1QPFA

Fk506 binding protein (12 kda, human) complex with l-709,858
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
publication title 32-Indolyl ether derivatives of ascomycin: three-dimensional structures of complexes with FK506-binding protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 107
sequence length 107
chains with identical sequence D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1qpfA00
5HTGA 4JFJA 1A7XA 2RUDA 2XPBA 1Y0OA 2KGJA 1FKLA 2RUCA 2ZR6A 1W26A 2L2SA 1U79A 5BXJA 3O5KA 5J6EA 1EYMA 1KT1A 2F4EA 2XP7A 3LUOA 2XP3A 2PV2A 4TW6A 3UI4A 5HKGA 1KT0A 2ZQTA 4GIVA 1FKRA 2MPHA 2VN1A 2D9FA 3UQAA 2XP5A 1R9HA 4DRJA 2PPNA 2N87A 1FD9A 2ZR4A 2Y78A 4G2PA 5HT1A 3KADA 2M2AA 3RFWA 3B7XA 4ODQA 1J4RA 2DG4A 1QZ2A 4U85A 4DRHA 2XPAA 4LAWA 1F8AB 2M08A 1NMWA 4TW8A 4QT3A 2ZQSA 2LGOA 3RGCA 1N1AA 1D7HA 3CGNA 4DRQA 3ODKA 3KAHA 3KAFA 3JYMA 2VCDA 4ITZA 2ZQUA 3PRBA 1FKKA 4DZ3A 5DIVA 3UI6A 4TX0A 1ZCNA 4JFIA 2FKEA 3O5RA 4ODOA 4TW7A 1J4HA 5B8IC 2PPPA 2RURA 2LPVA 4W9PA 5I98A 4FN2A 4N19A 1ROUA 5D75A 3KCEA 3O5JA 2MLZA 3H9RB 4TNSA 2PBCA 3JXVA 3O5OA 3O5EA 3PRDA 3KAGA 4FAPA 4BF8A 2LJ4A 3NI6A 3IKGA 3TDBA 1PBKA 2MLYA 5HUAA 3UQBA 4DIPA 1ZK6A 1TCOC 2PV1A 4ODRA 1QPLA 2MNTA 2PV3A 1YATA 4DZ2A 2ZR5A 4IPXA 5DIUA 4DROA 4ODMA 1BL4A 4DRPA 1PINA 1YW5A 2XP6A 4W9OA 3IHZA 1Q6HA 1QPFA 3TCZA 1FKSA 1Q6IA 1FKDA 4ODPA 1D7IA 2XP8A 4ODNA 1FKFA 1FKTA 1JVWA 2JZVA 1C9HA 4J4NA 4JFLA 4LAYA 5HWBA 1T11A 2OFNA 1BKFA 4GGQA 2KO7A 3KZ7A 3FAPA 4G50A 1JNSA 3UI5A 3WH0A 1FKGA 2KR7A 5HW6A 1FKIA 2DG3A 4DRIA 4TYOA 3GPKA 2ITKA 2AWGA 1NSGA 2F21A 2XP4A 2ZQVA 3JYJA 4JYSA 3KACA 4W9QA 3EY6A 1HXVA 1JNTA 2IF4A 3O5FA 3UF8A 1F40A 3KABA 3O5GA 2XP9A 3I6CA 5HW8A 2DG9A 2KE0A 1Q1CA 3O5PA 2FAPA 2RQSA 3O5LA 3KAIA 4ODKA 5GPGA 1FJDA 3NTPA 4JFKA 3MDYB 1J6YA 1ROTA 4MSPA 2KI3A 2F2DA 1FAPA 3O5IA 4MGVA 4ODLA 3VAWA 4IQ2A 3OOBA 4DRMA 1D7JA 2LKNA 4NNRA 4C02B 2KFWA 4LAVA 1EQ3A 1L1PA 3O5MA 4DH0A 4DRKA 2RSEA 2M1IA 4QT2A 3UQIA 4O2TA 3O5DA 4IQCA 2RUQA 1P5QA 3IKDA 5DITA 1J4IA 5HW7A 3TC5A 1FKBA 2PPOA 3PA7A 4J4OA 2Q5AA 2MF9A 2MLXA 3NRKA 4LAXA 4U86A 4DRNA 1FKJA 3IK8A 5HWCA 3O5QA 4DT4A 4U84A 1NMVA 1Q6UA 3CGMA 1FKHA 1M5YA 1B6CA 4QIBA 2UZ5A 4R0XA 4JFMA 2K8IA 1D6OA
chains in the Genus database with same CATH superfamily
2F23A 5HTGA 2AOSA 1W9PA 2KGJA 2RUCA 3CHCA 5J6EA 3ARWA 1FJDA 1KT1A 3CHFA 4ML4A 3WL0A 1X6LA 2PV2A 2ZQTA 1R9HA 4DRJA 4WIWA 1KFWA 1FFRA 4G2PA 4ODQA 4U85A 1NMWA 4QT3A 2P4VA 4MNMA 3KAFA 2VCDA 2ZQUA 3PRBA 4DZ3A 1IX5A 4MNJA 2FKEA 3O5RA 4TW7A 4HBOA 5B8IC 1D2KA 1GRJA 3PRDA 3KAGA 4BF8A 3RM4A 2DT0A 3IKGA 2MLYA 3RM8A 1OGGA 3WD4A 4XAKA 4DIPA 1ZK6A 2PV1A 4ODRA 2MNTA 4DROA 4L3NA 4IT4A 1E6ZA 1Q6HA 1FKSA 4Z2JA 1JNEA 1FKDA 4ODPA 1JVWA 4JFLA 4MAVA 5HWBA 3GU0A 1LL4A 2WK2A 5DO2A 1JNSA 1FKIA 2OLHA 4KQZA 3FY1A 3CH9A 2ZQVA 4W9QA 3EY6A 1F40A 3KABA 1SYTA 4WKHA 3ARYA 5GPGA 4R5EA 3MDYB 4MSPA 3VAWA 1ZB5A 3B9AA 1ZBVA 2LKNA 4NNRA 2DSZA 2RSEA 2YBUA 4QT2A 3WQWA 2PN0A 3ARRA 4O2TA 2G41A 1P5QA 1J4IA 1H0IA 4J4OA 2WM0A 3AS3A 3AS2A 1W1VA 3NRKA 3ARUA 4DRNA 1FKJA 4U84A 1NMVA 3CGMA 1OWQA 1RD6A 5HUAA 4HBEA 1D6OA 4JFJA 1A7XA 2G8ZA 5BXJA 3O5KA 3LUOA 3AROA 4GIVA 1E6RA 1E44A 3UQAA 1HJVA 2Y78A 3B7XA 1SR0A 2DPEA 3ALGA 4LAWA 1F8AB 1N1AA 1D7HA 3CGNA 4DRQA 3JYMA 2A3CA 2O9OA 3EIPA 4ITZA 4MNLA 1GUVA 3UI6A 1LG1A 5JH8A 3RMEA 2PPPA 2RURA 1ITXA 4FN2A 5D75A 3WL1A 3O5JA 4TNSA 2PBCA 3CZ8A 2FDMA 3NI6A 1NWTA 1E6NA 4Q7NA 1TCOC 2PV3A 4DZ2A 1LL7A 4DWSC 3WD3A 1PINA 2XP6A 4KR0B 3IHZA 4L72B 1OGBA 1EIBA 5I98A 4ODNA 1D7IA 3RM9A 1C9HA 4LAYA 1HKKA 1T11A 1BKFA 3WKZA 2KO7A 3WD2A 3ARSA 1ZBKA 4DRIA 1NH6A 1JCHB 2WLZA 1NSGA 2XP4A 1NWUA 1HXVA 5HW8A 2KE0A 5GPRA 2FAPA 2RQSA 3KAIA 4ODKA 1J6YA 1ROTA 2KI3A 1FAPA 1GPFA 4IQ2A 4S3KA 4NZCA 4Z2HA 4LAVA 1EQ3A 1TFVA 1W9UA 3O5DA 4IQCA 2RUQA 2Q5AA 2MF9A 2MLXA 4LAXA 3FXYA 3IK8A 3PR9A 4DT4A 1Q6UA 1B6CA 4QIBA 1K9TA 4Z2GA 3OA5A 4DWSD 2RUDA 2XPBA 1Y0OA 1ZU8A 1FKLA 4WKFA 1W9VA 3WQVA 2XP3A 4ZS6A 2N87A 1FD9A 2ZR4A 4MNKA 5HT1A 3AS0A 2M2AA 2DSWA 1NWRA 2ZQSA 2LGOA 3KAHA 4Q22A 2WLYA 4DWSB 1FKKA 2DT2A 5DEZA 3CHEA 4NSBA 3ARVA 1LJYA 3B9EA 4DWSA 4ODOA 4WKAA 1HKJA 1WAWA 3GTYX 4N19A 1ROUA 3QOKA 2MLZA 3H9RB 3O5EA 4FAPA 5GQBA 3TDBA 3ARTA 3ARZA 2A3EA 1W1YA 2A3BA 1GOIA 1LQ0A 4IPXA 2O92A 4DRPA 4W9OA 1UR9A 4S3JA 1QPFA 3TCZA 2XP8A 2YBTA 1FKFA 1FKTA 2JZVA 4J4NA 1HJWA 3G6MA 4GGQA 3KZ7A 3CHDA 4WK9A 4G50A 2KR7A 5HW6A 4TYOA 3GPKA 2ITKA 4JYSA 2IF4A 3UF8A 3O5FA 3O5GA 4UDMA 2XP9A 1Q1CA 2ETNA 1NWSA 3NTPA 3ARQA 4JFKA 4P8VA 4DRMA 3WD0A 4C02B 2KFWA 1L1PA 3O5MA 4DH0A 1VF8A 1W1PA 4DRKA 1ZBCA 5DITA 5HW7A 3TC5A 1FKBA 2PPOA 3PA7A 1WB0A 2B5UB 1HKIA 1ZBWA 1FKHA 1M5YA 2UZ5A 3B8SA 2K8IA 1XRVA 2ZR6A 1FFQA 1W26A 2L2SA 1U79A 2DSVA 1EYMA 2F4EA 2XP7A 3UI4A 4TW6A 2QF8A 5HKGA 1FKRA 1KT0A 2MPHA 2VN1A 2D9FA 2XP5A 2PPNA 4Z2IA 4PTMA 3KADA 3RFWA 1J4RA 2DG4A 1QZ2A 4DRHA 2XPAA 2DSUA 4ZPWR 2M08A 4TW8A 3RGCA 4URIA 2PI6A 3ODKA 4ZPTR 1WNOA 5DIVA 3W4RA 4ZPVR 4TX0A 1ZCNA 4JFIA 4W5UA 1J4HA 3AS1A 2LPVA 4W9PA 4QZVB 3KCEA 4LGXA 3G6LA 1JNDA 3JXVA 3ARPA 3O5OA 3WIJA 2LJ4A 1EHNA 2A3AA 1PBKA 4WJXA 3BXWA 3PRAA 2B31A 4Z2KA 3UQBA 1QPLA 2EULA 1YATA 5HBFA 3ALFA 2ZR5A 5DIUA 4MPKA 4ODMA 1BL4A 1YW5A 3ARXA 2DT1A 1UR8A 2ESCA 1X6NA 1LL6A 1Q6IA 1E6PA 1XHGA 2OFNA 1LG2A 1H0GA 3FAPA 3B9DA 3UI5A 3WH0A 1HJXA 4Z2LA 1FKGA 4IT6A 2DG3A 4P8XA 1W1TA 2AWGA 2F21A 3JYJA 1O6IA 4HARA 3KACA 1JNTA 3I6CA 2DG9A 3O5PA 3O5LA 4AY1A 5DF0A 4MGVA 2F2DA 4ODLA 3O5IA 3AQUA 3BMBA 3OOBA 2DT3A 1D7JA 1E15A 4P8UA 1HKMA 1ZL1A 2M1IA 3WD1A 3UQIA 3IKDA 4P8WA 4U86A 5HWCA 2IUZA 3O5QA 1CTNA 1EDQA 4MTVA 1E9LA 4R0XA 4JFMA
chains in the Genus database with same CATH topology
5HTGA 2AOSA 1W9PA 2KGJA 2RUCA 3CHCA 5J6EA 3ARWA 1FJDA 1KT1A 3CHFA 4ML4A 3WL0A 1X6LA 2PV2A 2ZQTA 1R9HA 4DRJA 4WIWA 1KFWA 1FFRA 4G2PA 4ODQA 4U85A 1NMWA 4QT3A 4MNMA 3KAFA 2VCDA 2ZQUA 3PRBA 4DZ3A 1IX5A 4MNJA 2FKEA 3O5RA 4TW7A 4HBOA 5B8IC 1D2KA 3PRDA 3KAGA 4BF8A 3RM4A 2DT0A 3IKGA 2MLYA 3RM8A 1OGGA 3WD4A 4XAKA 4DIPA 1ZK6A 2PV1A 4ODRA 2MNTA 4DROA 4L3NA 4IT4A 1E6ZA 1Q6HA 1FKSA 4Z2JA 1JNEA 1FKDA 4ODPA 1JVWA 4JFLA 4MAVA 5HWBA 1LL4A 2WK2A 5DO2A 1JNSA 1FKIA 2OLHA 4KQZA 3FY1A 3CH9A 2ZQVA 4W9QA 3EY6A 1F40A 3KABA 1SYTA 4WKHA 3ARYA 5GPGA 4R5EA 3MDYB 4MSPA 3VAWA 1ZB5A 3B9AA 1ZBVA 2LKNA 4NNRA 2DSZA 2RSEA 2YBUA 4QT2A 3WQWA 3ARRA 4O2TA 2G41A 1P5QA 1J4IA 1H0IA 4J4OA 2WM0A 3AS3A 3AS2A 1W1VA 3NRKA 3ARUA 4DRNA 1FKJA 4U84A 1NMVA 3CGMA 1OWQA 1RD6A 5HUAA 4HBEA 1D6OA 4JFJA 1A7XA 2G8ZA 5BXJA 3O5KA 3LUOA 3AROA 4GIVA 1E6RA 3UQAA 1HJVA 2Y78A 3B7XA 1SR0A 2DPEA 3ALGA 4LAWA 1F8AB 1N1AA 1D7HA 3CGNA 4DRQA 3JYMA 2A3CA 2O9OA 4ITZA 4MNLA 1GUVA 3UI6A 1LG1A 5JH8A 3RMEA 2PPPA 2RURA 1ITXA 4FN2A 5D75A 3WL1A 3O5JA 4TNSA 2PBCA 3CZ8A 2FDMA 3NI6A 1NWTA 1E6NA 4Q7NA 1TCOC 2PV3A 4DZ2A 1LL7A 4DWSC 3WD3A 1PINA 2XP6A 4KR0B 3IHZA 4L72B 1OGBA 1EIBA 5I98A 4ODNA 1D7IA 3RM9A 1C9HA 4LAYA 1HKKA 1T11A 1BKFA 3WKZA 2KO7A 3WD2A 3ARSA 1ZBKA 4DRIA 1NH6A 2WLZA 1NSGA 2XP4A 1NWUA 1HXVA 5HW8A 2KE0A 5GPRA 2FAPA 2RQSA 3KAIA 4ODKA 1J6YA 1ROTA 2KI3A 1FAPA 1GPFA 4IQ2A 4S3KA 4NZCA 4Z2HA 4LAVA 1EQ3A 1TFVA 1W9UA 3O5DA 4IQCA 2RUQA 2Q5AA 2MF9A 2MLXA 4LAXA 3FXYA 3IK8A 3PR9A 4DT4A 1Q6UA 1B6CA 4QIBA 1K9TA 4Z2GA 3OA5A 4DWSD 2RUDA 2XPBA 1Y0OA 1ZU8A 1FKLA 4WKFA 1W9VA 3WQVA 2XP3A 4ZS6A 2N87A 1FD9A 2ZR4A 4MNKA 5HT1A 3AS0A 2M2AA 2DSWA 1NWRA 2ZQSA 2LGOA 3KAHA 4Q22A 2WLYA 4DWSB 1FKKA 2DT2A 5DEZA 3CHEA 4NSBA 3ARVA 1LJYA 3B9EA 4DWSA 4ODOA 4WKAA 1HKJA 1WAWA 4N19A 1ROUA 3QOKA 2MLZA 3H9RB 3O5EA 4FAPA 5GQBA 3TDBA 3ARTA 3ARZA 2A3EA 1W1YA 2A3BA 1GOIA 1LQ0A 4IPXA 2O92A 4DRPA 4W9OA 1UR9A 4S3JA 1QPFA 3TCZA 2XP8A 2YBTA 1FKFA 1FKTA 2JZVA 4J4NA 1HJWA 3G6MA 4GGQA 3KZ7A 3CHDA 4WK9A 4G50A 2KR7A 5HW6A 4TYOA 3GPKA 2ITKA 4JYSA 2IF4A 3UF8A 3O5FA 3O5GA 2XP9A 1Q1CA 1NWSA 3NTPA 3ARQA 4JFKA 4P8VA 4DRMA 3WD0A 4C02B 2KFWA 1L1PA 3O5MA 4DH0A 1VF8A 1W1PA 4DRKA 1ZBCA 5DITA 5HW7A 3TC5A 1FKBA 2PPOA 3PA7A 1WB0A 1HKIA 1ZBWA 1FKHA 1M5YA 2UZ5A 3B8SA 2K8IA 1XRVA 2ZR6A 1FFQA 1W26A 2L2SA 1U79A 2DSVA 1EYMA 2F4EA 2XP7A 3UI4A 4TW6A 2QF8A 5HKGA 1FKRA 1KT0A 2MPHA 2VN1A 2D9FA 2XP5A 2PPNA 4Z2IA 4PTMA 3KADA 3RFWA 1J4RA 2DG4A 1QZ2A 4DRHA 2XPAA 2DSUA 4ZPWR 2M08A 4TW8A 3RGCA 4URIA 2PI6A 3ODKA 4ZPTR 1WNOA 5DIVA 3W4RA 4ZPVR 4TX0A 1ZCNA 4JFIA 4W5UA 1J4HA 3AS1A 2LPVA 4W9PA 4QZVB 3KCEA 4LGXA 3G6LA 1JNDA 3JXVA 3ARPA 3O5OA 3WIJA 2LJ4A 1EHNA 2A3AA 1PBKA 4WJXA 3BXWA 3PRAA 2B31A 4Z2KA 3UQBA 1QPLA 5HBFA 1YATA 3ALFA 2ZR5A 5DIUA 4MPKA 4ODMA 1BL4A 1YW5A 3ARXA 2DT1A 1UR8A 2ESCA 1X6NA 1LL6A 1Q6IA 1E6PA 1XHGA 2OFNA 1LG2A 1H0GA 3FAPA 3B9DA 3UI5A 3WH0A 1HJXA 4Z2LA 1FKGA 4IT6A 2DG3A 4P8XA 1W1TA 2AWGA 2F21A 3JYJA 1O6IA 4HARA 3KACA 1JNTA 3I6CA 2DG9A 3O5PA 3O5LA 4AY1A 5DF0A 4MGVA 2F2DA 4ODLA 3O5IA 3AQUA 3OOBA 2DT3A 1D7JA 1E15A 4P8UA 1HKMA 1ZL1A 2M1IA 3WD1A 3UQIA 3IKDA 4P8WA 4U86A 5HWCA 2IUZA 3O5QA 1CTNA 1EDQA 4MTVA 1E9LA 4R0XA 4JFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HTG A;  4JFJ A;  1A7X A;  2RUD A;  2XPB A;  1Y0O A;  2KGJ A;  1FKL A;  2RUC A;  2ZR6 A;  1W26 A;  2L2S A;  1U79 A;  5BXJ A;  3O5K A;  5J6E A;  1EYM A;  1KT1 A;  2F4E A;  2XP7 A;  3LUO A;  2XP3 A;  2PV2 A;  4TW6 A;  3UI4 A;  5HKG A;  1KT0 A;  2ZQT A;  4GIV A;  1FKR A;  2MPH A;  2VN1 A;  2D9F A;  3UQA A;  2XP5 A;  1R9H A;  4DRJ A;  2PPN A;  2N87 A;  1FD9 A;  2ZR4 A;  2Y78 A;  4G2P A;  5HT1 A;  3KAD A;  2M2A A;  3RFW A;  3B7X A;  4ODQ A;  1J4R A;  2DG4 A;  1QZ2 A;  4U85 A;  4DRH A;  2XPA A;  4LAW A;  1F8A B;  2M08 A;  1NMW A;  4TW8 A;  4QT3 A;  2ZQS A;  2LGO A;  3RGC A;  1N1A A;  1D7H A;  3CGN A;  4DRQ A;  3ODK A;  3KAH A;  3KAF A;  3JYM A;  2VCD A;  4ITZ A;  2ZQU A;  3PRB A;  1FKK A;  4DZ3 A;  5DIV A;  3UI6 A;  4TX0 A;  1ZCN A;  4JFI A;  2FKE A;  3O5R A;  4ODO A;  4TW7 A;  1J4H A;  5B8I C;  2PPP A;  2RUR A;  2LPV A;  4W9P A;  5I98 A;  4FN2 A;  4N19 A;  1ROU A;  5D75 A;  3KCE A;  3O5J A;  2MLZ A;  3H9R B;  4TNS A;  2PBC A;  3JXV A;  3O5O A;  3O5E A;  3PRD A;  3KAG A;  4FAP A;  4BF8 A;  2LJ4 A;  3NI6 A;  3IKG A;  3TDB A;  1PBK A;  2MLY A;  5HUA A;  3UQB A;  4DIP A;  1ZK6 A;  1TCO C;  2PV1 A;  4ODR A;  1QPL A;  2MNT A;  2PV3 A;  1YAT A;  4DZ2 A;  2ZR5 A;  4IPX A;  5DIU A;  4DRO A;  4ODM A;  1BL4 A;  4DRP A;  1PIN A;  1YW5 A;  2XP6 A;  4W9O A;  3IHZ A;  1Q6H A;  1QPF A;  3TCZ A;  1FKS A;  1Q6I A;  1FKD A;  4ODP A;  1D7I A;  2XP8 A;  4ODN A;  1FKF A;  1FKT A;  1JVW A;  2JZV A;  1C9H A;  4J4N A;  4JFL A;  4LAY A;  5HWB A;  1T11 A;  2OFN A;  1BKF A;  4GGQ A;  2KO7 A;  3KZ7 A;  3FAP A;  4G50 A;  1JNS A;  3UI5 A;  3WH0 A;  1FKG A;  2KR7 A;  5HW6 A;  1FKI A;  2DG3 A;  4DRI A;  4TYO A;  3GPK A;  2ITK A;  2AWG A;  1NSG A;  2F21 A;  2XP4 A;  2ZQV A;  3JYJ A;  4JYS A;  3KAC A;  4W9Q A;  3EY6 A;  1HXV A;  1JNT A;  2IF4 A;  3O5F A;  3UF8 A;  1F40 A;  3KAB A;  3O5G A;  2XP9 A;  3I6C A;  5HW8 A;  2DG9 A;  2KE0 A;  1Q1C A;  3O5P A;  2FAP A;  2RQS A;  3O5L A;  3KAI A;  4ODK A;  5GPG A;  1FJD A;  3NTP A;  4JFK A;  3MDY B;  1J6Y A;  1ROT A;  4MSP A;  2KI3 A;  2F2D A;  1FAP A;  3O5I A;  4MGV A;  4ODL A;  3VAW A;  4IQ2 A;  3OOB A;  4DRM A;  1D7J A;  2LKN A;  4NNR A;  4C02 B;  2KFW A;  4LAV A;  1EQ3 A;  1L1P A;  3O5M A;  4DH0 A;  4DRK A;  2RSE A;  2M1I A;  4QT2 A;  3UQI A;  4O2T A;  3O5D A;  4IQC A;  2RUQ A;  1P5Q A;  3IKD A;  5DIT A;  1J4I A;  5HW7 A;  3TC5 A;  1FKB A;  2PPO A;  3PA7 A;  4J4O A;  2Q5A A;  2MF9 A;  2MLX A;  3NRK A;  4LAX A;  4U86 A;  4DRN A;  1FKJ A;  3IK8 A;  5HWC A;  3O5Q A;  4DT4 A;  4U84 A;  1NMV A;  1Q6U A;  3CGM A;  1FKH A;  1M5Y A;  1B6C A;  4QIB A;  2UZ5 A;  4R0X A;  4JFM A;  2K8I A;  1D6O A; 
#chains in the Genus database with same CATH topology
 2F23 A;  5HTG A;  2AOS A;  1W9P A;  2KGJ A;  2RUC A;  3CHC A;  5J6E A;  3ARW A;  1FJD A;  1KT1 A;  3CHF A;  4ML4 A;  3WL0 A;  1X6L A;  2PV2 A;  2ZQT A;  1R9H A;  4DRJ A;  4WIW A;  1KFW A;  1FFR A;  4G2P A;  4ODQ A;  4U85 A;  1NMW A;  4QT3 A;  2P4V A;  4MNM A;  3KAF A;  2VCD A;  2ZQU A;  3PRB A;  4DZ3 A;  1IX5 A;  4MNJ A;  2FKE A;  3O5R A;  4TW7 A;  4HBO A;  5B8I C;  1D2K A;  1GRJ A;  3PRD A;  3KAG A;  4BF8 A;  3RM4 A;  2DT0 A;  3IKG A;  2MLY A;  3RM8 A;  1OGG A;  3WD4 A;  4XAK A;  4DIP A;  1ZK6 A;  2PV1 A;  4ODR A;  2MNT A;  4DRO A;  4L3N A;  4IT4 A;  1E6Z A;  1Q6H A;  1FKS A;  4Z2J A;  1JNE A;  1FKD A;  4ODP A;  1JVW A;  4JFL A;  4MAV A;  5HWB A;  3GU0 A;  1LL4 A;  2WK2 A;  5DO2 A;  1JNS A;  1FKI A;  2OLH A;  4KQZ A;  3FY1 A;  3CH9 A;  2ZQV A;  4W9Q A;  3EY6 A;  1F40 A;  3KAB A;  1SYT A;  4WKH A;  3ARY A;  5GPG A;  4R5E A;  3MDY B;  4MSP A;  3VAW A;  1ZB5 A;  3B9A A;  1ZBV A;  2LKN A;  4NNR A;  2DSZ A;  2RSE A;  2YBU A;  4QT2 A;  3WQW A;  2PN0 A;  3ARR A;  4O2T A;  2G41 A;  1P5Q A;  1J4I A;  1H0I A;  4J4O A;  2WM0 A;  3AS3 A;  3AS2 A;  1W1V A;  3NRK A;  3ARU A;  4DRN A;  1FKJ A;  4U84 A;  1NMV A;  3CGM A;  1OWQ A;  1RD6 A;  5HUA A;  4HBE A;  1D6O A;  4JFJ A;  1A7X A;  2G8Z A;  5BXJ A;  3O5K A;  3LUO A;  3ARO A;  4GIV A;  1E6R A;  1E44 A;  3UQA A;  1HJV A;  2Y78 A;  3B7X A;  1SR0 A;  2DPE A;  3ALG A;  4LAW A;  1F8A B;  1N1A A;  1D7H A;  3CGN A;  4DRQ A;  3JYM A;  2A3C A;  2O9O A;  3EIP A;  4ITZ A;  4MNL A;  1GUV A;  3UI6 A;  1LG1 A;  5JH8 A;  3RME A;  2PPP A;  2RUR A;  1ITX A;  4FN2 A;  5D75 A;  3WL1 A;  3O5J A;  4TNS A;  2PBC A;  3CZ8 A;  2FDM A;  3NI6 A;  1NWT A;  1E6N A;  4Q7N A;  1TCO C;  2PV3 A;  4DZ2 A;  1LL7 A;  4DWS C;  3WD3 A;  1PIN A;  2XP6 A;  4KR0 B;  3IHZ A;  4L72 B;  1OGB A;  1EIB A;  5I98 A;  4ODN A;  1D7I A;  3RM9 A;  1C9H A;  4LAY A;  1HKK A;  1T11 A;  1BKF A;  3WKZ A;  2KO7 A;  3WD2 A;  3ARS A;  1ZBK A;  4DRI A;  1NH6 A;  1JCH B;  2WLZ A;  1NSG A;  2XP4 A;  1NWU A;  1HXV A;  5HW8 A;  2KE0 A;  5GPR A;  2FAP A;  2RQS A;  3KAI A;  4ODK A;  1J6Y A;  1ROT A;  2KI3 A;  1FAP A;  1GPF A;  4IQ2 A;  4S3K A;  4NZC A;  4Z2H A;  4LAV A;  1EQ3 A;  1TFV A;  1W9U A;  3O5D A;  4IQC A;  2RUQ A;  2Q5A A;  2MF9 A;  2MLX A;  4LAX A;  3FXY A;  3IK8 A;  3PR9 A;  4DT4 A;  1Q6U A;  1B6C A;  4QIB A;  1K9T A;  4Z2G A;  3OA5 A;  4DWS D;  2RUD A;  2XPB A;  1Y0O A;  1ZU8 A;  1FKL A;  4WKF A;  1W9V A;  3WQV A;  2XP3 A;  4ZS6 A;  2N87 A;  1FD9 A;  2ZR4 A;  4MNK A;  5HT1 A;  3AS0 A;  2M2A A;  2DSW A;  1NWR A;  2ZQS A;  2LGO A;  3KAH A;  4Q22 A;  2WLY A;  4DWS B;  1FKK A;  2DT2 A;  5DEZ A;  3CHE A;  4NSB A;  3ARV A;  1LJY A;  3B9E A;  4DWS A;  4ODO A;  4WKA A;  1HKJ A;  1WAW A;  3GTY X;  4N19 A;  1ROU A;  3QOK A;  2MLZ A;  3H9R B;  3O5E A;  4FAP A;  5GQB A;  3TDB A;  3ART A;  3ARZ A;  2A3E A;  1W1Y A;  2A3B A;  1GOI A;  1LQ0 A;  4IPX A;  2O92 A;  4DRP A;  4W9O A;  1UR9 A;  4S3J A;  1QPF A;  3TCZ A;  2XP8 A;  2YBT A;  1FKF A;  1FKT A;  2JZV A;  4J4N A;  1HJW A;  3G6M A;  4GGQ A;  3KZ7 A;  3CHD A;  4WK9 A;  4G50 A;  2KR7 A;  5HW6 A;  4TYO A;  3GPK A;  2ITK A;  4JYS A;  2IF4 A;  3UF8 A;  3O5F A;  3O5G A;  4UDM A;  2XP9 A;  1Q1C A;  2ETN A;  1NWS A;  3NTP A;  3ARQ A;  4JFK A;  4P8V A;  4DRM A;  3WD0 A;  4C02 B;  2KFW A;  1L1P A;  3O5M A;  4DH0 A;  1VF8 A;  1W1P A;  4DRK A;  1ZBC A;  5DIT A;  5HW7 A;  3TC5 A;  1FKB A;  2PPO A;  3PA7 A;  1WB0 A;  2B5U B;  1HKI A;  1ZBW A;  1FKH A;  1M5Y A;  2UZ5 A;  3B8S A;  2K8I A;  1XRV A;  2ZR6 A;  1FFQ A;  1W26 A;  2L2S A;  1U79 A;  2DSV A;  1EYM A;  2F4E A;  2XP7 A;  3UI4 A;  4TW6 A;  2QF8 A;  5HKG A;  1FKR A;  1KT0 A;  2MPH A;  2VN1 A;  2D9F A;  2XP5 A;  2PPN A;  4Z2I A;  4PTM A;  3KAD A;  3RFW A;  1J4R A;  2DG4 A;  1QZ2 A;  4DRH A;  2XPA A;  2DSU A;  4ZPW R;  2M08 A;  4TW8 A;  3RGC A;  4URI A;  2PI6 A;  3ODK A;  4ZPT R;  1WNO A;  5DIV A;  3W4R A;  4ZPV R;  4TX0 A;  1ZCN A;  4JFI A;  4W5U A;  1J4H A;  3AS1 A;  2LPV A;  4W9P A;  4QZV B;  3KCE A;  4LGX A;  3G6L A;  1JND A;  3JXV A;  3ARP A;  3O5O A;  3WIJ A;  2LJ4 A;  1EHN A;  2A3A A;  1PBK A;  4WJX A;  3BXW A;  3PRA A;  2B31 A;  4Z2K A;  3UQB A;  1QPL A;  2EUL A;  1YAT A;  5HBF A;  3ALF A;  2ZR5 A;  5DIU A;  4MPK A;  4ODM A;  1BL4 A;  1YW5 A;  3ARX A;  2DT1 A;  1UR8 A;  2ESC A;  1X6N A;  1LL6 A;  1Q6I A;  1E6P A;  1XHG A;  2OFN A;  1LG2 A;  1H0G A;  3FAP A;  3B9D A;  3UI5 A;  3WH0 A;  1HJX A;  4Z2L A;  1FKG A;  4IT6 A;  2DG3 A;  4P8X A;  1W1T A;  2AWG A;  2F21 A;  3JYJ A;  1O6I A;  4HAR A;  3KAC A;  1JNT A;  3I6C A;  2DG9 A;  3O5P A;  3O5L A;  4AY1 A;  5DF0 A;  4MGV A;  2F2D A;  4ODL A;  3O5I A;  3AQU A;  3BMB A;  3OOB A;  2DT3 A;  1D7J A;  1E15 A;  4P8U A;  1HKM A;  1ZL1 A;  2M1I A;  3WD1 A;  3UQI A;  3IKD A;  4P8W A;  4U86 A;  5HWC A;  2IUZ A;  3O5Q A;  1CTN A;  1EDQ A;  4MTV A;  1E9L A;  4R0X A;  4JFM A; 
#chains in the Genus database with same CATH homology
 5HTG A;  2AOS A;  1W9P A;  2KGJ A;  2RUC A;  3CHC A;  5J6E A;  3ARW A;  1FJD A;  1KT1 A;  3CHF A;  4ML4 A;  3WL0 A;  1X6L A;  2PV2 A;  2ZQT A;  1R9H A;  4DRJ A;  4WIW A;  1KFW A;  1FFR A;  4G2P A;  4ODQ A;  4U85 A;  1NMW A;  4QT3 A;  4MNM A;  3KAF A;  2VCD A;  2ZQU A;  3PRB A;  4DZ3 A;  1IX5 A;  4MNJ A;  2FKE A;  3O5R A;  4TW7 A;  4HBO A;  5B8I C;  1D2K A;  3PRD A;  3KAG A;  4BF8 A;  3RM4 A;  2DT0 A;  3IKG A;  2MLY A;  3RM8 A;  1OGG A;  3WD4 A;  4XAK A;  4DIP A;  1ZK6 A;  2PV1 A;  4ODR A;  2MNT A;  4DRO A;  4L3N A;  4IT4 A;  1E6Z A;  1Q6H A;  1FKS A;  4Z2J A;  1JNE A;  1FKD A;  4ODP A;  1JVW A;  4JFL A;  4MAV A;  5HWB A;  1LL4 A;  2WK2 A;  5DO2 A;  1JNS A;  1FKI A;  2OLH A;  4KQZ A;  3FY1 A;  3CH9 A;  2ZQV A;  4W9Q A;  3EY6 A;  1F40 A;  3KAB A;  1SYT A;  4WKH A;  3ARY A;  5GPG A;  4R5E A;  3MDY B;  4MSP A;  3VAW A;  1ZB5 A;  3B9A A;  1ZBV A;  2LKN A;  4NNR A;  2DSZ A;  2RSE A;  2YBU A;  4QT2 A;  3WQW A;  3ARR A;  4O2T A;  2G41 A;  1P5Q A;  1J4I A;  1H0I A;  4J4O A;  2WM0 A;  3AS3 A;  3AS2 A;  1W1V A;  3NRK A;  3ARU A;  4DRN A;  1FKJ A;  4U84 A;  1NMV A;  3CGM A;  1OWQ A;  1RD6 A;  5HUA A;  4HBE A;  1D6O A;  4JFJ A;  1A7X A;  2G8Z A;  5BXJ A;  3O5K A;  3LUO A;  3ARO A;  4GIV A;  1E6R A;  3UQA A;  1HJV A;  2Y78 A;  3B7X A;  1SR0 A;  2DPE A;  3ALG A;  4LAW A;  1F8A B;  1N1A A;  1D7H A;  3CGN A;  4DRQ A;  3JYM A;  2A3C A;  2O9O A;  4ITZ A;  4MNL A;  1GUV A;  3UI6 A;  1LG1 A;  5JH8 A;  3RME A;  2PPP A;  2RUR A;  1ITX A;  4FN2 A;  5D75 A;  3WL1 A;  3O5J A;  4TNS A;  2PBC A;  3CZ8 A;  2FDM A;  3NI6 A;  1NWT A;  1E6N A;  4Q7N A;  1TCO C;  2PV3 A;  4DZ2 A;  1LL7 A;  4DWS C;  3WD3 A;  1PIN A;  2XP6 A;  4KR0 B;  3IHZ A;  4L72 B;  1OGB A;  1EIB A;  5I98 A;  4ODN A;  1D7I A;  3RM9 A;  1C9H A;  4LAY A;  1HKK A;  1T11 A;  1BKF A;  3WKZ A;  2KO7 A;  3WD2 A;  3ARS A;  1ZBK A;  4DRI A;  1NH6 A;  2WLZ A;  1NSG A;  2XP4 A;  1NWU A;  1HXV A;  5HW8 A;  2KE0 A;  5GPR A;  2FAP A;  2RQS A;  3KAI A;  4ODK A;  1J6Y A;  1ROT A;  2KI3 A;  1FAP A;  1GPF A;  4IQ2 A;  4S3K A;  4NZC A;  4Z2H A;  4LAV A;  1EQ3 A;  1TFV A;  1W9U A;  3O5D A;  4IQC A;  2RUQ A;  2Q5A A;  2MF9 A;  2MLX A;  4LAX A;  3FXY A;  3IK8 A;  3PR9 A;  4DT4 A;  1Q6U A;  1B6C A;  4QIB A;  1K9T A;  4Z2G A;  3OA5 A;  4DWS D;  2RUD A;  2XPB A;  1Y0O A;  1ZU8 A;  1FKL A;  4WKF A;  1W9V A;  3WQV A;  2XP3 A;  4ZS6 A;  2N87 A;  1FD9 A;  2ZR4 A;  4MNK A;  5HT1 A;  3AS0 A;  2M2A A;  2DSW A;  1NWR A;  2ZQS A;  2LGO A;  3KAH A;  4Q22 A;  2WLY A;  4DWS B;  1FKK A;  2DT2 A;  5DEZ A;  3CHE A;  4NSB A;  3ARV A;  1LJY A;  3B9E A;  4DWS A;  4ODO A;  4WKA A;  1HKJ A;  1WAW A;  4N19 A;  1ROU A;  3QOK A;  2MLZ A;  3H9R B;  3O5E A;  4FAP A;  5GQB A;  3TDB A;  3ART A;  3ARZ A;  2A3E A;  1W1Y A;  2A3B A;  1GOI A;  1LQ0 A;  4IPX A;  2O92 A;  4DRP A;  4W9O A;  1UR9 A;  4S3J A;  1QPF A;  3TCZ A;  2XP8 A;  2YBT A;  1FKF A;  1FKT A;  2JZV A;  4J4N A;  1HJW A;  3G6M A;  4GGQ A;  3KZ7 A;  3CHD A;  4WK9 A;  4G50 A;  2KR7 A;  5HW6 A;  4TYO A;  3GPK A;  2ITK A;  4JYS A;  2IF4 A;  3UF8 A;  3O5F A;  3O5G A;  2XP9 A;  1Q1C A;  1NWS A;  3NTP A;  3ARQ A;  4JFK A;  4P8V A;  4DRM A;  3WD0 A;  4C02 B;  2KFW A;  1L1P A;  3O5M A;  4DH0 A;  1VF8 A;  1W1P A;  4DRK A;  1ZBC A;  5DIT A;  5HW7 A;  3TC5 A;  1FKB A;  2PPO A;  3PA7 A;  1WB0 A;  1HKI A;  1ZBW A;  1FKH A;  1M5Y A;  2UZ5 A;  3B8S A;  2K8I A;  1XRV A;  2ZR6 A;  1FFQ A;  1W26 A;  2L2S A;  1U79 A;  2DSV A;  1EYM A;  2F4E A;  2XP7 A;  3UI4 A;  4TW6 A;  2QF8 A;  5HKG A;  1FKR A;  1KT0 A;  2MPH A;  2VN1 A;  2D9F A;  2XP5 A;  2PPN A;  4Z2I A;  4PTM A;  3KAD A;  3RFW A;  1J4R A;  2DG4 A;  1QZ2 A;  4DRH A;  2XPA A;  2DSU A;  4ZPW R;  2M08 A;  4TW8 A;  3RGC A;  4URI A;  2PI6 A;  3ODK A;  4ZPT R;  1WNO A;  5DIV A;  3W4R A;  4ZPV R;  4TX0 A;  1ZCN A;  4JFI A;  4W5U A;  1J4H A;  3AS1 A;  2LPV A;  4W9P A;  4QZV B;  3KCE A;  4LGX A;  3G6L A;  1JND A;  3JXV A;  3ARP A;  3O5O A;  3WIJ A;  2LJ4 A;  1EHN A;  2A3A A;  1PBK A;  4WJX A;  3BXW A;  3PRA A;  2B31 A;  4Z2K A;  3UQB A;  1QPL A;  5HBF A;  1YAT A;  3ALF A;  2ZR5 A;  5DIU A;  4MPK A;  4ODM A;  1BL4 A;  1YW5 A;  3ARX A;  2DT1 A;  1UR8 A;  2ESC A;  1X6N A;  1LL6 A;  1Q6I A;  1E6P A;  1XHG A;  2OFN A;  1LG2 A;  1H0G A;  3FAP A;  3B9D A;  3UI5 A;  3WH0 A;  1HJX A;  4Z2L A;  1FKG A;  4IT6 A;  2DG3 A;  4P8X A;  1W1T A;  2AWG A;  2F21 A;  3JYJ A;  1O6I A;  4HAR A;  3KAC A;  1JNT A;  3I6C A;  2DG9 A;  3O5P A;  3O5L A;  4AY1 A;  5DF0 A;  4MGV A;  2F2D A;  4ODL A;  3O5I A;  3AQU A;  3OOB A;  2DT3 A;  1D7J A;  1E15 A;  4P8U A;  1HKM A;  1ZL1 A;  2M1I A;  3WD1 A;  3UQI A;  3IKD A;  4P8W A;  4U86 A;  5HWC A;  2IUZ A;  3O5Q A;  1CTN A;  1EDQ A;  4MTV A;  1E9L A;  4R0X A;  4JFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...