4Q7NA

Crystal structure of the complex of buffalo signalling protein spb-40 with 4-n-trimethylaminobutyraldehyde at 1.79 angstrom resolution
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of the complex of Buffalo Signalling protein SPB-40 with 4-N-trimethylaminobutyraldehyde at 1.79 Angstrom Resolution
rcsb
molecule tags Signaling protein
total genus 129
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4q7nA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4q7nA01
1QW9A 4S3KA 2VRJA 1B2YA 1BPLB 1ISYA 2ZXDA 1NM9A 4ZENA 3THDA 3WQ4A 2DH3A 2QLYA 1GZJA 1EO5A 1WAWA 1UOKA 3VIHA 4MNKA 1QVBA 3WH5A 1V6UA 4GXPA 1WE5A 4GZJA 5LA1A 2ZUSA 4D71A 4AZIA 4D6JA 1BFNA 2JEPA 5M17A 3AIBA 2ZICA 4D72A 4UQBA 3PZNA 3KWXA 4PTXA 4FLOA 4X9YA 1NH6A 2WBGA 3T0DA 3ARYA 3SCPA 1V3HA 3SCWA 1W9XA 1K9FA 3K8KA 5DFAA 3PHAA 3AOFA 1JG9A 2GJXA 4XV0A 1U30A 4P7OA 4UTFA 4YHEA 4EAMA 2VX5A 2VZOA 5I3DA 2D1ZA 2GUYA 3W6LA 5M3WA 3WNMA 1K6AA 1GOIA 2PWFA 1UH3A 1VFMA 1LQ0A 4EE9A 1CBGA 2EPOA 4TX8A 4W7UA 2PWGA 2GK1A 2VTFA 3FHQA 4W7VA 2UY2A 3WD4A 1WB0A 4UFLA 1U2YA 5I79A 2G8ZA 5F7UA 1H4PA 4XX6A 1B31A 2XGBA 5HBFA 1XSJA 2VR5A 5JH8A 1XD1A 1WZKA 2JEQA 3ARVA 4IUGA 3VX0A 1H41A 1QBAA 4QCEA 1NWRA 2F2HA 3GXMA 4DWSD 3VVGA 2OWCA 3VD4A 3CUFA 4J28A 2VCAA 4PMZA 4DUWA 1BLIA 3T2PA 4HOZA 3BAJA 1HX0A 1JI2A 2XYLA 5A8MA 4UOQA 2EPMX 2XVLA 4U31A 1CEOA 2WMFA 5FCZA 3BXWA 1XGZA 3AFBA 3KL0A 2D3NA 4AEFA 4URIA 4OKDA 3THCA 1J9YA 1JFHA 2WNWA 1EOMA 4LYRA 4OUEA 3GH5A 3PZ9A 5EFFA 5A8PA 1TR1A 5A6BD 2C7FA 3AI0A 4PBGA 1WZMA 1VEPA 1MFVA 2EO7A 2G3NA 3MUZ1 4V28A 3K8MA 4D6DA 4PSPA 1XCXA 2WSPA 1CXIA 3MUY1 5CLTA 3WQ6A 1QI3A 2QV4A 1UKOA 2YJQA 3BAIA 1SMAA 3G6MA 4JL1A 3VD9A 1CGYA 3WQ8A 1H0IA 2E40A 1E73M 3HU7A 1G1YA 1TUXA 1EQPA 4GO9A 3ZQ9A 1GHRA 2NT1A 2WVTA 1JYVA 4NZCA 1E55A 2WSKA 3DECA 4B3KA 3CUIA 3OGVA 3QGVA 1HJQA 1EO7A 1M01A 1VIWA 2FHCA 2VVNA 5AYIA 5A6SA 1ISZA 1QNRA 3TA9A 3ZSSA 2YBTA 3RM9A 2WB5A 3NCOA 3N04A 1E6PA 2VUYA 5GNXA 2BFGA 2XSBA 4JFVA 3VM5A 4AIEA 1V02A 3W28A 4ZXLA 2OYKA 2WCSA 1ZBWA 3AZRA 1C8XA 2WVVA 1R86A 1JZ3A 2PBGA 2E0PA 1CXHA 4AY1A 2QMKA 1J01A 4N42A 5CPTA 2DIEA 4H7VA 1JYXA 5LA0A 1GVYA 3G6LA 4JFUA 2YOCA 1V6VA 3WNNA 3GM8A 2ZUUA 4TTGA 3WMCA 1H3GA 1C91A 1EDTA 3EDFA 1G0CA 1JXJA 2XSAA 2Y8KA 4J3TA 4WF7A 2VJXA 3LPPA 3RPMA 4U5KA 4MNJA 5DF0A 2ZOXA 4Z2JA 4UFHA 1CIUA 2VI0A 2YL9A 1BG4A 3VIFA 2PB1A 1R7AA 2QHAA 4YN5A 4AD2A 3TTQA 1W9VA 2X0HA 3BCFA 3D3AA 5GQBA 1NWUA 3BSGA 1KBKA 4S3JA 4CN1A 1KFWA 5ABFB 2XM2A 4Z2KA 3AIUA 3SCRA 2V5DA 1CGTA 4TOQA 3MMDA 5M03A 2F8QA 2J4GA 4MDOA 2W92A 2IXUA 3ZJ6A 5A2CA 2YL6A 5CJ5A 1CXLA 3TTYA 5CPQA 2EPNA 3VUPA 1LL6A 2GDVA 1W9UA 1UG6A 2EBNA 1TFVA 1W3HA 3N13A 1W1PA 1W1VA 1IZJA 1UD2A 1EDGA 1NOWA 3PN8A 1VEMA 5KEZA 4MNLA 4Q22A 2E9LA 2A3EA 1CZ1A 4D6FA 4MB1A 2DT2A 2WAGA 1CGVA 1DWIM 2MANA 3IAQA 1UD4A 3NDYA 3AHZA 2VC9A 3PZQA 1W91A 4QLKA 3ZJKA 1UWTA 4W5UA 3L4UA 3BH4A 1OGGA 1HKKA 2XJ7A 5ABHA 1FH7A 2GSJA 2VRKA 3PTQA 2CEQA 2VZUA 4D6HA 1UKQA 3MUIA 3WEZA 1KXQA 3CBWA 8CGTA 2DT0A 2WVUA 1JL8A 2TAAA 3GH4A 4DWSA 3VKKA 3NSXA 4CCDA 4KGLA 3WELA 2VT0A 1TZ7A 1VRXA 3HN3A 1V0NA 4JKKA 3CPUA 2CBUA 1TE1A 4JCLA 3BC9A 2VO5A 5EB8A 4F79A 1WDPA 4F66A 4CD6A 4BQ3A 5CSUA 2XGIA 5HDRA 1GOMA 3ARTA 1VB9A 3T2QA 4NRRA 3WFLA 2E8YA 1PIFA 3LPGA 1V3LA 7CGTA 1MQPA 4UQDA 4PSRA 4AZ5A 2CYGA 3SURA 1V6XA 1NP2A 4FK9A 5BCAA 5HPOA 4AIUA 3ARRA 4B9ZA 3MANA 3L4VA 1E56A 2C8NA 4AZBA 1JGIA 2D3LA 1UD6A 3L4ZA 3EDEA 4J3SA 4AISA 4MNMA 3A6OA 1ZL1A 4PMNA 4HMEA 1KGUA 1HP4A 1XC6A 1GPFA 1C90A 5I0DA 4GIAA 4TX6A 5FOOA 4U2YA 3AYSA 2DDXA 4UFIA 3IJ9A 1DTUA 4PTWA 4KH2A 2WMHA 3L2LA 1G9HA 3POCA 1JDAA 3NIYA 4CU7A 2BV9A 1JYNA 1ITXA 1Q6CA 1XHGA 2E3ZA 2E9MA 1UQZA 4GO8A 1MQQA 3FAWA 1B3ZA 3SCQA 4PUDA 3VD7A 3M07A 2YIHA 3MKKA 4E8CA 1HNYA 2ZX8A 1J11A 2J8GA 2WHLA 4W86A 1H11A 3EBVA 2WKGA 3AZSA 1JDCA 4LGXA 2GJRA 4D6GA 2WVSA 1TA3A 2CXGA 3VGBA 1E5NA 2D0HA 2J25A 3CMGA 2OSYA 1PX4A 3WEMA 1JZ8A 1HP5A 1NARA 1XH0A 3O9NA 4PCSA 2X05A 4CN4A 2DQXA 1GOOA 4CKQA 3NJ3A 2WM0A 1CDGA 1GCYA 1UYQA 3F5JA 4DUVA 2J7GA 1W3JA 2YLLA 2ZXQA 1RPKA 3WNPA 2CITA 3VDBA 1E71M 4C7GA 3WDIA 1KWKA 2BVDA 2VQUA 3W6MA 1ECEA 3ZM8A 2VX6A 2WHKA 3AICA 4HMDA 1LL7A 4P8WA 1E72M 1DWFM 5ABGA 3OA5A 4KWUA 5DO8A 4HA4A 4MJ2A 5D9OA 1WP6A 3VIIA 4M82A 2ESCA 4KMQA 3WF4A 5D9PA 1HKJA 3VDHA 3W25A 4MB5A 4MAVA 3QOMA 3RILA 3QHMA 1MXGA 2D24A 2PWEA 4J3VA 1TCMA 1UZ1A 1UWQA 4JFSA 5EFDA 1FP9A 3IANA 2YL8A 1CWYA 4ACZA 1OINA 2CETA 4UQ9A 2XIBA 1LWJA 3CH9A 4PMYA 2Y4SA 4AD1A 2V3FA 3AQUA 3UETA 5M5DA 1H1NA 2J77A 2J8FA 3GNPA 3GDBA 2JIEA 4JKLA 4TTUA 2DSUA 1FA2A 2BNJA 2XUCA 1TVNA 1LWHA 3VDCA 3BLKA 5IFTA 2CIPA 3M46A 5E0CA 3B8SA 1H49A 1HJSA 2VL4A 2XFYA 3VGFA 1JXKA 3BAYA 4E4PA 4P8XA 3AXHA 4P7RA 3SUTA 4AD5A 3AXXA 1HKIA 4CD7A 4GQRA 2CKSA 4W7WA 1ZS2A 1EQCA 3SCUA 4AYSA 1NOUA 1ZBKA 4YHGA 3AHYA 3SCSA 3WMSA 1ZBCA 3A4AA 5E0FA 1C3FA 1MVYA 1V6YA 3AHTA 3WQ5A 1UD5A 4AWEA 1OB0A 1OM0A 1WDQA 2WMKA 1U33A 4EANA 2AMGA 3CZGA 1UR9A 1Z32X 4M29A 2Y2WA 4HZ7A 3WNLA 3ZOAA 4WIWA 3GYCA 4UOJA 1CGXA 2CNCA 3WBEA 3EDDA 2ZX5A 1GOWA 2DSWA 3ARZA 4PMVA 4JFTA 3WN6A 2ZUNA 3AIQA 1UR1A 4NRSA 4XZWA 2FHFA 1JD9A 4HU8A 1VFOA 1BYCA 1X1NA 4JHOA 1SFSA 3MMWA 3N18A 5BXPA 1QI5A 3WY1A 2Q8XA 1L0PA 2XFRA 3CUJA 1A3HA 3GZAA 3SUSA 1KXHA 1GNXA 2OSXA 2AAAA 1R87A 1OGBA 3GTNA 4QCFA 3VX1A 4WKFA 5IFPA 2OYLA 2V38A 3I3EA 1VF8A 5A3HA 4ZFMA 5I2UA 2W63A 5JIPA 5JUVA 4AIOA 2DPEA 2HVMA 3BCDA 2VX4A 4LPCA 3OLIA 1BVZA 1CPUA 4L4PA 3PZTA 2WBKA 5I5RA 1RH9A 3U7VA 2X1IA 4K68A 1KXVA 1E0XA 1V3JA 4CU8A 3WDJA 2WLZA 2EJ1A 1LG2A 1BAGA 2EPLX 1BGGA 1GQJA 4AMCA 1QOXA 3ARUA 4AC1X 4F9DA 5I24A 1M04A 3U5YA 3ZIZA 1Q6DA 1HVXA 1Q6GA 2FHBA 3AMCA 5FIPA 1B0IA 4OBSA 5EBAA 1YHTA 3ZT6A 1PJ9A 5GNZA 3QHNA 3A4WA 3UESA 1R7OA 5FKYA 2YKKA 1QHPA 1ODUA 2WCAA 2BY3A 1E4MM 3O6AA 5A8OA 2OLHA 3KZSA 3PBGA 1MWOA 1CGUA 1UD8A 4H8UA 1CYGA 4ZE4A 1MFUA 4HMCA 4N0RA 1TG7A 2ZUWA 3SUVA 3ZT5A 4M1RA 5D4YA 4BQ2A 5TD4A 1SMDA 3A3HA 1BGAA 1E0VA 3WF3A 1W1TA 2YA1A 3TTSA 4MJ4A 2RGMA 1UA7A 1V0LA 3D5HA 4UQCA 4HOWA 3W81A 2W61A 2JF6A 4D1IA 1LLOA 4RL3A 3DYMA 1E6SM 1HVQA 4CGTA 4H41A 2XFFA 3AISA 6TAAA 3UERA 1HKMA 1UKPA 3CZKA 3ZR5A 5CSYA 3PZOA 2VQTA 3GBEA 3MUAA 3VGGA 3VPLA 1W3KA 1ZB5A 1W3LA 5CGMA 3WDQA 3IK2A 3VMOA 1V3MA 4U33A 5DMYA 3F4VA 4CCEA 1KBBA 3NYDA 2NW0A 2WXDM 3J7HA 5E6ZA 5AYBA 1JNEA 2BY1A 1NP0A 4RE3A 5A2AA 5BRQA 4GI9A 3WL0A 1QHZA 1JIBA 1ZJBA 3GNOA 3WF0A 4C7DA 2JF7A 3VU2A 4PRWA 1BF2A 3W24A 1EH9A 4PEEA 1JNDA 1E3ZA 2WYSA 5ABFA 1QNPA 5JIWA 2WKLA 5A6MA 1XYZA 4XB3A 2X09A 3W0KA 4WKHA 4DM2A 4PUEA 3CZEA 1WPCA 4CU6A 3IJ7A 1E1EA 2WC4A 1PIGA 2V3EA 2J7CA 3T0AA 1MW1A 1UR2A 1CNVA 1MW3A 3UG4A 1VFFA 3GNRA 3VGDA 3HJEA 1UHVA 3N9KA 5C71A 3CHDA 2D0FA 1JDDA 4NSBA 3ZJ7A 1FHDA 3WH8A 1LG1A 4W8AA 3WKZA 2YL5A 4AZGA 1L8NA 1A47A 2GVYA 1BSIA 1VBRA 3N11A 3ZR6A 1BQCA 1FFQA 1PAMA 4CD5A 2BS9A 4M8UA 1IT0A 1F4HA 3POHA 3VNYA 3AIWA 3OGSA 4B16A 1ISXA 5A94A 2D23A 5D9NA 1W1YA 1VEOA 1B1YA 1EDQA 3TONA 3OLDA 4BQ5A 3MSGA 2HISA 3GBDA 1CLXA 1F4AA 2CHNA 1MYRA 5HNNA 2WLYA 4PMUA 3WUGA 1VAHA 4IPNB 3WDPP 2JE8A 4EK7A 3VGHA 4LXFA 3W29A 1WDSA 2G4FA 2AOSA 3SCNA 4UR9A 2EQDA 1J0HA 3RM8A 2D22A 3BAKA 1UD3A 5C8BB 1G5AA 1UZ4A 1ITCA 2WMIB 2XWDA 2CPUA 3B9AA 4GKLA 2GFTA 3S6TA 4C7FA 1B3XA 1JF6A 4P8UA 4OBRA 1KQYA 3FAXA 3AMKA 3BAXA 2V5CA 3L2MA 4MPKA 3EYPA 3AXIA 1GHSA 1E6ZA 1KR0A 1N82A 1JZ7A 1US3A 4BF7A 2ZE0A 3CIVA 1E1FA 3AROA 1KWGA 1V02E 2WWCA 4M56A 1E6RA 1V3IA 3PZGA 1C8YA 1QNQA 1RP9A 1MQRA 4ATLA 1JD7A 4HA3A 5D9MA 2DH2A 3AZTA 5BXRA 3B9DA 2VOTA 5EMYA 1RP8A 2OWWA 1PPIA 3OG2A 4FMVA 1B9ZA 4M24A 1DEDA 1AQMA 2E4TA 4P7NA 4R27A 1LJYA 3K8LA 3PZUA 1NWTA 4TVCA 1GORA 3MV01 3FN9A 3BLPX 3RCNA 4ZEPA 1OT1A 4A3YA 1WDRA 1E6NA 2X2YA 3IAPA 3SCOA 3T0BA 3KL3A 4OZOA 2BVTA 2DSVA 5E70A 5BWFA 3FHAA 3OZPA 2DT1A 3AMLA 1BYAA 2W4XA 2WANA 3KL5A 1E43A 3UEQA 4B3LA 1G01A 4J3XA 4AZCB 2J7HA 2WCGA 3ZSTA 1OD0A 1O7AA 3UR7A 4GI6A 1V3KA 2JFEX 4QFUA 1OCQA 3CZ8A 3FNDA 1FHLA 1QI4A 3RIKA 1GQLA 1CXFA 2ZIDA 2WC7A 3WUBA 1VJSA 2XVPA 4P7LA 4Z2HA 1OIMA 5D8WA 2CBIA 2WZEA 3VIOA 3MO4A 2ZXAA 2BHZA 1HT6A 1V08A 3EMQA 1E6QM 4KGJA 2PC8A 3IJ8A 2XVNA 3OLEA 2J62A 3U7BA 2C0HA 1UR4A 2PWDA 3K1DA 3AJ7A 4UFKA 3I3DA 4AW7A 3VMPA 1KGXA 2CESA 2IXVA 1ZU8A 1WNOA 1GOQA 3OGRA 5DEZA 3MU7A 4PTVA 1V03A 1GONA 1E5JA 3CO4A 4ATDA 3HMCA 1XSKA 2E8ZA 3K46A 3VO0A 3BAWA 2CCRA 4D6EA 1C7TA 1AQ0A 4OOUA 1JI1A 5A69A 1DWHM 4PMQA 3KE0A 4WKAA 1AVAA 1MW2A 2W91A 3U57A 5CQ1A 4CCCA 1XYFA 4FF5A 5CGTA 1HL9A 1WZLA 2YDRA 2OSWA 1EOKA 1WCGA 1M03A 4AEEA 1HIZA 3DYOA 3WFZA 1W2VA 1WZAA 2EXOA 4QP0A 2FH8A 3CTTA 4BA0A 1EHAA 3AHXA 1SYTA 1EA9C 2O9RA 2YA2A 3CZJA 1LF1A 4B15A 9CGTA 2YDSA 3W53A 3AMGA 2VR4A 3APGA 3EDKA 3SCVA 4M81A 4ATWA 1S46A 3W4RA 1DWAM 1FH9A 4GZIA 5CG0A 2VCCA 4AD3A 2BY0A 4E8DA 4JFWA 4UCFA 4W84A 3TOPA 1ZJAA 4W89A 1I75A 1UWIA 2VZSA 4LX4A 3WUFA 1JF5A 2FGLA 4U3AA 4Z2IA 3VMNA 3AHVA 3CLWA 4WSKA 2XPKA 3WF1A 2D20A 3OIHA 3WH9A 3LMYA 4D6CA 4A3HA 1CGWA 2VX7A 1IV8A 2GDUA 4LYQA 3M7SA 3NUKA 3ALGA 1YQ2A 3WH7A 3N1AA 4DM1A 5I77A 1BYDA 3I3BA 2ZWYA 1UQYA 1V0KA 1B3WA 1K9EA 4H2CA 3MV11 4W87A 2ZUTA 4D1JA 4RE4A 4Z2GA 2UWFA 5JBDA 3RM4A 1W9DM 1DWGM 3ARQA 3WL1A 2BXZA 5IHSA 2O9TA 1H5VA 4PMOA 5IDIA 1GVIA 1UA3A 4FLSA 3OBAA 3SUWA 3ARPA 3PZIA 1KCKA 4TVUA 2YBUA 2YA0A 3RJYA 4BZYA 1J0YA 3ZJ8A 4PN2A 2O9OA 1QNOA 2NSXA 3BMWA 1CECA 1UWRA 3TP4A 1JZ5A 3CUHA 3DYPA 4HZ6A 2PWHA 3VIGA 5A6LA 1BVNP 1AQHA 3WIJA 3O2LA 4X0VA 1XSIA 3VD5A 1GW1A 1W9PA 3A47A 2OWXA 2J7BA 4OOZA 1WO2A 1M7XA 1J18A 3CHEA 3UG5A 1J12A 4JCMA 2BY2A 3SEPA 1V0MA 3II1A 1JFXA 3N12A 3VIPA 3QOKA 3LPOA 3GXDA 1UWSA 3AIEA 1HJWA 3AIVA 3UCQA 3BMVA 5KZ6A 3KEHA 2W5FA 1XRVA 4MTVA 1UKSA 5A2BA 2A3AA 1I1XA 2JIWA 1XH2A 2W66A 3VIJA 3JUGA 1FFRA 2GJXB 5A8NA 1TVPA 2Z1SA 2UY5A 5JBFA 5ECUA 3ALFA 3RDKA 3FXYA 4FLRA 1UKTA 4PCTA 3VOCA 5I6SA 1Q6FA 4W8LA 1E3XA 4GPNA 2Y5EA 4DUXA 4W88A 2XWEA 1E9LA 2V3DA 5GPRA 1CLVA 2J7EA 3L4TA 3VILA 5BXSA 4UZUA 2YDQA 4MB3A 2GK1B 1XV8A 1C8QA 1KQZA 4CN6A 1E70M 4QLJA 3U5UA 1W9BM 4H8HA 6A3HA 2ZUVA 2CKRA 3WDHA 1R8LA 3E1F1 2E9BA 4W8BA 2VZVA 3RMEA 4UQAA 3AS2A 3WUEA 3PZVA 4AZ7A 4P7QA 3A4XA 2J78A 3N15A 1E4NA 1VENA 1UWUA 2QPSA 4RE2A 4ACYA 2DIJA 3FY1A 3WD2A 1ZBVA 6CGTA 5BXTA 2G3JA 2A3CA 4NI3A 2J7FA 4UFJA 1PEZA 1RD6A 1B30A 3WNKA 3OB8A 3T2OA 5FL0A 1G94A 1US2A 3DC0A 1OBAA 4HA1A 4XZBA 3DHUA 3VGEA 1UUQA 3WEOA 1ESWA 4GI8A 2D2OA 2GJPA 4J3UA 1QHOA 4BQ4A 1W2PA 3EMZA 3SUUA 5BYWA 4MAZA 3SIMA 1ISWA 4W5ZA 4PTMA 5A6AA 1E0WA 4Z2LA 1C7SA 1B3YA 1PZ2A 4WLCA 2DGAA 2XVKA 1V6WA 1E6XM 4AD0A 4H04A 1JZ6A 2VMFA 1NQ6A 4JL2A 2D0GA 1GUVA 2ZXBA 1QI0A 2J75A 1H2JA 1JZ2A 4UQEA 2DSKA 3AIRA 2CERA 1HJXA 1KR1A 3GXIA 3S2CA 3QR3A 2WMGA 1H09A 7A3HA 1EXPA 3N17A 4V2XA 1D2KA 1PZ3A 4R5EA 4WK9A 1NOFA 4AZHA 2XG9A 4HZ8A 1VFUA 2JALA 4J3WA 4ZXOA 1D3CA 1FP8A 1DHKA 1J0KA 4QAWA 3MSDA 4JIEA 2Y8VA 3ARWA 2ZUMA 4TVDA 3WDRA 4LYPA 3W27A 1EGZA 2VNCA 2A3HA 3AS0A 4HP5A 1TMQA 4CVUA 2WWDA 2DT3A 4U2ZA 3CMJA 3CHCA 4FLQA 4E2OA 2WVVB 4F9JA 3MS8A 1UH4A 1UH2A 4CD4A 1P6WA 4JKMA 1QNSA 1M53A 2CHOA 2J7DA 3L4WA 4CVWA 1SR0A 1HF6A 4IPLA 4TXEA 5A6KA 1K9TA 2UY4A 1GJWA 4JHZA 2OYMA 4ML4A 3BSHA 1NWSA 5FL1A 4CUCA 4U5IA 1CXEA 1BHGA 4UFMA 4QDMA 1GOKA 4V27A 4UZSA 3T09A 1CTNA 3VDAA 1D7FA 1PX3A 5HOSA 3WD1A 2B31A 2XHYA 3AS1A 4HU0A 1C92A 2QPUA 2G41A 3F5LA 1CXKA 3VIKA 2G3MA 1EHNA 2FH6A 3WQWA 2DSZA 4W93A 1B3VA 1E15A 1JYWA 4WJXA 3WMBA 1GQKA 4HTYA 2WHJA 5BRPA 1UR8A 2ZX7A 3OZOA 3K4DA 1FH8A 4W85A 5HPCA 5JBEA 5A8QA 2WMIA 1HXJA 4F8XA 3ZMRA 3CUGA 1W32A 3ZT7A 1QI2A 3CHFA 3MMUA 5C70A 2BHYA 3FW6A 1XH1A 1PBGA 3PZMA 4ZE5A 1O6IA 1JAKA 4U3CA 2VVSA 4BCEA 4KRUA 5CXPA 4M80A 5I78A 4P8VA 1E4IA 2O9PA 5AC4A 2VZTA 1HJVA 1OT2A 1WKYA 5CZKA 1J0ZA 4MDPA 3VIMA 3F5KA 1KB3A 2CBJA 1LL4A 2VCBA 2VRQA 3L4YA 2XIIA 4GINA 4MADA 4TUFA 3WD0A 2BXYA 4B9YA 4AXNA 3M6DA 1XCWA 4OJYA 4IISA 3SCTA 1GQIA 4AZ6A 4A4AA 2QMJA 4HPGA 2O92A 5I23A 1E4LA 1OIFA 8A3HA 4UNIA 4Y7EA 3GXFA 5LA2A 4XUYA 1FOBA 1B90A 4EKJA 3ARXA 3TTOA 4DWSB 5CPSA 1HN1A 3LPFA 3WD3A 5GNYA 2WZHA 3ZO9A 3WH6A 4AZCA 2VURA 5LYRA 4PMRA 3WBAA 3WF2A 1BYBA 2BVYA 5A6BA 5CLWA 1UR0A 2F61A 2XM1A 2WC3A 3VNZA 3DHPA 2WPGA 4KRTA 1OWQA 2W67A 3RJXA 5HXMA 2NT0A 2WMJA 4YPJA 4MB4A 4WSJA 2PBOA 1OSEA 3WENA 3NDZA 2WHMA 3EMCA 4PMDA 4J7RA 2YLAA 2V3GA 2G3IA 2Y24A 3L4XA 2Z1KA 1OD8A 2RGLA 3UG3A 3PTKA 4IM4A 3W37A 1J0JA 4L4OA 3CZLA 2EPKX 1OGSA 1R85A 2ZWZA 4X0NA 1C93A 1VBUA 5IXEA 1Y7VA 2EEXA 1J10A 3UR8A 5A1AA 4PMXA 1X6LA 3OLGA 2CBVA 5ABEA 2X8RA 1K9DA 3ECQA 3K4AA 1I1WA 1QPKA 3AYRA 3NSNA 2QF8A 4GZEA 3VINA 5DT5A 4D6IA 5IHRA 4DWSC 5D8ZA 4BS0A 5E9AA 4AD4A 2XVGA 4LQ1A 3AS3A 2PF0A 7TAAA 4QLLA 5AC5A 3W38A 2ZX6A 3CGTA 4JAWA 3WSUA 4Q7NA 4CD8A 3NSMA 5FD0A 1TA3B 2BHUA 2ZX9A 3QHOA 3T08A 4JZ5A 1X6NA 3W26A 1PX8A 1J0IA 2IUZA 3ARSA 5E6YA 5A95A 1ODZA 4OIFA 1GJUA 3VD3A 3VTRA 1JZ4A 2J47A 5DT7A 1HL8A 3VM7A 3WQVA 2DEPA 2UY3A 1QW8A 1BTCA 4GQQA 1HJUA 1MXDA 2WZIA 5E09A 1KCLA 5A6JA 5BROA 4H8VA 3AMDA 2J74A 1QBBA 4J27A 1AMYA 4HOXA 2FDMA 1IZKA 1XD0A 1MW0A 1Q4NX 3W82A 3BGAA 1KXTA 3RO8A 1DWJM 3WNOA 4NF7A 1Q6EA 2A3BA 1ISVA 2J79A 4PYSA 1KGWA 1CENA 2W62A 1BG9A 2WK2A 2PI6A 3GH7A 1E40A 4UOZA 1H0GA 5AY7A 1JAEA 3EDJA 1VJZA 2FGZA 1EIBA 1DP0A 2X0YA 2XTKA 3PTMA 2WW5A 4HPHA 3B9EA 4ACZB
chains in the Genus database with same CATH superfamily
2QJNA 4LAYA 5LNVA 4QS5A 4ZENA 3THDA 3CO8A 3WFAA 5F1UA 3ZWTA 3A3XA 3JU2A 3W6YA 1UOKA 1BTMA 4GZJA 1X38A 4D71A 1BFNA 4IIEA 4HNUA 4KCVA 5E9XA 1TKKA 4MZ1A 2QCCA 1G4EA 3FVMA 3TIMA 1M7OA 4B5UA 2ALDA 4F2UA 4G2DA 3F2BA 1V3HA 1EC8A 1W9XA 2LPVA 1K9FA 5AHLA 1FCBA 4ADSA 1JG9A 1U30A 4ODQA 3VOIA 3RFAA 2VZOA 3APYA 2D1ZA 1J79A 3SW6A 1Q6LA 5KSWA 3IACA 2UBPC 3CL8A 3HPAA 2PODA 3W7DA 1LQ0A 4C6CA 4EE9A 4X2PA 3OVPA 4F2TA 1P0NA 4TX8A 3LM3A 1EEPA 5K9XA 3K30A 3LCLA 4Q8WA 2VTFA 3REQB 2VGGA 1W8SA 2UY2A 4JBRA 5I79A 3E2SA 3RGCA 3R6IA 4XX6A 5D02A 3LOTA 2XGBA 5HBFA 1VHCA 3C3UA 4L64A 1XD1A 2X2GA 1A5LC 4IGHA 1WZKA 3HPXA 1U83A 1JPDX 3K5XA 4QCEA 1NWRA 1MNSA 1QWKA 3PPFA 4DWSD 4IIBA 4IT4A 2OWCA 3W7QA 1KM3A 1ZUAX 3GG7A 3UXLA 1P4CA 3TQPA 3H54A 3C5QA 1HX0A 1WXJA 3QEZA 3UWYA 4O8RA 3W22A 4RDWA 1CEOA 2WMFA 2P8CA 5FCZA 4BF5A 1KO0A 3KFTA 4MFDA 1K77A 4O1EA 3NQ6A 3THCA 3CU2A 1JFHA 5H2ZA 4R7JA 5EFFA 5D2TA 4FO4A 4QDWA 1TR1A 3LCGA 4PBGA 3SZ8A 4HN8A 5E5CA 4N6EA 2PDMA 3NZQA 2NQZA 3NQAA 3LCIA 2EULA 1KM2A 3WLPA 4PSPA 4GD0A 4NHVA 4AG0A 1CXIA 2BTMA 3EEGA 4C6MA 2R1MA 1FKDA 1EPXA 1GW9A 4JL1A 4UTLA 5IRPA 4G1NA 2C19A 2M1IA 3EOLA 1S5TA 1G1YA 2KE0A 3W73A 5JQ9A 4LAOA 4GO9A 3R8RA 2NV1A 1E55A 4K1WA 2WSKA 2OQHA 3UPBA 3DECA 1EP2A 4B3KA 4O52A 5H1WA 2PDLA 3BGGA 1HJQA 1UBPC 4QHRA 3ANYA 1M01A 3MBDA 4HQVA 2XDFA 4GWEA 1ISZA 2ZA1A 3GNNA 4JTJA 1F9CA 2DQWA 3NEVA 2VUYA 4BEQA 4I5RA 1S1RA 5GNXA 5HNRA 4WRHA 4AIEA 1YNPA 1DJYA 4LRSA 2HE8A 1CXHA 1FKHA 2INEA 1J01A 4MM1A 2H3DA 3HZ3A 3BZJA 4H7VA 1XLDA 1JEZA 4LTSA 2O55A 1YTDA 1A3XA 4JFUA 4I9TA 4F0LA 5A8GA 3AYTA 3FS2A 2ZA3A 3DXIA 3WMCA 1C91A 1O95A 4AAJA 4NIRA 4J3TA 4WF7A 2VJXA 1JRBA 3G5EA 3RPMA 3IVSA 5DF0A 4C6LA 3WLHA 2C71A 3V3WA 1DE5A 2YL9A 3VIFA 3LENA 2HPMA 3KOYA 4OVXA 4WDWA 1W9VA 3UI5A 1P0EA 4S3JA 2V68A 1KFWA 2XM2A 3IVUA 1L8PA 2J4GA 3F4DA 2IXUA 3L23A 3WH0A 3PPHA 1HGWA 1J4RA 5CJ5A 3TTYA 5CPQA 5HKGA 4PODA 1Q8AA 4BK9A 3W70A 4XO6A 3N13A 1GZ1A 1JCXA 1IZJA 4GNJA 1VEMA 4E5TA 3AALA 1F7BA 3KCJA 7ENLA 4PCFA 1PKYA 3QV6A 5REQA 3MVIA 2QAFA 2MANA 3W7HA 1B4KA 3NDYA 3G1RA 4Q8NA 5T26A 4O1BA 4MZ8A 4MHBA 4IPIA 1TVLA 4QLKA 3ZJKA 1UWTA 5DX7A 3L4UA 5REQB 1OGGA 4IQEA 1OX4A 3M41A 1DE6A 2VC6A 1KFBA 3QH2A 1Z44A 1KBLA 4KFOA 2VZUA 2ZKMX 3MUIA 1KXQA 1XUZA 4A35A 8CGTA 4ZB5A 7TIMA 1OADA 3WELA 3RPTA 3GR7A 1PIIA 4JKKA 3CPUA 3BC9A 4HARA 3VOFA 5EB8A 4ZPWR 4H01A 4D8AA 1YRRA 4K6AA 4PRRA 4JHMA 1PCWA 4LVBA 4NRRA 3VC6A 2E8YA 1PIFA 4UQDA 4PSRA 3S3GA 4LAVA 4C6NA 5C5YA 5I3HA 3KDNA 3SURA 1OF8A 4M19A 3M47A 3UR5A 3ARRA 3G2GA 3MANA 2C8NA 4AZBA 4IG2A 3W00A 2ZZ5A 2P10A 3H8AA 4EX4A 1PSCA 4AISA 1ML1A 3L21A 1ZL1A 1Q8JA 1KGUA 1JPIA 4RW3A 3TQVA 1HP4A 3M7WA 1C90A 1VCGA 4GIAA 3WLQA 4IG2B 4U2YA 3O5MA 3AYSA 1DTUA 2QF7A 4KH2A 5K4XA 3LEPA 3W2LA 3L2LA 3NIYA 2DG4A 3QBUA 1W8GA 1R38A 3GHSA 2GQAA 1QU4A 1MQQA 3SCQA 2DZXA 2YIHA 3SGGA 1J6PA 3TZFA 2GJRA 1M5YA 3G22A 6XIMA 1L2UA 3STFA 1E5NA 2CZ5A 3CMGA 1LBLA 3G0XA 5I3GA 4OBTA 2OSYA 1PX4A 1JZ8A 1XH0A 1NARA 3CL6A 3LQLA 3O9NA 3NQCA 2X05A 3M0YA 1GOOA 4HB7A 4GMEA 4A3QA 3NQFA 1FWAC 3PJWA 3C2VA 3TN5A 3O5KA 3F5JA 1XIJA 3IV8A 1W3JA 2YLLA 3EOOA 1DXFA 2YZ5A 1RPKA 3WNPA 4W9PA 4QDPA 3MZNA 4EVZA 2BVDA 2VQUA 4XG1A 4JTEA 1RCXB 3QKZA 3DC8A 3RG6A 3A21A 4GK8A 4EXBA 3ZZ1A 4EAYA 3CV1A 3FJ4A 5PTDA 1Y0OA 4DXKA 5DO8A 4MJ2A 2ESCA 2X1SA 3C3NA 4MSPA 4MB5A 4DZ2A 5C6MA 4IHCA 4HA0A 3MI3A 2PTXA 1QWGA 3UQIA 4XZIA 1YE6A 2EHHA 4Q8UA 1PO9A 3RILA 2Z2AA 1MXGA 3DKJA 4R7WA 3BOLA 2PGFA 1R0MA 5EFDA 1FP9A 1I2RA 2YL8A 3D47A 1OINA 3C52A 4Q4PA 4UQ9A 4C90A 3HG3A 5HW7A 3GIPA 2V3FA 2RFGA 5FSDC 1C8VA 4HNLA 2DUAA 3GDBA 4C6JA 3M5ZA 1LWHA 3BLKA 4QISA 2CIPA 4S3DA 3GHUA 1YPXA 2VL4A 3VGFA 1ME7A 3SADA 3CAVA 3RRXA 3AXHA 3GG8A 4AD5A 1HKIA 4U85A 1WUEA 4UUIA 2CKSA 3H6OA 3M1ZA 1P0DA 4DIPA 1ZS2A 4XAGA 2B7QA 4IQLA 1ZBKA 2R24A 2O4QA 3AHYA 3W71A 5FESA 4ZO6A 3WQ5A 3CHVA 3CB3A 1Q85A 3F2CA 3W1TA 1OM0A 1RCQA 4JTCA 3O6CA 2AMGA 3LY0A 2YB4A 4JQ4A 1YTKA 1ICQA 1J8VA 5CG7A 3UJEA 2ZX5A 3M5VA 2R14A 4C1LA 1FWCC 4LAWA 4NRSA 1JD9A 4ZOBA 2FDSA 1SFSA 3MMWA 3W1MA 3EPMA 3N18A 2Y1HA 5FJTA 3P6LA 3SQLA 1LORA 2PDQA 2QEZA 1KXHA 4GI4A 1DORA 4DRQA 3IRSA 4DVOA 3LTPA 2OSXA 2AAAA 2YW3A 1U1HA 2IMRA 3GTNA 1UC4A 4QCFA 3VX1A 1IIHA 3DFQA 5M2FX 5IFPA 4MYXA 3T55A 4F48A 4ZFMA 3WBYA 1XWYA 3RAOA 3T4WA 5JIPA 5K2ZA 2HVMA 3BCDA 3MQTA 4QJ5B 2VFIA 3QF0A 5I5RA 4C6KA 2X1IA 3FKKA 4JS3A 3V1HA 3W7JA 3WDJA 2WLZA 1I9CB 2V82A 5JMUA 1BGGA 3AWOA 4AMCA 1UJPA 2V6AA 1TZ9A 1TPDA 2C15A 3USZA 2PDYA 3NPWA 1I60A 1W1IE 2MLYA 2B4GA 1HVXA 4KS0A 2FHBA 3O6DA 3EX2A 1B0IA 2GGGA 1KRMA 4OBSA 3KAIA 3ZT6A 5CPNA 1AJ2A 4GJJA 2I7GA 2XSXA 1M41A 4TYOA 2E5DA 3DAQA 1E4MM 1UOZA 4PEKA 1VRDA 4Q8QA 3EWBX 4PTDA 1MMFA 5MHBA 1OJXA 1CGUA 3GNXA 2Z25A 2HBVA 4H8UA 3W2KA 1OVDA 5D09A 3B97A 4MY8A 4WDTA 1QZ2A 3P84A 5FAGA 4BQ2A 1SMDA 1BGAA 5IBXA 5DBTA 4GLEA 3CWHA 3BLIA 1Q5MA 1LT8A 3H7UA 1SJBA 3TYBA 2OLAA 3W81A 2JF6A 4D1IA 2WKJA 4N6FA 1LLOA 2POTA 4XAFA 1HVQA 2E28A 1Y5XA 2J88A 2IPWA 3C2OA 5CSYA 3PZOA 4KERA 3MUAA 3VGGA 3VPLA 1ZB5A 3QW4B 4DJDD 2Q6ZA 4JY8A 4KFNA 2I9UA 3DHFA 4NAEB 1V3MA 5AVNA 3F4VA 4ZR8A 4CCEA 1LM1A 4H6QA 5E6ZA 3LG3A 1RBOB 5DELA 1NP0A 2PE4A 4KPLA 1ZJBA 3GNOA 4LAZA 4JFJA 3FJNA 4JTSA 2GVEA 3GUWA 1A7XA 2NV9A 4PRWA 3QN3A 4HGXA 1BF2A 1EH9A 4TO8A 4CNOA 1JNDA 5JIWA 1I8JA 2WKLA 1XYZA 4XB3A 3RLUA 4WKHA 3UR2A 2PAJA 4PUEA 1WPCA 1FXQA 1HKVA 4FXFA 4BWLC 2FYMA 2WC4A 3NM1A 2E6YA 2XPAA 1CNVA 3IJDA 1R3VA 3UT0A 2DW6A 3FIGA 4HYWA 3HJEA 3HB9A 3L5AA 3LSCA 1UHVA 3N9KA 4OWGA 3WG6A 1JJKA 4NSBA 3ZJ7A 1FHDA 2PLCA 4O18A 5IBXC 3W7MA 1L8NA 3HA1A 2DZSA 2GL5A 1FFQA 2CWNA 1SZFA 4ZB0A 4CQBA 1P7TA 4CD5A 4KETA 2BS9A 2H90A 5HMEA 3AIWA 3S4TA 4RDVA 4B16A 5A94A 1C9DA 4E3TA 2DUXA 3OLDA 3C86A 3TN4A 2OEKA 1F40A 4F40A 1P1XA 3GBDA 1F4AA 2CHNA 4NG3A 1EP1A 1MYRA 2WLYA 3WUGA 1VAHA 4C6BA 3VGHA 2PLKA 4LXFA 4TU1A 2PDHA 1YIXA 2D22A 4X9SA 3QW3A 1UZ4A 4EPDC 2FGBA 2WMIB 3N4EA 4ZQNA 1UMYA 2XP5A 1XJBA 3BARA 3S6TA 2OB3A 1L2QA 3N2XA 1HGYA 1JF6A 3FAXA 4N9EA 3L2MA 1H61A 4YU1A 3GXPA 3H9RB 3C0LA 6ENLA 2W3ZA 1JZ7A 5TF0A 1KM0A 1VJIA 3AROA 1KWGA 2E5BA 1T5AA 3BVJA 4DYKA 4F0MA 1P48A 3HV9A 1Z3NA 4ATLA 1JD7A 4ORMA 2DH2A 4UTHA 2A6NA 5EMYA 1G67A 1TR9A 4MLJA 4UTIA 3OG2A 3NG3A 4FMVA 3C6CA 4K8EA 3DCPA 4ZCWA 1AQMA 2A2IA 3U4AA 3UJ2A 1BKHA 4R27A 3K8LA 3KHJA 3PZUA 2FZ8A 1UZDA 4GRSA 3HG4A 3BJFA 4ZEPA 4A3YA 1WDRA 1S2CA 2X2YA 3MCMA 3OODA 4IF2A 2Y78A 2IKJA 2RUDA 4JNYA 2VENA 2PV3A 2NXIA 3KL3A 1FKJA 3GVGA 4DNMA 2BVTA 2DSVA 3WYZA 2Z26A 4NP7A 2PTDA 2J8TA 2W4XA 3LLDA 4IIFA 4W9TA 4J3XA 3BL3A 4L9ZA 1FBAA 3E2VA 4JIHA 1O7AA 3UR7A 4NX5A 2L5HA 4B3ZA 1FWSA 4Z42C 4QFUA 1QI4A 4GC4A 3ZLHA 1CXFA 3LGDA 2Y61A 3N6HA 3WUBA 4Z2HA 1OIMA 1R3SA 2XZ7A 3VNDA 3NTPA 4IL2A 2ZXAA 1QRQA 2XP8A 2ZVIA 1Z6KA 4S3AA 3TFCA 4LV4A 1XG4A 3IJ8A 2J62A 1THFD 3U7BA 1EX5A 5D32A 4LB3A 3N4FA 1UROA 1NMVA 4L65A 5I06A 1FUYA 4AYGA 1ZU8A 1ONEA 4ZPTR 4RNIA 5FI8A 3EXRA 3MU7A 3TSDA 1JCMP 3UYIA 1V03A 1GONA 2Y7DA 3T8QA 1XSKA 3K46A 2CCRA 4D6EA 1AQ0A 3PBYA 1J5TA 3KE0A 1C29A 5TBOA 5ABTA 4GYKA 4HNCA 1XYFA 3NO5A 3W3OA 1S38A 3P5ZA 5CGTA 1HL9A 3DBPA 2Y0FA 2V69A 1XIEA 4ZL1A 4ZTXA 7ODCA 4AEEA 1DIKA 4AWTA 1W2VA 4JIRA 3CQHA 3E0FA 1SSGA 9RUBA 4QP0A 4H9MA 1WA3A 4BA0A 3SRKA 3OU8A 3CLMA 1MRAA 2QS8A 3BJSA 4L72B 4W4QA 3EPNA 3P80A 3W53A 5HA7A 3E38A 4KW2A 3EDKA 5CAKA 4XZHA 4BHYA 1DWAM 4WY0B 3FXGA 5CG0A 4HSHA 4GQGA 3DESA 5BMXA 2F6UA 1ZJAA 2CFFA 2YCEA 4B2DD 3M6YA 1UWIA 4YCOA 4KCTA 4Y6GA 3MYPA 4KFPA 4AQLA 4JN8A 5G1MA 3UZXA 3N6QA 3VCCA 1FD9A 1FDJA 4LEFA 3AHVA 3NZPA 2VC5A 4LS1A 3GU0A 2QVNA 1RHCA 3LMYA 4A3HA 3W7GA 4LYQA 3NUKA 4DM1A 3MWAA 3N1AA 1IEXA 1NELA 4PB4A 1SO5A 2ZWYA 1UQYA 1SSDA 3VNKA 1B3WA 3TXVA 3EXSA 3NNTA 1E0UA 4Z2GA 1JCJA 5DY2A 3RM4A 1A4MA 3KS6A 3WL1A 2DZPA 4PMOA 2G0WA 4PB3A 4CQDA 3OHIA 3T40A 3SUWA 4QSHA 3PZIA 4BZYA 1VIZA 3B7XA 1QNOA 1CECA 3URAA 4NJHA 2PWHA 3VIGA 5H6HA 1AQHA 4X0VA 2VGFA 1EJRC 1V7AA 1W9PA 2X7WA 4G7EA 1WO2A 5LSMA 3CHEA 3LYEA 4OE7A 3HQPA 2BY2A 1IEVA 1B6CA 1V0MA 4REQB 3KUMA 4JQ2A 3VIPA 3N12A 3CT2A 3GXDA 1UWSA 4NI8A 4JX6A 3AIEA 3I6EA 3QMSA 2I57A 5I00A 3W01A 3A12A 3BMVA 4YTQA 5KZ6A 2W5FA 1QW7A 4CNPA 1XRVA 4MTVA 1UKSA 2WSQA 4WDXA 3V0TA 5C9UA 5A2BA 2DZTA 3HBLA 3VIJA 4LSBA 4EXQA 2YSWA 1ADSA 3GXNA 3G3DA 3S5OA 2PDGA 3WJSA 3ZLFA 3RDKA 4DJED 4Z0JA 4ICMA 4XAZA 4AWUA 1E9LA 3D46A 3L4TA 3NL2A 4UZUA 3CAKA 1C8QA 1KQZA 1O12A 2NX1A 1FKGA 4US5A 4H8HA 1YDYA 2E77A 3HO8A 2PF8A 5G4WA 2XIQA 2E1DA 3LXCA 2E9BA 4WJEA 1GG1A 5FF0A 3RMEA 4WD0A 1T6MA 5DXYA 1ROUA 2WOQA 2X1TA 3FSUA 3UY7A 4PL2A 3EKGA 3TEVA 1IEQA 1E4NA 1VENA 1XQKA 2OO6A 3FY1A 1ZBVA 1IGWA 1W3NA 3ZR4A 2OJPA 4K36A 4LBUA 1B30A 3WNKA 3OB8A 3T2OA 4DO5A 1X98A 4JEQA 4DI8A 3IJQA 5U7SA 3KVJA 3VGEA 3WJXA 3IIPA 4HJFA 4J3UA 1W2PA 3O5FA 3EMZA 5BYWA 4MAZA 3SIMA 3TH6A 1H5YA 2FMNA 4W5ZA 4PTMA 2D2JA 1F6KA 4DELA 5A6AA 1IGSA 1B3YA 3OP2A 1PV8A 3WJZA 3KCEA 3T07A 1TIMA 2REQB 3BCJA 1AL7A 3IUIA 2C1GA 1NQ6A 4Q8TA 1GUVA 3G77A 2J75A 1H2JA 1JZ2A 1V93A 2GLKA 1HJXA 3GXIA 2PWUA 3GD6A 3ENLA 3I6RA 3QR3A 1H09A 7A3HA 1NDWA 3SECA 3QC0A 3WLOA 2XP3A 1FRBA 4ZSUA 1FCVA 4MKNA 3QR0A 5FEPA 2R1NA 2Z1VA 1NOFA 4NXKA 3KAFA 3AXKA 5TAOA 4J3WA 3G8EA 5HWBA 4XD5A 3IJLA 1XBVA 5FEXA 3MSDA 3KRUA 2Y8VA 5D75A 4GXWA 4Q33A 2YFNA 3W27A 1EGZA 4XKYA 1DJNA 1RQHA 5HNTA 2XZ9A 5HW6A 1ONXA 4FIQA 3AS0A 5JH2A 4DWDA 4HP5A 3NZRA 4CVUA 1VKFA 1F05A 2WWDA 2DT3A 5H91A 1OHLA 2GUUA 4F9JA 3W75A 3MS8A 1UH4A 3JW7A 3NDOA 1K4GA 3JYJA 1Y0EA 2CLFA 5EL1A 4IPLA 3EX3A 3Q4DA 2UY4A 1OY0A 1IWPA 1CW2A 4RZ5A 3WLTA 5CEWA 5FL1A 4RK8A 3H70A 4QDMA 1GOKA 4DJFD 4V27A 3T09A 4BI6A 5HOSA 3GVRA 3KAOA 4XBKA 2QCDB 3CWOX 4B91A 4HU0A 1NJJA 3N3MA 4CEUC 3TAKA 4OGZA 1SZRA 2Z4GA 4IWWA 4ES4A 2FH6A 5FF2A 4LS2A 1E15A 4WJXA 1LYXA 3WMBA 2G50A 1GQKA 2P3EA 4HTYA 4WXYA 4DZIA 4C60A 4NKCA 2ZX7A 3OZOA 1FH8A 3C2YA 4DRSA 3ZMRA 4DO4A 3MA8A 3GFZA 3CUGA 4XISA 1W32A 2NX3A 2Z24A 1LDCA 4RXGA 3MMUA 1A49A 3FW6A 2YCKX 3GAKA 4KWSA 1X1ZA 2VEGA 4I3GA 2QGHA 2HNEA 2DY3A 3U2CA 1UW9A 1PWMA 4U3CA 2VVSA 4XZMX 1T11A 4KESA 2OTDA 4KRUA 1FKWA 4JXCA 4YTUA 5I78A 4P8VA 1E4IA 5AC4A 3NQVA 1HJVA 1FWBC 4MDPA 4IGMA 1Q6RA 2PRHA 1WDWA 3L4YA 1H7XA 1LQ2A 4NYUA 4OFCA 4GINA 3I4KA 4B9YA 3MSRA 4Q4OA 1PS9A 2ZQSA 3SCTA 2QMJA 3DEQA 4QS6A 5CSRA 5LA2A 1K8CA 4FEZA 3KVKA 4HBKA 3TTOA 3HF3A 4R88A 4DWSB 1O94A 4M6PA 3M0KA 3LBOA 2WZHA 1GVEA 4PUWA 5FEWA 4AZCA 3T0TA 3FVDA 3WF2A 2QJMA 4GHRA 3M9YA 3NQGA 5DBUA 1GEHA 1TV7A 5EMMA 2A0NA 2GGHA 3VZXA 2B5UB 4NZ4A 4ECLA 2WC3A 3CJPA 3W83A 3S5NA 3DHPA 3RJXA 1XLFA 2NT0A 4LUJA 3U6WA 3G1FA 4XAKA 1BXCA 1QTWA 5FJPA 2V3GA 1XIFA 4H1ZA 3UG3A 1XLGA 2ETNA 5MKGA 3EX6A 3GG1A 3MYOA 1B5TA 1JNTA 4ERIA 3UXDA 4X0NA 1R3QA 2A85A 2EEXA 2J13A 4GVHA 3SJ3A 1PE1A 2PDUA 4OTKA 5ABEA 2HEJA 2X8RA 3ECQA 3NSNA 3PRDA 4GZEA 4D6IA 4L6OA 3BQ5A 5IHRA 3UA3A 4K8HA 1XBXA 1VLIA 2JKPA 4DWSC 4HPJA 3P0XA 3AS3A 2PF0A 3UQBA 1W56A 4QLLA 5AC5A 4NYYA 3CGTA 4INFA 4JAWA 2OQYA 1WX0A 4C91A 5HW8A 3CYVA 3H12A 1VBHA 4S3EA 5D03A 4CNUA 2V5BA 3NSMA 5FACA 2V5JA 1TA3B 4O1AA 3PFRA 3PPGA 4JZ5A 1O60A 2NX9A 5JH1A 4XIAA 5E6YA 4QJ4B 3PG8A 3N73A 3VTRA 2ZZ6A 4IJBA 1JZ4A 2J47A 1I0BA 1OK6A 2PD9A 3CS2A 3CUXA 4GQQA 3PNZA 2WZIA 4WDUA 5E09A 2HS8A 1KCLA 5HWJA 1NF0A 2M08A 2WNQA 4H8VA 1G4PA 3AMDA 3UXAA 3BMBA 1H60A 3KM8A 3WQFA 1F74A 3WK2A 1PTGA 4MMWA 2VFGA 4O0KA 3O6YX 1DWJM 3WNOA 3BV4A 4Z1BA 3F7JA 1S2UA 2CLIA 1CI1A 4QBXA 2FGZA 3QQ0A 3WLNA 1EIBA 1DP0A 1NIUA 2PP1A 1W17A 4M7TA 4GNKB 4ACZB 5J8LA 3CV6A 3BO9A 4S3KA 2AQWA 2VRJA 1B2YA 3S9YA 3WQ4A 2C79A 2C14A 4GY1A 4H00A 4TX0A 1SW0A 2I9EA 4PUJA 4J4NA 4ONVA 4GUHA 3HQOA 4MNKA 5G2HA 1V6UA 4K7VA 4WR3A 1IF2A 4ERAA 2Y5SA 4QE4A 2J66A 2AMXA 4E38A 3W9ZA 4ODLA 3KWXA 2V81A 4H7ZA 3SRFA 2FVLA 3LHYA 4R34A 1XIBA 4A6GA 1OFAA 2WBGA 4XWUA 3ARYA 3SCWA 4IPPA 5CPMA 4GUIA 1TV2A 3H2OA 2Z2BA 3K4WA 5T9BG 2GZXA 2ZRWA 3AOFA 4H9YA 2PC4A 3R8HA 2GJXA 4XV0A 5CGQA 4UTFA 4YHEA 1KTBA 2VX5A 5I3DA 5HR6A 3N6JA 3CXOA 2QCGA 3W6LA 3AU6A 4Q4MA 3WNMA 1K6AA 5M3WA 1XLEA 4QM1A 2VYOA 4ZS6A 1VD6A 1NDYA 1ZQ5A 3RX4A 3LI1A 2Y62A 4JIQA 4Y9NA 4JTRA 2EPOA 4C6IA 3L7RA 1FHVA 4U28A 3RR4A 2PWGA 4TNSA 2GK1A 3FHQA 4W7VA 3WD4A 1WB0A 3GDRA 4J9JA 1NVMA 4H19A 1F73A 1H4PA 3GDKA 2GYIA 4RXFA 1XSJA 2XP7A 4FAPA 2VR5A 4DZ5A 4KBXA 1Z7AA 3RU8X 4AVNA 3R43A 1V51A 1YBQB 3MJMA 4EPBC 1QBAA 1YXCA 1EQ3A 3LXAA 1OC7A 3DU0A 1H7PA 1ALDA 2ZRVA 4J28A 3V5CA 4E2VA 4EF8A 2PRMA 3UWUA 1T99A 4DUWA 1BLIA 2MNRA 3QSRA 4HOZA 2FFIA 3MHFA 5IDZA 1JI2A 3CMFA 4IJRA 5XIAA 4UOQA 4IGNA 4DH0A 1DYSA 2BGSA 3AFBA 2D3NA 2V63A 1IXQA 2W6RA 1H1ZA 3UQNA 4J4OA 2JZVA 4I7VA 3TVAA 3PZ9A 5A8PA 2PFHA 5A6BD 2C7FA 3M0VA 2OEMA 1VEPA 1MFVA 1ONWA 1MUCA 1Q6IA 1HW6A 3MUZ1 3FX4A 5I09A 4DRMA 3O15A 1QO5A 1XCFA 2WSPA 1UKOA 2YJQA 3BAIA 4QIUA 3VD9A 1CGYA 2JQXA 1JCTA 4AXKA 4XVEA 3HGSA 1EQPA 5LKYA 3QM3A 2OX4A 4NZCA 1JPHA 1VCFA 1FKKA 3CUIA 3HOJA 3QGVA 4Q7BA 4FS9A 3FA4A 2VVNA 5AYIA 2AL1A 3LZ3A 3TA9A 5HMFA 3TCEA 3RM9A 2WB5A 2CZVA 3N04A 3WK3A 1E6PA 2D9FA 1VFLA 3KTCA 3R10A 4BJHA 2BFGA 2XSBA 2OFJA 1X8FA 4PUUA 4KIRA 1ZBWA 2MLXA 1SU5A 2WVVA 3GW3A 3IWPA 2E0PA 5CSSA 4AY1A 2QMKA 4YJ5A 1GPWA 1VYPX 4N42A 3DHDA 5BWAA 3UJRA 2QNEA 3TDFA 2AAMA 3M0IA 3VYLA 3CAWA 3MO7A 4LBRA 1D8WA 3GM8A 3UNTA 2ZUUA 4TTGA 3L67A 1L6YA 3LM7A 1TPB1 5HT1A 1KM4A 1OQFA 2XFWA 3GLCA 4U5KA 2A7RA 4FIRA 3UPWA 1CIUA 4Q4KA 5DCBA 2VGIA 3KRZA 2A6LA 5FJIA 3V5OA 4CN1A 3VZZA 4Q8PA 2I5IA 4H7CA 2Z1XA 5M03A 5J6EA 5BOFA 1HTIA 4M1BA 3LK6A 3ZJ6A 1EIXA 2P53A 2JK2A 3IHZA 1MDLA 3PSVA 2YL6A 3M64A 1CXLA 4HHLA 4S1FA 1W9UA 3EOEA 5I07A 3VXGA 5EMLA 3MT1A 5CC7A 3OJGA 1FWWA 4OECA 1SJAA 4GH1A 3IGXA 4WCJA 3TDBA 2QVHA 1CGVA 1DWIM 3H2AA 3IAQA 1ZFJA 4HCDA 3PZQA 4KQNA 1W91A 3NQ8A 5SWUA 5LNSA 1E9IA 2Z27A 2GSEA 4ZB2A 5ABHA 1FH7A 4FX7A 2GSJA 3GDTA 1XKJA 2CEQA 4US6A 3W7KA 2E68A 1EWDA 3WEZA 3P14A 2DT0A 1JL8A 3GH4A 1IE7C 3RK8A 4G2PA 4LV9A 1GYNA 3IK4A 1PDZA 4CCDA 2OFNA 1J4HA 4HTBA 4KGLA 3UZWA 1W26A 1TZ7A 1QPFA 3HN3A 1V0NA 3CM4A 2Q71A 3WLKX 1XISA 2VO5A 1F6PA 3V5FA 4EP8C 3EB4A 1WDPA 1MNZA 3W07A 1W1B1 3ARTA 1VB9A 3WFLA 5HULA 1P5QA 1V3LA 1AQFA 5K9DA 2ISWA 3JRKA 1BXNA 3B3DA 3KZ7A 1N8WA 1V6XA 5MF5A 1BRLB 3UA4A 5K4ZA 1D7HA 4YLWA 2RSEA 4UNKA 1NDZA 1JGIA 2D3LA 4GUJA 4GGHA 5D04C 1LLWA 2RKXA 4J3SA 4MNMA 4YVXA 2EKCA 2B81A 4PMNA 3DG6A 3N34A 4RPQA 1QUMA 1XC6A 4Z1AA 1BQGA 5I0DA 3RLVA 3WCZA 2DDXA 1J96A 2TODA 4NNAA 1B57A 1FQ0A 1YTEA 3IJ9A 4HK7A 4PTWA 3KLLA 1J6YA 4PUKA 4Y9OA 1SM9A 1G9HA 3POCA 3F1QA 3UGVA 1DJZA 1XICA 1IX5A 5TNVA 1XHGA 5AB3A 3IJ6A 1UQZA 5C9XA 2WNZA 1POKA 4FN2A 1LOSA 3BG3A 1B3ZA 3FAWA 1XXXA 4PUDA 5LIYX 3VD7A 4N4QA 3M07A 2ZX8A 2IKIA 2WHLA 2X41A 3B0PA 2GDQA 1TB3A 1YNYA 3A24A 3AZSA 4D6GA 3KOFA 2FKEA 2OCZA 4DJDA 3OZMA 3WEMA 3EWDA 1K4HA 2RUCA 1KNWA 4ODKA 4EWND 4J35A 2DQXA 3CB8A 1D8CA 5BOEA 5U4NA 4CKQA 1CDGA 3KRBA 1NY1A 1A5KC 1LRQA 2ZVRA 1UYQA 3MJYA 4RZ6A 4DUVA 4J3ZA 4FOJA 3KHDA 1P5BA 4C7GA 3WDIA 5DO2A 1KWKA 3MI6A 5DLCA 4AB4A 1B3OA 1QR7A 3TWBA 5A6TC 4Z08A 3DH7A 2OELA 3AICA 1QXLA 1FWIC 3TYCA 3PG9A 2GOKA 3QYQA 4X61A 4HMDA 5CC6A 1LL7A 3UXKA 1WP6A 2F9RA 4XAPA 2QT3A 4KMQA 3WF4A 3VDHA 1LUCA 4A2RA 4MAVA 4LNYA 4UMBA 4N2YA 3QOMA 2O0TA 1SZNA 3RX2A 2OOFA 2GQ9A 1UZ1A 4UTMA 4ZODA 4I7WA 1XYLA 3G3MA 1FDZA 2CETA 2O7SA 5IM51 3NPUA 2RUQA 1GVOA 2XGZA 3V16A 5I98A 3RX3A 3CH9A 5CZ0A 4PMYA 1PYFA 4LUYA 4JNZA 4J2MA 2BB0A 3OYXA 3UQAA 4CQ9A 2D2GA 3FEMA 3KCLA 4GYPC 3TTEA 1TVNA 4YYFA 5IFTA 1TX2A 3M46A 4DB7A 4NJJA 2DV0A 2KFWA 2PCEA 3ZVIA 3M0JA 2G37A 3R79A 2XFYA 3BAYA 4ALDA 3EA2A 3U8GA 3ME3A 4CD7A 4QG8A 3MPGA 2I14A 4N9CA 4LUTB 3UZJA 2KR7A 4YHGA 4DF1A 1JNSA 1QOPA 4FALA 1R30A 3NPVA 3WMSA 3A4AA 5E0FA 1MVYA 3H4GA 1V6YA 2QUUA 1UD5A 5G2WA 4AU0A 4AWEA 4JPGA 1A5MC 1EYMA 1WDQA 4XTIA 3CZGA 4M29A 4HZ7A 1OZMA 3ZOAA 1XUUA 4WIWA 3GYCA 1EGMA 1CGXA 4UOJA 2CNCA 3R89A 3WBEA 6ALDA 3P2VA 4PMVA 3WN6A 4QG9A 3CWNA 4ERGA 2EG7A 3ES7A 4JOMA 1VFOA 3DX5A 3IUHA 3K1GA 1BYCA 4JHOA 4JFIA 2ZRXA 5BXPA 3WY1A 3BPWA 2HZGA 1L0PA 1T8XA 2WPBA 3NOEA 3SUSA 2NQ9A 3L65A 1SW3A 1SFJA 3TYZA 1EJTC 2OYLA 2V38A 3I3EA 4NJIA 1WBJA 2NUYA 5A3HA 4UTKA 2CLEA 1PL9A 4AIOA 3STGA 3RITA 4NU7A 1H7NA 2PA6A 2Y5JA 4X3ZA 4Z1CA 1RH9A 4K68A 4MJMA 1KXVA 2YXXA 3S5YA 4CU8A 1RJRA 2EJ1A 1LG2A 1BAGA 3F4WA 1KA9F 2R1LA 2P76A 4H8NA 1GQJA 1YPFA 3NL5A 1RQBA 4AC1X 3ARUA 3W2NA 4O2TA 1M04A 3U5YA 3ABSA 1Q6GA 1CLKA 8XIAA 2YCLA 3AMCA 2VN1A 2DW7A 3QY8A 5EBAA 1YHTA 3PK7A 5GNZA 4FX8A 2IF4A 1T41A 3EY6A 4RCXA 3UESA 4UXDA 1FWGC 1RLDA 4LB4A 5FKYA 4IX2A 1I2OA 4KWOA 4GJIA 4O15A 2OU4A 3RR1A 3MY9A 2YCLB 2XINA 3RLHA 4GJ1A 1O68A 3SSJA 3KZSA 1ZJIA 1X97A 3KBJA 1MWOA 3ATZA 1UD8A 1CYGA 4QROA 1MFUA 4N0RA 4M1RA 5D4YA 3UI6A 3E49A 4AUBA 5TD4A 3O63A 4L5ZA 2VHLA 3GR4A 1W1TA 2YA1A 3P62A 3TTSA 4MJ4A 2W27A 2DVXA 4HOWA 5C7VA 4UDMA 1M1BA 3Q94A 3BICA 1VBGA 4YNGA 1TV3A 3DYMA 1MZHA 2XFFA 4TIMA 3UERA 1UKPA 3ZR5A 1K1DA 4M3PA 2JBMA 3LGEA 1SVDA 4G5DA 1AZ1A 1W3KA 1W3LA 3D6NA 2HDJA 1GEQA 1AFSA 1W0MA 4B2DA 1Z41A 3WQEA 3VAVA 3PBUA 3HURA 2V0TA 5AYBA 1JNEA 3MP4A 1OX6A 2A3LA 1F8MA 2BLEA 3WX7A 1R3YA 4M7SA 4PEEA 5ABFA 1QNPA 8XIMA 3W0KA 2X09A 2ISSA 4LY4A 4C1KA 2ACUA 4CU6A 4IP7A 3IJ7A 3HMJG 3I7QA 4UTTC 1TE6A 4B5WA 3L12A 1PIGA 2V3EA 1OFBA 2J7CA 3T0AA 1MW1A 5DXXA 1IWBA 1FKFA 1G6CA 2ZQUA 2NWSA 4O8AA 5C71A 3AYVA 2OZ0A 4C6OA 4KKXA 3E0IA 3R94A 4W8AA 2YL5A 4NASA 7REQA 1VBRA 3E2QA 3N11A 3ZR6A 4C1NA 3GY1A 3MDWA 4M8UA 4BY3A 4NZ3A 2F7FA 4IL0A 1EJWC 4WHBA 2ZDRA 4AVOA 3TONA 4UMCA 2Q01A 1IYXA 4BQ5A 3U2EA 3O5GA 1MSSA 2HISA 2MNTA 1DKWA 3TJIA 1GVSA 1CLXA 4DBWA 1FDYA 1W5OA 1S2VA 4WVXA 8RUCA 4EK7A 1OC6A 2Q8LA 2G4FA 2AOSA 4A22A 4K2SA 1J0HA 1FJDA 3BAKA 1J4IA 3GTXA 3DG7A 4UCGA 2J9ZA 1YW1A 3U3HA 1ITCA 2P0OA 4KEMA 1PINA 3KAHA 1SUXA 2NZLA 4MKVA 2OX1A 3B9AA 4RV8A 5BU9A 3DFTA 3UPMA 1TWDA 1XFCA 2INZA 3NTYA 3AMKA 3E74A 3B8UA 3ITOA 3EYPA 2FZBA 1VPQA 4TMCA 2HQAA 3TYEA 3A5VA 3U9IA 1N55A 3H2NA 3TAOA 4WJ8A 1US3A 3H21A 4BF7A 2ZE0A 1E1FA 1V02E 4M56A 1WUFA 3TKFA 4EF9A 4BI7A 3NZ1A 1MQRA 4HA3A 5D9MA 3AZTA 1RVKA 1GWJA 3V36A 3GK0A 4DEFA 3FGCA 1VS1A 3OYZA 4LAXA 4QXIA 1DEDA 4P7NA 5LXXA 3VABA 1T40A 2YYTA 1FWHC 1SW7A 4XD3A 3TMQA 4TVCA 4G50A 3ABQA 4G56A 4G8TA 5AZ0A 3BLPX 1TRIA 1OT1A 1E6NA 1EBHA 3IAPA 1BSLA 3BLEA 4GIEA 5B7YA 3O5EA 4EACA 3T0BA 5C9WA 3UVIA 4OZOA 1IWAA 2JGQA 2QIIA 4QSFA 3DFYA 5E70A 3OZPA 1BYAA 2QUTA 2WANA 3KL5A 2HWGA 1G01A 4TV6A 1OD0A 4MJZA 2QW5A 4E0CA 1TYGA 3AXMA 1TJ2A 3S1GA 2JFEX 2NXHA 1OCQA 3RIKA 1GQLA 2E67A 4US5D 3XINA 2ZIDA 3PA7A 4FNQA 1KV5A 2XVPA 4P7LA 2Y89A 2FKPA 3T1GA 4KRZA 1BKSA 1DJGA 2CBIA 4DJEC 1JCNA 2CC0A 4NAFA 1LROA 2EGZA 3ANVA 2PUZA 3EMQA 4KGJA 1AMKA 2PC8A 3IKDA 1OG0A 2AL2A 3SN1A 4MGGA 1M7PA 1MDRA 5DY3A 2IXVA 2G97A 3RCMA 3OGRA 4Z17A 3DOPA 1SFLA 3UY8A 1A5NC 1QMLA 1TPVA 4ATDA 4O12A 3VO0A 1C7TA 5CC3A 3UWQA 4WKAA 4H6EA 3WBWA 1PYMA 4L1XA 3VZYA 5CQ1A 4ASTA 4XZNX 3SO7A 2YDRA 2OSWA 1GJPA 1WCGA 3PNUA 1AL8A 4YMZA 3WFZA 1FAPA 2NLYA 3O5OA 1CX9A 2CLMA 1EHAA 3AHXA 5FJUA 2O9RA 1L6FA 1EL3A 3CZJA 1LF1A 4G6CA 1L6GA 4B15A 3KACA 4UIOA 3KOWA 1AD4A 5DANA 1QO2A 4M81A 3SFWA 4IQJA 3W4RA 3JZEA 1FH9A 3E9AA 4GZIA 4DJFA 2VCCA 3RGTA 3CGMA 1EB3A 4IIGA 5LNUA 3VDGA 3OVGA 4R33A 4QAIA 4FF7A 1IHIA 3N2MA 4WSKA 2PDNA 3CGNA 1NSJA 4LANA 2ZR4A 3TLLA 3KTXA 2JKEA 1PKMA 2ZCGA 4LBSA 1EBGA 1XRTA 1R2TA 4JIPA 1IV8A 2GDUA 3WH7A 3M7SA 4V33A 5TQLA 3I3BA 1V0KA 1K9EA 4RE4A 3ABZA 5JBDA 2YCIX 1EF3A 1WAUA 5IHSA 1Z42A 3BZGA 5AN7A 3VOHA 4GFIA 2I17A 1GVIA 4ZA0A 1KM6A 3BLFA 3OBAA 2RURA 3GG0A 1KCKA 1JVNA 4TVUA 4PN2A 2O9OA 1W5NA 4AHOA 1S3TC 3LA4A 1PHWA 2NSXA 3BLOA 1AZ2A 1UWRA 1JZ5A 4RKAA 4U10A 1QPOA 3O2LA 4OOZA 3CV2A 1J18A 3SEPA 1RK5A 3LPOA 4O0ZA 3A9BA 4F2BA 1RD5A 4HSOA 2OVLA 1HJWA 3N2BA 3TSBA 4JYEA 2HJPA 1DXEA 3KEHA 1NF7A 4WUIA 1D3GA 4Q8MA 1TPFA 1PWLA 4IUOA 3UGRA 5EU9A 4FNPA 5DMMA 2W66A 4M51A 3JUGA 3IUDA 2Z1SA 3B8WA 4K39A 3VKJA 5ECUA 5F4XA 1TPH1 4QGCA 1L9WA 5I6SA 3VOCA 2ZRYA 3QMRA 3K2GA 1Q7MA 1GTEA 1UCWA 1ZAIA 4W88A 2V3DA 2J7EA 2OO0A 2Z7GA 2YDQA 3FEQA 3ERPA 1XV8A 1WOAA 3RHGA 4MGVA 3U5UA 1W9BM 1R3TA 6A3HA 2DZWA 1GG0A 3WDHA 1ADOA 1BWVA 2YYUA 2VZVA 3AS2A 2KGJA 3PZVA 2HE5A 3D3FA 1R2RA 4TW7A 1PCKA 3GWQA 2QPSA 4RE2A 2DIJA 3BSMA 1X7IA 5KZEA 1I2NA 5C55A 3S8HA 2ASHA 3PTDA 2A3CA 1O1HA 1KFJA 2J7FA 1XLCA 3LD5A 2GGEA 4J2PA 1G94A 3DC0A 1OBAA 3H24A 1XIHA 3NI6A 1K8YA 2P4VA 1Q2SA 1ESWA 4GI8A 2D2OA 3ANUA 3NWRA 1BVWA 1NAL1 4BQ4A 4JTFA 1J5SA 3MP3A 2CLLA 2FPTA 1ISWA 1YX1A 4QEEA 3PAJA 1EPVA 3FKRA 1UP0A 1XBYA 5FF7A 2BGNE 2V2CA 3PWAA 4NJGA 1V6WA 2VWSA 4IMDA 1E6XM 5CPOA 5FJOA 3K13A 3LHTA 5T8GA 4ROPA 1VH7A 3BUVA 1HG3A 2VMFA 3LB0A 4D8LA 5B7ZA 1L6SA 4JL2A 2D0GA 2HCVA 1RVGA 1X6UA 3EKLA 2BDQA 2PURA 1JUEA 4ZTYA 3S2CA 5DQPA 4UTJA 2V8ZA 4ZQRA 4LUSA 3N17A 5HWCA 4V2XA 3URQA 3P81A 3CASA 1UC5A 1PKLA 3LRLA 4NJKA 2JALA 4MPQA 3ES8A 1FKLA 1J0KA 3N29A 1YXYA 1KRBC 1PXGA 4JIEA 1OZQA 3ARWA 3VUSA 4TVDA 3SQSA 4GACA 4O53A 3WDRA 4C6DA 4C6FA 2BG5A 3OZYA 3W85A 3M4HA 3TK7A 4HHMA 3C8FA 3ABOA 4U2ZA 3O3RA 3C2FA 4B5TA 4LS0A 5CKSA 1R5YA 3P74A 2DZBA 1M68A 4HU4A 5HATA 3ZFHA 2PDBA 1P6CA 4CVWA 1HF6A 4TXEA 2D2HA 3G0UA 1K9TA 4B5VA 4JHZA 2ADAA 1XX1A 3OW1A 2OYMA 1WKFA 3BSHA 1NWSA 1PKNA 4PUNA 4U5IA 4S3GA 2J9XA 4JFMA 1LOQA 2PBCA 5AC8A 4JTLA 3PY2A 1JCYA 2B31A 3B4YA 3BOXA 2H6RA 3G18A 2H8XA 3KDOA 2QPUA 2G41A 2H9AA 1EA0A 1CXKA 5FJRA 3WQWA 3TR9A 4L80A 2X1UA 1B3VA 2DZUA 3IEBA 4KEUA 1B4EA 5EMKA 1XLLA 4P61A 1HXJA 1REQA 1ZHAA 1WV2A 2GVLA 3SN4A 1QI2A 5C70A 3WQPA 3UF9A 1LOLA 4FI4A 2Y7GA 2YPIA 3WQGA 3PZMA 1O6IA 1RSCA 1JAKA 5CBBA 5CXPA 4M80A 1KCZA 4O17A 1WKYA 1JR1A 4S23A 3H23A 2EJAA 3EIPA 2CBJA 3AUJA 2VRQA 3SQMA 3A13A 4ZBCA 2LLEA 4IZGA 3YPIA 3QLDA 3R0KA 4MADA 3WD0A 3WQDA 1OX4B 5AFDA 4IOTA 4X63A 3TR2A 4A4AA 4HPGA 3H2CA 4LC6A 2XP4A 5HAOA 6XIAA 3UZYA 1JUKA 4D9PA 2XP6A 3JS3A 1KM1A 4EKJA 1OG6A 2I5QA 3MSYA 2Z2UA 5CPSA 5I3IA 3O5QA 3WD3A 1F76A 1E44A 2BOEX 1N8FA 3E5PA 3UWZA 3WH6A 4IP5A 3VFCA 1YADA 2CHRA 4ZFCA 1BYBA 2D69A 5A6BA 2CW6A 4FHAA 5HUAA 1EJVC 2VELA 5E1QA 5BZAA 1UR0A 3UBPC 4HYRA 2XM1A 2DP3A 1EZ2A 1OCNA 2WPGA 2NWRA 1O5RA 1RJPA 2WMJA 3LSBA 3STPA 3M0LA 4YPJA 4MB4A 4WSJA 1ZSXA 3E5BA 1P1MA 2AQOA 3EMCA 4J7RA 3VA8A 5HJXA 1IZCA 2CLHA 4A2SA 1YDNA 2CWXA 2Z1KA 2RGLA 2XH7A 3W37A 1J0JA 2PEVA 2HVOA 4L4OA 4I5XA 2ZWZA 4ML9A 2DG3A 1VBUA 4JYFA 4GNVA 2PDJA 2X40A 1J10A 4PMXA 1US0A 4PTNA 3OLGA 3QV7A 1ECQA 3P93A 5F2IA 4GUGA 3TU9A 1QPKA 2QCFA 2FFCA 1NQKA 4G9PA 3LRMA 3S2JA 1V79A 4BS0A 4PBFA 2IS7A 4AD4A 3C8NA 2I1OA 2R8WA 2HK0A 7TAAA 3W38A 7PTDA 4J1OA 4LYKA 3T81A 1ONRA 2PV2A 4CNNA 4QRNA 3OG3A 2C3ZA 5FD0A 2ZA2A 4RNJA 5GJMA 1ZENA 3T08A 1VQTA 1X6NA 4R85A 4X60A 1J0IA 3GTYX 4LVDA 3RYSA 2IPFA 4OIFA 1I2QA 3LMZA 1GJUA 4Q8OA 1ZGDA 3O1NA 2Z0IA 2YR1A 3O16A 4R3UA 1OFRA 3PFMA 4JQ1A 4O50A 3VM7A 3HG2A 1XYAA 3KBVA 1UMLA 3JR2A 5D37A 3U4FA 3QRHA 1QW8A 3KAGA 1HJUA 3DENA 3EX1A 5A6JA 1BWLA 4IIDA 3ZLGA 3KP0A 1QBBA 2HXTA 2PDIA 2QUNA 4UTUA 1XIIA 1MW0A 4Q7IA 3W23A 2ACSA 1Q4NX 1B54A 2BP1A 3DN5A 3BGAA 3GYEA 1Q4WA 1KTNA 3RO8A 1WXZA 2VEMA 1N7KA 1Q6EA 1FWDC 4DN1A 2YXOA 2C16A 4LF2A 5BOOA 4GVFA 2QR6A 2WK2A 2PZNA 4XSMA 3B8IA 4B4HA 4JYSA 4HNTA 1E40A 4PULA 3IK8A 1H0GA 4UBPC 5AY7A 1U5JA 3O07A 1PTDA 5I03A 3GTIA 1P43A 3PTMA 3B9EA 1FWNA 4LFYA 3FDKA 3U0HA 3PBVA 4POCA 1BPLB 4IFOA 1EKOA 2VFEA 1ZALA 1ISYA 2ZXDA 3SY5A 3XIMA 4GQBA 2DH3A 1FCQA 1EO5A 1SR9A 5DCEA 4A05A 2PTWA 2DORA 3VIHA 1QVBA 1WE5A 1GVFA 5LA1A 5LGZA 4R9XA 2JEPA 3AIBA 2GQ8A 4D72A 3HFYA 4A3UA 4FLOA 3Q45A 1S3HA 4H4IA 1NH6A 4L4MA 2OGYA 4I5UA 3T0DA 4UWMA 4BI5A 2OODA 3NXLA 1R9ZA 3K8KA 5DFAA 4FXRA 3BW2A 4H9UA 3W7EA 4WGXA 3BLLA 2PWFA 2Q3RA 1UH3A 2XH2A 3MDUA 1CBGA 3GR8A 3RLGA 4W7UA 1LRNA 3O06A 2PDFA 2ZTKA 4UFLA 1YNQA 1U2YA 3LN3A 1KV8A 4K37A 5D33A 5HMDA 5F2MA 3THUA 2E6AA 5JH8A 1S5VA 1S2WA 4Y90A 2JEQA 3ARVA 2BX7A 3C0QA 4S3FA 3QY7A 4GKTA 1H41A 3VX0A 3W1PA 3TA6A 1ZRQA 4GA8A 3URNA 4GGBA 4GYJA 3CYJA 4XKMA 3KTSA 1XGDA 3L0GA 5A5WA 1OFEA 3T2PA 2C13A 3FFSA 1Z8AA 1DIDA 2EPMX 2XVLA 1Y5VA 4U31A 3TYUA 4IFRA 3NM3A 4EXAA 4L6DA 3UJFA 3QXBA 4AEFA 3IIXA 4OKDA 1J9YA 1O66A 1XFBA 2WNWA 3EA1A 2Z29A 1W3TA 4UC5A 3AI0A 4ROQA 1T0OA 1UJQA 2TRSA 4K38A 2EO7A 3S1VA 2GVJA 2G3NA 3ITCA 3BK0A 4OHQA 3K8MA 4D6DA 3NURA 1XCXA 3L5MA 4OU1A 3LHUA 3WQ6A 1QI3A 2QV4A 4IQCA 1VLWA 1SMAA 3C2RA 2KO7A 3WQ8A 3HU7A 1XKYA 2FAPA 4QE1A 1EP3A 3S6DA 1GHRA 2NT1A 2WVTA 2HPIA 2P0IA 4MFEA 1N8IA 1FCUA 1PTAA 3QFWA 2WSYA 1EO7A 2NXGA 4N02A 4YXGA 1VIWA 5C2XA 2FHCA 3H2MA 1QNRA 2D73A 3SN0A 5M1TA 2A7NA 3N2OA 3AWNA 3ZSSA 4WQ6A 3NCOA 3HPSA 3HG5A 2FZMA 1UIPA 2J24A 3F2DA 3DG3A 4JEJA 3W28A 2NUXA 4ZXLA 3ZS4A 3AZRA 2EF9A 4RNFA 1YKWA 1P0KA 1QT1A 1R86A 3P60A 4NY2A 3P0WA 2PBGA 3DERA 4GVGA 2V2DA 2DIEA 2YW4A 5LA0A 1GVYA 4JQ3A 3G6LA 4N4PA 1UIOA 5C2CA 4WX2A 5I7GA 4FNUA 1CB7B 3TZNA 2YOCA 5LNWA 4CQCA 1V6VA 3GFYA 3WNNA 1DIOA 1H3GA 3BG9A 1EDTA 3VK5A 1YW5A 2XSAA 3LPPA 3ZYZA 4KF1A 3ITTA 4MNJA 2ZOXA 4NL1A 1MUWA 4N9DA 2X42A 2QDDA 2CU0A 2PB1A 1S39A 2GJLA 3NZGA 5B80A 2X0HA 3D3AA 4H9TA 1KBKA 3E96A 1S1PA 4Z2KA 2PDWA 4Y8EA 5CPLA 4CLMA 4O4VA 3SCRA 4JX4A 2V5DA 1CGTA 4TOQA 3MMDA 4NILA 2W92A 3WO8A 5A2CA 1XR2A 2NVDA 4IMFA 1ME9A 2EPNA 3VUPA 1LL6A 1XQLA 2GDVA 1CCWB 2EBNA 1TFVA 4V1XA 1W3HA 1W1PA 1W1VA 2C18A 1UD2A 3OBEA 3PN8A 5KEZA 2RJHA 2E9LA 3GHTA 2A3EA 1CZ1A 4D6FA 3LDVA 4JFKA 4MB1A 3S5ZA 1DBTA 3UWEA 1P7TB 4Y8FA 5C2GA 4GIVA 3GNDA 2VC9A 2A5HA 3S1UA 2VDHA 3B4UA 2ZDSA 1HKKA 3CTLA 2ACRA 4MWAD 4AF0A 2VRKA 1BF6A 1KBIA 1XGEA 3R11A 3PTQA 5AHIA 2Q3OA 3LCWA 4PA8A 1QASA 4FPSA 4DO6A 3T42A 3DKLA 2PTYA 2Y7EA 3VKKA 2VT0A 3SGZA 2C91A 2UV8G 1UR3M 4JCLA 1R47A 1JQVA 2FMOA 4XIMA 3AUOA 4C65A 4HVXA 3AU2A 4BQ3A 5CSUA 2XGIA 1TELA 4LF1A 4OV9A 4TMBA 1GOMA 1O5QA 3PWGA 4R7OA 3PBMA 3T2QA 2QDEA 4NT0A 7CGTA 1MQPA 4AZ5A 2CYGA 3STEA 1EX1A 1NP2A 4I9MA 5BCAA 1MXSA 3L4VA 4JTQA 6REQA 3B06A 1UD6A 3OHMB 3BV7A 3EDEA 5JXQA 3A6OA 4ZO7A 3GE7A 1TUFA 1JCLA 3B04A 3M43A 4C6QA 3L0NA 2V2HA 3E2RA 4IQ2A 1R3RA 2E25A 4UFIA 4ZOAA 2ABBA 4KR0B 2WMHA 3NQ2A 4S3BA 4S38A 4MVAA 4CU7A 2BV9A 1JYNA 4PCPA 2PV1A 9XIMA 1A5AA 5JVLA 4GO8A 1TV5A 5DIUA 1C9HA 1G7VA 1HNYA 2INFA 3GDMA 4QE5A 1GVRA 3OIXA 1EJSC 1KRCC 2IQTA 4LGXA 4GCAA 2WZMA 2CLPA 1XLBA 1VFHA 3JVAA 3WLLA 4LCQA 3VGBA 2J25A 3W72A 1TQJA 1HP5A 1DVJA 1IIGA 2OXNA 4H83A 3LTSA 1GGOA 4O1CA 4R53A 1LWIA 2WM0A 3VOJA 3SM0A 2F6XA 4IMAA 2ZXQA 2CITA 3GSMA 4K3ZA 1Y65A 1IEWA 1ECEA 1H7WA 2TYSA 4DXXA 1AH3A 2OPJA 5FEZA 5CZTA 1G7UA 1FKIA 1J2WA 4P8WA 4AHPA 1E72M 2KZHA 4KWUA 2W9MA 2XN1A 4LRTA 5D9PA 1VYRA 3W25A 1A50A 5FA5A 2CLKA 3S2LA 6PTDA 3OO2A 3QHMA 2LJ4A 3PS7A 4IPXA 3P82A 3IANA 3UFYA 1OYBA 3S0CA 3IIVA 4HJWA 1DV7A 2XIBA 3KXQA 1XLMA 1LWJA 3L5LA 1FWEC 2Y4SA 4AD1A 5C9ZA 3WBXA 3UG8A 3AQUA 5M5DA 3RFWA 1H1NA 1JVWA 1IXNA 2JIEA 1XLIA 4XD4A 2DSUA 1OYCA 2BNJA 2XUCA 3R1ZA 4AX6A 3R5EA 5G1TA 2PSNA 3NQMA 1H49A 1CB2A 1HJSA 3DFNA 3EOUA 5HJYA 3P5YA 4HZMA 1FVPA 3QYSA 3WJYA 4E4PA 3S9ZA 5EKYA 4P8XA 3AXXA 2FQIA 3TJXA 3NOYA 1PUDA 1OX5A 4GQRA 1QATA 4L1WA 2ALRA 1D9EA 4QT3A 4I8YA 1EQCA 3LHWA 3SCUA 1NOUA 4FB7A 2GWGA 1TMHA 1RJQA 3SCSA 1H7OA 3MTWA 1ZBCA 1C3FA 3NEHA 3PRBA 3AHTA 3MHUA 2WMKA 1U33A 4PL1A 3W7PA 4HNNA 1UR9A 1Z32X 2VEKA 2Y2WA 1SO3A 3M5XA 1HQTA 5KZDA 3EDDA 4L3NA 2ZUNA 3AIQA 4MOZA 3REQA 1UR1A 4XZWA 2QIWA 2FHFA 1LBFA 1IT7A 3GUGA 3GAYA 1X1NA 4IJCA 2VD9A 1QK0A 4O1DA 3IKGA 4QG6A 2Q8XA 1XDJA 2F2DA 2FPVA 1YMYA 3PB0A 3CUJA 3N9SA 4QITA 1E9ZB 1A3HA 1GNXA 4OQVA 3ONBA 4G7EB 5HINA 4BR1A 4IQDA 2QAPA 1KRAC 1FX6A 1LQAA 2N87A 4LAMA 1XIDA 2ZR5A 3UU0A 4IT1A 3NO3A 3DI0A 2DPEA 4UR8A 4L9XA 4LPCA 3OLIA 1BVZA 1XRSA 2O56A 4TQTA 4S3CA 1ZAHA 1R9YA 4JTUA 1E0XA 3L66A 4E4UA 1P6BA 1U22A 4R0XA 3UYCA 1QOXA 4F9DA 1OFPA 3GKAA 5D2VA 3N4AA 1Q6DA 3R58A 5FIPA 3GC5A 1KT0A 3Q67A 5HMSA 3A5FA 1R7OA 5AYYA 2WJEA 2YKKA 3W2JA 1F8AB 1ODUA 2HBXA 3O6AA 3UP8A 5A8OA 3CNYA 2NLIA 3QC3A 3TSMA 4PE8A 4HMCA 1TG7A 2ZUWA 1P0BA 2ITKA 2BGQA 3PANA 3A3HA 4H9ZA 2OZ8A 3I6TA 3G24A 1RR2A 2VC7A 1XM3A 2ZFAA 5J04A 2BSLA 1I2PA 2RGMA 1UA7A 3P61A 4UNLA 1RZMA 1V0LA 4UQCA 1A0EA 1W37A 2E1WA 4JDBA 3BG5A 2GJNA 2W61A 4DRHA 3Q58A 1QFEA 4CGTA