4O2TA

Crystal structure of a duf4827 family protein (bdi_1692) from parabacteroides distasonis atcc 8503 at 2.40 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
168
structure length
168
Chain Sequence
GKSYTDMLKDEKKAIERFIDDKGLEILDDFPADSVFKENQFVLLDNGVYLNIIDKGSDQRAVQYKTKMLYRCKMSYFMDSTIVAIENYGPHSNGTSPIAFTYGDYSKNSPYDPSYYYVSEGMQEPLKYVGDRAKVKMIVPFKRGAYNDQSNGQPVYYEILEYIFEENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BDI_1692) from Parabacteroides distasonis ATCC 8503 at 2.40 A resolution
rcsb
source organism Parabacteroides distasonis
total genus 44
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4o2tA00
1PINA 2RURA 4R0XA 2N87A 1D7HA 2ZR5A 2XPBA 2XP9A 4W9QA 2MNTA 3RFWA 1M5YA 4ODQA 3O5FA 1F8AB 2KO7A 1FJDA 1J4IA 3O5IA 2KR7A 2MPHA 4C02B 2ZQTA 2Q5AA 2XPAA 3EY6A 4DT4A 1T11A 4J4OA 1KT0A 3IHZA 1NSGA 2DG3A 3KAHA 4N19A 4IQ2A 3O5KA 1FKBA 1ROTA 3MDYB 2XP6A 4JFJA 3UQIA 4DRKA 5HW6A 3UI6A 2LPVA 2RQSA 3UQAA 4DRMA 2PPPA 5HWBA 1D7IA 3TCZA 2VN1A 2MLYA 1J4HA 4ITZA 1FKRA 3VAWA 1YW5A 3JYMA 4DROA 2MLXA 3KAIA 4BF8A 1Q6IA 2M2AA 3RGCA 1EQ3A 2RUCA 1A7XA 4W9PA 5DIVA 3IK8A 1B6CA 2XP3A 2ZQSA 4DH0A 3NRKA 1FKHA 1JVWA 2F21A 4LAVA 3PRDA 1FKKA 1Q6HA 4G2PA 1FKIA 3O5MA 4ODNA 4ODOA 3KABA 2AWGA 2L2SA 4IQCA 3O5DA 3O5PA 2MLZA 4QT2A 1R9HA 2F4EA 3ODKA 4DRIA 4QIBA 3JXVA 3PA7A 2KE0A 2LGOA 4DZ3A 1P5QA 2MF9A 2PV1A 3CGNA 2ZR4A 2LJ4A 2PPOA 3LUOA 5B8IC 3O5LA 1F40A 4DRQA 3KCEA 5HUAA 5J6EA 4J4NA 4ODRA 2XP8A 1W26A 2K8IA 5DITA 2XP7A 5GPGA 2FKEA 1QPLA 3KACA 2PBCA 1TCOC 3UI5A 1ROUA 2KI3A 4U85A 4G50A 1JNTA 1Q1CA 3KAGA 4GIVA 4IPXA 3I6CA 3O5RA 4DIPA 1FAPA 1QZ2A 3JYJA 4ODKA 4DZ2A 5I98A 4TX0A 2RUQA 2PV3A 2F2DA 3B7XA 4JFLA 1L1PA 4TW8A 5HT1A 1FKLA 4MGVA 2RSEA 5HTGA 2ITKA 5HW7A 1JNSA 4MSPA 1QPFA 1BL4A 3UQBA 4JFMA 4ODMA 2KGJA 2OFNA 1NMWA 2UZ5A 3O5JA 4TW6A 2IF4A 4TW7A 5DIUA 1BKFA 4U86A 2ZQVA 1ZCNA 1HXVA 2Y78A 4DRNA 2PV2A 2ZQUA 2ZR6A 3FAPA 4TYOA 3TDBA 4DRPA 3OOBA 2FAPA 2KFWA 2LKNA 3IKDA 3KAFA 5HW8A 3UF8A 2XP5A 1J6YA 5HKGA 3UI4A 4TNSA 5BXJA 1Y0OA 4ODLA 2D9FA 2M08A 1FD9A 4LAYA 5D75A 4LAXA 3CGMA 4DRHA 4LAWA 1FKTA 3NI6A 4NNRA 2JZVA 3H9RB 1J4RA 1KT1A 1NMVA 1EYMA 4W9OA 3WH0A 2RUDA 4FAPA 4QT3A 1PBKA 3GPKA 1D6OA 2PPNA 2DG9A 3IKGA 1Q6UA 1U79A 1YATA 4GGQA 2VCDA 3O5OA 3O5QA 5HWCA 3O5GA 1FKSA 1ZK6A 1FKDA 3KZ7A 3KADA 3PRBA 1FKFA 3TC5A 1FKJA 2DG4A 4DRJA 4U84A 4JYSA 1FKGA 2M1IA 2XP4A 4JFIA 1N1AA 3O5EA 4O2TA 1D7JA 3NTPA 4JFKA 1C9HA 4FN2A 4ODPA
chains in the Genus database with same CATH superfamily
1PINA 2RURA 4R0XA 4HARA 2N87A 4ZPWR 2XP9A 1O6IA 4ODQA 3O5FA 1NWUA 1SR0A 2ZQTA 1XHGA 2XPAA 2O9OA 1XRVA 4J4OA 1KT0A 3IHZA 4N19A 3O5KA 4JFJA 4AY1A 4ZPVR 4S3KA 3ALGA 2PPPA 3RM8A 1ZBKA 1HKJA 1VF8A 2DT3A 1B6CA 2ZQSA 3NRKA 1HJWA 5DO2A 3PRDA 4G2PA 4ODOA 3KABA 4XAKA 3O5PA 4QT2A 3AQUA 3PA7A 2LGOA 3ARPA 1P5QA 5GQBA 2LJ4A 2PPOA 4DRQA 3ARVA 4W5UA 5J6EA 2A3EA 1EHNA 4P8XA 3KACA 1QPLA 3ARUA 5DF0A 1TCOC 1JNTA 3KAGA 3I6CA 1RD6A 3WKZA 4DZ2A 2DSZA 4TX0A 4JFLA 3WIJA 5HT1A 1FKLA 1JNSA 4TW6A 3O5JA 3CHDA 2P4VA 1BKFA 1TFVA 4U86A 2F23A 3RM4A 3ARWA 3WD4A 1W1PA 3B9AA 2WLYA 1E9LA 2PI6A 3KAFA 5HKGA 1Y0OA 3OA5A 2YBTA 4MPKA 4LAXA 1LQ0A 4DRHA 1JNDA 1LG1A 1J4RA 4W9OA 1EDQA 1FFRA 3GPKA 3AS3A 3WL0A 2AOSA 4GGQA 3O5OA 3O5QA 1FKSA 1ZK6A 2DSUA 1FKFA 4DRJA 1GPFA 4ZPTR 4MNMA 4S3JA 1D7JA 2OLHA 1C9HA 2WM0A 2ZR5A 5GPRA 1M5YA 3WD0A 1FJDA 2KR7A 4C02B 1GOIA 4Z2KA 3KAHA 1FKBA 3MDYB 1GRJA 2XP6A 2LPVA 2RQSA 3UQAA 5HWBA 1D7IA 4Z2JA 4L72B 2QF8A 1SYTA 1FKRA 3FXYA 1W1YA 1YW5A 2MLXA 3KAIA 4BF8A 1Q6IA 2M2AA 2RUCA 1W9UA 3IK8A 1HKMA 2XP3A 4DH0A 3CHCA 4WKHA 1FKHA 4WJXA 3G6MA 4LAVA 3GU0A 1FKIA 4ODNA 1E15A 1R9HA 3B9DA 3ODKA 4QIBA 3JXVA 4DZ3A 2MF9A 3LUOA 1F40A 5HUAA 2O92A 3GTYX 2XP8A 1CTNA 5DITA 3ARZA 4GIVA 1Q1CA 2WK2A 4IPXA 3O5RA 4ODKA 3QOKA 4Z2IA 4L3NA 3B7XA 4P8UA 4TW8A 3CZ8A 2RSEA 4Z2GA 1ZBWA 2ITKA 1WAWA 3ALFA 1QPFA 3UQBA 2KGJA 5DIUA 2UZ5A 2IF4A 2ESCA 2B31A 2G41A 1WB0A 4DWSA 2FAPA 5BXJA 1JNEA 1GUVA 3AS2A 2D9FA 2M08A 1FD9A 4ODLA 5D75A 4NSBA 3CGMA 1NWRA 1LL4A 1FKTA 3NI6A 4NNRA 2JZVA 1ZBCA 1KT1A 3WH0A 1EYMA 4FAPA 4QT3A 2PPNA 1U79A 1ZB5A 3O5GA 1FKDA 1X6LA 2DG4A 4R5EA 1ITXA 2XP4A 4O2TA 2FDMA 3TCZA 4FN2A 1D7HA 4W9QA 3RFWA 4KQZA 2KO7A 3B8SA 4P8VA 4DT4A 3EY6A 2PN0A 1UR8A 2DG3A 1NWTA 4IQ2A 3UQIA 1ROTA 4PTMA 5HW6A 3UI6A 3ARQA 4ITZA 3JYMA 4DROA 1JCHB 3CHEA 1EIBA 3RGCA 5DIVA 1A7XA 1LL7A 4HBEA 5DEZA 1ZBVA 4WK9A 3WD1A 4Z2HA 4MTVA 1FKKA 1Q6HA 3O5MA 2AWGA 3O5DA 1E6NA 2F4EA 2DT1A 3PR9A 2KE0A 1IX5A 3ARSA 3CHFA 2A3AA 1FFQA 4ODRA 1W26A 2K8IA 3WQWA 1OGGA 3UI5A 1ROUA 2KI3A 4U85A 4G50A 3RMEA 1FAPA 1QZ2A 3JYJA 1OWQA 5HBFA 3W4RA 1W9PA 2EULA 2F2DA 1NWSA 2PV3A 2ETNA 2DT2A 4QZVB 4MSPA 1BL4A 4JFMA 3BMBA 4ODMA 5JH8A 4TW7A 2DSVA 3FY1A 2ZQVA 1ZCNA 4DRNA 2PV2A 1LG2A 3WD2A 3FAPA 4TYOA 3TDBA 3OOBA 1WNOA 2KFWA 3IKDA 3PRAA 5HW8A 3UF8A 2XP5A 3WD3A 1J6YA 3WQVA 4Q7NA 3EIPA 4LAYA 3ARTA 4LAWA 3H9RB 3BXWA 1UR9A 1PBKA 1D6OA 2DG9A 3IKGA 3ARYA 4UDMA 5HWCA 2DPEA 3KADA 3PRBA 4U84A 4JYSA 4Q22A 2M1IA 4JFIA 3NTPA 4JFKA 2A3CA 3CH9A 1HJVA 4DWSD 1W1VA 2XPBA 2MNTA 1F8AB 1J4IA 3O5IA 2MPHA 1H0IA 4WKAA 2Q5AA 1T11A 2A3BA 1K9TA 1NSGA 4DRKA 1HKKA 4DRMA 2VN1A 2MLYA 2YBUA 4WIWA 1J4HA 3VAWA 4ML4A 1E6RA 1EQ3A 4W9PA 2B5UB 3G6LA 4MAVA 3WL1A 1JVWA 2F21A 1LL6A 2L2SA 4IQCA 1W9VA 2MLZA 1E6ZA 4MNJA 4DRIA 1ZU8A 1X6NA 3ARXA 2PV1A 3CGNA 2ZR4A 5B8IC 1D2KA 3O5LA 4HBOA 1E44A 3KCEA 1LJYA 3AS1A 4J4NA 2XP7A 5GPGA 2FKEA 2PBCA 3AROA 1HKIA 1OGBA 2DSWA 4DIPA 5I98A 2RUQA 4LGXA 1L1PA 2IUZA 2DT0A 4MGVA 5HTGA 4WKFA 5HW7A 4KR0B 4P8WA 1NH6A 1NMWA 2OFNA 3AS0A 3ARRA 1HXVA 2Y78A 1KFWA 2G8ZA 2ZQUA 2ZR6A 4Z2LA 4DRPA 4IT4A 2LKNA 3UI4A 4TNSA 1HJXA 4ZS6A 1NMVA 2RUDA 4IT6A 1H0GA 1Q6UA 1YATA 3B9EA 1W1TA 4NZCA 2VCDA 3KZ7A 4URIA 4MNKA 3TC5A 1FKJA 1FKGA 1ZL1A 1E6PA 2WLZA 1N1AA 3O5EA 4DWSC 4DWSB 3RM9A 4MNLA 4ODPA
chains in the Genus database with same CATH topology
1PINA 2RURA 4R0XA 4HARA 2N87A 4ZPWR 2XP9A 1O6IA 4ODQA 3O5FA 1NWUA 1SR0A 2ZQTA 1XHGA 2XPAA 2O9OA 1XRVA 4J4OA 1KT0A 3IHZA 4N19A 3O5KA 4JFJA 4AY1A 4ZPVR 4S3KA 3ALGA 2PPPA 3RM8A 1ZBKA 1HKJA 1VF8A 2DT3A 1B6CA 2ZQSA 3NRKA 1HJWA 5DO2A 3PRDA 4G2PA 4ODOA 3KABA 4XAKA 3O5PA 4QT2A 3AQUA 3PA7A 2LGOA 3ARPA 1P5QA 5GQBA 2LJ4A 2PPOA 4DRQA 3ARVA 4W5UA 5J6EA 2A3EA 1EHNA 4P8XA 3KACA 1QPLA 3ARUA 5DF0A 1TCOC 1JNTA 3KAGA 3I6CA 1RD6A 3WKZA 4DZ2A 2DSZA 4TX0A 4JFLA 3WIJA 5HT1A 1FKLA 1JNSA 4TW6A 3O5JA 3CHDA 1BKFA 1TFVA 4U86A 3RM4A 3ARWA 3WD4A 1W1PA 3B9AA 2WLYA 1E9LA 2PI6A 3KAFA 5HKGA 1Y0OA 3OA5A 2YBTA 4MPKA 4LAXA 1LQ0A 4DRHA 1JNDA 1LG1A 1J4RA 4W9OA 1EDQA 1FFRA 3GPKA 3AS3A 3WL0A 2AOSA 4GGQA 3O5OA 3O5QA 1FKSA 1ZK6A 2DSUA 1FKFA 4DRJA 1GPFA 4ZPTR 4MNMA 4S3JA 1D7JA 2OLHA 1C9HA 2WM0A 2ZR5A 5GPRA 1M5YA 3WD0A 1FJDA 2KR7A 4C02B 1GOIA 4Z2KA 3KAHA 1FKBA 3MDYB 2XP6A 2LPVA 2RQSA 3UQAA 5HWBA 1D7IA 4Z2JA 4L72B 2QF8A 1SYTA 1FKRA 3FXYA 1W1YA 1YW5A 2MLXA 3KAIA 4BF8A 1Q6IA 2M2AA 2RUCA 1W9UA 3IK8A 1HKMA 2XP3A 4DH0A 3CHCA 4WKHA 1FKHA 4WJXA 3G6MA 4LAVA 1FKIA 4ODNA 1E15A 1R9HA 3B9DA 3ODKA 4QIBA 3JXVA 4DZ3A 2MF9A 3LUOA 1F40A 5HUAA 2O92A 2XP8A 1CTNA 5DITA 3ARZA 4GIVA 1Q1CA 2WK2A 4IPXA 3O5RA 4ODKA 3QOKA 4Z2IA 4L3NA 3B7XA 4P8UA 4TW8A 3CZ8A 2RSEA 4Z2GA 1ZBWA 2ITKA 1WAWA 3ALFA 1QPFA 3UQBA 2KGJA 5DIUA 2UZ5A 2IF4A 2ESCA 2B31A 2G41A 1WB0A 4DWSA 2FAPA 5BXJA 1JNEA 1GUVA 3AS2A 2D9FA 2M08A 1FD9A 4ODLA 5D75A 4NSBA 3CGMA 1NWRA 1LL4A 1FKTA 3NI6A 4NNRA 2JZVA 1ZBCA 1KT1A 3WH0A 1EYMA 4FAPA 4QT3A 2PPNA 1U79A 1ZB5A 3O5GA 1FKDA 1X6LA 2DG4A 4R5EA 1ITXA 2XP4A 4O2TA 2FDMA 3TCZA 4FN2A 1D7HA 4W9QA 3RFWA 4KQZA 2KO7A 3B8SA 4P8VA 4DT4A 3EY6A 1UR8A 2DG3A 1NWTA 4IQ2A 3UQIA 1ROTA 4PTMA 5HW6A 3UI6A 3ARQA 4ITZA 3JYMA 4DROA 3CHEA 1EIBA 3RGCA 5DIVA 1A7XA 1LL7A 4HBEA 5DEZA 1ZBVA 4WK9A 3WD1A 4Z2HA 4MTVA 1FKKA 1Q6HA 3O5MA 2AWGA 3O5DA 1E6NA 2F4EA 2DT1A 3PR9A 2KE0A 1IX5A 3ARSA 3CHFA 2A3AA 1FFQA 4ODRA 1W26A 2K8IA 3WQWA 1OGGA 3UI5A 1ROUA 2KI3A 4U85A 4G50A 3RMEA 1FAPA 1QZ2A 3JYJA 1OWQA 5HBFA 3W4RA 1W9PA 2PV3A 2F2DA 1NWSA 2DT2A 4QZVB 4MSPA 1BL4A 4JFMA 4ODMA 5JH8A 4TW7A 2DSVA 3FY1A 2ZQVA 1ZCNA 4DRNA 2PV2A 1LG2A 3WD2A 3FAPA 4TYOA 3TDBA 3OOBA 1WNOA 2KFWA 3IKDA 3PRAA 5HW8A 3UF8A 2XP5A 3WD3A 1J6YA 3WQVA 4Q7NA 4LAYA 3ARTA 4LAWA 3H9RB 3BXWA 1UR9A 1PBKA 1D6OA 2DG9A 3IKGA 3ARYA 5HWCA 2DPEA 3KADA 3PRBA 4U84A 4JYSA 4Q22A 2M1IA 4JFIA 3NTPA 4JFKA 2A3CA 3CH9A 1HJVA 4DWSD 1W1VA 2XPBA 2MNTA 1F8AB 1J4IA 3O5IA 2MPHA 1H0IA 4WKAA 2Q5AA 1T11A 2A3BA 1K9TA 1NSGA 4DRKA 1HKKA 4DRMA 2VN1A 2MLYA 2YBUA 4WIWA 1J4HA 3VAWA 4ML4A 1E6RA 1EQ3A 4W9PA 3G6LA 4MAVA 3WL1A 1JVWA 2F21A 1LL6A 2L2SA 4IQCA 1W9VA 2MLZA 1E6ZA 4MNJA 4DRIA 1ZU8A 1X6NA 3ARXA 2PV1A 3CGNA 2ZR4A 5B8IC 1D2KA 3O5LA 4HBOA 3KCEA 1LJYA 3AS1A 4J4NA 2XP7A 5GPGA 2FKEA 2PBCA 3AROA 1HKIA 1OGBA 2DSWA 4DIPA 5I98A 2RUQA 4LGXA 1L1PA 2IUZA 2DT0A 4MGVA 5HTGA 4WKFA 5HW7A 4KR0B 4P8WA 1NH6A 1NMWA 2OFNA 3AS0A 3ARRA 1HXVA 2Y78A 1KFWA 2G8ZA 2ZQUA 2ZR6A 4Z2LA 4DRPA 4IT4A 2LKNA 3UI4A 4TNSA 1HJXA 4ZS6A 1NMVA 2RUDA 4IT6A 1H0GA 1Q6UA 1YATA 3B9EA 1W1TA 4NZCA 2VCDA 3KZ7A 4URIA 4MNKA 3TC5A 1FKJA 1FKGA 1ZL1A 1E6PA 2WLZA 1N1AA 3O5EA 4DWSC 4DWSB 3RM9A 4MNLA 4ODPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIN A;  2RUR A;  4R0X A;  2N87 A;  1D7H A;  2ZR5 A;  2XPB A;  2XP9 A;  4W9Q A;  2MNT A;  3RFW A;  1M5Y A;  4ODQ A;  3O5F A;  1F8A B;  2KO7 A;  1FJD A;  1J4I A;  3O5I A;  2KR7 A;  2MPH A;  4C02 B;  2ZQT A;  2Q5A A;  2XPA A;  3EY6 A;  4DT4 A;  1T11 A;  4J4O A;  1KT0 A;  3IHZ A;  1NSG A;  2DG3 A;  3KAH A;  4N19 A;  4IQ2 A;  3O5K A;  1FKB A;  1ROT A;  3MDY B;  2XP6 A;  4JFJ A;  3UQI A;  4DRK A;  5HW6 A;  3UI6 A;  2LPV A;  2RQS A;  3UQA A;  4DRM A;  2PPP A;  5HWB A;  1D7I A;  3TCZ A;  2VN1 A;  2MLY A;  1J4H A;  4ITZ A;  1FKR A;  3VAW A;  1YW5 A;  3JYM A;  4DRO A;  2MLX A;  3KAI A;  4BF8 A;  1Q6I A;  2M2A A;  3RGC A;  1EQ3 A;  2RUC A;  1A7X A;  4W9P A;  5DIV A;  3IK8 A;  1B6C A;  2XP3 A;  2ZQS A;  4DH0 A;  3NRK A;  1FKH A;  1JVW A;  2F21 A;  4LAV A;  3PRD A;  1FKK A;  1Q6H A;  4G2P A;  1FKI A;  3O5M A;  4ODN A;  4ODO A;  3KAB A;  2AWG A;  2L2S A;  4IQC A;  3O5D A;  3O5P A;  2MLZ A;  4QT2 A;  1R9H A;  2F4E A;  3ODK A;  4DRI A;  4QIB A;  3JXV A;  3PA7 A;  2KE0 A;  2LGO A;  4DZ3 A;  1P5Q A;  2MF9 A;  2PV1 A;  3CGN A;  2ZR4 A;  2LJ4 A;  2PPO A;  3LUO A;  5B8I C;  3O5L A;  1F40 A;  4DRQ A;  3KCE A;  5HUA A;  5J6E A;  4J4N A;  4ODR A;  2XP8 A;  1W26 A;  2K8I A;  5DIT A;  2XP7 A;  5GPG A;  2FKE A;  1QPL A;  3KAC A;  2PBC A;  1TCO C;  3UI5 A;  1ROU A;  2KI3 A;  4U85 A;  4G50 A;  1JNT A;  1Q1C A;  3KAG A;  4GIV A;  4IPX A;  3I6C A;  3O5R A;  4DIP A;  1FAP A;  1QZ2 A;  3JYJ A;  4ODK A;  4DZ2 A;  5I98 A;  4TX0 A;  2RUQ A;  2PV3 A;  2F2D A;  3B7X A;  4JFL A;  1L1P A;  4TW8 A;  5HT1 A;  1FKL A;  4MGV A;  2RSE A;  5HTG A;  2ITK A;  5HW7 A;  1JNS A;  4MSP A;  1QPF A;  1BL4 A;  3UQB A;  4JFM A;  4ODM A;  2KGJ A;  2OFN A;  1NMW A;  2UZ5 A;  3O5J A;  4TW6 A;  2IF4 A;  4TW7 A;  5DIU A;  1BKF A;  4U86 A;  2ZQV A;  1ZCN A;  1HXV A;  2Y78 A;  4DRN A;  2PV2 A;  2ZQU A;  2ZR6 A;  3FAP A;  4TYO A;  3TDB A;  4DRP A;  3OOB A;  2FAP A;  2KFW A;  2LKN A;  3IKD A;  3KAF A;  5HW8 A;  3UF8 A;  2XP5 A;  1J6Y A;  5HKG A;  3UI4 A;  4TNS A;  5BXJ A;  1Y0O A;  4ODL A;  2D9F A;  2M08 A;  1FD9 A;  4LAY A;  5D75 A;  4LAX A;  3CGM A;  4DRH A;  4LAW A;  1FKT A;  3NI6 A;  4NNR A;  2JZV A;  3H9R B;  1J4R A;  1KT1 A;  1NMV A;  1EYM A;  4W9O A;  3WH0 A;  2RUD A;  4FAP A;  4QT3 A;  1PBK A;  3GPK A;  1D6O A;  2PPN A;  2DG9 A;  3IKG A;  1Q6U A;  1U79 A;  1YAT A;  4GGQ A;  2VCD A;  3O5O A;  3O5Q A;  5HWC A;  3O5G A;  1FKS A;  1ZK6 A;  1FKD A;  3KZ7 A;  3KAD A;  3PRB A;  1FKF A;  3TC5 A;  1FKJ A;  2DG4 A;  4DRJ A;  4U84 A;  4JYS A;  1FKG A;  2M1I A;  2XP4 A;  4JFI A;  1N1A A;  3O5E A;  4O2T A;  1D7J A;  3NTP A;  4JFK A;  1C9H A;  4FN2 A;  4ODP A; 
#chains in the Genus database with same CATH topology
 1PIN A;  2RUR A;  4R0X A;  4HAR A;  2N87 A;  4ZPW R;  2XP9 A;  1O6I A;  4ODQ A;  3O5F A;  1NWU A;  1SR0 A;  2ZQT A;  1XHG A;  2XPA A;  2O9O A;  1XRV A;  4J4O A;  1KT0 A;  3IHZ A;  4N19 A;  3O5K A;  4JFJ A;  4AY1 A;  4ZPV R;  4S3K A;  3ALG A;  2PPP A;  3RM8 A;  1ZBK A;  1HKJ A;  1VF8 A;  2DT3 A;  1B6C A;  2ZQS A;  3NRK A;  1HJW A;  5DO2 A;  3PRD A;  4G2P A;  4ODO A;  3KAB A;  4XAK A;  3O5P A;  4QT2 A;  3AQU A;  3PA7 A;  2LGO A;  3ARP A;  1P5Q A;  5GQB A;  2LJ4 A;  2PPO A;  4DRQ A;  3ARV A;  4W5U A;  5J6E A;  2A3E A;  1EHN A;  4P8X A;  3KAC A;  1QPL A;  3ARU A;  5DF0 A;  1TCO C;  1JNT A;  3KAG A;  3I6C A;  1RD6 A;  3WKZ A;  4DZ2 A;  2DSZ A;  4TX0 A;  4JFL A;  3WIJ A;  5HT1 A;  1FKL A;  1JNS A;  4TW6 A;  3O5J A;  3CHD A;  2P4V A;  1BKF A;  1TFV A;  4U86 A;  2F23 A;  3RM4 A;  3ARW A;  3WD4 A;  1W1P A;  3B9A A;  2WLY A;  1E9L A;  2PI6 A;  3KAF A;  5HKG A;  1Y0O A;  3OA5 A;  2YBT A;  4MPK A;  4LAX A;  1LQ0 A;  4DRH A;  1JND A;  1LG1 A;  1J4R A;  4W9O A;  1EDQ A;  1FFR A;  3GPK A;  3AS3 A;  3WL0 A;  2AOS A;  4GGQ A;  3O5O A;  3O5Q A;  1FKS A;  1ZK6 A;  2DSU A;  1FKF A;  4DRJ A;  1GPF A;  4ZPT R;  4MNM A;  4S3J A;  1D7J A;  2OLH A;  1C9H A;  2WM0 A;  2ZR5 A;  5GPR A;  1M5Y A;  3WD0 A;  1FJD A;  2KR7 A;  4C02 B;  1GOI A;  4Z2K A;  3KAH A;  1FKB A;  3MDY B;  1GRJ A;  2XP6 A;  2LPV A;  2RQS A;  3UQA A;  5HWB A;  1D7I A;  4Z2J A;  4L72 B;  2QF8 A;  1SYT A;  1FKR A;  3FXY A;  1W1Y A;  1YW5 A;  2MLX A;  3KAI A;  4BF8 A;  1Q6I A;  2M2A A;  2RUC A;  1W9U A;  3IK8 A;  1HKM A;  2XP3 A;  4DH0 A;  3CHC A;  4WKH A;  1FKH A;  4WJX A;  3G6M A;  4LAV A;  3GU0 A;  1FKI A;  4ODN A;  1E15 A;  1R9H A;  3B9D A;  3ODK A;  4QIB A;  3JXV A;  4DZ3 A;  2MF9 A;  3LUO A;  1F40 A;  5HUA A;  2O92 A;  3GTY X;  2XP8 A;  1CTN A;  5DIT A;  3ARZ A;  4GIV A;  1Q1C A;  2WK2 A;  4IPX A;  3O5R A;  4ODK A;  3QOK A;  4Z2I A;  4L3N A;  3B7X A;  4P8U A;  4TW8 A;  3CZ8 A;  2RSE A;  4Z2G A;  1ZBW A;  2ITK A;  1WAW A;  3ALF A;  1QPF A;  3UQB A;  2KGJ A;  5DIU A;  2UZ5 A;  2IF4 A;  2ESC A;  2B31 A;  2G41 A;  1WB0 A;  4DWS A;  2FAP A;  5BXJ A;  1JNE A;  1GUV A;  3AS2 A;  2D9F A;  2M08 A;  1FD9 A;  4ODL A;  5D75 A;  4NSB A;  3CGM A;  1NWR A;  1LL4 A;  1FKT A;  3NI6 A;  4NNR A;  2JZV A;  1ZBC A;  1KT1 A;  3WH0 A;  1EYM A;  4FAP A;  4QT3 A;  2PPN A;  1U79 A;  1ZB5 A;  3O5G A;  1FKD A;  1X6L A;  2DG4 A;  4R5E A;  1ITX A;  2XP4 A;  4O2T A;  2FDM A;  3TCZ A;  4FN2 A;  1D7H A;  4W9Q A;  3RFW A;  4KQZ A;  2KO7 A;  3B8S A;  4P8V A;  4DT4 A;  3EY6 A;  2PN0 A;  1UR8 A;  2DG3 A;  1NWT A;  4IQ2 A;  3UQI A;  1ROT A;  4PTM A;  5HW6 A;  3UI6 A;  3ARQ A;  4ITZ A;  3JYM A;  4DRO A;  1JCH B;  3CHE A;  1EIB A;  3RGC A;  5DIV A;  1A7X A;  1LL7 A;  4HBE A;  5DEZ A;  1ZBV A;  4WK9 A;  3WD1 A;  4Z2H A;  4MTV A;  1FKK A;  1Q6H A;  3O5M A;  2AWG A;  3O5D A;  1E6N A;  2F4E A;  2DT1 A;  3PR9 A;  2KE0 A;  1IX5 A;  3ARS A;  3CHF A;  2A3A A;  1FFQ A;  4ODR A;  1W26 A;  2K8I A;  3WQW A;  1OGG A;  3UI5 A;  1ROU A;  2KI3 A;  4U85 A;  4G50 A;  3RME A;  1FAP A;  1QZ2 A;  3JYJ A;  1OWQ A;  5HBF A;  3W4R A;  1W9P A;  2EUL A;  2F2D A;  1NWS A;  2PV3 A;  2ETN A;  2DT2 A;  4QZV B;  4MSP A;  1BL4 A;  4JFM A;  3BMB A;  4ODM A;  5JH8 A;  4TW7 A;  2DSV A;  3FY1 A;  2ZQV A;  1ZCN A;  4DRN A;  2PV2 A;  1LG2 A;  3WD2 A;  3FAP A;  4TYO A;  3TDB A;  3OOB A;  1WNO A;  2KFW A;  3IKD A;  3PRA A;  5HW8 A;  3UF8 A;  2XP5 A;  3WD3 A;  1J6Y A;  3WQV A;  4Q7N A;  3EIP A;  4LAY A;  3ART A;  4LAW A;  3H9R B;  3BXW A;  1UR9 A;  1PBK A;  1D6O A;  2DG9 A;  3IKG A;  3ARY A;  4UDM A;  5HWC A;  2DPE A;  3KAD A;  3PRB A;  4U84 A;  4JYS A;  4Q22 A;  2M1I A;  4JFI A;  3NTP A;  4JFK A;  2A3C A;  3CH9 A;  1HJV A;  4DWS D;  1W1V A;  2XPB A;  2MNT A;  1F8A B;  1J4I A;  3O5I A;  2MPH A;  1H0I A;  4WKA A;  2Q5A A;  1T11 A;  2A3B A;  1K9T A;  1NSG A;  4DRK A;  1HKK A;  4DRM A;  2VN1 A;  2MLY A;  2YBU A;  4WIW A;  1J4H A;  3VAW A;  4ML4 A;  1E6R A;  1EQ3 A;  4W9P A;  2B5U B;  3G6L A;  4MAV A;  3WL1 A;  1JVW A;  2F21 A;  1LL6 A;  2L2S A;  4IQC A;  1W9V A;  2MLZ A;  1E6Z A;  4MNJ A;  4DRI A;  1ZU8 A;  1X6N A;  3ARX A;  2PV1 A;  3CGN A;  2ZR4 A;  5B8I C;  1D2K A;  3O5L A;  4HBO A;  1E44 A;  3KCE A;  1LJY A;  3AS1 A;  4J4N A;  2XP7 A;  5GPG A;  2FKE A;  2PBC A;  3ARO A;  1HKI A;  1OGB A;  2DSW A;  4DIP A;  5I98 A;  2RUQ A;  4LGX A;  1L1P A;  2IUZ A;  2DT0 A;  4MGV A;  5HTG A;  4WKF A;  5HW7 A;  4KR0 B;  4P8W A;  1NH6 A;  1NMW A;  2OFN A;  3AS0 A;  3ARR A;  1HXV A;  2Y78 A;  1KFW A;  2G8Z A;  2ZQU A;  2ZR6 A;  4Z2L A;  4DRP A;  4IT4 A;  2LKN A;  3UI4 A;  4TNS A;  1HJX A;  4ZS6 A;  1NMV A;  2RUD A;  4IT6 A;  1H0G A;  1Q6U A;  1YAT A;  3B9E A;  1W1T A;  4NZC A;  2VCD A;  3KZ7 A;  4URI A;  4MNK A;  3TC5 A;  1FKJ A;  1FKG A;  1ZL1 A;  1E6P A;  2WLZ A;  1N1A A;  3O5E A;  4DWS C;  4DWS B;  3RM9 A;  4MNL A;  4ODP A; 
#chains in the Genus database with same CATH homology
 1PIN A;  2RUR A;  4R0X A;  4HAR A;  2N87 A;  4ZPW R;  2XP9 A;  1O6I A;  4ODQ A;  3O5F A;  1NWU A;  1SR0 A;  2ZQT A;  1XHG A;  2XPA A;  2O9O A;  1XRV A;  4J4O A;  1KT0 A;  3IHZ A;  4N19 A;  3O5K A;  4JFJ A;  4AY1 A;  4ZPV R;  4S3K A;  3ALG A;  2PPP A;  3RM8 A;  1ZBK A;  1HKJ A;  1VF8 A;  2DT3 A;  1B6C A;  2ZQS A;  3NRK A;  1HJW A;  5DO2 A;  3PRD A;  4G2P A;  4ODO A;  3KAB A;  4XAK A;  3O5P A;  4QT2 A;  3AQU A;  3PA7 A;  2LGO A;  3ARP A;  1P5Q A;  5GQB A;  2LJ4 A;  2PPO A;  4DRQ A;  3ARV A;  4W5U A;  5J6E A;  2A3E A;  1EHN A;  4P8X A;  3KAC A;  1QPL A;  3ARU A;  5DF0 A;  1TCO C;  1JNT A;  3KAG A;  3I6C A;  1RD6 A;  3WKZ A;  4DZ2 A;  2DSZ A;  4TX0 A;  4JFL A;  3WIJ A;  5HT1 A;  1FKL A;  1JNS A;  4TW6 A;  3O5J A;  3CHD A;  1BKF A;  1TFV A;  4U86 A;  3RM4 A;  3ARW A;  3WD4 A;  1W1P A;  3B9A A;  2WLY A;  1E9L A;  2PI6 A;  3KAF A;  5HKG A;  1Y0O A;  3OA5 A;  2YBT A;  4MPK A;  4LAX A;  1LQ0 A;  4DRH A;  1JND A;  1LG1 A;  1J4R A;  4W9O A;  1EDQ A;  1FFR A;  3GPK A;  3AS3 A;  3WL0 A;  2AOS A;  4GGQ A;  3O5O A;  3O5Q A;  1FKS A;  1ZK6 A;  2DSU A;  1FKF A;  4DRJ A;  1GPF A;  4ZPT R;  4MNM A;  4S3J A;  1D7J A;  2OLH A;  1C9H A;  2WM0 A;  2ZR5 A;  5GPR A;  1M5Y A;  3WD0 A;  1FJD A;  2KR7 A;  4C02 B;  1GOI A;  4Z2K A;  3KAH A;  1FKB A;  3MDY B;  2XP6 A;  2LPV A;  2RQS A;  3UQA A;  5HWB A;  1D7I A;  4Z2J A;  4L72 B;  2QF8 A;  1SYT A;  1FKR A;  3FXY A;  1W1Y A;  1YW5 A;  2MLX A;  3KAI A;  4BF8 A;  1Q6I A;  2M2A A;  2RUC A;  1W9U A;  3IK8 A;  1HKM A;  2XP3 A;  4DH0 A;  3CHC A;  4WKH A;  1FKH A;  4WJX A;  3G6M A;  4LAV A;  1FKI A;  4ODN A;  1E15 A;  1R9H A;  3B9D A;  3ODK A;  4QIB A;  3JXV A;  4DZ3 A;  2MF9 A;  3LUO A;  1F40 A;  5HUA A;  2O92 A;  2XP8 A;  1CTN A;  5DIT A;  3ARZ A;  4GIV A;  1Q1C A;  2WK2 A;  4IPX A;  3O5R A;  4ODK A;  3QOK A;  4Z2I A;  4L3N A;  3B7X A;  4P8U A;  4TW8 A;  3CZ8 A;  2RSE A;  4Z2G A;  1ZBW A;  2ITK A;  1WAW A;  3ALF A;  1QPF A;  3UQB A;  2KGJ A;  5DIU A;  2UZ5 A;  2IF4 A;  2ESC A;  2B31 A;  2G41 A;  1WB0 A;  4DWS A;  2FAP A;  5BXJ A;  1JNE A;  1GUV A;  3AS2 A;  2D9F A;  2M08 A;  1FD9 A;  4ODL A;  5D75 A;  4NSB A;  3CGM A;  1NWR A;  1LL4 A;  1FKT A;  3NI6 A;  4NNR A;  2JZV A;  1ZBC A;  1KT1 A;  3WH0 A;  1EYM A;  4FAP A;  4QT3 A;  2PPN A;  1U79 A;  1ZB5 A;  3O5G A;  1FKD A;  1X6L A;  2DG4 A;  4R5E A;  1ITX A;  2XP4 A;  4O2T A;  2FDM A;  3TCZ A;  4FN2 A;  1D7H A;  4W9Q A;  3RFW A;  4KQZ A;  2KO7 A;  3B8S A;  4P8V A;  4DT4 A;  3EY6 A;  1UR8 A;  2DG3 A;  1NWT A;  4IQ2 A;  3UQI A;  1ROT A;  4PTM A;  5HW6 A;  3UI6 A;  3ARQ A;  4ITZ A;  3JYM A;  4DRO A;  3CHE A;  1EIB A;  3RGC A;  5DIV A;  1A7X A;  1LL7 A;  4HBE A;  5DEZ A;  1ZBV A;  4WK9 A;  3WD1 A;  4Z2H A;  4MTV A;  1FKK A;  1Q6H A;  3O5M A;  2AWG A;  3O5D A;  1E6N A;  2F4E A;  2DT1 A;  3PR9 A;  2KE0 A;  1IX5 A;  3ARS A;  3CHF A;  2A3A A;  1FFQ A;  4ODR A;  1W26 A;  2K8I A;  3WQW A;  1OGG A;  3UI5 A;  1ROU A;  2KI3 A;  4U85 A;  4G50 A;  3RME A;  1FAP A;  1QZ2 A;  3JYJ A;  1OWQ A;  5HBF A;  3W4R A;  1W9P A;  2PV3 A;  2F2D A;  1NWS A;  2DT2 A;  4QZV B;  4MSP A;  1BL4 A;  4JFM A;  4ODM A;  5JH8 A;  4TW7 A;  2DSV A;  3FY1 A;  2ZQV A;  1ZCN A;  4DRN A;  2PV2 A;  1LG2 A;  3WD2 A;  3FAP A;  4TYO A;  3TDB A;  3OOB A;  1WNO A;  2KFW A;  3IKD A;  3PRA A;  5HW8 A;  3UF8 A;  2XP5 A;  3WD3 A;  1J6Y A;  3WQV A;  4Q7N A;  4LAY A;  3ART A;  4LAW A;  3H9R B;  3BXW A;  1UR9 A;  1PBK A;  1D6O A;  2DG9 A;  3IKG A;  3ARY A;  5HWC A;  2DPE A;  3KAD A;  3PRB A;  4U84 A;  4JYS A;  4Q22 A;  2M1I A;  4JFI A;  3NTP A;  4JFK A;  2A3C A;  3CH9 A;  1HJV A;  4DWS D;  1W1V A;  2XPB A;  2MNT A;  1F8A B;  1J4I A;  3O5I A;  2MPH A;  1H0I A;  4WKA A;  2Q5A A;  1T11 A;  2A3B A;  1K9T A;  1NSG A;  4DRK A;  1HKK A;  4DRM A;  2VN1 A;  2MLY A;  2YBU A;  4WIW A;  1J4H A;  3VAW A;  4ML4 A;  1E6R A;  1EQ3 A;  4W9P A;  3G6L A;  4MAV A;  3WL1 A;  1JVW A;  2F21 A;  1LL6 A;  2L2S A;  4IQC A;  1W9V A;  2MLZ A;  1E6Z A;  4MNJ A;  4DRI A;  1ZU8 A;  1X6N A;  3ARX A;  2PV1 A;  3CGN A;  2ZR4 A;  5B8I C;  1D2K A;  3O5L A;  4HBO A;  3KCE A;  1LJY A;  3AS1 A;  4J4N A;  2XP7 A;  5GPG A;  2FKE A;  2PBC A;  3ARO A;  1HKI A;  1OGB A;  2DSW A;  4DIP A;  5I98 A;  2RUQ A;  4LGX A;  1L1P A;  2IUZ A;  2DT0 A;  4MGV A;  5HTG A;  4WKF A;  5HW7 A;  4KR0 B;  4P8W A;  1NH6 A;  1NMW A;  2OFN A;  3AS0 A;  3ARR A;  1HXV A;  2Y78 A;  1KFW A;  2G8Z A;  2ZQU A;  2ZR6 A;  4Z2L A;  4DRP A;  4IT4 A;  2LKN A;  3UI4 A;  4TNS A;  1HJX A;  4ZS6 A;  1NMV A;  2RUD A;  4IT6 A;  1H0G A;  1Q6U A;  1YAT A;  3B9E A;  1W1T A;  4NZC A;  2VCD A;  3KZ7 A;  4URI A;  4MNK A;  3TC5 A;  1FKJ A;  1FKG A;  1ZL1 A;  1E6P A;  2WLZ A;  1N1A A;  3O5E A;  4DWS C;  4DWS B;  3RM9 A;  4MNL A;  4ODP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...