1QPFA

Fk506 binding protein (12 kda, human) complex with l-709,858
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 32-Indolyl ether derivatives of ascomycin: three-dimensional structures of complexes with FK506-binding protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
total genus 24
structure length 107
sequence length 107
chains with identical sequence D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1qpfA00
1A7XA 1FKGA 1YW5A 2OFNA 2KI3A 4BF8A 3KADA 3B7XA 4G50A 5HTGA 4C02B 4LAXA 4O2TA 3FAPA 2IF4A 4ODRA 3IHZA 4QIBA 4ODPA 4R0XA 1FKTA 3WH0A 4DRJA 4DT4A 2F21A 4DRIA 4MSPA 1EYMA 2M2AA 3KABA 4ODLA 3H9RB 3KAHA 3NI6A 4NNRA 5B8IC 5HW6A 1F8AB 2PV3A 4LAVA 2LJ4A 4ODKA 4JFIA 5HKGA 3IKDA 2MLXA 1M5YA 4JFKA 4DRMA 1W26A 4ITZA 2PPNA 3CGMA 1FKJA 4TYOA 1C9HA 1QPLA 1QPFA 4GGQA 1PBKA 3O5PA 1FKRA 3O5OA 4ODMA 5DIVA 1FKIA 3UI5A 1PINA 2LPVA 1BKFA 1JNTA 4DRNA 2D9FA 3IKGA 2VCDA 4JFJA 4TW7A 2LKNA 3UQIA 1D7HA 2XP6A 3LUOA 4MGVA 2RUQA 1R9HA 2PV2A 3EY6A 1N1AA 3IK8A 3OOBA 4ODQA 3UI6A 1L1PA 2ZQTA 5BXJA 2MLZA 4DRKA 4J4NA 4DRQA 2RSEA 3O5KA 4LAWA 1FD9A 2KGJA 4IPXA 2RURA 4DH0A 1Q1CA 1J4HA 2XP7A 4FAPA 4DZ2A 4TW6A 2KO7A 1YATA 1Q6HA 2XP3A 1D6OA 3KAFA 4JFMA 3KZ7A 4W9PA 1KT1A 4DIPA 5I98A 3UF8A 4TX0A 2RUCA 3O5EA 3JYJA 3O5QA 1J4RA 3NRKA 1FKFA 1FJDA 4U86A 5DITA 4U84A 1TCOC 1J6YA 3JXVA 3O5LA 5HWCA 2ZQUA 1JVWA 3TC5A 2ITKA 3KCEA 4J4OA 1JNSA 2RUDA 2XPBA 3O5JA 4QT2A 4FN2A 2DG3A 1FKKA 2LGOA 4DRPA 2MNTA 1FKDA 2PBCA 3JYMA 2AWGA 5HWBA 2KFWA 2L2SA 4JYSA 4LAYA 4QT3A 4TNSA 2PPOA 5HUAA 1Q6IA 3PA7A 2MF9A 4IQ2A 4G2PA 1KT0A 2M1IA 1BL4A 2UZ5A 3GPKA 2MLYA 3UI4A 1U79A 2Q5AA 2M08A 4JFLA 4ODNA 4DZ3A 3O5DA 3PRDA 2XP5A 4IQCA 2KE0A 2N87A 1ZK6A 3PRBA 1FKHA 2Y78A 3O5FA 3UQAA 2RQSA 2ZR5A 3O5MA 4N19A 2ZQSA 4GIVA 1NSGA 2FAPA 4TW8A 3TDBA 1J4IA 2XP8A 2JZVA 3KAGA 3RFWA 3CGNA 2XP4A 2ZR4A 5HW8A 2F4EA 4W9OA 2VN1A 3O5IA 2XP9A 2XPAA 4DROA 1Y0OA 2F2DA 1FKLA 5HT1A 4DRHA 1EQ3A 1NMVA 2DG9A 2PPPA 3KACA 2ZQVA 2FKEA 2PV1A 2ZR6A 3MDYB 1B6CA 3I6CA 1FKBA 1QZ2A 1D7JA 4U85A 1P5QA 4ODOA 5GPGA 3O5RA 1FAPA 1FKSA 1ROUA 3ODKA 1T11A 2MPHA 1D7IA 3VAWA 5HW7A 2DG4A 2KR7A 5D75A 3KAIA 1ZCNA 3RGCA 4W9QA 2K8IA 3NTPA 1Q6UA 3O5GA 1F40A 3TCZA 1HXVA 1ROTA 1NMWA 3UQBA 5DIUA 5J6EA
chains in the Genus database with same CATH superfamily
2OFNA 1NWRA 3B9AA 4BF8A 3G6LA 4LAXA 2YBUA 4O2TA 5JH8A 1LG1A 2F21A 3KAHA 5B8IC 3AS3A 3NI6A 3ARWA 1E15A 2LJ4A 4ODKA 2MLXA 2FDMA 3CGMA 1FKJA 1PBKA 3O5PA 1FKRA 4ODMA 3UI5A 3W4RA 4DRNA 1BKFA 3IKGA 2LKNA 3UQIA 4MAVA 4MGVA 2RUQA 3ARTA 3EY6A 3OOBA 3ARXA 2DT3A 4HBEA 4J4NA 3O5KA 1FD9A 4PTMA 1ZBWA 4AY1A 2DT1A 2A3EA 4MPKA 3RM9A 1Q6HA 4QZVB 3KZ7A 5I98A 3UF8A 2RUCA 2DSVA 1HKIA 1FKFA 4Z2JA 4U86A 1TCOC 3O5LA 5HWCA 4DWSC 1JVWA 1HKKA 1WNOA 1D2KA 4J4OA 4FN2A 4LAYA 4TNSA 4QT3A 2PPOA 3ARYA 2MF9A 3B8SA 3ARPA 1KT0A 3QOKA 3GPKA 2EULA 4MTVA 3RMEA 1NWTA 3PRDA 1ZBKA 2N87A 1ZK6A 1FKHA 1HJXA 3O5FA 4N19A 1CTNA 4GIVA 2FAPA 3TDBA 1ZU8A 4ZPVR 2XP9A 3ALFA 5HT1A 1FKLA 4ZPTR 4DWSD 4S3KA 2DT2A 3MDYB 1X6NA 1D7JA 4ODOA 1FAPA 1LL7A 1GPFA 1EIBA 2WM0A 5HW7A 2K8IA 3O5GA 1Q6UA 1HXVA 1JNEA 1ROTA 2G41A 1H0IA 1W9VA 5J6EA 2KI3A 2O9OA 1NWSA 2DSZA 3B7XA 3OA5A 3RM8A 5HTGA 4C02B 3FAPA 4ODPA 3WH0A 4DRIA 1XRVA 4MSPA 3EIPA 4JFIA 3IKDA 4MNJA 4DRMA 1E6RA 1LL4A 1ITXA 1OGGA 4ITZA 4GGQA 1QPLA 3WD1A 3O5OA 1FKIA 1ZB5A 3WL1A 1D7HA 3WD2A 1KFWA 1R9HA 1N1AA 3UI6A 1L1PA 5BXJA 2RSEA 4LAWA 3BMBA 2XP7A 4IT4A 3KAFA 1KT1A 2DSUA 5DEZA 3JYJA 4U84A 3JXVA 4P8WA 2ZQUA 4MNKA 1JNSA 4L72B 1FKKA 1WB0A 3WD4A 4DRPA 2MNTA 3JYMA 5HWBA 2AWGA 2G8ZA 4IT6A 4JYSA 5HUAA 4P8UA 2YBTA 1SR0A 1BL4A 2M1IA 1U79A 2Q5AA 4JFLA 4ODNA 4XAKA 3O5DA 3ALGA 4IQCA 3GTYX 2KE0A 1WAWA 3PRBA 2ZR5A 2ZQSA 2ESCA 2JZVA 3RFWA 3CGNA 2XP4A 4NZCA 1W9PA 2F4EA 3WQVA 2VN1A 4DROA 3AQUA 1ZL1A 2AOSA 1NMVA 2DG9A 3AS2A 4DWSB 3CHCA 5GQBA 2FKEA 2ZR6A 1LL6A 1FKBA 1QZ2A 1W1PA 2PI6A 1FKSA 1ROUA 3ODKA 1T11A 2MPHA 1RD6A 2DG4A 1NWUA 5D75A 2OLHA 4W9QA 3TCZA 4MNMA 2O92A 1YW5A 1OGBA 4G50A 3B9EA 1NH6A 4ODRA 4R0XA 3IHZA 2A3CA 4DT4A 1FKTA 1EYMA 2M2AA 3KABA 5HW6A 1E9LA 4W5UA 1F8AB 2PV3A 4LAVA 4WIWA 1M5YA 3WL0A 1W26A 1XHGA 4Z2KA 2QF8A 1C9HA 1SYTA 3ARQA 3WKZA 1PINA 2LPVA 1JNTA 2D9FA 1E6PA 1FFQA 1GRJA 1K9TA 4JFJA 1W9UA 2XP6A 3LUOA 1TFVA 3ARVA 1X6LA 2PV2A 3IK8A 4WK9A 2DSWA 1LQ0A 4UDMA 1LJYA 4DRKA 4DRQA 1FFRA 4S3JA 2KGJA 4IPXA 2RURA 1J4HA 4FAPA 3WQWA 4DZ2A 4TW6A 2A3AA 2XP3A 4DIPA 4JFMA 4W9PA 4TX0A 3O5EA 3O5QA 1FJDA 2A3BA 5DITA 1EHNA 2WLYA 2ITKA 3WIJA 2RUDA 2XPBA 4QT2A 2LGOA 4URIA 3AS0A 1FKDA 2KFWA 2DT0A 3CH9A 1Q6IA 3PA7A 4G2PA 3UI4A 1W1VA 3GU0A 2M08A 2XP5A 3RM4A 2WLZA 1HJWA 4HARA 2Y78A 1ZBVA 2RQSA 3UQAA 4TW8A 1J4IA 2XP8A 4ZS6A 3CHEA 1LG2A 2PPPA 1VF8A 3KACA 2IUZA 2PV1A 1B6CA 3I6CA 4Z2IA 4Z2GA 3ARRA 3O5RA 3VAWA 2KR7A 1ZCNA 1F40A 1W1YA 5HKGA 1E6ZA 1NMWA 1HKMA 1H0GA 4WJXA 3UQBA 1IX5A 1A7XA 1FKGA 2PN0A 3KADA 1HJVA 1E44A 1JCHB 1EDQA 4LGXA 2IF4A 4QIBA 4DRJA 3PR9A 4ODLA 3H9RB 4NNRA 4Z2HA 4Q7NA 3CHDA 4JFKA 5DF0A 3B9DA 4WKAA 2WK2A 2PPNA 4TYOA 1QPFA 5DIVA 3AROA 1O6IA 2VCDA 4TW7A 5GPRA 1W1TA 2B5UB 4NSBA 4ODQA 2ZQTA 2MLZA 1OWQA 1JNDA 4DH0A 1Q1CA 4ML4A 3FY1A 2KO7A 1YATA 2P4VA 1D6OA 4Z2LA 1J4RA 3NRKA 4WKFA 3G6MA 1GUVA 2B31A 1J6YA 3TC5A 3KCEA 4ZPWR 3O5JA 5DO2A 2DG3A 3WD0A 3ARUA 2PBCA 1UR8A 5HBFA 2L2SA 4DWSA 2ETNA 4KR0B 4IQ2A 2UZ5A 2MLYA 4P8VA 4DZ3A 4HBOA 4Q22A 3BXWA 3O5MA 2DPEA 1E6NA 1NSGA 4P8XA 4R5EA 3KAGA 3CHFA 5HW8A 2ZR4A 4W9OA 3O5IA 3AS1A 2XPAA 3CZ8A 1Y0OA 2F2DA 4WKHA 3WD3A 4DRHA 1EQ3A 3ARZA 2ZQVA 1GOIA 1UR9A 2F23A 4U85A 1P5QA 1HKJA 5GPGA 4MNLA 4KQZA 1D7IA 3ARSA 3FXYA 1ZBCA 4L3NA 3KAIA 3RGCA 3NTPA 5DIUA 3PRAA
chains in the Genus database with same CATH topology
2OFNA 1NWRA 3B9AA 4BF8A 3G6LA 4LAXA 2YBUA 4O2TA 5JH8A 1LG1A 2F21A 3KAHA 5B8IC 3AS3A 3NI6A 3ARWA 1E15A 2LJ4A 4ODKA 2MLXA 2FDMA 3CGMA 1FKJA 1PBKA 3O5PA 1FKRA 4ODMA 3UI5A 3W4RA 4DRNA 1BKFA 3IKGA 2LKNA 3UQIA 4MAVA 4MGVA 2RUQA 3ARTA 3EY6A 3OOBA 3ARXA 2DT3A 4HBEA 4J4NA 3O5KA 1FD9A 4PTMA 1ZBWA 4AY1A 2DT1A 2A3EA 4MPKA 3RM9A 1Q6HA 4QZVB 3KZ7A 5I98A 3UF8A 2RUCA 2DSVA 1HKIA 1FKFA 4Z2JA 4U86A 1TCOC 3O5LA 5HWCA 4DWSC 1JVWA 1HKKA 1WNOA 1D2KA 4J4OA 4FN2A 4LAYA 4TNSA 4QT3A 2PPOA 3ARYA 2MF9A 3B8SA 3ARPA 1KT0A 3QOKA 3GPKA 4MTVA 3RMEA 1NWTA 3PRDA 1ZBKA 2N87A 1ZK6A 1FKHA 1HJXA 3O5FA 4N19A 1CTNA 4GIVA 2FAPA 3TDBA 1ZU8A 4ZPVR 2XP9A 3ALFA 5HT1A 1FKLA 4ZPTR 4DWSD 4S3KA 2DT2A 3MDYB 1X6NA 1D7JA 4ODOA 1FAPA 1LL7A 1GPFA 1EIBA 2WM0A 5HW7A 2K8IA 3O5GA 1Q6UA 1HXVA 1JNEA 1ROTA 2G41A 1H0IA 1W9VA 5J6EA 2KI3A 2O9OA 1NWSA 2DSZA 3B7XA 3OA5A 3RM8A 5HTGA 4C02B 3FAPA 4ODPA 3WH0A 4DRIA 1XRVA 4MSPA 4JFIA 3IKDA 4MNJA 4DRMA 1E6RA 1LL4A 1ITXA 1OGGA 4ITZA 4GGQA 1QPLA 3WD1A 3O5OA 1FKIA 1ZB5A 3WL1A 1D7HA 3WD2A 1KFWA 1R9HA 1N1AA 3UI6A 1L1PA 5BXJA 2RSEA 4LAWA 2XP7A 4IT4A 3KAFA 1KT1A 2DSUA 5DEZA 3JYJA 4U84A 3JXVA 4P8WA 2ZQUA 4MNKA 1JNSA 4L72B 1FKKA 1WB0A 3WD4A 4DRPA 2MNTA 3JYMA 5HWBA 2AWGA 2G8ZA 4IT6A 4JYSA 5HUAA 4P8UA 2YBTA 1SR0A 1BL4A 2M1IA 1U79A 2Q5AA 4JFLA 4ODNA 4XAKA 3O5DA 3ALGA 4IQCA 2KE0A 1WAWA 3PRBA 2ZR5A 2ZQSA 2ESCA 2JZVA 3RFWA 3CGNA 2XP4A 4NZCA 1W9PA 2F4EA 3WQVA 2VN1A 4DROA 3AQUA 1ZL1A 2AOSA 1NMVA 2DG9A 3AS2A 4DWSB 3CHCA 5GQBA 2FKEA 2ZR6A 1LL6A 1FKBA 1QZ2A 1W1PA 2PI6A 1FKSA 1ROUA 3ODKA 1T11A 2MPHA 1RD6A 2DG4A 1NWUA 5D75A 2OLHA 4W9QA 3TCZA 4MNMA 2O92A 1YW5A 1OGBA 4G50A 3B9EA 1NH6A 4ODRA 4R0XA 3IHZA 2A3CA 4DT4A 1FKTA 1EYMA 2M2AA 3KABA 5HW6A 1E9LA 4W5UA 1F8AB 2PV3A 4LAVA 4WIWA 1M5YA 3WL0A 1W26A 1XHGA 4Z2KA 2QF8A 1C9HA 1SYTA 3ARQA 3WKZA 1PINA 2LPVA 1JNTA 2D9FA 1E6PA 1FFQA 4JFJA 1K9TA 1W9UA 2XP6A 3LUOA 1TFVA 3ARVA 1X6LA 2PV2A 3IK8A 4WK9A 2DSWA 1LQ0A 1LJYA 4DRKA 4DRQA 1FFRA 4S3JA 2KGJA 4IPXA 2RURA 1J4HA 4FAPA 3WQWA 4DZ2A 4TW6A 2A3AA 2XP3A 4DIPA 4JFMA 4W9PA 4TX0A 3O5EA 3O5QA 1FJDA 2A3BA 5DITA 1EHNA 2WLYA 2ITKA 3WIJA 2RUDA 2XPBA 4QT2A 2LGOA 4URIA 3AS0A 1FKDA 2KFWA 2DT0A 3CH9A 1Q6IA 3PA7A 4G2PA 3UI4A 1W1VA 2M08A 2XP5A 3RM4A 2WLZA 1HJWA 4HARA 2Y78A 1ZBVA 2RQSA 3UQAA 4TW8A 1J4IA 2XP8A 4ZS6A 3CHEA 1LG2A 2PPPA 1VF8A 3KACA 2IUZA 2PV1A 1B6CA 3I6CA 4Z2IA 4Z2GA 3ARRA 3O5RA 3VAWA 2KR7A 1ZCNA 1F40A 1W1YA 5HKGA 1E6ZA 1NMWA 1HKMA 1H0GA 4WJXA 3UQBA 1IX5A 1A7XA 1FKGA 3KADA 1HJVA 1EDQA 4LGXA 2IF4A 4QIBA 4DRJA 3PR9A 4ODLA 3H9RB 4NNRA 4Z2HA 4Q7NA 3CHDA 4JFKA 5DF0A 3B9DA 4WKAA 2WK2A 2PPNA 4TYOA 1QPFA 5DIVA 3AROA 1O6IA 2VCDA 4TW7A 5GPRA 1W1TA 4NSBA 4ODQA 2ZQTA 2MLZA 1OWQA 1JNDA 4DH0A 1Q1CA 4ML4A 3FY1A 2KO7A 1YATA 1D6OA 4Z2LA 1J4RA 3NRKA 4WKFA 3G6MA 1GUVA 2B31A 1J6YA 3TC5A 3KCEA 4ZPWR 3O5JA 5DO2A 2DG3A 3WD0A 3ARUA 2PBCA 1UR8A 5HBFA 2L2SA 4DWSA 4KR0B 4IQ2A 2UZ5A 2MLYA 4P8VA 4DZ3A 4HBOA 4Q22A 3BXWA 3O5MA 2DPEA 1E6NA 1NSGA 4P8XA 4R5EA 3KAGA 3CHFA 5HW8A 2ZR4A 4W9OA 3O5IA 3AS1A 2XPAA 3CZ8A 1Y0OA 2F2DA 4WKHA 3WD3A 4DRHA 1EQ3A 3ARZA 2ZQVA 1GOIA 1UR9A 4U85A 1P5QA 1HKJA 5GPGA 4MNLA 4KQZA 1D7IA 3ARSA 3FXYA 1ZBCA 4L3NA 3KAIA 3RGCA 3NTPA 5DIUA 3PRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7X A;  1FKG A;  1YW5 A;  2OFN A;  2KI3 A;  4BF8 A;  3KAD A;  3B7X A;  4G50 A;  5HTG A;  4C02 B;  4LAX A;  4O2T A;  3FAP A;  2IF4 A;  4ODR A;  3IHZ A;  4QIB A;  4ODP A;  4R0X A;  1FKT A;  3WH0 A;  4DRJ A;  4DT4 A;  2F21 A;  4DRI A;  4MSP A;  1EYM A;  2M2A A;  3KAB A;  4ODL A;  3H9R B;  3KAH A;  3NI6 A;  4NNR A;  5B8I C;  5HW6 A;  1F8A B;  2PV3 A;  4LAV A;  2LJ4 A;  4ODK A;  4JFI A;  5HKG A;  3IKD A;  2MLX A;  1M5Y A;  4JFK A;  4DRM A;  1W26 A;  4ITZ A;  2PPN A;  3CGM A;  1FKJ A;  4TYO A;  1C9H A;  1QPL A;  1QPF A;  4GGQ A;  1PBK A;  3O5P A;  1FKR A;  3O5O A;  4ODM A;  5DIV A;  1FKI A;  3UI5 A;  1PIN A;  2LPV A;  1BKF A;  1JNT A;  4DRN A;  2D9F A;  3IKG A;  2VCD A;  4JFJ A;  4TW7 A;  2LKN A;  3UQI A;  1D7H A;  2XP6 A;  3LUO A;  4MGV A;  2RUQ A;  1R9H A;  2PV2 A;  3EY6 A;  1N1A A;  3IK8 A;  3OOB A;  4ODQ A;  3UI6 A;  1L1P A;  2ZQT A;  5BXJ A;  2MLZ A;  4DRK A;  4J4N A;  4DRQ A;  2RSE A;  3O5K A;  4LAW A;  1FD9 A;  2KGJ A;  4IPX A;  2RUR A;  4DH0 A;  1Q1C A;  1J4H A;  2XP7 A;  4FAP A;  4DZ2 A;  4TW6 A;  2KO7 A;  1YAT A;  1Q6H A;  2XP3 A;  1D6O A;  3KAF A;  4JFM A;  3KZ7 A;  4W9P A;  1KT1 A;  4DIP A;  5I98 A;  3UF8 A;  4TX0 A;  2RUC A;  3O5E A;  3JYJ A;  3O5Q A;  1J4R A;  3NRK A;  1FKF A;  1FJD A;  4U86 A;  5DIT A;  4U84 A;  1TCO C;  1J6Y A;  3JXV A;  3O5L A;  5HWC A;  2ZQU A;  1JVW A;  3TC5 A;  2ITK A;  3KCE A;  4J4O A;  1JNS A;  2RUD A;  2XPB A;  3O5J A;  4QT2 A;  4FN2 A;  2DG3 A;  1FKK A;  2LGO A;  4DRP A;  2MNT A;  1FKD A;  2PBC A;  3JYM A;  2AWG A;  5HWB A;  2KFW A;  2L2S A;  4JYS A;  4LAY A;  4QT3 A;  4TNS A;  2PPO A;  5HUA A;  1Q6I A;  3PA7 A;  2MF9 A;  4IQ2 A;  4G2P A;  1KT0 A;  2M1I A;  1BL4 A;  2UZ5 A;  3GPK A;  2MLY A;  3UI4 A;  1U79 A;  2Q5A A;  2M08 A;  4JFL A;  4ODN A;  4DZ3 A;  3O5D A;  3PRD A;  2XP5 A;  4IQC A;  2KE0 A;  2N87 A;  1ZK6 A;  3PRB A;  1FKH A;  2Y78 A;  3O5F A;  3UQA A;  2RQS A;  2ZR5 A;  3O5M A;  4N19 A;  2ZQS A;  4GIV A;  1NSG A;  2FAP A;  4TW8 A;  3TDB A;  1J4I A;  2XP8 A;  2JZV A;  3KAG A;  3RFW A;  3CGN A;  2XP4 A;  2ZR4 A;  5HW8 A;  2F4E A;  4W9O A;  2VN1 A;  3O5I A;  2XP9 A;  2XPA A;  4DRO A;  1Y0O A;  2F2D A;  1FKL A;  5HT1 A;  4DRH A;  1EQ3 A;  1NMV A;  2DG9 A;  2PPP A;  3KAC A;  2ZQV A;  2FKE A;  2PV1 A;  2ZR6 A;  3MDY B;  1B6C A;  3I6C A;  1FKB A;  1QZ2 A;  1D7J A;  4U85 A;  1P5Q A;  4ODO A;  5GPG A;  3O5R A;  1FAP A;  1FKS A;  1ROU A;  3ODK A;  1T11 A;  2MPH A;  1D7I A;  3VAW A;  5HW7 A;  2DG4 A;  2KR7 A;  5D75 A;  3KAI A;  1ZCN A;  3RGC A;  4W9Q A;  2K8I A;  3NTP A;  1Q6U A;  3O5G A;  1F40 A;  3TCZ A;  1HXV A;  1ROT A;  1NMW A;  3UQB A;  5DIU A;  5J6E A; 
#chains in the Genus database with same CATH topology
 2OFN A;  1NWR A;  3B9A A;  4BF8 A;  3G6L A;  4LAX A;  2YBU A;  4O2T A;  5JH8 A;  1LG1 A;  2F21 A;  3KAH A;  5B8I C;  3AS3 A;  3NI6 A;  3ARW A;  1E15 A;  2LJ4 A;  4ODK A;  2MLX A;  2FDM A;  3CGM A;  1FKJ A;  1PBK A;  3O5P A;  1FKR A;  4ODM A;  3UI5 A;  3W4R A;  4DRN A;  1BKF A;  3IKG A;  2LKN A;  3UQI A;  4MAV A;  4MGV A;  2RUQ A;  3ART A;  3EY6 A;  3OOB A;  3ARX A;  2DT3 A;  4HBE A;  4J4N A;  3O5K A;  1FD9 A;  4PTM A;  1ZBW A;  4AY1 A;  2DT1 A;  2A3E A;  4MPK A;  3RM9 A;  1Q6H A;  4QZV B;  3KZ7 A;  5I98 A;  3UF8 A;  2RUC A;  2DSV A;  1HKI A;  1FKF A;  4Z2J A;  4U86 A;  1TCO C;  3O5L A;  5HWC A;  4DWS C;  1JVW A;  1HKK A;  1WNO A;  1D2K A;  4J4O A;  4FN2 A;  4LAY A;  4TNS A;  4QT3 A;  2PPO A;  3ARY A;  2MF9 A;  3B8S A;  3ARP A;  1KT0 A;  3QOK A;  3GPK A;  2EUL A;  4MTV A;  3RME A;  1NWT A;  3PRD A;  1ZBK A;  2N87 A;  1ZK6 A;  1FKH A;  1HJX A;  3O5F A;  4N19 A;  1CTN A;  4GIV A;  2FAP A;  3TDB A;  1ZU8 A;  4ZPV R;  2XP9 A;  3ALF A;  5HT1 A;  1FKL A;  4ZPT R;  4DWS D;  4S3K A;  2DT2 A;  3MDY B;  1X6N A;  1D7J A;  4ODO A;  1FAP A;  1LL7 A;  1GPF A;  1EIB A;  2WM0 A;  5HW7 A;  2K8I A;  3O5G A;  1Q6U A;  1HXV A;  1JNE A;  1ROT A;  2G41 A;  1H0I A;  1W9V A;  5J6E A;  2KI3 A;  2O9O A;  1NWS A;  2DSZ A;  3B7X A;  3OA5 A;  3RM8 A;  5HTG A;  4C02 B;  3FAP A;  4ODP A;  3WH0 A;  4DRI A;  1XRV A;  4MSP A;  3EIP A;  4JFI A;  3IKD A;  4MNJ A;  4DRM A;  1E6R A;  1LL4 A;  1ITX A;  1OGG A;  4ITZ A;  4GGQ A;  1QPL A;  3WD1 A;  3O5O A;  1FKI A;  1ZB5 A;  3WL1 A;  1D7H A;  3WD2 A;  1KFW A;  1R9H A;  1N1A A;  3UI6 A;  1L1P A;  5BXJ A;  2RSE A;  4LAW A;  3BMB A;  2XP7 A;  4IT4 A;  3KAF A;  1KT1 A;  2DSU A;  5DEZ A;  3JYJ A;  4U84 A;  3JXV A;  4P8W A;  2ZQU A;  4MNK A;  1JNS A;  4L72 B;  1FKK A;  1WB0 A;  3WD4 A;  4DRP A;  2MNT A;  3JYM A;  5HWB A;  2AWG A;  2G8Z A;  4IT6 A;  4JYS A;  5HUA A;  4P8U A;  2YBT A;  1SR0 A;  1BL4 A;  2M1I A;  1U79 A;  2Q5A A;  4JFL A;  4ODN A;  4XAK A;  3O5D A;  3ALG A;  4IQC A;  3GTY X;  2KE0 A;  1WAW A;  3PRB A;  2ZR5 A;  2ZQS A;  2ESC A;  2JZV A;  3RFW A;  3CGN A;  2XP4 A;  4NZC A;  1W9P A;  2F4E A;  3WQV A;  2VN1 A;  4DRO A;  3AQU A;  1ZL1 A;  2AOS A;  1NMV A;  2DG9 A;  3AS2 A;  4DWS B;  3CHC A;  5GQB A;  2FKE A;  2ZR6 A;  1LL6 A;  1FKB A;  1QZ2 A;  1W1P A;  2PI6 A;  1FKS A;  1ROU A;  3ODK A;  1T11 A;  2MPH A;  1RD6 A;  2DG4 A;  1NWU A;  5D75 A;  2OLH A;  4W9Q A;  3TCZ A;  4MNM A;  2O92 A;  1YW5 A;  1OGB A;  4G50 A;  3B9E A;  1NH6 A;  4ODR A;  4R0X A;  3IHZ A;  2A3C A;  4DT4 A;  1FKT A;  1EYM A;  2M2A A;  3KAB A;  5HW6 A;  1E9L A;  4W5U A;  1F8A B;  2PV3 A;  4LAV A;  4WIW A;  1M5Y A;  3WL0 A;  1W26 A;  1XHG A;  4Z2K A;  2QF8 A;  1C9H A;  1SYT A;  3ARQ A;  3WKZ A;  1PIN A;  2LPV A;  1JNT A;  2D9F A;  1E6P A;  1FFQ A;  1GRJ A;  1K9T A;  4JFJ A;  1W9U A;  2XP6 A;  3LUO A;  1TFV A;  3ARV A;  1X6L A;  2PV2 A;  3IK8 A;  4WK9 A;  2DSW A;  1LQ0 A;  4UDM A;  1LJY A;  4DRK A;  4DRQ A;  1FFR A;  4S3J A;  2KGJ A;  4IPX A;  2RUR A;  1J4H A;  4FAP A;  3WQW A;  4DZ2 A;  4TW6 A;  2A3A A;  2XP3 A;  4DIP A;  4JFM A;  4W9P A;  4TX0 A;  3O5E A;  3O5Q A;  1FJD A;  2A3B A;  5DIT A;  1EHN A;  2WLY A;  2ITK A;  3WIJ A;  2RUD A;  2XPB A;  4QT2 A;  2LGO A;  4URI A;  3AS0 A;  1FKD A;  2KFW A;  2DT0 A;  3CH9 A;  1Q6I A;  3PA7 A;  4G2P A;  3UI4 A;  1W1V A;  3GU0 A;  2M08 A;  2XP5 A;  3RM4 A;  2WLZ A;  1HJW A;  4HAR A;  2Y78 A;  1ZBV A;  2RQS A;  3UQA A;  4TW8 A;  1J4I A;  2XP8 A;  4ZS6 A;  3CHE A;  1LG2 A;  2PPP A;  1VF8 A;  3KAC A;  2IUZ A;  2PV1 A;  1B6C A;  3I6C A;  4Z2I A;  4Z2G A;  3ARR A;  3O5R A;  3VAW A;  2KR7 A;  1ZCN A;  1F40 A;  1W1Y A;  5HKG A;  1E6Z A;  1NMW A;  1HKM A;  1H0G A;  4WJX A;  3UQB A;  1IX5 A;  1A7X A;  1FKG A;  2PN0 A;  3KAD A;  1HJV A;  1E44 A;  1JCH B;  1EDQ A;  4LGX A;  2IF4 A;  4QIB A;  4DRJ A;  3PR9 A;  4ODL A;  3H9R B;  4NNR A;  4Z2H A;  4Q7N A;  3CHD A;  4JFK A;  5DF0 A;  3B9D A;  4WKA A;  2WK2 A;  2PPN A;  4TYO A;  1QPF A;  5DIV A;  3ARO A;  1O6I A;  2VCD A;  4TW7 A;  5GPR A;  1W1T A;  2B5U B;  4NSB A;  4ODQ A;  2ZQT A;  2MLZ A;  1OWQ A;  1JND A;  4DH0 A;  1Q1C A;  4ML4 A;  3FY1 A;  2KO7 A;  1YAT A;  2P4V A;  1D6O A;  4Z2L A;  1J4R A;  3NRK A;  4WKF A;  3G6M A;  1GUV A;  2B31 A;  1J6Y A;  3TC5 A;  3KCE A;  4ZPW R;  3O5J A;  5DO2 A;  2DG3 A;  3WD0 A;  3ARU A;  2PBC A;  1UR8 A;  5HBF A;  2L2S A;  4DWS A;  2ETN A;  4KR0 B;  4IQ2 A;  2UZ5 A;  2MLY A;  4P8V A;  4DZ3 A;  4HBO A;  4Q22 A;  3BXW A;  3O5M A;  2DPE A;  1E6N A;  1NSG A;  4P8X A;  4R5E A;  3KAG A;  3CHF A;  5HW8 A;  2ZR4 A;  4W9O A;  3O5I A;  3AS1 A;  2XPA A;  3CZ8 A;  1Y0O A;  2F2D A;  4WKH A;  3WD3 A;  4DRH A;  1EQ3 A;  3ARZ A;  2ZQV A;  1GOI A;  1UR9 A;  2F23 A;  4U85 A;  1P5Q A;  1HKJ A;  5GPG A;  4MNL A;  4KQZ A;  1D7I A;  3ARS A;  3FXY A;  1ZBC A;  4L3N A;  3KAI A;  3RGC A;  3NTP A;  5DIU A;  3PRA A; 
#chains in the Genus database with same CATH homology
 2OFN A;  1NWR A;  3B9A A;  4BF8 A;  3G6L A;  4LAX A;  2YBU A;  4O2T A;  5JH8 A;  1LG1 A;  2F21 A;  3KAH A;  5B8I C;  3AS3 A;  3NI6 A;  3ARW A;  1E15 A;  2LJ4 A;  4ODK A;  2MLX A;  2FDM A;  3CGM A;  1FKJ A;  1PBK A;  3O5P A;  1FKR A;  4ODM A;  3UI5 A;  3W4R A;  4DRN A;  1BKF A;  3IKG A;  2LKN A;  3UQI A;  4MAV A;  4MGV A;  2RUQ A;  3ART A;  3EY6 A;  3OOB A;  3ARX A;  2DT3 A;  4HBE A;  4J4N A;  3O5K A;  1FD9 A;  4PTM A;  1ZBW A;  4AY1 A;  2DT1 A;  2A3E A;  4MPK A;  3RM9 A;  1Q6H A;  4QZV B;  3KZ7 A;  5I98 A;  3UF8 A;  2RUC A;  2DSV A;  1HKI A;  1FKF A;  4Z2J A;  4U86 A;  1TCO C;  3O5L A;  5HWC A;  4DWS C;  1JVW A;  1HKK A;  1WNO A;  1D2K A;  4J4O A;  4FN2 A;  4LAY A;  4TNS A;  4QT3 A;  2PPO A;  3ARY A;  2MF9 A;  3B8S A;  3ARP A;  1KT0 A;  3QOK A;  3GPK A;  4MTV A;  3RME A;  1NWT A;  3PRD A;  1ZBK A;  2N87 A;  1ZK6 A;  1FKH A;  1HJX A;  3O5F A;  4N19 A;  1CTN A;  4GIV A;  2FAP A;  3TDB A;  1ZU8 A;  4ZPV R;  2XP9 A;  3ALF A;  5HT1 A;  1FKL A;  4ZPT R;  4DWS D;  4S3K A;  2DT2 A;  3MDY B;  1X6N A;  1D7J A;  4ODO A;  1FAP A;  1LL7 A;  1GPF A;  1EIB A;  2WM0 A;  5HW7 A;  2K8I A;  3O5G A;  1Q6U A;  1HXV A;  1JNE A;  1ROT A;  2G41 A;  1H0I A;  1W9V A;  5J6E A;  2KI3 A;  2O9O A;  1NWS A;  2DSZ A;  3B7X A;  3OA5 A;  3RM8 A;  5HTG A;  4C02 B;  3FAP A;  4ODP A;  3WH0 A;  4DRI A;  1XRV A;  4MSP A;  4JFI A;  3IKD A;  4MNJ A;  4DRM A;  1E6R A;  1LL4 A;  1ITX A;  1OGG A;  4ITZ A;  4GGQ A;  1QPL A;  3WD1 A;  3O5O A;  1FKI A;  1ZB5 A;  3WL1 A;  1D7H A;  3WD2 A;  1KFW A;  1R9H A;  1N1A A;  3UI6 A;  1L1P A;  5BXJ A;  2RSE A;  4LAW A;  2XP7 A;  4IT4 A;  3KAF A;  1KT1 A;  2DSU A;  5DEZ A;  3JYJ A;  4U84 A;  3JXV A;  4P8W A;  2ZQU A;  4MNK A;  1JNS A;  4L72 B;  1FKK A;  1WB0 A;  3WD4 A;  4DRP A;  2MNT A;  3JYM A;  5HWB A;  2AWG A;  2G8Z A;  4IT6 A;  4JYS A;  5HUA A;  4P8U A;  2YBT A;  1SR0 A;  1BL4 A;  2M1I A;  1U79 A;  2Q5A A;  4JFL A;  4ODN A;  4XAK A;  3O5D A;  3ALG A;  4IQC A;  2KE0 A;  1WAW A;  3PRB A;  2ZR5 A;  2ZQS A;  2ESC A;  2JZV A;  3RFW A;  3CGN A;  2XP4 A;  4NZC A;  1W9P A;  2F4E A;  3WQV A;  2VN1 A;  4DRO A;  3AQU A;  1ZL1 A;  2AOS A;  1NMV A;  2DG9 A;  3AS2 A;  4DWS B;  3CHC A;  5GQB A;  2FKE A;  2ZR6 A;  1LL6 A;  1FKB A;  1QZ2 A;  1W1P A;  2PI6 A;  1FKS A;  1ROU A;  3ODK A;  1T11 A;  2MPH A;  1RD6 A;  2DG4 A;  1NWU A;  5D75 A;  2OLH A;  4W9Q A;  3TCZ A;  4MNM A;  2O92 A;  1YW5 A;  1OGB A;  4G50 A;  3B9E A;  1NH6 A;  4ODR A;  4R0X A;  3IHZ A;  2A3C A;  4DT4 A;  1FKT A;  1EYM A;  2M2A A;  3KAB A;  5HW6 A;  1E9L A;  4W5U A;  1F8A B;  2PV3 A;  4LAV A;  4WIW A;  1M5Y A;  3WL0 A;  1W26 A;  1XHG A;  4Z2K A;  2QF8 A;  1C9H A;  1SYT A;  3ARQ A;  3WKZ A;  1PIN A;  2LPV A;  1JNT A;  2D9F A;  1E6P A;  1FFQ A;  4JFJ A;  1K9T A;  1W9U A;  2XP6 A;  3LUO A;  1TFV A;  3ARV A;  1X6L A;  2PV2 A;  3IK8 A;  4WK9 A;  2DSW A;  1LQ0 A;  1LJY A;  4DRK A;  4DRQ A;  1FFR A;  4S3J A;  2KGJ A;  4IPX A;  2RUR A;  1J4H A;  4FAP A;  3WQW A;  4DZ2 A;  4TW6 A;  2A3A A;  2XP3 A;  4DIP A;  4JFM A;  4W9P A;  4TX0 A;  3O5E A;  3O5Q A;  1FJD A;  2A3B A;  5DIT A;  1EHN A;  2WLY A;  2ITK A;  3WIJ A;  2RUD A;  2XPB A;  4QT2 A;  2LGO A;  4URI A;  3AS0 A;  1FKD A;  2KFW A;  2DT0 A;  3CH9 A;  1Q6I A;  3PA7 A;  4G2P A;  3UI4 A;  1W1V A;  2M08 A;  2XP5 A;  3RM4 A;  2WLZ A;  1HJW A;  4HAR A;  2Y78 A;  1ZBV A;  2RQS A;  3UQA A;  4TW8 A;  1J4I A;  2XP8 A;  4ZS6 A;  3CHE A;  1LG2 A;  2PPP A;  1VF8 A;  3KAC A;  2IUZ A;  2PV1 A;  1B6C A;  3I6C A;  4Z2I A;  4Z2G A;  3ARR A;  3O5R A;  3VAW A;  2KR7 A;  1ZCN A;  1F40 A;  1W1Y A;  5HKG A;  1E6Z A;  1NMW A;  1HKM A;  1H0G A;  4WJX A;  3UQB A;  1IX5 A;  1A7X A;  1FKG A;  3KAD A;  1HJV A;  1EDQ A;  4LGX A;  2IF4 A;  4QIB A;  4DRJ A;  3PR9 A;  4ODL A;  3H9R B;  4NNR A;  4Z2H A;  4Q7N A;  3CHD A;  4JFK A;  5DF0 A;  3B9D A;  4WKA A;  2WK2 A;  2PPN A;  4TYO A;  1QPF A;  5DIV A;  3ARO A;  1O6I A;  2VCD A;  4TW7 A;  5GPR A;  1W1T A;  4NSB A;  4ODQ A;  2ZQT A;  2MLZ A;  1OWQ A;  1JND A;  4DH0 A;  1Q1C A;  4ML4 A;  3FY1 A;  2KO7 A;  1YAT A;  1D6O A;  4Z2L A;  1J4R A;  3NRK A;  4WKF A;  3G6M A;  1GUV A;  2B31 A;  1J6Y A;  3TC5 A;  3KCE A;  4ZPW R;  3O5J A;  5DO2 A;  2DG3 A;  3WD0 A;  3ARU A;  2PBC A;  1UR8 A;  5HBF A;  2L2S A;  4DWS A;  4KR0 B;  4IQ2 A;  2UZ5 A;  2MLY A;  4P8V A;  4DZ3 A;  4HBO A;  4Q22 A;  3BXW A;  3O5M A;  2DPE A;  1E6N A;  1NSG A;  4P8X A;  4R5E A;  3KAG A;  3CHF A;  5HW8 A;  2ZR4 A;  4W9O A;  3O5I A;  3AS1 A;  2XPA A;  3CZ8 A;  1Y0O A;  2F2D A;  4WKH A;  3WD3 A;  4DRH A;  1EQ3 A;  3ARZ A;  2ZQV A;  1GOI A;  1UR9 A;  4U85 A;  1P5Q A;  1HKJ A;  5GPG A;  4MNL A;  4KQZ A;  1D7I A;  3ARS A;  3FXY A;  1ZBC A;  4L3N A;  3KAI A;  3RGC A;  3NTP A;  5DIU A;  3PRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...