4WK9A

Crystal structure of human chitotriosidase-1 catalytic domain in complex with chitobiose (0.3mm) at 1.10 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
369
structure length
368
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTENDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitotriosidase-1
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 132
structure length 368
sequence length 369
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wk9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wk9A01
1E6QM 2VX7A 4W88A 4HMCA 2BVTA 3L4YA 2WNWA 3ARXA 4J3XA 3CMGA 4MDPA 1FFQA 1JZ2A 1DWFM 4HMEA 5FL0A 3U7BA 1JFHA 1EO7A 2BXYA 2PWGA 1QHOA 3AMGA 2FDMA 1JD9A 4S3JA 5GNXA 5I5RA 1SR0A 2VX6A 2D3LA 3QOMA 2WCGA 4IPLA 1IZKA 4AD4A 1NOWA 3KL3A 2EO7A 3K4DA 2GFTA 3A4XA 1TUXA 1AMYA 4AXNA 4YN5A 5C8BB 3M07A 1C8YA 1Q6GA 2BY1A 4U5KA 1FP9A 1XYFA 2DDXA 5HDRA 1Q6CA 3NUKA 2X09A 3VU2A 4OOZA 2VZSA 1J11A 4W7UA 4X0NA 3SEPA 1NARA 1H0GA 1E1FA 2XVGA 4GXPA 4BZYA 3OG2A 1WZLA 1VEOA 3EDFA 2ZX6A 1UD3A 1M03A 1XSIA 4TUFA 3CTTA 4Q22A 2BXZA 4GKLA 3CMJA 3B9AA 3W82A 6CGTA 1EHNA 2D20A 1EHAA 2WM0A 3AHYA 4W5UA 1HP4A 5A2AA 2C0HA 3U7VA 4OUEA 3UR8A 3RJYA 2YBTA 2W5FA 3BLKA 3WNOA 2BVDA 3ZSSA 2GJPA 2Y2WA 4AZIA 5IHSA 2J7EA 2YDQA 1UD8A 1XV8A 1J0ZA 1HJSA 1KBKA 3RPMA 4MNKA 4X0VA 1K9TA 4CU8A 1OD0A 1KXTA 2J79A 1VF8A 2J75A 3W53A 3VX0A 1PEZA 1ZJBA 1C91A 1KCKA 1DP0A 3OZPA 4PMQA 3W27A 3ZT5A 3PZOA 4WJXA 4CCEA 1WO2A 3POCA 5BRQA 5CPQA 5CSUA 2WVTA 3IAPA 1ZJAA 3CUHA 2V5DA 1G0CA 3WSUA 1V3IA 3BAIA 1HF6A 1JDAA 1JZ3A 1XD0A 4Q7NA 4UNIA 1G9HA 3NSNA 5IFPA 2W66A 3VIFA 2EPMX 2FGLA 3THDA 5CPTA 2WSKA 1A3HA 2X05A 3BSGA 2GJRA 5ABEA 3PZMA 3O6AA 3RCNA 4M80A 1CECA 2A3CA 2JEQA 1EOKA 3OZOA 1C8QA 5DFAA 3WF1A 1MWOA 3A3HA 2WHJA 4B9YA 1ISXA 3O2LA 1HJXA 2J74A 4AEFA 3JUGA 4YHEA 4GINA 4EANA 4IPNB 1JZ8A 1MXGA 4F9DA 2G3JA 3BAWA 1XGZA 2WANA 1XH2A 4U2YA 3O9NA 3QHMA 1YQ2A 3WQ5A 3FHQA 1W9BM 1QNQA 2ZIDA 1PPIA 4CU6A 2TAAA 1W2VA 3VGHA 3VUPA 3SUTA 1E0XA 1MFUA 2QPSA 4JCMA 4D6IA 3WF4A 4EKJA 1W9XA 2DSUA 4FLSA 4CN1A 1E4LA 1TVPA 2VCCA 2GK1B 1B90A 1UOKA 3AXXA 3GBDA 3T2QA 1OCQA 5A6JA 1H0IA 1BTCA 1VB9A 4UR9A 1GJWA 3SCQA 2WWCA 4OBRA 4XV0A 4WKHA 3VNYA 1W3LA 1ZBWA 1XD1A 1OM0A 1UQZA 2O92A 3CBWA 3K8MA 6TAAA 4A3HA 2WVVB 3II1A 2VVNA 2WVVA 1B0IA 3AMCA 2WVSA 4GQRA 3WF3A 1GCYA 3PBGA 2EPKX 4MDOA 4PEEA 2ZXQA 4U5IA 3TTYA 1XHGA 1QI4A 1K9FA 2E8YA 5LA2A 4H2CA 4CD4A 5CGMA 2JIWA 4P8XA 3OGSA 1M04A 3EDKA 3AQUA 3WL0A 2PC8A 1B2YA 3MMWA 3WH9A 3SURA 2W61A 2O9OA 3SCPA 2ZWYA 4U2ZA 3ZMRA 1AQMA 4WSKA 5HNNA 4JKKA 3QOKA 2V5CA 2DT2A 1LG1A 4UFHA 4TXEA 3HU7A 1JDCA 3CZKA 4QAWA 4AZCB 1UR8A 1VRXA 2WCAA 2ZWZA 1UQYA 2J7DA 4DWSD 1VFMA 3IK2A 1FA2A 2XTKA 1OGBA 4AD3A 2EQDA 5A8PA 3NSXA 1C3FA 3K8LA 1H2JA 5FOOA 4P7QA 1JXJA 3WFZA 3WH6A 1U2YA 4GO8A 4AD2A 2DT3A 3SUWA 1HT6A 3UG4A 2J7FA 1EA9C 4HMDA 4WLCA 3GXFA 1R8LA 1VAHA 3MSGA 3AS2A 3GNOA 3TTSA 1JI1A 3VNZA 2JALA 4H04A 1E6SM 2UWFA 2VR5A 4MNMA 1C7SA 1XRVA 3WEOA 3WF2A 3WEMA 2WAGA 3W24A 1KFWA 4ZEPA 3VVGA 4AD0A 1XYZA 1R85A 1HJWA 2XJ7A 2VL4A 1FH7A 2XWDA 3ZOAA 2CEQA 5A6BD 4Z2LA 2XIIA 1UZ1A 3EBVA 2OWXA 3MKKA 3LPOA 1MQRA 3MMDA 3VGDA 2YA0A 4UQAA 1R7AA 3B8SA 4LX4A 1GZJA 4CN6A 2WZHA 3MUAA 3WDHA 5FD0A 4A3YA 4TTGA 3SCOA 4TVUA 4J3TA 1E1EA 1HIZA 5CG0A 1LF1A 4K68A 2CBUA 3FHAA 3VD4A 1KQZA 3GNRA 3L4UA 5A8MA 4D6GA 4WK9A 4TVDA 3BAYA 1LL7A 3SCRA 4AMCA 3FY1A 5A95A 2AMGA 1PX8A 1QNOA 2G3MA 4MJ4A 4D6CA 1SMDA 1VENA 1MXDA 5CLWA 3PZ9A 3AOFA 5E0FA 1ODUA 3VIPA 2ZE0A 1E43A 2D2OA 2VRJA 1D7FA 4E8CA 4JHZA 3ARVA 1LQ0A 4J3WA 5HBFA 2WXDM 2VZUA 4GIAA 3AMKA 1OD8A 3U5UA 3ZT7A 2WLYA 1ISYA 2YIHA 5C71A 1W91A 3VD9A 1OB0A 4UFJA 1HXJA 4ZE4A 2GDVA 1FHDA 4XX6A 3LPGA 3VIMA 5ABHA 2JF7A 1E15A 1I1XA 2CITA 3RM4A 1QNSA 1NWUA 1FH9A 1QNRA 3BCDA 4EAMA 2C7FA 1H49A 3G6MA 1O6IA 1F4AA 3VX1A 4V27A 1HJUA 1G1YA 1C92A 5D9MA 3SUUA 1PX3A 5BXPA 3WF0A 1M7XA 3TOPA 1CBGA 2GJXA 1UWTA 3ALFA 1WDRA 3AHZA 4HPGA 3WNPA 4H8VA 4BQ3A 1V6YA 2D23A 3AMLA 4LXFA 4FK9A 1CEOA 2X2YA 4W5ZA 1MW3A 1BQCA 1OGSA 1KB3A 3GH7A 3ZR6A 1MW0A 2CKSA 3K4AA 3CHFA 1EDGA 1CGYA 1CZ1A 2DH3A 4HTYA 1EH9A 1LWHA 2WPGA 1X6NA 2WZEA 1G5AA 5F7UA 1E5NA 4XUYA 2DIJA 4PMXA 1JNDA 1CDGA 1BSIA 4YPJA 1JYNA 1Z32X 3DECA 4JHOA 1BYAA 2XUCA 3SUVA 3ARRA 2X8RA 4U33A 5ABFB 4ATDA 4ATWA 1JNEA 5ABFA 2XIBA 1M01A 1KGXA 1HKJA 1CIUA 4NRSA 3K1DA 2XWEA 1BHGA 3HN3A 3FAWA 1DWGM 3AXIA 5DT5A 1LJYA 5FIPA 2MANA 5A94A 2XG9A 1US3A 1SYTA 2ZUUA 4UZSA 4HP5A 4JFVA 1PAMA 1CXLA 1VFUA 3KE0A 2Y8VA 3CO4A 1JZ5A 1CXEA 3CLWA 1CGVA 5M17A 4HU0A 3VOCA 1EIBA 1VJSA 4JFSA 1XH1A 2FHCA 2WYSA 5IFTA 2DT0A 4BQ5A 3DHUA 4LPCA 3PZQA 2DQXA 3AS3A 4L4PA 1MVYA 1DWHM 1NOUA 2D0HA 3WQ4A 1NP2A 4NF7A 4H8HA 2B31A 1UKSA 1E71M 2BY2A 1S46A 5DO8A 2O9PA 1CENA 1MQQA 4W85A 3E1F1 3WFLA 1QI0A 3AIVA 3MO4A 3SCWA 3AZTA 3BGAA 1QW8A 4ZE5A 5A1AA 5I79A 4D72A 1VIWA 2A3EA 3N15A 1BG4A 2EXOA 2YBUA 1CLVA 1HKKA 3MV11 1PZ2A 2VURA 3OLGA 1J18A 1ODZA 3PZTA 4PUEA 5A6MA 3WY1A 2Y24A 3TA9A 1HJVA 1GNXA 4ZFMA 3ZJKA 3KWXA 2VZOA 4PCTA 1GUVA 2JIEA 1KXQA 3U5YA 2F61A 5AY7A 2D22A 4DUVA 3ZJ8A 1D2KA 3G6LA 4TOQA 1W9UA 4B15A 1PJ9A 3AROA 4Z2GA 2Y4SA 2JE8A 2QMKA 2V3FA 2BV9A 5FKYA 2GSJA 1RH9A 1JYXA 1MFVA 3WIJA 1V6XA 5CQ1A 3F4VA 2VTFA 1OBAA 2D3NA 2ZX8A 3ALGA 1RP8A 5D4YA 4HOXA 1EOMA 2DIEA 2VOTA 2VCBA 3SCVA 3N04A 1HVXA 1OGGA 1E4IA 3AMDA 4PTWA 2J25A 4UOQA 2W67A 3OBAA 2Z1SA 1XC6A 1H09A 2J77A 1WDQA 3QHNA 1JAKA 5TD4A 4KGJA 3AYSA 1V3KA 3HMCA 3N18A 5CGTA 3FXYA 3EMZA 1J0YA 3QGVA 1JF5A 1U30A 5EFFA 1QI2A 5E09A 1WZKA 1GW1A 1MYRA 1R7OA 3UCQA 1CGTA 1PIFA 4CD8A 2WMIB 4UTFA 4BQ2A 4CKQA 1C8XA 4GPNA 2WMIA 8CGTA 2F2HA 4PN2A 1UHVA 3T0BA 5CSYA 1WCGA 1MW1A 3WNMA 1GQJA 1LL4A 3PZIA 3ECQA 1DWIM 4E2OA 3N1AA 5I24A 1VEPA 1E40A 1KR1A 1WDSA 4LYQA 1KQYA 4U3AA 5I78A 1LWJA 2DH2A 1FFRA 3PHAA 2XM1A 1XH0A 4CUCA 1JYVA 4D6JA 1CWYA 4FLOA 1OT2A 2D1ZA 3IJ7A 2X1IA 3MUIA 3W28A 4H7VA 4M8UA 3BH4A 3PTQA 5IXEA 5GPRA 2WC7A 5A6AA 4QCEA 4PRWA 2E9BA 1W32A 1UG6A 3AI0A 3VIHA 3T2PA 1VFFA 1CPUA 2YDSA 4PYSA 5C70A 4P8UA 4PCSA 3VD5A 3K8KA 3RM9A 4OOUA 1AQHA 5IDIA 1GOOA 2WBGA 4AZGA 1J0HA 4OKDA 3IJ8A 1V3HA 2WMGA 3WKZA 4KGLA 3UEQA 1E73M 5BXRA 2WKLA 3MMUA 5BRPA 5CPSA 1TG7A 3WD3A 4C7FA 2GK1A 4HA1A 4KMQA 4AIOA 1CGWA 4GZIA 1HP5A 1BGGA 4CCDA 3M7SA 2ZOXA 5GQBA 2ZUVA 3RJXA 4CD5A 1US2A 5ABGA 3CUJA 1E3ZA 2BNJA 4J3VA 5KEZA 2YKKA 4TX8A 3KL0A 3T0DA 3J7HA 7CGTA 1QI5A 4XZBA 3VM7A 5JUVA 4AWEA 1VEMA 5JIPA 3WD1A 4D6DA 4HOWA 3VPLA 2XYLA 3AYRA 3NYDA 3L4ZA 2G3NA 3POHA 4N0RA 1EXPA 4FF5A 5DF0A 3ZJ6A 2CCRA 3WDQA 3CGTA 3CUFA 1V0NA 4CD6A 4LYPA 3WDIA 2PB1A 3ZSTA 2YA1A 2VMFA 1UR1A 4WSJA 3GH5A 1DEDA 2PF0A 3VINA 1V6WA 1V08A 3VIJA 4ML4A 2V3GA 1PBGA 3QHOA 4P8VA 4Z2KA 7A3HA 4MB5A 4IUGA 2OYKA 2EEXA 4DWSB 3W38A 2CHNA 1B9ZA 4DWSA 1UA3A 4KH2A 2W4XA 4M24A 2DSKA 2DSWA 2Y5EA 3L4WA 3T2OA 3W37A 4MJ2A 4AISA 2JF6A 1WDPA 3ZJ7A 4AZCA 3L2MA 1J01A 3EMCA 2OWCA 1QVBA 4LGXA 4UQEA 1FH8A 3NDYA 3KZSA 4BF7A 2XFFA 2QV4A 5M3WA 1W1TA 2XFRA 4JIEA 2E8ZA 3WELA 3GBEA 1NWSA 3OGVA 4P7LA 1E5JA 2HISA 4BA0A 3N17A 2G4FA 1E6ZA 3UG3A 2E9LA 2WWDA 3ZIZA 4RE3A 2V3EA 2X0HA 2G8ZA 1Q4NX 1QBBA 1NOFA 3IAQA 1C90A 2C8NA 3W26A 3SIMA 4UQBA 5D8ZA 2YA2A 2VQUA 4MB4A 4JAWA 2QHAA 3WNLA 1VFOA 1ITXA 5E6ZA 4PTMA 4E4PA 4PMRA 2D24A 5ECUA 5A6LA 4RE2A 4HU8A 1KGUA 1TR1A 2OSXA 4HZ8A 4AIEA 3WUBA 4HZ6A 2UY5A 2XSAA 4D6EA 3B9EA 3A47A 1TZ7A 1UH3A 2WMHA 4MNJA 3MUY1 3IANA 3GDBA 1X6LA 1UKOA 2PBOA 3VIKA 4PMYA 3WDRA 4B3LA 1ZL1A 2YOCA 1V6UA 3KEHA 1WB0A 4HOZA 5CXPA 1WPCA 1BYBA 1QBAA 3F5JA 3VDHA 4CN4A 5BROA 2CBJA 2BY0A 2CPUA 2D0GA 3WDJA 2CHOA 2XPKA 1UD5A 1E55A 1UUQA 2WKGA 5JBEA 5A3HA 3ZR5A 1EDTA 3W4RA 3ARZA 2BHZA 4MNLA 1GQIA 1JIBA 3NCOA 1V0KA 3I3DA 2D0FA 4UFIA 1JZ6A 3VIIA 3ARWA 1JZ4A 4CU7A 1E70M 5I23A 4AZ5A 3EDJA 2VI0A 2ZUMA 1ZB5A 5D9NA 4MAVA 2G3IA 1QHPA 2AOSA 3UESA 1SFSA 4W7WA 2ZUWA 2ZUSA 2QF8A 2NT1A 3W29A 1W3JA 1GOIA 4EK7A 4WKFA 3DYMA 2J78A 4DUXA 1UWSA 1NWTA 3VKKA 4L4OA 1B31A 4S3KA 3BAKA 4AZHA 1R86A 2RGMA 1E3XA 5DEZA 3VIGA 4F9JA 4DM2A 1H41A 2V3DA 4UQCA 4KWUA 2WMFA 5CZKA 1CXIA 4XZWA 3I3EA 1XSJA 3WUEA 2BHYA 3AZRA 2W62A 2WB5A 2YDRA 3CHCA 1UYQA 2GVYA 1C93A 1UD2A 2XSBA 1V03A 3KL5A 1V3MA 3NSMA 3PTMA 2YJQA 3RO8A 1UR2A 4Z2IA 2DSVA 1UD6A 4QP0A 1WZMA 3IJ9A 1E6PA 2WLZA 1Q6EA 5D9OA 2YL5A 2NW0A 1U33A 2AAAA 2J4GA 3MS8A 4PMZA 4RL3A 1H1NA 3VM5A 4C7GA 1G94A 4PSRA 3DYOA 3NIYA 4JFUA 1W1VA 2RGLA 1CGUA 4URIA 1CTNA 4Z2HA 4JKMA 4AC1X 2PI6A 3UG5A 1KR0A 1UKPA 1UH4A 3UERA 1AQ0A 3NJ3A 1NM9A 4NI3A 3MV01 4ZXLA 8A3HA 1QPKA 3N11A 3FW6A 3NDZA 1EO5A 4MADA 5JBFA 5LA1A 1ZS2A 5BCAA 1WKYA 3D3AA 4GI8A 4GZEA 1CXKA 1ZU8A 1LLOA 2JEPA 4GZJA 3GXIA 4U31A 3WH8A 1BF2A 2WHKA 3WBEA 2BS9A 1K9DA 5BYWA 3AIQA 5E0CA 2WW5A 1NQ6A 3GZAA 4QLLA 3VGBA 2QLYA 4AZ7A 1KXHA 1V0LA 1EGZA 3CHDA 1UWQA 4UFMA 4FLQA 4GI6A 4MB3A 1JF6A 4W87A 3L2LA 1UH2A 5GNZA 3T08A 2BY3A 3FAXA 5A69A 3CH9A 4AY1A 2VZVA 1BVNP 3F5KA 2UY4A 3VIOA 3BAJA 3CZJA 3SCUA 1HKIA 1V6VA 2QPUA 5A2BA 2VO5A 1E0VA 4AZ6A 5DMYA 1KWGA 3CZEA 3ZM8A 1J9YA 2PWFA 1I75A 5I3DA 3N12A 2WSPA 5IHRA 2VRKA 4QDMA 3ZO9A 5JH8A 3RM8A 1FHLA 3WQ8A 3AISA 3EMQA 2ESCA 4W84A 4PTVA 3RMEA 3BMWA 2IXVA 5EFDA 1YHTA 4HA4A 3WMBA 2PWEA 2WK2A 1QW9A 3PZVA 4CVWA 3HJEA 1E6XM 3WQVA 1BYCA 4QLKA 2CXGA 2PWHA 4KRTA 4DM1A 1KGWA 3M46A 1K9EA 2WCSA 6A3HA 1GOWA 3OB8A 1B1YA 4AW7A 3L4XA 5FL1A 1GPFA 1WAWA 2OWWA 1W9VA 4IM4A 1HVQA 2CESA 3W81A 5EB8A 4B9ZA 2DSZA 3A4AA 1DTUA 4P7OA 5I6SA 1J0KA 3BMVA 3SUSA 2XVNA 3LMYA 1F4HA 1UR4A 4FLRA 3ZQ9A 1TCMA 2ZX9A 3S2CA 2DT1A 1UD4A 3U57A 1UKTA 1GOMA 1VBRA 4JKLA 5D9PA 1DWJM 1BVZA 2YL9A 4NZCA 1GHRA 3ARPA 1RD6A 3MANA 3DYPA 1KWKA 1H11A 4JZ5A 1K6AA 1E9LA 3WD2A 4R27A 1NH6A 1L8NA 4UOJA 2FHBA 2VR4A 1EDQA 4AIUA 3LPFA 1ISWA 2J7CA 2A3BA 3EYPA 3VGEA 1B3YA 4W93A 5HXMA 4ACYA 4XB3A 1E6RA 3AZSA 1BGAA 4F8XA 4UQ9A 1Q6FA 3VO0A 1D3CA 3RILA 1TMQA 3A4WA 1H4PA 5BWFA 4R5EA 4W8AA 2GUYA 4YHGA 3WN6A 4CGTA 5AYBA 3VDCA 4D1IA 2ZXBA 2PBGA 2ZX5A 1EQCA 3BCFA 4GQQA 1BPLB 4DWSC 4D1JA 1IZJA 2O9TA 2VCAA 2J8FA 2OYLA 2CYGA 1G01A 2CETA 4P7NA 2ZX7A 3TP4A 5CJ5A 3OLEA 2W92A 2Z1KA 4FMVA 1WP6A 4MAZA 3AIEA 4Y7EA 4Z2JA 2J47A 1JFXA 4J3UA 5EBAA 1GJUA 4D6FA 1Y7VA 2XGBA 4UOZA 2OSWA 2IXUA 2DGAA 3DC0A 4W86A 1JXKA 3M6DA 3VMOA 4KRUA 1ISZA 2ZUTA 4CD7A 1KBBA 2FH6A 3WL1A 2XVKA 2YL6A 3VTRA 1TE1A 3GM8A 4ACZB 1DWAM 2BHUA 4UQDA 1I1WA 5LA0A 3TTQA 1O7AA 4ACZA 1BLIA 1BAGA 5M03A 3UR7A 2EBNA 1FP8A 2WC3A 1B30A 3SCTA 2WVUA 4ATLA 1QNPA 3VILA 2VNCA 3K46A 1CYGA 4B3KA 4MB1A 1PX4A 1HKMA 3BLPX 4N42A 3TTOA 4JFWA 5AC4A 3ARQA 3T0AA 3CZLA 3VGGA 3AS1A 1E4NA 1HJQA 1P6WA 3VMPA 3CUGA 4EE9A 1HN1A 2O9RA 1JI2A 1LL6A 3WD4A 2WMKA 1IT0A 5E9AA 3VMNA 4V2XA 4BQ4A 2VT0A 2XVLA 4PSPA 3GXMA 2FGZA 1OSEA 4P8WA 5GNYA 2NSXA 1XCWA 4J27A 3BSHA 1V3JA 2CIPA 3PTKA 3WENA 2VX5A 1V3LA 1V02E 1W3KA 2CERA 1BFNA 4H41A 3OA5A 2YLLA 1TVNA 3PZUA 3THCA 3EDDA 3L4VA 1E72M 4CCCA 4J3SA 3GTNA 5HPCA 4J28A 1OWQA 4V28A 1PIGA 3CZ8A 1UR9A 1QOXA 4UFKA 1UA7A 4JL1A 2WBKA 5I2UA 3S6TA 1R87A 2WZIA 3FN9A 4M1RA 3AFBA 1X1NA 4MPKA 1E56A 3FNDA 1ITCA 1GORA 1HL8A 4X9YA 1HX0A 4M29A 1SMAA 1JGIA 4QFUA 4AEEA 2CBIA 3SCSA 1QHZA 3AICA 1GQLA 2EPOA 3MSDA 3RDKA 3OLIA 1JAEA 3GYCA 4M82A 4C7DA 4HA3A 5A8QA 2J7HA 3OLDA 4MTVA 3WNKA 1L0PA 1B3ZA 5I77A 1IV8A 1TFVA 1MW2A 4BS0A 1OIFA 2NT0A 3BXWA 1VBUA 1W9PA 3ARYA 3WMCA 4AYSA 3D5HA 1JDDA 3N13A 3UETA 3VDAA 1W2PA 1GVIA 4E8DA 3MU7A 1DHKA 3W6LA 1KCLA 1LG2A 2VX4A 4PBGA 3AIRA 4F79A 4W8LA 3AXHA 1C7TA 1NWRA 4QLJA 5A6BA 3CPUA 2XFYA 1H5VA 1XCXA 3T09A 4OIFA 1JD7A 1GHSA 4NSBA 5D8WA 1JL8A 5CLTA 2DEPA 1VJZA 5A6KA 4JCLA 4TVCA 2CNCA 1UWUA 4TX6A 1RP9A 2VZTA 4RE4A 1GQKA 3ARTA 1WNOA 2J7BA 1B3XA 9CGTA 1UKQA 1UWRA 2EPNA 2W63A 1J0IA 2YL8A 1CXHA 1MQPA 3CZGA 4D71A 3AIBA 1A47A 5KZ6A 2CKRA 3WBAA 3EDEA 1E4MM 3ARUA 4PMVA 3VD3A 2IUZA 2CBVA 5M5DA 2ZICA 2E9MA 1FOBA 2X0YA 1CLXA 1EQPA 2E3ZA 2ZXDA 1GOKA 3B9DA 3WEZA 1ZBCA 3N9KA 3PZNA 1WE5A 3MUZ1 1J10A 2BVYA 5E6YA 1V02A 2PWDA 3ARSA 2Y8KA 1W1YA 3W25A 2J62A 5FCZA 5AC5A 4UCFA 1UR0A 4PUDA 3BAXA 3WH5A 1V0MA 4AD5A 2QMJA 4QCFA 3AIWA 4LYRA 1OT1A 2VQTA 1Q6DA 1H3GA 1N82A 3L4TA 2WC4A 4W7VA 1CNVA 3OIHA 4W89A 4IISA 2VC9A 2J8GA 3W6MA 4PMDA 1QI3A 3GH4A 2JFEX 1ZBVA 2W91A 3GNPA 4DUWA 4WKAA 2WMJA 4PMOA 3CHEA 1E0WA 3PN8A 5AYIA 1JYWA 1W1PA 1TA3B 1GONA 1UZ4A 2E40A 1TA3A 4D6HA 3TONA 2Q8XA 1J0JA 1HNYA 5I0DA 3AIUA 2XVPA 4AZBA 2VVSA 4F66A 2VRQA 3AHXA 1XSKA 1BG9A 3DHPA 3AS0A 1PZ3A 2F8QA 3I3BA 3VDBA 1CGXA 1J12A 4AD1A 2BFGA 2ZXAA 3GXDA 2G41A 3PZGA 4GO9A 1ECEA 2VJXA 4HPHA 2DPEA 2GJXB 3CUIA 2E0PA 4ZENA 1RPKA 5JIWA 1UWIA 2FH8A 5A2CA 1HL9A 1E6NA 1NP0A 4B16A 2UY3A 3WH7A 5E70A 5HPOA 3LPPA 2OLHA 4U3CA 2EJ1A 7TAAA 2ZUNA 2A3AA 4JFTA 4J7RA 1ESWA 2FHFA 4WF7A 4A4AA 1B3WA 4ZXOA 1JG9A 4UZUA 4LQ1A 3WDPP 3BC9A 2YLAA 3W0KA 3AHTA 3SCNA 1OIMA 3QR3A 4H8UA 1OINA 4JL2A 2V38A 4UFLA 2WHMA 1CXFA 1JZ7A 5BXSA 2HVMA 1WZAA 2J7GA 3F5LA 4NRRA 5LYRA 5A8OA 1ZBKA 4BCEA 3AJ7A 1GOQA 4OZOA 3WQWA 5A6SA 2OYMA 4OBSA 3CIVA 2A3HA 5BXTA 1GVYA 4PMUA 4W8BA 1W9DM 4WIWA 3WQ6A 1AVAA 3RIKA 1B3VA 1BYDA 1W3HA 2XM2A 4PMNA 4TTUA 3WNNA 4PTXA 4P7RA 3ZT6A 2XGIA 4HZ7A 3AHVA 4M81A 1M53A 4M56A 2VUYA 3WUFA 3VD7A 2GDUA 3VGFA 3A6OA 2E4TA 3OGRA 4GI9A 5A8NA 3WUGA 2OSYA 5DT7A 2XHYA 2WHLA 3APGA 3WD0A 4OJYA 1KXVA 3WMSA 4CVUA 2UY2A 2EPLX 5JBDA 1ISVA 5HOSA 5EMYA
chains in the Genus database with same CATH superfamily
1U5JA 2WNWA 2PV3A 1R2RA 1GYMA 2E5CA 3O16A 1KRMA 1DWFM 1EO7A 1P48A 1EBGA 3NPXA 1JD9A 4S3JA 3KAFA 5I5RA 3GVQA 2VX6A 4H9UA 4E3TA 4AD4A 3B0YA 3WH0A 4O1FA 2EO7A 4QROA 4AXNA 4GVGA 2OGJA 5C8BB 3M07A 2FZMA 1C8YA 2HDJA 1P5BA 2BY1A 3MHGA 1FKGA 2CLPA 2DUAA 1EJVC 3UXLA 3VOHA 2DDXA 1Q6CA 3VU2A 3N6HA 1N7KA 4OOZA 4O12A 5BRBA 1E1FA 2XVGA 5F1VA 3KAOA 4I7WA 4C1LA 1FKWA 1XSIA 1Q6HA 4GKLA 4XD4A 1IR2A 4LB3A 3FKRA 4YWSA 3W82A 1A5BA 3TC3A 3B97A 3WQFA 3AHYA 1TKKA 3I6TA 1FCUA 3UR8A 2YBTA 1XFCA 3KACA 2BVDA 2GJPA 2GDQA 2D2GA 3B9OA 4HA0A 1XS2A 1XV8A 1HJSA 1BKFA 1MNZA 3SSZA 2GPTA 2C3ZA 4IXHA 4NJKA 1KXTA 2GQ8A 4ILSA 1VF8A 3GTYX 4LRSA 1Z9AA 1PEZA 3IWPA 1KCKA 1KO0A 4Q8QA 3DHDA 3HPAA 5CPQA 2FFIA 2FTYA 1YYAA 1F6YA 1G0CA 2I5QA 1V3IA 3BAIA 1PO9A 5IFPA 3NSNA 3FCPA 2QJHA 4YCPA 1TJRA 1H7PA 2EPMX 5C9RA 4QNWA 3P93A 4ZOBA 4DNHA 3DFPA 3F4CA 1KC7A 3QLDA 3EWYA 2X05A 1M7OA 2GJRA 5ABEA 2GGJA 4M80A 2OCZA 1CECA 3A5FA 2JEQA 2Q02A 4ZA0A 5EL1A 3OZOA 1C8QA 2V2CA 3LCLA 5DFAA 7PTDA 1HZYA 4GUGA 5LNWA 3QKZA 1PZ1A 4YWIA 1HJXA 3JUGA 3RLUA 1M3UA 2FTPA 1JZ8A 2FZBA 2XH0A 1EGVA 1EJWC 3G1AA 4JN8A 4U2YA 2V5JA 1YQ2A 2XINA 3SIZA 2RDWA 3BICA 1QNQA 3C3UA 3MCNA 1V93A 2BXVA 2ZYFA 4C1KA 2CLLA 1PPIA 3S9ZA 1JUKA 4PGLA 2QULA 1DJNA 4ZGYA 2QPSA 4EKJA 4WDUA 3BG5A 3KOFA 4H6EA 4CN1A 2Z2AA 1AODA 3QPYA 4GK8A 5HMSA 1QO2A 1IGSA 2W6RA 3AXXA 3GBDA 4FXJA 4QIBA 4O4VA 5A6JA 1XBYA 1YNPA 1BTCA 3LGDA 4FEZA 4OBRA 3QMTA 1NFBA 1OM0A 3VUSA 3RGTA 3GXPA 3UZWA 2ZDRA 3E0VA 4UTMA 3K8MA 3H7UA 2QXWA 1RA0A 3S5OA 3II1A 2FVKA 2VVNA 3AMCA 2WVSA 2FIQA 4GQRA 4MZYA 3WF3A 1FAPA 5F4SA 2PGFA 1EYWA 1XI3A 3PFRA 4IMCA 4MDOA 5DQPA 2DVXA 3EOLA 1OFPA 3TQVA 5EMMA 1XHGA 1WQ5A 2N87A 1RBLA 2ZRYA 2PPNA 4H2CA 5FEZA 3T78A 4P8XA 4FOUA 3TNBA 3RCMA 3FDGA 1Q8JA 3UZXA 4RCXA 5LHEA 4JTCA 2ZWYA 2PDYA 1R6WA 5HW6A 1XLHA 1AQMA 1KCXA 4AX6A 4JKKA 1LG1A 4TXEA 3GNDA 3N3MA 4UTUA 2PDMA 7XIMA 1VRXA 4YTQA 2J7DA 3T4WA 3ZVHA 3JRKA 1FA2A 3NVDA 1OGBA 4KQZA 1KM2A 4HARA 3NSXA 5FOOA 1CW2A 3USZA 4IIEA 3O5IA 4GO8A 2DT3A 1ZCNA 3SUWA 2ZQTA 1F73A 4DJFD 4NZ1A 1DE6A 4HMDA 3MSGA 3R8GA 1TTPA 2R1KA 1E6SM 2A6LA 2W27A 2A0NA 4GNJA 5DELA 2ASHA 3OJGA 3W24A 1KFWA 1OYAA 1KBIA 2XJ7A 2KGJA 3U2ZA 5A6BD 4MFEA 4EWND 1MO0A 1AD4A 4LUTA 5TIMA 3PPCA 1MQRA 4FNPA 1GT8A 1AW1A 1V8EA 5K9DA 1R7AA 4GQ0A 4LX4A 3TYUA 3AUOA 1VKFA 2PDLA 3WDHA 5FD0A 3MVTA 4TVUA 5CG0A 2DZWA 3LHUA 1QU4A 3LY0A 8XIMA 3UBPC 1GW9A 1KA9F 1P0NA 5A8MA 3BAYA 1UUMA 3SCRA 4AMCA 5A95A 2AMGA 1UPPA 1QNOA 2BOFX 1UJPA 3RX4A 4D6CA 1MXDA 2ZBTA 3PZ9A 3AOFA 2PDPA 4NZFA 3KOYA 1OC7A 4GY0A 4ICMA 2D2OA 1D7FA 4E8CA 1T0OA 4WOQA 4DRHA 4JQ4A 3UT0A 4HD5A 3UD6A 3KBWA 4TIMA 2NVDA 4MWAE 3F2DA 5MF5A 2WLYA 3EIPA 2PD5A 3F4NA 2WPBA 4ZE4A 3JYJA 3V7PA 1PTGA 4XX6A 5G1MA 4Z1DA 2AL2A 2DVUA 3KTCA 2QQ6A 3CS2A 3BG9A 4G8TA 4TW7A 4EAMA 4K36A 5T8GA 4V27A 4U10A 4AB4A 4EXBA 2J13A 3SUUA 2AKZA 4AF0B 1UCWA 2PDQA 2XISA 3OQEA 3P5YA 1UWTA 4B5NA 3ALFA 3ABRA 3GIYA 4ZQOA 2ODOA 4GYKA 3P14A 4UIOA 4W5ZA 1BQCA 1OGSA 3GH7A 4HCDA 4AC7C 5EMLA 3ZR6A 2QJGA 1UP2A 3ITOA 1AL8A 1EH9A 4G6CA 1X6NA 1G5AA 5L9FA 1E5NA 3JS3A 1DJXA 2OELA 1X6UA 4YPJA 1PDYA 1Z32X 4H6RA 1JYNA 1F5ZA 3FSTA 2X8RA 5KINA 4ATDA 5ABFA 4UWMA 1M01A 1KGXA 1PWMA 1HKJA 4PH6A 5CCZA 3DG3A 2XWEA 1BHGA 3G1RA 1W26A 1F3XA 1TV7A 2J9XA 1X7FA 3AXIA 4IMGA 5FIPA 1VFLA 2MANA 2XG9A 2FZNA 3JR2A 4UMCA 1SYTA 1H5YA 4UZSA 4HP5A 4JFVA 5HNUA 2QCFA 1CXLA 4K7YA 2PAJA 1B9BA 3CPGA 2PN0A 2J6XA 1EIBA 1J2WA 3G8RA 1VJSA 4JFSA 1YDVA 3W85A 4DYJA 4LPCA 2R6OA 3IKGA 3DBPA 1NOUA 3AWOA 2B7NA 3JW7A 4H8HA 1NFGA 3N25A 4W85A 4JIQA 5F4WA 4ZO8A 4LT9A 5DLCA 1MSSA 4UB9A 1A5MC 3OP2A 4S3CA 1PZ2A 3HGRA 4L1XA 2C16A 3SN4A 2I1OA 3RG6A 1J18A 3LBMA 4LAZA 4LOCA 3PZTA 3Q94A 5A6MA 3Q58A 3ZJKA 2GWGA 3T8QA 2VZOA 4PCTA 2ZA2A 3B8IA 1GKQA 1IWAA 1KXQA 2F61A 4DUVA 3ZJ8A 2BASA 1Q6QA 3UXKA 4DJDD 1ME9A 2Y4SA 2BV9A 4C65A 5FKYA 3F4WA 4O0KA 1OFEA 5I3HA 3CAQA 1JCXA 5CQ1A 1ZAIA 1OBAA 2ZX8A 4E4UA 3DEQA 4GBDA 1PKMA 1WDDA 3HGJA 1RP8A 4HOXA 1EOMA 4RZ4A 3NQGA 3W84A 2VOTA 2VCBA 3ANYA 3KBVA 3AMDA 4KEVA 4UOQA 1XC6A 2QEZA 2TRSA 4KGJA 1IEVA 3QGAC 3L5AA 3N18A 2D69A 3L7RA 3A13A 3H7RA 4Q8PA 3FXYA 2OO6A 4WXZA 4IH3A 4G50A 4X2PA 2K8IA 2H90A 2L5HA 2PU1A 1WZKA 1KBJA 1GW1A 1R7OA 3UCQA 1OEPA 2WMIB 3EOEA 1C8XA 3TMLA 4KIEA 8CGTA 2F2HA 3MYOA 2KZHA 5CSYA 1A5KC 3WNMA 2Y61A 3ECQA 1QDSA 3VE9A 3N1AA 6REQA 2X30A 3DI0A 4Z1BA 1TJPA 3V5FA 1E40A 3NO5A 1K70A 1J79A 1R2TA 5I78A 2DH2A 4MY9A 3WZ0E 2D1ZA 2VEMA 3IJ7A 3W28A 4H7VA 5DRCA 4QE1A 2BG5A 4ITZA 2NV1A 5GPRA 5A6AA 4N9CA 3S1GA 3AI0A 3VIHA 4HNUA 4DRIA 1NSJA 4FOKA 1CPUA 1VPYA 2CZDA 4P8UA 2PBCA 3VD5A 3QF0A 4OOUA 3W7OA 1AQHA 4WCJA 4A8RA 2ZDSA 1M68A 2WBGA 3TDFA 1XDLA 3IJ8A 3M0YA 3S2LA 5EGRA 4Q8TA 3GG0A 1G4PA 3O5EA 2DZVA 2OOGA 5BXRA 2WKLA 2SFPA 3N73A 3BARA 2C79A 1NDVA 4C7FA 2GK1A 4US5D 4HA1A 2FB3A 2TMDA 4QQUA 1F3WA 3H55A 4AIOA 4LNCA 3NTPA 1IZCA 1M7PA 3E0FA 3WJZA 1JRCA 4CCDA 2ZOXA 5GQBA 2ZUVA 3RX3A 1US2A 3LN3A 1E3ZA 3T0DA 4TX8A 5JH1A 4XZBA 4NJJA 2ZR5A 5JUVA 4EXQA 1X39A 4XAZA 3O5KA 4TW8A 1ADDA 3QYQA 2E28A 3FGCB 5JIPA 3WD1A 4HOWA 3RLHA 2VEIA 2H6RA 4OBTA 1UC5A 2QJIA 1VRDA 1Z44A 3E3HA 4N0RA 3TQPA 2IPGA 4A8IA 3R79A 3WDIA 1OY0A 3TYZA 4QT3A 2F6KA 2Y1HA 3NEHA 1DEDA 1GJPA 4H01A 2V3GA 3QHOA 3WQDA 4Z2KA 7A3HA 1WX0A 2AGKA 3O06A 1QJWA 4KH2A 1WUFA 1K4HA 2JGYA 3ZWSA 1TUFA 3LD5A 3TYDA 2DSKA 1QMLA 5LGZA 2A4AA 3IK4A 2V0TA 1AW2A 3NPUA 3IIOA 3VZZA 3QRHA 4I5UA 4AZCA 1DJGA 3P60A 3EMCA 1UROA 4DF2A 1FH8A 3KBSA 2QV4A 2QIWA 3GBEA 3OGVA 3UG8A 1RY0A 3N17A 1K8XA 2G4FA 3TC5A 2E9LA 3ABXA 3O5JA 2TSYA 1XJBA 3URNA 3W74A 3MT1A 2C8NA 5C9UA 3CGNA 4TMBA 3ZLGA 1VFOA 3FJNA 1F07A 1RQBA 3LEPA 3TWBA 4PTMA 3W07A 2HVOA 2IQ0A 3ME3A 4MGVA 2ISWA 1KGUA 4AFYA 4A3UA 4JFMA 2OSXA 3A64A 4HZ8A 1TPUA 3RPDA 1Z41A 1XLBA 2XSAA 3S5ZA 3TR2A 5ECVA 2WMHA 3GDBA 2PBOA 4J40A 3BWWA 3VIKA 5D33A 4B3LA 3KP0A 2YOCA 2PDHA 4C60A 1LDCA 3KEHA 1WB0A 4M7TA 3VOGA 1IWBA 1KBLA 3QBUA 1BYBA 2NV2A 3B9NA 2D0GA 2OT1A 1FWIC 1E55A 1UB3A 3R8HA 2GZXA 3ES7A 3NCOA 5FF4A 3HV8A 4NNAA 4UFIA 1JZ6A 3VIIA 1S2WA 3ARWA 3UCCA 3VNKA 2QGHA 2PC4A 4AZ5A 1TPDA 1A5UA 5D9NA 4MYXA 3PF3A 4UNLA 2AOSA 1Q1CA 3JYMA 4GYFA 4JFJA 5C55A 1EC9A 3A3XA 1PYFA 2QF8A 1KFKA 2ZRZA 2NT1A 1P7TB 3FAPA 1A4MA 4EK7A 3DYMA 3B04A 2IPFA 3VNDA 4XZ9A 5AHIA 2IS7A 3W2KA 3R4IA 3DERA 2GL5A 3H21A 2RGMA 4MUZA 3VIGA 4C6JA 2V3DA 4ES4A 3IJQA 3PA7A 4UQCA 3GTFA 1YNQA 4XZWA 4M5PA 1L8PA 4PRTA 5J8LA 4HJFA 3NL5A 3GR8A 3ZWTA 4IQ2A 2ALDA 1XSJA 3WUEA 4A22A 4UR8A 2W62A 4LUSA 5SWUA 3GUGA 1UD2A 2QJNA 1PHWA 5BNKA 3NSMA 3RO8A 4Z2IA 2DG3A 1UD6A 3GVGA 2PTXA 2W3ZA 2BGSA 3DUGA 3TN6A 3MS8A 4PMZA 3OW1A 1RPXA 3VM5A 3KTXA 1G94A 3DFQA 2RGLA 2OT0A 2HCVA 2ON3A 4URIA 1CTNA 4GQBA 4Q4RA 5C6MA 4XKMA 3W1QA 3CASA 4AC1X 1KR0A 1KLZA 2PP0A 3MSYA 1QRQA 4GIVA 3ITXA 3RPTA 1NM9A 3MV01 4J3ZA 3LXBA 4V33A 3R89A 3W2MA 3JXVA 3FW6A 4L61A 4TO8A 1U5HA 3SSJA 4RDWA 5JBFA 3VXGA 1WKYA 3D3AA 2EHHA 2WZTA 4GI8A 3W9ZA 1OX5A 1CXKA 4GZJA 1GVFA 3O8AA 4PEKA 1AMKA 3MJYA 3GXIA 4HU4A 3WH8A 2WHKA 4O57A 2CLFA 2BS9A 4PR4A 4Z1AA 2ALRA 1SSGA 5E0CA 3GZAA 4IFKA 1AUSL 4FXFA 3I4EA 2GQ3A 4IJBA 1JVNA 1EGZA 3CHDA 1FWGC 4W87A 1EFZA 2ISSA 5A69A 1R3SA 1T41A 1XDJA 3GDLA 4I7VA 3F5KA 2UY4A 3BAJA 3CZJA 2XIOA 4QGCA 2FLIA 2YCKX 3FJ4A 2VO5A 4H9VA 4AZ6A 1FCQA 5DMYA 5LXEA 4LYKA 3FDKA 2J27A 4JTTA 4LVDA 1J4HA 3N12A 3A9IA 3HURA 1Q3NA 1NIUA 1N1AA 1HQTA 3GU0A 1FCVA 1SFLA 2ESCA 5AN7A 4MWAD 4MKVA 3KCLA 2WK2A 1BQGA 1GVRA 4CVWA 4JD4A 2WNNA 1U1HA 3MY9A 3CTLA 4GWEA 3NVTA 3LCHA 3M46A 4CEXC 2WCSA 1GOWA 4AW7A 3EX2A 1XW8A 4DRPA 2INZA 3VOJA 5L6UA 4G7EB 3W81A 2XZ9A 5EYWA 5HNRA 3SUSA 2XVNA 2NQLA 2BOGX 1F05A 1F4HA 4O19A 3ZQ9A 2M2AA 4ODPA 1UKTA 1L9WA 1FWNA 1DWJM 2I16A 4MLRA 1BVZA 2YL9A 1L6WA 4DZHA 1RK5A 1GHRA 1MUMA 4GRSA 1KNWA 1KWKA 1E9LA 1NH6A 1EJSC 3M0MA 4DO4A 4AIUA 3NL6A 5HXMA 2QVNA 4O1EA 2D2JA 4XB3A 1BGAA 4JTEA 3TV8A 4UQ9A 3HFTA 3T0TA 1N8IA 4IGSA 3A4WA 2EPHA 4YL2A 1UWAA 4U86A 1S2UA 5REQA 2BLEA 1UMLA 5AZ0A 2B4GA 3P62A 2MLXA 2REQA 4XD5A 4D1IA 2PBGA 5FJIA 3UFYA 1EQCA 4WXYA 4ZO6A 4XVEA 3NWRA 2O9TA 1NMWA 2CYGA 2ZA1A 4P7NA 2JK2A 3AIEA 3UYCA 4C6LA 1D3GA 4D6FA 1O95A 2XGBA 3W1XA 4UOZA 2B5UB 4GVFA 1Z3NA 2H8ZA 4AQLA 5DY2A 3VMOA 4KRUA 1OFRA 1V79A 4J2MA 1BWVA 3VTRA 4ACZB 3GM8A 4BF5A 3TTQA 4ZSTA 3EAUA 3UR7A 4YNGA 2EBNA 1FP8A 1R9YA 4JR5A 2WVUA 4Q4KA 1LOQA 2NXHA 5C9XA 4ATLA 2C91A 5PTDA 3BZGA 1T96A 1W31A 3ITCA 2HS6A 3O0FA 3TCEA 3TTOA 5AC4A 4FXRA 3AU6A 1GTEA 3AS1A 1XM3A 3N2XA 1EWEA 1JI2A 3WD4A 4RJEA 3IGUA 2WMKA 4POCA 5E9AA 3VMNA 3QXBA 1WA3A 3IUDA 3UCDA 4BR1A 2FGZA 2GOKA 3GFYA 6ENLA 4J27A 3PTKA 3L23A 1EX5A 1KFCA 2LPVA 2DV0A 3MWCA 4KFOA 2ZVIA 3OA5A 3GVRA 2WJZA 2F4EA 3CH0A 2EKGA 1E72M 3M5ZA 5HPCA 3VNLA 2GGHA 3GKFA 3VCNA 4J28A 5B7YA 2CU0A 3CZ8A 1UR9A 4XZIA 3RX2A 3TMQA 1U5VA 3S6TA 3W86A 1WDWA 4M1RA 1GVSA 4X61A 4KEMA 1E56A 1GORA 3RFWA 2ZCGA 2FGBA 4AEEA 1JPKA 1QHZA 1KT1A 1XWYA 2G3FA 5E93A 4QXIA 5JMUA 1EPXA 1TJ1A 2A2IA 3E2SA 3QMSA 1I9CB 2ATMA 4G1KA 2FFCA 2J7HA 5E9XA 3WNKA 3BLEA 1FWEC 3P61A 3V36A 4QQ3A 2IKGA 5C54A 1OIFA 2B0MA 3L66A 2Q3OA 1W9PA 5EMKA 2RDTA 4EF8A 3D5HA 1JDDA 4XKYA 3ITTA 1EJ7L 1FWFC 1GVIA 4E8DA 3MU7A 1B6CA 1HKWA 2R1PA 2YGYA 2VX4A 3R58A 4JIRA 4W8LA 1EA0A 1C7TA 3CMFA 4LY4A 3PUEA 3W1UA 4UTJA 5AFDA 1RUSA 1Z42A 4QHRA 1JD7A 3NZRA 2H9AA 5D8WA 2DEPA 1V51A 5A6KA 3P6LA 4UC5A 4TVCA 4OECA 4D2JA 3LCGA 2G97A 3BUVA 2VZTA 4RE4A 4W9QA 3D47A 1WNOA 1B3XA 1QOQA 1TQXA 1UKQA 1BXCA 1J0IA 5CPMA 1CXHA 1OX4B 3WJXA 4LAKA 3CNYA 4LH8A 1A47A 5DCDA 1RA5A 2DZAA 4ZBCA 4JBRA 2QDDA 2ZICA 3G8EA 3KAGA 2E9MA 3WYZA 4JTUA 3N9KA 1J10A 4MFDA 1V02A 2PWDA 2XP6A 3G77A 5FCZA 5AC5A 4PUDA 3BAXA 3W00A 1V0MA 2B7QA 3KRBA 1Q66A 3IK8A 4F2UA 2QMJA 1I2QA 2ZKMX 3TYEA 2VQTA 2Z4GA 5CC3A 3TIMA 4GX9A 1N82A 3L4TA 4W7VA 1CNVA 3N2TA 2OFNA 1YE4A 2VC9A 3W6MA 2FB2A 1QI3A 3GH4A 1CLKA 1ZBVA 3ZR4A 2C1HA 4AUBA 3GNPA 2WMJA 2PSNA 2E1WA 4PMOA 1C9DA 4ZCWA 2IMRA 1VHNA 1XQLA 1J5SA 1EGMA 1EF3A 2R82A 3LENA 1WKFA 2VR2A 3TONA 2OFJA 3BOXA 1HNYA 3HO8A 3AIUA 1J4IA 4AZBA 2PA6A 4F66A 3KTSA 3KOZA 1BG9A 1E44A 3OOBA 4O54A 1IXPA 3AALA 3T81A 2BFGA 1IEXA 3F2BA 3GXDA 3PZGA 2VJXA 2GJXB 1AJ0A 3W75A 3C4UA 5EPDA 2HEJA 5JIWA 5F1UA 3HF3A 1E6NA 4IT6A 1OFBA 5JQ9A 5DRIA 1TTIA 5B80A 4ZVJA 5HPOA 2ZZ1A 3LPPA 1EC8A 4U3CA 1AH4A 2OQHA 4UTWA 3P8IA 3PY2A 4JFTA 1OZMA 2E6FA 4UMAA 3M5XA 2PDKA 3EB4A 2MPHA 4ZXOA 4UZUA 2QPXA 3WDPP 3LUOA 1UJQA 4HCLA 4H8UA 3E96A 3A5VA 3M4HA 2HVMA 2VEKA 3R0UA 5FJTA 2OZTA 5LIKX 4NRRA 5LYRA 4N4QA 1ZBKA 3AJ7A 1NJJA 1SZNA 2OYMA 4OBSA 4XAKA 3RGCA 5CPOA 1KTCA 4N19A 3CIVA 4YTUA 5C9ZA 3GDTA 2R9RA 4UDMA 1AVAA 4PMNA 2XM2A 2R1NA 1DL3A 4K8HA 4P7RA 3R0DA 1VLWA 2DZPA 2GUUA 3N3TA 4XBSA 3PBWA 4YYFA 2GDUA 3SRHA 2E4TA 3OGRA 2PDWA 3WUGA 1XYCA 3APGA 1XP3A 2RH9A 4MWAB 4W9TA 3WMSA 3THQA 3O07A 1I2OA 3S0CA 1LUCB 5HOSA 3NZ1A 3EKZA 4W88A 2HROA 3L4YA 3UI5A 3DFTA 3CMGA 1H7RA 3BJSA 1FFQA 3O5OA 4QEEA 2WO5A 5FL0A 1OG0A 3U7BA 1Q45A 5CAHA 2Z26A 4O0QA 1I2PA 4TV6A 4PFMA 1E0UA 3EWUA 3QOMA 4IPLA 1IZKA 1NOWA 3K4DA 2G0WA 3A4XA 1TUXA 3REQA 1NY1A 4YN5A 3QFEA 3APYA 4U85A 4LEQA 3LS9A 2VDHA 2WKJA 4U5KA 4XD6A 5HDRA 4XBKA 5C7VA 2CFFA 2R24A 1R3WA 1TRIA 1XIEA 2VZSA 4W7UA 4V1XA 3R13A 1H0GA 2OOFA 4GNVA 4BZYA 4KEUA 1VZWA 3DU0A 1JNTA 4JGDA 4NP7A 2PODA 1V7AA 3B9AA 4GUJA 1Q65A 4IX0A 3LBOA 4IL2A 4KCUA 4FNTA 6CGTA 3S8HA 1UIOA 3S6DA 4W5UA 2HE5A 2C0HA 4MMWA 4OUEA 4AH7A 2W5FA 3BLKA 3WNOA 1CB7B 2Y2WA 3T0CA 4PULA 2PUZA 2TYSA 1OHLA 2J7EA 4WEVX 1UD8A 2DZBA 4C6QA 1J0ZA 3O1NA 1JCNA 3IACA 1JGMA 2OTDA 1KBKA 1SFTA 3IJDA 1K9TA 3AO0A 3KM8A 5F2IA 4CU8A 3TJ4A 4UTIA 2W0UA 2J79A 1QPLA 3W3OA 2ZTJA 3W53A 1QWGA 1LQ2A 1ZJBA 1C91A 3OZPA 4PMQA 2EULA 4JTAA 3UQBA 2VHLA 4XISA 4C6NA 4B5XA 2F9RA 2WVTA 3E9AA 2I57A 1ZJAA 4AU0A 2V5DA 1S5VA 3QH2A 1E9ZB 1JDAA 1XD0A 1AA1B 4Q7NA 2WNQA 2W66A 3IVTA 3QZAA 3PFMA 3FEMA 4O53A 3QMRA 5AYYA 2VWSA 4QM1A 3BSGA 3GQYA 3RCNA 2P76A 3G1YA 1GWJA 3G1VA 2A3CA 4HSHA 1Z69A 4US6A 4DQWA 3S3GA 2QVHA 3TTEA 3N9SA 3HTWA 1MI3A 3WF1A 1MWOA 1GYLA 4E4FA 2WHJA 1ISXA 1NVMA 4A29A 2QAFA 1PS9A 3BGGA 5DMNA 4AEFA 3T42A 4S2CA 4WJEA 1MXGA 1K03A 3G1FA 2EG6A 1HGWA 2G3JA 1FKHA 4PB5A 2WANA 3O9NA 5CSRA 3WQ5A 3FHQA 4C1NA 4DRKA 4MJZA 2ZIDA 3CQHA 2MNTA 3IKDA 2TAAA 1W2VA 4Q4QA 2P50A 3VUPA 5DO2A 1E0XA 2NXIA 3HGSA 3STGA 1E4LA 1W3IA 3BG3A 3N6JA 1B90A 1UOKA 2KX9A 4IPPA 3T2QA 1OCQA 1QOPA 1H0IA 3SQSA 4LV9A 1OK4A 2RUDA 3C8FA 4UR9A 4EPDC 3VNYA 3LNMA 4MPQA 1VBHA 3UR5A 1YW1A 5JVLA 4X3ZA 5M2FX 2O92A 4H6QA 4Y90A 3CBWA 2C6QA 1VBJA 5G4WA 3STPA 3C61A 3SRKA 3W1RA 2WVVA 1B0IA 4AMAA 1GCYA 5DCBA 1KRCC 1PUDA 5K3VA 1PL9A 4UCGA 3TTYA 5MKGA 1IYXA 2QGYA 2E8YA 4FX7A 4C6KA 3KABA 1EC7A 4Y9OA 3PG9A 2IPWA 1G6CA 3IVUA 4PCPA 2FAPA 3NL2A 2JIWA 1SFJA 2OO0A 3LSCA 3OGSA 1M04A 3C0SA 1LBFA 3CM4A 3EDKA 3AQUA 3WL0A 5C2GA 3SURA 2P88A 4NL1A 4U2ZA 3WCZA 4WSKA 1D3HA 3QOKA 2PEVA 2DT2A 4ODNA 2V5CA 4QAWA 2PRMA 2WCAA 3ZVHB 2ZWZA 4IPIA 1UQYA 2F21A 3GHSA 3IK2A 4IT4A 2XTKA 1OCBA 3ANUA 1J93A 1EBHA 2QUVA 3WH6A 3RU6A 2AL1A 4F2BA 5LIWX 1OVDA 3GR4A 2WV8A 3B03A 2J7FA 4JTIA 1NAL1 4WLCA 4WQ6A 4ZPWR 4Z42C 1VAHA 3ATZA 3V5OA 1P5QA 4UUIA 3GX9A 1JI1A 2F84A 5E0KA 3VNZA 4H04A 3T8LA 2QCMA 1M7JA 2UWFA 3K2GA 1C7SA 3H4XA 3WEOA 2ATSA 4ZQNA 3WEMA 1DJWA 4UTWC 3PRAA 1Q6OA 2J24A 3TZFA 1HJWA 4LRTA 3ZOAA 3MDWA 3W2JA 4KETA 1QW7A 4LUTB 2OWXA 3LPOA 1WKEA 3MMDA 2OB3A 4IUOA 3VGDA 1XLGA 2YA0A 4UQAA 3SFWA 3G24A 5XIAA 4CN6A 4KCTA 2TODA 3MUAA 3WK2A 1EL3A 3GVWA 4DZAA 2W9MA 1LF1A 1W17A 3DZ1A 3ITYA 3MKVA 3EPOA 2V9DA 4N2YA 1DQWA 4JQAA 2QCDA 3VD4A 1LL7A 3M0HA 4NT0A 3H23A 5CLWA 4BI7A 2YCIX 3UJRA 3ARVA 4J3WA 1GQNA 4HBEA 3KFTA 3O63A 3QC0A 6PTDA 1AH0A 3H7VA 3G0UA 3IIZA 3ZT7A 2YPIA 3KX6A 3LNPA 3HQPA 4YLWA 5BU6A 3CQJA 2BODX 4JY8A 3VD9A 3R94A 2HBXA 4UFJA 1OQFA 3PUDA 1KV8A 1XIMA 1TZ9A 4CNNA 2QCCA 4CQBA 4EWJA 1K3UA 1FHDA 4H9TA 3LPGA 1E15A 1Y5WA 3SGUA 1FH9A 1L6SA 5DY3A 3SBFA 4DBDA 1VCFA 2Z28A 3NFUA 1KM5A 3STCA 2C7FA 1O6IA 3RO6A 3BANA 1HJUA 1OC5A 1CB2A 1TX0A 5D9MA 5BMWA 1DHPA 4S3AA 4S3BA 4S3GA 3HOJA 3GR7A 1WDRA 3WNPA 3IV3A 4BQ3A 1V6YA 3AMLA 4LXFA 3IIXA 4E8GA 3WMLA 2X2YA 3T40A 1WAUA 1MW0A 4FX8A 3CHFA 1CGYA 1EP2A 2DH3A 4HTYA 2PDXA 3W7HA 3T07A 3M43A 4XUYA 4M6PA 2DIJA 3IGXA 1R3RA 5LNVA 3FVDA 4JHOA 4XUGA 4ROPA 5HK4A 9XIAA 4U33A 5ABFB 4K37A 5F2MA 2C15A 4ATWA 1FKBA 4X63A 2J8TA 1PV8A 3GAKA 4NRSA 1DPMA 3R5EA 5I3IA 1UASA 3K1DA 1AJZA 1TCOC 3BVJA 4QX4A 3OQ8A 3PUOA 1TPC1 4Q4SA 2NWRA 4MG4A 3BK0A 1US3A 3VNJA 2ZUUA 2HWGA 1S5TA 2XH2A 1PAMA 4IP4A 5IM51 2OEKA 3H12A 1VFUA 3WK0A 3CPRA 3HQNA 1CXEA 5D03A 5M17A 1WV2A 4ODOA 3VOCA 3UWZA 2DG9A 3QC3A 4LF1A 5IFTA 3IGSA 4BQ5A 3DHUA 1TJ0A 5LHFA 3TNOA 4ERIA 3QQ0A 3VFCA 1MVYA 1DWHM 1KV5A 2XP3A 1LLZA 3WQ4A 4NF7A 4ZODA 1UKSA 1E71M 2BY2A 3GFXA 2HJPA 1CENA 4Z08A 1QI0A 3AIVA 1EPVA 1S2CA 1DTNA 1E51A 3G1SA 5FJJA 1QW8A 2QDGA 4OWGA 5I79A 4D72A 7ODCA 2A3EA 1YIXA 3CGMA 3S83A 4KFPA 2L2SA 1BG4A 1CLVA 5G2WA 4GGQA 3GG7A 1ZPTA 4RV8A 3L65A 3VC6A 2Y89A 1SW7A 4GIYA 3FXGA 1HJVA 4ZFMA 3PJUA 3TKFA 3DKJA 4K39A 2X1TA 1GUVA 5HINA 1RALA 3W1MA 4TU1A 3U5YA 1TREA 4K7VA 5AY7A 2LLEA 1XLFA 5FF2A 5I07A 4FS9A 3LHYA 3UA3A 4TOQA 1W9UA 1PJ9A 3AROA 1W37A 1FWBC 5HULA 1PB0A 1JYXA 3HIJA 5ABTA 1MFVA 3GG8A 3LM3A 4G9PA 4N02A 2VTFA 3P8JA 3S4TA 3LQLA 3M41A 3ALGA 4J5NA 2DIEA 1OGGA 2ZZ5A 1E4IA 3PR9A 3VKAA 5HW7A 4F2TA 2W67A 2Z1SA 3DX5A 1SQ7A 4O10A 3UF9A 3HPFA 1K77A 2J77A 1S3TC 4LS1A 1WDQA 4QDPA 3QHNA 4IX2A 5TD4A 4GI4A 1V3KA 2VWTA 3EXSA 1TSIA 4RK8A 3HMCA 2ADAA 4JFLA 2UZ9A 4FXSA 3IJLA 2ZRWA 1JF5A 3HPXA 1Q6LA 1D7HA 1U30A 3GS6A 4JQ2A 4P5UA 4Q8MA 3BTNA 4L1WA 1CGTA 3BE7A 4BQ2A 4CKQA 1GG0A 4RNHA 1I60A 4YXGA 3KOXA 4PN2A 5DX7A 1FCBA 1YPXA 1NDYA 4F3HA 1P4CA 1MW1A 3PZIA 3CUXA 4JDYA 6REQB 1RCOB 1DWIM 1L2QA 5B8IC 4E2OA 1PWLA 5I24A 5AHNA 4DBUA 2AQWA 4JS3A 1KR1A 1ITUA 5CPLA 5BXJA 1TV8A 1K8CA 7REQA 1XLMA 1OFQA 1KQYA 3M5YA 4B90A 4DNMA 3P0WA 2DZUA 3O6YX 4CUCA 2C13A 4UTLA 4ADUA 3B8UA 1X8CA 4XZHA 2X1IA 3NOEA 2A79A 3R6IA 1MZRA 5KTLA 4HYWA 4O8AA 1SJAA 1UG6A 3LCIA 3RF9A 3S1WA 1D9EA 5GJMA 3C8NA 3C2VA 4ZPTR 4AAJA 4ICNA 3DDMA 4JTGA 5EU9A 3RM9A 5KSWA 1V7YA 5IDIA 1FWHC 4PFHA 1GOOA 2H3DA 2XGZA 3G3MA 5C2XA 4KGLA 1E73M 3O5RA 3LI1A 4JX5A 2RDXA 3N4FA 3MMUA 3TX9A 3T44A 3WD3A 3ATYA 4DB7A 4KMQA 4A8NA 1CGWA 3CIXA 2QAPA 4ODQA 3NL3A 3M7SA 3RJXA 1FXQA 4QAIA 4DI8A 3I7RA 3CUJA 4NUWA 5KEZA 2YKKA 3J7HA 1QI5A 5I3JA 2DP3A 2HE8A 3MCMA 4AWEA 3MHUA 1ZENA 3RFAA 1B54A 3EKLA 1Q6UA 4XTDA 4D6DA 2PGWA 3VPLA 1VYSX 4DAFA 2XYLA 3BLFA 4RW3A 3CB3A 3POHA 3WX7A 1ZK6A 5DF0A 3GG1A 4PBFA 5KMYA 1IXNA 2PLKA 4EAYA 1QCWA 4LYPA 2PB1A 4R33A 3U8GA 2Z1XA 3ERPA 2NX1A 3VOIA 4WSJA 3C2YA 2ZADA 4NXKA 2PF0A 1HL2A 1V08A 3PULA 4DXVA 4GJJA 2EEXA 3COTA 4JEJA 3M1ZA 1UBPC 2CHNA 4N9DA 1LT8A 4DWSA 1YLVA 3NM3A 1ROTA 4M24A 3SECA 1EUAA 1W54A 1QTWA 1XL9A 3O6CA 3S1XA 1XLLA 3TC6A 1GYNA 2OWCA 3N4EA 4DO6A 1XLKA 4PTNA 1W3TA 2GJLA 3NDYA 1PXGA 1EIXA 4BF7A 2HV5A 1A5CA 3BDKA 4JYDA 2GGGA 4H9XA 4BF9A 4YVVA 3ANVA 3VABA 3LRMA 4QISA 4BA0A 3O5LA 3KOWA 5FF3A 3UG3A 2QW5A 2YZRA 4DLFA 3CC1A 3P80A 2G8ZA 1QBBA 3QVQA 2Y70A 4KF1A 2R1MA 4LVGA 1DJIA 1Z48A 3SIMA 4J4KA 1BWLA 3EWZA 2YA2A 3KAIA 2VQUA 4JAWA 2QHAA 2BWGA 1K02A 1ITXA 3L21A 4PBEA 5E1QA 4CNOA 1KTBA 4E4PA 4XK2A 4Q32A 4HU8A 1ZTVA 1W8SA 3N14A 1R9HA 4IL0A 3G18A 1ONEA 3A4JA 3LLDA 3RR4A 3B0XA 1TTQA 1FVPA 4AIEA 3WLRA 4D6EA 1TZ7A 1UH3A 1POKA 4MNJA 1T7LA 1UKOA 3TH6A 3QSRA 2GVEA 4YS1A 3T1GA 1LM1A 4C6FA 3WDRA 3M7WA 4DXXA 2C1GA 4NYUA 3ODKA 2VGFA 3NXFA 1FRBA 1ICPA 3GUWA 4E38A 4HOZA 3UU0A 4YVXA 3M0XA 3M5VA 3MP5A 5CXPA 1WPCA 3F5JA 3E2VA 4KWOA 3L9CA 3VDHA 5XIMA 4CN4A 2BY0A 1IHIA 2CHOA 3P81A 4RXFA 1UUQA 2RAGA 5JBEA 2P1FA 2I14A 3W88A 2BHZA 4MNLA 2JKEA 1V0KA 3I3DA 4ZQMA 4HN8A 1D8WA 4DROA 1E70M 1TRDA 4XO7A 5H6HA 1ZB5A 4MAVA 2V82A 2G3IA 1XYMA 3UESA 3C0LA 1SFSA 1KD0A 3GDMA 4JN7A 5KZDA 3B4YA 5J5RA 4WY0B 4DRNA 4JTDA 1KW1A 4DUXA 1NWTA 3U2EA 4AF0A 4Q8OA 1S2VA 1XPGA 1TV3A 1EP3A 4IFRA 2DIKA 4F9JA 4C6IA 1ZP3A 3M6YA 4O1AA 4DM2A 5AC8A 4QIUA 3TDBA 3UA4A 2YDRA 4CNPA 3MA8A 2XP4A 1UYQA 1US0A 3CT7A 3DKLA 3VFLA 2XSBA 1V03A 3KL5A 4RLIA 1V3MA 2OLSA 2YJQA 4MOZA 5G1YA 3EEZA 3TA6A 4QP0A 4JTLA 3IJ9A 2WLZA 4XAYA 4GG9A 1OX6A 2AAAA 4A3QA 1H1NA 3OA3A 3NIYA 4JFUA 3R43A 2Z1VA 3VE7A 4MY8A 4M7SA 3SADA 1X1OA 4NJHA 4H7ZA 3QPEA 4ZXLA 1L6GA 8A3HA 4XG1A 3ONCA 5H91A 1R3YA 5FACA 5G1TA 3EWDA 4JY9A 4AEOA 1TPEA 3N29A 3IARA 1ZU8A 1LLOA 4HYVA 3FS2A 4U31A 5AYZA 2VC7A 4GHRA 4E6MA 5K9CA 5HQMA 1DKWA 4IFKB 1K9DA 2PPPA 4MSSA 5BYWA 1SR9A 2WW5A 2ZE3A 1TCDA 2VCDA 1H1ZA 1LT7A 1KXHA 2RUSA 4IFOA 1V0LA 3FVMA 3V18A 1YADA 3EOSA 1UWQA 5T9CE 4FLQA 1AH3A 5HUPA 5IOBA 1XQKA 3UJEA 2VDIA 3NO3A 3T08A 4JNMA 2BY3A 4KERA 5DXYA 3CH9A 3V16A 2VZVA 1UZDA 1TWZA 1BVNP 4JX4A 3I65A 3VIOA 2QPUA 3KCEA 2NV9A 1ZAHA 3LV6A 3ZM8A 1J9YA 1D7KA 1ZJIA 5I3DA 4QDMA 4H2HA 3WQ8A 3V3WA 4PTVA 5D32A 3BMWA 5HKGA 3WMBA 2PWEA 3O15A 3LHWA 3FFSA 2F23A 4GJ1A 4QLKA 1L2UA 1RLDA 2CXGA 1ZHAA 3IIVA 1KGWA 2V69A 6A3HA 3OB8A 2A7PA 1BRLA 3QPZA 1B1YA 3F1QA 2PV1A 4FR1A 4QG6A 5FL1A 4IGHA 4IM4A 3PVFA 3ORWA 4KBXA 4CEUC 5EB8A 3QYSA 4GC3A 4ZB5A 1XISA 1J0KA 3LMYA 4H9MA 4G2PA 4FLRA 4Q6JA 1RD5A 1BVWA 2QNEA 2DT1A 4WDWA 1VBRA 4JPGA 5D9PA 3I7QA 1OYCA 1XRTA 5HJXA 4IWWA 1UZHA 4NZCA 4ZR8A 3EY6A 3PNUA 3UF8A 4NQ1A 4JZ5A 2QT3A 4F0SA 3NZGA 3DG7A 1L8NA 1MRQA 3QQWA 4GC4A 3TR9A 3NQBA 1EDQA 3LPFA 1ISWA 3FYOA 3B7XA 3TEVA 1XRFA 1WKDA 4W93A 4U4MA 3WK3A 4ACYA 2CLEA 1A0DA 2Z6IA 4L9YA 3S5YA 3NQFA 3Q2DA 1OCJA 1UOZA 5JU6A 3M0ZA 5H8MA 2CWXA 1RR2A 5REQB 1YEYA 2OEMA 2VEGA 3IHZA 3VZXA 4W8AA 2GUYA 4CGTA 1JVWA 1EJUC 1GEHA 2P10A 3VDCA 3UI4A 1X98A 4DWSC 2HPIA 2VCAA 1NEYA 3KLKA 1G01A 1O12A 4UBPC 2CETA 3DGRA 3TP4A 3OLEA 1BD0A 1N8WA 4FMVA 3UZJA 1F61A 1BKHA 1JFXA 1JNSA 1ZCCA 2O56A 2OKTA 4DBSA 3CLMA 2AKMA 3S2NA 4HK7A 4R7JA 2OSWA 2IXUA 3TYCA 1YRRA 2DGAA 3DC0A 4W86A 4CQAA 1OFOA 4QJ3B 1JXKA 3M6DA 4N6FA 5G4HC 5I98A 1G7VA 1QPRA 1GVEA 1KM1A 1KBBA 5A5WA 2NLYA 4R9OA 3WL1A 2XVKA 3P0XA 5K4XA 1DWAM 1RVGA 4R34A 4UQDA 1I1WA 5LA0A 1BLIA 1F2JA 3TE9A 4GVIA 3RRAA 5AKQA 1IEWA 2O0TA 3K46A 2Y7FA 3DAQA 4XAFA 4B3KA 1FHUA 4LUYA 2PGRA 1HKMA 1NQKA 3C52A 2Q8ZA 5T26A 1E4NA 1P6WA 1FKIA 4J2PA 2R1LA 4EE9A 3EA3A 4FI4A 1IT0A 3IRSA 4I8YA 4V2XA 4OFCA 1XIDA 2XVLA 4L6HA 4DRQA 2YSWA 1OSEA 4P8WA 5HANA 1XCWA 2PDGA 2NSXA 3WENA 1HO4A 2G37A 2PTDA 2Z24A 3GU9A 2CERA 1BFNA 1O1ZA 3CV2A 3AC0A 3U4FA 4LWWA 4ICCX 1TMHA 4GGHA 3T7VA 4WJ8A 1PIGA 3I6EA 4QT2A 4JL1A 1AD1A 3KZ7A 4NZ5A 4F0LA 1X1NA 3W7CA 3DBNA 5J6EA 1ITCA 1HL8A 3KVMA 4NILA 3V5CA 1SMAA 3GHRA 4BEUA 3SCSA 5D30A 1T40A 3MSDA 3PAJA 1LBLA 3BJTA 4AXKA 3O0KA 4B2DA 3GYCA 4M82A 1WOAA 4HA3A 3LTYA 4LAOA 5I77A 1L0PA 1B3ZA 4I90A 5DMMA 2E67A 3BW3A 3BXWA 3C2EA 4LFYA 3ARYA 4KCVA 4XKYB 4ERGA 3N13A 2VENA 1F8IA 1L1PA 5CJMA 5HATA 1KCLA 1LG2A 4YU1A 4PBGA 2RHGA 3AIRA 4F79A 2R14A 3AXHA 2ZQUA 4OT7A 1WBHA 4S38A 9XIMA 5A6BA 4GABA 3LA4A 4HTBA 1FKDA 4JTFA 1XCXA 2DZXA 3TOYA 4HVXA 3T09A 4NYYA 4OIFA 3IIPA 5AVHA 5CLTA 4FZIA 1FKSA 4PCFA 4DLMA 3H8AA 2P3EA 1PSCA 2J7BA 3PG8A 3LCXA 1MQPA 3W2UA 5KZ6A 3TCZA 3TUUA 3WBAA 1W1B1 4BEQA 4G1NA 4PMVA 1EJTC 5FI8A 2IUZA 2CBVA 5M5DA 1GOXA 2Z00A 1EQPA 2QCNA 2QIIA 2VP8A 5FJPA 2BVYA 3NQ2A 4PC8A 4Y9AA 1BXNA 3ARSA 2Y8KA 1W1YA 3TW6A 4DBEA 1QAPA 4K1GA 4LV4A 4GCXA 2OKOA 4LU0A 3PB0A 4AD5A 1XUUA 3LCWA 1KRAC 2XH7A 3S1UA 4IHCA 4QCFA 4E5TA 2G4JA 1RSCA 2POZA 4JFKA 1FWRA 5HMDA 2XN2A 4IISA 3W02A 1XYBA 2J8GA 2WJDA 4O15A 3EKGA 4KQNA 2HTMA 3CAKA 3BURA 4Q4OA 1AL7A 1R47A 1C9HA 4WKAA 5I09A 3MWAA 3RR1A 4KW2A 4C02B 1UZ4A 3PM6A 1GZGA 3UWYA 4GX8A 3KP1A 5AOUA 4TX0A 3V4BA 4IIBA 4LCQA 1PCWA 2XVPA 4ONVA 1MMFA 2PU0A 3MI3A 1XIBA 5T9BG 3AS0A 3I3BA 4EPBC 3VDBA 1J12A 5AHEA 1JCYA 2ZXAA 1F76A 1C29A 4DYKA 1ECEA 4HPHA 1O68A 3HJZA 3R7MA 2R91A 2NVCA 3EX1A 1ME7A 3CL7A 2KFWA 1WUEA 3GLCA 3W73A 2YZ5A 3HV9A 3NI6A 2UZ5A 1NP0A 2ANUA 4B16A 2UY3A 1JJKA 1TPWA 1JR1A 3C56A 5E70A 4MM1A 3W01A 4QBXA 2P8BA 7TAAA 4G5DA 3URQA 2VFFA 1VP5A 5F4XA 2ZQ0A 3EB3A 4A4AA 2M1IA 4RX0A 2YBVA 2GQAA 4LS0A 4ZS6A 3AHTA 1M65A 3SCNA 1OIMA 3UYIA 3BSMA 1T6MA 2ICSA 2ACRA 1POJA 4JL2A 1S38A 3F5LA 3T4CA 2D2HA 5CEWA 4OZOA 1GOQA 5A6SA 3LV5A 2BZNA 4MJMA 2A3HA 3ISIX 3LDVA 5BXTA 4HNTA 4PMUA 4IMAA 4S3FA 3MC5A 4H8NA 4I5XA 1R0MA 5I03A 4LNYA 5LNRA 4HBKA 1W3HA 2IKJA 2OX1A 2FVLA 3MTWA 2XP5A 2HS8A 2X7VA 1VS1A 4HZ7A 3CT2A 4R7WA 4M81A 1M53A 1AJ2A 3WQOA 3VD7A 2DQWA 3W7IA 1UW9A 4GI9A 1V4YA 3C3NA 2XHYA 1F7BA 3WD0A 6XIMA 3RMJA 3BLDA 3VZYA 2E68A 2EPLX 1ISVA 1PINA 3SGZA 4WSHA 4HGXA 5EMYA 3TSDA 3S47A 3KCOA 2PDNA 2BVTA 3ARXA 4J3XA 1U83A 4MDPA 1XC4A 4RV3A 3TN3A 4HMEA 1SPQA 4XIMA 2BXYA 2PWGA 1QHOA 3V1PA 2F38A 4ZL1A 3AMGA 2FDMA 4HB7A 4JXCA 1X38A 1GVOA 4IQLA 3EPMA 1SR0A 3NNTA 1PBKA 2D3LA 1GGOA 2HK0A 1RQHA 4IMFA 3KL3A 3O6DA 2VEFA 4OTKA 4RXGA 3REQB 3CWNA 2GFTA 1Q2SA 4WOZA 3WJSA 4X22A 4MLJA 1Q6GA 4GXWA 1FHVA 1FP9A 7TIMA 4D9PA 3KCJA 2ABAA 3NUKA 1A53A 1J4RA 2YW3A 3NQEA 5BW6A 4X0NA 3SEPA 1NARA 4GXPA 3OG2A 1WZLA 4Y9PA 4MIMA 1VEOA 3EDFA 4MSPA 4HNOA 2ZX6A 1M03A 4TUFA 3CTTA 4Q22A 5CZSA 4BWLA 4Z0SA 1EHNA 2Z25A 3IV8A 1EHAA 4W9OA 1HP4A 3U7VA 3TU9A 5HWJA 1T8XA 3W1TA 1UR3M 2RURA 3ZSSA 1JCHB 1FWTA 4LUIA 1Y0EA 5IHSA 3M0VA 1IR1A 2BBFA 2C0AA 2YDQA 4ZOEA 1YDYA 1HO1A 3LHZA 3BV7A 3QY6A 3RPMA 4MNKA 3DCPA 1OD0A 3BW4A 1SO6A 1TR9A 3UNTA 3ZT5A 1DP0A 3MP3A 3PZOA 2PP3A 4WJXA 2PD9A 1WO2A 4MVAA 4CCEA 3POCA 2F7FA 3DC8A 3QY7A 1D8CA 1FDZA 1OF8A 3CUHA 1GRJA 1ELSA 3WSUA 1HF6A 5CZ0A 1JZ3A 4FALA 1B4KA 1G9HA 3RLVA 3CV1A 1YTKA 1ONRA 4FR6A 5CH9A 4AHPA 3R10A 3H2CA 2FGLA 1TPB1 4GLEA 1D7JA 3THDA 1Y65A 3URAA 4H4IA 3PZMA 3O6AA 1NTHA 2ACUA 3QFWA 4YTSA 3APTA 4HT3A 1FWDC 1NU5A 4ALDA 4R85A 2P5NA 2WSQA 3UQAA 3H70A 3NQDA 3O2LA 3D0CA 1H62A 1QPQA 2J74A 1J6YA 3UNDA 4ODKA 3BO9A 4GINA 4EANA 2E5BA 1RV8A 4F9DA 1XGZA 2ZVRA 3A12A 1XH2A 4DPPA 4LEFA 4QSHA 3QHMA 1W9BM 4O1BA 3L12A 3HG3A 1A0EA 2BSLA 3TQKA 3QQ1A 4AHQA 3VGHA 3I6RA 4E0CA 3GY1A 1DXIA 1ZALA 2DSUA 4FLSA 5K4ZA 3PWIA 3E0IA 1H63A 2VCCA 2ZQSA 4GD0A 4IGNA 4H9YA 4S3DA 3EA2A 1FWWA 3GKAA 1VB9A 1GJWA 5I02A 5CAKA 4WKHA 2DUXA 4LCRA 1W3LA 1ZBWA 1XD1A 4ADTA 1IEQA 1AG1O 2YYUA 4OU1A 4IIGA 4ZQPA 6TAAA 4A3HA 2XP9A 2A7RA 1EQ3A 1YE6A 4XBJA 2WVVB 4O28A 2HZGA 3EPNA 4MUPA 1EJXC 3PBGA 5DIUA 1REQA 4PEEA 1A80A 4U5IA 4Q8VA 4KFNA 2CZ5A 1QI4A 2GVGA 3QR0A 1K9FA 5LA2A 1DXFA 2J9YA 3MUCA 1QPNA 4CD4A 3RHGA 4NZJA 3P84A 1U1UA 4DXKA 1SUXA 3UR2A 2NWSA 2W61A 3FA3A 3DHFA 3BLOA 3SCPA 4EOUA 4PL1A 5HNNA 2QUMA 4LAUA 3B06A 4UFHA 3HU7A 1JDCA 1R38A 2PP1A 2Y0FA 2YXXA 4N9EA 4DWSD 2FKPA 1IT8A 1XUZA 1FKJA 3Q37A 2FKEA 4AD3A 4DEFA 4FNUA 5A8PA 1C3FA 1EX1A 4P7QA 2UV8G 4QG8A 2Z6JA 4NKCA 3HGOA 1U2YA 4AD2A 3EWWA 5DCEA 3NQ8A 3UWVA 3OYXA 4IQJA 2ZR6A 3GXFA 1MUWA 1R8LA 2CHRA 3GC4A 3T05A 2ETNA 3TN4A 2VR5A 1XRVA 4UNKA 4RZBA 3WF2A 4XZLX 2WAGA 4NY2A 4ZEPA 3VVGA 5LIYX 5H2ZA 1HXVA 3SB0A 3OEXA 1VYPX 1FH7A 1TPH1 1PDZA 1TWIA 1J4EA 3Q45A 4Z2LA 4AYGA 3KZPA 2VYOA 4OVXA 2NQHA 1GVQA 4XZMX 3KHDA 3QGKC 1GZJA 3SY1A 3QTPA 3SCOA 5D09A 1MEIA 3B4UA 3HM7A 1FY6A 2CBUA 2QCDB 4L6DA 2FZ8A 1KQZA 3GNRA 3L4UA 3TWAA 4AY7A 3FY1A 4ODLA 1T5AA 1PX8A 2G3MA 1ZGDA 3EGJA 1LRQA 1SMDA 1VENA 4MKNA 3CV6A 5E0FA 3VIPA 1E43A 3AXKA 5D2TA 5AECA 3WK1A 3FEQA 4CNTA 1LQ0A 1S5WA 3M0JA 5HBFA 2NVAA 3LOTA 2RJGA 1XRSA 2RKXA 1XGDA 1A7XA 1O66A 2VZUA 4Q7BA 2G96A 1IEIA 4GIAA 1GK8A 2FPTA 1OD8A 3AMKA 3H54A 3U5UA 5C71A 1YDNA 2BVWA 1W91A 1DQUA 4XSLA 1HXJA 3BW2A 3VAWA 3QV9A 3NQMA 4HU3A 2GDVA 5EBUA 5I7GA 3VIMA 5ABHA 1IXQA 2JF7A 1YTEA 4Q8UA 1I1XA 1W1A1 1QNSA 1K4GA 4KT2A 4EPKA 1QNRA 3BCDA 2PLJA 3QEZA 3KS5A 4XIAA 1DJYA 1C92A 1PX3A 1M7XA 2HNHA 3TOPA 4OV9A 2GJXA 1A5SA 4GIEA 3AHZA 2C71A 4H3DA 2D23A 2YCLB 2VELA 1UC4A 2A21A 1TVLA 4DRSA 1CEOA 1CT5A 2HPMA 1TIMA 3DI1A 3AYTA 4HHMA 1KB3A 3P67A 3DESA 1XLAA 2CKSA 1EDGA 2V8ZA 4LAWA 3W7RA 2B7OA 2HNEA 1OCNA 2VUNA 1LWHA 4GYJA 2WZEA 5GPGA 4M51A 1TV5A 5BU9A 3RAOA 1JNDA 1BSIA 3DECA 4LB4A 1BYAA 1ML1A 2YB4A 4BWLC 3R12A 1CIUA 4UTKA 4EF9A 2J6VA 2M08A 5HR6A 1QNVA 3HN3A 4L80A 2GVJA 5DT5A 1VJIA 3HB9A 1LJYA 3XISA 4LBUA 4LCSA 3W7JA 3B8WA 1V77A 2Z0IA 3E74A 2QCHA 4YIWA 4XTIA 4NHVA 4NNCA 4L65A 1FXPA 3KE0A 2Y8VA 1JZ5A 4F0MA 3KRZA 3MPGA 3CLWA 3GNXA 2HRWA 4R88A 1CGVA 2OPJA 4HU0A 4GNKB 3K1GA 3PTDA 1E1CA 3OHIA 1Q5MA 1RXOB 3K30A 4L9XA 4A2SA 2DT0A 3DN5A 1FKLA 5CC7A 1L6FA 5LIXX 3PBMA 2DY3A 2DQXA 3PZQA 1O4UA 1YDOA 2F6UA 5K7JA 3HZ3A 3LX9A 3OG3A 4XWUA 4MWAA 4L4PA 4QE4A 1KM6A 1LUCA 4FO4A 2B31A 3KVKA 3C0JA 1KTNA 1S46A 5DO8A 3N2CA 1MQQA 3WFLA 3E1F1 2ZC1A 3MO4A 2O7QA 4GKTA 5A1AA 4PB3A 3BQ5A 1J6PA 1S1RA 5LXXA 4B92A 2YCEA 1VIWA 5FEXA 1W3NA 2MLYA 3N15A 3RU8X 2YBUA 3VOFA 3T55A 3ZZ1A 3MV11 1JCLA 3CXOA 2VURA 3OLGA 4PUEA 3WY1A 2VXNA 1GNXA 1A5NC 3QTGA 1BF6A 3PR2A 3QSTA 5HAOA 3KWXA 4HNLA 2XP7A 2KI3A 2JIEA 4HIBA 3VYLA 3XINA 1MEWA 3DFNA 1IGWA 2D22A 3G6LA 2XIQA 2V63A 4B4HA 3M64A 1JUEA 4QZVB 2JE8A 2QMKA 2V3FA 2GSJA 3ZYZA 4Y6GA 2DZTA 2WM1A 3K13A 1I4NA 3SN1A 3ZLHA 2VM8A 4ZO7A 3SCVA 3VNIA 3N04A 3PAOA 4NZ3A 2XZ7A 1Q7ZA 2DFAA 5LGXA 4PTWA 1FKKA 3MMTA 1QPOA 1JAKA 2BB0A 3ABZA 2Z27A 5A8GA 3NZQA 4TMCA 4Y8FA 2UBPC 5CGTA 3UZYA 3KAHA 1G69A 1Q7MA 4JTKA 4O2TA 2V6AA 5EFFA 3NPWA 4D8LA 1MYRA 4W4QA 5CJNA 1PIFA 4CD8A 2F2DA 4GPNA 2VD8A 3QY8A 5E5CA 5FJRA 1WCGA 3NA8A 2H8XA 4HHPA 1LL4A 2E25A 1DVJA 4RR4A 1R3TA 3UXAA 1VEPA 7REQB 4LYQA 2PDFA 4U3AA 1LWJA 1ALDA 4DPQA 5EMUA 1FFRA 3PHAA 1EF2A 1XH0A 1EUNA 1P0DA 1KM0A 1JYVA 4D6JA 1QPFA 1CWYA 4FLOA 5FEWA 1OT2A 2BDQA 3OZYA 4K8GA 5LSMA 1QUMA 4M8UA 4JTSA 1XIFA 5AYXA 1VQTA 3V75A 8XIAA 1O5XA 2WC7A 5LNUA 3N6QA 4QCEA 3W7GA 3KLLA 2YDSA 4PYSA 2PE4A 1XF0A 4LF2A 1YW5A 4NAEA 3C2FA 5IRPA 3B8VA 3SY5A 4Q8NA 3AJXA 5FJUA 3LCFA 4HK5A 1J0HA 1PCKA 4AHOA 4OHQA 4OKDA 5HTGA 2WMGA 1D7IA 3GO2A 3SRDA 3GPKA 1OG6A 3TLLA 5DN1A 5BRPA 1S1PA 1F8MA 5CPSA 4EP8C 2GVLA 2X41A 4A8LA 1SM9A 4IXXA 3W1AA 1SO3A 1XLDA 1HP5A 3H2EA 4IJCA 1LCOA 1JQVA 4NJGA 4CD5A 2CXEA 4RNFA 3IUIA 4J3VA 3KL0A 1KFEA 3CL8A 1DYSA 3VM7A 4HPNA 1KT0A 3GE7A 1ZAJA 4ZQCA 3EWXA 3C0QA 1PKLA