4O2TA

Crystal structure of a duf4827 family protein (bdi_1692) from parabacteroides distasonis atcc 8503 at 2.40 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
168
structure length
168
Chain Sequence
GKSYTDMLKDEKKAIERFIDDKGLEILDDFPADSVFKENQFVLLDNGVYLNIIDKGSDQRAVQYKTKMLYRCKMSYFMDSTIVAIENYGPHSNGTSPIAFTYGDYSKNSPYDPSYYYVSEGMQEPLKYVGDRAKVKMIVPFKRGAYNDQSNGQPVYYEILEYIFEENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (BDI_1692) from Parabacteroides distasonis ATCC 8503 at 2.40 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 44
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4o2tA00
4TW8A 1A7XA 4J4OA 1NMVA 5HT1A 2XP5A 4LAWA 2PPNA 3I6CA 2MLZA 1FKTA 4W9OA 2PBCA 1QPLA 1FKBA 4JFIA 3JYJA 3O5FA 1EQ3A 3TCZA 1J6YA 1FKIA 2ZR4A 2PPOA 3IHZA 1QPFA 3KADA 4JFJA 4W9QA 2JZVA 1L1PA 5HW8A 1YATA 4ODRA 1P5QA 2PV2A 3KAIA 2UZ5A 4ODMA 5J6EA 3O5LA 2RUDA 3UQBA 4FN2A 4JYSA 3VAWA 2N87A 3O5OA 4GGQA 4W9PA 4DRKA 5I98A 1ZCNA 2RURA 4TYOA 2LPVA 3GPKA 4J4NA 4MGVA 3RFWA 5BXJA 3UQAA 1Q6HA 1FKSA 2KI3A 3JYMA 4ODNA 5HWBA 3UF8A 3TDBA 5HW7A 3LUOA 3NRKA 1ROTA 2F21A 1N1AA 2F2DA 2VN1A 4IQCA 1ZK6A 4JFKA 5D75A 4DZ3A 4O2TA 2DG9A 2ZQSA 2PPPA 1D7IA 1JNTA 4ODQA 1Q6UA 1Y0OA 2FKEA 1ROUA 2ITKA 3KACA 2XPBA 1FKGA 4ODPA 2MLXA 3MDYB 2KO7A 1BL4A 2L2SA 3B7XA 2XP4A 3IKGA 2AWGA 4R0XA 5DIVA 3EY6A 1NMWA 5GPGA 1U79A 4FAPA 2RUQA 1F8AB 3WH0A 3O5MA 2DG3A 2KFWA 2Y78A 3O5GA 4NNRA 3JXVA 2KR7A 4U86A 1C9HA 3NI6A 4DRHA 3UI4A 1F40A 3OOBA 2ZR5A 4IQ2A 2ZQUA 2F4EA 4DZ2A 3O5RA 3IKDA 1D7HA 3KZ7A 2XP8A 2LJ4A 4DRNA 4QT2A 1FKDA 4MSPA 4G50A 3UI6A 1FKJA 3O5JA 1JNSA 4DH0A 3O5EA 3TC5A 4TW7A 4ITZA 2XP7A 4DRMA 4ODOA 2M1IA 1FKRA 3IK8A 3KAGA 2XPAA 3O5PA 4DRPA 5HKGA 1PBKA 1FAPA 1M5YA 4BF8A 2MF9A 3NTPA 4ODLA 4TW6A 3CGNA 5HW6A 3O5IA 5DIUA 1D7JA 2KGJA 1FKFA 3KABA 3PRBA 4DRQA 1FJDA 1KT1A 4U85A 4DROA 1Q1CA 2MPHA 3KAHA 3FAPA 5HTGA 2XP9A 3PRDA 4DRIA 2XP6A 2M2AA 2VCDA 2FAPA 1T11A 4G2PA 4TX0A 1J4RA 2LGOA 2ZQVA 1TCOC 1J4IA 1FKLA 4QT3A 1EYMA 1FKHA 3O5KA 4DIPA 1FD9A 4N19A 2PV1A 2KE0A 2Q5AA 4QIBA 4U84A 2XP3A 2IF4A 5B8IC 2M08A 2MLYA 1BKFA 4DT4A 2MNTA 5HWCA 4TNSA 4GIVA 2DG4A 4JFLA 3UQIA 5HUAA 1FKKA 1J4HA 1JVWA 4ODKA 3UI5A 2D9FA 2RUCA 2OFNA 1HXVA 1R9HA 3CGMA 4LAYA 1Q6IA 1KT0A 4IPXA 4LAXA 3RGCA 3ODKA 4DRJA 1B6CA 2LKNA 4LAVA 3O5QA 2ZR6A 1D6OA 2K8IA 3KAFA 1NSGA 1PINA 1YW5A 3H9RB 2PV3A 2RQSA 3PA7A 5DITA 1W26A 2ZQTA 2RSEA 3KCEA 4JFMA 4C02B 1QZ2A 3O5DA
chains in the Genus database with same CATH superfamily
1NMVA 1HKJA 5HT1A 4Z2LA 4LAWA 2PN0A 4JFIA 4Z2HA 2JZVA 1YATA 4ODRA 3CHDA 3KAIA 5J6EA 3O5LA 1W9VA 1E6RA 3UQBA 4FN2A 3VAWA 2N87A 3O5OA 1JCHB 4GGQA 3FY1A 3GPKA 5BXJA 1WB0A 4ODNA 2ESCA 1OWQA 5HW7A 3PRAA 1D2KA 3NRKA 1N1AA 1NWRA 2PPPA 3ARTA 1HKMA 1W1YA 3ARYA 3ARWA 3MDYB 2KO7A 3B7XA 2L2SA 3WL0A 5JH8A 3G6LA 3B8SA 4ZS6A 1NMWA 4ZPTR 4U86A 1E15A 2KR7A 3OOBA 1SYTA 4P8XA 2WK2A 2XP8A 3GU0A 3CHCA 1FKDA 4QT2A 4DWSC 3O5JA 3B9AA 1FKRA 3IK8A 3KAGA 2XPAA 2QF8A 1PBKA 4ODLA 4TW6A 3CGNA 3B9DA 3G6MA 3PRBA 2ETNA 2A3AA 4HBEA 4L3NA 3AS1A 2M2AA 1T11A 2YBTA 3WIJA 1HKIA 2LGOA 4QT3A 4DIPA 3OA5A 1NWUA 2MLYA 1KFWA 1BKFA 4WKHA 4JFLA 4Z2JA 1LL6A 1HXVA 4WK9A 2F23A 1WNOA 4LAYA 4IPXA 1LG2A 2G41A 4DRJA 4LAVA 1ITXA 2ZR6A 1D6OA 4P8UA 1ZBVA 3H9RB 2RQSA 4DH0A 3O5PA 3EY6A 1QZ2A 4TW8A 2XP5A 1FKTA 4W9OA 1FKBA 3O5FA 1J6YA 1FKIA 1FFRA 3IHZA 1LL7A 1OGGA 4JFJA 4Q22A 4W9QA 4Z2KA 5GPRA 4R5EA 2PV2A 2RUDA 1K9TA 1EHNA 4JYSA 3CHFA 4ZPWR 4W9PA 2A3BA 2LPVA 4J4NA 3RFWA 5HBFA 2KI3A 3ARQA 5HWBA 3UF8A 3TDBA 2F21A 2VN1A 4IQCA 2P4VA 2DG9A 4Z2IA 4ODQA 1Q6UA 4ODPA 2XPBA 3AS3A 3AQUA 3QOKA 4MNMA 3WD1A 5DIVA 1NH6A 4FAPA 3PR9A 4QZVB 2RUQA 3BMBA 2KFWA 1GUVA 1NWTA 2DSZA 3ARSA 3NI6A 4DRHA 1EDQA 4MNJA 3WD4A 2ZQUA 1W1TA 4DZ2A 3O5RA 1XHGA 2DT1A 4DRNA 3GTYX 1FKJA 2YBUA 4P8WA 3O5EA 4ITZA 4DWSA 2XP7A 1HJXA 4MNKA 3ARPA 5GQBA 4MNLA 4DRPA 1FFQA 1FAPA 4BF8A 3ARZA 3NTPA 5HW6A 1D7JA 2IUZA 2KGJA 1SR0A 3KABA 1KT1A 3RM4A 1Q1CA 2MPHA 3KAHA 5DO2A 4G2PA 1J4RA 4W5UA 3O5KA 1UR8A 1E6ZA 1FD9A 4N19A 3WD2A 2KE0A 2IF4A 2M08A 1JNEA 4P8VA 3ARRA 4DT4A 5HWCA 4HARA 3UQIA 5HUAA 2B5UB 1W1VA 1R9HA 4NZCA 1LJYA 1B6CA 2LKNA 1XRVA 5DF0A 3WKZA 2DPEA 2WLYA 4KR0B 4JFMA 2RSEA 1EIBA 1A7XA 4J4OA 1GRJA 3I6CA 1QPLA 3TCZA 3AS0A 2PPOA 1LL4A 3ALFA 1GPFA 3KADA 2DT3A 5HW8A 4ODMA 1W1PA 4WKFA 4DRKA 5I98A 1ZCNA 2RURA 1CTNA 4TYOA 4MGVA 4ML4A 1NWSA 3UQAA 1LQ0A 3WL1A 4MAVA 1E9LA 1ZK6A 4JFKA 1LG1A 4IT6A 2ZQSA 4URIA 4DWSD 1Y0OA 1ROUA 2ITKA 1ZBWA 2A3EA 2XP4A 2AWGA 3WH0A 2OLHA 2DG3A 2DSUA 2Y78A 4ZPVR 4NNRA 1C9HA 2ZR5A 3WD0A 4KQZA 3KZ7A 1GOIA 1TFVA 2B31A 1ZU8A 3ARVA 4MSPA 1JNSA 1RD6A 3TC5A 4TW7A 1ZBKA 4DRMA 3WD3A 2MF9A 3ALGA 5DIUA 1JNDA 4DRQA 4U85A 4UDMA 2O92A 5HTGA 4NSBA 4IT4A 3WQWA 2ZQVA 1J4IA 4PTMA 1OGBA 1EYMA 1FKHA 3CHEA 4MPKA 2PV1A 4QIBA 4U84A 2XP3A 4AY1A 5B8IC 2MNTA 2DG4A 1J4HA 4ODKA 2D9FA 1ZBCA 1Q6IA 4HBOA 4LAXA 1O6IA 4WKAA 3O5QA 4L72B 3KAFA 1PINA 3PA7A 2A3CA 1UR9A 2PPNA 2MLZA 2PBCA 3JYJA 1IX5A 1EQ3A 2ZR4A 1QPFA 1L1PA 1P5QA 1ZB5A 2UZ5A 2WLZA 4XAKA 1VF8A 2EULA 3CZ8A 1Q6HA 3EIPA 1FKSA 1HJWA 2DT2A 3JYMA 2WM0A 3LUOA 1ROTA 2F2DA 5D75A 4DZ3A 4O2TA 1D7IA 1JNTA 3RMEA 2FKEA 3KACA 1H0GA 1FKGA 2MLXA 4WIWA 1BL4A 1H0IA 3IKGA 3AS2A 4R0XA 3FXYA 5GPGA 1U79A 1F8AB 3O5MA 3O5GA 4LGXA 3JXVA 3UI4A 1F40A 4IQ2A 2F4EA 2FDMA 1D7HA 3ARXA 3IKDA 2LJ4A 4G50A 3UI6A 1HKKA 2G8ZA 3W4RA 2DSWA 4ODOA 2M1IA 1ZL1A 5HKGA 1HJVA 1M5YA 1WAWA 1E6NA 3AROA 4Z2GA 3O5IA 4WJXA 1FKFA 1FJDA 4DROA 5DEZA 3FAPA 2XP9A 3PRDA 4DRIA 2XP6A 4S3KA 2VCDA 2FAPA 3B9EA 4TX0A 1TCOC 1FKLA 3CH9A 4DWSB 4S3JA 2Q5AA 1X6NA 2DSVA 3BXWA 3ARUA 4TNSA 4GIVA 1FKKA 1JVWA 2PI6A 3UI5A 2RUCA 2OFNA 2O9OA 4MTVA 3WQVA 1W9PA 3CGMA 1KT0A 3RGCA 3ODKA 2DT0A 3RM9A 1E44A 3RM8A 1X6LA 1E6PA 2K8IA 1W9UA 1NSGA 1YW5A 4Q7NA 2PV3A 4C02B 5DITA 1W26A 2ZQTA 3KCEA 2AOSA 3O5DA
chains in the Genus database with same CATH topology
1NMVA 1HKJA 5HT1A 4Z2LA 4LAWA 4JFIA 4Z2HA 2JZVA 1YATA 4ODRA 3CHDA 3KAIA 5J6EA 3O5LA 1W9VA 1E6RA 3UQBA 4FN2A 3VAWA 2N87A 3O5OA 4GGQA 3FY1A 3GPKA 5BXJA 1WB0A 4ODNA 2ESCA 1OWQA 5HW7A 3PRAA 1D2KA 3NRKA 1N1AA 1NWRA 2PPPA 3ARTA 1HKMA 1W1YA 3ARYA 3ARWA 3MDYB 2KO7A 3B7XA 2L2SA 3WL0A 5JH8A 3G6LA 3B8SA 4ZS6A 1NMWA 4ZPTR 4U86A 1E15A 2KR7A 3OOBA 1SYTA 4P8XA 2WK2A 2XP8A 4QT2A 3CHCA 1FKDA 4DWSC 3O5JA 3B9AA 1FKRA 3IK8A 3KAGA 2XPAA 2QF8A 1PBKA 4ODLA 4TW6A 3CGNA 3B9DA 3G6MA 3PRBA 4HBEA 2A3AA 4L3NA 3AS1A 2M2AA 1T11A 2YBTA 3WIJA 1HKIA 2LGOA 4QT3A 4DIPA 3OA5A 1NWUA 2MLYA 1KFWA 1BKFA 4WKHA 4JFLA 4Z2JA 1LL6A 1HXVA 4WK9A 1WNOA 4LAYA 4IPXA 1LG2A 2G41A 4DRJA 4LAVA 1ITXA 2ZR6A 1D6OA 4P8UA 1ZBVA 3H9RB 2RQSA 4DH0A 3O5PA 3EY6A 1QZ2A 4TW8A 2XP5A 1FKTA 4W9OA 1FKBA 3O5FA 1J6YA 1FKIA 1FFRA 3IHZA 1LL7A 1OGGA 4JFJA 4Q22A 4W9QA 4Z2KA 5GPRA 4R5EA 2PV2A 2RUDA 1K9TA 1EHNA 4JYSA 3CHFA 4ZPWR 4W9PA 2A3BA 2LPVA 4J4NA 3RFWA 5HBFA 2KI3A 3ARQA 5HWBA 3UF8A 3TDBA 2F21A 2VN1A 4IQCA 2DG9A 4Z2IA 4ODQA 1Q6UA 4ODPA 2XPBA 3AS3A 3AQUA 3QOKA 4MNMA 3WD1A 5DIVA 1NH6A 4FAPA 3PR9A 4QZVB 2RUQA 2KFWA 1GUVA 1NWTA 2DSZA 3ARSA 3NI6A 4DRHA 1EDQA 4MNJA 3WD4A 2ZQUA 1W1TA 4DZ2A 3O5RA 1XHGA 2DT1A 4DRNA 1FKJA 2YBUA 4P8WA 3O5EA 4ITZA 4DWSA 2XP7A 1HJXA 4MNKA 3ARPA 5GQBA 4MNLA 4DRPA 1FFQA 1FAPA 4BF8A 3ARZA 3NTPA 5HW6A 1D7JA 2IUZA 2KGJA 1SR0A 3KABA 1KT1A 3RM4A 1Q1CA 2MPHA 3KAHA 5DO2A 4G2PA 1J4RA 4W5UA 3O5KA 1UR8A 1E6ZA 1FD9A 4N19A 3WD2A 2KE0A 2IF4A 2M08A 1JNEA 4P8VA 3ARRA 4DT4A 5HWCA 4HARA 3UQIA 5HUAA 1W1VA 1R9HA 4NZCA 1LJYA 1B6CA 2LKNA 1XRVA 5DF0A 3WKZA 2DPEA 2WLYA 4KR0B 4JFMA 2RSEA 1EIBA 1A7XA 4J4OA 3I6CA 1QPLA 3TCZA 3AS0A 2PPOA 1LL4A 3ALFA 1GPFA 3KADA 2DT3A 5HW8A 4ODMA 1W1PA 4WKFA 4DRKA 5I98A 1ZCNA 2RURA 1CTNA 4TYOA 4MGVA 4ML4A 1NWSA 3UQAA 1LQ0A 3WL1A 4MAVA 1E9LA 1ZK6A 4JFKA 1LG1A 4IT6A 2ZQSA 4URIA 4DWSD 1Y0OA 1ROUA 2ITKA 1ZBWA 2A3EA 2XP4A 2AWGA 3WH0A 2OLHA 2DG3A 2DSUA 2Y78A 4ZPVR 4NNRA 1C9HA 2ZR5A 3WD0A 4KQZA 3KZ7A 1GOIA 1TFVA 2B31A 1ZU8A 3ARVA 4MSPA 1JNSA 1RD6A 3TC5A 4TW7A 1ZBKA 4DRMA 3WD3A 2MF9A 3ALGA 5DIUA 1JNDA 4DRQA 4U85A 2O92A 5HTGA 4NSBA 4IT4A 3WQWA 2ZQVA 1J4IA 4PTMA 1OGBA 1EYMA 1FKHA 3CHEA 4MPKA 2PV1A 4QIBA 4U84A 2XP3A 4AY1A 5B8IC 2MNTA 2DG4A 1J4HA 4ODKA 2D9FA 1ZBCA 1Q6IA 4HBOA 4LAXA 1O6IA 4WKAA 3O5QA 4L72B 3KAFA 1PINA 3PA7A 2A3CA 1UR9A 2PPNA 2MLZA 2PBCA 3JYJA 1IX5A 1EQ3A 2ZR4A 1QPFA 1L1PA 1P5QA 1ZB5A 2UZ5A 2WLZA 4XAKA 1VF8A 3CZ8A 1Q6HA 1FKSA 1HJWA 2DT2A 3JYMA 2WM0A 3LUOA 1ROTA 2F2DA 5D75A 4DZ3A 4O2TA 1D7IA 1JNTA 3RMEA 2FKEA 3KACA 1H0GA 1FKGA 2MLXA 4WIWA 1BL4A 1H0IA 3IKGA 3AS2A 4R0XA 3FXYA 5GPGA 1U79A 1F8AB 3O5MA 3O5GA 4LGXA 3JXVA 3UI4A 1F40A 4IQ2A 2F4EA 2FDMA 1D7HA 3ARXA 3IKDA 2LJ4A 4G50A 3UI6A 1HKKA 2G8ZA 3W4RA 2DSWA 4ODOA 2M1IA 1ZL1A 5HKGA 1HJVA 1M5YA 1WAWA 1E6NA 3AROA 4Z2GA 3O5IA 4WJXA 1FKFA 1FJDA 4DROA 5DEZA 3FAPA 2XP9A 3PRDA 4DRIA 2XP6A 4S3KA 2VCDA 2FAPA 3B9EA 4TX0A 1TCOC 1FKLA 3CH9A 4DWSB 4S3JA 2Q5AA 1X6NA 2DSVA 3BXWA 3ARUA 4TNSA 4GIVA 1FKKA 1JVWA 2PI6A 3UI5A 2RUCA 2OFNA 2O9OA 4MTVA 3WQVA 1W9PA 3CGMA 1KT0A 3RGCA 3ODKA 2DT0A 3RM9A 3RM8A 1X6LA 1E6PA 2K8IA 1W9UA 1NSGA 1YW5A 4Q7NA 2PV3A 4C02B 5DITA 1W26A 2ZQTA 3KCEA 2AOSA 3O5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TW8 A;  1A7X A;  4J4O A;  1NMV A;  5HT1 A;  2XP5 A;  4LAW A;  2PPN A;  3I6C A;  2MLZ A;  1FKT A;  4W9O A;  2PBC A;  1QPL A;  1FKB A;  4JFI A;  3JYJ A;  3O5F A;  1EQ3 A;  3TCZ A;  1J6Y A;  1FKI A;  2ZR4 A;  2PPO A;  3IHZ A;  1QPF A;  3KAD A;  4JFJ A;  4W9Q A;  2JZV A;  1L1P A;  5HW8 A;  1YAT A;  4ODR A;  1P5Q A;  2PV2 A;  3KAI A;  2UZ5 A;  4ODM A;  5J6E A;  3O5L A;  2RUD A;  3UQB A;  4FN2 A;  4JYS A;  3VAW A;  2N87 A;  3O5O A;  4GGQ A;  4W9P A;  4DRK A;  5I98 A;  1ZCN A;  2RUR A;  4TYO A;  2LPV A;  3GPK A;  4J4N A;  4MGV A;  3RFW A;  5BXJ A;  3UQA A;  1Q6H A;  1FKS A;  2KI3 A;  3JYM A;  4ODN A;  5HWB A;  3UF8 A;  3TDB A;  5HW7 A;  3LUO A;  3NRK A;  1ROT A;  2F21 A;  1N1A A;  2F2D A;  2VN1 A;  4IQC A;  1ZK6 A;  4JFK A;  5D75 A;  4DZ3 A;  4O2T A;  2DG9 A;  2ZQS A;  2PPP A;  1D7I A;  1JNT A;  4ODQ A;  1Q6U A;  1Y0O A;  2FKE A;  1ROU A;  2ITK A;  3KAC A;  2XPB A;  1FKG A;  4ODP A;  2MLX A;  3MDY B;  2KO7 A;  1BL4 A;  2L2S A;  3B7X A;  2XP4 A;  3IKG A;  2AWG A;  4R0X A;  5DIV A;  3EY6 A;  1NMW A;  5GPG A;  1U79 A;  4FAP A;  2RUQ A;  1F8A B;  3WH0 A;  3O5M A;  2DG3 A;  2KFW A;  2Y78 A;  3O5G A;  4NNR A;  3JXV A;  2KR7 A;  4U86 A;  1C9H A;  3NI6 A;  4DRH A;  3UI4 A;  1F40 A;  3OOB A;  2ZR5 A;  4IQ2 A;  2ZQU A;  2F4E A;  4DZ2 A;  3O5R A;  3IKD A;  1D7H A;  3KZ7 A;  2XP8 A;  2LJ4 A;  4DRN A;  4QT2 A;  1FKD A;  4MSP A;  4G50 A;  3UI6 A;  1FKJ A;  3O5J A;  1JNS A;  4DH0 A;  3O5E A;  3TC5 A;  4TW7 A;  4ITZ A;  2XP7 A;  4DRM A;  4ODO A;  2M1I A;  1FKR A;  3IK8 A;  3KAG A;  2XPA A;  3O5P A;  4DRP A;  5HKG A;  1PBK A;  1FAP A;  1M5Y A;  4BF8 A;  2MF9 A;  3NTP A;  4ODL A;  4TW6 A;  3CGN A;  5HW6 A;  3O5I A;  5DIU A;  1D7J A;  2KGJ A;  1FKF A;  3KAB A;  3PRB A;  4DRQ A;  1FJD A;  1KT1 A;  4U85 A;  4DRO A;  1Q1C A;  2MPH A;  3KAH A;  3FAP A;  5HTG A;  2XP9 A;  3PRD A;  4DRI A;  2XP6 A;  2M2A A;  2VCD A;  2FAP A;  1T11 A;  4G2P A;  4TX0 A;  1J4R A;  2LGO A;  2ZQV A;  1TCO C;  1J4I A;  1FKL A;  4QT3 A;  1EYM A;  1FKH A;  3O5K A;  4DIP A;  1FD9 A;  4N19 A;  2PV1 A;  2KE0 A;  2Q5A A;  4QIB A;  4U84 A;  2XP3 A;  2IF4 A;  5B8I C;  2M08 A;  2MLY A;  1BKF A;  4DT4 A;  2MNT A;  5HWC A;  4TNS A;  4GIV A;  2DG4 A;  4JFL A;  3UQI A;  5HUA A;  1FKK A;  1J4H A;  1JVW A;  4ODK A;  3UI5 A;  2D9F A;  2RUC A;  2OFN A;  1HXV A;  1R9H A;  3CGM A;  4LAY A;  1Q6I A;  1KT0 A;  4IPX A;  4LAX A;  3RGC A;  3ODK A;  4DRJ A;  1B6C A;  2LKN A;  4LAV A;  3O5Q A;  2ZR6 A;  1D6O A;  2K8I A;  3KAF A;  1NSG A;  1PIN A;  1YW5 A;  3H9R B;  2PV3 A;  2RQS A;  3PA7 A;  5DIT A;  1W26 A;  2ZQT A;  2RSE A;  3KCE A;  4JFM A;  4C02 B;  1QZ2 A;  3O5D A; 
#chains in the Genus database with same CATH topology
 1NMV A;  1HKJ A;  5HT1 A;  4Z2L A;  4LAW A;  2PN0 A;  4JFI A;  4Z2H A;  2JZV A;  1YAT A;  4ODR A;  3CHD A;  3KAI A;  5J6E A;  3O5L A;  1W9V A;  1E6R A;  3UQB A;  4FN2 A;  3VAW A;  2N87 A;  3O5O A;  1JCH B;  4GGQ A;  3FY1 A;  3GPK A;  5BXJ A;  1WB0 A;  4ODN A;  2ESC A;  1OWQ A;  5HW7 A;  3PRA A;  1D2K A;  3NRK A;  1N1A A;  1NWR A;  2PPP A;  3ART A;  1HKM A;  1W1Y A;  3ARY A;  3ARW A;  3MDY B;  2KO7 A;  3B7X A;  2L2S A;  3WL0 A;  5JH8 A;  3G6L A;  3B8S A;  4ZS6 A;  1NMW A;  4ZPT R;  4U86 A;  1E15 A;  2KR7 A;  3OOB A;  1SYT A;  4P8X A;  2WK2 A;  2XP8 A;  3GU0 A;  3CHC A;  1FKD A;  4QT2 A;  4DWS C;  3O5J A;  3B9A A;  1FKR A;  3IK8 A;  3KAG A;  2XPA A;  2QF8 A;  1PBK A;  4ODL A;  4TW6 A;  3CGN A;  3B9D A;  3G6M A;  3PRB A;  2ETN A;  2A3A A;  4HBE A;  4L3N A;  3AS1 A;  2M2A A;  1T11 A;  2YBT A;  3WIJ A;  1HKI A;  2LGO A;  4QT3 A;  4DIP A;  3OA5 A;  1NWU A;  2MLY A;  1KFW A;  1BKF A;  4WKH A;  4JFL A;  4Z2J A;  1LL6 A;  1HXV A;  4WK9 A;  2F23 A;  1WNO A;  4LAY A;  4IPX A;  1LG2 A;  2G41 A;  4DRJ A;  4LAV A;  1ITX A;  2ZR6 A;  1D6O A;  4P8U A;  1ZBV A;  3H9R B;  2RQS A;  4DH0 A;  3O5P A;  3EY6 A;  1QZ2 A;  4TW8 A;  2XP5 A;  1FKT A;  4W9O A;  1FKB A;  3O5F A;  1J6Y A;  1FKI A;  1FFR A;  3IHZ A;  1LL7 A;  1OGG A;  4JFJ A;  4Q22 A;  4W9Q A;  4Z2K A;  5GPR A;  4R5E A;  2PV2 A;  2RUD A;  1K9T A;  1EHN A;  4JYS A;  3CHF A;  4ZPW R;  4W9P A;  2A3B A;  2LPV A;  4J4N A;  3RFW A;  5HBF A;  2KI3 A;  3ARQ A;  5HWB A;  3UF8 A;  3TDB A;  2F21 A;  2VN1 A;  4IQC A;  2P4V A;  2DG9 A;  4Z2I A;  4ODQ A;  1Q6U A;  4ODP A;  2XPB A;  3AS3 A;  3AQU A;  3QOK A;  4MNM A;  3WD1 A;  5DIV A;  1NH6 A;  4FAP A;  3PR9 A;  4QZV B;  2RUQ A;  3BMB A;  2KFW A;  1GUV A;  1NWT A;  2DSZ A;  3ARS A;  3NI6 A;  4DRH A;  1EDQ A;  4MNJ A;  3WD4 A;  2ZQU A;  1W1T A;  4DZ2 A;  3O5R A;  1XHG A;  2DT1 A;  4DRN A;  3GTY X;  1FKJ A;  2YBU A;  4P8W A;  3O5E A;  4ITZ A;  4DWS A;  2XP7 A;  1HJX A;  4MNK A;  3ARP A;  5GQB A;  4MNL A;  4DRP A;  1FFQ A;  1FAP A;  4BF8 A;  3ARZ A;  3NTP A;  5HW6 A;  1D7J A;  2IUZ A;  2KGJ A;  1SR0 A;  3KAB A;  1KT1 A;  3RM4 A;  1Q1C A;  2MPH A;  3KAH A;  5DO2 A;  4G2P A;  1J4R A;  4W5U A;  3O5K A;  1UR8 A;  1E6Z A;  1FD9 A;  4N19 A;  3WD2 A;  2KE0 A;  2IF4 A;  2M08 A;  1JNE A;  4P8V A;  3ARR A;  4DT4 A;  5HWC A;  4HAR A;  3UQI A;  5HUA A;  2B5U B;  1W1V A;  1R9H A;  4NZC A;  1LJY A;  1B6C A;  2LKN A;  1XRV A;  5DF0 A;  3WKZ A;  2DPE A;  2WLY A;  4KR0 B;  4JFM A;  2RSE A;  1EIB A;  1A7X A;  4J4O A;  1GRJ A;  3I6C A;  1QPL A;  3TCZ A;  3AS0 A;  2PPO A;  1LL4 A;  3ALF A;  1GPF A;  3KAD A;  2DT3 A;  5HW8 A;  4ODM A;  1W1P A;  4WKF A;  4DRK A;  5I98 A;  1ZCN A;  2RUR A;  1CTN A;  4TYO A;  4MGV A;  4ML4 A;  1NWS A;  3UQA A;  1LQ0 A;  3WL1 A;  4MAV A;  1E9L A;  1ZK6 A;  4JFK A;  1LG1 A;  4IT6 A;  2ZQS A;  4URI A;  4DWS D;  1Y0O A;  1ROU A;  2ITK A;  1ZBW A;  2A3E A;  2XP4 A;  2AWG A;  3WH0 A;  2OLH A;  2DG3 A;  2DSU A;  2Y78 A;  4ZPV R;  4NNR A;  1C9H A;  2ZR5 A;  3WD0 A;  4KQZ A;  3KZ7 A;  1GOI A;  1TFV A;  2B31 A;  1ZU8 A;  3ARV A;  4MSP A;  1JNS A;  1RD6 A;  3TC5 A;  4TW7 A;  1ZBK A;  4DRM A;  3WD3 A;  2MF9 A;  3ALG A;  5DIU A;  1JND A;  4DRQ A;  4U85 A;  4UDM A;  2O92 A;  5HTG A;  4NSB A;  4IT4 A;  3WQW A;  2ZQV A;  1J4I A;  4PTM A;  1OGB A;  1EYM A;  1FKH A;  3CHE A;  4MPK A;  2PV1 A;  4QIB A;  4U84 A;  2XP3 A;  4AY1 A;  5B8I C;  2MNT A;  2DG4 A;  1J4H A;  4ODK A;  2D9F A;  1ZBC A;  1Q6I A;  4HBO A;  4LAX A;  1O6I A;  4WKA A;  3O5Q A;  4L72 B;  3KAF A;  1PIN A;  3PA7 A;  2A3C A;  1UR9 A;  2PPN A;  2MLZ A;  2PBC A;  3JYJ A;  1IX5 A;  1EQ3 A;  2ZR4 A;  1QPF A;  1L1P A;  1P5Q A;  1ZB5 A;  2UZ5 A;  2WLZ A;  4XAK A;  1VF8 A;  2EUL A;  3CZ8 A;  1Q6H A;  3EIP A;  1FKS A;  1HJW A;  2DT2 A;  3JYM A;  2WM0 A;  3LUO A;  1ROT A;  2F2D A;  5D75 A;  4DZ3 A;  4O2T A;  1D7I A;  1JNT A;  3RME A;  2FKE A;  3KAC A;  1H0G A;  1FKG A;  2MLX A;  4WIW A;  1BL4 A;  1H0I A;  3IKG A;  3AS2 A;  4R0X A;  3FXY A;  5GPG A;  1U79 A;  1F8A B;  3O5M A;  3O5G A;  4LGX A;  3JXV A;  3UI4 A;  1F40 A;  4IQ2 A;  2F4E A;  2FDM A;  1D7H A;  3ARX A;  3IKD A;  2LJ4 A;  4G50 A;  3UI6 A;  1HKK A;  2G8Z A;  3W4R A;  2DSW A;  4ODO A;  2M1I A;  1ZL1 A;  5HKG A;  1HJV A;  1M5Y A;  1WAW A;  1E6N A;  3ARO A;  4Z2G A;  3O5I A;  4WJX A;  1FKF A;  1FJD A;  4DRO A;  5DEZ A;  3FAP A;  2XP9 A;  3PRD A;  4DRI A;  2XP6 A;  4S3K A;  2VCD A;  2FAP A;  3B9E A;  4TX0 A;  1TCO C;  1FKL A;  3CH9 A;  4DWS B;  4S3J A;  2Q5A A;  1X6N A;  2DSV A;  3BXW A;  3ARU A;  4TNS A;  4GIV A;  1FKK A;  1JVW A;  2PI6 A;  3UI5 A;  2RUC A;  2OFN A;  2O9O A;  4MTV A;  3WQV A;  1W9P A;  3CGM A;  1KT0 A;  3RGC A;  3ODK A;  2DT0 A;  3RM9 A;  1E44 A;  3RM8 A;  1X6L A;  1E6P A;  2K8I A;  1W9U A;  1NSG A;  1YW5 A;  4Q7N A;  2PV3 A;  4C02 B;  5DIT A;  1W26 A;  2ZQT A;  3KCE A;  2AOS A;  3O5D A; 
#chains in the Genus database with same CATH homology
 1NMV A;  1HKJ A;  5HT1 A;  4Z2L A;  4LAW A;  4JFI A;  4Z2H A;  2JZV A;  1YAT A;  4ODR A;  3CHD A;  3KAI A;  5J6E A;  3O5L A;  1W9V A;  1E6R A;  3UQB A;  4FN2 A;  3VAW A;  2N87 A;  3O5O A;  4GGQ A;  3FY1 A;  3GPK A;  5BXJ A;  1WB0 A;  4ODN A;  2ESC A;  1OWQ A;  5HW7 A;  3PRA A;  1D2K A;  3NRK A;  1N1A A;  1NWR A;  2PPP A;  3ART A;  1HKM A;  1W1Y A;  3ARY A;  3ARW A;  3MDY B;  2KO7 A;  3B7X A;  2L2S A;  3WL0 A;  5JH8 A;  3G6L A;  3B8S A;  4ZS6 A;  1NMW A;  4ZPT R;  4U86 A;  1E15 A;  2KR7 A;  3OOB A;  1SYT A;  4P8X A;  2WK2 A;  2XP8 A;  4QT2 A;  3CHC A;  1FKD A;  4DWS C;  3O5J A;  3B9A A;  1FKR A;  3IK8 A;  3KAG A;  2XPA A;  2QF8 A;  1PBK A;  4ODL A;  4TW6 A;  3CGN A;  3B9D A;  3G6M A;  3PRB A;  4HBE A;  2A3A A;  4L3N A;  3AS1 A;  2M2A A;  1T11 A;  2YBT A;  3WIJ A;  1HKI A;  2LGO A;  4QT3 A;  4DIP A;  3OA5 A;  1NWU A;  2MLY A;  1KFW A;  1BKF A;  4WKH A;  4JFL A;  4Z2J A;  1LL6 A;  1HXV A;  4WK9 A;  1WNO A;  4LAY A;  4IPX A;  1LG2 A;  2G41 A;  4DRJ A;  4LAV A;  1ITX A;  2ZR6 A;  1D6O A;  4P8U A;  1ZBV A;  3H9R B;  2RQS A;  4DH0 A;  3O5P A;  3EY6 A;  1QZ2 A;  4TW8 A;  2XP5 A;  1FKT A;  4W9O A;  1FKB A;  3O5F A;  1J6Y A;  1FKI A;  1FFR A;  3IHZ A;  1LL7 A;  1OGG A;  4JFJ A;  4Q22 A;  4W9Q A;  4Z2K A;  5GPR A;  4R5E A;  2PV2 A;  2RUD A;  1K9T A;  1EHN A;  4JYS A;  3CHF A;  4ZPW R;  4W9P A;  2A3B A;  2LPV A;  4J4N A;  3RFW A;  5HBF A;  2KI3 A;  3ARQ A;  5HWB A;  3UF8 A;  3TDB A;  2F21 A;  2VN1 A;  4IQC A;  2DG9 A;  4Z2I A;  4ODQ A;  1Q6U A;  4ODP A;  2XPB A;  3AS3 A;  3AQU A;  3QOK A;  4MNM A;  3WD1 A;  5DIV A;  1NH6 A;  4FAP A;  3PR9 A;  4QZV B;  2RUQ A;  2KFW A;  1GUV A;  1NWT A;  2DSZ A;  3ARS A;  3NI6 A;  4DRH A;  1EDQ A;  4MNJ A;  3WD4 A;  2ZQU A;  1W1T A;  4DZ2 A;  3O5R A;  1XHG A;  2DT1 A;  4DRN A;  1FKJ A;  2YBU A;  4P8W A;  3O5E A;  4ITZ A;  4DWS A;  2XP7 A;  1HJX A;  4MNK A;  3ARP A;  5GQB A;  4MNL A;  4DRP A;  1FFQ A;  1FAP A;  4BF8 A;  3ARZ A;  3NTP A;  5HW6 A;  1D7J A;  2IUZ A;  2KGJ A;  1SR0 A;  3KAB A;  1KT1 A;  3RM4 A;  1Q1C A;  2MPH A;  3KAH A;  5DO2 A;  4G2P A;  1J4R A;  4W5U A;  3O5K A;  1UR8 A;  1E6Z A;  1FD9 A;  4N19 A;  3WD2 A;  2KE0 A;  2IF4 A;  2M08 A;  1JNE A;  4P8V A;  3ARR A;  4DT4 A;  5HWC A;  4HAR A;  3UQI A;  5HUA A;  1W1V A;  1R9H A;  4NZC A;  1LJY A;  1B6C A;  2LKN A;  1XRV A;  5DF0 A;  3WKZ A;  2DPE A;  2WLY A;  4KR0 B;  4JFM A;  2RSE A;  1EIB A;  1A7X A;  4J4O A;  3I6C A;  1QPL A;  3TCZ A;  3AS0 A;  2PPO A;  1LL4 A;  3ALF A;  1GPF A;  3KAD A;  2DT3 A;  5HW8 A;  4ODM A;  1W1P A;  4WKF A;  4DRK A;  5I98 A;  1ZCN A;  2RUR A;  1CTN A;  4TYO A;  4MGV A;  4ML4 A;  1NWS A;  3UQA A;  1LQ0 A;  3WL1 A;  4MAV A;  1E9L A;  1ZK6 A;  4JFK A;  1LG1 A;  4IT6 A;  2ZQS A;  4URI A;  4DWS D;  1Y0O A;  1ROU A;  2ITK A;  1ZBW A;  2A3E A;  2XP4 A;  2AWG A;  3WH0 A;  2OLH A;  2DG3 A;  2DSU A;  2Y78 A;  4ZPV R;  4NNR A;  1C9H A;  2ZR5 A;  3WD0 A;  4KQZ A;  3KZ7 A;  1GOI A;  1TFV A;  2B31 A;  1ZU8 A;  3ARV A;  4MSP A;  1JNS A;  1RD6 A;  3TC5 A;  4TW7 A;  1ZBK A;  4DRM A;  3WD3 A;  2MF9 A;  3ALG A;  5DIU A;  1JND A;  4DRQ A;  4U85 A;  2O92 A;  5HTG A;  4NSB A;  4IT4 A;  3WQW A;  2ZQV A;  1J4I A;  4PTM A;  1OGB A;  1EYM A;  1FKH A;  3CHE A;  4MPK A;  2PV1 A;  4QIB A;  4U84 A;  2XP3 A;  4AY1 A;  5B8I C;  2MNT A;  2DG4 A;  1J4H A;  4ODK A;  2D9F A;  1ZBC A;  1Q6I A;  4HBO A;  4LAX A;  1O6I A;  4WKA A;  3O5Q A;  4L72 B;  3KAF A;  1PIN A;  3PA7 A;  2A3C A;  1UR9 A;  2PPN A;  2MLZ A;  2PBC A;  3JYJ A;  1IX5 A;  1EQ3 A;  2ZR4 A;  1QPF A;  1L1P A;  1P5Q A;  1ZB5 A;  2UZ5 A;  2WLZ A;  4XAK A;  1VF8 A;  3CZ8 A;  1Q6H A;  1FKS A;  1HJW A;  2DT2 A;  3JYM A;  2WM0 A;  3LUO A;  1ROT A;  2F2D A;  5D75 A;  4DZ3 A;  4O2T A;  1D7I A;  1JNT A;  3RME A;  2FKE A;  3KAC A;  1H0G A;  1FKG A;  2MLX A;  4WIW A;  1BL4 A;  1H0I A;  3IKG A;  3AS2 A;  4R0X A;  3FXY A;  5GPG A;  1U79 A;  1F8A B;  3O5M A;  3O5G A;  4LGX A;  3JXV A;  3UI4 A;  1F40 A;  4IQ2 A;  2F4E A;  2FDM A;  1D7H A;  3ARX A;  3IKD A;  2LJ4 A;  4G50 A;  3UI6 A;  1HKK A;  2G8Z A;  3W4R A;  2DSW A;  4ODO A;  2M1I A;  1ZL1 A;  5HKG A;  1HJV A;  1M5Y A;  1WAW A;  1E6N A;  3ARO A;  4Z2G A;  3O5I A;  4WJX A;  1FKF A;  1FJD A;  4DRO A;  5DEZ A;  3FAP A;  2XP9 A;  3PRD A;  4DRI A;  2XP6 A;  4S3K A;  2VCD A;  2FAP A;  3B9E A;  4TX0 A;  1TCO C;  1FKL A;  3CH9 A;  4DWS B;  4S3J A;  2Q5A A;  1X6N A;  2DSV A;  3BXW A;  3ARU A;  4TNS A;  4GIV A;  1FKK A;  1JVW A;  2PI6 A;  3UI5 A;  2RUC A;  2OFN A;  2O9O A;  4MTV A;  3WQV A;  1W9P A;  3CGM A;  1KT0 A;  3RGC A;  3ODK A;  2DT0 A;  3RM9 A;  3RM8 A;  1X6L A;  1E6P A;  2K8I A;  1W9U A;  1NSG A;  1YW5 A;  4Q7N A;  2PV3 A;  4C02 B;  5DIT A;  1W26 A;  2ZQT A;  3KCE A;  2AOS A;  3O5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...