1QPFA

Fk506 binding protein (12 kda, human) complex with l-709,858
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
publication title 32-Indolyl ether derivatives of ascomycin: three-dimensional structures of complexes with FK506-binding protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 24
structure length 107
sequence length 107
chains with identical sequence D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1qpfA00
1EYMA 3GPKA 3ODKA 1F8AB 4U86A 3RGCA 1C9HA 4QT2A 4C02B 4JFIA 2PV1A 4JFKA 3KABA 3O5DA 1QPLA 3EY6A 3NTPA 3O5FA 2PPPA 5HW6A 5DIVA 3CGNA 1FKIA 1YATA 1T11A 3NI6A 4W9OA 3VAWA 2PPOA 3KAHA 4J4NA 2XPAA 2LKNA 2RUDA 4QIBA 4DRKA 4DRHA 4DRJA 1J6YA 2XP5A 1BKFA 2RUCA 1ZCNA 4JYSA 1N1AA 2KGJA 2LPVA 1FKTA 2XP8A 3H9RB 2KE0A 4DH0A 1HXVA 2MLXA 2PBCA 2ZR4A 3JYMA 3KZ7A 3UQIA 1EQ3A 5I98A 2F2DA 2OFNA 1JNSA 1Q6IA 2K8IA 1JVWA 2VN1A 5HW8A 2IF4A 4MGVA 2XP9A 4DRMA 4ODNA 1ROTA 1QZ2A 3O5MA 2KR7A 2PPNA 4U84A 3PRDA 1FAPA 4ODOA 1ZK6A 1FKBA 2VCDA 3O5IA 1Y0OA 4G2PA 4IQ2A 3UQAA 2LJ4A 1U79A 2MF9A 5HWCA 2KO7A 2XP4A 3JYJA 2DG3A 2RSEA 1F40A 1FKFA 1J4IA 4TX0A 4DZ3A 4W9PA 3TCZA 4R0XA 3KACA 4TNSA 1PBKA 3B7XA 4TW6A 1FKHA 2XP6A 2JZVA 4FN2A 4DIPA 4LAWA 1Q1CA 3CGMA 2F21A 2FKEA 2PV2A 3KAFA 3UQBA 2XP3A 1KT1A 3O5QA 2AWGA 4GGQA 4IQCA 4DZ2A 2XP7A 5HUAA 2XPBA 1ROUA 1YW5A 5DITA 3JXVA 1D7IA 4ODRA 1FKLA 1QPFA 2M1IA 3KAIA 2MLZA 2ZQUA 3FAPA 3I6CA 1D7HA 3O5OA 3O5GA 3UI5A 2L2SA 2FAPA 2ZQTA 1B6CA 4LAYA 1KT0A 3O5RA 4NNRA 3UI6A 3KADA 5HTGA 3UI4A 1P5QA 2ITKA 3PA7A 3O5JA 2ZQVA 4G50A 4ITZA 1Q6UA 4O2TA 1FKRA 2RUQA 4DRIA 4JFMA 1FKGA 1TCOC 1NMWA 2KFWA 4TW7A 4MSPA 4TYOA 4DRQA 2LGOA 1PINA 4DRNA 4JFLA 5GPGA 2ZR5A 5D75A 5BXJA 4GIVA 4U85A 2D9FA 2KI3A 4ODPA 5HW7A 1NMVA 3IKDA 1R9HA 3O5KA 3KAGA 3WH0A 5HWBA 3NRKA 2F4EA 2DG9A 2ZQSA 1J4HA 1JNTA 2Q5AA 2Y78A 4ODMA 2MNTA 4DT4A 3PRBA 1D6OA 1L1PA 2MPHA 2ZR6A 4ODQA 4ODLA 4TW8A 5HKGA 1FKKA 2DG4A 2RQSA 2UZ5A 3IK8A 4IPXA 1Q6HA 4LAVA 3RFWA 3TC5A 1NSGA 3UF8A 3O5PA 1FKJA 4QT3A 3O5EA 5HT1A 1FKSA 4ODKA 1FD9A 4DROA 4FAPA 2M2AA 4J4OA 1D7JA 4N19A 4LAXA 5DIUA 5B8IC 2MLYA 4DRPA 1M5YA 1FJDA 2N87A 3OOBA 3LUOA 4JFJA 3KCEA 1J4RA 2RURA 2PV3A 3IHZA 3IKGA 3MDYB 4BF8A 2M08A 4W9QA 1FKDA 3O5LA 1W26A 3TDBA 1A7XA 5J6EA 1BL4A
chains in the Genus database with same CATH superfamily
1F8AB 4URIA 3RGCA 1CTNA 4JFKA 1QPLA 3EY6A 4HARA 1FKIA 4ML4A 3NI6A 4S3JA 2DPEA 3VAWA 5DO2A 3KAHA 1FFQA 4QIBA 1WAWA 2XP5A 2KGJA 2LPVA 2WLZA 3H9RB 2WK2A 3ALFA 3WD3A 4DH0A 2PBCA 2ZR4A 1HXVA 3JYMA 2FDMA 2F2DA 5I98A 1GRJA 1WNOA 3ARZA 4MGVA 3O5MA 2KR7A 3WL0A 1HJVA 3PRDA 1JNEA 4IQ2A 2VCDA 2DSWA 2G8ZA 2LJ4A 2DT0A 4Z2IA 5JH8A 1E15A 1F40A 1ZU8A 2OLHA 3TCZA 1E44A 3KACA 3B7XA 4TW6A 5HBFA 1EDQA 4DIPA 1UR9A 3CGMA 2F21A 2FKEA 3KAFA 3O5QA 1LJYA 2AWGA 4GGQA 5HUAA 2XPBA 1ROUA 1FKLA 2M1IA 3KAIA 3O5OA 3I6CA 1D7HA 4KR0B 2A3CA 1XHGA 5HTGA 4ZPWR 2YBUA 1ZL1A 3O5JA 2PI6A 1IX5A 2RUQA 2ETNA 2O92A 3WD0A 1E6NA 2B31A 4DRIA 2G41A 1FKGA 1TCOC 4L3NA 4MSPA 3B9DA 4DRNA 4JFLA 2ZR5A 3WQVA 4GIVA 4WKFA 4U85A 3ARWA 4ZS6A 3KAGA 3NRKA 1L1PA 2ZR6A 4ODQA 4IT4A 4ODLA 5HKGA 1FKKA 3AS3A 4IPXA 3UF8A 4P8WA 4Z2LA 3O5EA 1KFWA 1FD9A 4ODKA 4N19A 1E6ZA 1UR8A 1GOIA 3CH9A 3LUOA 3KCEA 2RURA 2PV3A 3IHZA 3IKGA 4BF8A 1FKDA 4NSBA 1W1TA 1A7XA 4HBOA 3RM8A 4U86A 4Z2HA 4Z2JA 4Q7NA 3O5FA 5HW6A 1NH6A 4NZCA 4W9OA 4J4NA 1VF8A 2XPAA 2LKNA 4DRKA 4DRHA 1BKFA 1ZBKA 2XP8A 3AS2A 2KE0A 4WIWA 3KZ7A 1Q6IA 3ARTA 1WB0A 3ARSA 4ODNA 1ROTA 1QZ2A 2PPNA 4P8VA 3WD2A 1FKBA 1RD6A 4G2PA 2KO7A 2XP4A 3JYJA 1K9TA 3WQWA 1H0GA 1NWTA 4TX0A 4DZ3A 4W9PA 2WLYA 1HJWA 1HJXA 2XP6A 4IT6A 2IUZA 4IQCA 2F23A 3CZ8A 2DT1A 2A3BA 4DWSD 4QZVB 1QPFA 3UI5A 4ZPVR 2L2SA 1B6CA 3O5RA 4NNRA 3UI6A 1P5QA 4ITZA 1Q6UA 4O2TA 4JFMA 4KQZA 2O9OA 2KFWA 1PINA 1W1PA 1ITXA 5BXJA 3GTYX 2EULA 3W4RA 2DG9A 3G6MA 1JNTA 3PRAA 2MNTA 4ZPTR 5DF0A 1D6OA 2MPHA 2RQSA 3TC5A 1Q6HA 1XRVA 3O5PA 3B9AA 4Q22A 4QT3A 5HT1A 4DROA 1W1YA 3ARRA 1D7JA 3WD4A 1FJDA 4MAVA 3MDYB 3WKZA 1ZBVA 3O5LA 3TDBA 3BXWA 1NWRA 1JCHB 1EYMA 3ODKA 1C9HA 1W9UA 4C02B 4JFIA 2ESCA 2PV1A 3KABA 3NTPA 3RMEA 3CGNA 3PR9A 1YATA 3FXYA 1HKKA 1D2KA 2RUDA 4DRJA 4WKHA 2RUCA 3B8SA 1HKJA 4DWSC 3UQIA 2OFNA 4L72B 2K8IA 5HW8A 4DRMA 1SYTA 2A3EA 3ARXA 4U84A 1W9VA 1ZB5A 1ZK6A 3UQAA 3ARUA 3WIJA 1U79A 2DSZA 3QOKA 2DG3A 3WL1A 1EHNA 2A3AA 2DSVA 4R0XA 1OWQA 4FN2A 4LAWA 2PV2A 1FFRA 4MPKA 5DITA 3JXVA 1D7IA 2MLZA 3FAPA 2FAPA 5GQBA 2ZQTA 4MNJA 1EIBA 3KADA 2ITKA 4G50A 3B9EA 4S3KA 4MNLA 1FKRA 1E9LA 1H0IA 4TW7A 1O6IA 4TYOA 4DRQA 3CHFA 3ARQA 1LL4A 5GPGA 5D75A 2YBTA 2D9FA 4ODPA 5HW7A 3IKDA 3O5KA 1R9HA 3ARYA 3WH0A 5HWBA 1W9PA 3AROA 2F4EA 2ZQSA 4R5EA 2Q5AA 4DT4A 1X6LA 5GPRA 4TW8A 4MTVA 2DG4A 3IK8A 2UZ5A 3ALGA 4LAVA 3AS0A 1NSGA 1FKJA 1FKSA 4HBEA 3AQUA 5B8IC 2MLYA 4DRPA 4PTMA 1ZBCA 1J4RA 3AS1A 2WM0A 1W26A 4DWSB 3UQBA 2AOSA 5J6EA 1BL4A 1GPFA 3GU0A 1HKIA 3GPKA 4P8XA 4QT2A 3O5DA 4WK9A 2PPPA 3CHDA 5DIVA 1T11A 1LQ0A 4UDMA 2PPOA 1X6NA 3CHEA 4WJXA 1J6YA 2DSUA 1ZCNA 4JYSA 1N1AA 1FKTA 4P8UA 2MLXA 1W1VA 1EQ3A 1JNSA 5DEZA 1LG1A 1JVWA 2P4VA 2VN1A 2DT2A 2IF4A 1HKMA 2XP9A 1OGGA 1SR0A 4LGXA 3BMBA 1FAPA 4ODOA 3O5IA 1Y0OA 2MF9A 5HWCA 1TFVA 2RSEA 1NWSA 1FKFA 1J4IA 3EIPA 4W5UA 3WD1A 4TNSA 1PBKA 1FKHA 2B5UB 2JZVA 1Q1CA 2XP3A 1KT1A 4DZ2A 2XP7A 4XAKA 2PN0A 1YW5A 4ODRA 1NWUA 2ZQUA 3O5GA 3ARPA 4LAYA 3RM9A 4AY1A 1KT0A 1ZBWA 3UI4A 1GUVA 3PA7A 2ZQVA 4MNMA 1E6RA 1OGBA 1NMWA 1E6PA 2LGOA 3G6LA 3RM4A 2KI3A 4DWSA 2QF8A 1NMVA 1LL6A 3ARVA 1J4HA 2Y78A 3FY1A 4ODMA 3OA5A 3PRBA 3RFWA 4WKAA 1LG2A 4Z2GA 4FAPA 2M2AA 4J4OA 3CHCA 4LAXA 5DIUA 1M5YA 2N87A 2DT3A 3OOBA 4Z2KA 4JFJA 1LL7A 4MNKA 2M08A 1JNDA 4W9QA
chains in the Genus database with same CATH topology
1F8AB 4URIA 3RGCA 1CTNA 4JFKA 1QPLA 3EY6A 4HARA 1FKIA 4ML4A 3NI6A 4S3JA 2DPEA 3VAWA 5DO2A 3KAHA 1FFQA 4QIBA 1WAWA 2XP5A 2KGJA 2LPVA 2WLZA 3H9RB 2WK2A 3ALFA 3WD3A 4DH0A 2PBCA 2ZR4A 1HXVA 3JYMA 2FDMA 2F2DA 5I98A 1WNOA 3ARZA 4MGVA 3O5MA 2KR7A 3WL0A 1HJVA 3PRDA 1JNEA 4IQ2A 2VCDA 2DSWA 2G8ZA 2LJ4A 2DT0A 4Z2IA 5JH8A 1E15A 1F40A 1ZU8A 2OLHA 3TCZA 3KACA 3B7XA 4TW6A 5HBFA 1EDQA 4DIPA 1UR9A 3CGMA 2F21A 2FKEA 3KAFA 3O5QA 1LJYA 2AWGA 4GGQA 5HUAA 2XPBA 1ROUA 1FKLA 2M1IA 3KAIA 3O5OA 3I6CA 1D7HA 4KR0B 2A3CA 1XHGA 5HTGA 4ZPWR 2YBUA 1ZL1A 3O5JA 2PI6A 1IX5A 2RUQA 2O92A 3WD0A 4DRIA 1E6NA 2B31A 2G41A 1FKGA 1TCOC 4L3NA 4MSPA 3B9DA 4DRNA 4JFLA 2ZR5A 3WQVA 4GIVA 4WKFA 4U85A 3ARWA 4ZS6A 3KAGA 3NRKA 1L1PA 2ZR6A 4ODQA 4IT4A 4ODLA 5HKGA 1FKKA 3AS3A 4IPXA 3UF8A 4P8WA 4Z2LA 3O5EA 1KFWA 1FD9A 4ODKA 4N19A 1E6ZA 1UR8A 1GOIA 3CH9A 3LUOA 3KCEA 2RURA 2PV3A 3IHZA 3IKGA 4BF8A 1FKDA 4NSBA 1W1TA 1A7XA 4HBOA 3RM8A 4U86A 4Z2HA 4Z2JA 4Q7NA 3O5FA 5HW6A 1NH6A 4NZCA 4W9OA 4J4NA 1VF8A 2XPAA 2LKNA 4DRKA 4DRHA 1BKFA 1ZBKA 2XP8A 3AS2A 2KE0A 4WIWA 3KZ7A 1Q6IA 3ARTA 1WB0A 3ARSA 4ODNA 1ROTA 1QZ2A 2PPNA 4P8VA 3WD2A 1FKBA 1RD6A 4G2PA 2KO7A 2XP4A 3JYJA 1K9TA 3WQWA 1H0GA 1NWTA 4TX0A 4DZ3A 4W9PA 2WLYA 1HJWA 1HJXA 2XP6A 4IT6A 2IUZA 4IQCA 3CZ8A 2DT1A 2A3BA 4DWSD 4QZVB 1QPFA 3UI5A 4ZPVR 2L2SA 1B6CA 3O5RA 4NNRA 3UI6A 1P5QA 4ITZA 1Q6UA 4O2TA 4JFMA 4KQZA 2O9OA 2KFWA 1PINA 1W1PA 1ITXA 5BXJA 3W4RA 2DG9A 3G6MA 1JNTA 3PRAA 2MNTA 4ZPTR 5DF0A 1D6OA 2MPHA 2RQSA 3TC5A 1Q6HA 1XRVA 3O5PA 3B9AA 4Q22A 4QT3A 5HT1A 4DROA 1W1YA 3ARRA 1D7JA 3WD4A 1FJDA 4MAVA 3MDYB 3WKZA 1ZBVA 3O5LA 3TDBA 3BXWA 1NWRA 1EYMA 3ODKA 1C9HA 1W9UA 4C02B 4JFIA 2ESCA 2PV1A 3KABA 3NTPA 3RMEA 3CGNA 3PR9A 1YATA 3FXYA 1HKKA 1D2KA 2RUDA 4DRJA 4WKHA 2RUCA 3B8SA 1HKJA 4DWSC 3UQIA 2OFNA 4L72B 2K8IA 5HW8A 4DRMA 1SYTA 2A3EA 3ARXA 4U84A 1W9VA 1ZB5A 1ZK6A 3UQAA 3ARUA 3WIJA 1U79A 2DSZA 3QOKA 2DG3A 3WL1A 1EHNA 2A3AA 2DSVA 4R0XA 1OWQA 4FN2A 4LAWA 2PV2A 1FFRA 4MPKA 5DITA 3JXVA 1D7IA 2MLZA 3FAPA 2FAPA 5GQBA 2ZQTA 4MNJA 1EIBA 3KADA 2ITKA 4G50A 3B9EA 4S3KA 4MNLA 1FKRA 1E9LA 1H0IA 4TW7A 1O6IA 4TYOA 4DRQA 3CHFA 3ARQA 1LL4A 5GPGA 5D75A 2YBTA 2D9FA 4ODPA 5HW7A 3IKDA 3O5KA 1R9HA 3ARYA 3WH0A 5HWBA 1W9PA 3AROA 2F4EA 2ZQSA 4R5EA 2Q5AA 4DT4A 1X6LA 5GPRA 4TW8A 4MTVA 2DG4A 3IK8A 2UZ5A 3ALGA 4LAVA 3AS0A 1NSGA 1FKJA 1FKSA 4HBEA 3AQUA 5B8IC 2MLYA 4DRPA 4PTMA 1ZBCA 1J4RA 3AS1A 2WM0A 1W26A 4DWSB 3UQBA 2AOSA 5J6EA 1BL4A 1GPFA 1HKIA 3GPKA 4P8XA 4QT2A 3O5DA 4WK9A 2PPPA 3CHDA 5DIVA 1T11A 1LQ0A 2PPOA 1X6NA 3CHEA 4WJXA 1J6YA 2DSUA 1ZCNA 4JYSA 1N1AA 1FKTA 4P8UA 2MLXA 1W1VA 1EQ3A 1JNSA 5DEZA 1LG1A 1JVWA 2VN1A 2DT2A 2IF4A 1HKMA 2XP9A 1OGGA 1SR0A 4LGXA 1FAPA 4ODOA 3O5IA 1Y0OA 2MF9A 5HWCA 1TFVA 2RSEA 1NWSA 1FKFA 1J4IA 4W5UA 3WD1A 4TNSA 1PBKA 1FKHA 2JZVA 1Q1CA 2XP3A 1KT1A 4DZ2A 2XP7A 4XAKA 1YW5A 4ODRA 1NWUA 2ZQUA 3O5GA 3ARPA 4LAYA 3RM9A 4AY1A 1KT0A 1ZBWA 3UI4A 1GUVA 3PA7A 2ZQVA 4MNMA 1E6RA 1OGBA 1NMWA 1E6PA 2LGOA 3G6LA 3RM4A 2KI3A 4DWSA 2QF8A 1NMVA 1LL6A 3ARVA 1J4HA 2Y78A 3FY1A 4ODMA 3OA5A 3PRBA 3RFWA 4WKAA 1LG2A 4Z2GA 4FAPA 2M2AA 4J4OA 3CHCA 4LAXA 5DIUA 1M5YA 2N87A 2DT3A 3OOBA 4Z2KA 4JFJA 1LL7A 4MNKA 2M08A 1JNDA 4W9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYM A;  3GPK A;  3ODK A;  1F8A B;  4U86 A;  3RGC A;  1C9H A;  4QT2 A;  4C02 B;  4JFI A;  2PV1 A;  4JFK A;  3KAB A;  3O5D A;  1QPL A;  3EY6 A;  3NTP A;  3O5F A;  2PPP A;  5HW6 A;  5DIV A;  3CGN A;  1FKI A;  1YAT A;  1T11 A;  3NI6 A;  4W9O A;  3VAW A;  2PPO A;  3KAH A;  4J4N A;  2XPA A;  2LKN A;  2RUD A;  4QIB A;  4DRK A;  4DRH A;  4DRJ A;  1J6Y A;  2XP5 A;  1BKF A;  2RUC A;  1ZCN A;  4JYS A;  1N1A A;  2KGJ A;  2LPV A;  1FKT A;  2XP8 A;  3H9R B;  2KE0 A;  4DH0 A;  1HXV A;  2MLX A;  2PBC A;  2ZR4 A;  3JYM A;  3KZ7 A;  3UQI A;  1EQ3 A;  5I98 A;  2F2D A;  2OFN A;  1JNS A;  1Q6I A;  2K8I A;  1JVW A;  2VN1 A;  5HW8 A;  2IF4 A;  4MGV A;  2XP9 A;  4DRM A;  4ODN A;  1ROT A;  1QZ2 A;  3O5M A;  2KR7 A;  2PPN A;  4U84 A;  3PRD A;  1FAP A;  4ODO A;  1ZK6 A;  1FKB A;  2VCD A;  3O5I A;  1Y0O A;  4G2P A;  4IQ2 A;  3UQA A;  2LJ4 A;  1U79 A;  2MF9 A;  5HWC A;  2KO7 A;  2XP4 A;  3JYJ A;  2DG3 A;  2RSE A;  1F40 A;  1FKF A;  1J4I A;  4TX0 A;  4DZ3 A;  4W9P A;  3TCZ A;  4R0X A;  3KAC A;  4TNS A;  1PBK A;  3B7X A;  4TW6 A;  1FKH A;  2XP6 A;  2JZV A;  4FN2 A;  4DIP A;  4LAW A;  1Q1C A;  3CGM A;  2F21 A;  2FKE A;  2PV2 A;  3KAF A;  3UQB A;  2XP3 A;  1KT1 A;  3O5Q A;  2AWG A;  4GGQ A;  4IQC A;  4DZ2 A;  2XP7 A;  5HUA A;  2XPB A;  1ROU A;  1YW5 A;  5DIT A;  3JXV A;  1D7I A;  4ODR A;  1FKL A;  1QPF A;  2M1I A;  3KAI A;  2MLZ A;  2ZQU A;  3FAP A;  3I6C A;  1D7H A;  3O5O A;  3O5G A;  3UI5 A;  2L2S A;  2FAP A;  2ZQT A;  1B6C A;  4LAY A;  1KT0 A;  3O5R A;  4NNR A;  3UI6 A;  3KAD A;  5HTG A;  3UI4 A;  1P5Q A;  2ITK A;  3PA7 A;  3O5J A;  2ZQV A;  4G50 A;  4ITZ A;  1Q6U A;  4O2T A;  1FKR A;  2RUQ A;  4DRI A;  4JFM A;  1FKG A;  1TCO C;  1NMW A;  2KFW A;  4TW7 A;  4MSP A;  4TYO A;  4DRQ A;  2LGO A;  1PIN A;  4DRN A;  4JFL A;  5GPG A;  2ZR5 A;  5D75 A;  5BXJ A;  4GIV A;  4U85 A;  2D9F A;  2KI3 A;  4ODP A;  5HW7 A;  1NMV A;  3IKD A;  1R9H A;  3O5K A;  3KAG A;  3WH0 A;  5HWB A;  3NRK A;  2F4E A;  2DG9 A;  2ZQS A;  1J4H A;  1JNT A;  2Q5A A;  2Y78 A;  4ODM A;  2MNT A;  4DT4 A;  3PRB A;  1D6O A;  1L1P A;  2MPH A;  2ZR6 A;  4ODQ A;  4ODL A;  4TW8 A;  5HKG A;  1FKK A;  2DG4 A;  2RQS A;  2UZ5 A;  3IK8 A;  4IPX A;  1Q6H A;  4LAV A;  3RFW A;  3TC5 A;  1NSG A;  3UF8 A;  3O5P A;  1FKJ A;  4QT3 A;  3O5E A;  5HT1 A;  1FKS A;  4ODK A;  1FD9 A;  4DRO A;  4FAP A;  2M2A A;  4J4O A;  1D7J A;  4N19 A;  4LAX A;  5DIU A;  5B8I C;  2MLY A;  4DRP A;  1M5Y A;  1FJD A;  2N87 A;  3OOB A;  3LUO A;  4JFJ A;  3KCE A;  1J4R A;  2RUR A;  2PV3 A;  3IHZ A;  3IKG A;  3MDY B;  4BF8 A;  2M08 A;  4W9Q A;  1FKD A;  3O5L A;  1W26 A;  3TDB A;  1A7X A;  5J6E A;  1BL4 A; 
#chains in the Genus database with same CATH topology
 1F8A B;  4URI A;  3RGC A;  1CTN A;  4JFK A;  1QPL A;  3EY6 A;  4HAR A;  1FKI A;  4ML4 A;  3NI6 A;  4S3J A;  2DPE A;  3VAW A;  5DO2 A;  3KAH A;  1FFQ A;  4QIB A;  1WAW A;  2XP5 A;  2KGJ A;  2LPV A;  2WLZ A;  3H9R B;  2WK2 A;  3ALF A;  3WD3 A;  4DH0 A;  2PBC A;  2ZR4 A;  1HXV A;  3JYM A;  2FDM A;  2F2D A;  5I98 A;  1GRJ A;  1WNO A;  3ARZ A;  4MGV A;  3O5M A;  2KR7 A;  3WL0 A;  1HJV A;  3PRD A;  1JNE A;  4IQ2 A;  2VCD A;  2DSW A;  2G8Z A;  2LJ4 A;  2DT0 A;  4Z2I A;  5JH8 A;  1E15 A;  1F40 A;  1ZU8 A;  2OLH A;  3TCZ A;  1E44 A;  3KAC A;  3B7X A;  4TW6 A;  5HBF A;  1EDQ A;  4DIP A;  1UR9 A;  3CGM A;  2F21 A;  2FKE A;  3KAF A;  3O5Q A;  1LJY A;  2AWG A;  4GGQ A;  5HUA A;  2XPB A;  1ROU A;  1FKL A;  2M1I A;  3KAI A;  3O5O A;  3I6C A;  1D7H A;  4KR0 B;  2A3C A;  1XHG A;  5HTG A;  4ZPW R;  2YBU A;  1ZL1 A;  3O5J A;  2PI6 A;  1IX5 A;  2RUQ A;  2ETN A;  2O92 A;  3WD0 A;  1E6N A;  2B31 A;  4DRI A;  2G41 A;  1FKG A;  1TCO C;  4L3N A;  4MSP A;  3B9D A;  4DRN A;  4JFL A;  2ZR5 A;  3WQV A;  4GIV A;  4WKF A;  4U85 A;  3ARW A;  4ZS6 A;  3KAG A;  3NRK A;  1L1P A;  2ZR6 A;  4ODQ A;  4IT4 A;  4ODL A;  5HKG A;  1FKK A;  3AS3 A;  4IPX A;  3UF8 A;  4P8W A;  4Z2L A;  3O5E A;  1KFW A;  1FD9 A;  4ODK A;  4N19 A;  1E6Z A;  1UR8 A;  1GOI A;  3CH9 A;  3LUO A;  3KCE A;  2RUR A;  2PV3 A;  3IHZ A;  3IKG A;  4BF8 A;  1FKD A;  4NSB A;  1W1T A;  1A7X A;  4HBO A;  3RM8 A;  4U86 A;  4Z2H A;  4Z2J A;  4Q7N A;  3O5F A;  5HW6 A;  1NH6 A;  4NZC A;  4W9O A;  4J4N A;  1VF8 A;  2XPA A;  2LKN A;  4DRK A;  4DRH A;  1BKF A;  1ZBK A;  2XP8 A;  3AS2 A;  2KE0 A;  4WIW A;  3KZ7 A;  1Q6I A;  3ART A;  1WB0 A;  3ARS A;  4ODN A;  1ROT A;  1QZ2 A;  2PPN A;  4P8V A;  3WD2 A;  1FKB A;  1RD6 A;  4G2P A;  2KO7 A;  2XP4 A;  3JYJ A;  1K9T A;  3WQW A;  1H0G A;  1NWT A;  4TX0 A;  4DZ3 A;  4W9P A;  2WLY A;  1HJW A;  1HJX A;  2XP6 A;  4IT6 A;  2IUZ A;  4IQC A;  2F23 A;  3CZ8 A;  2DT1 A;  2A3B A;  4DWS D;  4QZV B;  1QPF A;  3UI5 A;  4ZPV R;  2L2S A;  1B6C A;  3O5R A;  4NNR A;  3UI6 A;  1P5Q A;  4ITZ A;  1Q6U A;  4O2T A;  4JFM A;  4KQZ A;  2O9O A;  2KFW A;  1PIN A;  1W1P A;  1ITX A;  5BXJ A;  3GTY X;  2EUL A;  3W4R A;  2DG9 A;  3G6M A;  1JNT A;  3PRA A;  2MNT A;  4ZPT R;  5DF0 A;  1D6O A;  2MPH A;  2RQS A;  3TC5 A;  1Q6H A;  1XRV A;  3O5P A;  3B9A A;  4Q22 A;  4QT3 A;  5HT1 A;  4DRO A;  1W1Y A;  3ARR A;  1D7J A;  3WD4 A;  1FJD A;  4MAV A;  3MDY B;  3WKZ A;  1ZBV A;  3O5L A;  3TDB A;  3BXW A;  1NWR A;  1JCH B;  1EYM A;  3ODK A;  1C9H A;  1W9U A;  4C02 B;  4JFI A;  2ESC A;  2PV1 A;  3KAB A;  3NTP A;  3RME A;  3CGN A;  3PR9 A;  1YAT A;  3FXY A;  1HKK A;  1D2K A;  2RUD A;  4DRJ A;  4WKH A;  2RUC A;  3B8S A;  1HKJ A;  4DWS C;  3UQI A;  2OFN A;  4L72 B;  2K8I A;  5HW8 A;  4DRM A;  1SYT A;  2A3E A;  3ARX A;  4U84 A;  1W9V A;  1ZB5 A;  1ZK6 A;  3UQA A;  3ARU A;  3WIJ A;  1U79 A;  2DSZ A;  3QOK A;  2DG3 A;  3WL1 A;  1EHN A;  2A3A A;  2DSV A;  4R0X A;  1OWQ A;  4FN2 A;  4LAW A;  2PV2 A;  1FFR A;  4MPK A;  5DIT A;  3JXV A;  1D7I A;  2MLZ A;  3FAP A;  2FAP A;  5GQB A;  2ZQT A;  4MNJ A;  1EIB A;  3KAD A;  2ITK A;  4G50 A;  3B9E A;  4S3K A;  4MNL A;  1FKR A;  1E9L A;  1H0I A;  4TW7 A;  1O6I A;  4TYO A;  4DRQ A;  3CHF A;  3ARQ A;  1LL4 A;  5GPG A;  5D75 A;  2YBT A;  2D9F A;  4ODP A;  5HW7 A;  3IKD A;  3O5K A;  1R9H A;  3ARY A;  3WH0 A;  5HWB A;  1W9P A;  3ARO A;  2F4E A;  2ZQS A;  4R5E A;  2Q5A A;  4DT4 A;  1X6L A;  5GPR A;  4TW8 A;  4MTV A;  2DG4 A;  3IK8 A;  2UZ5 A;  3ALG A;  4LAV A;  3AS0 A;  1NSG A;  1FKJ A;  1FKS A;  4HBE A;  3AQU A;  5B8I C;  2MLY A;  4DRP A;  4PTM A;  1ZBC A;  1J4R A;  3AS1 A;  2WM0 A;  1W26 A;  4DWS B;  3UQB A;  2AOS A;  5J6E A;  1BL4 A;  1GPF A;  3GU0 A;  1HKI A;  3GPK A;  4P8X A;  4QT2 A;  3O5D A;  4WK9 A;  2PPP A;  3CHD A;  5DIV A;  1T11 A;  1LQ0 A;  4UDM A;  2PPO A;  1X6N A;  3CHE A;  4WJX A;  1J6Y A;  2DSU A;  1ZCN A;  4JYS A;  1N1A A;  1FKT A;  4P8U A;  2MLX A;  1W1V A;  1EQ3 A;  1JNS A;  5DEZ A;  1LG1 A;  1JVW A;  2P4V A;  2VN1 A;  2DT2 A;  2IF4 A;  1HKM A;  2XP9 A;  1OGG A;  1SR0 A;  4LGX A;  3BMB A;  1FAP A;  4ODO A;  3O5I A;  1Y0O A;  2MF9 A;  5HWC A;  1TFV A;  2RSE A;  1NWS A;  1FKF A;  1J4I A;  3EIP A;  4W5U A;  3WD1 A;  4TNS A;  1PBK A;  1FKH A;  2B5U B;  2JZV A;  1Q1C A;  2XP3 A;  1KT1 A;  4DZ2 A;  2XP7 A;  4XAK A;  2PN0 A;  1YW5 A;  4ODR A;  1NWU A;  2ZQU A;  3O5G A;  3ARP A;  4LAY A;  3RM9 A;  4AY1 A;  1KT0 A;  1ZBW A;  3UI4 A;  1GUV A;  3PA7 A;  2ZQV A;  4MNM A;  1E6R A;  1OGB A;  1NMW A;  1E6P A;  2LGO A;  3G6L A;  3RM4 A;  2KI3 A;  4DWS A;  2QF8 A;  1NMV A;  1LL6 A;  3ARV A;  1J4H A;  2Y78 A;  3FY1 A;  4ODM A;  3OA5 A;  3PRB A;  3RFW A;  4WKA A;  1LG2 A;  4Z2G A;  4FAP A;  2M2A A;  4J4O A;  3CHC A;  4LAX A;  5DIU A;  1M5Y A;  2N87 A;  2DT3 A;  3OOB A;  4Z2K A;  4JFJ A;  1LL7 A;  4MNK A;  2M08 A;  1JND A;  4W9Q A; 
#chains in the Genus database with same CATH homology
 1F8A B;  4URI A;  3RGC A;  1CTN A;  4JFK A;  1QPL A;  3EY6 A;  4HAR A;  1FKI A;  4ML4 A;  3NI6 A;  4S3J A;  2DPE A;  3VAW A;  5DO2 A;  3KAH A;  1FFQ A;  4QIB A;  1WAW A;  2XP5 A;  2KGJ A;  2LPV A;  2WLZ A;  3H9R B;  2WK2 A;  3ALF A;  3WD3 A;  4DH0 A;  2PBC A;  2ZR4 A;  1HXV A;  3JYM A;  2FDM A;  2F2D A;  5I98 A;  1WNO A;  3ARZ A;  4MGV A;  3O5M A;  2KR7 A;  3WL0 A;  1HJV A;  3PRD A;  1JNE A;  4IQ2 A;  2VCD A;  2DSW A;  2G8Z A;  2LJ4 A;  2DT0 A;  4Z2I A;  5JH8 A;  1E15 A;  1F40 A;  1ZU8 A;  2OLH A;  3TCZ A;  3KAC A;  3B7X A;  4TW6 A;  5HBF A;  1EDQ A;  4DIP A;  1UR9 A;  3CGM A;  2F21 A;  2FKE A;  3KAF A;  3O5Q A;  1LJY A;  2AWG A;  4GGQ A;  5HUA A;  2XPB A;  1ROU A;  1FKL A;  2M1I A;  3KAI A;  3O5O A;  3I6C A;  1D7H A;  4KR0 B;  2A3C A;  1XHG A;  5HTG A;  4ZPW R;  2YBU A;  1ZL1 A;  3O5J A;  2PI6 A;  1IX5 A;  2RUQ A;  2O92 A;  3WD0 A;  4DRI A;  1E6N A;  2B31 A;  2G41 A;  1FKG A;  1TCO C;  4L3N A;  4MSP A;  3B9D A;  4DRN A;  4JFL A;  2ZR5 A;  3WQV A;  4GIV A;  4WKF A;  4U85 A;  3ARW A;  4ZS6 A;  3KAG A;  3NRK A;  1L1P A;  2ZR6 A;  4ODQ A;  4IT4 A;  4ODL A;  5HKG A;  1FKK A;  3AS3 A;  4IPX A;  3UF8 A;  4P8W A;  4Z2L A;  3O5E A;  1KFW A;  1FD9 A;  4ODK A;  4N19 A;  1E6Z A;  1UR8 A;  1GOI A;  3CH9 A;  3LUO A;  3KCE A;  2RUR A;  2PV3 A;  3IHZ A;  3IKG A;  4BF8 A;  1FKD A;  4NSB A;  1W1T A;  1A7X A;  4HBO A;  3RM8 A;  4U86 A;  4Z2H A;  4Z2J A;  4Q7N A;  3O5F A;  5HW6 A;  1NH6 A;  4NZC A;  4W9O A;  4J4N A;  1VF8 A;  2XPA A;  2LKN A;  4DRK A;  4DRH A;  1BKF A;  1ZBK A;  2XP8 A;  3AS2 A;  2KE0 A;  4WIW A;  3KZ7 A;  1Q6I A;  3ART A;  1WB0 A;  3ARS A;  4ODN A;  1ROT A;  1QZ2 A;  2PPN A;  4P8V A;  3WD2 A;  1FKB A;  1RD6 A;  4G2P A;  2KO7 A;  2XP4 A;  3JYJ A;  1K9T A;  3WQW A;  1H0G A;  1NWT A;  4TX0 A;  4DZ3 A;  4W9P A;  2WLY A;  1HJW A;  1HJX A;  2XP6 A;  4IT6 A;  2IUZ A;  4IQC A;  3CZ8 A;  2DT1 A;  2A3B A;  4DWS D;  4QZV B;  1QPF A;  3UI5 A;  4ZPV R;  2L2S A;  1B6C A;  3O5R A;  4NNR A;  3UI6 A;  1P5Q A;  4ITZ A;  1Q6U A;  4O2T A;  4JFM A;  4KQZ A;  2O9O A;  2KFW A;  1PIN A;  1W1P A;  1ITX A;  5BXJ A;  3W4R A;  2DG9 A;  3G6M A;  1JNT A;  3PRA A;  2MNT A;  4ZPT R;  5DF0 A;  1D6O A;  2MPH A;  2RQS A;  3TC5 A;  1Q6H A;  1XRV A;  3O5P A;  3B9A A;  4Q22 A;  4QT3 A;  5HT1 A;  4DRO A;  1W1Y A;  3ARR A;  1D7J A;  3WD4 A;  1FJD A;  4MAV A;  3MDY B;  3WKZ A;  1ZBV A;  3O5L A;  3TDB A;  3BXW A;  1NWR A;  1EYM A;  3ODK A;  1C9H A;  1W9U A;  4C02 B;  4JFI A;  2ESC A;  2PV1 A;  3KAB A;  3NTP A;  3RME A;  3CGN A;  3PR9 A;  1YAT A;  3FXY A;  1HKK A;  1D2K A;  2RUD A;  4DRJ A;  4WKH A;  2RUC A;  3B8S A;  1HKJ A;  4DWS C;  3UQI A;  2OFN A;  4L72 B;  2K8I A;  5HW8 A;  4DRM A;  1SYT A;  2A3E A;  3ARX A;  4U84 A;  1W9V A;  1ZB5 A;  1ZK6 A;  3UQA A;  3ARU A;  3WIJ A;  1U79 A;  2DSZ A;  3QOK A;  2DG3 A;  3WL1 A;  1EHN A;  2A3A A;  2DSV A;  4R0X A;  1OWQ A;  4FN2 A;  4LAW A;  2PV2 A;  1FFR A;  4MPK A;  5DIT A;  3JXV A;  1D7I A;  2MLZ A;  3FAP A;  2FAP A;  5GQB A;  2ZQT A;  4MNJ A;  1EIB A;  3KAD A;  2ITK A;  4G50 A;  3B9E A;  4S3K A;  4MNL A;  1FKR A;  1E9L A;  1H0I A;  4TW7 A;  1O6I A;  4TYO A;  4DRQ A;  3CHF A;  3ARQ A;  1LL4 A;  5GPG A;  5D75 A;  2YBT A;  2D9F A;  4ODP A;  5HW7 A;  3IKD A;  3O5K A;  1R9H A;  3ARY A;  3WH0 A;  5HWB A;  1W9P A;  3ARO A;  2F4E A;  2ZQS A;  4R5E A;  2Q5A A;  4DT4 A;  1X6L A;  5GPR A;  4TW8 A;  4MTV A;  2DG4 A;  3IK8 A;  2UZ5 A;  3ALG A;  4LAV A;  3AS0 A;  1NSG A;  1FKJ A;  1FKS A;  4HBE A;  3AQU A;  5B8I C;  2MLY A;  4DRP A;  4PTM A;  1ZBC A;  1J4R A;  3AS1 A;  2WM0 A;  1W26 A;  4DWS B;  3UQB A;  2AOS A;  5J6E A;  1BL4 A;  1GPF A;  1HKI A;  3GPK A;  4P8X A;  4QT2 A;  3O5D A;  4WK9 A;  2PPP A;  3CHD A;  5DIV A;  1T11 A;  1LQ0 A;  2PPO A;  1X6N A;  3CHE A;  4WJX A;  1J6Y A;  2DSU A;  1ZCN A;  4JYS A;  1N1A A;  1FKT A;  4P8U A;  2MLX A;  1W1V A;  1EQ3 A;  1JNS A;  5DEZ A;  1LG1 A;  1JVW A;  2VN1 A;  2DT2 A;  2IF4 A;  1HKM A;  2XP9 A;  1OGG A;  1SR0 A;  4LGX A;  1FAP A;  4ODO A;  3O5I A;  1Y0O A;  2MF9 A;  5HWC A;  1TFV A;  2RSE A;  1NWS A;  1FKF A;  1J4I A;  4W5U A;  3WD1 A;  4TNS A;  1PBK A;  1FKH A;  2JZV A;  1Q1C A;  2XP3 A;  1KT1 A;  4DZ2 A;  2XP7 A;  4XAK A;  1YW5 A;  4ODR A;  1NWU A;  2ZQU A;  3O5G A;  3ARP A;  4LAY A;  3RM9 A;  4AY1 A;  1KT0 A;  1ZBW A;  3UI4 A;  1GUV A;  3PA7 A;  2ZQV A;  4MNM A;  1E6R A;  1OGB A;  1NMW A;  1E6P A;  2LGO A;  3G6L A;  3RM4 A;  2KI3 A;  4DWS A;  2QF8 A;  1NMV A;  1LL6 A;  3ARV A;  1J4H A;  2Y78 A;  3FY1 A;  4ODM A;  3OA5 A;  3PRB A;  3RFW A;  4WKA A;  1LG2 A;  4Z2G A;  4FAP A;  2M2A A;  4J4O A;  3CHC A;  4LAX A;  5DIU A;  1M5Y A;  2N87 A;  2DT3 A;  3OOB A;  4Z2K A;  4JFJ A;  1LL7 A;  4MNK A;  2M08 A;  1JND A;  4W9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...