4Q7NA

Crystal structure of the complex of buffalo signalling protein spb-40 with 4-n-trimethylaminobutyraldehyde at 1.79 angstrom resolution
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex of Buffalo Signalling protein SPB-40 with 4-N-trimethylaminobutyraldehyde at 1.79 Angstrom Resolution
rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 129
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4q7nA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4q7nA01
1IT0A 3CZLA 2J7GA 1Q6FA 4W8LA 1EHAA 1OSEA 4JAWA 1ZBWA 1GHSA 1W2PA 4TTUA 5EFFA 1Q4NX 5HOSA 3A4AA 3VKKA 1JZ5A 1V08A 2WHKA 4PCTA 4DWSD 2FDMA 1XSKA 2CEQA 1Z32X 2J7BA 4UOQA 1E5NA 2IXUA 4Z2GA 3N17A 2G3IA 3VVGA 5I24A 1KGXA 1BYDA 1QHOA 2IXVA 4DUVA 1NWSA 4A3HA 4C7GA 5DO8A 4TOQA 1KFWA 3BSGA 2BS9A 5AYIA 4GKLA 1ISXA 1C92A 4BS0A 2X1IA 3FNDA 3OG2A 1FOBA 2PF0A 1S46A 5D9OA 1E0WA 1U30A 2D3LA 4HU8A 1UWTA 1JZ3A 1MW3A 2D24A 2VZOA 5GNYA 8A3HA 1C7TA 1CDGA 4E8CA 4WKFA 3B9EA 4ZE4A 5I2UA 1BYBA 3IJ7A 3T0AA 1FHDA 3MV01 1RP9A 4M80A 4QFUA 4GQRA 3K4AA 2YLAA 3AISA 5M3WA 3WQ4A 3ZSSA 1HP4A 4Z2JA 4MB3A 1HJQA 1LF1A 3MUZ1 3AIQA 3CZJA 3AIRA 2FH6A 1RP8A 1UOKA 1JF5A 4ZFMA 2E9LA 3W26A 1HKJA 3G6MA 3L2LA 4UQCA 2YDQA 2DIJA 1PJ9A 3FN9A 4JFWA 4AC1X 3WD4A 3RIKA 2BNJA 3PTQA 4Y7EA 3VGGA 3VIOA 1NOWA 3W0KA 1WZLA 1SYTA 2DSKA 5A3HA 2QMKA 1E3XA 3IANA 1ZB5A 3UCQA 2W67A 3VD9A 5EMYA 2Z1KA 1KB3A 4IPNB 1TFVA 4UFLA 2VZSA 8CGTA 2YDRA 2QF8A 3PZNA 4ACZB 2VX5A 3L4TA 3RDKA 4B9ZA 3VIHA 3CMGA 5CSUA 2WK2A 3K8MA 1J9YA 1E6PA 3LPPA 1JXKA 1UHVA 1V0LA 2UWFA 5D9PA 1VENA 4UFJA 3WDIA 4D1IA 3PZ9A 3VINA 3N04A 3AHYA 5A1AA 1QBBA 3U5UA 3WUGA 5A6LA 2E4TA 2YA0A 2XFRA 2J7EA 1KCLA 2E8ZA 4PMZA 5ABEA 3RCNA 2J7DA 4MDOA 4PMYA 1GZJA 3W6MA 4M8UA 2EPMX 3CHDA 3IJ9A 1CPUA 3RJXA 4NSBA 2WLZA 3WFZA 2EXOA 2V3FA 1CXLA 1GPFA 1XH2A 4LYPA 3FXYA 2D23A 2GUYA 1CGXA 1IZKA 1JZ4A 1JDAA 2XJ7A 4PUEA 1TUXA 1B90A 1JYVA 4AZIA 3AOFA 1E40A 2VTFA 3RM4A 5A94A 1TA3A 1V3HA 2OSWA 1TCMA 2ZUNA 4A3YA 1RPKA 3AMGA 2C7FA 5BRQA 5LA2A 1V03A 3WUBA 1BSIA 5IFPA 5JBEA 1CGUA 1PX8A 3W81A 3CUHA 4MNJA 1MQQA 1XSJA 3AJ7A 3ZOAA 3AXIA 2DSVA 1E71M 1GVYA 2VJXA 1CGTA 3A3HA 4JFTA 3VU2A 1DWJM 1BHGA 1UH2A 3VIJA 1UD5A 3KZSA 3POHA 5BCAA 2BVDA 3VMOA 4H8HA 2XFFA 1LL4A 2O9RA 3MMDA 1XD0A 2JIWA 3MMWA 2VZVA 5A6BD 3AMKA 1UG6A 4ACYA 1EDTA 3MANA 1QNQA 4CUCA 1NM9A 1W9PA 5E70A 5JIPA 3AZRA 3UR7A 2O9PA 3HMCA 1MXDA 2BXZA 1QHZA 1OT2A 3VX1A 1B0IA 2OWCA 3CZEA 5CJ5A 3B9DA 1H11A 3NSMA 3BC9A 4JL2A 2YL8A 4D6DA 5I79A 1HJUA 1E43A 2FHBA 4CD8A 4F9DA 4QDMA 3SCUA 1M7XA 4KGLA 3W25A 2FGLA 5EB8A 5M03A 2VL4A 3PN8A 3A4XA 3WEZA 4F9JA 3N18A 1OGBA 2PWHA 3BXWA 1N82A 1NOFA 1WNOA 4U33A 1VB9A 4DUWA 2YA2A 3VD3A 1FP9A 1DWFM 3FAXA 1CYGA 4J3VA 1QI3A 1BVNP 1Y7VA 4MNMA 5I3DA 2GJXB 5A2AA 1JL8A 9CGTA 4FF5A 2UY2A 4BF7A 3VIKA 1J0HA 2YBUA 3VNYA 3F5KA 4Q22A 2VX7A 1UQYA 3L4WA 3PZUA 3CLWA 1U33A 2CHNA 4WF7A 1JD7A 1SMAA 4BZYA 5IXEA 1D3CA 1V02E 2G41A 3ZJKA 3DYOA 4CD7A 2XTKA 3BAIA 4HOWA 1QI0A 2WHJA 2Y5EA 2XVPA 4TX6A 1V6WA 1GUVA 1JXJA 1JAEA 3LPFA 4TXEA 1H0GA 3ZM8A 1NP2A 4IPLA 4FK9A 5EFDA 2DGAA 4M81A 4HU0A 2D1ZA 4B3LA 2WSPA 3WNOA 3AROA 4UOJA 2A3AA 1I75A 4QCEA 3CBWA 4JL1A 2WCSA 2X09A 1UA3A 2ZXBA 4LYQA 7CGTA 4L4OA 1IV8A 3GH7A 2ZIDA 1UZ1A 4W86A 1E6XM 5GNXA 1SFSA 3MSGA 3WBAA 2HISA 3FAWA 2FH8A 1KR1A 1OIMA 4D6CA 5A6BA 2F61A 4UFMA 3BAWA 1G5AA 3PZIA 4AY1A 3OLIA 3UG5A 3GBEA 4CN6A 5DT5A 2DT2A 4AZBA 3RMEA 4HA3A 1CXIA 3OLDA 5A6KA 5CPQA 2WVVB 4UQAA 1FFRA 2V38A 4C7DA 1TE1A 1MVYA 1YHTA 3SCPA 1WZMA 2ZX5A 3WN6A 1ZU8A 1A3HA 3KEHA 3NUKA 4PTXA 3G6LA 3W82A 1D2KA 1WKYA 3BGAA 2G4FA 5CPTA 1JZ6A 1V02A 2XVLA 3VM7A 4AEEA 3PZMA 3T2QA 4HZ6A 3U57A 4D1JA 3DHUA 4ACZA 3RO8A 1LL7A 1CGWA 4AD3A 2VI0A 3L4VA 4UQEA 1WZKA 1RD6A 4OBSA 2J75A 2OYLA 3F5LA 1CTNA 1UKOA 4Z2HA 1GOQA 3AI0A 2WMIB 3VO0A 2WCAA 1ZJAA 3ALGA 4DWSA 2BY1A 1ZBKA 4OOZA 5DFAA 2YOCA 4DWSB 1A47A 1BYCA 2CNCA 2X0HA 1VAHA 4C7FA 4J27A 4U3CA 1J01A 3N1AA 1KGWA 4P7NA 3T0BA 1XSIA 3APGA 1CEOA 2WMGA 4KRTA 1OB0A 4R27A 3AS3A 5IFTA 3GXIA 5CGMA 3E1F1 3AZTA 2BHYA 3CUGA 3AMCA 1J0ZA 1JYNA 2VQUA 3L4ZA 1QI5A 3UR8A 4NRSA 5IHRA 4AZ5A 4AD5A 4UQ9A 3AHZA 1X6NA 1E0VA 1QI4A 1MXGA 5A8OA 4J3SA 1W2VA 1DWAM 3GBDA 4UR9A 3VOCA 5DEZA 5HBFA 2DH2A 4HMCA 1JGIA 1E56A 3L4UA 2XSBA 1K9EA 3BMVA 2E0PA 4J3XA 3W37A 5CPSA 2WMHA 5CQ1A 1JG9A 4F79A 5IDIA 2GJRA 2XYLA 1HJXA 1XYZA 3N9KA 1B3ZA 1KBKA 1BFNA 3AIVA 1YQ2A 4PMVA 5CXPA 2JEPA 3M07A 1W9VA 1QW8A 4XB3A 4ZXLA 3EDKA 3QGVA 1JZ8A 2DSWA 5JIWA 1BPLB 1W1PA 4GZIA 2OWXA 2YA1A 3GM8A 4W87A 2X2YA 4B3KA 4WIWA 1WCGA 4YHGA 4PYSA 3A6OA 1HJVA 1MW0A 1OGGA 2WSKA 3PBGA 1E4LA 5I77A 4U31A 2CETA 4PN2A 1WP6A 3F5JA 5E0CA 4BQ5A 1B3WA 1QVBA 2BY0A 4J3TA 3ARSA 5A8NA 2PI6A 1KXTA 2YL6A 3ZT7A 3NJ3A 5KZ6A 4D6IA 1KWKA 3W38A 1PBGA 2GDUA 2NW0A 1J10A 1Q6EA 1E9LA 1C8YA 2WCGA 2BFGA 3MU7A 1R7OA 3PTMA 2JF6A 4OZOA 3WNPA 4AXNA 4M56A 1UKSA 4CVWA 4HP5A 1FHLA 3NDZA 1Q6GA 3AFBA 4L4PA 2BHZA 3I3DA 4IISA 3OBAA 1UWSA 3AYSA 3VGHA 4NI3A 3ARTA 1JZ7A 3WUEA 2V5DA 2WHLA 2OYMA 1C91A 2WVUA 2QPSA 3VMPA 2G3MA 4AEFA 6A3HA 3FW6A 3AIEA 1E6SM 1LJYA 1HF6A 3AZSA 2Z1SA 3IAPA 5ECUA 3TTSA 1CECA 5JBDA 2OLHA 2W63A 2J25A 1CWYA 3CUJA 5D8WA 4JFUA 1F4HA 3PZTA 3II1A 5HDRA 3VUPA 3ZQ9A 4D6EA 4W7UA 1EQCA 3K1DA 4HA4A 1DTUA 3AS0A 1PZ3A 2WC3A 3BAXA 4X0NA 2MANA 3SCWA 3ZT6A 5E0FA 4CCEA 3WNLA 4TVCA 1UR2A 5A8QA 2AMGA 5A69A 3VGFA 3NSNA 4WSJA 3WNMA 3ARQA 1HKKA 1NWRA 1JDDA 3OGSA 4HMEA 4UFKA 2EQDA 1GOKA 1FFQA 4W93A 5BRPA 4UQBA 2WYSA 1ISZA 1JD9A 1ODUA 3WH5A 3EYPA 3A4WA 3W28A 5HNNA 4H8VA 4DM2A 2GDVA 3RM8A 3O9NA 2XM1A 1UR0A 2FHFA 1JZ2A 3MUY1 4PMXA 1FA2A 4W8AA 3RPMA 4AMCA 1HNYA 1FH7A 3W24A 4ATLA 1CLVA 4GZEA 2WLYA 1GVIA 4OOUA 3EDFA 1GOIA 1WZAA 5A6JA 1J0KA 1J0JA 5FD0A 1G9HA 3UG4A 4E8DA 3VIFA 1TVPA 2E9MA 2ZUWA 3S6TA 3VD5A 3K46A 4D71A 1KCKA 1M01A 2QHAA 1RH9A 1UH3A 1XH0A 3PZGA 2WC7A 3VIGA 2EPKX 1KXHA 3WH7A 3GXMA 2J74A 4V28A 4J3UA 3ZSTA 3ARZA 1Q6DA 1GQJA 2WZHA 4TUFA 2G3JA 1GJUA 5GNZA 2Y2WA 3U7VA 2VZUA 3MSDA 3RM9A 2GK1B 1JYWA 1WDSA 1HT6A 2QMJA 3AS1A 2VRJA 1HVXA 4EAMA 4KGJA 3POCA 2VURA 3CHFA 4B9YA 1R86A 2Y24A 3QOKA 3EDEA 1ZS2A 3MV11 1UWIA 2G8ZA 4EE9A 1B3XA 4ATDA 2CBUA 3THCA 3PHAA 2DSUA 1R85A 2XVGA 4D72A 2CBJA 1SMDA 3SCQA 5FOOA 1E6QM 4LPCA 5GQBA 3NDYA 4YN5A 2VCAA 1U2YA 1UD6A 4OBRA 4W84A 3CH9A 3M46A 3AXXA 4MDPA 3SCVA 4PSPA 4JCMA 2PBGA 4HPGA 2BY3A 3TTOA 2D3NA 2BHUA 2DDXA 5ABHA 4HPHA 1TVNA 3ZIZA 3EMZA 3OGRA 2WWDA 2UY4A 3L2MA 4JKMA 1GQKA 2XFYA 3WIJA 4WLCA 1UD3A 2V3EA 3HJEA 3SUVA 1SR0A 4IUGA 3GNOA 2F8QA 3AIBA 3VD7A 4Q7NA 3WD2A 4UZSA 3ZJ7A 4QLLA 3TP4A 1UR9A 1V3IA 1V0MA 3LPOA 1CGVA 4Z2KA 3WF2A 4YHEA 4NRRA 4GIAA 1C7SA 2WKLA 4PSRA 2WVSA 1CLXA 3BCFA 1W9DM 3SEPA 4GO8A 1DWGM 3BCDA 5E9AA 3ARVA 2Y4SA 4URIA 1W32A 3CPUA 2XG9A 4OUEA 2ZUUA 1W3HA 2ZE0A 3N15A 2X05A 1HIZA 5JUVA 2DSZA 1W1VA 5DT7A 4ATWA 3RJYA 2ZOXA 3CMJA 1I1XA 4BQ2A 1EQPA 2J8FA 2CBIA 3EMCA 4K68A 1V3KA 1B30A 2ZICA 2X8RA 2ZUTA 2VQTA 2J8GA 3ZJ8A 6TAAA 1OBAA 4TVDA 2WC4A 3HU7A 1M53A 1E55A 3WF4A 5A8PA 3WF1A 4WKAA 3WY1A 4N0RA 2YL5A 3EDJA 2PBOA 3CUIA 3ZJ6A 1H4PA 3AHVA 3VD4A 1E73M 3B8SA 2YBTA 4PTMA 3CZ8A 4J7RA 3UEQA 2J7CA 4UTFA 4UZUA 5BYWA 1KBBA 4WKHA 4XZWA 1B3VA 2V5CA 2J79A 2BVTA 2E3ZA 1E4IA 5AC5A 2CKRA 5BXSA 2NT0A 3WMSA 1XRVA 3LPGA 4J3WA 2XWEA 1VEOA 2OSXA 1C90A 1US2A 4PBGA 3EBVA 1MFUA 5LA0A 1BGGA 1G1YA 1XYFA 4D6GA 2PWDA 4CGTA 4AIEA 2WMIA 2ZX7A 1UA7A 4PTWA 1JFXA 1HP5A 3OLEA 1DWHM 1WAWA 3WQVA 5KEZA 4W5ZA 1K9TA 3DHPA 3ARRA 4JZ5A 3TA9A 3T0DA 2VNCA 2RGLA 4GI6A 1BGAA 1L8NA 2W5FA 2BXYA 1QHPA 2CKSA 4LQ1A 5A8MA 1E1EA 4CCCA 1XHGA 2VCBA 1LL6A 5CGTA 3HN3A 1E15A 2EJ1A 3BLKA 1W91A 1WDPA 4AYSA 1EDGA 1LWHA 1WB0A 4B15A 2D0GA 1J12A 1EO7A 1LG2A 2CIPA 3U5YA 1G94A 3BSHA 5BXRA 3GDBA 1UKQA 4BCEA 1DHKA 4P8XA 2DT1A 2GSJA 4W89A 1ISVA 3QHOA 3ALFA 3CHEA 3UG3A 3WNKA 3B9AA 2WB5A 4MADA 3BMWA 4MNKA 1UUQA 3KE0A 3IK2A 2C0HA 2D0HA 4BQ4A 4PCSA 4J28A 1QNOA 1KQZA 3KL3A 3VNZA 5I23A 1GCYA 3BH4A 1KR0A 3SCRA 3VILA 4GZJA 4GPNA 4GI9A 3SCNA 4E2OA 1NWTA 2CERA 3WQ8A 3OLGA 1QNPA 3MUIA 1V0KA 4FLSA 3WBEA 1E4NA 3PTKA 1UYQA 4JHOA 1OCQA 1NQ6A 2XWDA 3TONA 1TZ7A 7A3HA 2W62A 1V3JA 1WE5A 5A6SA 1V3MA 5A6MA 3WL1A 2VR4A 3VDBA 1VIWA 3AMLA 1UKTA 5E6YA 1W9BM 2W4XA 4AZHA 3NSXA 3WMBA 5C8BB 5FL1A 2PB1A 1WO2A 2Y8VA 4CKQA 3WQWA 2JALA 1J11A 1NOUA 4P7OA 1TMQA 4AIUA 2J77A 1F4AA 3L4YA 1UH4A 2VC9A 1EA9C 1PEZA 2UY3A 3WF3A 3J7HA 1UWQA 3NIYA 2J78A 3VIIA 4CN4A 1BAGA 4M82A 2JEQA 1GORA 3VGBA 3VGDA 4M29A 2HVMA 4PMUA 1DP0A 4RE4A 4H04A 1MW2A 2EEXA 1XC6A 1V6VA 2F2HA 3WEMA 4HA1A 2YJQA 4U2YA 5AY7A 1OGSA 3MO4A 3WNNA 4KMQA 2G3NA 2BV9A 3KL0A 1B1YA 1H41A 4F66A 5I5RA 2EPOA 2EPLX 3K8KA 3GYCA 3T08A 2NT1A 1W9UA 2BY2A 2WMKA 1ZBCA 4CVUA 3IJ8A 4TTGA 1GOMA 2JE8A 4NZCA 1E6NA 2PWFA 1NWUA 3OB8A 4GXPA 4AWEA 3OA5A 3WSUA 2A3BA 1UD2A 1UD8A 1VFFA 2YL9A 3WDHA 3FY1A 1ITCA 3WQ6A 4AD2A 3QR3A 5ABFA 2VVNA 1VEPA 1GHRA 1H49A 3CHCA 2GVYA 5ABFB 1OD0A 4RE3A 5I78A 1QBAA 3BLPX 2C8NA 3AXHA 4UQDA 3L4XA 2DEPA 3GNPA 3TTYA 1EGZA 1I1WA 2D0FA 5E09A 1E0XA 2WM0A 4U3AA 4N42A 4PRWA 3ZT5A 5C70A 3ARYA 2V3DA 2XIIA 1HXJA 4KRUA 4PMDA 3DC0A 1KGUA 2XGIA 1NARA 4P8UA 1AQ0A 3WL0A 4GINA 2VO5A 2XVNA 3N11A 4MAZA 1E1FA 1E70M 3WQ5A 2J4GA 4AD4A 2DQXA 3UESA 4HZ7A 5BXPA 3JUGA 2OSYA 4TX8A 4QAWA 4XV0A 1E3ZA 3SCTA 2QV4A 3WEOA 3ZO9A 1J0YA 1OIFA 4XX6A 1QW9A 1ISYA 2CITA 2VZTA 1VF8A 2CHOA 4WK9A 5FCZA 3TOPA 2YIHA 1GNXA 4S3KA 1LG1A 1TG7A 2WBKA 4E4PA 3ZR6A 1PX3A 4UOZA 3W4RA 1VJSA 3CGTA 1H0IA 1BYAA 5AC4A 3GXFA 3CO4A 1NP0A 4V27A 2IUZA 1UD4A 2ZUMA 4UCFA 4PMOA 1FP8A 1B2YA 1VFUA 5A2BA 1ECEA 4P8WA 2VRKA 2CPUA 1DWIM 7TAAA 1P6WA 2WMJA 3SIMA 1CNVA 2UY5A 2WZIA 4H41A 3SCOA 3T2OA 1EO5A 4KH2A 2XSAA 1H5VA 1H09A 1BTCA 3PZQA 1CGYA 3WDPP 4OIFA 4JHZA 2CCRA 3EDDA 3F4VA 2W91A 1QNRA 4JFVA 5LA1A 4H2CA 3WDJA 1AQMA 3WF0A 1HVQA 2Y8KA 4D6JA 4PMNA 1CENA 5M17A 1XV8A 2OWWA 2EO7A 2WMFA 4H7VA 2ZXAA 3VMNA 1OINA 4M24A 1CBGA 5D4YA 2ZXQA 2W66A 2B31A 2W61A 1VFOA 2FHCA 3MMUA 4GI8A 3SUWA 2QPUA 3DYMA 1E72M 1HL8A 3GNRA 3M6DA 2DIEA 1E6ZA 1LQ0A 1R87A 3OZPA 4FLQA 1AQHA 2RGMA 1CXFA 2O9TA 3LMYA 5AYBA 1MQPA 1CXKA 4AZCA 3QHMA 5D9NA 3W27A 5JBFA 1KXVA 4FMVA 1MYRA 5D9MA 2WVTA 2VX4A 3ARWA 4IM4A 1PAMA 1V6UA 5LYRA 2WBGA 5HPOA 4MAVA 1BVZA 2E40A 1QNSA 4CD6A 1OM0A 3AICA 1EHNA 1H1NA 4W8BA 2CBVA 4TVUA 3M7SA 3MS8A 4CU7A 2AOSA 1QPKA 2E8YA 3QHNA 1XCXA 1HL9A 3ARUA 2O92A 2YKKA 3ARXA 4RE2A 2NSXA 2Q8XA 1PIFA 4P7QA 3ZMRA 4P8VA 1W3KA 4CU6A 3VDAA 2TAAA 5ABGA 3GXDA 1UR1A 3WMCA 1KXQA 1HJSA 3W53A 2QLYA 3AHXA 3PZVA 1QI2A 2J62A 2ZUVA 3THDA 1ISWA 1GJWA 3CTTA 3FHAA 4YPJA 1VBUA 2VR5A 2E9BA 4XUYA 1W1TA 2ZX9A 4AZGA 4S3JA 3WDQA 3WD0A 1WDRA 1FH9A 4MNLA 4BA0A 2XUCA 1PZ2A 5M5DA 3PZOA 1JF6A 1KQYA 4ZE5A 1L0PA 5BXTA 2EPNA 3O6AA 2A3HA 2DH3A 3OZOA 2WHMA 3FHQA 1JNEA 2VMFA 3CUFA 1M03A 3WD3A 4BQ3A 1X6LA 3I3BA 2YDSA 1R7AA 1OD8A 4EK7A 4AZ7A 4U5KA 1C3FA 1E6RA 1ODZA 4PMQA 1M04A 1O7AA 4D6HA 3K8LA 1GOOA 2GFTA 2VRQA 1CXHA 5CSYA 3SUSA 4AIOA 3SCSA 2BVYA 3VDCA 2WKGA 2J7FA 2XGBA 4QLKA 1XCWA 3NYDA 4PEEA 5A2CA 1JNDA 1B31A 2D20A 1GONA 4AD1A 1JFHA 4AD0A 3VTRA 2VX6A 3W6LA 2V3GA 1GOWA 4LXFA 1US3A 2OYKA 3OGVA 1C8XA 3SUTA 3AIWA 2ZWYA 3AHTA 1ESWA 1XGZA 3AMDA 2GJPA 4MJ2A 2FGZA 1HX0A 1QOXA 5A95A 5CZKA 2A3CA 1GQIA 3NCOA 4DM1A 1K9FA 2EBNA 5FKYA 1WPCA 3WELA 1XH1A 3A47A 2A3EA 1V6YA 5JH8A 3BAJA 4JKLA 4F8XA 1HN1A 3VM5A 5I6SA 5DF0A 4PTVA 4WSKA 3W29A 1B9ZA 4P7RA 4JFSA 2PC8A 3UETA 3KL5A 1EDQA 4GQQA 5D8ZA 2D2OA 1XD1A 3SUUA 1PX4A 3MKKA 3BAYA 1LLOA 4UFHA 2ZWZA 4DUXA 2CXGA 3GTNA 4W7WA 1PPIA 2VUYA 3N13A 3WFLA 4WJXA 1UR4A 3KWXA 1W1YA 4R5EA 3QOMA 4HOXA 5TD4A 1V3LA 3WH8A 1K6AA 4FLRA 3ECQA 5C71A 2AAAA 4DWSC 3BAKA 4FLOA 1VEMA 3ZR5A 4W88A 4CCDA 2JF7A 4W85A 5E6ZA 4Z2IA 4GO9A 1UWRA 4CD5A 3WUFA 4MB4A 1AMYA 2WXDM 3RILA 3VPLA 2ESCA 1VJZA 4AZCB 2JIEA 2XM2A 4A4AA 4CN1A 1CIUA 1X1NA 2WW5A 1MWOA 2DPEA 3WENA 4UFIA 1UZ4A 4U5IA 3N12A 3I3EA 4LX4A 3VGEA 2O9OA 2WANA 1UR8A 1VBRA 4B16A 1BG9A 1V0NA 1GQLA 2XHYA 4D6FA 2WAGA 1VFMA 1G01A 3WH6A 3VX0A 4HTYA 3CZKA 3D3AA 1JI2A 4M1RA 4QCFA 3AS2A 3UERA 1EIBA 4UNIA 2WNWA 1UKPA 5CLWA 1EOMA 4Z2LA 4AISA 1ITXA 5BROA 1R8LA 4AW7A 4XZBA 4H8UA 3WDRA 1Q6CA 2ZXDA 2WPGA 3IAQA 3U7BA 4NF7A 3GH5A 5HXMA 3MUAA 1UQZA 2GJXA 3WH9A 3AQUA 4ML4A 1CXEA 5DMYA 3T2PA 2VT0A 4CU8A 2X0YA 2XIBA 4ZXOA 2J47A 3T09A 2VVSA 3AIUA 2YLLA 4HZ8A 2XPKA 4HMDA 3D5HA 2DT0A 2ZUSA 1WDQA 2WZEA 2ZX6A 2VOTA 1H3GA 1TR1A 1W9XA 3GH4A 3K4DA 1E4MM 1D7FA 1OT1A 2D22A 3CIVA 2J7HA 3WKZA 1B3YA 5EBAA 1V6XA 1C93A 3VIPA 1FH8A 5FL0A 1JAKA 1LWJA 3S2CA 1ZBVA 1JDCA 5BWFA 3SURA 2PWGA 2VCCA 4MB5A 4MTVA 5A6AA 1HJWA 5IHSA 1CZ1A 1G0CA 4U2ZA 1NH6A 5F7UA 1ZL1A 1BG4A 1VRXA 4X9YA 4W5UA 1J0IA 3O2LA 4KWUA 4LYRA 3DECA 1MFVA 3AYRA 1C8QA 4P7LA 4JKKA 1DEDA 4JCLA 3OIHA 4MJ4A 1BLIA 1W3LA 4CD4A 1PIGA 1MQRA 1JI1A 1O6IA 5CLTA 4JIEA 5CG0A 1JIBA 5FIPA 5I0DA 1EOKA 4OJYA 1KWGA 3DYPA 2PWEA 1ZJBA 3ARPA 1JYXA 4RL3A 2WWCA 3EMQA 2WVVA 1J18A 1OWQA 3TTQA 5HPCA 2CYGA 1HKIA 1UWUA 1TA3B 4W7VA 4MB1A 4ZEPA 6CGTA 1MW1A 3WD1A 1K9DA 4QLJA 4X0VA 2GK1A 5GPRA 1EH9A 4OKDA 4LGXA 1GW1A 1H2JA 4QP0A 4V2XA 3CZGA 2ZX8A 2XVKA 4PUDA 4MPKA 1W3JA 2DT3A 4AZ6A 2CESA 4EKJA 1EXPA 1BF2A 1IZJA 3VDHA 4ZENA 2W92A 1HKMA 3VIMA 1E5JA 3GZAA 4PMRA 4HOZA 2JFEX 4EANA 1AVAA 1BQCA
chains in the Genus database with same CATH superfamily
4PH6A 1TPDA 1IT0A 1B57A 3C2EA 2ZFAA 1Q6FA 4MUZA 3AYTA 2YB1A 3CC1A 2DVXA 3L5MA 5T9BG 4F2BA 4B5UA 5EFFA 5FI8A 4XTIA 1ZALA 3CAVA 1AJ2A 4DYKA 3A4AA 3VKKA 4UTLA 3QR0A 5G4WA 1GQNA 3AWOA 3VABA 2CEQA 1Z32X 2J7BA 4WVXA 1GYMA 1TE6A 3GDLA 2BG5A 3W00A 2FJKA 4C6LA 3GTXA 1OZQA 2X2GA 3H2MA 1NWSA 4IZGA 1YTDA 1ZCCA 2OEKA 1KFWA 5KZMA 3BSGA 1RK6A 1ISXA 3RGTA 3UVIA 4CQDA 4L9XA 4AVFA 1GYLA 1I2OA 4NZ5A 1OHLA 5MHBA 5IOBA 3GVVA 2D3LA 3ONBA 1MW3A 3GFXA 3TJLA 1C7TA 3NPUA 2OODA 5F2IA 4ZE4A 3KAOA 3SGUA 3KM8A 3IJ7A 1XBVA 2OKOA 3KCOA 5I02A 4QFUA 2AKZA 2VFGA 4ENLA 3WX7A 3R79A 2YLAA 5M3WA 3WQ4A 3ZSSA 3KW3A 3AIQA 3W7LA 4GJ1A 2X40A 4JIIX 2B7QA 1RP8A 1TTPA 1UOKA 1XQLA 3CQIA 4ZFMA 2AL2B 5DCEA 3L2LA 5JH2A 4H9VA 3VZZA 3D6NA 4NI8A 1PJ9A 1A4LA 4JFWA 1GOXA 3WD4A 4NX0A 2BNJA 1FCUA 2CLHA 3W7IA 3SO7A 2PP1A 5I00A 4KR0B 4F48A 3WLKX 2A21A 1ADSA 3IANA 3VD9A 4US5D 3KTXA 1KB3A 4IPNB 3FDGA 4TMCA 3S83A 4IQ2A 5CBJA 4ACZB 3PZNA 3L4TA 3URQA 2VEKA 4K38A 2XP6A 5CEWA 3CMGA 1PTDA 3K8MA 1J9YA 2RHGA 3FVMA 1JXKA 3BLIA 1TV8A 2PCQA 4EWND 2UWFA 1VENA 4UFJA 4G7EB 4D1IA 1F7BA 4NAEA 3SI9A 1VP5A 4G56A 2DW7A 3GO2A 2ISWA 4J4KA 3U5UA 4KWVA 1ZUAX 2J7EA 2FZ9A 4MDOA 1GZJA 3MI6A 2XU2A 4M8UA 1YW5A 2O4MA 3H24A 3CHDA 5D2TA 1XL9A 3IJ9A 3RJXA 3VI2A 2EXOA 2V3FA 3FXYA 1CGXA 1JDAA 2XJ7A 3BJSA 4Q3MA 1TUXA 4NZ1A 1S1RA 2WJFA 3VNMA 4UTTC 5A94A 4P61A 2B5UB 1TCMA 1U1UA 3IWPA 3M0ZA 3ITVA 3WJWA 5JQ9A 5EGRA 2C7FA 1W26A 5BRQA 5LA2A 3WUBA 5IFPA 4GK8A 2HPIA 3ITTA 4XSMA 3CUHA 4MNJA 6ALDA 1XYCA 1GVYA 2X41A 3O16A 2CWNA 1CGTA 1U1HA 4JFTA 2V0TA 3QR1A 3CS2A 1UD5A 3KZSA 3POHA 2QCMA 4HTBA 4R9OA 3UJEA 2KI3A 3TLQA 1R2TA 3DFTA 5DIUA 3D47A 1X8FA 1FAPA 1W9PA 5JIPA 3O5OA 3UR7A 4S23A 4F40A 2NQJA 3HMCA 1MXDA 1T96A 3VX1A 1KM1A 1B0IA 3CZEA 3NSMA 3BC9A 4D6DA 1HJUA 5I7GA 3SRKA 1AJ0A 1R9ZA 4QZVB 3UQBA 1NJJA 4FNUA 6XIMA 3A4XA 4QITA 4I5XA 3WEZA 2PWHA 4JTJA 1WNOA 4U33A 4AIBA 4DUWA 1HW6A 1DWFM 2PPGA 4Y9NA 1GVOA 2YPIA 3UCCA 4J3VA 5FF3A 4HKPA 1W17A 2OT0A 1QI3A 1Y7VA 5A2AA 3NQCA 1OVDA 1JL8A 2CLPA 2UY2A 4L80A 3L23A 3H7VA 2OT1A 4CQ9A 3BQ5A 3MWCA 3V1PA 3VNYA 2BODX 2N87A 4GQBA 4AQLA 1X1ZA 3L4WA 3PZUA 1N8FA 3EOSA 4IP5A 3KOYA 4BZYA 3G0SA 5IXEA 1UC4A 4JYEA 2X0SA 4CD7A 1KC7A 1K1DA 2XTKA 2PPPA 4NNBA 1MEWA 2A7NA 1QI0A 2PDWA 2WHJA 2XVPA 1V6WA 1GUVA 3RXZA 1JAEA 2QDGA 3ZM8A 4DRNA 1LOSA 4FK9A 3WLJA 2V81A 7PTDA 4FOJA 4M81A 4B3LA 4GVIA 4UOJA 2A3AA 2ZZ5A 3CBWA 2R82A 4JOMA 1YBQB 4AAJA 1AODA 3WLTA 1P0EA 1QNVA 2PA6A 3PRDA 2PLJA 4DIPA 2PPOA 2NVCA 2ZIDA 1UZ1A 3MP5A 5CC3A 2OG9A 3M0IA 5C55A 4RW5A 4UFMA 3BAWA 5LSMA 3OLIA 4L1WA 2NUWA 2OZ8A 3RMEA 1EWEA 4KPLA 1CXIA 3BGJA 4WOQA 1TE1A 1YHTA 3LHVA 1VIZA 3WN6A 4AX6A 1ZU8A 2V5LA 4PTXA 2VDIA 4UTWC 1DJQA 2BDQA 4G2PA 1DQUA 1DXEA 5FEXA 3VM7A 3SIZA 4HZ6A 3U57A 3HURA 1CGWA 1R3VA 4AD3A 1ZJIA 2DZSA 4PR4A 2VI0A 1F3EA 3L4VA 4FALA 1I2PA 3OVPA 1RD6A 2YYTA 2J75A 4O18A 1REQA 4GX9A 3RU8X 4Z2HA 2V30A 3GPKA 1W3IA 3CEUA 2AWGA 1PCWA 4ROPA 1K8YA 8RUCA 3CL8A 2NSOA 4DWSA 1FKGA 4YWSA 2IF4A 4ZCWA 2GGIA 3E6EA 2G95A 3T4WA 5DFAA 1ZRQA 5KMYA 2ZC8A 4IQJA 4F3HA 2BTMA 1JGMA 3R8HA 4P7NA 1XSIA 1EXBA 2R1PA 3APGA 2ODOA 2ZE3A 3C4UA 3BW3A 1J4IA 1M5WA 3IUDA 2Z25A 1E1CB 2WJDA 4JN8A 4ORMA 1ICQA 1FD9A 2PTXA 3GXPA 2BHYA 3CUGA 4KKXA 1JYNA 1J93A 1SZEA 4PZVA 4A05A 4DJDD 2IQDA 1HGYA 3W6YA 2ETNA 1W2VA 2Z1BA 1FWHC 4CNUA 2PC4A 4WY0F 1T0OA 3FAPA 2ON3A 2DH2A 4HMCA 1JGIA 4RZ4A 2BGSA 3I7RA 4WSHA 2XSBA 3HPSA 1Q2RA 3W37A 2V2DA 1OFAA 1SUXA 5BOFA 1JG9A 1LT8A 3KCLA 1J6PA 3H2FA 1EEPA 1BFNA 2JEPA 2FFCA 3QV9A 3QYQA 1QW8A 4ZXLA 3QGVA 1JZ8A 4M6VA 3HGSA 3IIZA 1RA5A 2OWXA 5C2CA 4W87A 2VGFA 1FKXA 1WYIA 4WIWA 1DJWA 3KP0A 3HPZA 4MVAA 3GIQA 1RVKA 1A5MC 1F3XA 3F5JA 4NYYA 3DCPA 4BQ5A 1QVBA 3GIYA 1KRCC 3CT2A 1V51A 4J3TA 1OCJA 5J5RA 1KXTA 2XISA 3NJ3A 5AOUA 1FWNA 3H9RB 3LRMA 5KZ6A 4D6IA 3TH6A 3W38A 3KDOA 5K7JA 4Q8UA 4OV4A 3SJNA 2ZQTA 1J10A 1Q6EA 4NNAA 3DBNA 1QPQA 1UP3A 2HMCA 2BFGA 1R7OA 4LW7A 4Q8MA 3BCJA 4HD5A 2TMDA 4AXNA 3VC5A 3PFRA 2CZ5A 3TMLA 2ACQA 1P5BA 2HCVA 1Q6GA 1AD4A 3NEHA 5HULA 3N9RA 2Q02A 3LERA 3OBAA 3EOOA 1UWSA 3AYSA 2AQVA 1PYMA 4V33A 2L2SA 4MWAD 4YU1A 3QV8A 3H7RA 4GY7A 2G3MA 4H6EA 4OVXA 4XKMA 3OZYA 1EQ3A 1DIOA 3P7YA 1FBAA 1XLJA 3ZYZA 4XZ9A 1XUUA 4IMAA 2J25A 1JPIA 3NQEA 4REQA 2CZVA 2XIQA 5CSRA 4D6EA 4DZIA 3TC6A 1EQCA 1DJNA 3G22A 3TAKA 1OK6A 4HA4A 4GH1A 1LLWA 4N9CA 1PZ3A 3BAXA 2G50A 2MANA 5CBIA 4M6QA 1O60A 3ZT6A 3PFMA 4CCEA 3LU2A 1PV8A 3LK6A 4HNNA 3FX4A 3LEPA 1UR2A 4DNMA 5A69A 3TOYA 4ALDA 1KD0A 4FIRA 4LUIA 1GOKA 2FPTA 3WQDA 2QJNA 5CCZA 4Z1CA 3TJIA 2CLMA 5DXYA 4IFOA 1BKFA 4F0LA 2H3DA 3IIVA 3G1SA 2ZRXA 1QK2A 3O63A 2Y5SA 2VC5A 2V69A 1JUEA 3SAZA 4GIRA 2XM1A 2A5HA 3RX4A 3URBA 1WX0A 2IQTA 2ZZ4A 3TQPA 1WAUA 3I6CA 2AKMA 5HUPA 5AFDA 4W8AA 1ME9A 3TR2A 4GZEA 2WLYA 1VLIA 3RCYA 2RDXA 4ZTXA 1LRNA 4FAMA 2QYGA 3NXLA 3GW0A 2GQAA 1FWDC 3GVGA 4XZMX 1ENUA 1J0JA 4ZL1A 3UG4A 2OOGA 3D0CA 3HGOA 1TVPA 4H7CA 3UNTA 3ZVHA 4D71A 5XIAA 5GJNA 1OF6A 3H2EA 2NVDA 3PZGA 2E1WA 1K77A 2WC7A 1KXHA 2J74A 1IEXA 3W71A 4J3UA 3GG8A 2G3JA 1X96A 1TPC1 1MUCA 3WBYA 1NQKA 3WK2A 2Z2AA 3WQEA 3MSDA 3RM9A 4BF8A 1JYWA 1WDSA 5HWMA 3AS1A 2VRJA 3LGGA 4BJHA 5AVHA 3O5PA 1S2CA 2VURA 4DJED 4WOZA 1Z69A 1KT0A 2ACRA 1Z48A 4KEUA 1ZS2A 4Q8VA 1UWIA 3CL7A 4RV8A 1RJRA 4LU0A 2QUMA 4CEXC 2KGJA 2YZRA 2CBUA 4IOTA 3MSRA 3R5EA 1E44A 4IL2A 5FOOA 3A9IA 1E6QM 4PUJA 2Y61A 4W84A 3CH9A 3LDVA 4PSPA 2YFOA 4HCLA 2PBGA 2D3NA 2DDXA 5ABHA 3ZIZA 2C15A 5HMDA 4NHVA 2UY4A 3L2MA 2M2AA 3F4CA 3G1RA 4WLCA 1SJBA 2ZRUA 3HJEA 3SUVA 3VCRA 5FF0A 1MEHA 1Y5WA 1LP6A 2PGRA 3PNZA 3A9BA 3W73A 1NF0A 1I0DA 3H2CA 4TMBA 4L64A 4QLLA 1CGVA 2CHRA 3NVDA 1Q6IA 4YHEA 1TQXA 3P67A 1C7SA 4GYJA 4RKAA 2WVSA 2A1YA 3E5BA 4NVTA 3E0FA 3GLCA 4GO8A 3DUGA 5C5YA 5E9AA 4B2DD 1QAPA 4BY3A 2A79A 2ZUUA 3A3WA 2O56A 2Z1VA 2GWNA 1HIZA 3CWNA 1AG1O 1WKDA 1W1VA 3GC2A 3H2AA 4QG9A 3E96A 4Y6GA 5FJIA 2CU0A 5AB3A 3RFAA 2GSHA 4H01A 2PUZA 4DT4A 5CPLA 4K68A 3TSBA 1ZGDA 2ZICA 4HPXA 3VNDA 3U6WA 2J8GA 2AQWA 1UJQA 4RCXA 5GPGA 5LNVA 5HATA 4TVDA 1BKHA 3L5LA 3QSRA 1FWGC 1TQJA 2Y70A 4NAFA 3S42A 4UBPC 3T8QA 5A8PA 4N0RA 2W3ZA 2QCNA 1J5SA 1QK0A 3CUIA 1WDWA 5AHLA 3ZJ6A 1H4PA 2OR2A 2YCLB 3CGNA 2DZAA 3NQGA 1PE1A 4A2RA 4PTMA 2I1OA 4UZUA 5BYWA 5HR7A 1KBBA 2E6AA 4XUGA 4E4FA 2OELA 2R1MA 2BVTA 1VFHA 2NV9A 2PDQA 2IKJA 5AC5A 2NT0A 2QDHA 1TPUA 2LKNA 1SGJA 3NPVA 3GAKA 1US2A 4PBGA 1SW3A 1REQB 3SFWA 2CZFA 3UXDA 4D6GA 3OOQA 3URNA 2D2GA 4JX6A 4AIEA 2WMIA 1K4HA 2ZX7A 4PTWA 1Q2SA 1WAWA 1DWHM 3OLEA 2C3ZA 4Z08A 4WRHA 5CH9A 3TA9A 2XP3A 3T0DA 3MP3A 4GI6A 2LJ4A 2DJLA 2H8ZA 1Q85A 3DERA 2CKSA 5T91A 1QMLA 1JPDX 4RZ5A 2XH7A 2VCBA 1LL6A 2H3BA 3FEMA 4GG9A 2OGJA 4S3GA 3CYJA 1A5LC 1BXCA 4I8YA 1AMKA 1H1ZA 4N19A 4A29A 2WSQA 4HT3A 2CIPA 2JGYA 4HBEA 1JCTA 4NP7A 1Z7AA 2VCDA 1TJPA 1UW9A 4DJEC 3ALFA 3CHEA 3WNKA 3P8JA 5H6HA 2WB5A 1XG3A 1UUQA 3M41A 3LXBA 2C0HA 5TIMA 1S2UA 1U1JA 1C9WA 1UUMA 3EEGA 2PCEA 3GHTA 3DKLA 1KQZA 3KL3A 3IVSA 5I23A 1ELSA 2GL5A 3W2KA 3BH4A 4KF1A 4O53A 4DYEA 4IP7A 1QNPA 1DOSA 1FWAC 3WBEA 4JHOA 3PTKA 4LSBA 3R8GA 1OCQA 4EXQA 7A3HA 1L2UA 5TQLA 1K4GA 2EG8A 1V3JA 1WE5A 5A6MA 1FKIA 1E51A 3WL1A 4FIQA 1XRTA 3VDBA 3H2NA 5FJPA 1P7TA 1MI3A 3UI6A 1MDLA 4D8ZA 2PB1A 1XINA 3AAMA 2Q6ZA 3P80A 1V77A 2Y8VA 4V1YA 4JD4A 3T6CA 2Z1XA 2JALA 1OFEA 4P7OA 2J77A 1E9ZB 1F4AA 4C91A 1C8VA 2UY3A 1UWAA 1UWQA 3PUGA 2J78A 3VIIA 3UR5A 4GISA 4UTTA 4UC5A 2WJEA 3WEMA 2YJQA 1WXZA 4D9PA 4DZ5A 1TTQA 1KFBA 3WNNA 1VFSA 2G3NA 5HWBA 1W56A 2PWVA 3O5MA 1H62A 4QJ5B 4LEQA 1DIKA 1TV5A 2ONEA 3T08A 1FXPA 1ZBCA 4CVUA 1OADA 3ID7A 4MGGA 3RLUA 5EL1A 4UNKA 1LQ2A 1NWUA 2UZ5A 3OB8A 4JYFA 3WSUA 3EPMA 1VFFA 1YLVA 3UF8A 2AL2A 3SGGA 5I98A 4AD2A 2VVNA 3TAOA 1HXVA 4FPSA 1VEPA 4AWSA 3CHCA 2Y88A 2ABBA 2GVYA 2XP5A 1QBAA 4CQCA 3AXHA 4FI4A 3Q67A 3L4XA 5DCBA 9XIAA 2DEPA 1VLWA 2P4VA 1M41A 1EGZA 2WM0A 3UZXA 4PRWA 5C70A 2IS7A 4JIRA 2XIIA 3PSVA 1HXJA 4KRUA 3DC0A 4DROA 1NARA 5AZ0A 4GINA 1Q66A 1E70M 3WQ5A 2LPVA 4C65A 1QXLA 2E6FA 2XP4A 1IXOA 3KLLA 4IQEA 1A7XA 4C1NA 4UTMA 2OSYA 3MPGA 1GEHA 4FF7A 4QAWA 3F4NA 1E3ZA 3WEOA 1J0YA 4IPJA 3IV3A 3GG1A 4GWEA 2CHOA 3LCHA 5FSEC 3GDKA 3B40A 1J4RA 1TG7A 5K9XA 1XIEA 3W01A 2EJAA 4R33A 3CGTA 4FA3A 1UD4A 5E9XA 4GUGA 1PWMA 4JDYA 3UZJA 4AG0A 4PUKA 5A2BA 2VRKA 3BW2A 2CPUA 3WLRA 1DWIM 3P14A 4NAEB 3QW4B 3W1UA 3UWQA 5TF0A 5ABTA 3T2OA 4KH2A 5D2VA 3FEQA 3CJPA 2XSAA 1Z3NA 1CGYA 3EDDA 1IWAA 4I9AA 4JFLA 3LRKA 1QNRA 3ZLGA 4IGNA 4MMWA 3VKBA 2E6YA 1WXYA 1AQMA 3WF0A 2Y8KA 3VFLA 4J2MA 4XBKA 4PMNA 1CENA 2H9AA 4IFKA 1Q6LA 1AJZA 1JQXA 4OE7A 1NF7A 3I6TA 2EO7A 3SQMA 1UMYA 2Q5AA 4RDYA 1OINA 1YATA 4M24A 1CBGA 2HV5A 5G5IA 2ZXQA 5B8IC 2B31A 1T41A 2FHCA 4I7UA 1Q8AA 1TMHA 3DYMA 2XFWA 2ATSA 1ZSXA 2VGBA 1TPH1 3B0YA 2DIEA 1AQHA 3GXNA 1XP3A 3LMYA 6REQA 1CXKA 4AZCA 1KLZA 3HV8A 2CFFA 1KXVA 1IWBA 5D9MA 3T55A 3XIMA 2WVTA 2VX4A 4IM4A 4JEJA 3TN6A 4W9QA 4IH3A 4AHOA 5HPOA 3MVTA 3CUZA 3E2RA 4JTKA 1MRAA 1OM0A 4LNCA 1XLKA 2QNEA 3ABSA 4PTNA 3OG3A 3F03K 3QLLA 5I3GA 3ZFHA 3QHNA 2QPXA 4ODKA 4YS1A 4A8NA 3TCZA 4LH8A 2IPGA 2Q8XA 2LLEA 5CAKA 1TUFA 3ZMRA 4F4RA 1WKFA 3VDAA 5ABGA 3GXDA 1DL3A 3WMCA 3NAVA 1QFEA 5AVNA 1A5CA 3NQAA 5CAHA 3QTGA 1OABA 3SN1A 3O5GA 2P8BA 3MCOA 2Y62A 5CJMA 1EUAA 4GUIA 3FIGA 1FKRA 3I65A 2BASA 3FHAA 4YPJA 2VR5A 5AYXA 2OB3A 1W1TA 1TWSA 3WK0A 4DO7A 1ZNNA 3GZ3A 3SM0A 3PZOA 1JF6A 3LHUA 5LHFA 3P2VA 2HK0A 1PUDA 5HK4A 1F74A 3U0HA 3WFAA 4X9SA 3FHQA 4O14A 1KRBC 3WG6A 2CW6A 4WX2A 4F2TA 3I3BA 2YDSA 3UU0A 3DHFA 4XO6A 1EZ2A 4U5KA 1C3FA 1E6RA 1ODZA 4H9MA 4QBXA 4YLWA 4PMQA 2X1RA 2RDTA 5HR6A 3ES8A 4D6HA 1GOOA 4KERA 3QMTA 2GFTA 2EKCA 3GD6A 3SCSA 2BVYA 3L21A 5FAGA 4E0CA 2V8ZA 2XGBA 1F8MA 4M3PA 4MZYA 1O1ZA 2QCLA 3CM4A 4PEEA 4H9UA 4HGXA 2Y7FA 1VFTA 1NFPA 1XBZA 4OFCA 2VX6A 3MY9A 4G5DA 3VUSA 2C0AA 4YMZA 3TYAA 3NQMA 1BRLA 3LSBA 3AIWA 1JPHA 3SW6A 5TBOA 1QOXA 5CZKA 2I9EA 1HKVA 3NCOA 1A3XA 4YXGA 1LCOA 1LOLA 4B5TA 4HNOA 2DUXA 4HQVA 1AA1B 1ZPTA 5IDZA 1FDZA 3JS3A 1PDYA 4LAVA 2HRWA 4PTVA 3VNJA 1RBAA 2OO6A 3Q4DA 1LM1A 2PC8A 4H9TA 3QBUA 4BI7A 3KL5A 5AC7A 2DZTA 2F9RA 4IT6A 1UPPA 3HMJG 3S9YA 3BAYA 1KTCA 1LLOA 4UFHA 4DUXA 3DG6A 4HU3A 2XIOA 3A5FA 2QJIA 4RXGA 1TWDA 3QOMA 1XXXA 3ECQA 4QQ3A 2Z28A 4B5SA 1R47A 4FLOA 3IVUA 3W1MA 1X7IA 3MUCA 5E6ZA 4Z2IA 4GO9A 1UWRA 4MB4A 4QQUA 2XP7A 4AYGA 1OX5A 1OZMA 2XM2A 4A4AA 3M47A 3VKAA 2C1HA 4MFEA 2DPEA 4YTQA 1L6SA 3VGEA 1UR8A 4B16A 3W1XA 3LXCA 2POTA 4XKYA 4HZMA 1G01A 3VX0A 4TV5A 1EJ7L 3KFTA 4K8EA 2OJPA 2XINA 4H7ZA 2QXWA 2WJZA 1EIBA 3RHGA 2P0OA 2WNWA 4IGHA 3GVQA 1Y0EA 4QSHA 4AISA 3TYCA 2OCZA 3NFUA 3U4FA 1R8LA 4YVXA 3VYLA 1R6WA 4EF8A 4LYKA 5LIXX 3L0GA 4ASTA 2ADAA 1X1OA 1Q6CA 4I6KA 2D9FA 3PAJA 1MO0A 5CZSA 1UQZA 2GJXA 3HQ1A 3WH9A 1KW1A 5DMYA 2D2JA 1ALDA 5G4EA 2VT0A 3CNYA 4RZBA 1KRMA 4ORIA 4HVXA 5HWJA 3AIUA 3HA1A 3AU2A 4R3UA 3D5HA 1AZ1A 3K4DA 1UC5A 5DMNA 1RA0A 4JR5A 4RLIA 4I3GA 1S38A 2G3FA 2J7HA 1B3YA 4Q33A 1C93A 3PR2A 1JAKA 4JNZA 4GJJA 4BEUA 4MB5A 2GGJA 3W3OA 3EWZA 1HJWA 3AYVA 3C5QA 3TE9A 3W7EA 1ZL1A 1O12A 1KCZA 3O2LA 1P6CA 3WQCA 3DECA 3OU8A 1R3YA 1DEDA 5LIUX 3OIHA 2PRHA 3PA7A 3HM7A 1W3LA 3PWIA 2PDJA 3M7WA 3A13A 1JI1A 4MKNA 4Z42C 1O6IA 3BE7A 3EKGA 2Y7DA 5CG0A 1JIBA 4G1NA 1ZHAA 4LAUA 2RFGA 1KWGA 3DYPA 1ZJBA 3M0YA 1MNSA 3SECA 3G1DA 3BZJA 4S3AA 4O28A 3NYZA 4LAWA 1A5KC 5BMWA 1HKIA 1KFEA 1UWUA 4LVBA 2AQOA 5C9XA 1PTGA 1KFJA 3QY6A 3T40A 4LUTA 3IVTA 4RNIA 2GK1A 5GPRA 2UZ9A 4OKDA 2X30A 5H8MA 4C6QA 3ZLHA 4O1DA 4QT2A 4PUDA 4MPKA 2CESA 3S46A 4LAYA 1OJXA 1R3SA 1IZJA 2NLIA 3VDHA 4WHBA 1OX4A 2W92A 3VCCA 3VIMA 3PBYA 1V8EA 3GU2A 2XH0A 4PMRA 4HOZA 3HGRA 1BQCA 1DJZA 3TIMA 4L72B 3CZLA 2J7GA 4W8LA 2V6AA 1AW2A 4K8HA 4HCHA 1HKWA 3KADA 4PCTA 4DWSD 2OEJA 1XSKA 3HBLA 2VM8A 5HAOA 1E5NA 2IXUA 3N17A 4ODMA 2PLCA 5I24A 3QFWA 1QHOA 2BP1A 3S9ZA 1JPKA 4DUVA 5J6EA 3O06A 3BG3A 5BU6A 4C7GA 4BI6A 4TOQA 2P76A 2BS9A 2GYIA 5AYIA 1C92A 2R24A 3FNDA 4LNYA 2RUSA 2ZDRA 3ABOA 3FJ4A 3CV6A 2PDYA 4AH7A 4Q4PA 4S39A 1S46A 5D9OA 1E0WA 3C6CA 1U30A 4IMCA 3CIXA 4LTSA 3HG5A 4KFNA 5C2XA 4H4IA 4GVFA 4E8CA 3B9EA 5I09A 4QR6A 4WEVX 3W2UA 3T0AA 3MV01 3IEBA 4H6RA 1RP9A 5FF4A 1G69A 1ZAIA 4GQRA 3LBOA 3K4AA 1U83A 4DB7A 3O8AA 1AFSA 1RV8A 1XIHA 5CC7A 1HJQA 1LF1A 1A5NC 2UBPC 4YVVA 3CV2A 3UXIA 5E0KA 1IGWA 3FKRA 2FH6A 5G1MA 2R1NA 3EB2A 2P1FA 1JF5A 2MLXA 1O1HA 3W26A 3WBXA 5H2ZA 1KA9F 5D03A 2YDQA 5J5DA 2C79A 3IK8A 1BWVA 4I9MA 3FN9A 5U7SA 4L61A 3PTQA 2AGTA 4Y7EA 3VGGA 3MVIA 3W2LA 3E2QA 4NJHA 1K8CA 1SYTA 2QMKA 1TVLA 2HDJA 3U48A 1S3TC 1TFVA 3CO8A 2XN1A 4R53A 4Z1YA 2VZSA 8CGTA 2YDRA 2VX5A 3UYIA 4MJMA 1FDJA 2PD5A 2WK2A 1E6PA 1MZHA 4Q4QA 2VEFA 2FZ8A 1LTDA 1V0LA 1RCOB 5BMXA 5HUOA 3T42A 3W07A 1Q4WA 2XSXA 3N04A 3GUGA 3R6IA 5A1AA 2E4TA 1S2AA 5H8PA 2AAMA 5ABEA 2HS8A 3EX1A 3PF3A 3KBMA 4EPBC 5HQEA 3WFZA 1GPFA 3LUTA 1Y0OA 4LYPA 2GUYA 3S5ZA 4HPJA 1IZKA 4PUEA 1IHIA 3EA3A 4ERAA 2KZHA 2HROA 1MXSA 2OX1A 1JYVA 2VTFA 3VK5A 1TA3A 3G3DA 4ECLA 1ZFJA 3KUMA 4QNWA 4LUYA 3MJMA 2ZUNA 5DRCA 3TK7A 1P4CA 1RPKA 1TCDA 1I0BA 1KKOA 4CNPA 3MUXA 3PP7A 3L9CA 1UP0A 1PX8A 1ONEA 3AXIA 2DSVA 5HINA 2E28A 5BCAA 1ROTA 4NJIA 4OECA 4QXIA 3MMDA 1XD0A 3MMWA 2VZVA 1EDTA 3MANA 4UXDA 4CUCA 2PDPA 4QM1A 1EYMA 2F38A 4C6DA 4ZZ9A 3ANUA 3UY8A 2OWCA 5CJ5A 3B9DA 3STPA 4B2DA 4GLEA 2YL8A 5I79A 2PP3A 2FHBA 3GAYA 4CD8A 4PE8A 4QDMA 1M7XA 3STCA 5EB8A 4DIAA 3HPAA 1J4HA 1FWIC 3W1RA 1KM3A 3NPXA 4RK8A 3TC3A 1QATA 1N82A 3PY2A 2J66A 1W0MA 1FP9A 4IXXA 2EAWA 3FAXA 5RUBA 2ZYFA 4XAYA 1E9YB 4HK5A 3LTPA 3CL6A 1KFCA 3LB0A 4EPKA 4NNCA 4GGQA 3HB9A 5SWUA 4DZ3A 3EPNA 3QPEA 4YCPA 2GSEA 2C13A 3FXGA 2ZRYA 3TW6A 5CBBA 4BF7A 1J0HA 1J8VA 4Q22A 2VX7A 4GIYA 3QKEA 1U33A 3LOTA 4DJDC 3M5YA 4OQVA 4B5NA 3ZJKA 3B0VC 3UD6A 3T0TA 3DYOA 3USBA 1K7EA 1R3QA 3F7JA 4HOWA 1IGSA 3VXGA 5FJJA 1VGAA 1X98A 3LPFA 3A4JA 4NZFA 4QEEA 5DLCA 3NZQA 1QZ2A 4XQ6A 4DBUA 3IPWA 3AROA 3WLQA 4QCEA 1TO3A 1XDJA 3KBNA 2QR6A 2WCSA 3VZYA 4NILA 1UA3A 4ZO9A 1CB7B 3THQA 2ZXBA 4ZQRA 3QGKC 1IV8A 4J2PA 3OOBA 4W86A 1FHUA 3O6YX 3WBAA 2HISA 3OVRA 3FAWA 3HO8A 1OIMA 2F61A 1G5AA 3PZIA 1Z89A 4HK7A 3GBEA 4L1GA 4CN6A 1Q3NA 2XZ7A 2HZGA 3PUDA 3W1LA 2QS8A 4O57A 1PWLA 5A6KA 1SQ7A 1FFRA 2V38A 4C7DA 3FLUA 1MVYA 1GZ1A 2J27A 3TU9A 2XIMA 3G6LA 1TYGA 4ES4A 3BGAA 1HQTA 4AEEA 3UY7A 3DHUA 4GVGA 3H8AA 3RO8A 1FWRA 1LL7A 4QX4A 1WZKA 3NOYA 2Z6JA 3M1ZA 4IGMA 1MEIA 3BL3A 3F5LA 1CTNA 1GVQA 1V7AA 3RLGA 2F2DA 1S5MA 1GOQA 2WMIB 5I3IA 1IWPA 1EJXC 3EGJA 3ODKA 3GC5A 3M5ZA 5ECVA 5K9DA 4HHMA 3PC0A 1RLDA 4HCDA 2CNCA 3DFSA 4C7FA 1VAHA 3R12A 4LVFA 4U3CA 4WGXA 3UA4A 4GUJA 3BURA 2YYUA 3T0BA 2WOQA 4LS2A 1IEQA 4CEUC 3B8VA 4QTGA 3W23A 4FX8A 3THAA 3AS3A 1UASA 1PIIA 3TQ0A 5LGZA 5T9CE 4IMGA 1TV7A 4M5PA 1D7HA 4GUFA 3UR8A 4NRSA 2ISDA 2MNRA 4KFPA 4UQ9A 4M6PA 1X6NA 1N7KA 1ICPA 2CLOA 1GTHA 4J3SA 1X7FA 4ODOA 4UR9A 1TTJA 4H8NA 1M1BA 1T99A 1VD6A 3GHUA 3M43A 4H2HA 3W1NA 1XLCA 5CPSA 1IXNA 1H7OA 1PS9A 4LCQA 1F73A 5IDIA 4NZ4A 2XYLA 3N9KA 4GC4A 1KBKA 2PN0A 4PMVA 5CXPA 3M07A 3GFYA 1W9VA 3EDKA 3JR2A 4DRHA 3ITGA 4Y9PA 3VOGA 3C8FA 3DX5A 4GZIA 2WSRA 3HPFA 1J2BA 3LV5A 4XTDA 2TPSA 4YHGA 4PYSA 1OC5A 1MW0A 3VNLA 3PBGA 1SSDA 5J8LA 2CETA 4PN2A 1WP6A 4UDMA 2RUCA 1P43A 5E0CA 1FKSA 1XLAA 3U2OA 3HQNA 4LC8A 3PPFA 2NQ5A 5A8NA 2C1IA 5H8UA 3ZT7A 4Q4SA 1FWWA 4DI9A 1EPXA 2P0IA 2OLSA 2Y6ZA 1TJ0A 3MU7A 2F23A 3PTMA 4Z0JA 4OZOA 4M56A 3NDZA 4S38A 1SO6A 2BHZA 4KT2A 3IKGA 2JZVA 1EZWA 1ZLPA 4NI3A 2QCDB 2ABAA 3WUEA 3BLLA 4JQ4A 2WHLA 2OYMA 3WLNA 2WVUA 3OEXA 4QEHA 3A64A 2QPSA 3VMPA 3BLEA 3FW6A 4LS1A 2BWGA 1LJYA 3RMJA 4B5XA 4INFA 3GX9A 3M64A 4WXYA 1CECA 4L56A 2OLHA 1E0TA 1TV4A 4ADSA 2V2CA 3DGBA 4QE4A 4O11A 4JFUA 3PZTA 3II1A 3S3GA 3VUPA 3E0WA 1XUZA 1QRQA 3TROA 4KIRA 4W9PA 3O5DA 2FDSA 3IARA 1DTUA 2ZA2A 2A6NA 3SCWA 3TCSA 5E0FA 1EL3A 3WNLA 3EOEA 4G8TA 4TVCA 2AMGA 4N6FA 4FXJA 1BXBA 3INPA 3ARQA 4KQZA 4TYOA 2X7VA 2RUDA 1NWRA 4S1FA 4UFKA 3BG9A 5EYWA 3CXOA 4W93A 5BRPA 3U2CA 4UQBA 2WYSA 3AUJA 5DY3A 1O5XA 1W8SA 3I4KA 4IPXA 2VXNA 4O54A 3MDYB 3W7CA 2F4EA 4H8VA 1W1ZA 3TKFA 2RH9A 3BLDA 4E2VA 1AW1A 4FAPA 2R1KA 3I68A 3QY7A 3MUY1 2R8WA 4PMXA 1M65A 3SFKA 3I4EA 3RPMA 5I3KA 1HNYA 3HOJA 3WCZA 1CLVA 3C2YA 4X2RA 1TV3A 3EDFA 3RPDA 1R46A 3TDFA 2PRLA 3NO5A 3NA8A 5A6JA 1J0KA 4QIUA 1G9HA 1FKFA 1MRQA 2PEVA 2E9MA 3S6TA 3K46A 2QHAA 1RH9A 1UH3A 2VKZG 3WH7A 2EPKX 1S2TA 3ZSTA 3ARZA 1GQJA 1DJHA 4IIBA 3STGA 3CQKA 4WDUA 4YCOA 1NELA 2VZUA 4NZ3A 2OFJA 3K1GA 1GG0A 2QMJA 4EAMA 3NGFA 4KGJA 3POCA 3MBFA 4Y9AA 3LQLA 1R3RA 1QT1A 4LAMA 4UTUA 1R86A 2OTDA 5XIMA 4XVDA 3DFOA 3MV11 4L6OA 3MTWA 1B3XA 4XO7A 1BRLB 4M7TA 1TTIA 4D72A 2DSUA 1R85A 2CBJA 1SMDA 1ML1A 4PUNA 1B6CA 1EC9A 1MDRA 2VCAA 1UD6A 3M46A 4TX9A 2A7PA 3AXXA 3DU0A 3SQLA 4JCMA 1GT8A 4JN6A 2BB0A 2BY3A 2BHUA 4M51A 3FA5A 4HPHA 4NX5A 3EMZA 4QS6A 1L6WA 2WWDA 1GQKA 1K3UA 3WIJA 2V3EA 1LQAA 2FKPA 4IUGA 3UWYA 3AIBA 3VD7A 1LOQA 4ZS6A 4AHQA 2BBFA 3TP4A 2VFFA 1V3IA 2DQWA 1PHQA 1T40A 4NRRA 4GIAA 3XISA 3N25A 4U4MA 4PSRA 3CU2A 2R14A 3TLLA 3M0VA 3LI0A 1DWGM 4ZQCA 3BCDA 2PGWA 3P84A 1R38A 4L4LA 2O4QA 1QO5A 1OC7A 2I17A 2NQLA 3CPUA 3PB0A 2XG9A 4OUEA 2OU4A 1RLCL 2Y1HA 1E0UA 4KWOA 1Q8JA 4ATWA 2QKFA 3RJYA 2X16A 1DIEA 3F2CA 1FTXA 3O0KA 5FEPA 2J8FA 3EMCA 1YPXA 3P8IA 2FPVA 1B30A 4TO8A 2X8RA 2ZUTA 3CEPA 2IKHA 3CH0A 4B91A 6TAAA 1FKTA 2E6DA 3O7UA 4OWGA 4XKYB 4ZTYA 4BHYA 2QCHA 1JNTA 1C9DA 3B8TA 2XN2A 3HU7A 3SGZA 4L6HA 2RQSA 3FS2A 1XC4A 3CAQA 3LENA 3WF4A 3BOLA 2IPFA 2YL5A 4FP1A 3IUIA 5LKYA 3CZ8A 1M9HA 4UTFA 4MWAB 1Q5MA 1EC8A 3COTA 5FJUA 3GTHA 3QYSA 5FACA 4BKNA 1B3VA 3G18A 2V5CA 3RU6A 2V82A 1TIMA 1YRRA 3PRBA 2E3ZA 4O15A 5BXSA 1XRVA 1W54A 3LPGA 4J3WA 2XWEA 2P10A 5LA0A 1TRIA 1SJDA 4YNGA 4EVZA 1UA7A 2PZ0A 1JFXA 3WQVA 4EXAA 1NDYA 3WLOA 3IRDA 3M0HA 2VNCA 3C8NA 4U84A 1BGAA 4KBXA 1RY0A 3FVDA 2HEJA 3E49A 4QNEA 4LQ1A 1PZ0A 5I03A 1E1CA 3NZPA 4N9DA 2PGFA 3C3NA 1UMLA 3A5VA 1XHGA 4WXZA 3EWCA 2C91A 1DJIA 2EJ1A 4GXMA 3S8HA 4TIMA 1W91A 1WDPA 1T11A 5AN7A 3VOHA 3P5YA 4FNRA 1LWHA 2Q09A 1WB0A 4XSLA 2VR2A 1EO7A 3V1HA 3U5YA 5JVLA 3PPGA 4IPPA 4C60A 5BXRA 4V1XA 1UKQA 2NX9A 4BCEA 1GZGA 4W89A 1ISVA 1YXCA 7XIMA 3QV7A 3B9AA 3V16A 5I3JA 2PTDA 4J9JA 3E5PA 3IK2A 3B8IA 4JFKA 2ZQVA 1THFD 2D0HA 2DVUA 3EKZA 2QUNA 3WLPA 2VOMA 3NL3A 1QNOA 1ME8A 3MI2A 2DU2A 1BXNA 4J35A 3SCRA 4WY0A 3LLDA 4GPNA 4GI9A 3SCNA 2UV8G 1T7LA 2CERA 3WQ8A 3OLGA 3N34A 3KHDA 1E4NA 5T26A 2ZBTA 2XWDA 2LGOA 2RUQA 3IV8A 4G1KA 2VR4A 1CCWB 2PV2A 3QN3A 1TPEA 3GNDA 3KWSA 1A4MA 4IPIA 1I6NA 3IIPA 4CKQA 3QXBA 1J11A 4CNSA 1JQVA 1UH4A 2QUVA 1BTMA 1FWTA 1OYCA 1WV2A 3GE7A 1OFBA 4M82A 3VGDA 1GEQA 3H21A 4M29A 4DPQA 4K7VA 3LA4A 2HVMA 4PMUA 3GQYA 1DP0A 3KBJA 4RE4A 2NWSA 4H04A 3MCNA 4JTGA 2DY3A 2W79A 5KINA 1XC6A 1OX6A 4S3BA 2RJGA 1OGSA 5I3HA 1YDOA 3KL0A 5T8GA 1XGDA 4IIDA 3LCFA 5I5RA 2EPOA 2Y89A 2FB3A 3GYCA 3K8KA 1W9UA 2BY2A 4MZ8A 3N3TA 3IJ8A 2OX4A 4LV4A 3RNDA 5D30A 1V93A 3T05A 4DUOA 1BKSA 3MI3A 2PWFA 4ONVA 3OA5A 2A3BA 4ZO7A 3CV1A 1UD8A 5AC6A 4S3EA 3FY1A 1ITCA 4LS0A 3WQ6A 2TSYA 5HANA 1AQFA 4LWWA 7REQB 1H49A 1Y65A 4O52A 1IT8A 2HBVA 2MUCA 2HQAA 3TTYA 4G6CA 5IRPA 4C6MA 2XIJA 3ZT5A 3IGUA 3ARYA 5XINA 2F6UA 3NTYA 4NASA 3G0UA 3M0XA 4GE8A 1KGUA 2XGIA 2KX9A 1QUMA 1XM3A 3WL0A 2VO5A 4MAZA 2QIIA 3UF9A 2DQXA 2EPHA 1FKJA 4OTKA 3NPWA 3SR7A 1Z8AA 1SFTA 4J5NA 4JTAA 1Z44A 5DCDA 1R0MA 2PDGA 4XAPA 3UXKA 1XI3A 1SSGA 3PSWA 2G5WA 4WJEA 4UUIA 3TOPA 1LG1A 3MA8A 2GGGA 3W4RA 4UOZA 3IACA 3HG2A 3CO4A 5GJMA 2IUZA 3K5XA 3M0JA 4FNPA 2ZUMA 2WKJA 3R11A 3GVRA 4UCFA 3APYA 4M1BA 1B2YA 3VCNA 1PINA 4P8WA 3RLVA 2PDKA 2PS2A 4DRPA 3Q2DA 3WLHA 2BGNE 4PB4A 5EKYA 1CNVA 1UIPA 3GU0A 4LV9A 3B7XA 2NWRA 2YXOA 1EO5A 3TVAA 1BTCA 3NO1A 4IFRA 3PZQA 3WDPP 2CCRA 1TRDA 3F4VA 1J2WA 3NWRA 4H2CA 3WDJA 3P74A 3GRIA 1R30A 3S1GA 3WZ0E 3GDMA 2YX0A 3QPYA 4Q8OA 2VD9A 2OWWA 4IIFA 4H7VA 3B4UA 3V0UA 1FCVA 4Z1DA 4LAZA 3R58A 3N2CA 5D4YA 3VFCA 2W61A 1VFOA 5FJTA 2XPAA 1ZQ5A 3HQOA 1XFCA 2QCGA 1E72M 4OU1A 3M6DA 5PTDA 4Y96A 1E6ZA 4FLQA 2RGMA 5AYBA 3O0FA 3CQ0A 3W27A 4MWAE 1MYRA 4JTQA 1A5AA 4XD4A 3O5LA 1YPIA 3R7MA 4ODNA 4KWWA 2OGYA 4K39A 1H7NA 1OG6A 5LYRA 3PPHA 1W5NA 4JTFA 1AH4A 1YXDA 1I60A 1QNSA 3QF0A 3AICA 4RNJA 5G2IA 1QWGA 2CBVA 3WLMA 4ODQA 1ICSA 3DXIA 4DVOA 2E8YA 4GGHA 1HL9A 1TPWA 3SQSA 4RE2A 4DEFA 1PIFA 3REQA 1RBOB 4P7QA 5MF5A 3KS6A 2P88A 4IUOA 3MT1A 1W3KA 2TAAA 1UR1A 3B0XA 2MLZA 1HJSA 4R7JA 3AHXA 3W22A 3HJZA 1BD0A 4UTKA 2Y7EA 6PTDA 3FJLA 3VA8A 3C2VA 4XUYA 4S3JA 1RCXB 3RR1A 3WDQA 1GRJA 1FH9A 4DJFC 2PV1A 3OO2A 3TFXA 5M5DA 3OHIA 4Q8TA 3DN5A 1PSCA 3A22A 1L0PA 3QH2A 2EPNA 1FKDA 4H1ZA 3V5OA 1JDEA 4AC7C 3OZOA 1T8XA 2HE5A 3BANA 3CUFA 2IPWA 4BQ3A 1X6LA 2Z0IA 3LQGA 3N4AA 2DZUA 3K4WA 3JZEA 4JPGA 2NQZA 2OMAA 3QQWA 4UNLA 3K8LA 2VELA 4GCAA 5KSWA 4HSHA 3TC7A 5CSYA 4EOUA 5BOOA 2WNNA 3KCEA 3VDCA 1Q6QA 4CNTA 2WKGA 4MY9A 4ICNA 3NQDA 4FNTA 1JNDA 2D20A 4GYPA 4GFIA 1OX4B 1FRBA 4K2SA 2NV1A 3I7QA 3FJNA 1JULA 2V3GA 5D38A 1VCFA 4LXFA 3SUTA 3AHTA 3AMDA 4UIOA 3T44A 2GJPA 3CPRA 4J3ZA 2CLKA 4JTEA 4N9BA 1GQIA 4DM1A 4NKCA 2QJGA 1SW0A 1K9FA 1V4YA 1WPCA 2C6QA 1XH1A 4DO4A 3UVAA 4D8AA 3HPXA 5JH8A 2VENA 4JKLA 1UB3A 4A22A 2FYMA 1XRSA 4FHAA 2PTWA 4QHRA 5I6SA 1XLBA 1JDFA 4LUSB 4WSKA 1B9ZA 2B81A 3SRDA 1OEPA 4NXSA 4P7RA 3TYZA 3PWGA 4Q8QA 1FCQA 3AXMA 2X1TA 3BMXA 4GQQA 3UQAA 3W1PA 1WBJA 1XD1A 3SY8A 2XDFA 2ZWZA 3N13A 3EX2A 1P6BA 1UR4A 1B4EA 3KWXA 3M5VA 1GVSA 4R5EA 4ZMGA 4HOXA 2OQLA 5TD4A 3APTA 1V3LA 3ITCA 1K6AA 4FEZA 4FLRA 5C71A 4DF0A 3H7UA 3DZ1A 1VEMA 3G77A 1IE7C 4W88A 2ZZ1A 4EXBA 3W2NA 4W85A 4AHPA 4XWUA 1JCXA 3NQ8A 3G1YA 1OCBA 2WXDM 2MF9A 4FXSA 3RILA 2WZMA 4XBJA 3L5AA 2JIEA 4IFKB 3ONCA 1L6FA 2E5BA 3C56A 5KZEA 3WENA 3GR8A 4UFIA 1UZ4A 4U5IA 4XAFA 4E2BA 1UPMB 3GSMA 4D2JA 4IMEA 4WR3A 2WANA 2NQ9A 4O10A 4F2UA 1VBRA 2QZRA 1BG9A 3M0MA 4JY9A 2WAGA 4L9ZA 1VFMA 2DG4A 3VKDA 3D3AA 3PUOA 1TPFA 4M1RA 4YYFA 1VC4A 4YJ5A 2GQ3A 2F6XA 1DIDA 2R91A 1ITXA 5MKGA 2I5IA 1EJVC 1X39A 3A3XA 3T1GA 3WDRA 3W9ZA 2ZXDA 3CGMA 1P5QA 3GWQA 4NF7A 3GH5A 3TYEA 1CXEA 2ICSA 3T2PA 2QAPA 1HUVA 5FEWA 3BVJA 3T09A 1ZAJA 1K6WA 3BOFA 2G0WA 2XPKA 4HMDA 4DJFD 2DT0A 3UI4A 1WDQA 2ZX6A 4IQCA 1N1AA 4D8LA 2B7NA 1D7FA 3NURA 4E38A 3OP2A 2NVAA 5EBAA 3ABQA 3VIPA 3LZ5A 1LWJA 5BWFA 2VCCA 5A6AA 3O05A 1NH6A 3D3FA 1VRXA 4K3ZA 4XVEA 1J0IA 3R43A 2DIKA 4EPDC 3EY6A 1MFVA 1C8QA 3P81A 3PG9A 4JCLA 4JX5A 1F3WA 1SZGA 4MJ4A 4F0KA 1BLIA 1PIGA 2PP0A 1QWKA 1RXOB 4O19A 5CLTA 4AVNA 4O1CA 1LBLA 3EPOA 3OA3A 2BGQA 5I0DA 2ISFA 2QW5A 2PWEA 1JYXA 3O3RA 1GVRA 3PS7A 3LHWA 4ZEPA 3CAWA 6CGTA 4XISA 4GQGA 1O4UA 4X0VA 4AB4A 2VDHA 3W1AA 4V2XA 1YEYA 1JCLA 2J6XA 2DT3A 1I9CB 3FGCB 1BF2A 4GC3A 3U2EA 4AWUA 1E5JA 3NL6A 2E5DA 3BUVA 3W7GA 1AVAA 5F1UA 1W1IE 2PGEA 4DPPA 4ZPWR 1ZBWA 3A12A 1W2PA 4TTUA 3W1TA 3GIPA 2CXEA 5K3VA 2QUUA 1KM2A 1OFDA 1V08A 4JTSA 2WHKA 3VE9A 3PULA 3V3WA 3R10A 1PZ1A 3P93A 4GYFA 2G3IA 2JKAA 3TN5A 3HF3A 1SZFA 3VVGA 3TR9A 2IXVA 3SDOA 1XIBA 1RBLA 3NG3A 4A3HA 4IGSA 4GYKA 4ICCX 4MY1A 2Q71A 3LM7A 4BS0A 2X1IA 3IJIA 5C9UA 3VE7A 3OG2A 3W7HA 4BWLC 4O0QA 3OZMA 5HW6A 4HMNA 1XLMA 4DXKA 3OQ8A 4HU8A 1UWTA 4IIGA 1JZ3A 2VZOA 5CSSA 5GNYA 8A3HA 3OVQA 1CDGA 3UPMA 1F61A 5I2UA 3RN6A 1WKEA 3RCMA 5CC6A 5LIYX 2GZXA 4REQB 2M1IA 2J9YA 4Q8WA 2VEMA 3TYUA 5G4HC 4H6QA 3AISA 2INZA 5DO2A 3S1XA 4Z2JA 1H60A 1UROA 3MUZ1 3CZJA 4H83A 2BOGX 2H8XA 6REQB 4QSFA 3T8LA 3PTDA 4ZOCA 1A50A 2E9LA 4DH0A 4DBEA 3RITA 1HKJA 3G6MA 1I2NA 1H5YA 2Y5JA 2NV2A 5HMFA 4AY7A 1OFRA 2V67A 4I7VA 1YTEA 3L66A 4UR7A 3RIKA 4O1BA 1W8GA 1P0NA 5CPOA 1NOWA 2JBMA 3W0KA 1WZLA 1RVGA 4H19A 2DSKA 4K6AA 4I90A 3K2GA 1E3XA 4PC8A 3UCQA 4KFOA 5EMYA 2Z1KA 4WJ8A 1Q6UA 3BK0A 2VEIA 4NG3A 4UFLA 2QF8A 3W72A 1FWFC 4A8LA 3VIHA 5CSUA 3NZ1A 3WQOA 2OQHA 3LPPA 3JYMA 4ICMA 3KRUA 2JQXA 5C2GA 2H9AB 4PFHA 3WLIA 1X8CA 3PZ9A 1QPNA 3C2OA 3DOPA 3R8RA 3B03A 4JBRA 2DG9A 1XKYA 3WUGA 3LMZA 2YA0A 2XFRA 1O94A 4KEMA 1KCLA 5D75A 2VGGA 4PMZA 2J7DA 4PMYA 1WQ5A 1CPUA 5U4NA 1CXLA 3NR0A 1XH2A 3ZVHB 2D23A 3KOZA 3N2BA 4KQNA 1B90A 4O50A 4EIVA 4AZIA 1E40A 3BARA 4GY1A 4IG2B 2E77A 3M5XA 3UZZA 2PDIA 4JTRA 2OSWA 1RAKA 3E12A 1Z6KA 5FESA 1U5HA 3O5IA 2ZZ2A 5REQB 3QFEA 4A3YA 3JW7A 3AMGA 4XD5A 4X60A 1EYEA 2DORA 2G37A 3LYEA 3LI1A 5HNTA 4S2BA 5KETA 3I7SA 1XSJA 3AJ7A 3ZOAA 3CQJA 4GIVA 1DWJM 1BHGA 4HJWA 1UH2A 3VIJA 2ZVIA 4XAZA 2BVDA 4AUBA 1ECQA 2O9RA 1EP1A 1VJIA 2JIWA 1V6TA 3ZS4A 3UR2A 3JVAA 3H53A 1POJA 5A6BD 3TW9A 3AMKA 1UG6A 4Z0SA 4ACYA 4JDBA 5FEZA 1NM9A 3C0QA 3B8UA 5E70A 4O4VA 4NXKA 2O9PA 1PO9A 4HSNA 2BXZA 1OT2A 3NM1A 1IT7A 1S2VA 3U4AA 4RXFA 4F0MA 3BWWA 3SCUA 4KGLA 2K8IA 4ZSUA 4FR6A 5TNVA 1LUCA 2YDAA 3PN8A 5D2YA 3JXVA 4F9JA 2ISVA 3BQ6A 1NOFA 5AKQA 3CMFA 1VB9A 3VD3A 5M1TA 2PBCA 4MG4A 1CYGA 3O1NA 3B05A 5EMJA 2GJXB 1ZCNA 1EJRC 1Z41A 3MDWA 5AHMA 1AH0A 1EX1A 3CLWA 3MZ2A 2CHNA 2Q8LA 3GNNA 1KBJA 1KFLA 1Q6OA 1XDMA 2ANUA 4E2DA 3LNMA 2G41A 2P5NA 5K9CA 1PKMA 5K2ZA 3WJSA 3BAIA 4NNRA 3DDMA 3HZ3A 3B0UX 1RQHA 2P3ZA 4TX6A 5BXJA 4BFAA 1FY6A 3PANA 4E3TA 2ZZ3A 4U85A 1JXJA 1C9HA 4ZSTA 3PM6A 4TXEA 4IPLA 1RPXA 3S5OA 4OBTA 5EFDA 2DGAA 4HU0A 2D1ZA 2WSPA 4UTIA 4A21A 3WNOA 3QW3A 4UTWA 1JR1A 1B3OA 1ADDA 2X09A 5HW8A 4H9XA 1AL8A 3MHUA 4DI8A 4ERGA 1W1A1 2GUBA 3SADA 1SFSA 3MSGA 3DGRA 2FTYA 5FA5A 2FH8A 1KR1A 3DG7A 3L68A 3WYZA 4JNYA 3UG5A 5DT5A 2DT2A 4AZBA 3LHYA 3CK5A 3LG3A 4OUIA 3B06A 2WVVB 1R5YA 4UQAA 1KV8A 3E74A 2FZDA 3S1VA 3SCPA 2ZX5A 2Y85A 6XIAA 4DF2A 3KEHA 3NUKA 5LGXA 2YCEA 3W82A 4YIWA 4N4PA 3WJYA 1V02A 4GJIA 4TW6A 1OCNA 3QVQA 4J4OA 4LBRA 1IR2A 1XBXA 3PZMA 4D1JA 5DXXA 4ACZA 3NGJA 4UQEA 1LBFA 3HFTA 1Q65A 3NM3A 2OYLA 1UKOA 3ES7A 4YTRA 4QISA 2GQ9A 3QV6A 2J6VA 1DHPA 2XP9A 1ZJAA 2E67A 2PAJA 4AWTA 5C6MA 1Q45A 4US5A 4DRIA 2P50A 3PBMA 1ZBKA 4JS3A 2YOCA 3DFNA 4DWSB 1A47A 1BYCA 3IRSA 4C6KA 3EXSA 4J27A 1J01A 1KGWA 2FKEA 2P3EA 2YZ5A 3PG8A 1TSIA 1CEOA 2WMGA 1N8IA 4KRTA 4R27A 3PAOA 1WBHA 4O1AA 5IFTA 4IJBA 5LNSA 3GXIA 3CWOX 1J4EA 3DENA 4DQWA 3W7PA 5F1VA 1J0ZA 2VQUA 1F9CA 2Z7KA 3L4ZA 3LN3A 4I8DA 3W7NA 4AD5A 3AHZA 1QI4A 2D69A 2OLAA 4A3QA 3GBDA 1DWAM 1YYAA 5I07A 4IF2A 4BEQA 1E56A 3PPCA 3L4UA 4KWSA 5CKSA 3BMVA 2E0PA 4J3XA 4A6GA 1ZZMA 2WMHA 3THUA 3TSMA 4WD0A 5CQ1A 5C7HA 5B7ZA 2GJRA 2PU1A 1HJXA 4JXCA 4IT1A 1YQ2A 1EWDA 4IP4A 2L5HA 1FWCC 2NXIA 5D2WA 1B5TA 5JIWA 2ZZ6A 3CB8A 1QOPA 1A5SA 4RE0A 5AYZA 1W1PA 1OFOA 4F0RA 3NQ7A 2YA1A 4N2YA 3GM8A 3G3MA 3YPIA 1EC7A 1IEIA 3MYOA 2X2YA 1PB0A 3GXTA 3KOXA 4MJZA 2OFNA 3PB2A 3A6OA 3TNOA 1OGGA 5I77A 3M16A 3VAVA 5IBXA 1SJAA 2W9MA 2IKIA 3BW4A 2NXGA 1B3WA 2BY0A 4H3DA 1KCXA 3ARSA 2GVJA 4JTHA 3G8RA 3ZLFA 3OTRA 1KWKA 3GTYX 1JCJA 1PBGA 3BSMA 2WPBA 3UXLA 1C8YA 3P6LA 2JF6A 5HJXA 1UKSA 3CASA 4Y9OA 3OBKA 4IL0A 4PMJA 3TEVA 2BSLA 4CVWA 3PBVA 1EJTC 4HP5A 4C90A 4DJFA 1VKFA 1L6GA 2VFIA 4IHCA 4WDTA 4KCUA 3TX9A 4L4PA 3I3DA 2ZQUA 2XH4A 1ADOA 3VGHA 1JZ7A 2ZR5A 4I6VA 1G67A 1L9WA 2V5DA 1C91A 1M7PA 7ODCA 3AIEA 1Y5XA 1E6SM 4JTLA 1HF6A 2Z1SA 3IAPA 1DJYA 3TTSA 1GJPA 5JBDA 5AHNA 1NVMA 2MPHA 3PBWA 2YSWA 2W63A 1CWYA 3OHMB 1AL7A 3CUJA 2ZTJA 5D8WA 3CT7A 1B4KA 1F4HA 2O0TA 5LNUA 3VKCA 5HDRA 4W7UA 4C6PA 3TN3A 3RAOA 5K4XA 3K1DA 3G1XA 4TU1A 3W02A 1RZMA 4QT3A 4KS0A 2BLEA 2PDCA 4U10A 4G2DA 3P0XA 1P7TB 5BU9A 3F2BA 1NMWA 4U28A 3F4DA 3KLKA 4R85A 3W75A 4B90A 4LCSA 4XIMA 2I5QA 3VGFA 4WSJA 1Z42A 2TYSA 4JIPA 1XCFA 3OGSA 4HMEA 3FYOA 1BF6A 1XKJA 2C71A 9RUBA 3R94A 8TIMA 3UI5A 5L9FA 1ISZA 1VZWA 1JD9A 1KLYA 2EF9A 5MKGB 4C6CA 2GGEA 3W87A 3A4WA 3W28A 1U5JA 5HNNA 4ITZA 4DM2A 3EWYA 2GDVA 1UZHA 1OK4A 3RM8A 3O9NA 3UWWA 1UR0A 2FHFA 3TXVA 1FA2A 2HSAA 5CC5A 4AMCA 4IWWA 3W24A 4ATLA 1IQ8A 3S1UA 3GVWA 1A0CA 3KCJA 3UNDA 2I5GA 4I9TA 1SVDA 3UP8A 4OOUA 3PWAA 3LBMA 1WZAA 5FD0A 3ZVIA 2GVLA 5EPDA 3VIFA 4PB5A 2ZUWA 2ZADA 1XLFA 4NYUA 3HQPA 3JRKA 1XH0A 3KOFA 4ZQMA 3RRAA 3GXMA 5IBXC 1VFLA 4C6IA 1V7YA 4DAIA 4X61A 4JGDA 4MZ1A 3WQGA 3RFWA 2Y2WA 4PODA 2HWGA 2ITKA 3TUUA 1HT6A 4NUWA 1VCGA 1NFGA 4H9YA 3ITOA 3NO3A 4OT7A 3PJTA 3VOFA 2GUUA 4MM1A 3I6EA 3QOKA 1LROA 3LLXA 4C6JA 3W76A 1BQGA 3EA2A 4EE9A 2NX1A 3UCDA 1F8IA 1LORA 3LZ3A 4HJFA 4TR9A 4ATDA<