4Q7NA

Crystal structure of the complex of buffalo signalling protein spb-40 with 4-n-trimethylaminobutyraldehyde at 1.79 angstrom resolution
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of the complex of Buffalo Signalling protein SPB-40 with 4-N-trimethylaminobutyraldehyde at 1.79 Angstrom Resolution
rcsb
total genus 129
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4q7nA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4q7nA01
2BVYA 3VKKA 1PBGA 3AYSA 2BV9A 4UNIA 4MADA 1HKMA 2HVMA 4H8VA 4D71A 4Q22A 1EA9C 2CHNA 1H3GA 3UETA 1WAWA 5BYWA 1MW3A 2TAAA 3PZQA 4U2YA 3ARUA 3WEOA 2UY2A 2YA1A 5ABGA 3LMYA 3QOMA 3ARVA 3AS0A 3BSGA 1UQZA 1XD0A 1JD7A 4DUXA 4DWSC 3MUY1 1QNPA 3DECA 2GJPA 5D9MA 2D2OA 3AROA 1L8NA 3VVGA 3MMWA 2VX5A 4RE2A 3ZR5A 5A8NA 2BY2A 1B3WA 3KL5A 1BGAA 1RH9A 1GJUA 2Z1SA 5AYBA 2XG9A 4JKKA 4P7QA 4PCSA 2CPUA 3M6DA 1K9TA 1Q6GA 4E4PA 1ITXA 1E6QM 4BS0A 3VIKA 2DPEA 3WH7A 1GOWA 3L4UA 3L4ZA 5HOSA 1UH4A 3WH6A 2G3NA 4AC1X 3QR3A 2J7GA 1H0GA 1UKSA 2QPSA 1B3VA 3MANA 1GUVA 1XH1A 1BYBA 2VZOA 2Z1KA 1BVZA 1UR9A 2PWFA 4PSRA 2WKLA 5A6AA 4KH2A 3PZGA 1ZBWA 2XWDA 4CKQA 5A6KA 3WFLA 3WF0A 4CCDA 5CJ5A 5D9NA 1WDQA 5ABEA 5CXPA 3WIJA 2BS9A 1HKKA 3AIBA 4U31A 1RD6A 2WK2A 1QW8A 1UWSA 4CU8A 4WKFA 4QCEA 3DC0A 2PWDA 1C3FA 4LPCA 5I79A 1M01A 2YL6A 1KCKA 2C0HA 1BYAA 1SR0A 1UH3A 2ZE0A 2FDMA 4AD5A 4PMQA 4ZXOA 1E1EA 3VU2A 4OBSA 4TXEA 4HOXA 1JZ6A 1ZBVA 1H09A 4BCEA 4M82A 4PTWA 2RGLA 3WY1A 3VD9A 1F4HA 4OZOA 3L4TA 1XH2A 1NWUA 3AXHA 1CGTA 5EB8A 3K8LA 1LL6A 5HPCA 2WMGA 3K46A 1B2YA 4UFMA 4D6HA 5JBEA 3ALFA 2ZWZA 4W89A 1OINA 4V28A 4JKMA 4W7WA 4UZSA 3WDIA 5I23A 4YHGA 4C7DA 1RP8A 1CGXA 4CCCA 1W1TA 4PRWA 5BROA 5FD0A 1QNSA 1B1YA 1Q6DA 4PYSA 1QI0A 4ATLA 3AIWA 1OGGA 2WCGA 2ZX8A 4JIEA 3GBDA 3WD3A 1VJSA 1UOKA 1XRVA 1M7XA 2WMHA 4FLQA 3RMEA 3WMCA 4CD4A 4WSKA 1X6NA 1PZ2A 1ISZA 3A4WA 3AXXA 4AD0A 1E5JA 2WM0A 1EOKA 1EH9A 1A3HA 5A6BA 4N42A 4AZCB 2DT0A 3AICA 3GTNA 2VRKA 1XGZA 4P8WA 2YDRA 1JF5A 2JALA 2ZICA 1BGGA 4XUYA 1CYGA 4J3UA 2J7FA 4QDMA 3ECQA 1K9EA 1OT1A 2YJQA 3K4DA 1W1PA 1G94A 1H41A 3AI0A 4AEFA 3VTRA 4J3SA 3TP4A 1VRXA 1WDPA 2VZVA 3CZEA 3F5KA 4HTYA 3MUZ1 2BHYA 2ZX7A 4WLCA 4E2OA 3WNPA 4HU8A 3GNRA 3AMKA 2J8GA 5D9OA 3WBAA 5F7UA 1W1YA 3A4AA 1PAMA 1KB3A 3SUWA 2AAAA 1O7AA 1H2JA 4MB4A 4AZGA 1CTNA 4B3KA 3PTMA 2FHFA 1E1FA 4CN4A 2DGAA 4UOJA 3ZSSA 1TG7A 4HMCA 2FGLA 3GYCA 2W61A 3VX1A 4R5EA 2WHLA 1VENA 1JDDA 2VCCA 1HJXA 4AD1A 2V3DA 3WQ6A 4MJ2A 1UKOA 4KGJA 2VRQA 3W24A 1UR0A 1OCQA 2OYMA 5HPOA 4TOQA 3WD2A 5A94A 4AW7A 3FXYA 1C7TA 2YBUA 3VIJA 2A3BA 3VUPA 3RJYA 4DUWA 3WF3A 1UR2A 2PF0A 1FH8A 1CXHA 1KXQA 5JBFA 5DMYA 3IJ8A 3KL0A 3N18A 1DWIM 3CGTA 2WNWA 2OYKA 3AMCA 4H04A 3AYRA 3CUGA 4PUEA 1E73M 2BY1A 1JAEA 1EOMA 2J79A 9CGTA 2DT1A 3NYDA 5E09A 6CGTA 2VVSA 2ZUMA 1W9DM 2WHKA 4HZ7A 2VCBA 3T0DA 2VTFA 3CUFA 2DT3A 4DWSA 3CZJA 1B9ZA 3NDZA 1C8YA 4BF7A 5I6SA 2XGBA 4U3AA 4URIA 4QLKA 4P8XA 1ISXA 3VDHA 1CXIA 4AWEA 3NSMA 3RPMA 2W62A 1J0ZA 4RL3A 1MVYA 2DSWA 3FAWA 3BAKA 3LPGA 3MO4A 3VIPA 1ZJBA 5BXSA 3T0AA 1CXLA 3WDJA 1VBUA 3WQ5A 1UD2A 3AZSA 3RM8A 2OWXA 1UWRA 4F8XA 1UWTA 4UQ9A 1YQ2A 1UD5A 3ZSTA 5A69A 1LJYA 3VO0A 1EQCA 4XZWA 1J0JA 1OGBA 2BHZA 7CGTA 4GPNA 3SUVA 1KWKA 4AZCA 1JF6A 3T0BA 1TR1A 3W0KA 4RE4A 4KMQA 1MW1A 3VGDA 4C7FA 1EGZA 5I0DA 2YBTA 2GJRA 4JFWA 1CGVA 1MXDA 5IHRA 3MMUA 4UFKA 4MAVA 3VGHA 1CGWA 1JYNA 1MQQA 3T09A 3VIFA 2DSZA 1KBKA 3SCWA 4X0VA 3AMDA 4GIAA 3ZJKA 4TX8A 2XM2A 4AZ6A 1UHVA 2C8NA 2CBIA 2UWFA 4XZBA 1SMAA 5LA0A 1HJQA 1E6NA 1HJVA 2XPKA 1GQKA 3MUAA 1C8QA 1V02E 3WQ4A 2J47A 3WD0A 1GCYA 1JL8A 3JUGA 3O9NA 2XWEA 2FHBA 3BC9A 2XVNA 1G5AA 1HNYA 1XCWA 2V3GA 1HL9A 1UA7A 3VILA 2QLYA 3PZMA 4A4AA 1XSJA 4JHOA 1ZU8A 3OBAA 3GDBA 4CN1A 3WH8A 1H0IA 2CCRA 2EJ1A 3AOFA 2XSAA 5BXRA 3B9AA 4GO9A 2Y8KA 1AQMA 3T2OA 1E43A 1QBBA 2WMFA 2GSJA 3CO4A 3F4VA 2WHMA 3EYPA 2CEQA 2DSKA 2WLYA 2VQTA 3WQWA 1UZ1A 4QFUA 3VD4A 1LG1A 1OGSA 2EPMX 5HBFA 5GNZA 3CBWA 3SCTA 1OSEA 2F61A 3THCA 5A2CA 1NOWA 1JDAA 1QNRA 1J11A 1CIUA 3K4AA 1V3HA 2WC7A 3CHFA 4D6EA 4U33A 4JL2A 5FKYA 2ZUUA 3TONA 3SCOA 1MW0A 1MXGA 1V03A 4MNJA 1KXTA 3NSNA 1TE1A 5IDIA 3GM8A 2YL5A 1C7SA 5IHSA 5AYIA 4LYQA 3ARTA 1ZS2A 4OKDA 3ZM8A 2VC9A 1WCGA 2X05A 1W9PA 4HZ8A 3ZO9A 4EE9A 4R27A 5A95A 3M7SA 1J9YA 1JZ5A 3POHA 2J75A 1I1XA 2D0FA 4KGLA 3ZIZA 1GNXA 1VFMA 1QHOA 1HVXA 3CMGA 2D20A 4HP5A 3WEMA 1Q6EA 3QHNA 1J01A 4PUDA 1FHLA 2ZOXA 2D3LA 3ARSA 2DT2A 1ZJAA 1C93A 3EDDA 2WVVA 4V27A 2CNCA 2BY0A 4AXNA 1GVIA 5EFFA 3N1AA 3O6AA 1R86A 1ISVA 1QOXA 3VGGA 1BLIA 3BLPX 4A3HA 1J12A 1TVNA 5D8WA 3UERA 1KGUA 2Y5EA 4W85A 1X6LA 1JG9A 3UG5A 2OLHA 1SFSA 2VX6A 4AMCA 2RGMA 2EXOA 3NIYA 1I75A 2DH3A 4PBGA 3ZJ8A 1BF2A 1DP0A 3AS2A 2ZX6A 3OLIA 2E8ZA 2QPUA 3AIUA 4H2CA 5FL0A 3U57A 3W4RA 4UQBA 2QF8A 1C92A 1Q4NX 4Z2JA 3IJ7A 2CITA 3GH5A 3WENA 1WZLA 2WHJA 4AD3A 1Q6CA 4J3TA 1XSKA 1Q6FA 5AC4A 3RM4A 2YLAA 5I77A 1X1NA 1BPLB 1DWJM 4HOWA 3VD7A 2PI6A 4QLLA 3WNLA 4B9ZA 1EDGA 2A3EA 1V0KA 4PMZA 2ZUVA 2VI0A 1V6VA 1ZBKA 1CGUA 4W93A 5KEZA 5FCZA 2WMIB 3KL3A 4JCMA 3SCNA 3FHAA 1EO5A 3NSXA 3WDHA 2QV4A 4OBRA 1S46A 4OOZA 2WKGA 3VX0A 1JXJA 4B3LA 1FOBA 2FH8A 4N0RA 1HJSA 4CCEA 1W3KA 4D6GA 2JF6A 2O9PA 4Z2HA 4M56A 5CQ1A 3WFZA 2WWCA 2W63A 2VCAA 1PX8A 4TUFA 1E0XA 4GINA 3UG4A 2WPGA 1WP6A 6TAAA 3B9EA 1EO7A 2D22A 4DM1A 1J0HA 1NOUA 4W8AA 1VEOA 2D23A 3F5JA 1W3JA 5M3WA 5ABHA 2DSVA 2BHUA 3ZT5A 4ATWA 3O2LA 1NWSA 2VQUA 5I3DA 3L4XA 1BSIA 3OZPA 2BY3A 4J3WA 4P8VA 3TTQA 1E72M 4AZBA 3G6MA 3SUSA 1ODUA 2ZWYA 5M17A 3VMNA 4UFHA 2V3FA 4ACZB 5I24A 2X2YA 3OLDA 1DHKA 4FK9A 1QVBA 2J77A 3K8KA 3I3DA 2AOSA 1VIWA 3MS8A 2PB1A 2ZUSA 4GO8A 2GDVA 4UFJA 1MFVA 3AZRA 3PZOA 3UR7A 1GPFA 4LYPA 2GK1B 4GI9A 1LWHA 3VM5A 3UESA 3NCOA 1UWIA 1RPKA 1OD0A 4AD4A 4JFUA 1QHPA 3SCRA 4CVWA 1CXKA 3OLEA 3OGRA 1TZ7A 5C71A 4AZHA 1PPIA 4PTXA 1GJWA 4H7VA 1QNOA 2WCSA 3WKZA 1JYWA 2W92A 3MSGA 4X0NA 3AMLA 4UCFA 2YDSA 4FLOA 2NT0A 2VOTA 1XYFA 3IAQA 3VGBA 1GVYA 4NSBA 1AQ0A 4DUVA 3W81A 1UUQA 3AS1A 2X1IA 4CD6A 4HPGA 4TVCA 1W3LA 4PMOA 3S6TA 3N12A 1UYQA 1VEPA 3CZ8A 3CHCA 5JBDA 5JH8A 2IXUA 1KXHA 2Y4SA 3CUJA 3TA9A 1BQCA 1FHDA 2J7BA 4H41A 4JKLA 1V0NA 5CLTA 1RP9A 1BYDA 2PC8A 2WMIA 1E4LA 4M29A 5JIPA 1PX3A 4IPNB 4GKLA 2NW0A 2IUZA 1HIZA 2GVYA 4MB5A 2CKSA 2VX7A 4D6JA 5FIPA 3D3AA 3WEZA 4EAMA 5A6MA 1KWGA 1CEOA 5AC5A 1JI2A 2B31A 4ML4A 4XB3A 3WUGA 2D24A 4PMDA 3RILA 2CXGA 3TTYA 4ACYA 1XSIA 1J18A 1W32A 3MUIA 4PMRA 2WC4A 3GXDA 3RM9A 5D9PA 5BRQA 1US3A 5FL1A 3RDKA 3FN9A 5EBAA 3ZT6A 1QI5A 3OGSA 2VZTA 3N13A 4KRTA 2O9TA 4XX6A 1IZJA 3ARQA 4D1IA 1E4NA 2XUCA 1US2A 1FFRA 1XCXA 4UTFA 1UR1A 1W9BM 1GQLA 3NUKA 4P7RA 2CKRA 1BYCA 2NSXA 2V5CA 1R85A 1HKJA 5A2AA 1VJZA 3PZVA 1J0YA 3BMWA 1UKTA 3AHXA 1Y7VA 1HX0A 4J3VA 2VJXA 1JZ2A 3FNDA 3WQ8A 2XVPA 4PCTA 4W84A 4UFLA 5D8ZA 1CNVA 3VNYA 1V6XA 1AQHA 3SCVA 4ACZA 3EMZA 4CGTA 1VF8A 1OT2A 2VURA 3AXIA 4W7VA 1DWAM 1NOFA 3VGFA 5ABFB 1KFWA 1EDTA 1HF6A 2XHYA 3BH4A 1V6WA 1GW1A 4GI6A 4UQDA 2JIWA 3VIOA 3VIIA 4W8BA 2GK1A 1DTUA 1GOOA 1Z32X 2ZIDA 3DYMA 1WE5A 2D3NA 2XGIA 1VB9A 2GJXB 2FGZA 5GNYA 4D72A 5E6YA 3J7HA 1NP2A 4Z2GA 3CZLA 2VR5A 1UA3A 1U30A 2WC3A 1JZ8A 2JF7A 5A6BD 2YA0A 4CUCA 3WNMA 3MKKA 4J28A 2BFGA 3QHMA 1J0KA 2J8FA 2Q8XA 1WKYA 4D1JA 4AIEA 1LL7A 1L0PA 3VDAA 1HVQA 1KCLA 3EBVA 1HT6A 5ECUA 2E9LA 3OB8A 1BVNP 3NJ3A 4GZIA 5GNXA 1WDSA 2WZIA 4TVDA 2G4FA 4P7OA 3AFBA 2XTKA 4W88A 2WYSA 1FH9A 3BAJA 3K1DA 2GFTA 4CD7A 3ARYA 1E40A 2V5DA 1UZ4A 2JEQA 3EMCA 1E56A 4X9YA 2WVSA 1LWJA 3N9KA 3OA5A 1GZJA 1TCMA 1FA2A 4AIOA 3ZR6A 2JEPA 1B0IA 5CZKA 1UG6A 3T2QA 3AIVA 4NF7A 3AHVA 5A6LA 3PZNA 3A6OA 4YPJA 1UQYA 1NP0A 3SEPA 2ZUWA 3GZAA 1XV8A 4EKJA 1M03A 2EBNA 3RIKA 1EXPA 2J7CA 4GZEA 2AMGA 4IPLA 4H8HA 1M53A 3CUHA 4WK9A 2X0HA 1QI3A 2E3ZA 1CENA 5DF0A 1ODZA 3WN6A 1PZ3A 1GONA 1WPCA 1QI2A 3WELA 3VMOA 2ZX9A 4F9JA 1G1YA 5M03A 1GHRA 1OIFA 4IISA 3TTSA 1UD6A 4U5IA 1JFHA 4KWUA 4UOQA 1H1NA 2OSYA 4MNMA 3QGVA 5HXMA 1U2YA 5I5RA 4KRUA 3T08A 4E8CA 3U5UA 2EPOA 4C7GA 3D5HA 2XFRA 3EDKA 5A8MA 4PMNA 5A3HA 4DWSD 1W9VA 2BXZA 4WSJA 3SCPA 2OWCA 5I78A 2VRJA 5ABFA 1EHAA 2DEPA 1V3KA 2XIIA 2A3AA 2F2HA 2YOCA 2ZXDA 1D7FA 4BA0A 2UY5A 7A3HA 3W6MA 4ZENA 2WSPA 5D4YA 2GUYA 2YDQA 1WZAA 1UR4A 3WUFA 3CH9A 4NRSA 2W91A 2WBKA 4D6CA 2VT0A 2J25A 3CHDA 2CIPA 3WH9A 1E0WA 1H4PA 3F5LA 5GPRA 2DIJA 3IK2A 2GJXA 2QMJA 1HL8A 1MFUA 1NWTA 5HNNA 5A6JA 2CESA 1J0IA 3WL1A 4J3XA 4OOUA 1LQ0A 1E55A 4IM4A 1QNQA 3TTOA 2W66A 3ZJ6A 3W38A 2MANA 1ZBCA 4UQCA 3AMGA 3WSUA 2E8YA 2CETA 2BXYA 2CHOA 4RE3A 1U33A 1DEDA 4NZCA 1GOMA 1XH0A 3L2MA 3BCDA 3UR8A 4UQAA 1LLOA 4ZXLA 1I1WA 4LYRA 2UY3A 3IJ9A 4CD5A 3U7BA 1OIMA 4MJ4A 8CGTA 2QHAA 1GHSA 1QI4A 4PMYA 3I3EA 3RJXA 2EPNA 3KWXA 1WO2A 4ZEPA 4QCFA 3HJEA 4D6IA 1V0MA 4FLSA 2G3IA 2YL9A 3A47A 3CLWA 2J4GA 2C7FA 3GH4A 5A2BA 5E70A 2WLZA 4ATDA 4P8UA 1UWUA 3RO8A 2XM1A 4E8DA 1TUXA 2G3MA 5FOOA 2J7EA 3UCQA 4B16A 2GDUA 1V02A 1P6WA 3ZQ9A 2YL8A 2WVTA 5CLWA 2PBOA 3VMPA 4PTMA 3WDPP 3BSHA 2CBVA 1ISYA 1MWOA 3OG2A 3WD4A 3PTKA 4L4PA 3RCNA 2XFFA 4M8UA 2DQXA 2O9RA 3ZJ7A 1DWFM 2JE8A 3EDFA 5C8BB 3WMBA 2G3JA 2PBGA 4HPHA 4P7LA 3W82A 4PEEA 3B8SA 2UY4A 3A4XA 4AZ5A 1K9DA 4FLRA 2QMKA 1ECEA 3B9DA 2DH2A 1XD1A 1E6ZA 1GQIA 2ZXAA 1WB0A 4PMVA 4W5ZA 1UKPA 1O6IA 3QOKA 3VDCA 4YHEA 2J7DA 3BAYA 2CYGA 1JZ4A 3E1F1 3AHZA 4Q7NA 1E4IA 1N82A 3TOPA 1FFQA 5LA2A 2XYLA 4F79A 4EANA 1ZL1A 4MNLA 2X0YA 4L4OA 2EPKX 2XJ7A 3WUEA 3HN3A 1A47A 2XVLA 4MNKA 4PN2A 1D3CA 4AISA 3UEQA 5CPQA 5IXEA 2BVTA 3CZKA 3SURA 1WNOA 1FH7A 1R7OA 2J74A 2XIBA 1MW2A 5EFDA 4HA1A 2XVKA 1V08A 2IXVA 1QHZA 4GQQA 3VNZA 4TTGA 3ARZA 2VX4A 1B3ZA 2OYLA 3GNPA 3BGAA 2FH6A 4UZUA 2BNJA 5M5DA 3MV01 1W1VA 3SUUA 8A3HA 3APGA 2VUYA 3L4YA 3M07A 1W3HA 3BAWA 4D6DA 3AIRA 3AHYA 4GZJA 2VO5A 3VD3A 1V6YA 5DFAA 1NARA 3ARXA 1B3YA 1E4MM 4MB3A 1GOKA 2VZSA 3MSDA 5CPTA 3GNOA 1LL4A 1QPKA 3L4VA 3T2PA 4AZIA 2ZXQA 5I2UA 3WF4A 1IT0A 1KGWA 1E6SM 1TVPA 2D0GA 4B15A 3AS3A 1CLXA 1W2VA 1JDCA 3CIVA 1VAHA 3IANA 1CGYA 4W7UA 2WANA 3ARWA 2WMJA 1CBGA 1JYXA 6A3HA 1JXKA 3FW6A 4A3YA 1BFNA 3DHUA 3LPFA 4U2ZA 4ZE5A 4CVUA 3SCUA 3WDRA 2ZX5A 1EIBA 1OBAA 3VGEA 2VVNA 1TA3B 5JIWA 3MU7A 1G01A 2NT1A 1ISWA 4JHZA 1YHTA 1G9HA 3N11A 3VPLA 3W29A 1TMQA 3WL0A 4MTVA 4DWSB 3PZIA 2EPLX 3CHEA 3U7VA 3VIMA 3LPOA 2XVGA 4M81A 3W27A 4PTVA 4Z2KA 1KXVA 1UH2A 2VL4A 1ESWA 3SCSA 4PMXA 3PZ9A 1JZ7A 4F66A 2WW5A 1V3LA 1W2PA 4YN5A 1CLVA 1UD3A 1PIGA 1VEMA 3GXMA 4W86A 3GH7A 2E0PA 4QLJA 3S2CA 3ZT7A 1XYZA 4GQRA 3WD1A 1C8XA 1CXFA 1JZ3A 4MB1A 1GOQA 3DYPA 2E4TA 4ZE4A 2ZUTA 2YA2A 1JFXA 1HP5A 4UQEA 1CECA 1WZMA 1E71M 1PEZA 4JL1A 4DM2A 3AISA 2X8RA 1MQRA 3OIHA 2PWHA 4IUGA 1R87A 5CSYA 2WBGA 1CWYA 4MDOA 4AY1A 3WMSA 4WIWA 1E0VA 1SMDA 5DO8A 2V38A 4UOZA 2PWEA 4HMEA 1PIFA 2EO7A 2HISA 1J10A 4FF5A 2VMFA 4JFSA 4M1RA 2FHCA 1JIBA 1PJ9A 4WKAA 4WJXA 3KE0A 2F8QA 3FY1A 1UD8A 1DWHM 2CERA 1K9FA 4Z2IA 4PMUA 1BG9A 3PZTA 1KBBA 3FHQA 1E9LA 3W6LA 3VDBA 1WDRA 3SUTA 2O92A 1C91A 1E15A 1HKIA 2X09A 3I3BA 3POCA 1OWQA 1KGXA 1W91A 5CPSA 4MDPA 2XSBA 3OZOA 4GI8A 1HJWA 4W87A 1IZKA 1VFFA 2Y8VA 3EDJA 1R8LA 4V2XA 1ITCA 2WVUA 3BAIA 1HJUA 1G0CA 2WMKA 4TTUA 1E3ZA 2D1ZA 1SYTA 4HMDA 4XV0A 3PBGA 1XHGA 5E6ZA 2E9MA 2OWWA 1NQ6A 5C70A 5A8OA 1AVAA 3W28A 3N15A 1JAKA 4BZYA 3SIMA 4JFVA 2DDXA 2WZHA 5A8QA 4CN6A 4OIFA 2G41A 2ESCA 5E0CA 4J7RA 5TD4A 1B31A 4MAZA 1D2KA 1ZB5A 1TA3A 3EMQA 4LX4A 2W5FA 3HMCA 1OB0A 4NI3A 4HU0A 1AMYA 4AD2A 3WDQA 3DYOA 3PZUA 5GQBA 2O9OA 3CPUA 1WZKA 3ZMRA 2E9BA 2YLLA 4EK7A 1F4AA 4JCLA 1E70M 3GBEA 3N17A 2J62A 4MPKA 3OGVA 4WF7A 1KQYA 3THDA 3WBEA 3AHTA 4AEEA 1LG2A 1NWRA 4HZ6A 1VFUA 5DT5A 1LF1A 1GORA 5JUVA 3L4WA 1W9XA 2ZXBA 2WVVB 1B3XA 1EQPA 1JNEA 2DIEA 3AZTA 1OD8A 5E9AA 3ZOAA 3WF1A 2WB5A 2YIHA 1HN1A 4OUEA 4HOZA 5E0FA 1CZ1A 4TX6A 3KEHA 4K68A 3NDYA 4M24A 3SCQA 1K6AA 3UG3A 4CU7A 1CDGA 2WWDA 2XFYA 2D0HA 2JIEA 3MV11 4H8UA 3GXIA 3G6LA 1CPUA 3AJ7A 5BRPA 1MQPA 1W9UA 4QAWA 5CG0A 3AQUA 2OSXA 4BQ4A 4W8LA 4UFIA 5BXPA 3ARPA 4UR9A 2JFEX 1TFVA 2WCAA 1B90A 3PN8A 2VZUA 2VR4A 2YKKA 4B9YA 1EHNA 5CGMA 1JNDA 1UD4A 4M80A 3W25A 4U3CA 1H49A 1B30A 1H5VA 1OM0A 4D6FA 1E6RA 1KQZA 3PTQA 4S3KA 3BAXA 4P7NA 3BMVA 4U5KA 3W53A 3CMJA 4Y7EA 4BQ5A 2Y24A 3VOCA 1GQJA 1NM9A 2BVDA 3HU7A 1BAGA 3BLKA 1IV8A 2Y2WA 4JAWA 1XC6A 1GOIA 3QHOA 4HA3A 3WH5A 1VBRA 1UR8A 2WSKA 2WXDM 3WQVA 2EEXA 1VFOA 1NH6A 5LA1A 3K8MA 5A1AA 3ARRA 2CBUA 4LXFA 4QP0A 5EMYA 1BG4A 4TVUA 3M46A 1UWQA 5BXTA 1MYRA 1V3IA 1PX4A 4WKHA 5BWFA 3L2LA 5CGTA 5CSUA 1JD9A 3WF2A 3VD5A 1V3MA 1JI1A 4AIUA 3ALGA 1UKQA 1V3JA 4AZ7A 3BCFA 1DWGM 1KR0A 5HDRA 1E6PA 5DT7A 1E3XA 1HP4A 3LPPA 1JGIA 1FP9A 3AIQA 4Z2LA 2E40A 4J27A 4CD8A 4F9DA 4JFTA 1JYVA 1V6UA 4GXPA 2W4XA 3A3HA 2WZEA 3KZSA 3VIHA 1FP8A 3W26A 3U5YA 2J78A 4JZ5A 1BTCA 2J7HA 5AY7A 2A3CA 1E5NA 2VNCA 4BQ3A 5LYRA 1E6XM 3WNKA 5A8PA 3MMDA 3WUBA 2A3HA 4HA4A 3VM7A 1H11A 1V0LA 3IAPA 3FAXA 3WNNA 5A6SA 5IFPA 2EQDA 3AIEA 4FMVA 3VIGA 5DEZA 1KR1A 3GXFA 3DHPA 3WNOA 4OJYA 1CXEA 2W67A 3OLGA 1BHGA 4W5UA 3W37A 2WAGA 4PSPA 5BCAA 1M04A 2V3EA 4LQ1A 1C90A 3CTTA 5KZ6A 1QBAA 4BQ2A 3N04A 4ZFMA 1HXJA 3PHAA 2PWGA 4LGXA 5IFTA 3BXWA 4NRRA 2G8ZA 4AYSA 3EDEA 2OSWA 3II1A 3CUIA 2DSUA 3CZGA 1EDQA 7TAAA 4S3JA 3VINA 2CBJA 1R7AA 1QW9A 2ZUNA 4CU6A
chains in the Genus database with same CATH superfamily
3TN6A 5DANA 3O0KA 1PBGA 3ZWTA 1FHVA 3ANYA 4UNIA 4MADA 4H8VA 3W87A 2CHNA 4Y6GA 2XDFA 4M1BA 3UETA 3G18A 3ABQA 4GABA 2FVKA 1MW3A 3ARUA 2XP6A 1QPFA 5ABGA 1QATA 1A5NC 3B4UA 3LMYA 4GC4A 5E5CA 4QEEA 1AW5A 3DECA 1JQXA 2D2OA 4R88A 4U85A 1YMYA 4K39A 3VK5A 4RE2A 2VN1A 3OVPA 1U79A 3WYZA 1LLZA 3WLNA 2VC7A 1AL8A 5TBOA 5AYBA 2XG9A 2XP9A 4JKKA 2ZADA 3QRHA 4P7QA 1Q7QA 2CU0A 3M6DA 3W01A 3S5OA 2IS7A 3XINA 3S46A 1QAPA 3EIPA 3T6CA 1Q63A 3PWIA 4ERGA 5F2GA 4Q8WA 1EXBA 4HBEA 4PE8A 1UR9A 4M6QA 2KO7A 1VZWA 4KH2A 3QYQA 1LQ2A 3WF0A 1C29A 3NZPA 3SY8A 5ABEA 4PUNA 3PM6A 4JTHA 1HKKA 1QW8A 3BJSA 4CU8A 2OOGA 1LUCB 1MDLA 2Z2BA 3RFAA 1D3HA 2YL6A 3ME3A 4E3VA 4A6GA 2ZA1A 1SR0A 3TE9A 1U83A 4HSNA 3BZGA 3TDBA 4TW7A 4PMQA 3M0VA 4ZXOA 2XH4A 3EB3A 3EWYA 1H09A 4M82A 2RGLA 3VD9A 5EBUA 1DPMA 3NO3A 3MP4A 5EB8A 1Q85A 3K8LA 4UFMA 4D6HA 2I1OA 2YW4A 2A7PA 3NOEA 4V28A 5AYYA 1I2RA 1GZGA 3W3OA 3QPZA 4AWSA 3ZFHA 4H4IA 2OU4A 1W1TA 2G0WA 2VD9A 4MWAC 4PYSA 1QI0A 1AH3A 3S83A 3FSTA 1Z44A 1JEZA 4NXSA 3L0KA 2ODOA 2B7QA 3GBDA 3FOKA 3WD3A 1VJSA 1OFDA 1UOKA 3PY2A 1M7XA 1EJXC 2Q02A 1Z41A 3VDGA 3AXXA 2V9DA 2R6OA 4UIOA 2A0NA 3H54A 4GXMA 1R2RA 3TQPA 4RZ4A 2BG5A 1EOKA 3UY8A 1XIHA 1LLWA 1FKDA 4AZCB 3GTNA 1UCWA 2OFJA 1AJ2A 4P8WA 3P0WA 2YDRA 2BBFA 2BGSA 2ACRA 1CYGA 4L3NA 2EJAA 1RBLA 2YJQA 1G94A 5AC6A 3N9SA 1J2BA 1R3VA 2VZVA 2ONEA 3W75A 4B5NA 2C3ZA 1FTXA 3N2BA 1UPPA 4K2SA 4HU8A 2RJHA 3FA5A 4NZ3A 2PDUA 1RBOB 2J8GA 4KEUA 5F7UA 1W1YA 4GXWA 2AAAA 1O7AA 5LXXA 4AWTA 3QLDA 4IMCA 4LUSB 4Q4RA 3M0LA 4UTHA 3ZSSA 1TG7A 2RDTA 4HMCA 2V68A 2W61A 2ZQUA 4I6KA 4R5EA 1F8IA 5D30A 1A5MC 1L6YA 4NJHA 3W24A 4XIMA 3A5FA 1NEYA 5U4NA 4XVEA 1HO1A 2MF9A 4TOQA 3WD2A 4MJMA 3VZZA 3FXYA 5AHFA 3TYUA 3VE7A 3KAIA 3WF3A 3SIZA 4LVGA 2EKCA 4KQNA 3DCPA 4C1LA 1CXHA 1EC7A 1X7FA 2FFIA 4H04A 3H2FA 3NVDA 3R25A 4HQVA 2J79A 9CGTA 3G1AA 3ELFA 5FAGA 2DT1A 1ICSA 4XD6A 2PU1A 4GGBA 2WHKA 2VCBA 4LVDA 3H70A 3UXAA 4R85A 2ZR5A 3CUFA 2DT3A 3DENA 3NDZA 4BF7A 5H2ZA 3GG8A 4URIA 3MVIA 3D0CA 3VDHA 2E25A 3IK4A 4XVDA 2HNEA 1DJIA 1CXIA 3EY6A 3RPMA 4FNTA 3TWAA 3T0TA 1DQUA 2V2DA 2W62A 3CIWA 4RL3A 4Q8UA 1MVYA 1XYCA 3VYLA 4NZJA 3BAKA 2FKPA 3W7HA 5BXSA 3T0AA 1VBUA 3WQ5A 1UD2A 1UWRA 4UQ9A 1YQ2A 1UD5A 1S5NA 3QKEA 1W5OA 1LJYA 1ZRQA 2DU2A 4XZWA 2Y61A 7CGTA 4QX4A 3RYSA 1JF6A 3DOPA 4LNCA 3T0BA 4PB4A 1NDYA 2IPFA 1HTIA 4JTAA 2PDCA 4KFPA 3EA2A 4MKNA 1CGVA 1Q6IA 4MAVA 1VPQA 3VGHA 5DCDA 4J5NA 4R33A 1JYNA 3T09A 3VIFA 4HMNA 3BJFA 2ABAA 4TX8A 1D7JA 4IP4A 1XUUA 4QJ1A 4AZ6A 1BXBA 2C8NA 4US5D 5AZ0A 1KM3A 4Q4OA 1KFEA 2CBIA 1FKLA 5LIUX 4Q4PA 3W7EA 1HJVA 2XPKA 1V02E 1FXPA 4JD4A 2WJFA 1B57A 1SQ7A 5FEXA 4DPQA 5D04C 1GKPA 3O9NA 1BKFA 3MSYA 1TJPA 2V69A 3PZMA 4MY9A 4G9PA 1AFSA 1ZU8A 3OBAA 3WH8A 3KOYA 2CCRA 2XSAA 3B9AA 5B7YA 1VPXA 1YBQB 2J27A 3T2OA 1CX9A 1E43A 2EF9A 2DJLA 3M6YA 1EZ2A 4GJ1A 3QZAA 4M7TA 3DESA 2FMOA 3MCOA 2DSKA 4XK2A 4PULA 3WQWA 1U5HA 2OODA 5LNVA 3S1WA 4HYWA 4QTGA 1YDOA 5GNZA 3DDMA 3SCTA 1OSEA 2I16A 3AC0A 1J11A 6PTDA 4H01A 3T40A 3SADA 3CHFA 4D6EA 3NGFA 3NSNA 1E51A 4Y8FA 3ODKA 2O0TA 1ZZMA 3GXNA 2MNTA 3LSCA 3L5LA 2QJJA 1Y5XA 5HAOA 3WLQA 2VC9A 1RCOB 2X05A 3KVJA 4R27A 5A95A 1J9YA 4DJEC 1DIDA 1I1XA 2D0FA 3P5YA 2VYOA 3D3FA 1HVXA 3CMGA 4NAEB 4KW2A 2QJIA 2Y70A 1D3GA 1FBAA 3UFYA 1I6NA 3EDDA 2WSRA 2WVVA 1DBTA 3EWBX 5D33A 4AXNA 2PAJA 3N1AA 3O6AA 3VGGA 3DHFA 1BLIA 2VWSA 3C52A 4A3HA 4EWJA 2YGYA 2B0MA 4NKCA 1KW1A 3MZ2A 5D8WA 2Y5EA 1V77A 3IGHX 3WQPA 3W7JA 2V67A 3SI9A 2VX6A 3GHTA 3NA8A 1TRIA 2DQWA 2OOFA 4PBGA 3ZJ8A 3AS2A 2E8ZA 3NURA 3W4RA 4UQBA 5E1QA 1Q4NX 3IJ7A 1EP3A 2VP8A 3WENA 1ME9A 1EUNA 1XSKA 4LVBA 1L2QA 3OZYA 5CZ0A 4DZIA 5D2WA 4NIRA 1BPLB 4HOWA 3N2OA 5BW6A 2VFFA 5H8MA 2VI0A 1ZBKA 1CGUA 5KEZA 3RLUA 4KRZA 4DRKA 1TSIA 3BQ6A 3HPFA 3NZGA 4F2TA 2VCDA 2NQHA 2DFAA 1S46A 5FF3A 1JXJA 4IJCA 3KOFA 2RDWA 2P10A 4B3LA 3H2MA 4FX8A 3SQLA 4C91A 1HJSA 2ICSA 1NSJA 4D8LA 3HFTA 3PANA 5F4XA 1EYMA 5CQ1A 1M5WA 4WUIA 1LYXA 3WFZA 1SO6A 2VCAA 4TUFA 3U2ZA 4IQEA 1SZRA 1VC4A 3UG4A 3BOFA 2WPGA 3WJXA 2E67A 3E02A 1Q2SA 6TAAA 3B9EA 1A49A 3SJ3A 1FUYA 4W8AA 2RJGA 3B0XA 3KAGA 3BMXA 1W31A 1W3JA 1QU4A 2Z7GA 1ZAJA 5CC5A 5M3WA 3FXGA 2BHUA 2NXIA 1OG6A 3O2LA 1A5CA 3I6CA 1U5JA 3L4XA 3G24A 1WUFA 3IUIA 4P8VA 4AZBA 3EOUA 5M17A 1SFLA 3OLDA 4X61A 1DHKA 1JPMA 1H7PA 1R30A 3EA1A 1VIWA 3BOXA 1ZAIA 5CPMA 3R7MA 1I2OA 3W7OA 3HZ3A 4IFKA 4GI9A 1LWHA 3VCNA 2GVEA 1I45A 4WXZA 1UWIA 3VKAA 4OECA 4U28A 4BJHA 1ZPTA 3QTPA 2Y5SA 3EX3A 4PTXA 4H7VA 3UNTA 1EGMA 2WCSA 4QS6A 5DO2A 1JYWA 3MSGA 2MUCA 2HS6A 4X0NA 3BCJA 4UCFA 2YDSA 1ZK6A 4FLOA 3QC0A 2VEIA 1XYFA 4DT4A 4X9SA 4N02A 4TVCA 3EX4A 4F0SA 1T0OA 5TF0A 2E6AA 3APYA 4GBUA 1XG3A 4S3DA 3GU0A 1TIMA 1KXHA 4AHQA 2NWSA 2QGYA 4H6QA 1NVMA 3W1AA 2J7BA 2ZRXA 1V0NA 1BYDA 4GKLA 2HNHA 4MB5A 4JX5A 2BGQA 2VX7A 5FIPA 3WEZA 3AU2A 5A6MA 1AUSL 1CEOA 3KADA 3LUTA 3HGRA 3LCFA 4ML4A 3WUGA 5C9UA 2CXGA 3TTYA 5FSDC 1XLCA 1VPYA 3W2KA 1J18A 1W32A 4MLJA 1FCVA 3GXDA 4AHPA 3RM9A 1MRQA 2FVLA 3G0SA 4YNGA 3JVAA 3GU9A 1QI5A 1LOSA 3S5YA 3E3HA 3V0TA 4XX6A 1LROA 1E4NA 1US2A 1FFRA 1YDVA 5C7VA 1UR1A 1IHIA 2AMXA 2CKRA 2NSXA 1ML1A 3PR9A 2R14A 4BI5A 3TQKA 3S2MA 5F2LA 2ASHA 1A7XA 1JCHB 1F5ZA 2PPNA 2F6KA 4A2SA 1YXDA 2ZQ0A 1T41A 3QSRA 3CMFA 1CNVA 3VNYA 4UCGA 1V6XA 3RPDA 1AQHA 1ALDA 3DN5A 3EPOA 4E3TA 1QNVA 5AKQA 3W1XA 1DIKA 1XKYA 1WAUA 1NOFA 3L12A 1VYSX 3VGFA 3N6JA 4HSHA 2RUQA 3WBWA 3UI6A 3LZ5A 5CPOA 2POTA 4ODLA 1EPXA 3TXZA 1GW1A 5LSMA 3SDOA 3SN1A 4GI6A 2Y6ZA 3LSBA 2JIWA 1S5VA 4LF1A 1GOOA 3PTDA 1WE5A 1EB3A 3C8NA 2XGIA 4YS1A 4DAIA 4B5TA 2PDMA 2GJXB 5GNYA 5FJOA 2H9AB 4V15A 1JVNA 3J7HA 2V5KA 4LB3A 1UA3A 1U30A 1XJBA 4LANA 4XKYA 4FAMA 5A6BD 2HVOA 6TIMA 5T9CE 3MKKA 3HV9A 1J0KA 4MFEA 2J8FA 5FF4A 5HANA 1JDEA 2E5CA 4YYCA 3UWYA 4GVIA 2GWGA 1UP2A 3VDAA 2QNEA 5HK4A 2HEJA 1FWCC 3PAOA 4TVDA 2G4FA 4BEQA 4P7OA 2M08A 4W88A 2XTKA 3CWHA 5FJJA 1FH9A 5HNTA 3BAJA 3K1DA 3ARYA 2V5DA 4X9YA 3USZA 5XIMA 1GGOA 2WJDA 4XAKA 1FA2A 1EA0A 3VKDA 1UG6A 3AIVA 4G7FA 3NL5A 1HGWA 1XIJA 4F0KA 3T4WA 2CWXA 2E6FA 4GIEA 2Y88A 1NP0A 2ZUWA 2I9UA 2WO5A 2B7PA 5CJNA 2HMCA 3RMJA 5AHNA 5I3GA 3QQ1A 3RCMA 4HNUA 4L9YA 4NU7A 4GZEA 2P3ZA 1M53A 1K8ZA 1QI3A 1CENA 1IIGA 3VMOA 3B0YA 3IIPA 3PR2A 4J4KA 3IUHA 4JIPA 4HPJA 2PDJA 3RLVA 3W1PA 2R1LA 4LUSA 3M0YA 3ITTA 4DZ5A 2QQ6A 4U5IA 2Z1VA 2VGIA 4Q6JA 4NNRA 3PF3A 2UZ9A 1A5KC 2PN0A 4NASA 5KITA 2ZRVA 4KWUA 2HK1A 1YDYA 4YLWA 3O5OA 1W5QA 1N1AA 4OV9A 3WK3A 1U2YA 4WD0A 3T08A 4C6JA 3PUEA 1NFBA 5LIYX 3OIXA 2CFFA 1B5TA 5C9WA 3ZYZA 4XAPA 3GLCA 4MIMA 4B92A 1M68A 1G4PA 4C1NB 5D38A 4KWVA 2VRJA 1Z69A 1V3KA 3RX2A 3DFSA 3QXBA 4S1FA 3UG8A 3T07A 4PUJA 2DZAA 4FNUA 2WSPA 5LHFA 2GUYA 4NILA 3CH9A 1VFSA 2W91A 3VOHA 4PRRA 4IPIA 2VT0A 3CHDA 1E0WA 3GWQA 2DIJA 3IK2A 2L5HA 3CB3A 5A6JA 2CESA 4M0XA 4QITA 3WL1A 2Z1XA 1VP5A 4IM4A 1UC5A 4F2BA 1S2TA 2MANA 3OHMB 1TTQA 1NQKA 3AMGA 3ABOA 4O28A 3KS5A 3VFCA 3N6QA 8XIAA 5DITA 1U33A 4LAMA 1RALA 1GOMA 2W9MA 3GNXA 3L2MA 1ONXA 3P60A 2V5LA 1SZFA 2POZA 1I1WA 3T7VA 2UY3A 5EYWA 3CEPA 1SJDA 4XTDA 4CD5A 1KM1A 3U7BA 1OIMA 5LNWA 1W3IA 1XPGA 4LWWA 4MJ4A 1ONWA 2Q8ZA 8CGTA 4DZ2A 3QV7A 1SW7A 1E1CB 2EPNA 3KWXA 1THFD 2NQ5A 4QCFA 2KGJA 4FLSA 3B4YA 3GUWA 3A47A 3DFOA 2F38A 4X2PA 5E70A 2WLZA 4ATDA 3WLRA 2Y62A 2XM1A 1H63A 4E8DA 2G3MA 5CZTA 5SWUA 1WQ5A 4Q8MA 2D73A 3UGRA 1V02A 1P6WA 3MWAA 2WVTA 4KF1A 3PULA 1R3QA 4DVOA 2PBOA 3VMPA 3UWQA 4PTMA 4MWAD 3BSHA 2CBVA 3M41A 1ISYA 1VCFA 3OG2A 3WD4A 3PTKA 3RCNA 3B0VC 2XP4A 4XD3A 1JPKA 2JE8A 3NYZA 3EDFA 3IKDA 4PR4A 1QJWA 3REQB 3AXKA 2D2JA 4MZ8A 4HPHA 1E0UA 3K4WA 2G5WA 2UY4A 3CV7A 3GTXA 1YBQA 3FVMA 4FLRA 3SSJA 2AGTA 3N3TA 4KKXA 2NQ9A 1TJ2A 3PVFA 3KBSA 3N4FA 4N19A 4Q6XA 3RAOA 4HTBA 3G0UA 1JZ4A 1N82A 1FFQA 1O12A 2DUAA 1FKFA 4MNLA 3RCYA 4R7JA 1IXNA 3R0KA 1KLYA 4JTEA 2EPKX 2XJ7A 1D7HA 1OC7A 3GFYA 5CSSA 3F7JA 3STGA 4AISA 1O68A 3UEQA 2BVTA 4GBDA 5G4WA 1WNOA 3E2RA 5KZEA 4FB7A 2J74A 3CEUA 3O15A 2Q8LA 1TWIA 5EFDA 4H7ZA 2DORA 3NI6A 1QHZA 4EXAA 4GQQA 2AL1A 2PPPA 1XBVA 2OYLA 5H6HA 3OTRA 1DTNA 4P61A 2BNJA 4ZPWR 5M5DA 4FIQA 1I0BA 2JKPA 3IJIA 4FX6M 5BRBA 2NUWA 4BF8A 1GT8A 4HJWA 3BLEA 4L9XA 1TRDA 4NAEA 3KFTA 3BAWA 4GZJA 1UC4A 1F74A 1V6YA 3D47A 3ARXA 3PPHA 3WO8A 3NL3A 1XRSA 3LD5A 1H51A 1FKSA 3O5PA 1QPKA 3UA4A 3WF4A 2XSXA 2C18A 2D0GA 1YIXA 2BSLA 4OE7A 1GYNA 5REQB 4R9OA 4KCVA 3GDRA 3ABRA 2ZZ6A 4W7UA 3HQNA 2WANA 3ARWA 2WMJA 3FW6A 1TO3A 3WLJA 2PRHA 1BFNA 4LV9A 2CLFA 4CVUA 4M6VA 1EIBA 5L6UA 4GH1A 1X8CA 5JIWA 1G01A 2NT1A 4JHZA 1KBLA 4ERIA 1W17A 2SFPA 4PCFA 1R46A 3P8IA 2NX1A 5T26A 3VCCA 3CHEA 1LP6A 4UTKA 5HUPA 1ESWA 3KZPA 4LAYA 4PH6A 3T0CA 3CV1A 3NDOA 3K13A 3EOOA 2DY3A 3H53A 2FZNA 2E0PA 3ZT7A 4YL2A 4FAPA 1XYZA 2QZRA 3CL6A 1DKWA 2YR1A 3B9OA 2XH0A 3Q2DA 2O7SA 4YCOA 4M6UA 2FKEA 3E0FA 2E4TA 3FFSA 2YA2A 3AYTA 1JFXA 1HP5A 1TPUA 4F40A 1CECA 1WZMA 1E71M 1DIEA 3AISA 4E5TA 2X8RA 2PWHA 4NZFA 2PV1A 1MSSA 2QGHA 1R9ZA 1YEYA 1LBLA 1E0VA 4X22A 3OOQA 5DO8A 4IFOA 2QJGA 3PG9A 2BMBA 2HISA 5HMEA 1H1YA 3PPFA 1NDZA 4JFSA 2VMFA 4XBKA 2WKJA 2PV2A 4MY8A 2WJZA 4LUIA 4IXXA 3KE0A 3FK4A 1D8WA 1OYCA 4PMUA 3KBMA 5C2GA 3IJQA 2YYTA 3T9PA 1FD9A 2QCFA 4O8RA 4N2YA 2XN2A 4L80A 4I7WA 3W6LA 4A22A 3VDBA 2MLYA 4H9ZA 1PYMA 1FKIA 4IGMA 1HKIA 1RCQA 2X09A 3DUGA 3I3BA 1OC6A 1OWQA 1X39A 1KGXA 4MFDA 3T8QA 4MDPA 1YW5A 4FA3A 1YKWA 3MTWA 3RRXA 1JCJA 3PBVA 4KQZA 1AJ0A 4V2XA 4ODNA 3UVAA 1ITCA 1V4YA 2X30A 1IIHA 3BAIA 3CT2A 4TTUA 1E3ZA 2V5JA 3TYAA 4XV0A 4MWAB 1MI3A 4FR1A 4AC7C 4IL0A 1K8YA 1NQ6A 2IPGA 3QZ6A 3BGGA 1JAKA 4BZYA 3SIMA 3B8VA 3KTXA 4O19A 4O4WA 1T8QA 4J7RA 2FFCA 2W27A 4D2JA 1ZB5A 1TA3A 5K2ZA 2VELA 4NI3A 4ONVA 1OCNA 3VC5A 2I56A 3URQA 1R3SA 3NPVA 5I7GA 2ZR6A 1OYBA 2V0TA 3ZMRA 3L9CA 2E9BA 3W71A 3UJFA 4DJED 3LX9A 1H60A 4R7WA 3N17A 1TTJA 5K4XA 3OGVA 3C0QA 3UWVA 3O5KA 3WBEA 3SECA 3Q45A 3QMSA 1UB3A 1KA9F 4MGVA 4JEQA 1VCVA 1VFUA 3NQCA 1LF1A 1W54A 2OJPA 3UPMA 1W9XA 4LAXA 3WLIA 3GIQA 3RPTA 1HN1A 4OUEA 1YPXA 4YU1A 5E0FA 3QBUA 3IIVA 1XFCA 3DX5A 3KEHA 4K68A 3NDYA 4JYEA 1XDLA 3UG3A 1EJ7L 4HU3A 1I9CB 4CU7A 1S2AA 2A3LA 4OT7A 2XFYA 4OV4A 3UJ2A 3KAOA 2INFA 3S2JA 4RV8A 3BUVA 1QPLA 5BRPA 1MQPA 4LALA 4QAWA 4UTJA 1C9DA 2A1YA 2XN1A 3O7UA 3NTPA 2IQ0A 5K9XA 5C0QA 3EX1A 4IUOA 3OQ8A 4XUGA 4DNHA 1B90A 2VZUA 2YKKA 4Q4KA 1X97A 3QMRA 2PFHA 5ECVA 1H49A 5CZSA 4H9YA 5DIUA 2EHHA 3BMVA 2QDEA 1T8XA 3QGAC 4Y7EA 1K8XA 3ENLA 5CKSA 4BQ5A 2BVDA 2W3ZA 1BAGA 2A6LA 5HWJA 2GZXA 4XKMA 1KFCA 4GQ0A 1GOIA 1VBRA 5HULA 2WSKA 5FJUA 2WXDM 3OPSA 1FWHC 1VFOA 4ZFCA 5AFDA 3VZYA 3PBMA 5KETA 1XGEA 1BG4A 2KR7A 2KX9A 4TVUA 3H2AA 5BXTA 3LTSA 3GHRA 3PRBA 4DZHA 4TU1A 2V81A 4F0MA 1V3MA 3F4WA 3RO6A 1JI1A 3H7VA 2PUZA 4U86A 4RZ6A 2H9AA 4AZ7A 4UTUA 4IF2A 3BCFA 5HR6A 2ISFA 1ICPA 5HDRA 5DT7A 3HGSA 1TMLA 3O5LA 3LPPA 4Z2LA 4ODRA 4F9DA 3PA7A 5FEWA 5KINA 1TE6A 4FO4A 3CAKA 5A5WA 3VIHA 1UASA 4UNKA 3IUDA 5AY7A 3PJXA 3W00A 1QOPA 3TYDA 3IJDA 1DV7A 3TNOA 2A3HA 3NPWA 4HA4A 4GE8A 5A6TC 3VM7A 1W3NA 2XZ9A 1FDJA 3MYOA 3DFPA 1EP2A 4ZQPA 4XZIA 5HWNA 4FMVA 2HE5A 3DHPA 1GVFA 3RLHA 1CXEA 4K7VA 2MLZA 4W5UA 4L1GA 2WAGA 2NVAA 4PFMA 3M16A 3LV5A 2V3EA 5D2XA 1FDZA 1W6TA 4BQ2A 1IWBA 1W1A1 3UA3A 1HXJA 2BP1A 2JBMA 3SN0A 4NVTA 5IFTA 4NRRA 3KDNA 2DSUA 4S3JA 2CBJA 2PPOA 4CU6A 2BVYA 1A3XA 4O0ZA 3MJYA 3WJSA 1FCUA 3AYSA 3UZWA 1UW9A 2HVMA 4GIVA 2NQLA 2OFNA 4IXHA 3VXGA 5BYWA 2RUCA 4C6DA 1D6OA 5HJLA 3GG0A 3IKGA 1FWWA 3WEOA 4FEZA 3TZNA 5BWAA 2YA1A 2DIKA 3QOMA 4ZO7A 5FJTA 1OFPA 1B54A 4ADSA 3W83A 3APTA 3N25A 3NM1A 3CTLA 2PURA 4DWSC 1QNPA 5EMMA 1F05A 2GJPA 1EEXA 3SQSA 4WHBA 1PTDA 1GVEA 4Y2WA 3ZR5A 5A8NA 2BY2A 2B7NA 3M0KA 1BGAA 1RH9A 1GJUA 3FA3A 1WBHA 2FTWA 1FWBC 1DJZA 1LORA 1REQB 2CXEA 4DZ3A 3LCHA 4GY0A 4WGHA 3AU6A 2A6NA 4E4PA 3RF9A 3VIKA 2GUBA 5IBXA 4AB4A 2DPEA 3F4NA 4AG0A 3HPXA 1UH4A 4Z08A 2QPSA 3TSBA 1B3VA 3MANA 1MMFA 5DMMA 1XH1A 2P1FA 2DZPA 1FWGC 4ZOBA 4G7EB 1O4UA 4GUJA 2VHLA 1ZFJA 4LV4A 3CASA 3Q94A 2XWDA 4NAFB 3G5EA 4CCDA 3LI1A 5AC7A 5CJ5A 5FJIA 2RDXA 4F0RA 3WIJA 2GDQA 3E9AA 3OEXA 3P82A 4U31A 4UTWA 1RD6A 4B5UA 2FTYA 3B03A 4QCEA 2RFGA 1JCTA 5D75A 3SSZA 3LNMA 3W1RA 3O5GA 3NQGA 4M7SA 3NZQA 1KCKA 5HWCA 2ZE0A 1TKKA 4DQWA 3GTFA 4AD5A 4M5PA 1XG4A 3H4GA 4OBSA 4TXEA 4HOXA 4HGXA 3WQGA 1JCLA 1F4HA 5HW7A 4OZOA 3L4TA 3CU2A 4E4UA 1NWUA 3HO8A 4O1FA 1EUAA 1R2SA 2HZGA 3TCEA 3LTYA 4JKMA 4UZSA 4LOCA 4C7DA 2JZVA 3KCOA 3BV7A 4JQ3A 5BROA 1B1YA 1Q6DA 4ATLA 3AIWA 3K1GA 2P4VA 4JIEA 3VKJA 3LXAA 2RSEA 5KTLA 3S9ZA 4FLQA 3WMCA 4AD0A 1X6NA 1PZ2A 1ISZA 2DZWA 3ABXA 1E5JA 2HVNA 1Q6LA 1ZNNA 3GU1A 4DXXA 3H4WA 2NUYA 1YXYA 5DRCA 1BWVA 1ONRA 5A6BA 1L1PA 1VFLA 3DKJA 2VRKA 1FKHA 1XX1A 4UTMA 1ME7A 3ZXWA 1BGGA 4XUYA 2J7FA 3LRLA 3ECQA 2OO0A 1XC4A 3UW6A 2EG7A 1AG1O 4AEFA 3BW3A 1RZMA 4LAZA 1KRCC 3H24A 3H2EA 1VRXA 3CZEA 3TN5A 4YTRA 3MUZ1 3MA8A 2BHYA 4C90A 4K37A 1SZNA 2F7FA 3GNRA 3CAQA 3WX7A 5D9OA 3KRSA 4PTDA 3SUWA 4BWLA 4MB4A 4AZGA 1VJIA 1CTNA 4JXCA 1G7UA 2FHFA 1E1FA 4LB4A 4UOJA 5J8LA 3GYCA 1ROTA 4CQBA 4YTSA 3WK2A 5HINA 5D2TA 1SJAA 3L2IA 3VX1A 3QR1A 1HJXA 3E2VA 4UBPC 1GRJA 3WQ6A 5C55A 4JOMA 1UKOA 2VRQA 1UR0A 2NLYA 3LN3A 1TMHA 1OCQA 2OYMA 4DRIA 1S5MA 1YTKA 3OYZA 5A94A 1C7TA 4HNLA 2ACQA 4K8HA 2Y85A 4LS2A 3LK6A 3VIJA 2AQVA 2A3BA 1WV2A 4B5XA 3RJYA 1MNZA 2X1TA 2WM1A 4ICMA 3U2CA 3BOLA 1FH8A 5JBFA 4KESA 4B4FA 4Q33A 3KL0A 3MCMA 3R2GA 3N18A 2X1UA 2OYKA 4DJFC 3P0XA 3CUGA 2EAWA 1E73M 1TQJA 4H19A 4DIAA 1AW2A 1S1PA 3BPWA 4H9XA 3S9YA 4Z1AA 2VVSA 1A80A 1PWLA 1W9DM 1G69A 2OEJA 3T0DA 1P48A 1R2TA 3GC5A 3BW2A 2QDDA 1C8YA 5I6SA 2XGBA 4U3AA 1D7IA 3UXDA 4DB7A 3TN3A 4XBSA 4S3AA 4DY1A 1VHCA 3CPGA 3ANUA 1J0ZA 2G37A 4P5UA 3URBA 2DSWA 5CEWA 1W1B1 3MO4A 3MKVA 3WDJA 3RM8A 2OWXA 4PODA 4QSFA 3NWRA 1M3UA 4JTJA 3O0FA 4IJRA 1TPEA 4JN7A 3C61A 1OGBA 2CW6A 4GPNA 2VDIA 1TR1A 5CBBA 3N4AA 4LCSA 4RE4A 3FEQA 4GI4A 3UR2A 1EGZA 4LAOA 4J9JA 3OA3A 1ZJHA 4JFWA 4J40A 3I7QA 5HUOA 3UWUA 3OVGA 2QJNA 3DI0A 3TC5A 4X0VA 3AMDA 1F3WA 3ZJKA 5DELA 1RQBA 2C15A 3TK7A 4IIBA 2HRWA 4HT3A 4XZBA 4GISA 2AL2B 3TX9A 3FS2A 1XLBA 4O0KA 3EAUA 1X8FA 1GCYA 5FEPA 3JUGA 2DVUA 5LNUA 1FKBA 2FHBA 1A5OC 3O3RA 3WBXA 1UA7A 1LT7A 2X16A 2QLYA 5E0KA 4JHOA 2ZR4A 3G22A 3UI4A 3R0DA 5IOBA 1H0IA 3BE7A 1LQAA 3H2OA 1SZGA 3W88A 3AOFA 5BXRA 2Y8KA 2WMFA 3LCXA 5EMLA 3M5VA 1BSLA 3PJTA 2GOUA 3CO4A 1OZMA 2WHMA 2YW3A 3EYPA 1Q4WA 4KCUA 1DJHA 1OX5A 4GQGA 4QFUA 1J5SA 1R9XA 3VD4A 3CJPA 1OGSA 4MWAA 3N2XA 2OZ8A 1XM3A 2GWNA 3HG4A 1TPWA 1DQWA 3THCA 2F61A 2YZ5A 4NX5A 1Q3NA 2ZZ2A 1QNRA 3W72A 1KRAC 1CIUA 2RUSA 1P1MA 3K4AA 4W4QA 4HA0A 4TW6A 1EF3A 2XGZA 4U33A 2WNQA 4R53A 2ZUUA 3SCOA 4HK5A 3OVQA 1F3XA 1BKSA 3A5VA 4JY9A 3VOGA 4CNSA 3CAVA 1AH4A 4S38A 5IHSA 5AYIA 4DYKA 3QW3A 3ARTA 3UU0A 2CC0A 1W9PA 3W07A 2DZSA 4BY3A 4Q8TA 3BARA 1TCDA 4QS5A 4ZSTA 3POHA 2J75A 3ZIZA 3SBFA 2PGFA 1VFMA 4LEFA 3GZ3A 4I9TA 1MNSA 3QHNA 3NNTA 2TPSA 4YMZA 1JUEA 2E7FA 3UQAA 1GEQA 2D3LA 4LW7A 1C93A 1EC9A 3JYJA 4V27A 2XH2A 4L61A 5BMXA 1N8IA 1V8EA 5EFFA 4AWUA 1WUEA 1OHLA 3M44A 3A24A 4ZL1A 1X1ZA 1H62A 1DJNA 1A4LA 3UERA 3DFTA 4B5WA 3MP3A 3TR2A 4TMBA 1JG9A 4C6NA 2QJMA 3TUUA 4MOZA 4GFSA 1BWKA 3RX3A 3VKCA 2RGMA 2DH3A 4LSBA 5JU6A 1BF2A 3S1UA 5I07A 4AAJA 3OLIA 4H2CA 1B4KA 3NRKA 3ITYA 2OGJA 1WKFA 4Z2JA 2WHJA 4AD3A 4YVVA 3W1MA 1Q6FA 2YLAA 3RU6A 4RJEA 4RDVA 2VEPA 2HSAA 2TODA 4QDPA 4FNPA 1V0KA 4ZQCA 2Z1WA 1V6VA 4W93A 3UXLA 3WMLA 2WMIB 3R10A 3M0XA 3C2EA 3CC1A 3SCNA 3FHAA 4FXFA 1EO5A 3LEPA 1X96A 5H1WA 4DO5A 4ZQOA 2Z28A 4PZVA 4BKNA 2BB0A 3B40A 2FH8A 3M0HA 3FSUA 4N0RA 4IQLA 1TZ9A 4CCEA 1QWGA 1W3KA 4W9TA 2JF6A 3WFAA 4Z2HA 4WXYA 4GG9A 3GIPA 1GG1A 1RJRA 2WWCA 1PX8A 1S2WA 3UJRA 3DFNA 3TV8A 2HBVA 4GINA 4LAUA 3BK0A 4L1XA 1WP6A 4LAWA 1EWEA 2V6AA 2E6DA 4Y8EA 2D23A 3GPKA 3LGEA 3EEZA 4GZ7A 1O66A 3GDTA 2Z4GA 3P62A 3CWNA 1KT1A 4GX8A 5XIAA 3OZPA 3DU0A 5A8GA 1E72M 3I7SA 3IJLA 2OT1A 2ZWYA 3F1QA 1QFEA 1XBXA 4UFHA 2V3FA 4O13A 3PB2A 4ADUA 2Q6ZA 2VFHA 3HV8A 4FK9A 2PDFA 1O94A 3GFZA 2ZCGA 4JICA 3MS8A 2I17A 4GO8A 2UBPC 3EZ4A 2R82A 2GDVA 3UVIA 3BQ5A 1LRNA 4UFJA 2YXOA 4Z1BA 3TAOA 3DXIA 3AZRA 1O95A 4DBWA 2NZLA 3UR7A 1GPFA 1FDYA 1Q6OA 5EMUA 1B9BA 1OVDA 4IQ2A 3UESA 3L5MA 1PXGA 1OD0A 1QHPA 2XN0A 4CVWA 2ZC1A 1ZQ5A 1TZ7A 5F1VA 4WEVX 4AZHA 1PPIA 4LS0A 5E93A 3CXOA 2PBCA 1HZYA 4KFNA 1IT7A 5MKGB 4IOTA 3WZ0E 2MNRA 4ORIA 3LCIA 3AMLA 2R94A 4JYDA 5C54A 2NT0A 1P1XA 4NSBA 4YIWA 3UR5A 2X1IA 4CD6A 4HPNA 1W3LA 4PMOA 1AODA 1UYQA 3CZ8A 1VEPA 3I6RA 1UMYA 1R3RA 3NPXA 4CNNA 5JH8A 2IXUA 2Y4SA 3PPGA 3FJ4A 1TPC1 3UYCA 3LS9A 4OUIA 4H6KA 4JKLA 2Z2UA 3L67A 1RXOB 4IPNB 3KW3A 3P14A 4RV3A 3MI6A 2PDNA 1HIZA 2H3DA 2GVYA 2CKSA 3GIYA 2KFWA 4D6JA 4FHAA 3G1SA 4EAMA 5C5YA 5AC5A 3V0UA 2VFIA 1TWDA 4XB3A 3MYPA 1VBJA 3MWCA 1POJA 2LGOA 1BWLA 4ACYA 4QT3A 2GJLA 1UUMA 1REQA 4KERA 5D9PA 3A13A 4DJEA 1US3A 3RN6A 5D05A 4PB3A 4JTTA 1XIEA 1AMKA 3OGSA 2HTMA 4KRTA 1XLFA 3ARQA 5BOEA 4Y90A 1PINA 2XUCA 2Z0IA 3IVSA 1GQLA 4P7RA 2WZTA 4EP8C 4MSPA 3FCPA 3PZVA 4QR6A 1NY1A 2OKOA 4G7EA 1AQFA 4WGXA 3S6DA 1K4GA 4NAFA 2XU2A 2CLEA 4CNOA 3QH2A 4QJ4B 1ZAHA 4HIBA 1TV7A 2XVPA 3R8RA 1K77A 4UFLA 5D8ZA 3MW7A 3O5JA 2FZ9A 3UQNA 1QK0A 3EMZA 4ACZA 2VURA 5XINA 3AXIA 4W7VA 3DEQA 4Z0JA 4HU4A 1ENUA 2X40A 1H7OA 2IW0A 3BH4A 3HF3A 2VFDA 3TR9A 4UUIA 1LTDA 2GK1A 4AEOA 4IHCA 1GQNA 1TX0A 1XYMA 1Z32X 4GCXA 3TH6A 2D3NA 3F2CA 4TW8A 5EA9A 3TEVA 2FGZA 5BOFA 1A5AA 2VEMA 1TWZA 1NF7A 5E6YA 1XLMA 2GVGA 2YA0A 4J3ZA 4CUCA 4J2MA 3WNMA 1ADDA 2ALDA 3QHMA 3QFEA 1WKYA 3R94A 4AIEA 4PUUA 3WLMA 1SO4A 1UWAA 2OZ0A 4ZPVR 3W7RA 3OB8A 3NJ3A 1XQLA 2DZUA 1WDSA 3IARA 2O7QA 4X2RA 2PMQA 1OF8A 4LUYA 4JEJA 3AFBA 1FWFC 2IMRA 1E40A 3LHVA 3SGZA 1QT1A 2WVSA 3N9KA 1GZJA 3ZR6A 4DRPA 3S6OA 2JEPA 1B0IA 5CZKA 3TMLA 3R13A 1M5YA 5A6LA 3VKBA 1FKJA 1KFBA 3ISIX 4QE4A 1O5QA 4C6MA 5CC7A 4JGDA 3I6EA 3G1VA 3V7PA 2PODA 2BGNE 4TYOA 4I7VA 5DF0A 2C71A 2QXWA 2ZE3A 1PZ3A 3UT0A 3KWSA 4U84A 1QI2A 3SZ8A 5CH9A 1QPOA 4F9JA 3VCRA 5BU9A 3R12A 4EF9A 3PBYA 3QY6A 3MBFA 4HHMA 2YFOA 3C0LA 3IV3A 3P2VA 1OIFA 3IS4A 3N6HA 4IISA 4MKSA 1QO2A 3KHDA 3BG9A 3FJLA 1A5BA 4I9MA 4MNMA 5HXMA 3PWAA 3C0JA 3A3WA 4KRUA 4E8CA 3ZLGA 2V63A 2EPOA 4C7GA 2J13A 3EDKA 4H83A 4DBSA 4UTTC 5A8MA 2ZDSA 4PMNA 4DWSD 2E1DA 3L65A 3I6TA 5LXEA 4HB7A 5ABFA 1EHAA 2DEPA 2XIIA 2ZXDA 1D7FA 5D09A 3W6MA 5D4YA 4FI4A 1ZALA 3WUFA 5JH1A 1IX5A 4QG8A 4R7OA 1CLKA 3W85A 2WBKA 2PPGA 2J25A 1ME8A 4V1YA 4WVXA 2R1PA 5GPRA 1R9HA 4HARA 1MDRA 3B8TA 1NWTA 5HNNA 4JPGA 1LQ0A 1E55A 1QNQA 3MBDA 5FJPA 4JDYA 1W26A 3FVDA 3M5YA 1UZHA 1OX6A 4D8ZA 3NEVA 3TLLA 4L1WA 2VM8A 3KXQA 2C13A 4C6KA 1I0DA 4BI7A 3QGKC 3UPBA 4NZCA 4JFJA 1XH0A 4ZOEA 3W74A 4AX7A 4DF0A 2NV9A 4ZSUA 4UQAA 4N9DA 4EACA 4ZXLA 2H3BA 2YCEA 1JNSA 1P43A 2RAGA 4UR8A 4R0XA 2F84A 1QI4A 2BLEA 2VFGA 4PMYA 5EY5A 3ZVHB 4IL2A 3IRDA 4ZEPA 1XLKA 3H22A 2Q09A 4XG1A 4IT4A 2G3IA 1Q8AA 2HPMA 3CLWA 2ZZ7A 3LUOA 4RCXA 1IEIA 1PO9A 1UWUA 2BXVA 2ZKMX 2J7EA 1QK2A 1T7LA 3UCQA 4DLMA 1V5XA 1K7FA 3CWOX 4AMAA 2AL2A 5CLWA 3WK0A 3ATYA 1VBHA 3H26A 6ALDA 5KMYA 3C4UA 4M8UA 4NJGA 1EX5A 1HL2A 2O9RA 2OR2A 3N73A 2QF7A 1UZDA 4NL1A 3GVQA 1YDNA 2PBGA 4NYYA 4P7LA 1H7XA 1P0KA 1SSDA 3DFQA 4DXVA 5I3FA 3B8SA 1K9DA 2DH2A 3CH0A 1T6MA 1GQIA 4PMVA 1FKGA 2KAUC 3MHUA 3U6WA 4GYJA 4YHEA 3W6YA 3BAYA 2OPJA 2DZVA 2CYGA 2WPBA 3E1F1 7TIMA 4Q7NA 3S5ZA 2XYLA 1RBAA 1ZL1A 1J8VA 3KRZA 3RR1A 3MVTA 3NL6A 3C5QA 4L4OA 3WLKX 3HN3A 1A47A 1A0CA 2XVLA 4MNKA 4PN2A 3S1VA 4IQCA 1Z42A 3DG7A 1A3WA 1MW2A 3LMZA 3EGJA 3LHTA 4DLFA 2NQZA 1V08A 1UBSA 2BASA 1UIOA 3UBPC 1Z48A 1H50A 2PDBA 2FH6A 3MZNA 2QDHA 5GJNA 5HWBA 3SUUA 4OWGA 2I5QA 1GK8A 4UR7A 1RVKA 2YSWA 1K4HA 4JQ2A 1ITUA 1P6BA 2XIMA 4BEUA 4G5DA 4O17A 3NQBA 1XYLA 2J88A 3KABA 3W2MA 1NMVA 4WOZA 4C02B 1MZRA 1Z89A 3VD3A 2Q71A 1SJCA 4OGZA 4O4VA 4MB3A 3ITVA 1YADA 2VZSA 1J4HA 1Y65A 3MSDA 4Y9AA 5FJRA 5CPTA 3L4VA 1OX4B 1YNQA 2ZXQA 5G1MA 1LOQA 3JS3A 1RAKA 1JDCA 3DKLA 4Q4QA 4Z1DA 2R1NA 3CIVA 1VAHA 1R0MA 1CGYA 2ACSA 4CQDA 4O10A 4C6QA 2LKNA 4DJFD 1JXKA 1AZ2A 2FGBA 1DJQA 4PB5A 2QUTA 5TQLA 3DHUA 4B2DD 4ROPA 3UZZA 4JFKA 4RNFA 3NQMA 5DRIA 3SCUA 4PBEA 1OBAA 4F0HA 2NSOA 2VFEA 3MU7A 1ISWA 4XO6A 3NXFA 2QCDB 2QUUA 3N11A 1NFPA 4Z17A 4PCNA 4DWSB 2EPLX 3I68A 4A8NA 3U7VA 3LPOA 1R38A 2VKZG 1UH2A 1QO5A 1XDMA 1WKDA 3PAJA 4PMXA 5J6EA 1S1RA 4KEZA 1JZ7A 4H6EA 1V3LA 4YN5A 4YXGA 3KAHA 1PIGA 4J35A 4W86A 4QLJA 3S2CA 3STCA 1C8XA 1P0NA 3BL3A 4QM1A 2ZQSA 4ZE4A 2ZUTA 2DVTA 5H8UA 4ASTA 4LC8A 4UQEA 3URAA 2VDGA 3FJNA 1OFOA 1PEZA 2ZZ5A 7XIMA 2XINA 4JL1A 4DM2A 3C3NA 1MQRA 4NUWA 2WBGA 4JFMA 1CWYA 1J96A 4MDOA 3EXTA 1D7KA 3WMSA 2B4GA 3THUA 1HW6A 1FWTA 4GK8A 2PWEA 3QR0A 3TDFA 2GOKA 2MPHA 2EO7A 1FKKA 4GOAA 1KM5A 4M1RA 3MDYB 3LLDA 3PB0A 4DBDA 4WJXA 1UUOA 3W22A 1EJSC 4E2BA 1N8WA 2PDGA 2B81A 4Z2IA 4S3BA 3PZTA 2PLMA 1L8PA 5JMUA 1LM1A 2CLKA 1EP1A 2D2HA 3AO0A 3P61A 1GW9A 2DJXA 3PFRA 1KBBA 2WSQA 3A64A 3SAZA 1WXYA 3V3WA 3C2FA 1E15A 3POCA 1W91A 4AUBA 1WYIA 2XSBA 3MUCA 3OZOA 3T44A 4IGHA 2WNZA 2AAMA 4GGHA 1VFFA 3EDJA 1R8LA 3K5XA 2WVUA 5LIWX 1G0CA 1LOLA 1FX6A 3P3BA 4LUTB 3TKFA 2E9MA 1JCMP 3I4KA 4IMFA 4QAIA 1RLDA 2QJHA 4WDWA 3HPAA 2DDXA 2WZHA 5A8QA 5MKGA 4AFYA 2L2SA 3W86A 1Q6HA 1XWYA 2ESCA 1KO0A 5E0CA 4AY8A 1B31A 1P4CA 4MAZA 2QV5A 1XUZA 4LX4A 3RITA 1OB0A 1AMYA 3BWWA 7PTDA 2GQ3A 5DMLA 4NJJA 3WDQA 4LEQA 4Y9OA 3DYOA 1WZKA 1Q8JA 1F4AA 4WDUA 3CQIA 4ZQNA 4DI8A 3VA8A 4JIIX 2Q3OA 1UROA 5CBJA 3XIMA 3ITXA 4M6PA 3G77A 4AEEA 4LTSA 1LG2A 1NWRA 4HZ6A 1OFAA 2J6VA 4LVFA 3HG2A 1GORA 4LAKA 3NQVA 4DJDA 4Q8OA 1X38A 5JUVA 3GX9A 4WJEA 2ZXBA 5DCBA 4IIGA 2DIEA 3PJUA 5GPGA 4X3ZA 4HOZA 2G95A 1CZ1A 4PUMA 4HVXA 4TX6A 4M24A 1K6AA 4N6FA 4FF7A 2EGZA 4EOUA 2D0HA 3EOSA 2HWGA 5HQEA 4H8UA 3GXIA 3G6LA 2PDWA 3EEGA 1RSCA 4L4MA 2HK0A 4N4PA 3GW3A 2OSXA 4BF9A 5BXPA 1TFVA 2WCAA 2NV2A 4UMAA 1XXXA 2P8CA 3OYXA 1EHNA 4MZYA 2FJUB 5CGMA 4H9MA 1UD4A 3W25A 1MUMA 4U3CA 3M43A 3U4FA 1H5VA 4J1OA 4S3KA 3BAXA 4DF2A 3KOZA 3H7RA 3W1UA 4RDZA 2Z6IA 2Y24A 1NM9A 1X7IA 3BLKA 3QZEA 2Y2WA 3KRBA 1XC6A 3QHOA 1U1UA 4HA3A 4I9AA 1XPYA 2ALRA 5BMWA 3K8MA 5AB3A 5A1AA 3ARRA 4LXFA 4QROA 1EC8A 3TC7A 1IE7C 2PTWA 3QC3A 2PWUA 1OY0A 4C6LA 3M46A 1UWQA 1MYRA 4FS9A 5BWFA 1WKEA 3C8FA 2OCZA 3W7LA 4JQAA 1JD9A 5G1YA 3C0SA 5I02A 1U5VA 1PE1A 3M0IA 4AIUA 3GB6A 3TYBA 2EG8A 3CB8A 1DWGM 1KR0A 2PZ0A 3PRDA 2EKGA 1JNTA 4EXQA 4JQ4A 5LNRA 4NJKA 1HP4A 4LCQA 4DO4A 3W2LA 4ZOAA 1YXCA 4GUIA 4LS1A 3KUMA 4GLEA 4J27A 1XR2A 4CD8A 1EX1A 2PZNA 1F8MA 2G3FA 4POCA 1AZ1A 1T11A 2J78A 5CAHA 4JZ5A 2DUZA 4CQCA 1BTCA 3P7YA 3EKLA 1NU5A 3U0HA 4BQ3A 4L64A 2VENA 1B4EA 4QG9A 2VGFA 2E77A 1VYPX 4H1ZA 4H6RA 3MMDA 3PFMA 3QV9A 2F9RA 4IQDA 4XZMX 3IAPA 4ODQA 5A6SA 1UBPC 5IFPA 3E96A 3AAMA 3VIGA 5DEZA 4C6EA 3WNOA 2ANUA 2W67A 4JIHA 3W37A 5TIMA 5EL1A 4ORMA 5CC3A 1M04A 3SJNA 1C90A 5KZ6A 2WV8A 1QBAA 1EJVC 1NIUA 4GY7A 3RHGA 1ZUAX 1VD6A 4AH7A 3DZ1A 2TMDA 2X41A 2ZC8A 3CUIA 3VZXA 3CZGA 2ZDRA 1EDQA 7TAAA 3VINA 1K7EA 4RDYA 4KWOA 4JTGA 2BV9A 1S39A 5LKYA 3N3MA 5EU9A 4Q22A 5G4EA 4Q8PA 5FACA 4A8IA 3ZS4A 3G3MA 2TAAA 2WZMA 3C86A 2CHRA 3N34A 4K6AA 1EGVA 3PSWA 3AS0A 1PHWA 5AHIA 1UQZA 1JD7A 1HKWA 3MUY1 4TIMA 3HB9A 5D9MA 4GUFA 1D9EA 4HKPA 2F23A 1UMLA 3VVGA 3MMWA 5I00A 3ICJA 2WQPA 3KL5A 3KOWA 4UTLA 4LH8A 3H12A 2Z1SA 4N6EA 1JPIA 3VNJA 4OFCA 1N8FA 1K9TA 2YZRA 4XQ6A 3RFWA 4GY1A 3URNA 4F0LA 1CI1A 3OZMA 2YDAA 1LCOA 2YB4A 2G3NA 1I2QA 4AC1X 2J7GA 4MKVA 1H0GA 3TN4A 1UKSA 2VWTA 2VZOA 3B8WA 1BVZA 4CCZA 4GACA 3BDKA 4PC8A 1ICQA 4PSRA 5D2VA 2WKLA 1XIIA 1GTEA 4K1WA 3SFKA 1ZBWA 1AD1A 5A6KA 4O1BA 3WFLA 1V51A 1XYBA 1T40A 1BVWA 2FB3A 5D03A 3NPUA 3AIBA 4QQ3A 4GYFA 2WK2A 1P6CA 3PJWA 3LYEA 5KZMA 4WKFA 3IGSA 3DC0A 3GDLA 3QN3A 2PWDA 3LG3A 1C3FA 3SW6A 3MI3A 1M01A 3VABA 5HNRA 4GVGA 3ZVHA 2XPAA 2C0HA 1TB3A 1UH3A 2FDMA 1ZSXA 5AYXA 3O5MA 1E1EA 3VU2A 4I7UA 1JZ6A 1ZBVA 3O05A 4ICCX 4PTWA 4Q4MA 3WY1A 1J93A 5HNUA 1PVNA 3O6DA 3AXMA 1LL6A 2WMGA 1B2YA 4S3CA 4DRNA 3ALFA 2PF8A 2ZWZA 4W89A 2Z6JA 3FYOA 1YE4A 1EIXA 3PC0A 4W7WA 4YHGA 1RP8A 4WR3A 1GYLA 2Y8UA 1W37A 3F4DA 5FD0A 1PCWA 1ZCOA 1RK6A 2WCGA 1YLVA 3CYVA 2OX1A 3B05A 2ZX8A 3KS6A 1F61A 1A5SA 4KIRA 2PTZA 5U7SA 4HNOA 1XRVA 2WMHA 1ZTVA 4AQLA 5AHEA 4CD4A 4WSKA 1FWAC 1KM2A 4QIUA 2WM0A 3CAWA 2QCLA 2VXNA 3QEZA 1SSGA 4Y9MA 4N42A 2DT0A 4O8AA 3ZLHA 1GTHA 2ZICA 4GH3A 1TJRA 3E0WA 1MO0A 2V30A 4QDMA 2WOQA 2ZTKA 1OT1A 3NZRA 4B90A 1W1PA 4DRMA 2Z25A 4NP7A 3AI0A 4N7QA 3VTRA 4H9UA 4L72B 1BKHA 2TSYA 3TP4A 1WDPA 4HTYA 2QIWA 4O11A 3SRDA 1QDSA 3DG6A 2BOEX 9XIAA 2OMAA 1NDWA 3AMKA 3WBAA 3A4AA 1DJXA 1PAMA 1Y0OA 3BLOA 4PTNA 4IIHA 1H2JA 2A2IA 4O1DA 3TOYA 4B3KA 4RW3A 3NQ7A 4CN4A 5J5RA 4S3EA 3W7CA 1BQGA 2WHLA 3K30A 2A21A 3UCDA 4FXJA 1JDDA 1W0MA 1TPVA 4AD1A 4GRSA 4KGJA 1HQTA 1EYEA 1IWPA 4DX3A 3GW0A 5HQMA 3VNDA 3WJYA 4WOQA 4MUPA 2DVXA 5CG7A 1OX4A 1LUCA 4FPSA 1M7PA 3G1HA 4KS0A 3CQJA 4DUWA 1UR2A 2GUUA 4QJ3B 2HROA 4A29A 3EPNA 2WJEA 4DWDA 1G7VA 1KXQA 3WLOA 5DMYA 1R3YA 2GGEA 3AYRA 3UNDA 3MC5A 2BY1A 1PTAA 4ZOCA 4DIPA 3NYDA 5E09A 1OFEA 4FZIA 4QRNA 2QCDA 6CGTA 1PKNA 3D6NA 1J6PA 4HZ7A 2J9YA 1Y5WA 4DWSA 1B9ZA 3KRUA 2GGJA 4GYKA 4AWEA 3P67A 2QCCA 1SZEA 4A35A 1Y8BA 2E5DA 2J8TA 3LPGA 4HYRA 1JJKA 4HSOA 5K9DA 1XLHA 4N9BA 3AZSA 3W1QA 5HTGA 3LXCA 5A69A 3E0VA 1EQCA 1M65A 1J0JA 1OYAA 2BHZA 4LRTA 3U3HA 4XTIA 1UR3M 2RKXA 4GCAA 4AZCA 1KWKA 2P50A 2PP0A 2QPXA 2VGGA 2V5BA 4KMQA 1MW1A 4DN1A 5JXQA 3VGDA 3L7RA 5I0DA 4WY0B 3QKZA 1MXDA 2IKIA 2BOFX 2OT0A 3T8LA 4CEUC 1KNWA 3WQEA 1QPNA 1QWKA 3M0MA 1CGWA 1MQQA 3RGCA 1RJQA 3SCWA 4GWEA 1EFZA 4O1EA 1E44A 2BWGA 4G1KA 4QEHA 1LWIA 1VR6A 3TWBA 2FLIA 1RA0A 3MMTA 1ELSA 1F2JA 4DUOA 2UWFA 1RV8A 1EF2A 1SMAA 3LTPA 4JYSA 2PU0A 1GQKA 2NUXA 3MUAA 1C8QA 3WQ4A 1XLDA 3KTCA 1TV2A 2FQIA 3PNUA 4TX9A 3UD6A 3BC9A 2XVNA 2IKHA 1XCWA 1HL9A 5AHMA 3VILA 4A4AA 1XSJA 1O5KA 1MUWA 5C9XA 2EJ1A 1FWDC 4GO9A 1TTPA 1AQMA 2QUVA 2FPYA 3GAKA 3L0GA 3B0UX 3IWPA 1H7RA 2AKMA 3MHGA 5HW6A 3DC8A 3UY7A 3BLLA 2WLYA 2P76A 3GU2A 1ROUA 4A05A 3OODA 4F3HA 4LUTA 2E5BA 1OFRA 4Y9NA 2BZNA 3CBWA 2UV8G 3TMQA 4PMJA 4ZTYA 1NOWA 1RY0A 2CLPA 1TJ1A 2YBVA 3S2LA 3HQPA 4X63A 3FGCB 3TONA 1XRTA 3COTA 3GVGA 4S39A 4MNJA 1OEPA 2ZVRA 5IDIA 3RUBL 4RZBA 1C7SA 4LYQA 3LHZA 3MJMA 1RA5A 4OKDA 2GVLA 3ZM8A 1WCGA 1Z9AA 3H23A 4EE9A 4R34A 1RPXA 4XZ9A 3JXVA 1GNXA 5AZ1A 1QHOA 3UWWA 2D20A 4ZCWA 3WEMA 3MSRA 3S8HA 4JN8A 1Q6EA 2GGHA 1J01A 4O12A 1FHLA 4TV6A 1FXQA 2ZOXA 4BWLC 1GYMA 1XKJA 2WSYA 2CNCA 4RE0A 3V5FA 4KEMA 3NO5A 4E4FA 1QOXA 3BLPX 2DG3A 1J12A 3TSDA 4KR0B 2HPIA 1KGUA 1YPIA 4AMCA 1T5AA 2A5HA 3WQCA 2O4QA 1N7KA 5GJMA 4JYFA 2EXOA 3NIYA 1DP0A 3NQAA 3T55A 1HUVA 3VOJA 2ZX6A 4EAYA 3SQMA 5FL0A 4AVNA 1C92A 2CITA 3GH5A 1VFTA 4IPPA 1A53A 1Q6CA 4TX0A 3TXVA 3MP5A 2BVWA 5C9ZA 2E68A 4RZ5A 3RM4A 4AF0B 1X1NA 3EX2A 3QY8A 3MDUA 2D2GA 2PI6A 2ZRWA 4QLLA 1E9ZB 3WNLA 2V2HA 4BK9A 1EDGA 2A3EA 1XDJA 5C6MA 2ZUVA 3VC6A 4DJFA 1G4EA 5FCZA 1NTHA 1RD5A 1WDWA 2QCGA 1TQXA 7ENLA 2PDPA 4B2DA 1LZOA 2NV1A 4Q8VA 2FZ8A 3DERA 1PL9A 3WDHA 3HURA 2QV4A 1XF0A 4OBRA 2XP5A 2WKGA 3VX0A 1SR9A 1H61A 3TQVA 1TUFA 3V36A 1FOBA 1X98A 2HCVA 5GVJA 1S3TC 4DBUA 3P84A 5DY3A 4D6GA 1YATA 2A85A 2O9PA 2OVLA 4QZVB 3OG3A 4FXRA 3T81A 4NHVA 2IQTA 4GUGA 4XBJA 3GNNA 1E0XA 1O1HA 4QISA 2NLIA 1DYSA 4AU0A 5J5DA 2QDGA 1ZJIA 1EO7A 1ZCCA 1OF6A 2GL5A 4H3DA 2GVJA 5HMSA 2YCKX 4GA8A 3QQ0A 2FZDA 3FV9A 2NX3A 1JCXA 3ZT5A 1R9YA 3RGTA 4ATWA 4FX7A 2ON3A 1NWSA 2VQUA 1Z8AA 4GFIA 2BY3A 4JR5A 3V1HA 1Q65A 2DW6A 3SUSA 3EWDA 3RXZA 5G5IA 5M2FX 1VGAA 2X2YA 2VC6A 2I14A 3LZ3A 4A2RA 1QVBA 3K8KA 3CGMA 3I3DA 2PB1A 2ZUSA 4HYVA 2QKFA 2ITKA 1K02A 4MYAA 4Q4SA 2ZRYA 2Y7FA 3E74A 9XIMA 3A21A 3CNYA 3PZOA 1XBZA 3GR4A 4LYPA 1V7AA 3LGGA 2C16A 1RPKA 4AD4A 1P0DA 2PC4A 4NJIA 4NY2A 5K3VA 1CXKA 5LZLA 5C71A 1O5RA 2NVCA 4QIBA 3P80A 3UXKA 1GJWA 3MCNA 3WKZA 1PS9A 4RK8A 4IZGA 4XKYB 3EWWA 3LNPA 4J2PA 3KACA 5D2YA 3M9YA 1PWMA 3W7KA 3UJSA 4L6HA 3VGBA 1GVYA 2OLAA 3LCWA 4DUVA 1UUQA 4HPGA 3UYIA 2QULA 3BANA 3CV6A 4ZO6A 3N12A 3CHCA 5JBDA 4IGNA 4HZMA 3CUJA 3WJWA 1XBYA 3SM0A 1BQCA 1FHDA 3CL8A 2ZBTA 2PDHA 3BVJA 2OTDA 3TZFA 2PC8A 3WJZA