG0A 3I3BA 4W84A 1QNPA 3ARXA 3WMCA 5DF0A 1ZBWA 3WNKA 3WH7A 1ISWA 4CN4A 2WANA 1WCGA 2WWCA 2WLZA 3WD0A 2WB5A 2XFFA 3VD9A 4J28A 2VRQA 4HA3A 4AMCA 2QV4A 3BCFA 3WMSA 1PPIA 3FAWA 3BSHA 3M07A 1BVZA 4HMEA 2D0HA 1JYVA 1BGAA 2X8RA 3K8KA 2VR5A 2YL8A 3ZSSA 4F9DA 1PAMA 2YL9A 3ZT5A 4P8VA 1C92A 3PZQA 2GK1B 2OWWA 5FL1A 4F79A 7A3HA 4PCSA 2GFTA 2VVSA 3CGTA 2VRJA 2BNJA 3WD1A 4MJ2A 1XSKA 5GNYA 3SCRA 3BLPX 2V5DA 3UERA 1W1PA 1GQIA 2J8GA 5ABEA 5A6AA 2PWGA 2YBUA 1NM9A 4JIEA 1Q6EA 3WF2A 2ZOXA 5HPCA 3MSGA 4TOQA 1QHZA 2WMGA 4P8XA 1XH1A 2E40A 3TTOA 1BTCA 4EANA 1CNVA 1E6RA 4PMUA 5E6YA 1MQQA 3SIMA 1I75A 2PF0A 2HISA 4U5KA 5C70A 3W27A 2YDSA 2J7GA 3U7VA 2DSVA 4AZHA 4QP0A 3EBVA 2Y24A 1OM0A 2WHKA 2WHJA 1E9LA 4P7NA 3VIGA 1HJQA 1HJUA 4TX8A 4YHEA 1K6AA 3KE0A 1NOUA 4D1JA 1HP4A 1V6VA 3AS3A 1CXKA 2OSXA 4OUEA 4RE4A 4CD4A 1JZ5A 3PZIA 3EDJA 3MUAA 2C0HA 2TAAA 4IPLA 2VCCA 5A2BA 2RGLA 1R7AA 3N9KA 2XJ7A 5A1AA 2CBJA 4AW7A 3CLWA 2WC3A 3WY1A 4CD7A 5IFTA 1W2VA 4FF5A 1MW2A 4DWSB 1GJWA 3THCA 3U7BA 3AIRA 2XGBA 1ZU8A 4BS0A 2XUCA 1LJYA 1GOKA 1KCKA 2XVNA 1HT6A 1V02E 4GZEA 4TVCA 1GHSA 1QNOA 3E1F1 3L4UA 3WQ6A 2ZUVA 4AZ6A 1BHGA 1HVQA 2J7EA 4JKMA 3A47A 3MO4A 4QCFA 5A2AA 5HXMA 2ESCA 1UR8A 4ZXOA 1PBGA 3KZSA 4TUFA 3W0KA 3L4VA 1ISVA 2V3FA 1H3GA 5D8WA 4GZIA 1IZJA 2JEQA 2J7FA 3MUY1 2E3ZA 2OYKA 3ZR5A 1FOBA 1BVNP 3WEZA 2OYLA 1HVXA 2E9LA 5BRQA 2J79A 2DT2A 3WH6A 2VZSA 3W26A 1MFVA 1K9FA 3NCOA 5BXSA 2J47A 2J7BA 3GBDA 1E4LA 4KRTA 1ODUA 3CIVA 1ODZA 2WNWA 2BVDA 5DEZA 1DWJM 4JCLA 1XRVA 2QPSA 4XX6A 4W88A 4MPKA 3ZT7A 1PX8A 1Q4NX 1UD5A 3L2LA 5A69A 1JYWA 1HP5A 1VEOA 1KGXA 2VT0A 3NIYA 4TVDA 2OWXA 1BG9A 1HJWA 4W5ZA 3G6MA 1KWKA 2XWDA 4GIAA 1X6NA 4AZGA 3CUJA 4A4AA 3RM4A 5IHSA 5M5DA 1H0IA 4PTVA 1E6QM 1W2PA 2JEPA 1V6YA 1E3XA 2CITA 3DYMA 2NW0A 2WVVA 1LL4A 4BA0A 1NP0A 4UFIA 1XYZA 2BY2A 1CXIA 2FHCA 1BFNA 5I5RA 1V03A 4U5IA 4JFTA 3WEMA 2BHUA 3A6OA 3GH4A 4DUXA 4DWSD 2VX4A 3VU2A 5JIWA 5M17A 2JF7A 3POHA 2D0GA 1E6XM 4M29A 4DWSA 3WUBA 2DEPA 2G8ZA 3IANA 3BC9A 1L8NA 1M04A 4M8UA 1UH3A 1WPCA 1VF8A 1OIMA 4HPGA 1KGWA 1HKMA 3NSMA 1JI2A 4MNLA 1DWGM 1CLXA 3EMZA 4PYSA 4M1RA 1HL9A 1O6IA 4UZUA 5IHRA 4AD3A 3IJ9A 4E2OA 3AHYA 5E0CA 4UFJA 4B16A 1M03A 1W32A 1TG7A 3GZAA 1E3ZA 4U33A 4W89A 4GINA 3CHCA 1CGYA 3GDBA 5AYIA 4PMVA 4LXFA 1ZL1A 5I2UA 4GPNA 2DDXA 2XSBA 1JDAA 3AOFA 2O9TA 2OYMA 4UZSA 2QMJA 3AIQA 4IPNB 4NF7A 4V27A 2D1ZA 3RPMA 3AS2A 5DT5A 3IAQA 3FY1A 1E71M 2CKRA 4ZXLA 5FL0A 4ZE4A 1K9EA 3QGVA 1DWIM 2GVYA 2J74A 3VVGA 1TA3A 3VDAA 4RE3A 2AMGA 4PMZA 1H1NA 3MU7A 3PTKA 4PMXA 3WN6A 3CH9A 1UKSA 1FHDA 2WC7A 3O6AA 1EO7A 2Y2WA 1H41A 4WKHA 3VIIA 4AD2A 5BWFA 2ZX6A 1V02A 2D22A 5A8QA 4JCMA 3BAIA 5DFAA 1D2KA 2ZX7A 3RM8A 2GJPA 5AC4A 4KGJA 4CVUA 1ISXA 1NARA 1J12A 2FH8A 4HPHA 3WENA 3D5HA 3K46A 1OWQA 2W66A 2Y5EA 1UQZA 2XVPA 5IXEA 1HX0A 8A3HA 2ZXQA 2Z1SA 4LX4A 4P7OA 5A6BD 3SUTA 1WKYA 4D6FA 2PWHA 1OGGA 5CSUA 1YQ2A 4AZ7A 4WIWA 2J7HA 5JBDA 1XGZA 1CEOA 1ECEA 3EDKA 2VVNA 1J0IA 2CCRA 1XSJA 3B9AA 1NH6A 3MMDA 4QCEA 1ZBVA 1OD8A 2CNCA 2J77A 4GO8A 2VZTA 1QW9A 3SCVA 1TVPA 3MUZ1 2D0FA 5LYRA 2ZX8A 4JZ5A 1W9BM 4PSPA 1BSIA 4W8LA 1UD6A 2JIEA 3B8SA 3WH8A 1KFWA 1RH9A 1UA3A 2CPUA 3F4VA 1CWYA 3VO0A 1FHLA 1BYBA 3OBAA 5BCAA 2G41A 4NRRA 1X6LA 4YPJA 1J0HA 3UEQA 1EH9A 1TZ7A 3K8LA 4M80A 4C7GA 1N82A 2BXYA 5A3HA 4AZIA 2G3JA 2J7CA 3WD2A 2YL5A 4AD5A 1MXDA 1ISZA 1EHNA 1UD2A 1FH8A 1L0PA 2CBIA 4W86A 4MTVA 4AIOA 3NYDA 3O9NA 2IXUA 3II1A 2A3AA 4EK7A 4MNJA 1R8LA 2YLLA 3ARPA 5HNNA 1G0CA 1VFUA 2DT3A 1G01A 2WVTA 1EDTA 3MV11 4BCEA 4OBSA 2PI6A 4W5UA 1E4MM 1BPLB 1KXTA 1QNRA 1JYXA 1E4IA 1GNXA 1D3CA 2DH3A 3IJ8A 4AD1A 1HKJA 3NDYA 2VCAA 1B3ZA 1E43A 4RL3A 2VI0A 5CQ1A 2WCGA 3BGAA 3N18A 4U2ZA 4D6DA 1E55A 1JF5A 3SCPA 4GZJA 2JIWA 1VJSA 2VX7A 1OGBA 4S3JA 1JD9A 2CIPA 4UFMA 1UH2A 1E0WA 3PZNA 1M7XA 1NWUA 4CD8A 3QHMA 3CTTA 3FW6A 2NT0A 4MJ4A 2PBGA 4L4OA 1QI3A 3UG3A 3IK2A 3VMPA 5CZKA 1V6WA 1BYCA 5CLTA 3ZR6A 1K9TA 1GOMA 3MSDA 4IISA 3UCQA 3WDPP 4N42A 1GZJA 4Z2LA 3MKKA 2O9PA 5CPTA 5JUVA 4NZCA 1MYRA 5A6MA 4J3VA 2PWFA 4GO9A 2XSAA 2BY3A 3GTNA 1KXHA 3W4RA 5A6JA 3AS1A 3ZO9A 3CZJA 4A3HA 2D23A 5GPRA 3FNDA 4PCTA 4KRUA 3AZTA 1US2A 3EYPA 5I78A 2YJQA 4W8AA 3BCDA 1CZ1A 4AEFA 2HVMA 2VL4A 2C7FA 1PEZA 1B0IA 5EBAA 4Z2HA 1B3YA 1W3JA 3TTYA 4E8DA 1JNDA 2WKGA 4Z2IA 4H8HA 4OZOA 4PBGA 2FHBA 2MANA 4Z2GA 4TXEA 4J3UA 4GI6A 1XCXA 2ZUSA 1W9VA 1WZAA 2BV9A 4CD6A 2BHYA 3VGDA 1BAGA 1UZ1A 5LA2A 1QNSA 2ZX5A 4A3YA 2WVVB 1C8QA 1D7FA 1IV8A 3AMCA 3CZKA 1G1YA 4HA1A 1JL8A 2WMHA 1V0MA 2BHZA 3GH5A 1S46A 1PZ2A 1UD8A 1C90A 1GONA 1TVNA 3T2PA 1J0ZA 1OT1A 4UQEA 1ZJAA 3DC0A 4MB4A 2YA0A 1B3XA 3ZQ9A 4PUEA
chains in the Genus database with same CATH superfamily
2AQOA 2YCJA 5REQB 4JICA 3TN4A 4GYPA 3O8AA 4A3UA 4UR7A 4GX8A 4LYPA 3SSZA 1LG2A 2WM0A 1FWCC 4RXGA 5HWNA 4IOTA 1AJ0A 1FVPA 4I90A 3ITOA 1U1HA 1W1B1 3O0KA 1E6SM 2GGEA 3A4WA 2V82A 4O8AA 3W2MA 5FD0A 1ZP3A 3STFA 4D9PA 3ES8A 4WRHA 3SFWA 3G1FA 2CBUA 2PLKA 4PUWA 4LRTA 3AZRA 1XSIA 3GYEA 3V1HA 2DV0A 1UR2A 2WO5A 4RPPA 3W81A 3O3RA 1OC7A 4GYJA 4ACZB 2VFEA 3NL3A 1JXKA 3W86A 2PWDA 1XX1A 4GGHA 4QE4A 1KV5A 3ZSTA 1D3GA 1JPMA 1ZJIA 3B8WA 3BLDA 3UJEA 1R9YA 4N6EA 4HHLA 4ML4A 3NPXA 1KD0A 3E0WA 2CLEA 2YCKX 3NL2A 1Q65A 4W87A 2EPKX 3PUGA 3PTMA 3OU8A 4UTLA 3AHTA 4OOUA 3PK7A 3MSRA 3WUGA 3NJ3A 1WXZA 4G2PA 1ICPA 2ZR5A 3L5LA 4O15A 3TJLA 4HNUA 5LXXA 4LVAA 1VBHA 3H2AA 1K7EA 3D0CA 4QDWA 1ADSA 1KR0A 4JFUA 3GDKA 4JL1A 4X3ZA 3M0ZA 5CG7A 2ABBA 3SIZA 2GDVA 2O55A 4ZOEA 2QF8A 4XZMX 3OA5A 1QW8A 3D3FA 3CZEA 4PBEA 3DFYA 4AQLA 2VUNA 4ZQMA 1JZ4A 3R4IA 3V0SA 1TPC1 4DY1A 4G2DA 1CDGA 1KM2A 4XSLA 3WLSA 2E9MA 3PZGA 4HK7A 3IVUA 3P67A 2BBFA 4J27A 2HPIA 4WEVX 4MB1A 1HFBA 2OU4A 1Y65A 3NDZA 3RN6A 1GEHA 4E6MA 3W1MA 2WBGA 3S2NA 3GC2A 1HKWA 4R7OA 4XK2A 4DBUA 1JZ3A 4KRZA 1EQPA 3KBNA 3PZUA 2HNEA 2WVSA 3EXSA 1XWYA 3WQGA 1YTDA 2W4XA 4V1YA 3WBWA 1O7AA 4NSBA 4RNJA 2O0TA 1V0NA 3VOIA 3EA1A 1NDWA 2A3CA 5XIMA 2BX7A 4AXKA 5CGMA 1KB3A 1IZKA 2HCVA 3BLKA 1DQWA 3QTGA 1MQPA 4RZ6A 9CGTA 4OIFA 1Q63A 1RPKA 2AOSA 3AIVA 4O1BA 1H2JA 2DUZA 4ZL1A 4HZMA 3H2FA 4S39A 1DPMA 3WBYA 4J2MA 4GCXA 2Y0FA 3RU8X 2XP8A 1K8YA 1RVGA 3I10A 4DPQA 3CNYA 2E09A 3QYSA 2X1TA 1W37A 4PMOA 1WKDA 3IACA 3PZ9A 1FH9A 1KR1A 3G2GA 2BWGA 3LERA 1ZCOA 1S5TA 2OZTA 2I17A 1LT7A 8XIAA 4JHMA 3IIXA 3CWNA 5M3WA 3EWZA 1E40A 2EO7A 4GD0A 3ITYA 1AZ2A 2QF7A 1MVYA 2QDEA 3C86A 4GKTA 5DCDA 4E3VA 4GJ1A 3NQMA 1Z89A 2QULA 4UFHA 3FN9A 2VOMA 1UH4A 1D8CA 3UWZA 4WDWA 3O5OA 4R9XA 1WAWA 3ANYA 2R14A 1C91A 4LAXA 2XFYA 8RUCA 3EWUA 4N9BA 1X96A 2R24A 2BFGA 2Q09A 4J3XA 5FEXA 1NP2A 4N9EA 3BL3A 3W7GA 2ZXAA 1UD3A 1KRCC 1T6MA 1C7SA 4XZLX 3W28A 2BTMA 4Y9AA 2PCEA 3RJYA 3GSMA 1QCWA 2ZQ0A 2OX1A 3KVLA 3WK2A 1HJXA 1CW2A 3MHUA 2VC9A 4LAZA 4G1KA 3SAZA 3BXWA 4TR9A 1LQ0A 2BODX 2RHGA 3WG6A 5A94A 3AROA 2WSKA 4GMEA 2GYIA 3WKZA 1J93A 1U1JA 3UWQA 4ZQOA 3M0HA 1H7RA 4LUYA 2R91A 4JY9A 4JYSA 2TSYA 2BGQA 3DBNA 4UQDA 3LPPA 3WNMA 5LIKX 4OT7A 4DRMA 1DIDA 5A8OA 1CB7B 4AWSA 1CXHA 3IPWA 5E6ZA 1YEYA 5GPGA 1V3KA 2B7QA 3UVAA 3GHSA 1TTIA 1JDCA 2O4MA 3O5GA 3DKJA 2PEVA 5A95A 1LWJA 2PDMA 2P4VA 5CZ0A 1U2YA 3CBWA 1P6CA 4AXNA 4US5A 5PTDA 1FKIA 3TOYA 4PB5A 4XD3A 4J5NA 1GCYA 3MVTA 3GLCA 2BY0A 1OHLA 3HZ3A 4PUMA 3ZVHB 1EOMA 3NEHA 4TU1A 4LRSA 5FACA 4MZ1A 4KERA 3NEVA 1M5YA 4D6EA 1PDZA 5A6KA 3GH7A 3HTWA 3UBPC 4DYJA 3I68A 1B90A 3V5OA 4IQEA 3ONCA 4RW5A 1TPWA 3SBFA 3QN3A 4PB3A 1XLHA 4OWGA 1A50A 1O5KA 3GAYA 1OIFA 1GPWA 2FMOA 2EQDA 2H3DA 3KXQA 3LPFA 2XZ9A 4D71A 3UF9A 4GOAA 4LU0A 5G4EA 3M44A 3KAIA 2WJFA 1RBLA 1FA2A 4URIA 2RFGA 5B7ZA 4MSSA 3OLGA 4GI8A 4CN1A 3KDNA 4S3AA 4RDWA 1QT1A 5ABHA 3TWAA 3OQ8A 4Y8EA 3U9IA 5C9XA 1AD1A 2B31A 3TC6A 4UOZA 1R2SA 4GXMA 4CU6A 2QCCA 3UXDA 1OCBA 4WY0B 3I6TA 2BVYA 1E56A 2P5NA 3GVRA 4GVIA 2WCAA 6ALDA 1UOKA 5JBFA 5F2LA 4MADA 3EIPA 3LS9A 3OIXA 3BSGA 3CO4A 3OODA 3S1XA 4IZGA 1VBUA 3ZJ8A 1R3QA 3W1TA 4AD0A 3LPOA 1L6WA 4MLJA 3EEGA 4HA4A 2HV5A 4RNIA 3SDOA 3UNDA 3VYLA 2WMFA 4ACYA 1D8WA 1DTUA 1GW9A 1KFEA 4JNZA 3N4FA 1TREA 1OGSA 3WQEA 3VZZA 1KM3A 1JNTA 2DSKA 1WV2A 1W3KA 1O60A 3ARQA 4K8HA 3HOJA 1F3XA 1RP9A 2CW6A 3FSTA 2JQXA 3P0WA 1LDCA 2EPOA 4DRKA 5G1YA 2W92A 1UZ4A 2QYGA 1P6WA 3N13A 5J8LA 1EKOA 5KZMA 3NFUA 3I3DA 1UR0A 1EF3A 1UWSA 1H63A 3T2QA 2RQSA 3DXIA 4FP1A 4H2HA 3N4EA 4GY0A 2QUUA 4BI7A 5D30A 2V9DA 1FWEC 4YIWA 3TTQA 3VDBA 4Q4SA 1V6TA 3CMGA 3ABSA 3QQWA 4LYKA 2YKKA 4HBOA 3LTSA 3R11A 3RRXA 3WLRA 3NOYA 3CWHA 4FNTA 1KFLA 4P7QA 5LXEA 3B0XA 4DX3A 2XYLA 4AVFA 1ZS2A 4B3LA 3CQJA 4JFWA 1X1OA 1A5AA 3BMBA 4LV4A 4XO6A 3Q67A 1ONWA 4OUIA 4A29A 1X1NA 1VBGA 2P0IA 4GIEA 1VLIA 4XO7A 3S6OA 4CGTA 4OV9A 4UTWC 2PGFA 1EB3A 2OEJA 1V5XA 1AK5A 2V2CA 4TIMA 3SN4A 3ZJ6A 4H3DA 1VLWA 3OLEA 4WQ6A 1B9ZA 1UW9A 1HKKA 3EDFA 4M24A 1H1ZA 1BQCA 2Y8KA 4Y9OA 4Q8QA 3PG9A 1DXEA 5I06A 4ZPVR 4XD6A 4YVPA 1BGGA 5K9XA 2YBTA 3OOBA 1EIXA 1MDLA 3VD3A 2VUYA 4FIQA 3NGJA 1VPYA 4KW2A 3LHYA 3GX9A 4JFLA 1OK6A 1F4HA 1QPNA 4MFEA 4UTTA 4L56A 4LGXA 2CESA 5F2MA 3BK0A 3FCPA 2X42A 3QVQA 1RUSA 4YCPA 5G4WA 4RE2A 3AMGA 3RPDA 2GVEA 4ZQCA 5L9FA 1AODA 3BV4A 3MANA 3ZS4A 1UUQA 2MLYA 2RUSA 2Y1HA 2FPYA 3LRKA 3FGCB 5A8GA 1HL8A 1SO4A 1VGAA 4XZWA 4R88A 1GOIA 4FLRA 5GJPA 1OG0A 3NQAA 5FEPA 2FHFA 2WJEA 2BMBA 3PPHA 4UNKA 1RXOB 2D2OA 3AALA 2QHAA 4PCFA 4I6VA 5AC5A 2C71A 3GU2A 2Y78A 4CKQA 3KFTA 1OJXA 3ZJ7A 4H8NA 3BJSA 3T05A 2VMFA 4LCSA 3AZSA 1Z32X 4XISA 1VH7A 1T11A 2EEXA 5FSDC 3GTXA 3UJFA 1AQMA 5LNSA 1RQBA 2DZWA 2Z2BA 1CLKA 3REQB 3CHDA 4JNYA 3GVQA 5EU9A 2VZUA 1MFUA 3R25A 5HWMA 3U8GA 4PMJA 2GWGA 2HWGA 2ISSA 2OZ8A 4NHVA 3MT1A 2VFDA 7TAAA 1XDLA 1XD0A 1H7NA 2GJRA 5DBTA 1ITUA 5CAHA 3E2VA 3QRHA 2CZDA 3TOPA 1VENA 1RCOB 4D72A 3OZOA 1HO4A 4S2BA 1VC4A 3IIPA 3MJYA 1C93A 3APTA 1DE6A 3A3XA 3BSMA 4N0RA 4D6HA 3BQ6A 1ZAHA 2VZVA 2ZVRA 4MDPA 3QPEA 1DP0A 3CO8A 3T4WA 3LPGA 2G96A 2Z29A 4PGLA 3SEPA 3NSXA 1QUMA 2X7VA 3WMBA 4TV5A 3R8RA 3CHFA 2VEIA 3M46A 4G7FA 3QSRA 2XPKA 3AI0A 1VRXA 4HU4A 1GTHA 1CCWB 1K8ZA 3NNTA 5D9MA 2PA6A 5C8BB 2C16A 1UP3A 4FLSA 2BOGX 3B9NA 3B06A 3UI6A 3K30A 3PR2A 1UUOA 1XW8A 1J4HA 4HSHA 3WD3A 1XHGA 4ZO6A 1C3FA 1F4AA 5FJJA 4G9PA 3RIKA 3LXCA 3GR8A 2J6VA 3BE7A 2VFIA 1BXNA 4V2XA 4HMNA 1YE4A 3WQVA 2VURA 5K2ZA 1K8CA 3UWVA 3FXGA 1DWHM 3N12A 4UOJA 4P8UA 3M64A 4JGDA 4W93A 2AWGA 3P74A 4JQ1A 4US6A 1TPEA 3OHIA 1BWKA 2POTA 3MDWA 5JIPA 4U2YA 3AXHA 3N6JA 4JL2A 2RUQA 3DH7A 4LSBA 3ZMRA 1UR9A 1EBHA 2ZVIA 4INFA 2O92A 2A3BA 1SFJA 3E38A 4QITA 4DIPA 2YCLB 5GVJA 2EPNA 3PBWA 4FOJA 1ITXA 3PWAA 4C6CA 7ENLA 3EOSA 3ZFHA 2UBPC 4TX6A 3W83A 3WQ5A 2AAAA 4Q8TA 3VXGA 2JALA 1ZFJA 4MMWA 3M43A 4Q22A 4EVZA 5A2CA 4HYWA 1BKHA 1OABA 3VD4A 1V6UA 3AS0A 1DWFM 2JZVA 4YNGA 3M4HA 4BF7A 4DF0A 2ZICA 2AQWA 1TX0A 1YADA 1LBMA 4TO8A 1IWAA 2NX1A 3AWNA 4PMDA 3DFSA 3T55A 1ZGDA 4C6OA 1E4NA 1CXFA 3KBMA 1ENUA 5IBXC 1HTIA 2WK2A 2WZIA 5AOUA 4TW6A 4ZOAA 1EGMA 3UCDA 2Z0IA 2ALDA 2Z24A 1FWAC 3V75A 2FH6A 1QHPA 2ZTJA 3C52A 4OTKA 4KT2A 3LB0A 3SUWA 4PL2A 1XC6A 3G5EA 4X63A 5AHMA 3SCNA 3TYBA 3UR7A 3VIJA 2X1UA 2VC7A 4AZCB 3TU9A 1EEPA 3ECQA 4DXVA 4B9ZA 4CNOA 4XUYA 3EX2A 3SUVA 1A49A 1E15A 1RBAA 3GHRA 2DZSA 2VD9A 1W3NA 4H6QA 5TD4A 2GUYA 2ZUNA 3W3OA 1W9PA 1QI2A 1DKWA 1UA7A 2G0WA 3BDKA 3TW9A 4AB4A 3CAKA 4X0NA 4ZBCA 3DN5A 2P0OA 1NSJA 3KL3A 5LA1A 3H23A 2OSWA 2WMKA 5K3VA 3JZEA 2Z28A 3KABA 1A47A 3LTPA 4F66A 3ARTA 4OQVA 2EAWA 4PTWA 1MRAA 4C6FA 2BG5A 4O16A 2OR2A 4PMYA 2F23A 1X8CA 4JTRA 3AISA 3GW0A 2YDQA 4AHOA 1XIBA 2MUCA 3FS2A 2VFGA 1S2UA 3RMEA 4X60A 1XCWA 2E68A 3TAOA 7TIMA 2Y8VA 3VNJA 2DZXA 4QE5A 3ABZA 1EQ3A 4ZFCA 2DQXA 3NOEA 2Y88A 2Z2AA 3R0UA 4Q8MA 2VDHA 2WVUA 2XN1A 3EPMA 4PFHA 4XBSA 5D33A 2YCEA 4M6PA 3W70A 5M1TA 3H7UA 6XIMA 4YTUA 1W5NA 3VC5A 3PZTA 4DH0A 1GRJA 4BF8A 3THUA 1QMLA 5BU6A 1F2JA 3PUDA 1G4TA 2VHLA 1JFXA 1CX9A 1V7YA 4MZYA 4D1IA 2CXEA 3M7SA 4ZPWR 1TJ2A 3WUFA 3AU6A 5TQLA 3GB6A 3W9ZA 4TQTA 3EB2A 3VTRA 1LLOA 4XZBA 3NWRA 3GNOA 5I03A 2ISWA 4QISA 4Z2JA 3JRKA 5CLWA 3N25A 2GL5A 2JFEX 1QRQA 4WGXA 5E70A 4DM1A 1QI0A 4MY1A 3NVTA 4H00A 4B5UA 3ZT6A 2XGIA 1CYGA 3KP0A 3KRBA 3H9RB 2VWSA 4D8LA 1ME9A 3L9CA 2GVJA 3BAKA 1MDRA 3K4DA 4EP8C 3LCIA 1JNEA 5E09A 5LNRA 4O12A 1AH4A 1EUAA 3TYDA 1UWUA 5EYWA 5CG0A 3I3BA 1QNPA 3ARXA 3DG6A 2A0NA 3WH7A 2WANA 2WWCA 3WD0A 1YKWA 3VD9A 2V0TA 3QV6A 4AMCA 3P84A 3WMSA 4QSHA 1BVZA 2VXNA 2V2DA 3PF3A 4GVHA 2VR5A 2YL8A 3QBUA 2YL9A 3ZT5A 4YTSA 1PO9A 4ORMA 4QJ3B 1PL9A 4PCSA 7A3HA 3WK3A 4JN7A 1OFQA 1A5OC 3KVJA 4YWSA 3H54A 4R85A 3JXVA 4E0CA 1QDSA 3W1AA 4AH7A 5HINA 2QUTA 3P5YA 2J8GA 2QCLA 3TH6A 2PWGA 4JIEA 3WF2A 4ZO8A 1KM0A 2NUYA 5HPCA 3S4TA 2H9AB 4G7EB 1XH1A 1XR2A 4EANA 1EC7A 1FAPA 1E6RA 3R0DA 4XAPA 1LROA 2ZE3A 1KFKA 2GQ8A 3KBWA 2B7PA 3IJQA 3NZQA 3CV1A 2PF0A 3TWBA 4JTJA 1GVFA 3K5XA 4AZHA 3STPA 1W3TA 5HJLA 1DE5A 3H21A 4GUJA 1VFLA 4FF7A 1E9LA 1HJUA 1WUFA 2Z2UA 4D1JA 4GABA 3MDYB 1VP5A 3EX1A 4KIEA 4FX8A 1O5QA 3BOLA 4JIQA 3G24A 3ABOA 1JPKA 5G1TA 4RE4A 2GQ9A 4B4FA 2XGZA 4CD4A 1JZ5A 2CZVA 2YGYA 2HMCA 2AQVA 2BASA 3F4NA 2W79A 3C3UA 3Q4DA 3N9KA 1DV7A 1GGOA 1S5VA 1UBPC 2TRSA 3EX3A 3I6EA 3CLWA 4X9SA 2WC3A 4R53A 3UY7A 1PKMA 3FYPA 3PAJA 3WY1A 4FX6M 1DXIA 2GVGA 1LUCB 2P76A 5FESA 3HFYA 3U7BA 3GFZA 1ZU8A 3W07A 4RLIA 4LAWA 1GOKA 5HQLA 2GSEA 1V02E 4K7VA 2DUXA 4TVCA 4QNWA 3UXIA 3WQ6A 3W00A 1LT8A 4AZ6A 4JKMA 3A47A 4QCFA 1AMKA 3B0YA 1UR8A 1TZ9A 1PBGA 4TUFA 2DVUA 4DBEA 5HUAA 1H3GA 4AVOA 1IZJA 2OYKA 1TV4A 3WEZA 3BG5A 4HHHA 2NV9A 2TMDA 2J79A 3W7MA 3W26A 4QJ5B 1UMYA 4JQ3A 5BXSA 1M3UA 1YBQB 1AZ1A 5A6TC 2DP3A 3N2TA 2V5BA 3CIVA 1ODZA 3GG0A 4DWDA 2JKAA 5JVLA 1XRVA 2NWSA 2QPSA 2INZA 5TNVA 2B0MA 4Z1DA 1UD5A 3NQ6A 5A69A 1JYWA 1LORA 1BG9A 5C5YA 1AG1O 2GJNA 3MKCA 3EB4A 4JYEA 2G4JA 3AXMA 3MCOA 2PD5A 1I4NA 2CLPA 2EF9A 2GQAA 5IHSA 4JIRA 1GK8A 2JEPA 5FJRA 2NW0A 5I7GA 3GC4A 3IK4A 4CQAA 4BA0A 4R7JA 1H61A 5I5RA 5HUOA 1V03A 4Q4QA 4U5IA 4JFTA 1REQB 4NUWA 3GH4A 3WZ0E 2ZA2A 5ABTA 3GFXA 5J04A 4DUXA 4Y6GA 3P3BA 3TQKA 5FF7A 4M29A 3VKAA 3C2OA 3BC9A 2V81A 3RX4A 1WPCA 3PPFA 1HKMA 6PTDA 4LUIA 1IHIA 1PCWA 1CLXA 2DORA 3MWAA 1HL9A 3UQAA 3AHYA 4B16A 3GNNA 1TG7A 2YZ5A 3GZAA 3CHCA 1CGYA 4S2CA 2Z6JA 1TJRA 1XLAA 2DDXA 3RLUA 1FWNA 2OYMA 1JCLA 3NO1A 4GA8A 1TV7A 2F9RA 1UCWA 1QO5A 1M41A 5DT5A 4IG2A 1SJDA 5FJIA 3BUVA 1PYMA 4ZE4A 2ZDRA 3VVGA 3WJZA 1TA3A 4XD5A 2AMGA 3OBKA 3PUEA 4PMXA 3CQ0A 1UKSA 1Y0OA 4LUSA 1VCVA 1W17A 1P6BA 3UZZA 2D22A 1TRIA 3TDBA 4U28A 1LOQA 5DFAA 5MF5A 2VGIA 1D2KA 2ZX7A 3DGBA 4H4IA 5HATA 1GKRA 1WOAA 2GJPA 2QUVA 3OEXA 1R0MA 1ISXA 4G7EA 2BSLA 4LEQA 4FEZA 4HPHA 1A5BA 3IV8A 2VDGA 3M9YA 5D37A 5T9BG 3TA6A 3LM3A 4IWWA 3ATZA 1HX0A 2NSOA 3P14A 1EPXA 1AQFA 1FWTA 4O17A 3JYMA 1J5TA 3H2CA 2OOFA 1FCQA 5CSUA 4TNSA 3LHWA 5JBDA 3GU9A 4M6QA 2FVKA 2V69A 4DIAA 1Q2RA 1CEOA 5AB3A 3N2XA 2CCRA 2M2AA 2HROA 3B9AA 1YW5A 3MMDA 4QCEA 1A5SA 1OD8A 2GDQA 3TYUA 1UJPA 2VZTA 1QW9A 1OYBA 4QT3A 1J6YA 3SY5A 1DQXA 4F3HA 1UD6A 3TW7A 3B04A 1D7HA 1KFWA 1RH9A 3HO8A 3KOZA 2CPUA 1CWYA 1L1PA 3SADA 4GIRA 1KTBA 2DJXA 1QAPA 4XKYB 5BCAA 4NRRA 3UZYA 1J0HA 2ISFA 3WQCA 2PN0A 2V2HA 1XINA 3K8LA 3BZJA 1MMFA 1S2TA 4KFPA 3PJTA 5A3HA 3WQOA 4C6QA 2G3JA 4BEQA 2YL5A 4AD5A 2KGJA 4CQDA 4J1OA 3FJNA 2CBIA 3L5MA 4W86A 3UZXA 3O9NA 3WLLA 4O2TA 2G97A 3BG9A 5DMMA 2Z1VA 1TWIA 1SO5A 3V5FA 3EOEA 2DT3A 2MNTA 1WBHA 3MV11 2I56A 1FHUA 2NV2A 4WDXA 4BCEA 2XH7A 3W7IA 1FKRA 3AO0A 1E4IA 1OFDA 4XAYA 2C15A 3TYCA 1YBQA 2PTYA 3TK7A 1ICSA 3IJ8A 4AD1A 3KZPA 1HKJA 3NDYA 4S1FA 1TMHA 2PLMA 4U2ZA 4D6DA 1OC6A 2GUBA 2FZMA 2VX7A 1OGBA 1JD9A 2CIPA 1DXFA 4IMGA 1L6YA 3QHMA 4UTIA 3KVKA 3UG3A 2QCGA 3ZR6A 3B0VC 4HK5A 3PWIA 4NXKA 3HV9A 5DX7A 6XIAA 3T81A 5FF0A 3TC5A 2OFJA 4J3VA 4GO9A 1YPFA 3W4RA 5A6JA 4JYFA 1PV8A 2PV2A 1XIJA 1I9CB 5TAOA 3T6CA 3ZO9A 1IEXA 1K70A 3S9ZA 2WJDA 4C6PA 3AYVA 4DT4A 1F6YA 4KRUA 3WFAA 3RGTA 2NVAA 2PPNA 2FZBA 3KAFA 2YJQA 1A5UA 2J88A 3CS2A 5I98A 4XZNX 3D6NA 4J9JA 1C8VA 4JQ4A 1EUNA 4JIIX 2Z25A 3CIXA 2FHBA 3P80A 2W3ZA 2MANA 4Z2GA 3E5PA 1K1DA 5BW6A 1N8FA 4GI6A 3UYCA 1S1RA 1G4SA 3TXZA 1UZ1A 3ZLFA 4A3YA 2WVVB 2X1SA 1L2QA 2WMHA 4UXDA 1V0MA 2FFIA 4C6IA 3COTA 4Y9NA 3HPZA 4XAZA 3ZYZA 3W72A 2QPXA 5MKGA 1M7PA 4UQEA 4CNNA 1B3XA 3TZNA 4KWVA 3VIMA 4O0KA 3EOOA 5CPSA 1A3XA 1GORA 4AC7C 1VJIA 2FJUB 3KOXA 1JFHA 1SW0A 2BY1A 2PV3A 1NWSA 3OYZA 1WDSA 2R1PA 1NWRA 4AY1A 3VIKA 1UWAA 4GQRA 1H7XA 4DF1A 3VMOA 3AMKA 4GE8A 1J0JA 1WO2A 4HZ6A 2R9RA 3K4AA 3ARRA 2RH9A 5BXTA 4M82A 3CAVA 2FAPA 4PMNA 4DRSA 1RY0A 2AL1A 2EKGA 1LP6A 1W8SA 3RGCA 5D2TA 1R2RA 1EF2A 1KKOA 2RSEA 1UQYA 5HDRA 4WD0A 2N87A 2WLYA 3SY1A 5EA9A 1IWBA 3VOFA 2D3NA 3JS3A 5DBUA 2OLAA 4RDZA 4LC8A 5F2GA 4FNPA 2EPMX 2UY3A 3LNMA 5G5IA 4X9YA 2OCZA 4DLMA 1A5LC 3H2MA 1W31A 1V8EA 3LCLA 3UA4A 1B3WA 3RX2A 5CAKA 1CB2A 2IKGA 1W1VA 3NL6A 1QNVA 3UPBA 2ZUMA 1MUCA 3S5ZA 3L12A 3STGA 1XG3A 4LBRA 2Q6ZA 1L6GA 4B92A 3WFZA 3ZWSA 2DIJA 3HV8A 1JD7A 1LG1A 5HJXA 4DRJA 2YR1A 1O1ZA 1SVDA 1JZ8A 4FIRA 1VFHA 4R34A 2KE0A 5LIYX 4TVUA 4O57A 3TSMA 3JR2A 2QGYA 3NL5A 1E6NA 1OCQA 2VQUA 3SW6A 1G7UA 3QM3A 4H6EA 4M5PA 4EXQA 4Q4RA 2X0YA 3EWWA 2BS9A 2NT1A 2ZRUA 3AJ7A 4DBWA 1WYIA 2J78A 4HP5A 3LHTA 2X09A 4ZTYA 3MBDA 1PIFA 2ZXBA 1JGMA 3DZ1A 3HG3A 3OVRA 3OVGA 3EOLA 5DRCA 3SUUA 3GYCA 3NUKA 1RP8A 4GWEA 2BDQA 1YRRA 4FZIA 5CPNA 4G56A 1QK2A 3WH9A 2ZXDA 3FJLA 2POZA 2IMRA 1GOOA 4RV8A 3N15A 3QR0A 4H9XA 4U10A 4IGMA 3Q94A 3LRLA 3GK0A 4IMAA 4ICCX 2E5DA 4IMDA 2QCFA 2CERA 3L67A 4IIGA 1J79A 4S38A 4N4QA 2YL6A 1VIWA 3ITTA 2R1MA 1EOKA 4XAGA 2NVDA 5FJOA 3AC0A 4H7ZA 4RJEA 2RDWA 3RMJA 1T0OA 3GPKA 4NG3A 1V0KA 4PFMA 4PH6A 3IIZA 1KQYA 3WEOA 1E5NA 5KEZA 2V3DA 3V7PA 3B8UA 5SWUA 3VAVA 2PODA 2X30A 5KMYA 3UYIA 4MZ8A 3CEUA 3U5YA 4PEEA 3D3AA 4NL1A 5DLCA 3UF8A 1CPUA 3NM3A 5DMNA 3UQIA 2YZRA 4GGBA 3WBEA 1B30A 5CZSA 2J62A 4YL2A 4QFUA 4RCXA 3B05A 2F38A 2UWFA 1KBIA 3EOUA 4QT2A 3RHGA 1WXJA 3GR4A 1D6OA 5KINA 4F0KA 3N2MA 5H8UA 2GGJA 4EE9A 3C2VA 4FHAA 1V3IA 5H6HA 3PJUA 5E9AA 3FJ6A 4RZBA 4FR1A 3F1QA 4L6OA 3O5QA 1QBBA 3LOTA 4EX4A 1W1ZA 1FD9A 2E7FA 1GJUA 2CLIA 3QOKA 4UQ9A 1QZ2A 2XP9A 3DHUA 1EYWA 4IP5A 5H2ZA 2IQDA 2VWTA 1M01A 3MVIA 1JAEA 1EC8A 4AG0A 3H4WA 2A3HA 3EDDA 1ONXA 1V3HA 2IKJA 3MZ2A 1AMYA 1H51A 2GJXB 2DW7A 2V5LA 2F21A 3W2JA 4AEEA 1R2TA 1W5OA 1KFJA 2I57A 3O2LA 3EB3A 3QH2A 3UQNA 3C0JA 4YTRA 3S0CA 4ODLA 1BEUA 3WMLA 3ZIZA 4LB4A 1EWEA 3W6MA 1YX1A 4GVFA 1AQHA 4AZ5A 3AWOA 1XI3A 2XM1A 2Z26A 5C7HA 4ES4A 3RX3A 3QZAA 3VABA 3AHZA 1S3TC 4QEEA 4YYCA 3WLOA 2PP3A 4DYKA 5JQ9A 2GQ3A 2PPPA 2WQDA 3MP4A 1GQJA 3WNNA 2PDNA 4QDPA 3KHJA 4XB3A 2E5CA 4GKLA 3KOWA 3H8AA 3VAWA 5XIAA 4C6EA 3WQWA 2BGSA 2FDMA 3BAJA 3PZOA 4RR4A 2A7PA 4D6IA 4ZFMA 4I9MA 1TV8A 3V4BA 2Q02A 3FVDA 4ECLA 4UMBA 4IQ2A 4Q8UA 5AVNA 4D6GA 2KFWA 1NEYA 1N2VA 4UR9A 2F61A 3FYOA 4HTBA 2XIOA 4MJZA 5I09A 1HQTA 4I8DA 4W7WA 5J5DA 4OOZA 4HJWA 3SRDA 5C2GA 3R12A 4E38A 1KCLA 3VE9A 4B3KA 2HTMA 2CHRA 3GS6A 2A7NA 3SGZA 3AHVA 3SI9A 5I77A 1XIFA 2NXGA 4U84A 1CGUA 1SFTA 2IPJA 2PWEA 3WFLA 2OKTA 1ICQA 3V36A 4J3SA 2WOQA 4IPJA 3WSUA 2C18A 1TCMA 4ZQNA 3ZM8A 1VEMA 1YMYA 3KCJA 3P93A 2PC8A 4MDOA 4CD5A 3HURA 1XYMA 3SGUA 3RLGA 5HK4A 1XBXA 1ECQA 4DJDC 2ZE0A 4HCHA 4WXYA 5BXPA 2Q3OA 1KV8A 2HRWA 4DZIA 2NQLA 1R86A 3URQA 2EULA 4LCQA 4N9DA 1IEQA 3VUSA 1Q6DA 2VC6A 1D7KA 1NJJA 1BYAA 1JCTA 5AY7A 3HMJG 4MYXA 4AHPA 4QG8A 4K1GA 4DEFA 3AICA 3L4WA 2V63A 1A5CA 3SB0A 1QI4A 3R79A 3GR7A 1KM5A 1WP6A 4MWAD 2D24A 2NZLA 1V6XA 3QFEA 3EEZA 1HJSA 1Q6HA 2G3IA 1P1MA 2J13A 4ODPA 1VQTA 2W27A 2NX9A 1JULA 4LF1A 4HYVA 5BMXA 1OADA 1SR0A 4PRWA 3F2CA 4RPQA 4YVVA 2IUZA 4H2CA 1OD0A 4J35A 1W1YA 4WCJA 4U3CA 4Q4KA 5EPDA 1QPLA 4GUGA 4YVXA 2A1YA 3W75A 3R8HA 4UTWA 3W6YA 1UZDA 1G9HA 3FHQA 4ODMA 1NTHA 2C3ZA 2FIQA 1NFPA 5CC6A 1FBAA 3VDCA 3TCZA 4LJ3A 1JPDX 1SSDA 1UKOA 1FWIC 1F7BA 1XV8A 1YIXA 3SCQA 1R6WA 2LGOA 3E0LA 2F6UA 2C6QA 5D2XA 2W63A 5AKQA 1VB9A 2WKLA 4DAFA 3PTDA 1CBGA 5A8NA 4A8LA 1A3HA 1B3VA 4L4LA 5I23A 4R7WA 3O7UA 1NOWA 4WKAA 2YIHA 3C8NA 4JFIA 2GPTA 4PB4A 1GOQA 1QOPA 3IVTA 4YXGA 2QVHA 1R30A 3F5KA 4JTQA 1FJDA 3UXLA 1NDVA 4QXIA 1G5AA 1H0GA 2XP5A 3A12A 5EKYA 3RJXA 4OJYA 1KBBA 3GDMA 2XIIA 3BARA 4KWUA 2V5CA 3VIOA 4YHGA 2PBOA 1GVOA 3WDHA 2VKZG 1GYNA 1E73M 1A4LA 3N9RA 2PRMA 3MA8A 4MWAB 3BOFA 3T09A 4Z08A 5I6SA 1I1WA 4EPKA 3GXDA 4E4PA 1SUXA 3PBYA 3AMDA 1R3WA 3SJ3A 5LHEA 1XLIA 2O7QA 4QGCA 2OQYA 1QASA 3W6LA 3Q2DA 4NVTA 3AQUA 1ZHAA 3UG4A 2QDDA 3RFAA 4GNVA 5HULA 3ZLGA 1Z6KA 4LUTB 3OIHA 4XG1A 5D2VA 3W2LA 1J6PA 5E0KA 4F48A 4ZCWA 4HU8A 4HU3A 4GVGA 3RXZA 1QNQA 4Z1BA 4FLQA 4LS2A 1W3HA 3OG2A 4MPQA 2C13A 1ZRQA 4KEZA 1W5PA 3WLJA 1T40A 3TJ4A 3E0IA 2QJJA 4ODKA 5LSMA 3VGBA 3L2MA 3ITGA 3P7YA 1DWAM 2E9BA 5D9PA 3RITA 1R85A 2AGTA 4IMEA 2FPTA 4EXBA 3DC8A 1WNOA 3G8RA 4C90A 1R9XA 3HPAA 1V51A 1YTKA 1P5BA 2V67A 1J6OA 4IIDA 4PMRA 2G3NA 1EIBA 4K68A 2Q8ZA 4A8RA 1UR1A 3R6IA 1P0DA 3QFWA 4LYQA 4C6JA 3GQYA 2WW5A 3GW3A 2Z27A 3IRDA 3FAXA 4ZVJA 4A35A 1NVMA 3RDKA 2CKSA 1O1HA 5D09A 1JI1A 5T9CE 3W24A 1XLGA 2J9YA 3HIJA 3IGXA 5B80A 3NRKA 1JCXA 1IQ8A 1W1TA 2VDIA 1VPQA 1AJZA 3U4FA 4IX0A 3LBCA 2WYSA 4ROQA 5CJMA 3KAHA 1JCYA 4DF2A 1W9XA 1MO0A 4IPXA 1NFGA 4U31A 1QVBA 4L64A 2XG9A 4GC4A 3VK5A 3TSBA 4WGHA 1FWFC 1W5MA 3O0FA 4S3DA 1KXQA 5D04C 3MS8A 1SFLA 4H41A 4TW7A 7CGTA 2VJXA 4E2DA 3SCUA 4MB3A 4HBEA 2C1GA 1F3WA 2DIEA 3SZ8A 1QJWA 2ZZ2A 2J4GA 5AN7A 3EKGA 3GZ3A 2M08A 3T0DA 3G0XA 2DJLA 1TWZA 3MI2A 2E4TA 4QSFA 2HZGA 1KGUA 1I2QA 3WLQA 3G6LA 1OC5A 1VBRA 3W37A 3W1NA 1BL4A 1J18A 4UQBA 4WK9A 4B9YA 3CWOX 4RV3A 1J9YA 1XLMA 3KCLA 5K4XA 4LC6A 2QDGA 2KO7A 1E9IA 5CXPA 4Q8PA 1G4PA 4H9UA 1IIGA 3VI2A 4YU1A 3W85A 1C9HA 3GTHA 1EDQA 4JEJA 3M5VA 2C0AA 4IH3A 4TTUA 3XIMA 3VIPA 4Q7IA 1TWDA 1EJ7L 4DXXA 1UG6A 1TA3B 2Z1KA 3B4UA 3HGOA 3IGHX 1TJPA 1O12A 4QG6A 2Q5AA 5CSYA 1Q6QA 4PUJA 1DJIA 4EPEC 3MC5A 4PC8A 4QLJA 3CZLA 4UCGA 1R87A 2WWDA 2QCNA 3TQ0A 4DUOA 1EO5A 4MKNA 3RG6A 3PVFA 2PTZA 1WDQA 4ODNA 3JYJA 2EJ1A 1XICA 3HBLA 5HMFA 1OT2A 1IXNA 2P8BA 1PXGA 5H8MA 3W7HA 3E2SA 3TTEA 4UTHA 4MJMA 6TAAA 3DFHA 4NIRA 1Q3NA 2DH2A 5AHLA 5I3DA 1F40A 1DJHA 2FGLA 3UY8A 1QTWA 4LNCA 3H2EA 4R0XA 1Q4WA 5D4YA 1V77A 3UR5A 1W9DM 3HM7A 3A22A 1KM4A 4L80A 3S1GA 2PFHA 3AIBA 5DIUA 1JDDA 2Z00A 1FH7A 2F8QA 4Z2KA 2PP0A 5CJ5A 3UPWA 3N2CA 1H62A 4O0ZA 1GTEA 2J75A 5DXXA 3N2OA 5G2WA 4ZGYA 5DELA 1DTNA 1VCGA 3ICJA 4EPBC 4ROPA 4UQAA 2EGZA 4LPCA 1FKLA 5BZAA 2VX5A 3P0XA 1TCOC 3FHAA 3M0VA 5HR7A 1XIDA 5HW6A 4GYPC 4KQNA 2ZZ4A 4JN6A 1PTAA 3LQLA 5EMMA 1ESWA 3LSBA 4WOQA 2YDRA 4DJDD 4E2VA 1H5VA 1R7OA 1CXLA 4H9TA 4ATDA 4GBUA 3WNPA 1AW5A 3KAGA 4I9TA 4CEXC 4LV9A 2QVNA 5I07A 4JTUA 4IGSA 1ZP4A 2VYOA 4K39A 3M0IA 1BKFA 4CCEA 2X1IA 3K2GA 1K02A 2FB2A 2QGHA 4FXSA 3WF0A 2E1DA 2HXUA 2LJ4A 1CIUA 3T08A 1PIIA 4UOQA 5C55A 1FWRA 2R1LA 3LV5A 3P8IA 2QQ6A 4IIFA 5JBEA 3DOPA 2A4AA 5HNUA 3VUPA 1K8XA 1HF6A 3ANVA 3ME3A 4XVDA 1OF8A 3BMVA 3W82A 3VM7A 1PZ1A 4JR5A 1POKA 1SR9A 4ZQRA 2QPUA 1JCMP 3CMJA 3AUJA 3L0KA 1DJGA 2I5QA 3W74A 5EL1A 2E6AA 3KAOA 4YN5A 5CZJA 3EMCA 3SURA 3M7WA 3QF0A 2J7DA 2YW3A 5EY5A 3WDJA 3AIWA 1ISYA 5LZLA 3N3MA 2DZTA 1UJQA 4A21A 4W84A 4F0MA 4GH3A 5DF0A 3WNKA 1ISWA 1WCGA 2WLZA 1GVQA 2QJGA 1PVNA 2PDQA 2LPVA 2YYTA 4B4HA 3E2RA 1T99A 2QV4A 3BCFA 1B57A 4JY8A 5KETA 1ZNNA 1PPIA 4NI8A 4HMEA 2D0HA 3KUMA 1BGAA 2PLJA 3DUGA 3UR2A 3ZSSA 4ZSUA 4F9DA 2ZQUA 2GK1B 2OWWA 3I65A 4V15A 4F0HA 4FX7A 4IHCA 2HQAA 2C79A 2GFTA 4MY9A 5FI8A 2E28A 3F2DA 2AAMA 2A3LA 2VRJA 1NELA 1TYGA 3SCRA 2V5DA 3UERA 4K36A 3KOYA 1ITQA 5A6AA 4FAPA 1CI1A 2WNZA 1ME8A 4TOQA 1QHZA 1SZEA 4K1WA 5C9ZA 1HL2A 1H1YA 1CNVA 4PMUA 5K4ZA 4L61A 1Z42A 3KBJA 2HISA 4U5KA 3VZYA 2YDSA 2HE8A 2FZDA 2DSVA 4GNJA 1XM3A 3HGSA 4QP0A 4OU1A 1ZJHA 3EBVA 3KOFA 1KCXA 1E0UA 3NM1A 1HJQA 4HPXA 1NOUA 1HP4A 3AS3A 3LM7A 3KCEA 3MI3A 2YFNA 3H7VA 1JRBA 2NLIA 5JXQA 5D2YA 4O8RA 3QKZA 2NXHA 2IF4A 4B91A 3MUAA 1RA0A 4WJ8A 2VCCA 1JQVA 2RGLA 3QQ0A 4GUHA 3LQGA 2Q71A 4K3ZA 4M0XA 3O5RA 5A1AA 3MCNA 3LHZA 4AW7A 4GHRA 1UBSA 3C5QA 2AKMA 4Z42C 3KRSA 4QJ4B 3TC7A 2GGIA 3LN3A 4JEQA 4ADSA 3GO2A 5IFTA 4FF5A 2ACUA 4DWSB 5LNWA 1PDYA 3C0QA 3THCA 3OPSA 3TE9A 5F4SA 3PB2A 4YTQA 4BS0A 3LCWA 4LAUA 4ENLA 3WJWA 3BLOA 2XVNA 5CZTA 4IQDA 4Q4MA 2OEKA 1GHSA 4DO6A 1QNOA 2WZMA 3QC0A 4NX0A 3EX4A 2OXNA 3B8DA 5HXMA 4L9ZA 1CT5A 3PS7A 1QFEA 1S39A 1M68A 2DU2A 3KZSA 3W0KA 1OX4B 1HG3A 3L4VA 3UA3A 1M65A 2W0UA 4UTTC 1KCZA 1F3EA 2JEQA 4JN8A 2J7FA 3ZR5A 3MHFA 1HVXA 5BRQA 3W02A 4IXHA 2DT2A 3S2MA 1Q5MA 1MNSA 2J47A 2J7BA 5GJMA 1O5XA 1E4LA 3VOJA 1P0BA 2FMNA 2WNWA 2BVDA 4YJ5A 3S6DA 4JCLA 1LQ2A 3HPXA 2UZ5A 2M1IA 3V0UA 4XX6A 2VEGA 2FDSA 4DBSA 1KGXA 2VT0A 2YCIX 2HJPA 1IEWA 3UJSA 3MP5A 3LLFA 3W84A 4QX4A 4W5ZA 4MKSA 3G6MA 3WQPA 1X6NA 4AZGA 5LNUA 3RUBL 1W0MA 1MEHA 5M5DA 3FA3A 1UMLA 2QCEA 4JTGA 4FPSA 4BF5A 1V6YA 3PY2A 1E3XA 2CITA 4NQ1A 1Y8BA 4S3BA 4HT3A 4KPLA 4NXSA 2V5JA 2BY2A 1X7FA 2EG7A 3SM0A 3N6QA 3WEMA 4MOZA 1Q85A 4OBTA 3C0SA 3TXVA 3SSJA 4DWSD 1XS2A 2VX4A 4EXAA 2D0GA 3TQVA 4DN1A 5CKSA 3H4XA 4DWSA 3VCNA 2DEPA 3W7LA 3IANA 4HNLA 1L8NA 4M8UA 1Q66A 4HHMA 2QR6A 2ZCGA 3NSMA 1JI2A 2OZ3A 4PYSA 4M1RA 7REQB 4CCZA 4O1FA 3S5YA 1O6IA 5KZEA 5IHRA 4NAFB 1SO6A 4AD3A 3IJ9A 4E2OA 1XLBA 3DIPA 1Z9AA 5E0CA 4ERAA 1W32A 5C9WA 4XTDA 4U33A 3NGFA 5AYIA 2BOEX 5LIWX 4IXXA 3WYZA 1JDAA 1DIOA 3EWCA 2O9TA 2DG3A 2ACRA 2R1NA 3ITLA 4UZSA 3AIQA 3HG4A 4PEKA 2RDXA 4V27A 3H55A 2D1ZA 3BTNA 1JJKA 3RPMA 3M0LA 2F6KA 3A23A 3AS2A 3FY1A 1TZZA 3BWWA 2QEZA 4ZXLA 5FL0A 1K9EA 2TPSA 2GVYA 2A6NA 3TKFA 1P0NA 2HVNA 3I6CA 3Q58A 1H1NA 1XF0A 4QROA 4Y96A 4TW8A 4WKHA 3VIIA 5BWFA 5DO2A 2ZX6A 5A8QA 4JCMA 1SW7A 3MYPA 3W23A 1TR9A 4S23A 3RM8A 2ZDSA 4CNSA 5CCZA 4KGJA 5U7SA 4MWAA 2PBCA 1NARA 1J12A 3WENA 2B7OA 3D5HA 4H1ZA 1OWQA 1UQZA 3MBFA 1FTXA 1TWWA 4D8ZA 1RR2A 1XLFA 4P7OA 8TIMA 2PWHA 1OGGA 3LA4A 4AZ7A 2A6LA 3APYA 4WIWA 1TSIA 2VVNA 3CV7A 1J0IA 3MZNA 4TMCA 1XSJA 2Y70A 1NH6A 3G3DA 4QE1A 2FZ9A 4GO8A 1LLWA 4DNMA 1XBYA 3MUZ1 2Q8LA 1IYXA 1HW6A 2ZX8A 4JIPA 4DJDA 2V68A 1BSIA 3TR9A 3ZWTA 4W8LA 2JIEA 4KIRA 4ZPTR 3N29A 4PULA 2QCDA 2H9AA 2VEFA 2PDPA 4DO4A 5HKGA 1H5YA 1UA3A 1HKVA 3F4VA 2BVWA 3LUTA 3VO0A 1FWSA 4DZ5A 3H2OA 3OBAA 3Q65A 4DRNA 1X6LA 4YPJA 3O5IA 4PA8A 2NQZA 5CC5A 2WSQA 4M80A 7PTDA 1N82A 3MJMA 5AC6A 1TMLA 1YNQA 2BXYA 3O6CA 4AZIA 3CEPA 1UD2A 2FZ8A 2GVLA 3PBVA 1FH8A 2NQHA 2ACSA 4EWND 1S5MA 2XU2A 2TODA 1MZHA 3NZRA 4MTVA 4AIOA 1H7WA 2WZTA 2A3AA 4DRQA 2RDUA 1BF6A 4MNJA 2QIWA 3GG1A 2YLLA 3GTIA 5HNNA 2NWRA 1G01A 4L7ZA 2I1OA 4OBSA 4W5UA 4NKCA 1E4MM 1BPLB 1KXTA 2RURA 2MPHA 1D3CA 2DH3A 5HMEA 5CQ1A 2WCGA 3BGAA 1VIZA 4JX5A 1E55A 4HSNA 1A0CA 4GZJA 2JIWA 3QW3A 3T07A 7XIMA 4UFMA 1Z41A 4LS1A 3PZNA 5F1UA 4CD8A 3CTTA 5T26A 3MQTA 2NT0A 4MJ4A 4L4OA 1JVNA 3KWSA 3VMPA 1ZALA 5CLTA 4UUIA 1U5HA 3RF9A 3MSDA 1F3TA 1OX5A 3FLUA 3UCQA 1EX5A 2INEA 2A79A 3ITCA 1R47A 3M0XA 4LTSA 1JUBA 4NZCA 3DHFA 2X16A 4D8AA 1MYRA 2J8TA 3DG3A 2CLOA 5D32A 1PE1A 3GTNA 1KXHA 4GLEA 3R2GA 3M1ZA 4MIMA 4HQVA 4CQBA 8XIMA 1FRBA 2OJPA 4JQ2A 5GPRA 4Y9PA 5DY3A 2IKHA 2XSXA 4K38A 2IW0A 4ZSTA 3UT0A 2VGFA 1US2A 4WXZA 2ZA1A 4N4PA 1NDYA 3UWYA 3BCDA 3K1GA 4AEFA 2Y5JA 2VL4A 1PBKA 2C7FA 1VYPX 1MSSA 6REQB 1LTDA 4LAKA 1W3JA 2DZVA 1SSGA 2PD9A 2JKEA 4DHGA 3SQLA 3LMZA 3DHDA 4GZ7A 4KR0B 1MI3A 4JTTA 4TXEA 2O4QA 4J3UA 3E49A 3OZMA 3DFNA 2XH2A 4IMFA 2BHYA 3E9AA 1QPQA 4GGQA 2ZX5A 1EP2A 4HB7A 1XDJA 4JTKA 1D7FA 1IV8A 3TDFA 1G1YA 1RV8A 3DBPA 3P62A 3UWWA 3TROA 5FJPA 4Q8NA 3GH5A 1W3IA 1C90A 3C6CA 1VD6A 4W4QA 1TVNA 3T2PA 1RD5A 1OT1A 3C2FA 4J40A 1FKGA 1OFPA 3CQKA 3UNTA 2CLLA 3N73A 3E0FA 3ZQ9A 4PUEA 2OT1A 3A64A 4F0SA 1FFRA 1HXJA 2H90A 2ISDA 4UIOA 1YHTA 4CUCA 3B9DA 2JKPA 3YPIA 2E8ZA 1QHOA 5I79A 3B03A 4IQCA 1RK5A 1AD4A 4IX2A 3SQSA 1GYMA 5EFFA 2CHOA 4DB7A 4BF9A 3THQA 2ETNA 3QZ6A 3W7RA 3VKCA 4HNVA 1EJXC 2WM1A 2EXOA 6ENLA 3BO9A 4W8BA 5FKYA 3W38A 3LZ3A 4KCWA 4JTDA 1M5WA 3BANA 2Z4GA 3G1XA 1TPFA 1VKFA 3A5VA 4A2SA 1SMDA 4GIVA 1UKPA 1ZPTA 4UCFA 4M81A 4XKYA 3VGGA 3DYOA 1XGEA 2J27A 3W1LA 3WL1A 2XVGA 4HTYA 4W85A 4HPNA 1KWGA 2VELA 4FALA 1Y0EA 2VX6A 2DT1A 1FDJA 1SFSA 4AAJA 2WMIB 4M6UA 2VEPA 3WLPA 3UZ5A 4J2PA 2EHHA 2ZRXA 1M9HA 1TQXA 4XVEA 4I5RA 3G1YA 3MV01 4WY0A 3OLDA 3H6OA 1S3HA 5IOBA 4ZOCA 3L0GA 3EPOA 1U5JA 1U83A 1XFBA 3FDGA 4GH1A 5EMLA 4ZO7A 3VA8A 3LCXA 3KCOA 3R1ZA 5CPQA 5DCEA 1TR1A 5TF0A 3ODKA 1SJAA 3NPVA 2PDIA 1F5ZA 4WSKA 2WNNA 3B7XA 1E6PA 2HK1A 3G1AA 3PBMA 2WBKA 4M56A 4NI3A 3SQMA 2RDTA 4JX4A 1CGVA 2VFFA 1CGTA 1H50A 1POJA 1XIGA 1UOZA 3L68A 1JEZA 3NTPA 4IG2B 1I2NA 2R8WA 2I5GA 1H7PA 3NQ8A 3TYAA 5IM51 4ML9A 1K9DA 5EGRA 4ADUA 3P61A 3KW3A 3U6WA 2MNRA 2CBVA 1JDFA 5AFDA 3PJWA 1VEPA 3GIPA 2ZR4A 4AIUA 3HQPA 4JNMA 4JYDA 4RX0A 5AHFA 4WSJA 1CGWA 1Q6LA 1LM1A 4QLLA 2WJZA 1T8XA 3WQ4A 3NR0A 5EFDA 2VOTA 1Q6CA 1R3YA 1R3VA 3A9BA 3VILA 3URNA 4R5EA 5D9NA 1QATA 2EPLX 3E96A 4NASA 2WNQA 3UZWA 2ZWYA 1FKHA 1C8XA 2GDUA 3O07A 1MW3A 3CB8A 3ERPA 5C0QA 3W22A 3PRDA 3P82A 4LUJA 4MHBA 3TUUA 3W2NA 1FP8A 2HE5A 3LLXA 4IJRA 3GXFA 3IS4A 7REQA 4F2TA 4I3GA 2VN1A 4BQ2A 1XLDA 1PTDA 4K37A 2PP1A 3ZJKA 5EB8A 4DJFA 3PRAA 1UR4A 1XYBA 1LOLA 3GVWA 4HNOA 4NAEA 3R58A 1PSCA 1RZMA 3QR1A 2AMXA 3EPNA 4UTJA 4AVNA 2IPGA 1J0YA 5H91A 3D46A 5IDIA 1DJNA 3G3MA 1DJYA 1BQGA 3BLEA 3DESA 2CZFA 4ILSA 4HMCA 4Q3MA 1RA5A 3OP2A 4IT1A 1S2CA 4DXKA 3N1AA 4CCDA 1XLLA 4KGLA 5GQBA 4NYUA 1XIMA 3NZPA 4C7FA 2PS2A 4JFSA 4Z0SA 3V3WA 1QBAA 1GVIA 2OWCA 4WDUA 5CSSA 1RSCA 3C4UA 3BVJA 1AW1A 2YXGA 1OY0A 3UG8A 1FDZA 2CYGA 3N11A 1B1YA 3SGGA 2OSYA 1K3UA 1XL9A 4AZCA 2E1WA 2WXDM 5JH8A 3BW3A 1ZAJA 4FOUA 4TMBA 1F8AB 1UIPA 3OZYA 5AYBA 4HOWA 4X22A 5F4WA 4XWUA 3LX9A 4UBPC 2W67A 3QY8A 3CJPA 4XZIA 2RUDA 1G6CA 1H09A 3QC3A 4PL1A 1JNSA 1DHKA 3DECA 5EBUA 3CT7A 1GOWA 1IT8A 4KS0A 1SJBA 1WZMA 3KRUA 5BXJA 3POCA 2C14A 3EA2A 1Q6UA 3QV9A 1W54A 1XYAA 2OTDA 3ITXA 1SZNA 1ME7A 5D8ZA 3W29A 1UPMB 3EDEA 4DO7A 3L23A 3UETA 2OO0A 1KTCA 5HANA 3R8GA 3LTYA 1BLIA 3LI1A 2BP1A 4E3TA 1GZ1A 1TPUA 3OLIA 3I7RA 2DVTA 4EAMA 4HN8A 2X1RA 4DZ3A 1X1ZA 4UNLA 3ABRA 3QY7A 6REQA 3GVVA 3LI0A 2H8ZA 5HQEA 1T41A 2FZNA 2PCQA 2ASHA 2EJAA 3LUOA 2H3BA 4PCPA 2Y85A 3H70A 1IE7C 3TLLA 1UR3M 3CQHA 1FX6A 2V38A 3P5ZA 4JFKA 1M53A 1GUVA 2UV8G 4DUWA 2DFAA 4O10A 2W6RA 3CHEA 3APGA 3KL5A 5D2WA 4RNFA 1WZLA 4OGZA 4JDYA 1JZ2A 4UFKA 3LHUA 4NNCA 5IDZA 4AWUA 4ATLA 4C65A 4LT9A 1VJZA 1E70M 3DG7A 2IXVA 3WBAA 3KTSA 4B15A 2FLIA 3LXAA 3AYSA 4A8NA 3MY9A 1BF2A 1TV2A 3H22A 2E6YA 1EBGA 1OFOA 1QPFA 4UNIA 3A4JA 3EMQA 2DSWA 3L4XA 5I3KA 2HXTA 4HZ7A 1OZQA 1L2UA 3UWEA 4NZ1A 4MGGA 3FEQA 1AVAA 1XRFA 1XUZA 4GQ0A 2VNCA 3B8VA 2Y6ZA 2RJGA 1G94A 2PWUA 1DJZA 2D9FA 3CYVA 1OINA 4IFOA 1O4UA 4QDMA 4PODA 3GC5A 4HHPA 3U5UA 4W7UA 1YXDA 1GQNA 3QW4B 2FFCA 4QEHA 3ELFA 2O9RA 1J11A 4E4UA 2VQTA 3CV2A 3WQ8A 3MUXA 1TTQA 3T2OA 3AXIA 1HKIA 4AD4A 3SRHA 3TP4A 3F4DA 1YDNA 4HBKA 4C91A 3MWCA 5AC7A 4BZYA 3DAQA 3L4TA 2W91A 4MNMA 1V4YA 1S5NA 1TFVA 2KI3A 3ARUA 2ZUTA 3PBGA 4HOXA 4UQCA 4PUDA 4NP7A 6CGTA 2ICSA 3ARYA 1EWDA 2REQB 3VX0A 4DWSC 5BRBA 4DRIA 2A3EA 3M41A 4JAWA 4P8WA 1QPRA 1YPXA 1V08A 1IR2A 2MLZA 3CUIA 1UKQA 4Q6JA 4FMVA 3UZJA 3FFSA 3I3EA 3STEA 4DJFC 3HU7A 5IFPA 3T0AA 1NSGA 5BROA 3L4ZA 1S38A 4DAIA 3OGRA 2JF6A 3L5AA 4B5SA 2CXGA 3RR1A 1GYLA 3BQ5A 5DT7A 4LF2A 2VD8A 3I7QA 4IMCA 3BCJA 1W9UA 5B8IC 2XVLA 3LU2A 3DENA 4WLCA 1F74A 4AYGA 2V3GA 4B2DA 3B8TA 4O4VA 1J2BA 1UP0A 2PDHA 3QTPA 2WMJA 1IXPA 4B2DD 4MGVA 3G1HA 4AU0A 5T91A 1PIGA 4O14A 5KZDA 2VGGA 3AIUA 1TCDA 1LWHA 1RLDA 4BFAA 1MEIA 1XYFA 1FKDA 3S2LA 3B40A 4AIBA 2E6DA 3OZPA 3CUGA 4LAOA 2KX9A 4WJXA 1FCUA 4MYAA 3WH5A 5EMYA 5HTGA 1EPVA 2PURA 4AX7A 5I02A 1OG6A 5BXRA 2IQ0A 1XBZA 1TVLA 1PX4A 3QOMA 4ZEPA 1UWTA 1GVRA 1Q1CA 3MKVA 1GKQA 2QW5A 4GNKB 1DOSA 3HJZA 4A8IA 4JTLA 1NMVA 2BVTA 1UZHA 4PSRA 1A7XA 3GU1A 4FB7A 3O6YX 3GU0A 3CGMA 1C8YA 3PN8A 5DY2A 4DO5A 4XBJA 3WF4A 3VINA 4F40A 4JX6A 2G4FA 2OOGA 3WUEA 2VTFA 3W1RA 1MZRA 1RQEA 2PZNA 1WDDA 1Q2SA 4F2UA 4GACA 2O56A 3HGRA 4H9VA 5A8MA 2E77A 2TYSA 1I2OA 3RCYA 3IKDA 4IUOA 3TNOA 3MUIA 3OGSA 1US0A 3DHPA 3CPRA 4AIEA 3A4XA 2X0SA 4EF9A 3KRZA 1D7JA 4BI6A 1F05A 2XPAA 3VDHA 4B5VA 3VGHA 3GM8A 3FGCA 1XFCA 3WLHA 1E0TA 2PSNA 1SO3A 2XIJA 2ITKA 3DEQA 3L66A 4K8GA 3SUSA 3MW7A 2ZWZA 5RUBA 1J4IA 1OFBA 4OFCA 3NQVA 1E0XA 1EXBA 2V3EA 4PUKA 3LXBA 2DT0A 1ZAIA 2C19A 1IGWA 1KM1A 1DIEA 1O94A 3NSNA 5C7VA 5BU9A 3I4KA 1XC4A 3DYPA 5ECUA 3G18A 1U5VA 1JDEA 4GY1A 4OECA 1TPB1 2E8YA 2DG4A 4HARA 2WSYA 2R6OA 2I7GA 2W62A 2DZAA 1E1EA 3VD5A 3E74A 1W26A 2OT0A 1IEIA 1KLZA 1IEVA 3TCEA 4XBKA 4LB3A 1SU5A 3ONBA 4EOUA 3A4AA 1ZB5A 2Z7GA 2FGZA 3WDRA 4Q4OA 1KT1A 2BXZA 2Y62A 4ONVA 3PB0A 3IHZA 1IGSA 2I9EA 3HG5A 3SECA 4QQUA 3JUGA 2NUXA 4Q32A 2ZUUA 4F0LA 2PDYA 4LUTA 2PDBA 3VNZA 3GXIA 5AYXA 3W7PA 1PS9A 6A3HA 3E02A 2IS7A 1B54A 1LQAA 1BG4A 1PYFA 3HPFA