4Q7NA

Crystal structure of the complex of buffalo signalling protein spb-40 with 4-n-trimethylaminobutyraldehyde at 1.79 angstrom resolution
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex of Buffalo Signalling protein SPB-40 with 4-N-trimethylaminobutyraldehyde at 1.79 Angstrom Resolution
rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 129
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4q7nA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4q7nA01
3POHA 2ZXAA 1B90A 3AISA 4CD6A 2X1IA 3MV11 2RGLA 3WEOA 1TA3B 1GVIA 1JI1A 4DWSB 1W9VA 3CZKA 1E0VA 3VVGA 2D0GA 3SEPA 4UOQA 4JKMA 2W61A 3UEQA 5BXSA 1W3LA 2EJ1A 4QAWA 3VIJA 2EPLX 2G4FA 3A4WA 3IJ9A 4PTXA 3K4AA 4TTGA 4M80A 1DWFM 2EQDA 1W1YA 4QCFA 4OBSA 5EB8A 5IXEA 4X0NA 3U7VA 3WQ6A 1C93A 1VBRA 3CMJA 3AYRA 1PJ9A 3VGEA 1FFRA 4D71A 2WLYA 5LYRA 3WD0A 2TAAA 4L4PA 3AZSA 1U33A 1G94A 2CBJA 3SCTA 3B8SA 2J74A 4AZHA 1UD8A 5E9AA 2ZX5A 3ARQA 2J7GA 3RMEA 3CZGA 4FK9A 4XB3A 3L4VA 3WIJA 4QFUA 4AD3A 2CKSA 1E3ZA 2ZIDA 1BGAA 1G01A 2CKRA 2VI0A 3N17A 2BY2A 1UG6A 1K6AA 3WD3A 3SCOA 4B3LA 4ZENA 1BVZA 3AFBA 4N0RA 1CZ1A 1B3VA 3CIVA 4AY1A 4M1RA 1GOMA 1JZ8A 1W91A 2YA2A 2V3EA 5CGMA 1MQQA 2XM2A 1WB0A 3SCQA 2WHJA 1NWUA 4BA0A 4PMDA 2ZUNA 5JIWA 2VTFA 1V03A 1ZBCA 3AHZA 4BQ2A 2XFYA 2V5DA 2XSAA 1QBAA 1YQ2A 2XVLA 1JI2A 4OJYA 2EEXA 1EDGA 1HKIA 1VF8A 1PZ3A 1HT6A 3GH7A 3LPFA 3CZ8A 4Z2GA 4UOJA 3FN9A 1WNOA 2Y2WA 1HN1A 1PIGA 4B16A 3AZTA 4JL2A 3CUHA 5DEZA 2QMKA 3ZJ7A 2E4TA 1UKTA 4NI3A 1V0NA 3W4RA 4E2OA 3VD4A 2YL5A 4CN1A 3EBVA 4HMEA 1CLVA 3WUFA 3AIUA 3THCA 2UY5A 5A94A 1B3YA 4DWSA 4AD1A 2GUYA 1UR9A 3TA9A 5E09A 4W89A 1LL6A 2DPEA 1LQ0A 3WELA 3HN3A 4FF5A 5HPOA 2ZUTA 1GQKA 3VOCA 4UOZA 1XRVA 4H8HA 5BXRA 3AHXA 4F9DA 5A95A 1ZS2A 1UYQA 4PEEA 1ISXA 1XCXA 5A6KA 1IZKA 2XHYA 3VNZA 2C8NA 4Q7NA 3BMVA 1TFVA 3B9AA 2VOTA 1CGTA 4OIFA 1UWQA 2E0PA 2WMFA 4HU8A 3NCOA 2GJPA 1UA7A 1EA9C 4U3CA 1L0PA 5FD0A 3PZNA 4W5UA 2E8YA 4M24A 5A6AA 1GQIA 4A3HA 1XSKA 2A3HA 2DEPA 3EDFA 5BCAA 1GOOA 5DF0A 1BPLB 4W7UA 3AMGA 3IAQA 3DHUA 1TR1A 1JNDA 1CEOA 1PEZA 3EDJA 1V02A 3SUSA 2PC8A 2ZUUA 1XC6A 1NOFA 1X1NA 1XCWA 2X09A 2XFRA 4TVUA 2WM0A 5IHSA 4C7DA 1V6WA 4AWEA 3I3DA 4RL3A 4AEEA 3VPLA 1CGUA 2VVNA 4DUWA 1JDCA 1ZJBA 2XVKA 4CN4A 1QHZA 1Q6FA 1CBGA 4W85A 4UFJA 1BG4A 2A3BA 2V3GA 1O6IA 2NT0A 3GH5A 3AHVA 3A47A 1K9TA 1ISZA 1WZKA 1VEPA 3L2MA 2HVMA 3ZOAA 1OIFA 5DMYA 5HDRA 4WSKA 3AIWA 4P7NA 3MUIA 1E6NA 4PMXA 1XH0A 3VO0A 2D1ZA 3L4WA 6CGTA 2YKKA 3PZUA 2J79A 4MDPA 1LG1A 1M04A 3L2LA 3LPGA 5M03A 8CGTA 1UKPA 2JFEX 1TE1A 4HA3A 3WMSA 3WH7A 2YDSA 3WENA 4TX6A 2PBOA 1NM9A 2MANA 4IM4A 1WKYA 2GDVA 1DWAM 2WPGA 4QP0A 2XVNA 1JYNA 2O92A 3ZJ6A 4EAMA 5CPQA 7A3HA 2PI6A 1CGVA 1OGSA 3FAXA 1LJYA 1V6XA 2W63A 2RGMA 2ZX9A 3SUWA 1VFMA 3MS8A 1Q6CA 4F66A 1QHOA 4ATDA 1N82A 2WVVB 1KR0A 5AYIA 3RCNA 3UG3A 4D1JA 3ZT5A 2YA0A 1YHTA 4KGLA 3ZT7A 3ARSA 2X8RA 1AQ0A 3VDCA 1FA2A 3WF0A 1E6XM 1C7TA 1XH2A 5AC5A 3VM7A 1UR0A 1FH7A 1Q6EA 3WFLA 3WH8A 4W93A 1CECA 2B31A 3IAPA 2WMJA 3FNDA 4P7QA 1J12A 4BZYA 1KGXA 1BYDA 2FDMA 3PZQA 4CD4A 1CGWA 2ZWYA 4W7WA 1W3HA 3CGTA 1UUQA 2WMHA 1KXTA 3WF3A 3AIRA 2CBUA 1UH2A 3IK2A 4JKKA 3BAIA 4HTYA 4LYPA 2UY4A 3VIFA 1QOXA 2BS9A 2D0HA 3GTNA 4J3TA 3AXHA 1QHPA 3F5LA 3U5UA 4WJXA 5CZKA 3SCWA 2FGZA 3LMYA 3K8KA 3OGRA 2J78A 1EH9A 1MW3A 1XYFA 4CCCA 4ZFMA 1MYRA 4YHEA 3HU7A 4C7GA 1R7AA 2ZXBA 5CPTA 4AIEA 2GJXB 3PTMA 4UFKA 5JBDA 2EPNA 2OSWA 8A3HA 5I2UA 1C8YA 1KXVA 1DP0A 3F4VA 1GOQA 3L4TA 1CYGA 1GJUA 3PN8A 1OGGA 2WCGA 3EDDA 4AC1X 4S3JA 2OYKA 3WDHA 4K68A 2ZUVA 5CGTA 1HJXA 3UETA 3OIHA 5FKYA 5ABEA 4GIAA 1GUVA 3GNRA 3GYCA 4DM1A 5JBEA 5HXMA 1EO5A 4AW7A 2Y5EA 4PMVA 2JALA 3VGHA 5FL1A 1BFNA 2A3AA 1W1TA 4YN5A 1MW0A 4MB4A 5A1AA 3EMZA 1WCGA 1LG2A 1OWQA 3AS3A 2VQUA 3UG5A 3WDIA 4CU8A 3AS2A 3DYOA 2BVYA 5CQ1A 1V3KA 5BXPA 2YLLA 1CIUA 4A3YA 4LQ1A 3VIIA 4AXNA 2BVDA 2DSKA 1TMQA 1TZ7A 5F7UA 3BXWA 1I1WA 3CBWA 5GPRA 1OCQA 3CUJA 5CSUA 3QR3A 4CD7A 4UZUA 1NH6A 3MKKA 3UESA 3MU7A 1E0XA 1QNOA 3T2PA 1KBBA 1HKKA 3PZVA 4PBGA 5I24A 4WF7A 1R87A 3ZJ8A 2CHOA 4GZEA 5EFDA 3SCRA 1WDRA 3B9DA 2ZE0A 2WSKA 3NSMA 3OLEA 3EMQA 2DGAA 4NRRA 2WXDM 2XGBA 3IJ8A 4CN6A 4FLSA 3NSXA 2OWWA 1HP4A 3WBAA 1J01A 4XUYA 5CSYA 2WHMA 5A2BA 3W25A 5D8ZA 2NW0A 2PWHA 3NSNA 2Y24A 5ABHA 1KCKA 1UZ1A 2X05A 4LPCA 2J7DA 3WDRA 1JFHA 2O9PA 4H41A 2VCAA 1IZJA 1JZ6A 4J3WA 1FP8A 5ABFA 1Z32X 1JXJA 2FH8A 1WDPA 2Z1KA 1E4MM 4IUGA 2O9RA 1OIMA 1F4AA 3OLGA 4W7VA 3T09A 3W82A 1W9XA 3AMKA 1E72M 4AZBA 2FHBA 5A8QA 3FHAA 2VX7A 1CWYA 5I23A 2BY1A 2VR4A 4MDOA 1X6LA 4B3KA 3MSDA 5HPCA 1B31A 1UKOA 4AD4A 1K9FA 4UR9A 4MJ2A 3WFZA 1GOKA 1UD5A 1JG9A 3IJ7A 1W9PA 4M29A 1UH3A 1B0IA 2VRJA 3VNYA 1UD6A 1TVPA 1HJVA 4X0VA 4CGTA 1EXPA 1QPKA 4PMYA 1CXLA 2ZX8A 4JKLA 2OYMA 1JL8A 2CITA 2VJXA 1NOUA 3CUFA 2WVUA 3MUY1 2W92A 3OZOA 1S46A 3QGVA 1XSIA 3VX0A 1JYVA 3GXIA 1K9EA 4W86A 2DH3A 2JIEA 3DYPA 1QI3A 3W38A 1MQPA 4HU0A 1KCLA 1BYCA 4AZ7A 2QPSA 1QI5A 1PX4A 2WC3A 1E4LA 5D9PA 3PBGA 4X9YA 3TTYA 2WCAA 2JF7A 1V02E 2DSUA 4TVDA 3CHEA 2W67A 2BVTA 3WH5A 3K4DA 3WF4A 2D23A 4WKFA 3WL1A 3CUGA 4R27A 5EBAA 3GXMA 2E3ZA 1PBGA 1E6SM 1C92A 2G3JA 2PB1A 3VIKA 3WH9A 4MB5A 3EYPA 2VT0A 1HKMA 3PZMA 4D6HA 3ARUA 5D9MA 2D3LA 1B2YA 5C8BB 1EHNA 3VGFA 2EPMX 2WANA 1KFWA 1MWOA 2YLAA 3W27A 1E6QM 1H0IA 1KXHA 3BAKA 4P7RA 3QOKA 1OGBA 3II1A 2GVYA 4CCEA 1V6YA 3CUIA 2Y8VA 1EDQA 4P7OA 1MFVA 2PF0A 1XYZA 3WMCA 1CGXA 1NWRA 5A3HA 4JHOA 1VAHA 5FOOA 1AQHA 5BXTA 1E0WA 2VX5A 1J10A 1UR1A 1UKQA 1HP5A 3KL5A 3LPOA 4CU7A 2WYSA 1UKSA 2E9BA 3AMLA 1LL4A 4JHZA 2DT3A 1H0GA 4H8VA 3MUZ1 3AMDA 1JD9A 2WVTA 3WNOA 2VNCA 3WL0A 3AROA 1HX0A 4LYQA 3VDAA 1E4IA 2WAGA 2WMKA 3N13A 2WC4A 3GNOA 4JCMA 4DWSD 1RD6A 3VGGA 1NP2A 3IANA 3AHTA 1QVBA 1W9DM 5FCZA 1W9UA 2W4XA 3F5KA 2VX6A 1EOKA 2XUCA 1AQMA 4PRWA 4AZCB 3SUTA 1JZ5A 4UQBA 3BSGA 7CGTA 3ARPA 4HMDA 1ZBKA 2J4GA 4AZCA 5A6MA 3ZT6A 4JL1A 1AMYA 4U31A 3ZM8A 4QLLA 2CESA 4D6EA 3ALGA 1G1YA 3WUBA 4ATWA 6A3HA 4TTUA 4QLKA 4MNMA 2GFTA 1C8QA 4GZJA 1NWSA 2BHUA 1GONA 4JZ5A 1X6NA 2DDXA 3DYMA 3MMDA 1U2YA 3ARYA 1IT0A 5I77A 4GQRA 2V3DA 5I3DA 1EQCA 2AMGA 2J25A 4W5ZA 3VU2A 1HF6A 1ODZA 3GBDA 3J7HA 2J7EA 4PSRA 1ZB5A 4QCEA 3AZRA 4HOZA 3VIGA 3PHAA 1OSEA 2X0HA 3DHPA 1ESWA 1ZBVA 3WF1A 5E6YA 3CTTA 4GXPA 3WEMA 1ISYA 3PTQA 3NDYA 4Z2LA 1HJSA 4L4OA 2WMIB 5I6SA 1V3MA 2QV4A 3OZPA 5DT5A 1LWHA 2ZUSA 3JUGA 3AXXA 3BSHA 3RIKA 2OYLA 1HL8A 3BC9A 4KWUA 2ZOXA 3FW6A 2WZIA 1QNPA 1E73M 2XIBA 1CLXA 1E1FA 5CPSA 1HKJA 1ZL1A 1M01A 4D6GA 3W6MA 2YBUA 3NYDA 4UNIA 4JCLA 1QNSA 4J3XA 3CO4A 2FHFA 1W3JA 1A47A 3WNPA 1QI0A 1UOKA 1KQYA 3VINA 2PWEA 2VX4A 4TVCA 1QW9A 3MMWA 3N9KA 1CXEA 2F8QA 2WBGA 2WWCA 4YHGA 3ZR5A 1G9HA 4NSBA 5A6SA 1B1YA 4ZXLA 5E6ZA 5IHRA 2D20A 2VVSA 1DWIM 1GVYA 1GQJA 1HVXA 1V3JA 4P7LA 2XYLA 4D72A 1A3HA 4J28A 3ARZA 2UY2A 2VMFA 4ACZB 2VCCA 5LA1A 5JIPA 4HA4A 2PWDA 2O9OA 4M82A 3APGA 4B9YA 1CENA 4TUFA 1GORA 2JEPA 2A3CA 1BYAA 3UR7A 3W26A 1BVNP 2VR5A 2EXOA 1BYBA 4GO9A 2WVVA 1SR0A 5A6BD 3BMWA 2WC7A 5A8PA 5M5DA 3AIBA 3O2LA 4MAZA 2GJRA 3A3HA 1HNYA 1QNRA 3GZAA 3I3EA 3W24A 3AS0A 1WP6A 2V5CA 3WH6A 2EBNA 5AC4A 4OKDA 5IDIA 1B3XA 3AIEA 3VMNA 4ZE5A 1Y7VA 3FHQA 1HIZA 3WD2A 4ZXOA 4EE9A 4CD8A 2D0FA 4LYRA 2VUYA 1J18A 1H3GA 2J8FA 3SUUA 1I1XA 3N12A 3VDBA 3T0BA 4YPJA 1V08A 4HOXA 1OT1A 3WD4A 3BH4A 4XZWA 3WSUA 4MB1A 1KWKA 3UERA 5A8OA 3RM4A 4JFUA 3W28A 3ALFA 1CGYA 2WWDA 1UZ4A 1J0IA 4UQ9A 1CNVA 5A2CA 1C90A 1TVNA 3WN6A 1KBKA 2DT1A 1UR8A 4CD5A 5GNXA 4UTFA 1MW1A 2PWFA 3WDPP 2ZXDA 4M8UA 1JD7A 4OBRA 5DT7A 2F61A 3T2QA 2EPOA 1O7AA 4J3SA 1VFUA 4GINA 4WSJA 1JGIA 4W8BA 4UFIA 3EDKA 1ODUA 3E1F1 1XGZA 4OOZA 5AYBA 5C70A 2CPUA 1C3FA 3KEHA 1CDGA 1VRXA 3TP4A 3M07A 5CJ5A 4KH2A 2QF8A 4CU6A 3QOMA 2DSZA 1PX8A 1VENA 4UQDA 3QHNA 1J0KA 1R7OA 3KE0A 3MSGA 1W2PA 4UQAA 4M56A 3SCSA 1FHDA 2YL6A 4PMRA 1LL7A 2W62A 3N11A 1E6RA 3CZEA 3ZO9A 3M6DA 4AIOA 4W88A 4P8WA 2XWDA 4MADA 2XFFA 4B15A 3MV01 4Z2JA 4BQ3A 4Z2KA 1BGGA 1E56A 2WKLA 1FH8A 2V3FA 1WZLA 1LLOA 4W8LA 2YJQA 3VMPA 3CZJA 4H8UA 3U57A 1DWHM 3VGDA 1V6VA 2E9MA 3SCVA 1XD0A 4PMZA 1DEDA 3KZSA 3WF2A 1JF6A 2QMJA 4CVUA 2IXVA 4XX6A 4IPLA 4GI9A 1OT2A 1OB0A 1WDSA 1DTUA 1GQLA 3POCA 2VRQA 3M46A 4ZE4A 5LA0A 1V0MA 3VILA 1VJZA 5D4YA 4OZOA 1KQZA 3MO4A 5I0DA 4R5EA 4JAWA 1XHGA 1GOIA 1H2JA 2EPKX 1VFOA 4QLJA 2ZX6A 3ARRA 3KWXA 4U5KA 2WNWA 3ARWA 5KEZA 4P8XA 1QNQA 1J0YA 1OD0A 1HJWA 5I5RA 2DSVA 1H09A 2J8GA 2VZSA 3WNMA 1J9YA 4U3AA 1EGZA 2ESCA 2ZXQA 4TX8A 4BQ5A 1GOWA 1M53A 4WKAA 3WDJA 1NOWA 3SCPA 1ISVA 1MXDA 2XSBA 4XV0A 3WY1A 2WZEA 3VKKA 3PTKA 3RILA 3WQWA 1JZ2A 5M17A 6TAAA 1JZ7A 3FY1A 4P8UA 2JIWA 4Z2HA 1B30A 4DUVA 1BAGA 1CXKA 1MW2A 4S3KA 1KXQA 3K8MA 4V28A 5BYWA 3QHMA 1XH1A 1SFSA 2V38A 3W37A 2WCSA 4D6DA 3OGSA 1BLIA 4GQQA 1EIBA 3CHCA 2DIEA 1FH9A 1TG7A 1RH9A 3ARVA 1E55A 1KGWA 2DQXA 2GDUA 4E8CA 4NF7A 1ISWA 4PTVA 2DSWA 2Z1SA 3GBEA 2JE8A 3SURA 4CKQA 2XJ7A 1F4HA 2VC9A 1B9ZA 2CHNA 1NWTA 1XD1A 2UWFA 3HJEA 3FAWA 3RM8A 3DC0A 1RP9A 3QHOA 2D24A 4U5IA 1KGUA 2PBGA 3AIQA 3K1DA 2CEQA 2UY3A 5GNYA 3WUGA 1GPFA 4IPNB 3AI0A 4RE2A 5ECUA 3S6TA 1SMDA 2DH2A 4ACYA 4WLCA 3ECQA 3U7BA 1AVAA 1CTNA 3T0AA 2YDQA 4HZ8A 5CXPA 4HZ7A 4EANA 4HP5A 5HOSA 4D6IA 2XPKA 1CPUA 2FHCA 2YDRA 1W32A 1R86A 4JFSA 3OB8A 4GKLA 3L4YA 4LXFA 5ABFB 1HJUA 1EO7A 3BCDA 3WMBA 4AD0A 1EOMA 4FLQA 3W0KA 1P6WA 4FLOA 3THDA 4PMNA 3N04A 3NDZA 3RJXA 1QI2A 2CXGA 1E3XA 3F5JA 4AZGA 4HPHA 1V3HA 3ZSSA 5E0CA 3OGVA 2WHLA 2VZVA 1ZU8A 4A4AA 5JH8A 4WK9A 4H2CA 4PCTA 2XG9A 2VZUA 1UWRA 2J7BA 4PCSA 2G3MA 3WQ5A 3TTOA 1JZ4A 1JIBA 1E43A 3NUKA 2D3NA 2XGIA 3K46A 1C8XA 3BAJA 2CCRA 1XV8A 4AD2A 3OLIA 4PTMA 1J0HA 3EMCA 1D3CA 4Y7EA 2J77A 1OD8A 1GHSA 5HNNA 2NSXA 4MAVA 1C7SA 3BAWA 5CLTA 1FOBA 2PWGA 5BWFA 1CXFA 4J3VA 4E4PA 1EHAA 1VB9A 4AZ6A 1JZ3A 3SCNA 3WKZA 2FGLA 2QPUA 4U2ZA 1G5AA 1DWJM 1W1PA 2BNJA 5GNZA 2BV9A 2DT2A 2VRKA 2WZHA 4AIUA 5IFTA 3PZTA 4UQCA 5BRQA 1E1EA 3D5HA 1W1VA 1MXGA 1SMAA 1HL9A 4GPNA 2ZUWA 2G3NA 3T08A 2YL8A 3WNLA 2BY3A 4W84A 3SIMA 3KL3A 4DWSC 1J0ZA 2VO5A 5FIPA 4PYSA 2WMGA 1UA3A 4V2XA 4RE3A 1ITCA 1Q4NX 1JF5A 3AICA 2VURA 3VD7A 2CNCA 5HBFA 1C91A 1XSJA 3GXDA 5JUVA 4H04A 1J11A 1UQYA 2XVPA 1VEMA 1VFFA 4OOUA 4AMCA 2G41A 2HISA 4UFHA 1M03A 1Q6DA 2FH6A 2YL9A 4NZCA 3OG2A 4AD5A 1WPCA 1IV8A 4AZIA 5D9NA 1QBBA 2XIIA 3FXYA 1PPIA 4N42A 4MPKA 1MFUA 2BXYA 3GM8A 4FLRA 1NARA 5D9OA 5A8MA 4H7VA 2YBTA 3PZGA 4UZSA 3VIMA 1U30A 2XM1A 4BQ4A 1UD2A 3NJ3A 3WNNA 3D3AA 3W81A 4JIEA 3WQ8A 3WNKA 2CERA 4JFVA 3MUAA 2XVGA 5BRPA 2WB5A 4KMQA 1FHLA 3TTQA 4JFWA 2WK2A 1VIWA 1DHKA 4HPGA 1GJWA 1H41A 4MJ4A 1UQZA 3VX1A 4KRUA 1GCYA 3RO8A 3W53A 2J47A 2OSYA 4QDMA 5D8WA 1H4PA 3EDEA 2CIPA 1E6ZA 2BHZA 4AISA 5A6LA 2Y4SA 1ECEA 1VJSA 1WDQA 3CPUA 3ARTA 1DWGM 1UD3A 5E0FA 2J7FA 1WZAA 4EK7A 2IUZA 1BTCA 4ZEPA 4KGJA 2VL4A 1G0CA 4J7RA 3A6OA 4FMVA 2JEQA 4AYSA 2IXUA 5BROA 1UWIA 3UCQA 1E5NA 3PZIA 1JDDA 2BXZA 3AMCA 1R85A 1JDAA 4GI8A 4HA1A 2CETA 2VQTA 4BCEA 2YA1A 1KR1A 4NRSA 5C71A 1JYWA 1US2A 1GZJA 3TTSA 4AZ5A 4E8DA 4ML4A 4HMCA 4PUEA 3SCUA 1JAEA 2OSXA 3GH4A 3BAXA 3BGAA 1HXJA 4EKJA 3MANA 1QI4A 3ARXA 1QW8A 1H1NA 4CUCA 5FL0A 1KWGA 3VUPA 3MMUA 1UD4A 3NIYA 4F79A 2ZX7A 1TCMA 3VDHA 3CHFA 2E9LA 2EO7A 2G8ZA 2ZICA 4HZ6A 3AS1A 5JBFA 2WMIA 3HMCA 4UFLA 2Q8XA 1RPKA 3VD5A 1OBAA 1WZMA 4JFTA 2DIJA 3BLPX 3G6LA 1E70M 2WSPA 5IFPA 7TAAA 3CLWA 3S2CA 4HOWA 4GO8A 4W87A 1TA3A 3AJ7A 2GJXA 1UWTA 5AY7A 3L4UA 4MNKA 3BCFA 5TD4A 4XZBA 1US3A 2CBVA 2QHAA 2OWCA 5I78A 4PMQA 3ZSTA 3CH9A 4OUEA 1EDTA 2J7CA 1LWJA 3KL0A 4WKHA 1PZ2A 3N15A 3VIOA 1H11A 5M3WA 2BY0A 1CXIA 5LA2A 5A2AA 4ATLA 2OWXA 5A6BA 1PX3A 5ABGA 1JYXA 2AOSA 2BHYA 1E40A 4MNJA 2C0HA 1MVYA 4URIA 3B9EA 2GK1A 5CLWA 1Q6GA 3N1AA 4LX4A 2XTKA 1EQPA 1PAMA 4AEFA 4MB3A 1UR4A 1V3IA 1ITXA 2G3IA 2WW5A 3WEZA 1HJQA 3AIVA 4MNLA 1BSIA 3WD1A 3CMGA 4U2YA 5CG0A 5DFAA 2A3EA 5A8NA 3OLDA 2X2YA 3RM9A 3VIHA 4U33A 2OLHA 2J62A 1B3WA 4M81A 2JF6A 2W66A 3AXIA 3A4AA 2D22A 4B9ZA 3T2OA 3W29A 2WLZA 3VGBA 4PTWA 1UWUA 3VMOA 1H49A 1JNEA 2GSJA 1ZJAA 2X0YA 3GDBA 3AQUA 1VBUA 3WDQA 1E5JA 4PMUA 1V3LA 1JFXA 3L4ZA 4DUXA 1D7FA 2Y8KA 4UQEA 5EMYA 3U5YA 4KRTA 4J27A 4TXEA 4D6FA 3AHYA 2VZTA 1LF1A 3RDKA 2XWEA 1GW1A 4MTVA 1WO2A 1E71M 1H5VA 1WAWA 1WE5A 2W5FA 4UCFA 4PUDA 2NT1A 3SUVA 5DO8A 3PZ9A 3UR8A 3I3BA 1V0LA 1OINA 2VCBA 3M7SA 1K9DA 3VM5A 3BAYA 3AOFA 1GHRA 3OA5A 3T0DA 3LPPA 1MQRA 2WBKA 4RE4A 1E6PA 3UG4A 4D1IA 2E8ZA 2DT0A 1NP0A 1OM0A 5A69A 1HVQA 3VTRA 3RPMA 3W6LA 3WQ4A 2YOCA 5I79A 4GZIA 1JAKA 1RP8A 1L8NA 1BQCA 5A6JA 1TUXA 2ZUMA 1FFQA 3RJYA 1M7XA 4DM2A 3VIPA 3PZOA 1I75A 1W2VA 3N18A 1UR2A 4Q22A 1E4NA 4CVWA 3O9NA 2CYGA 1PIFA 1BF2A 2J75A 4BF7A 1SYTA 3OBAA 1R8LA 3BLKA 1W3KA 2E40A 1W9BM 2YIHA 3WQVA 3GXFA 3CHDA 4LGXA 2BFGA 1ZBWA 2VZOA 4C7FA 5GQBA 1E15A 4ACZA 4PSPA 3ZMRA 3ZQ9A 4V27A 3WBEA 1JXKA 4IISA 4F8XA 9CGTA 1VEOA 4GI6A 4CCDA 4UFMA 1E9LA 2O9TA 4J3UA 2ZWZA 4W8AA 1BG9A 4BS0A 2J7HA 1CXHA 2CBIA 4WIWA 1V6UA 2QLYA 5EFFA 2D2OA 2AAAA 1UWSA 2WVSA 3L4XA 1BHGA 3WUEA 5KZ6A 1GNXA 1UHVA 1NQ6A 5E70A 3G6MA 2GK1B 3GNPA 1B3ZA 1FP9A 3ZJKA 4PN2A 3TONA 3K8LA 1KB3A 3AYSA 4Z2IA 2WHKA 3DECA 3TOPA 2C7FA 4PMOA 2WKGA 3A4XA 3O6AA 1D2KA 3ZIZA 3VD9A 1V0KA 3ZR6A 4F9JA 4D6JA 3CZLA 2F2HA 1UH4A 4TOQA 2W91A 1J0JA 4D6CA 3VD3A 4P8VA
chains in the Genus database with same CATH superfamily
3E9AA 3TIMA 3S5OA 1S5VA 4CD6A 3MV11 1JI1A 4DWSB 3K2GA 3CZKA 5BXJA 3ID7A 4FS9A 1GK8A 4FB7A 2TPSA 3DFNA 3UEQA 1US0A 2CXEA 3N73A 3M16A 3GLCA 4D8AA 4KIRA 3WJSA 3V4BA 3K4AA 3G5EA 1DWFM 4PR4A 1EJTC 4OBSA 4N6EA 4Y9NA 1E51A 2Z00A 5H6HA 2QULA 3U7VA 2D9FA 1FVPA 1BRLB 3UXIA 4JIQA 1VBRA 2DV0A 4NX0A 2Y5JA 1G67A 3VGEA 4HPNA 3VOJA 2PWVA 1PO9A 2YW3A 3CO8A 1PBKA 3MCOA 1JPKA 1T0OA 1G94A 4MWAE 1T8QA 2CBJA 3B8SA 1C9WA 2PCEA 3PTDA 1DJZA 4XB3A 4B5TA 1LBFA 4AD3A 1E3ZA 1BGAA 1G01A 1FHUA 3SCOA 3PBMA 3AFBA 3O6CA 1CZ1A 1B3VA 1SZGA 2OR2A 1H51A 4XTIA 4AY1A 4K6AA 4M1RA 1OCJA 2J6VA 2V3EA 3TLQA 5CGMA 3HPXA 2NX9A 4L6DA 3ZLGA 2XP3A 2WHJA 1NWUA 1C9DA 3MO7A 4JTKA 3OU8A 3W7KA 4G8TA 3AHZA 1XM3A 3B03A 5DY2A 2V5DA 2R94A 1EGVA 3FA5A 4NNRA 1HKIA 2P3EA 4ZSTA 3W84A 1PZ3A 3CZ8A 4Z2GA 2YX0A 1JCTA 4UOJA 1MEHA 1WNOA 3DKLA 5AOUA 4PE8A 4JL2A 4M19A 3VKBA 4DPPA 3KOZA 3TW6A 1UROA 3H9RB 2E4TA 3LDVA 3GG7A 3W4RA 3O5MA 3VD4A 4ZTYA 4IWWA 3EBVA 1RCXB 3LI1A 2UY5A 5A94A 1CLKA 3BOFA 4AD1A 3VNIA 3NG3A 4GJIA 3DH7A 3W22A 3PS7A 3KUMA 1U22A 3W7QA 4QISA 2ZUTA 3GVVA 4DHGA 1Z6KA 5BXRA 4F9DA 2YYTA 1ZS2A 1KM1A 4IHCA 4PEEA 3KCEA 3LM7A 1R9ZA 2XHYA 3MB9A 1U1HA 4JX4A 3TXZA 1F5ZA 2PDKA 3UI6A 1TFVA 1KCZA 4OIFA 5AECA 2E0PA 4HU8A 3R10A 1UA7A 1EA9C 4JICA 4P5UA 3NM1A 3L66A 4LUTB 1EYEA 4NT0A 5F4WA 3QV9A 2AGTA 7TIMA 2DEPA 2QQ6A 4QDWA 1Y65A 3URNA 1DJWA 3IAQA 3P82A 3DHUA 3RX3A 1JNDA 1ZTVA 1V02A 1JNTA 2WZTA 4PC8A 1DBTA 4GYPC 1OG6A 3WBWA 2ZYFA 4RL3A 3VPLA 4GNJA 3W7IA 1Z41A 2ETNA 4MSSA 4PUUA 4G7EB 1UZHA 3PRAA 4W85A 1V77A 1ZRQA 3CV1A 3BV7A 5J6EA 1P5BA 3BG5A 3PPCA 3FJLA 1O6IA 1S5NA 1IZCA 4PRRA 4MJMA 1ISZA 4G9PA 3T07A 1VEPA 5DMYA 2EGZA 2Q8ZA 1MZRA 4F3HA 4O1CA 1E6NA 3WQOA 4PMXA 3NPWA 1G6CA 3VO0A 2D1ZA 3L4WA 4LV4A 3SFKA 1LRNA 3L2LA 3A4JA 2P0OA 2W6RA 2OO0A 2HE5A 1UKPA 2JFEX 3L12A 1N1AA 4RLIA 3BJFA 3P8IA 1EP1A 3PY2A 3WENA 3T7VA 1NM9A 4A29A 7A3HA 2PI6A 1VPYA 1OGSA 4NNAA 1LJYA 1V6XA 3GDMA 2W63A 2RGMA 2ZX9A 1FKKA 1VFMA 2OPJA 1Q6CA 1QHOA 1LCOA 1IX5A 1N82A 1RVKA 4Q8WA 1N2VA 4IX2A 5DLCA 2Y5SA 2E68A 4R53A 4WGHA 1C7TA 1NF7A 3S42A 1AD4A 1W54A 3VM7A 2GQ8A 4C5ZA 3SRFA 4TNSA 4W93A 1VS1A 2EF9A 3NQ7A 3UWQA 2B31A 3ELFA 4P7QA 1J12A 4LVAA 1W3HA 3CGTA 5CPMA 3AIRA 2CBUA 3BAIA 4LYPA 4DH0A 3VIFA 1PWMA 1QOXA 2BS9A 3AXMA 2OT0A 3GFZA 4KFNA 2VC7A 3JZEA 2ISWA 3NQVA 4A8RA 4LS2A 1DJYA 1JPHA 4KIEA 3R89A 2FGZA 1NFBA 3A5FA 3NO3A 4WZHA 4NASA 5CC3A 5H8PA 3HQ1A 1L6FA 4GACA 5DBUA 4ZFMA 2NUWA 2PTXA 1QO2A 2YDAA 4F2UA 3DXIA 4JN6A 3PTMA 3IACA 4HT3A 5D09A 3CU2A 3H2OA 1GJPA 5C9ZA 3GK0A 2DFAA 5F2MA 1AMKA 1CYGA 1O60A 3B40A 2WCGA 4AC1X 2LKNA 4CQBA 4ZSUA 2HVOA 4ODNA 4FOJA 3T8QA 1WA3A 4DZ2A 4GIAA 1JPMA 3GNRA 3GYCA 5CGQA 5CZTA 4DM1A 1L1PA 2JGYA 1EO5A 5HXMA 3PUDA 4QM1A 4JTIA 3MKVA 3H2FA 3LLFA 3WK2A 4DBSA 2ONEA 3JYMA 3K30A 5GJNA 4J1OA 2C15A 3Q45A 3CAQA 1FAPA 3VC5A 2PDQA 1V3KA 2YLLA 4A3YA 1A0EA 4AXNA 5BNKA 3S0CA 3BXWA 2OXNA 1S1PA 4NNCA 4OTKA 1OCQA 3MPGA 5CSUA 4IQJA 4CD7A 3MKKA 2GVGA 3UESA 1KBBA 5C55A 2WKJA 3TAOA 4DBDA 2OOGA 4MWAD 3IIZA 1QWKA 2XIOA 4DO4A 1R87A 3MJMA 5T9BG 3ZJ8A 3S2JA 5DRIA 4GZEA 4HGXA 3WLIA 1WXJA 2ZE0A 2DGAA 4NRRA 3SY1A 3DUGA 3GHRA 2XGBA 3NSXA 4BY3A 3PAOA 4BHYA 1XCFA 3W25A 2NW0A 3N9SA 3G8EA 3NSNA 3NO1A 4HBEA 2RQSA 1KCKA 5KZDA 1UZ1A 3SQLA 5C7HA 5FAJA 4LPCA 2J7DA 4LBSA 3V0TA 1WBJA 5LGZA 3ITLA 1DXEA 5TF0A 2ISSA 1XI3A 3PSVA 1Z32X 1J4IA 2D73A 2CHRA 3NVTA 2HNHA 2Z1KA 3RHGA 4QEHA 2YCKX 1E4MM 4IUGA 4W7VA 4JN7A 2WSRA 4DELA 2FHBA 2PF8A 4FALA 3FHAA 1CWYA 2BY1A 2EPHA 3O5FA 2FZDA 3G1FA 3TC7A 3NEHA 3O15A 3T05A 2R9RA 1UKOA 3N19B 4WDWA 4KQNA 1KT1A 1YKWA 3SFWA 3VNYA 1UD6A 4CGTA 6ENLA 2GGEA 4JKLA 1P48A 1RA5A 5D04C 4NIRA 1SW0A 2WVUA 3LHZA 3MUY1 3OZOA 3QGVA 3VX0A 1JYVA 1RALA 3A3WA 3MWCA 4LYKA 4AZ7A 1QI5A 1PX4A 2XH7A 1OC5A 3UP8A 1XF0A 4IPXA 3VC6A 3PFMA 4TVDA 1R47A 4X61A 5G2IA 3S1VA 2VWTA 2P5NA 3QRHA 4WKFA 3WL1A 2E3ZA 5DX7A 1K03A 2WSQA 3B97A 3HZ3A 3NO5A 4MB5A 1ZJIA 1O5KA 2KR7A 1HKMA 4OV9A 3RFAA 2ZDSA 3ARUA 4DO7A 2PBCA 3O06A 2R1PA 3KAFA 5C8BB 3HGSA 1KFWA 1EBGA 2PZNA 1XW8A 3OIXA 4GRSA 1YLVA 1DJNA 1E6QM 3R4IA 3BAKA 4PTNA 3W7OA 3QOKA 3W88A 1Y8BA 2GVYA 4AWUA 1K3UA 3ES7A 4WY0A 4P7OA 1L6YA 1XYZA 3TVAA 3R6IA 3LLXA 4JHOA 3L2IA 1WOBA 4L72B 1AQHA 2QKFA 3BLIA 1DV7A 1ZJHA 3KL5A 1QCWA 4A6GA 4GWEA 1XLFA 2GL5A 4IQDA 4DRKA 4LS0A 4XIAA 4FNTA 1M41A 1BL4A 5C6MA 3PF3A 4C6EA 5FJRA 3A22A 3MUZ1 3L0NA 3Q37A 1IGWA 4KWVA 1V5XA 3PBUA 4LYQA 5L9FA 4JCMA 4DWSD 4HD5A 4H6QA 1Z8AA 3FS2A 3CB8A 3IANA 4LUJA 1JUEA 2NV9A 4ZGYA 5FCZA 1ZFJA 3GFXA 4WCJA 3SM0A 4RV3A 1OFEA 2CZVA 2FZMA 3GDRA 1H60A 3SUTA 4HVXA 3PPHA 4AWSA 3SRDA 4JTGA 2PTYA 4HMDA 2J4GA 1TCDA 4AZCA 4UTLA 3EB2A 1I8JA 4PUKA 4WQ6A 3MDWA 2CESA 3ITYA 4D6EA 3ERPA 3UZWA 1J4HA 4MNMA 1C8QA 1GONA 2EG7A 4MWAA 1FCUA 3KP0A 2DDXA 3LV5A 1G4EA 1UIPA 4MY9A 2IQDA 4GQRA 2V3DA 1Z69A 2J25A 2RSEA 1J6YA 5MKGB 3M5YA 4E6MA 3P84A 1ZB5A 2G4JA 4HOZA 3VIGA 4B5SA 3APYA 4LF2A 8XIMA 3CAVA 4WDTA 4NXSA 3W2MA 3KWSA 3PTQA 1HKVA 2IQ0A 1XLKA 1HJSA 2LLEA 4KRZA 2E28A 2QV4A 2C14A 1S2VA 1SVDA 3JUGA 3S83A 3AXXA 2V2CA 2OYLA 4HCDA 1XLIA 1FWAC 1T99A 2G0WA 1CLXA 4NHVA 4XO7A 3W1UA 5G1YA 4ZTXA 3FYOA 1LQ2A 3E5BA 4O8RA 1QNSA 3RMJA 4C6PA 4HNTA 1VFTA 3OEXA 5J8LA 3ZVIA 4LH8A 4TVCA 3WLHA 3MMWA 1FKGA 3N9KA 2ZZ6A 1U1UA 1EYMA 3NL2A 3G0SA 4D9PA 4NSBA 5A6SA 4Y9OA 4A21A 1UR3M 2Y63A 3AC0A 4LU0A 1TV7A 4S3AA 1SJBA 4GYFA 3COTA 4GD0A 4G2DA 6TIMA 4EPDC 2FVLA 5EL1A 1P0KA 1V3JA 3LTSA 2CWXA 2UY2A 2VMFA 1VHCA 3LMZA 3MDUA 5JIPA 1NDZA 3UYIA 2O9OA 1O5RA 3O6DA 4R9XA 3HMJG 3EOLA 4J4NA 1EFZA 1FWHC 2YB1A 1MSSA 3QZAA 3RG6A 1YRRA 2XP9A 4LB4A 4PB4A 2VEFA 2P3ZA 2HCVA 4WXYA 1SR0A 3OW1A 4WY0F 3SJNA 4HJFA 2WC7A 4L65A 3HO8A 4G1NA 2GQ9A 3IUIA 4ZMGA 2GOKA 5AC4A 5HATA 5IDIA 3AIEA 3DG3A 4TV6A 3VMNA 1Y7VA 1HIZA 5AVNA 4ZXOA 3GAYA 4CD8A 3CC1A 4LYRA 2VUYA 1H3GA 3VDBA 1F3WA 1OT1A 3HPFA 1TV5A 4XD6A 4XZWA 3S5NA 3UERA 4TU1A 2BOEX 1M68A 3TXVA 1J0IA 3I4EA 2E6AA 1O4UA 4QSFA 3SN0A 1CNVA 2DZWA 3W02A 2E6YA 4QG9A 4C6FA 1AJZA 1K8ZA 4I90A 4TW7A 1KM5A 4TMBA 1RV8A 3NOEA 4UTFA 2PWFA 2WJDA 4M8UA 4OBRA 3RLUA 2ACUA 3MC5A 3G3DA 3O5RA 1O7AA 3E5PA 2OU4A 2KE0A 1VFUA 4WSJA 5SWUA 1O94A 4W8BA 3EDKA 2Z7KA 3DOPA 2VGGA 5XIMA 2DUAA 2FMOA 4OFCA 1HG3A 2CPUA 3KCJA 1C3FA 3O1NA 3FIGA 1CDGA 1VRXA 5CH9A 5LIKX 3TP4A 4HMNA 4KH2A 2NWSA 3ZS4A 2DSZA 3FX4A 2C1IA 4F2TA 1DE6A 2X16A 4QGCA 3PJUA 3QHNA 4PUMA 4H9ZA 2PODA 1W2PA 2A5HA 4UQAA 2YL6A 1KKOA 3C2FA 1E6RA 5FSDC 3UXKA 2GVEA 2RDXA 5D75A 2BP1A 2XH2A 5T8GA 3VE9A 1CI1A 3LD5A 1ONEA 4W88A 2FDSA 1XIFA 5CAKA 3VZXA 4NX5A 1BD0A 3C2OA 3PSWA 3TX9A 4Z2KA 1E56A 2V2DA 1FH8A 3S6DA 2H8ZA 4NI8A 4W8LA 1F3EA 1G4PA 4H1ZA 3GIQA 2GWGA 1SFTA 3W71A 3EB3A 3HB9A 2KI3A 3FK4A 1BXNA 3U57A 1HL2A 4NAFB 4DI8A 3VGDA 2A7NA 2VGIA 3MW7A 1XD0A 4PMZA 2O7QA 4J3ZA 1Y5XA 3LCFA 1P5QA 4LY4A 4YVVA 4ZS6A 3E74A 4FAMA 1QPOA 1P6CA 2H3DA 3B0YA 4UNKA 2E6FA 3W1AA 1DTUA 3RX4A 5HT1A 4GCAA 3PRDA 1V0MA 3GNXA 1VJZA 2WNZA 1KQZA 5HWNA 4GBUA 3WJYA 4O4VA 2QEZA 4JAWA 5BOFA 4J4KA 1YTKA 2ACQA 1W56A 3F7JA 4ZCWA 5LNVA 3VNKA 3ARRA 3EOOA 1UJQA 1ME8A 2FZBA 1NVMA 4UBPC 4JQ1A 2J8GA 3VCRA 3VZYA 3WNMA 4KWSA 1E0UA 2Y78A 3GKAA 3OHIA 1EGZA 3VDGA 2ESCA 4IPJA 4IZGA 1VGAA 1KT0A 4MY1A 3SCPA 4FI4A 3R12A 2XSBA 4XV0A 2WZEA 3PTKA 3CGMA 3M44A 3W72A 3TC3A 3R8RA 2G96A 3WQWA 1LBMA 3U8GA 1FWBC 2P50A 5G5IA 4ZB0A 2ZDRA 3D0CA 3MSYA 2J8TA 1F3XA 5M17A 1G4TA 1JZ7A 2XP6A 2ALDA 5IRPA 1X7FA 5DIUA 3G24A 5H8UA 3KAHA 3UJRA 1JCNA 2IW0A 5HW7A 1RAKA 1MW2A 1KXQA 3K8MA 4V28A 5BYWA 4MIMA 2YXXA 3CUXA 2DVXA 2V38A 3C61A 2WOQA 3OGSA 4RNJA 5HQMA 4JTHA 1FH9A 1RH9A 3ARVA 3TR9A 2V5KA 2GDQA 4GVHA 2Z1SA 1W8GA 1SZRA 4ZA0A 3SURA 1F4HA 1W3IA 1F74A 2VC9A 1B9ZA 3OOQA 3C86A 1XD1A 3HJEA 3FAWA 4HSOA 5KZMA 3BLEA 4U5IA 1KGUA 2PBGA 4J35A 3K1DA 3ABQA 1GPFA 5M1TA 3AI0A 2ABBA 4IG2B 4WLCA 1CTNA 1DIKA 2YDQA 3O5QA 1NELA 4HP5A 4LTSA 4IGHA 1IXPA 3EWWA 1QPLA 4WJ8A 2FHCA 2YDRA 2CLHA 4R9OA 4JFSA 3NQDA 3L4YA 3I6CA 4C02B 3QGAC 1J5TA 1DXIA 4FLQA 1P6WA 1IIGA 1XYCA 3GS6A 3NDZA 3LS9A 2NUYA 1E3XA 3F5JA 4ECLA 3ZSSA 2VM8A 4K39A 5E0CA 3OGVA 1SO4A 3R5EA 4FXJA 2VZVA 5JH8A 1FWWA 1TSIA 4JTRA 4Y9MA 1A5KC 3MT1A 3N4FA 4POCA 3C5QA 3GVRA 3O5JA 3WLRA 3FVDA 1E43A 3NUKA 3K5XA 1NTHA 2ANUA 3NL5A 1XIBA 1YPIA 4HN8A 1BWVA 3WBYA 2M2AA 4QXIA 1K8CA 3W7HA 4AD2A 3B8DA 4PTMA 2QIWA 3T9PA 3EMCA 2VR2A 4Y7EA 3OPSA 2C16A 3UPWA 4QSHA 2DZAA 1KBIA 4KT2A 5J5RA 4MAVA 3S5ZA 3L9CA 3O0FA 1F3TA 1IEQA 4HHLA 7PTDA 1CXFA 4E4PA 3MYPA 1QRQA 2FGLA 4GI4A 4HK6A 4YL2A 4GYPA 4KFPA 1EZWA 2BNJA 2ZQTA 2WZHA 2QNEA 1I60A 2YYUA 5AHEA 3EXSA 3C3NA 2AGKA 3PM6A 1YATA 2G3NA 4S3GA 2O4MA 4W84A 1SGJA 5I3FA 5I02A 1K02A 4WJEA 1J0ZA 2G3FA 1AJ2A 4RE3A 1WQ5A 3P5ZA 1JF5A 2VURA 5FF2A 3CL8A 3SAZA 3EA2A 5AHNA 1VFFA 4AMCA 3FYPA 2G95A 2HISA 3QH2A 4UFHA 2B0MA 3N2MA 3NPUA 4NZCA 1S2TA 4U4MA 1WPCA 4AZIA 3PPFA 3W2NA 2PP3A 3AO0A 4N42A 2YBTA 3NI6A 3VIMA 1IXNA 1OX6A 4RPQA 4BQ4A 2FTPA 4O28A 3ZZ1A 4XZHA 1UD2A 4K37A 3UYCA 2PLMA 3WQ8A 4JFVA 1F7BA 1XS2A 1JULA 4EXBA 5C9RA 1AD1A 5BRPA 1FHLA 3TTQA 1QPQA 4F40A 1DHKA 4MUZA 1ROUA 1TJ0A 1L9WA 3W53A 2J47A 3ODKA 3LQLA 4MGGA 3WLMA 1E6ZA 5A6LA 2Y4SA 1ECEA 1VJSA 4NYYA 3CPUA 3ARTA 1DWGM 1X38A 4HQVA 1BTCA 5D2XA 2VL4A 1G0CA 4J7RA 5HMDA 3O63A 4JTAA 1E1CB 2JEQA 4W9QA 3EX3A 2RURA 4N2YA 4ILSA 3LTPA 3PZIA 4Q4OA 1GEHA 4HA1A 4BCEA 3R58A 4A35A 2YA1A 1VRDA 5DN1A 4LANA 3G0XA 3TTSA 3FLUA 4S3FA 4FF7A 1S2AA 4PUEA 3TKFA 3TNOA 4Q4PA 1VIZA 1FD9A 2HJPA 3GH4A 2GGHA 3ARXA 4JTJA 5FL0A 3VUPA 1P0NA 1UD4A 3RFWA 1EJUC 1WXYA 2E9LA 3QGKC 4J4OA 4OUIA 1AFSA 3AS1A 3HMCA 2WPBA 5FEPA 4JOMA 3KLKA 4DIPA 4AY7A 1V7YA 2DIJA 4QT3A 3OODA 2F6UA 3ITOA 3UXLA 3PRBA 3QKEA 3AJ7A 4GYJA 5AY7A 1KNWA 2QYGA 3L4UA 1F6PA 3BCFA 5TD4A 2QHAA 2OWCA 1D8WA 4GY1A 1XKYA 5HNUA 3LGDA 1Q2RA 2AOSA 4NP7A 2BHYA 1DVJA 3ISIX 3B9EA 5FF7A 2GK1A 2PDJA 5CLWA 2ZE3A 3LNMA 5HA7A 4LX4A 4F0KA 1XLEA 1QO5A 4DT4A 1EQPA 1GVSA 3OQEA 4AEFA 4Q8OA 2G3IA 3AAMA 3H26A 1W5MA 3VFLA 1EX1A 3CMGA 4U2YA 5EPDA 5A8NA 3L65A 2X2YA 3RM9A 3VIHA 1B3WA 1W8SA 2ABAA 3A4AA 1GGOA 4C5YA 3T2OA 1UASA 1UWUA 1D3HA 3VXGA 2DW7A 2X0YA 1H7PA 2RJHA 3P74A 3GHTA 5IDZA 3WDQA 2QUNA 1L6SA 3C8FA 4ALDA 2IS7A 3URQA 3EX6A 1D7FA 4R0XA 4QNWA 2BGSA 1RUSA 4UQEA 3DZ1A 1AA1B 3KAIA 4KRTA 1RJRA 3CQ0A 1I0DA 3PB2A 2PGEA 2V5JA 3HG5A 1KBJA 4AUBA 1J2WA 3SRKA 1AH4A 3TFCA 1XYBA 1KM6A 2Z7GA 3QYSA 3SUVA 4LAXA 3WFAA 4S38A 3UR8A 2OODA 3DFPA 1OINA 2PN0A 2GUUA 3VM5A 1M7OA 1I0BA 2XH0A 1L6GA 3SN1A 3TJ4A 3W7RA 4RW3A 1E6PA 4AX7A 2GSHA 2E8ZA 2Z6IA 4ZO8A 1OM0A 5A69A 3QF0A 2XN0A 3DIPA 4ZPWR 4QQUA 4S3DA 3W6LA 3WQ4A 2YOCA 5I79A 3MCNA 1EX5A 2HWGA 1L8NA 3M0MA 2ZC8A 1TUXA 4YCOA 4IMFA 3W7DA 2ZKMX 1QWGA 3C56A 3HGOA 2WNQA 1M7XA 1B4KA 5CSSA 4ODLA 5M2FX 1I75A 1KW1A 4R3UA 1UR2A 4Q22A 3WK3A 1PIFA 2W79A 2J75A 3P81A 4UTIA 4BF7A 1W1A1 1SYTA 3OP2A 1W9BM 3APTA 9XIMA 3PJWA 3EY6A 2M1IA 4UC5A 1AL8A 3CXOA 3D46A 4IFRA 2OLSA 2QPXA 3G1VA 3AU2A 1XQLA 4HK5A 4E5TA 4PA8A 3NGJA 4FR6A 1RK6A 5BWAA 1VLIA 3N4EA 4GIRA 4V27A 2C91A 1VEOA 4EPKA 1TPDA 4GZ7A 2O9TA 4J3UA 4W8AA 3TAKA 4RDYA 1H50A 3M5VA 2X1UA 3S46A 2YZ5A 3CASA 4IGSA 4B5NA 4GMEA 3L67A 5KZ6A 2WM1A 4IX0A 1QOPA 3LEPA 3QW4B 2A3LA 4JN8A 1XDMA 1B3ZA 1OJXA 1XRSA 2HBVA 2A6NA 5B80A 2FKEA 4Z2IA 1SPQA 2WHKA 3O6AA 2Q01A 4XTDA 3VD9A 1DPMA 2X40A 1UUMA 2IPFA 2F2HA 2W91A 4IMGA 3V35A 5JU6A 2ISVA 3CHVA 3M6YA 5IM51 2I17A 2DP3A 3AISA 2DUXA 2X1IA 1XLMA 2RGLA 4Q8NA 4IG2A 4IIDA 3VVGA 1T96A 1CB2A 1RY0A 1A80A 3MSRA 2XISA 3RUBL 2W61A 5T91A 5BXSA 4E4UA 4FZIA 3EOEA 3IVUA 3L5MA 2ZZ1A 2QIIA 3BGGA 3GG0A 4JIIX 5DY3A 4PTXA 1V93A 3LBMA 2EQDA 1W1YA 3PWIA 2ZFAA 1A0DA 3UU0A 3WQ6A 2VEPA 1C93A 3U6WA 4NAFA 1PJ9A 4O11A 1WX0A 1SW3A 1E9YB 5LYRA 3QZ6A 1I9CB 2JGQA 3VOIA 3BTNA 2C0AA 3SCTA 2HSAA 2J74A 4XAKA 3I7RA 5E9AA 5F1VA 4FK9A 3CZGA 3DC8A 4M7TA 1JCLA 1RCOB 3ZFHA 5K7JA 1WUFA 3TDFA 2CKRA 2ZR6A 3N17A 4U84A 2BY2A 1UG6A 5C9XA 5GJMA 4B3LA 1XIIA 1FKSA 3NL6A 3CIVA 2O56A 4AWTA 3P2VA 1EPVA 2XM2A 3QEZA 4BA0A 4PMDA 2ZUNA 2VTFA 1V03A 1N8WA 2XFYA 3E2QA 2F84A 3BANA 3KVKA 2EEXA 1EDGA 3LZ3A 3S8HA 1FWSA 3P62A 1IXOA 1VF8A 5TNVA 1HT6A 3E02A 1AW1A 1TWZA 1JNSA 2AWGA 4GKTA 4DBUA 4UTTA 1PL9A 2Y2WA 4B16A 1XWYA 4BFAA 4X2PA 2YZRA 1ENUA 3EX1A 3STGA 3N9RA 3LSCA 3EA3A 1UKTA 2QCLA 4E2OA 3N3TA 2EHHA 3H7VA 2YL5A 4RZBA 4LVFA 3H2NA 3RK8A 1O1ZA 3AIUA 3THCA 3TH6A 4N9BA 2XN1A 3CPGA 1KFCA 3RGCA 4TX9A 4WR3A 5E09A 4FX7A 1LL6A 4W89A 2DPEA 4AVNA 4B5XA 1VHNA 2JKAA 3WELA 3HN3A 3UI5A 4Y2WA 2OLAA 3RPDA 3RU6A 3PWGA 1GQKA 4CNTA 1XRVA 2DVUA 4H8HA 3LI0A 5A95A 4ODMA 1UYQA 4PBEA 5FEWA 2KO7A 2Y1HA 2NQHA 3PR2A 3BMVA 4Q7NA 2C8NA 4ZVJA 2H3BA 4O1EA 3B9AA 4KCVA 1CGTA 2R6OA 3CV2A 3NCOA 1JQVA 4U3CA 4IP7A 1KFLA 1J5SA 1FKWA 2A79A 4IFKA 1GQIA 3W83A 1JCXA 2X42A 2BDQA 1REQB 3N34A 1GOOA 1OX4B 3O5GA 3REQA 5FJJA 4LAKA 1CEOA 2VUNA 3IIXA 4HHMA 4HBOA 2PC8A 5CSRA 1XC6A 1IEWA 1RBAA 1RR2A 1NOFA 1X1NA 5HAOA 1XCWA 4TVUA 5IHSA 1Q7QA 4XVDA 1QK2A 4AWEA 4TO8A 3THQA 1D7JA 1JDCA 3WQCA 2ISFA 1F76A 1SSDA 3CL7A 1X97A 1BG4A 2A3BA 1R2TA 1M3UA 3LHUA 2B4GA 1OABA 5K9DA 3PUOA 3UWEA 1DJHA 2C18A 3A47A 2WQDA 3DFTA 3SIZA 5CPNA 4DRJA 3ZOAA 2PS2A 5BMWA 3EKLA 2OGYA 1XLCA 3FEMA 4P7NA 4UNLA 3MHUA 2P10A 3WBXA 1TRDA 3KM8A 4WSHA 1PHQA 2YKKA 2BWGA 3W2UA 1LG1A 3LPGA 5M03A 8CGTA 2ZRXA 1L2UA 1TE1A 3OYXA 3WMSA 1UOZA 5DBTA 1G4SA 4R7JA 5XIAA 1ZCOA 2PTWA 3F4NA 2PBOA 3T0TA 2DW6A 1KFBA 3LOTA 3O7UA 4GBDA 4IM4A 3WX7A 2ATSA 2GDVA 2WPGA 4C1NA 4EAMA 2YPIA 3M47A 3FAXA 3VNLA 3LQGA 1B9BA 1PKYA 3BL3A 2J88A 4GJJA 3SUWA 3BJSA 3MS8A 3FV9A 2WVVB 1KR0A 2NV2A 4OU1A 3GC2A 4C6QA 3O5KA 5HW6A 3CQJA 3ZT7A 1D6OA 3BLDA 1JJKA 4X22A 1JQXA 4O2TA 4LUSA 4ODKA 1J8VA 3WH8A 3NZPA 4Y6GA 1CECA 1D9EA 3IAPA 4GNVA 4ROQA 1R3SA 2YCJA 4HPJA 2DJXA 4BZYA 4E2DA 1KGXA 2X1TA 2PTZA 5HANA 3H22A 4YVXA 3IK2A 4JKKA 3UQBA 2DZVA 2ICSA 2I9EA 4C91A 1UC4A 1W31A 3O05A 4J3TA 5T9CE 3KOXA 3TDBA 3G77A 4MZ8A 1KA9F 4Y96A 1EJWC 4WJXA 2LPVA 3R1ZA 1M7JA 3SCWA 2HVNA 3K8KA 1I4NA 1Q85A 3DFOA 1IEIA 3E49A 1XYFA 2J13A 4CCCA 1MYRA 2D2JA 1M65A 2E77A 1EXBA 1R7AA 4AIEA 1TX2A 5LIUX 4TW8A 6XIMA 2NWRA 3O8AA 3KLLA 1C8YA 4I5UA 4JDBA 5D33A 3F4VA 3L4TA 3TMQA 1OGGA 4A8NA 4DVOA 4B92A 3OIHA 1BQGA 2ITKA 1A5BA 4LVBA 5MKGA 3IIOA 5ABEA 5I03A 3W7MA 1GUVA 3B8TA 4L9YA 2I5QA 3TYEA 4AW7A 2Y5EA 4PMVA 2XP8A 5CJNA 3C0JA 5FA5A 4A8LA 5C2CA 3R2GA 5DIVA 1BFNA 4GOAA 3JVAA 4YN5A 3GKFA 5A1AA 4WEVX 3EMZA 1WCGA 1OWQA 2FJUB 1F6YA 3F03K 3WDIA 4CU8A 1OFQA 3AS2A 1H62A 1OFPA 1KRCC 1CIUA 1QPFA 2IQTA 3R94A 5FSEC 3VIIA 5F7UA 2OZ8A 5GPRA 4H01A 4UZUA 1NH6A 2C79A 1QNOA 2G5WA 1HQTA 3PZVA 4PBGA 5F1UA 3U4FA 5I24A 1TWSA 3CEUA 5EFDA 3SCRA 3UVIA 1FDJA 1ZGDA 1SZNA 1XPGA 1RA0A 3B9DA 2VYOA 3LUTA 1A50A 3E6EA 3VKAA 3WLNA 3IWPA 1W5OA 1VBJA 1YYAA 4CN6A 4FLSA 1HP4A 2IPJA 1XISA 5KSWA 1Q6IA 5CZSA 3NTPA 5D8ZA 4C1NB 4JEQA 2X05A 3B9OA 4C1LA 2PCQA 3RX2A 4A3RA 2YB4A 1A0CA 1R46A 1JFHA 1R3WA 4UTHA 4NZFA 4A3UA 4J3WA 1FP8A 3IJLA 2RHGA 1YMYA 3E38A 4X9SA 3NQBA 4PB5A 3PPGA 4XAGA 4I5RA 4RNFA 1E72M 5E0KA 1XIGA 4DY1A 4UTUA 4Z1YA 3MSDA 3HQOA 4XKMA 4X3ZA 3MWAA 3SI9A 1K9FA 5CBIA 4ADUA 1D7KA 1ROTA 4M29A 2VRJA 3UQNA 1TVPA 4HBKA 4Q8UA 4X0VA 5E1QA 2REQA 3EPOA 1EXPA 3RN6A 4PMYA 4HK7A 5AHIA 1P0EA 1FWRA 4DO6A 4ERIA 4R33A 2CITA 2V9DA 1NOUA 1KRAC 3VYLA 2W92A 3B8VA 3CEPA 4C6BA 4Z1BA 3T4WA 1K9EA 1VR6A 4W86A 2JIEA 3SY8A 1MQPA 4HU0A 1BYCA 3TQ0A 1KTNA 5D38A 1FUYA 1OYBA 2WC3A 1HW6A 3PBGA 4X9YA 3TTYA 1ONRA 4DLFA 3RRXA 1X1ZA 4FP1A 4HU3A 4Y90A 1UWAA 2W67A 2BVTA 2VFFA 3K4DA 2D23A 5BOEA 2HEJA 3QR1A 1W3NA 1E6SM 2G3JA 4IIHA 2ISDA 3WH9A 2VT0A 3ABRA 4N4PA 3LRKA 5E9XA 4I3GA 3A23A 3PZMA 4Z0SA 3TYAA 3HBLA 4D6HA 4CLMA 2HROA 5HWJA 5HNRA 2A21A 1B2YA 4DJFA 3KBWA 2ZR5A 3VGFA 2EPMX 1BSLA 2YLAA 5D05A 1K77A 1KXHA 4PBFA 4HNLA 3NQEA 3G8RA 5LGXA 5G4HC 1LM1A 3II1A 3B0VC 4O13A 4CCEA 3FA3A 2Y8VA 2Y89A 1EC7A 4GFIA 1O5XA 4OECA 1BXBA 1MFVA 2Y61A 2W27A 4LRTA 1CGXA 1XDLA 3RLGA 3GTXA 1VAHA 5FOOA 1EWDA 5BXTA 1E0WA 2VX5A 5FESA 3UWUA 1FKLA 2QGHA 2AL2B 1XC4A 2VGBA 3LPOA 4ZR8A 5DO2A 3H2EA 3GW3A 1FKFA 2DT3A 1H0GA 4H8VA 5TAOA 1JD9A 1EJSC 3QLDA 3AROA 1T8XA 3HG2A 4QIUA 3U4AA 1BF6A 2WC4A 3N13A 3GNOA 4K8HA 1SSGA 1O66A 3UR5A 1L6WA 1NP2A 3MJYA 3AHTA 2E09A 4LBUA 4ODQA 1TPEA 2DZBA 3F5KA 2VX6A 3LK6A 4OVXA 4LNYA 4LAVA 3V5CA 4A2RA 2HMCA 4BKNA 3C2YA 5CCZA 7CGTA 3ARPA 2XGZA 3LN3A 2C1HA 5CBJA 4JL1A 1AMYA 3S5SA 1OFDA 4U31A 2BVWA 2V69A 3ZM8A 1RK5A 1XFCA 5J5DA 3P60A 2FIQA 3WUBA 2OX4A 4X2RA 1QOQA 4QLKA 3DG6A 2P88A 2E7FA 1NWSA 2BHUA 1GKQA 3DFSA 1KM0A 3T40A 1SM9A 3LHWA 1U2YA 2G37A 4NJJA 4YS1A 1IT0A 2YXGA 2DZTA 4W5ZA 2OZ3A 1I2QA 3W1XA 4AVFA 3VU2A 3USZA 4E38A 1A3XA 1KV8A 2J7EA 3P0XA 4PSRA 5C5YA 3DCPA 1EEPA 4ZOBA 3I65A 4JFMA 3PHAA 1OSEA 2X0HA 1R9HA 1MI3A 4WVXA 6REQA 1PSCA 3CTTA 4GXPA 2VFDA 2C13A 1ISYA 1ZAIA 4GXWA 4O1FA 5C7VA 1ZPTA 3WH0A 4L4OA 3DHFA 3PANA 1AJ0A 5KINA 1D8CA 5I6SA 1V3MA 5DT5A 4QE1A 1EL3A 1JRBA 2LJ4A 3M9YA 3BARA 4CEUC 1QUMA 3QC3A 4ZQMA 1HL8A 4KWUA 2ZOXA 3RR1A 2TYSA 1E73M 1TJ1A 1E1FA 2Y7DA 3MUXA 1ZL1A 4S3EA 3R8GA 3W6MA 3CO4A 4XQ6A 3WNPA 4E3TA 1UOKA 1KQYA 3VINA 1BKHA 1T7LA 1QW9A 3IJDA 3ZR5A 2WBGA 4YHGA 1RBLA 1YE6A 3W7NA 1G9HA 3WLQA 3GIPA 3G3MA 1Y0EA 1TJRA 4ZXLA 3B05A 1NSJA 3P80A 3CYJA 1PE1A 2XINA 3AUJA 5ECVA 1C8VA 3EWBX 5HUOA 3CWHA 4D72A 1A3HA 3TC6A 2QDDA 2VCCA 5LA1A 2PWDA 3BCJA 4M82A 4AQLA 3IUHA 1JVWA 2JEPA 2A3CA 3G1RA 1H63A 4YTUA 1PWLA 4LVGA 5I7GA 3ES8A 5HK4A 3HF3A 2NVAA 1VFLA 5A6BD 3G1XA 5E93A 3L0GA 3BMWA 2QW5A 3EGJA 3O2LA 3E3HA 1I45A 1QNRA 3W24A 4YYCA 3AS0A 1WP6A 4C90A 4OKDA 1DKWA 4JGDA 5BW6A 4X60A 5FJTA 3THUA 4JFLA 3FOKA 3G1DA 5MF5A 1POKA 4BI6A 3HGJA 1TPC1 1YDOA 3BH4A 1KKRA 2D2HA 4RV8A 3R0DA 4MB1A 3QVQA 5BOOA 4UQ9A 5KITA 3NQ8A 4FN2A 3MA8A 4GC3A 4NAEA 2QDHA 1F9CA 1YTEA 2YCLB 4IXHA 1O68A 2Z27A 3UJ2A 2OFNA 2MUCA 1UR8A 4CD5A 4WDXA 1RPXA 2CW6A 5GNXA 1MW1A 3TQPA 5DT7A 4C6IA 1EP3A 2EPOA 4GY0A 3H24A 4UFIA 5EMLA 4RNHA 2FB2A 2PDYA 5FF4A 2JZVA 2YFNA 4FNQA 1GZGA 1X7IA 3KAGA 1X8CA 4HNUA 2K8IA 2QF8A 3A13A 1VENA 1FTXA 4RK8A 1FKHA 4HARA 4S2CA 4W9OA 1R7OA 3KE0A 1F8MA 1YXDA 4DZIA 1W6TA 3CAKA 2FMNA 4JIRA 1XBZA 5HJYA 2XWDA 2Y62A 4MADA 2OOFA 4H9YA 3AWNA 4I8DA 3MV01 3M1ZA 1ICQA 3R13A 1NDVA 3EPMA 4RPPA 3PNZA 5I00A 2V3FA 1WZLA 5ENLA 2R1NA 3VMPA 3KVMA 4H8UA 2PE4A 4JYFA 3ITTA 2BTMA 3SGZA 4V33A 2BGNE 1QU4A 3QMRA 5FEXA 5I3HA 4UMCA 3BMBA 4GIVA 4HJWA 1DEDA 4LNCA 4OT7A 3W1PA 3GY1A 4ONVA 1JF6A 4CVUA 2OZTA 4IPLA 4GI9A 1X1OA 3IGSA 2IF4A 3IK4A 3PP7A 3LUOA 5A5WA 3POCA 4Z0JA 2PAJA 1FBAA 3KFTA 1I2PA 4OZOA 3E2VA 2EPKX 1HGYA 3PA7A 4JNYA 5KEZA 4MF4A 1Q6RA 1J0YA 4UTWA 4RE0A 4DRMA 2ZZ2A 3O3RA 3XISA 3UY8A 4OV4A 3S47A 1WDDA 4AYGA 4KS0A 2ZXQA 1N55A 3S5YA 2NLIA 4DYEA 1PTDA 1OFOA 3WDJA 1ISVA 3WY1A 3VKKA 2Z1BA 3EOSA 3SR7A 3M43A 2BSLA 3SGGA 4Q8QA 3LTYA 1E1CA 4XBJA 2QCGA 4G7FA 3FY1A 1S1RA 4P8UA 2VD9A 3V0SA 4Z2HA 2PV2A 3GQYA 1B30A 3KVJA 2DQWA 1GYNA 3GPKA 3LERA 1YBQB 4AF0B 3M0VA 1EIBA 3CHCA 2DIEA 1QJWA 4JDYA 3LYEA 2VOMA 4DRPA 4E8CA 4NF7A 3EXRA 1OK6A 3W73A 2XJ7A 5JXQA 3EWYA 4AG0A 4TW6A 1NWTA 2UWFA 3RM8A 1H7RA 4I8YA 2CEQA 3KS5A 5GNYA 3WUGA 1TB3A 3TFXA 4TV5A 4ACYA 3U7BA 3T0AA 3IV8A 5CXPA 3DERA 4EANA 1FKRA 1JR1A 1CPUA 1PTAA 1R86A 4GKLA 3UQIA 4LXFA 3NL3A 3ZXWA 1HJUA 1V51A 4AD0A 4LBRA 2I9UA 4FLOA 3DAQA 4YTRA 3L23A 3F4CA 3RJXA 2CXGA 4GQBA 2O7SA 4HPHA 5CC5A 4QBXA 3ICJA 3E2RA 4Z42C 4IIEA 1ZU8A 3JW7A 3KZPA 4A4AA 1EA0A 4H2CA 2UZ9A 2OVLA 2VZUA 3OTRA 3TTOA 4AAJA 3K46A 3HQNA 3BAJA 3CLMA 1XP3A 2CCRA 4DJDA 1XV8A 2A85A 3W1RA 1ZCNA 1AK5A 3RO6A 2P53A 2J77A 5KZEA 2ZA1A 4RR4A 5HNNA 1TPUA 3BAWA 2Y7FA 5D2YA 4YWSA 5EMUA 2PWGA 1VJIA 3H12A 3P61A 5EMKA 2Z2BA 5BWFA 4J3VA 5D2TA 3B0UX 1VB9A 4AZ6A 3WKZA 3FYYA 3V5OA 2I5IA 1GYMA 2VCDA 4U2ZA 1G5AA 4GX8A 2ZVIA 2BV9A 4XISA 4AIUA 5IFTA 2J27A 4UQCA 4BF9A 1GWJA 1E1EA 5BRQA 3D5HA 1W1VA 2F9RA 4IMDA 4E4FA 4RDVA 4V1YA 7ENLA 1JCHB 3TSDA 4HNNA 3SIMA 3KL3A 3CS2A 2OTDA 3WZ0E 1Z9AA 2WMGA 4V2XA 4Q3MA 1CW2A 1XIMA 3AICA 1A5MC 2CNCA 5HBFA 3GXDA 1X96A 1OCBA 5JUVA 3I6TA 4M7SA 1I2NA 2OO6A 3F4DA 1UQYA 1XXXA 3NOYA 1Y0OA 2XVPA 1PKNA 4JD4A 4XZMX 2RDTA 4D8ZA 5F2IA 4B2DA 1TUFA 3MP5A 2F38A 2HE8A 2FH6A 2YL9A 5E5CA 5HMSA 5FF0A 4L61A 4O53A 1KC7A 2Z2UA 5D9NA 3PR9A 3IIVA 1GKPA 3KBVA 3JR2A 2BXYA 4FLRA 5A8MA 3E96A 4H7VA 2ZQUA 3O5EA 5BZAA 1U30A 4NKCA 4Q8VA 2C3ZA 1HXVA 3NJ3A 5AC7A 1Q8AA 3D3AA 3R0UA 3GRIA 4JIEA 3BPWA 2CERA 4L6HA 4N7QA 4MVAA 3MUAA 5CC7A 1TJ2A 2DZSA 2DG9A 2QJJA 1VIWA 2Q6ZA 1GJWA 1H41A 1Z3NA 3LCGA 4EVZA 4NXKA 4GK8A 4AISA 4GYKA 1TR9A 1WDQA 2VFIA 5IBXC 1PINA 1XKJA 1UD3A 5E0FA 2J7FA 1A53A 3V18A 4KGJA 3A6OA 1U5HA 4FMVA 4LUYA 1S3HA 3UZYA 4AYSA 1P1XA 3UCQA 5DXXA 1JDDA 6XIAA 2BXZA 1U79A 1FDZA 1IWAA 2QS8A 1R85A 3E0LA 4NRSA 5C71A 3GE7A 1US2A 1GZJA 4ML4A 4WDUA 4LC8A 3JZUA 4EAYA 1LBLA 3QY8A 4BEUA 3TYUA 3LENA 1ECQA 1OFAA 3PWAA 1HXJA 4XIMA 3TQKA 1TYGA 1H1NA 1U5JA 4CUCA 1KFJA 2DU2A 4N4QA 4US6A 1JUBA 4CQCA 2JBMA 5C2GA 2OFJA 2R91A 2G8ZA 2ZICA 4ZQOA 2D69A 5JBFA 4UFLA 3BWWA 1RPKA 3WQPA 4XZNX 1WZMA 4JFTA 3G6LA 4FR1A 3GR8A 1TIWA 3EWUA 3B7XA 2H9AB 4H9UA 5C0QA 4WD0A 3T0CA 1UWTA 4XZBA 1PUDA 4RX0A 4C6KA 2VFEA 4PMQA 4EPBC 3CH9A 4OUEA 1EDTA 3TYZA 4XK2A 1PZ2A 4E0CA 3ABXA 1JYXA 3UY7A 4I6KA 1S2WA 1E40A 2C0HA 2HZGA 1OQFA 3F2BA 4R7WA 1TKKA 2Z1WA 4AY8A 1Q6GA 2CWNA 1IHIA 2HPIA 2XTKA 1OEPA 4JHMA 3NXFA 1Q6LA 1W17A 2POTA 2WW5A 3WEZA 1HJQA 5HTGA 2E1DA 1HGWA 4MNLA 4BR1A 4M0XA 1BSIA 3WD1A 2V2HA 5CG0A 1WAUA 3VI2A 1IQ8A 4QJ5B 3MBFA 4U33A 2NSOA 3VNMA 4MYXA 3UCCA 2J62A 3K4WA 5FF3A 1LRQA 2W66A 4J2PA 1F8AB 2IKHA 3JU2A 2PD5A 5CZ0A 3VGBA 4PTWA 1H49A 3QQ1A 4R7OA 1ZJAA 4O14A 4Q4MA 2BX7A 1TV8A 4CNNA 1NJJA 4DUXA 2Y8KA 2KFWA 5HQEA 4F2BA 3G1YA 2Q09A 3U5YA 4RXFA 2IPGA 1LF1A 1SJCA 1GW1A 1WO2A 4XD5A 4DRSA 2PP1A 1H5VA 4UCFA 2QJHA 2Y70A 4HKPA 1A5SA 4PUDA 4Z1DA 2NT1A 4A2SA 4LALA 3LHTA 5DO8A 1P6BA 3PZ9A 3I3BA 4ZQCA 1V0LA 3DI0A 2VCBA 4HSHA 3D3FA 3BAYA 3AOFA 1K6WA 3GUGA 4QNEA 3LPPA 1MQRA 2WBKA 4RE4A 3GXPA 4K36A 4DZAA 4D1IA 1PYMA 3UXDA 4BEQA 2PDBA 1M1BA 4NYUA 5ABTA 2XP4A 4YIWA 1JAKA 4L5ZA 1RP8A 3MI2A 4E2BA 1FFQA 4XD4A 4LRSA 3G1AA 4GIYA 3RJYA 2Q71A 3JXVA 3OVPA 3B3DA 1IGSA 4MZ1A 1W2VA 4LW7A 4D2JA 1XRTA 1BKSA 4PL1A 4AFYA 1E4NA 3W85A 4CVWA 3LHVA 1DTNA 3OJGA 3UR2A 2E40A 1H7NA 4G2PA 1NDYA 4C6NA 1KV5A 2BFGA 4S39A 5GPGA 1MRQA 1JVNA 5GQBA 3QFWA 3MTWA 4LFYA 2JK2A 3DFYA 2R1LA 3ZMRA 1LRTA 4IISA 2VEKA 2WJZA 1C29A 2ZWZA 1Q2SA 2WJFA 1VKFA 2QLYA 1U5VA 3CAWA 1OADA 4BI7A 3L4XA 2QJNA 4JTCA 3WUEA 2G97A 3NZRA 3VCNA 4XZIA 1J96A 4NQ1A 2Q3RA 2PDXA 2A4AA 3GNPA 1J6PA 1FP9A 3UI4A 3ZJKA 4PN2A 1SZFA 4GX9A 3C4UA 3AYSA 3GTIA 1XIHA 3A4XA 3ZIZA 5FJPA 3ZR6A 4F9JA 2QDGA 4K8EA 1BRLA 2PURA 1O5QA 3STEA 3VD3A 3TLLA 4C65A 3WG6A 1LP6A 3POHA 2DG3A 4US5A 2V68A 2Z1VA 4DJFC 2ZXAA 1B90A 3NXLA 2CU0A 3WEOA 1TA3B 3O6YX 3TC5A 1Q66A 1W9VA 4RZ6A 3WCZA 5LNSA 2D0GA 3GVWA 4PZVA 4Z1AA 4O50A 2HS8A 5MHBA 4UOQA 5G1TA 3VFCA 2CLMA 5DXYA 1W3LA 1A5CA 2OT1A 3S1WA 1XLBA 4IQCA 3UNDA 3VIJA 2EPLX 1UC5A 4DIAA 3VKDA 3IGUA 3NPVA 3VNJA 4TTGA 4M80A 4NG3A 1ZK6A 3KRBA 2QGYA 5EB8A 5IXEA 4X0NA 1FCBA 1YNPA 5EY5A 1ITQA 3CMJA 3AYRA 3CIXA 4C6DA 1DORA 2WLYA 4MWAB 4ES4A 2GWNA 2TAAA 4L4PA 2ZBTA 3AZSA 1U33A 1PCWA 2W9MA 2ZX5A 3RMEA 1PDZA 4JPGA 5LNWA 1GTEA 3WQGA 2CKSA 2ZRVA 4GE8A 5T26A 1QMLA 2ZIDA 2ODOA 2VI0A 3FA4A 1ML1A 3CIWA 1K6AA 3AYVA 1XYLA 1BVZA 4N0RA 1P0BA 4XSLA 3H2MA 3S1GA 3Q58A 4HYVA 4FX8A 1JZ8A 2YA2A 2YBVA 1EUNA 5JIWA 1ZBCA 3UF8A 2XSAA 3BW3A 2QCFA 4JFKA 1YQ2A 2FFIA 1JI2A 4J40A 4OJYA 1W1IE 1W37A 1NIUA 3EWCA 3V36A 5I3GA 1W1ZA 3XINA 1TMLA 1NMWA 1AW2A 3FN9A 3W2LA 1HN1A 1PIGA 4RKAA 3ENLA 2NV1A 2YGYA 3MDYB 1ZP4A 2ACRA 4O57A 1XYMA 2BBFA 4YYFA 1SO5A 1KRMA 2V5BA 4CN1A 1HUVA 3WUFA 3Q65A 5I06A 4DWSA 4UDMA 1GW9A 4J9JA 1UR9A 3RPTA 3TA9A 5LHEA 3TSBA 4FF5A 3BZJA 1W0MA 1VPQA 3KHJA 3VOCA 4UOZA 3O5DA 3KRSA 1N8IA 3CYVA 4X63A 1ISXA 1IZKA 2BXVA 3V5FA 3VNZA 2QUVA 1E9IA 3GDTA 4QQ3A 3M0XA 3SADA 1UWQA 4DRHA 1MDLA 5FJIA 2P1FA 2ZA2A 3N6HA 4TYOA 1WOAA 1L0PA 5FD0A 2QAFA 3PZNA 2ON3A 2AQVA 4W5UA 2E8YA 4M24A 3CM4A 5A6AA 3UT0A 3EX2A 1LOSA 3MUCA 3DBNA 4DJFD 1JPIA 3AMGA 1PEZA 4L3NA 2CZFA 1L2QA 2ZUUA 1JCJA 1J79A 3IGHX 3LCHA 1FKJA 2WM0A 4E8GA 1V6WA 1ZSXA 3LZ5A 2VDIA 3I3DA 3TCSA 4AEEA 1ZJBA 2XVKA 1P1MA 4JR5A 4ASTA 1QHZA 1Q6FA 5FEZA 2HS6A 3Q4DA 2YCEA 4UFJA 3MI3A 1WV2A 2V3GA 5HWBA 4O10A 1FQ0A 3KAOA 1K9TA 4ORIA 4EF9A 1WZKA 3KBSA 1OIFA 1FKXA 4WSKA 4DO5A 2I1OA 3AIWA 4R34A 1XH0A 2YFOA 4H7ZA 3IGXA 4QS5A 2OG9A 4O17A 4MDPA 5G1MA 3KOFA 1WYIA 1M04A 2PC4A 2NQJA 1Q6QA 4JTDA 4XAPA 3DBPA 3WH7A 2YDSA 3KRZA 1IIHA 4A22A 3HPSA 4K7VA 7REQB 4Q4QA 3UCDA 4TX6A 3QPZA 3WK1A 4RCXA 3IJ6A 1WKYA 1DWAM 3N6QA 1N7KA 4QP0A 1Y5VA 4HCHA 2X1SA 1TELA 1JYNA 4CQDA 2O92A 2QAPA 1MNSA 2XIJA 4ERGA 1CGVA 2VEIA 2Q8LA 1RHCA 5EU9A 5A6TC 3H8AA 2CFFA 1PKMA 3NZQA 4F66A 4ATDA 3KBNA 4ICNA 5AYIA 3RCNA 3ABZA 3TR2A 5AKQA 3ZT5A 2YA0A 2RUQA 3EXTA 1AQFA 4IQLA 1YHTA 1WDWA 3ARSA 1Z7AA 2XFWA 3IRDA 1FA2A 2I16A 4Y9AA 1E6XM 5HJLA 1XH2A 3SN4A 2Q5AA 3LV6A 5AC5A 2AKMA 1FH7A 3T81A 3W3OA 1Q6EA 3TW7A 3WFLA 3LM3A 2INEA 5FJUA 5C9WA 2M08A 3AWOA 1RD5A 1ZAJA 1EQ3A 1ME7A 1BYDA 1MO0A 3VUSA 4CD4A 1CGWA 3LCWA 1TPH1 1UUQA 2WMHA 4DB7A 3WF3A 1UH2A 2KAUC 3H53A 3IJIA 3GTNA 5B7YA 3AXHA 1QHPA 2O55A 3GU1A 4QDPA 3F5LA 3VOHA 4HNVA 1XUUA 5CPLA 5CZKA 3IRSA 4MY8A 3LCIA 2ADAA 2J78A 1IXQA 4B4FA 1VCVA 3OQ8A 5I3JA 1MW3A 3P8JA 2Z29A 1OZQA 3OBEA 3SW6A 4YHEA 4C7GA 3V0UA 2KGJA 2GJXB 5AZ0A 4UTTC 1Q7ZA 4PGLA 3LG3A 4UFKA 5JBDA 2QJIA 8A3HA 5I2UA 5C9UA 4Q7IA 3FVMA 2FYMA 1DP0A 4KPLA 1ZALA 2HRWA 2GGIA 1AH3A 4H00A 3SSJA 4LAUA 5CGTA 1HJXA 3UETA 2X1RA 4B90A 4OQVA 3DEQA 4EP8C 5FKYA 2PD9A 1XBYA 1ZAHA 1VLWA 3Q67A 3GZ3A 4U86A 1R2RA 3U9IA 4MM1A 3VGHA 3NQGA 4QT2A 2BLEA 2A3AA 2X7VA 4GUIA 4DNHA 1IR1A 3TE9A 1MW0A 4MB4A 1FWFC 3M0HA 4JTSA 2ATMA 1LG2A 3GDLA 3AS3A 1YDNA 2VQUA 2E6DA 4F0LA 1BEUA 1JEZA 5LXEA 2Z0IA 5CQ1A 3QXBA 1SQ7A 4XZLX 2DSKA 3AXKA 1TMQA 1I1WA 1DL3A 1EP2A 3GTFA 3QR3A 2JQXA 1KFEA 1E0XA 3QV6A 4IP5A 4JYSA 3H55A 4KWWA 3BUVA 4XAYA 2HDJA 2NVCA 1MEIA 5H8MA 3RF9A 2CHOA 2PU1A 4NY2A 3KDNA 1WDRA 1KLZA 1KD0A 3NSMA 2WSKA 3OLEA 5FJOA 3EMQA 2F2KA 1YDYA 1P7TA 2FKPA 3IJ8A 3U0HA 3BW2A 4O19A 4XUYA 5A2BA 2EJAA 4HN4A 1ZP3A 3IPWA 2Y24A 2Z24A 4HNOA 3IVTA 3PG9A 4H9XA 3IV3A 1QASA 1XPYA 3I10A 2UZ5A 4IICA 5CBBA 2O9PA 3TU9A 1J4EA 4H41A 2VCAA 1S3TC 2FAPA 4NJKA 3RITA 1JXJA 2FH8A 1AH0A 1LLZA 3T8LA 4FO4A 1GYLA 2FJKA 2O9RA 4MWAC 4KEMA 3DFQA 4GISA 3GC5A 3DHDA 3RLVA 1IEVA 5AHLA 2I56A 3H7UA 4YTTA 1X6LA 4NJIA 4B3KA 2X2GA 4M1BA 2VDGA 5HPCA 2Y88A 4S23A 2PRHA 4ZQPA 4LB3A 4UR9A 5DMLA 2P8CA 1GOKA 1UD5A 1JG9A 3IJ7A 3NM3A 3C8NA 1W9PA 1UH3A 1B0IA 1TWDA 4KR0B 2ZCGA 4L6OA 4L9XA 1F2JA 1TO3A 4FOKA 5KTLA 1CXLA 4DWDA 2WNNA 1S5MA 2OYMA 1JL8A 2VJXA 1PTGA 4QE4A 1CCWB 1RSCA 1DXFA 3GXIA 3GVGA 3W38A 4QJ1A 3QQWA 3LNPA 1EJVC 1E4LA 5D9PA 4YTQA 3LXAA 2WCAA 1S5TA 3BQ5A 4RDZA 1V02E 2ZRYA 3ABOA 4ZOCA 2VFHA 2GQ3A 3WF4A 1F07A 3CUGA 4R27A 5EBAA 3GXMA 3ZWSA 3ANUA 3KTCA 3MP4A 1PBGA 3LCLA 4IFKB 1C92A 2PB1A 2GGGA 3VIKA 2Y6ZA 4GUJA 3EYPA 3OYZA 1IE7C 3ABSA 5DCEA 5D9MA 1H7WA 3DU0A 3WO8A 2A1YA 3TZFA 2CLIA 3R79A 4WOQA 1MWOA 4O16A 4TQTA 4NZ1A 3A9BA 1YXCA 3W27A 1H0IA 2QJGA 2GVLA 3P5YA 5AZ1A 1LQAA 3NQ2A 3PJTA 1RQBA 1OGBA 3EWXA 2VN1A 1V6YA 3CUIA 3C0SA 4Q6JA 3W23A 1EDQA 3V1HA 3H7RA 2AL1A 1NWRA 1ADDA 1ICPA 5A3HA 1W5QA 4AXKA 5TQLA 4RNIA 2E1WA 1VBHA 5DQPA 4S2BA 3NFUA 1J10A 3QN3A 1UR1A 3TNBA 3C2EA 4CU7A 3YPIA 1FWIC 3T78A 3ITCA 2PSNA 2NUXA 4JFIA 2ACSA 3AMDA 4IJCA 3RYSA 1HX0A 2BG5A 3H2AA 1E4IA 3RLHA 3NZ1A 1XLJA 3FXGA 1RD6A 2MLXA 2HXTA 1QW7A 4L56A 1BVWA 1W9DM 4O0ZA 3GG8A 2ZZ7A 1B4EA 1EOKA 3N2OA 3TCEA 2XUCA 1AQMA 4PRWA 5DANA 5DELA 4AZCB 1FWGC 2VELA 1V79A 1U1JA 3H54A 1JGMA 2OMAA 3ZT6A 4QLLA 1WUEA 3UBPC 3ALGA 1G1YA 6A3HA 2CZ5A 1QNVA 3UA3A 4N19A 2GFTA 3EIPA 3BGJA 4GZJA 2RUCA 2ZRWA 4JZ5A 4WUIA 3W2KA 1UMYA 3STFA 1X6NA 2OEMA 3BG3A 4JXCA 1Q65A 3ARYA 5I77A 4JTTA 5I3DA 1DIOA 1EQCA 3MI6A 1GVEA 3QQ0A 1ODZA 1F73A 4QROA 2R1KA 3VNDA 4I7UA 2E25A 2AKZA 3U48A 4DI9A 1EKOA 4QCEA 3AZRA 4CNUA 4DJED 4XD3A 1CT5A 3DHPA 3KOWA 3WF1A<