1QPFA

Fk506 binding protein (12 kda, human) complex with l-709,858
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 32-Indolyl ether derivatives of ascomycin: three-dimensional structures of complexes with FK506-binding protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
total genus 24
structure length 107
sequence length 107
chains with identical sequence D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1qpfA00
1FKIA 3H9RB 3PRBA 1FKHA 3I6CA 2ZQUA 3CGMA 4JFJA 4ODPA 4QT2A 3RGCA 2ZR5A 4JFMA 1P5QA 4TYOA 5B8IC 3PRDA 4DH0A 1Q6UA 5DIUA 2XP8A 2MLYA 2F21A 1FKDA 1JNTA 4ODKA 1FKRA 2LJ4A 2JZVA 3MDYB 4BF8A 2KGJA 3JYMA 4ITZA 2Y78A 4LAVA 3B7XA 3PA7A 3KAFA 3TDBA 1ZCNA 2IF4A 2LGOA 3KADA 4J4NA 4MGVA 4TX0A 4DRIA 2RUCA 5HW7A 1FKLA 1QZ2A 2MLZA 2VN1A 1PBKA 1KT0A 2XP7A 2ZR6A 3IHZA 3KAIA 4G50A 4W9OA 1EQ3A 3NRKA 1T11A 3O5GA 4DRHA 4TW7A 5HTGA 3CGNA 3O5MA 1HXVA 1QPFA 5I98A 4O2TA 1F40A 2KE0A 3IKGA 3JXVA 1D6OA 3KAGA 1ROUA 5HW6A 1R9HA 4G2PA 1BL4A 1FKBA 2PPOA 2RUDA 3KZ7A 5HWBA 2XP5A 3KACA 2XPBA 4ODNA 2RUQA 4TW6A 1KT1A 1Q1CA 3JYJA 4W9QA 1Q6HA 1NMWA 2XP3A 2LPVA 4IQCA 1F8AB 3EY6A 1FKKA 3O5OA 3KCEA 1BKFA 2KFWA 2PV3A 4JFLA 1D7HA 2ZQTA 1FJDA 3NTPA 2F4EA 1FKJA 4ODRA 3O5QA 2FKEA 4U84A 2DG3A 1YATA 2DG4A 2KI3A 1C9HA 2RSEA 3IK8A 3LUOA 4LAWA 4DRPA 1W26A 3KAHA 5HT1A 2D9FA 1FD9A 3UQAA 4GIVA 3O5IA 3OOBA 3VAWA 2XP4A 4U86A 3TC5A 2LKNA 2XP6A 4QT3A 3FAPA 5HUAA 2F2DA 4J4OA 4DZ2A 3O5RA 1NMVA 2ZQSA 5BXJA 2AWGA 2KR7A 1B6CA 3IKDA 1Y0OA 3KABA 3O5KA 4IPXA 4DRQA 4DRNA 4DIPA 2M2AA 4DRKA 1ROTA 4FAPA 2KO7A 2N87A 2MPHA 1D7IA 1FKSA 4JYSA 3TCZA 1J6YA 4DROA 2M08A 4JFIA 4DRMA 3UI5A 5HKGA 2Q5AA 3O5JA 2VCDA 2XPAA 3O5DA 1N1AA 3ODKA 1EYMA 2PV2A 2RURA 2M1IA 2MF9A 4IQ2A 3RFWA 4TW8A 1L1PA 4C02B 2ZQVA 4ODMA 2UZ5A 5GPGA 2FAPA 4LAXA 2PBCA 1J4RA 4ODQA 1JVWA 1A7XA 4LAYA 4DZ3A 3O5EA 1ZK6A 4TNSA 3O5LA 5DIVA 4FN2A 4GGQA 4DT4A 2K8IA 1M5YA 1J4IA 4ODOA 5HW8A 3UQIA 1TCOC 4MSPA 4NNRA 3UI4A 1JNSA 1FKGA 1U79A 2ITKA 4U85A 3WH0A 5HWCA 2PV1A 4QIBA 2OFNA 2MLXA 2ZR4A 3GPKA 1NSGA 2PPPA 4ODLA 2L2SA 3UQBA 3NI6A 2PPNA 3UF8A 1QPLA 1Q6IA 3UI6A 1PINA 2MNTA 1D7JA 1YW5A 3O5PA 1FAPA 4DRJA 2XP9A 4R0XA 4W9PA 5D75A 5DITA 4N19A 1FKFA 3O5FA 4JFKA 2DG9A 5J6EA 2RQSA 1FKTA 1J4HA
chains in the Genus database with same CATH superfamily
1FKIA 4AY1A 2ZQUA 3PRDA 1RD6A 3ARSA 4Z2GA 1H0GA 2XP8A 2MLYA 1JNTA 1FKRA 2OLHA 2LJ4A 3MDYB 4BF8A 1HKKA 2Y78A 4LAVA 1ZBCA 1EIBA 3KAFA 1ZCNA 2LGOA 3KADA 4MNMA 4NSBA 4TX0A 2A3EA 4W5UA 1KT0A 3NRKA 4TW7A 5I98A 4O2TA 1ZB5A 4S3KA 3IKGA 3JXVA 1WAWA 1ROUA 2G41A 2RUDA 2PPOA 3KACA 1Q1CA 3WL0A 1Q6HA 3WD2A 3EIPA 3EY6A 1FKKA 3O5OA 3G6LA 3KCEA 3ARWA 2FDMA 3CHFA 2F4EA 1ZBVA 3O5QA 1WB0A 4U84A 1LQ0A 2DT1A 2RSEA 2O92A 4DRPA 3KAHA 5HT1A 2D9FA 4GIVA 4U86A 4QT3A 2F2DA 1H0IA 4MNJA 2ZQSA 2AWGA 3IKDA 3O5KA 4DRQA 4L72B 4DIPA 2M2AA 1ROTA 1KFWA 1D7IA 1JCHB 2Q5AA 2PV2A 2RURA 1L1PA 2G8ZA 2PBCA 1X6NA 1JVWA 3RMEA 1LJYA 4P8WA 4DT4A 3B9AA 3UI4A 1JNDA 1OGBA 3GPKA 2L2SA 4Q22A 3AS3A 1QPLA 3O5PA 4WKAA 3GTYX 2XP9A 4ZPWR 3CZ8A 4MNKA 4JFKA 2PN0A 3AS2A 1J4HA 1FKHA 1UR9A 3QOKA 4JFMA 4ZPTR 4P8VA 4DH0A 5DIUA 1LG1A 1HKMA 1FKDA 1OGGA 2KGJA 3JYMA 2DPEA 3TDBA 3FY1A 3AS0A 1UR8A 2YBTA 1WNOA 2RUCA 5HW7A 1QZ2A 2AOSA 3OA5A 2VN1A 3ARYA 2ZR6A 4G50A 3KAIA 4IT4A 4W9OA 1HJVA 1T11A 1W9UA 1QPFA 2O9OA 1E6ZA 2KE0A 2EULA 5HW6A 1R9HA 4G2PA 3KZ7A 5HWBA 3AROA 4ODNA 2XPBA 4W9QA 2RUQA 1NWUA 1KT1A 2WM0A 1NMWA 1SR0A 2LPVA 3ARVA 4IQCA 2PV3A 1XHGA 1XRVA 1HKJA 3NTPA 2ETNA 1FKJA 3RM8A 4Z2KA 3LUOA 4WIWA 2A3AA 3WD1A 3UQAA 3OOBA 3VAWA 2XP4A 3ARUA 2XP6A 3AQUA 3FAPA 4J4OA 4DZ2A 3O5RA 1K9TA 3KABA 4IPXA 1B6CA 2A3BA 2ESCA 1E44A 1FKSA 4HBOA 1NWSA 3RM9A 1J6YA 3O5JA 4DWSA 1N1AA 1LG2A 4C02B 5GPGA 2F23A 1JNEA 4ZPVR 3O5EA 5DIVA 2K8IA 1M5YA 5HW8A 4ODOA 4MSPA 4NNRA 3WL1A 3WQWA 2ITKA 3WKZA 4QIBA 2MLXA 4ML4A 3B8SA 3UQBA 1HJXA 5JH8A 4KR0B 2WLYA 1D7JA 1YW5A 2DSUA 4W9PA 1X6LA 5DITA 5J6EA 3H9RB 3PRBA 3I6CA 1OWQA 1D2KA 4JFJA 4ODPA 4QT2A 3ARZA 3RGCA 2ZR5A 5B8IC 1Q6UA 2PI6A 1GUVA 2F21A 2IUZA 4Q7NA 2JZVA 4DWSB 4PTMA 4ITZA 1W1TA 3B7XA 3PA7A 4MGVA 2IF4A 4J4NA 4DWSC 3W4RA 1PBKA 3WD0A 2XP7A 3IHZA 2P4VA 1HKIA 3BMBA 5HTGA 3O5MA 1HXVA 1E6NA 4MNLA 1F40A 1IX5A 5GPRA 1BL4A 2XP5A 4MPKA 4Z2IA 5DEZA 1D7HA 2ZQTA 1FJDA 2DSVA 2DG3A 1YATA 2DG4A 4LAWA 1FD9A 4ZS6A 3O5IA 3TC5A 1E6RA 2LKNA 3ARRA 5BXJA 2KR7A 4DRNA 1Y0OA 3PRAA 3ALFA 4DRKA 2KO7A 2N87A 2DSZA 3FXYA 3GU0A 3WQVA 2M08A 4Z2LA 1E6PA 4JFIA 4QZVB 4NZCA 4P8UA 3UI5A 4DRMA 5HKGA 4L3NA 3ARPA 2VCDA 3WIJA 3RFWA 2M1IA 4IQ2A 2ZQVA 4ODMA 4MAVA 1J4RA 4ODQA 3B9DA 1ZK6A 1ZBKA 4FN2A 1VF8A 1TCOC 2WK2A 1JNSA 1FKGA 1U79A 4U85A 3WH0A 5HWCA 2PV1A 3G6MA 2OFNA 3BXWA 3WD3A 1GPFA 2ZR4A 1NSGA 2PPPA 1ZU8A 4KQZA 4WK9A 3NI6A 5DO2A 2PPNA 3WD4A 4DRJA 3AS1A 1ZBWA 1FAPA 1EDQA 5D75A 4N19A 3O5FA 1E9LA 5HUAA 3B9EA 1FKTA 1EHNA 3CGMA 1P5QA 4TYOA 4S3JA 3CHCA 3ARTA 3PR9A 1W1PA 2DSWA 4ODKA 2YBUA 1W1VA 4LGXA 1TFVA 3RM4A 2WLZA 4DRIA 1W9PA 4URIA 1FFQA 1FKLA 3ARQA 2MLZA 1EQ3A 4Z2HA 1LL7A 2B5UB 3O5GA 4DRHA 3CGNA 1CTNA 5DF0A 1D6OA 3KAGA 1FKBA 4TW6A 3JYJA 2XP3A 2A3CA 3CH9A 1F8AB 1BKFA 2KFWA 4JFLA 5GQBA 4WJXA 4MTVA 1FFRA 4HARA 3ARXA 4ODRA 2FKEA 4R5EA 2KI3A 1C9HA 3IK8A 1LL4A 1W26A 4DWSD 2DT0A 1HJWA 3ALGA 3CHDA 4Z2JA 2QF8A 1NMVA 2DT2A 2DT3A 4FAPA 2MPHA 1SYTA 1ZL1A 4JYSA 3TCZA 4P8XA 4DROA 2B31A 2XPAA 3O5DA 1NWTA 3ODKA 1EYMA 1E15A 2MF9A 4TW8A 4WKHA 2UZ5A 2FAPA 4LAXA 5HBFA 1A7XA 4LAYA 4DZ3A 4TNSA 3O5LA 4WKFA 4GGQA 1J4IA 4IT6A 4XAKA 3UQIA 1W1YA 1GOIA 1NWRA 1O6IA 1W9VA 4ODLA 1NH6A 4UDMA 1LL6A 3UF8A 1Q6IA 3UI6A 1PINA 2MNTA 4HBEA 4R0XA 3CHEA 1FKFA 1GRJA 1ITXA 2DG9A 2RQSA
chains in the Genus database with same CATH topology
1FKIA 4AY1A 2ZQUA 3PRDA 1RD6A 3ARSA 4Z2GA 1H0GA 2XP8A 2MLYA 1JNTA 1FKRA 2OLHA 2LJ4A 3MDYB 4BF8A 1HKKA 2Y78A 4LAVA 1ZBCA 1EIBA 3KAFA 1ZCNA 2LGOA 3KADA 4MNMA 4NSBA 4TX0A 2A3EA 4W5UA 1KT0A 3NRKA 4TW7A 5I98A 4O2TA 1ZB5A 4S3KA 3IKGA 3JXVA 1WAWA 1ROUA 2G41A 2RUDA 2PPOA 3KACA 1Q1CA 3WL0A 1Q6HA 3WD2A 3EY6A 1FKKA 3O5OA 3G6LA 3KCEA 3ARWA 2FDMA 3CHFA 2F4EA 1ZBVA 1WB0A 3O5QA 4U84A 1LQ0A 2DT1A 2RSEA 2O92A 4DRPA 3KAHA 5HT1A 2D9FA 4GIVA 4U86A 4QT3A 2F2DA 1H0IA 4MNJA 2ZQSA 2AWGA 3IKDA 3O5KA 4DRQA 4L72B 4DIPA 2M2AA 1ROTA 1KFWA 1D7IA 2Q5AA 2PV2A 2RURA 1L1PA 2G8ZA 2PBCA 1X6NA 1JVWA 3RMEA 1LJYA 4P8WA 4DT4A 3B9AA 3UI4A 1JNDA 1OGBA 3GPKA 2L2SA 4Q22A 3AS3A 1QPLA 3O5PA 4WKAA 2XP9A 4ZPWR 3CZ8A 4MNKA 4JFKA 3AS2A 1J4HA 1FKHA 1UR9A 3QOKA 4JFMA 4ZPTR 4P8VA 4DH0A 5DIUA 1LG1A 1HKMA 1FKDA 1OGGA 2KGJA 3JYMA 2DPEA 3TDBA 3FY1A 3AS0A 1UR8A 2YBTA 1WNOA 2RUCA 5HW7A 1QZ2A 2AOSA 3OA5A 2VN1A 3ARYA 2ZR6A 4G50A 3KAIA 4IT4A 4W9OA 1HJVA 1T11A 1W9UA 1QPFA 2O9OA 1E6ZA 2KE0A 5HW6A 1R9HA 4G2PA 3KZ7A 5HWBA 3AROA 4ODNA 2XPBA 4W9QA 2RUQA 1NWUA 1KT1A 2WM0A 1NMWA 1SR0A 2LPVA 4IQCA 3ARVA 2PV3A 1XHGA 1XRVA 1HKJA 3NTPA 3RM8A 1FKJA 4Z2KA 3LUOA 4WIWA 2A3AA 3WD1A 3UQAA 3OOBA 3VAWA 2XP4A 3ARUA 2XP6A 3AQUA 3FAPA 4J4OA 4DZ2A 3O5RA 1K9TA 3KABA 4IPXA 1B6CA 2A3BA 2ESCA 1FKSA 4HBOA 1NWSA 3RM9A 1J6YA 3O5JA 4DWSA 1N1AA 1LG2A 4C02B 5GPGA 1JNEA 4ZPVR 3O5EA 5DIVA 2K8IA 1M5YA 5HW8A 4ODOA 4MSPA 4NNRA 3WL1A 3WQWA 2ITKA 3WKZA 4QIBA 2MLXA 4ML4A 3B8SA 3UQBA 1HJXA 5JH8A 4KR0B 2WLYA 1D7JA 1YW5A 2DSUA 4W9PA 1X6LA 5DITA 5J6EA 3H9RB 3PRBA 3I6CA 1OWQA 1D2KA 4JFJA 4ODPA 4QT2A 3ARZA 3RGCA 2ZR5A 5B8IC 1Q6UA 2PI6A 1GUVA 2F21A 2IUZA 4Q7NA 2JZVA 4DWSB 4PTMA 4ITZA 1W1TA 3B7XA 3PA7A 4MGVA 2IF4A 4J4NA 4DWSC 3W4RA 1PBKA 3WD0A 2XP7A 3IHZA 1HKIA 5HTGA 3O5MA 1HXVA 1E6NA 4MNLA 1F40A 1IX5A 5GPRA 1BL4A 2XP5A 4MPKA 4Z2IA 5DEZA 1D7HA 2ZQTA 1FJDA 2DSVA 2DG3A 1YATA 2DG4A 4LAWA 1FD9A 4ZS6A 3O5IA 3TC5A 1E6RA 2LKNA 3ARRA 5BXJA 2KR7A 4DRNA 1Y0OA 3PRAA 3ALFA 4DRKA 2KO7A 2N87A 2DSZA 3FXYA 3WQVA 2M08A 4Z2LA 1E6PA 4JFIA 4QZVB 4NZCA 4P8UA 3UI5A 4DRMA 5HKGA 4L3NA 3ARPA 2VCDA 3WIJA 3RFWA 2M1IA 4IQ2A 2ZQVA 4ODMA 4MAVA 1J4RA 4ODQA 3B9DA 1ZK6A 1ZBKA 4FN2A 1VF8A 1TCOC 2WK2A 1JNSA 1FKGA 1U79A 4U85A 3WH0A 5HWCA 2PV1A 3G6MA 2OFNA 3BXWA 3WD3A 1GPFA 2ZR4A 1NSGA 2PPPA 1ZU8A 4KQZA 4WK9A 3NI6A 5DO2A 2PPNA 3WD4A 4DRJA 3AS1A 1ZBWA 1FAPA 1EDQA 5D75A 4N19A 3O5FA 1E9LA 5HUAA 3B9EA 1FKTA 1EHNA 3CGMA 1P5QA 4TYOA 4S3JA 3CHCA 3ARTA 3PR9A 1W1PA 2DSWA 4ODKA 2YBUA 1W1VA 4LGXA 1TFVA 3RM4A 2WLZA 4DRIA 1W9PA 4URIA 1FFQA 1FKLA 3ARQA 2MLZA 1EQ3A 4Z2HA 1LL7A 3O5GA 4DRHA 3CGNA 1CTNA 5DF0A 1D6OA 3KAGA 1FKBA 4TW6A 3JYJA 2XP3A 2A3CA 3CH9A 1F8AB 1BKFA 2KFWA 4JFLA 5GQBA 4WJXA 4MTVA 1FFRA 4HARA 3ARXA 4ODRA 2FKEA 4R5EA 2KI3A 1C9HA 3IK8A 1LL4A 1W26A 4DWSD 2DT0A 1HJWA 3ALGA 3CHDA 4Z2JA 2QF8A 1NMVA 2DT2A 2DT3A 4FAPA 2MPHA 1SYTA 1ZL1A 4JYSA 3TCZA 4P8XA 4DROA 2B31A 2XPAA 3O5DA 1NWTA 3ODKA 1EYMA 1E15A 2MF9A 4TW8A 4WKHA 2UZ5A 2FAPA 4LAXA 5HBFA 1A7XA 4LAYA 4DZ3A 4TNSA 3O5LA 4WKFA 4GGQA 1J4IA 4IT6A 4XAKA 3UQIA 1W1YA 1GOIA 1NWRA 1O6IA 1W9VA 4ODLA 1NH6A 1LL6A 3UF8A 1Q6IA 3UI6A 1PINA 2MNTA 4HBEA 4R0XA 3CHEA 1FKFA 1ITXA 2DG9A 2RQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKI A;  3H9R B;  3PRB A;  1FKH A;  3I6C A;  2ZQU A;  3CGM A;  4JFJ A;  4ODP A;  4QT2 A;  3RGC A;  2ZR5 A;  4JFM A;  1P5Q A;  4TYO A;  5B8I C;  3PRD A;  4DH0 A;  1Q6U A;  5DIU A;  2XP8 A;  2MLY A;  2F21 A;  1FKD A;  1JNT A;  4ODK A;  1FKR A;  2LJ4 A;  2JZV A;  3MDY B;  4BF8 A;  2KGJ A;  3JYM A;  4ITZ A;  2Y78 A;  4LAV A;  3B7X A;  3PA7 A;  3KAF A;  3TDB A;  1ZCN A;  2IF4 A;  2LGO A;  3KAD A;  4J4N A;  4MGV A;  4TX0 A;  4DRI A;  2RUC A;  5HW7 A;  1FKL A;  1QZ2 A;  2MLZ A;  2VN1 A;  1PBK A;  1KT0 A;  2XP7 A;  2ZR6 A;  3IHZ A;  3KAI A;  4G50 A;  4W9O A;  1EQ3 A;  3NRK A;  1T11 A;  3O5G A;  4DRH A;  4TW7 A;  5HTG A;  3CGN A;  3O5M A;  1HXV A;  1QPF A;  5I98 A;  4O2T A;  1F40 A;  2KE0 A;  3IKG A;  3JXV A;  1D6O A;  3KAG A;  1ROU A;  5HW6 A;  1R9H A;  4G2P A;  1BL4 A;  1FKB A;  2PPO A;  2RUD A;  3KZ7 A;  5HWB A;  2XP5 A;  3KAC A;  2XPB A;  4ODN A;  2RUQ A;  4TW6 A;  1KT1 A;  1Q1C A;  3JYJ A;  4W9Q A;  1Q6H A;  1NMW A;  2XP3 A;  2LPV A;  4IQC A;  1F8A B;  3EY6 A;  1FKK A;  3O5O A;  3KCE A;  1BKF A;  2KFW A;  2PV3 A;  4JFL A;  1D7H A;  2ZQT A;  1FJD A;  3NTP A;  2F4E A;  1FKJ A;  4ODR A;  3O5Q A;  2FKE A;  4U84 A;  2DG3 A;  1YAT A;  2DG4 A;  2KI3 A;  1C9H A;  2RSE A;  3IK8 A;  3LUO A;  4LAW A;  4DRP A;  1W26 A;  3KAH A;  5HT1 A;  2D9F A;  1FD9 A;  3UQA A;  4GIV A;  3O5I A;  3OOB A;  3VAW A;  2XP4 A;  4U86 A;  3TC5 A;  2LKN A;  2XP6 A;  4QT3 A;  3FAP A;  5HUA A;  2F2D A;  4J4O A;  4DZ2 A;  3O5R A;  1NMV A;  2ZQS A;  5BXJ A;  2AWG A;  2KR7 A;  1B6C A;  3IKD A;  1Y0O A;  3KAB A;  3O5K A;  4IPX A;  4DRQ A;  4DRN A;  4DIP A;  2M2A A;  4DRK A;  1ROT A;  4FAP A;  2KO7 A;  2N87 A;  2MPH A;  1D7I A;  1FKS A;  4JYS A;  3TCZ A;  1J6Y A;  4DRO A;  2M08 A;  4JFI A;  4DRM A;  3UI5 A;  5HKG A;  2Q5A A;  3O5J A;  2VCD A;  2XPA A;  3O5D A;  1N1A A;  3ODK A;  1EYM A;  2PV2 A;  2RUR A;  2M1I A;  2MF9 A;  4IQ2 A;  3RFW A;  4TW8 A;  1L1P A;  4C02 B;  2ZQV A;  4ODM A;  2UZ5 A;  5GPG A;  2FAP A;  4LAX A;  2PBC A;  1J4R A;  4ODQ A;  1JVW A;  1A7X A;  4LAY A;  4DZ3 A;  3O5E A;  1ZK6 A;  4TNS A;  3O5L A;  5DIV A;  4FN2 A;  4GGQ A;  4DT4 A;  2K8I A;  1M5Y A;  1J4I A;  4ODO A;  5HW8 A;  3UQI A;  1TCO C;  4MSP A;  4NNR A;  3UI4 A;  1JNS A;  1FKG A;  1U79 A;  2ITK A;  4U85 A;  3WH0 A;  5HWC A;  2PV1 A;  4QIB A;  2OFN A;  2MLX A;  2ZR4 A;  3GPK A;  1NSG A;  2PPP A;  4ODL A;  2L2S A;  3UQB A;  3NI6 A;  2PPN A;  3UF8 A;  1QPL A;  1Q6I A;  3UI6 A;  1PIN A;  2MNT A;  1D7J A;  1YW5 A;  3O5P A;  1FAP A;  4DRJ A;  2XP9 A;  4R0X A;  4W9P A;  5D75 A;  5DIT A;  4N19 A;  1FKF A;  3O5F A;  4JFK A;  2DG9 A;  5J6E A;  2RQS A;  1FKT A;  1J4H A; 
#chains in the Genus database with same CATH topology
 1FKI A;  4AY1 A;  2ZQU A;  3PRD A;  1RD6 A;  3ARS A;  4Z2G A;  1H0G A;  2XP8 A;  2MLY A;  1JNT A;  1FKR A;  2OLH A;  2LJ4 A;  3MDY B;  4BF8 A;  1HKK A;  2Y78 A;  4LAV A;  1ZBC A;  1EIB A;  3KAF A;  1ZCN A;  2LGO A;  3KAD A;  4MNM A;  4NSB A;  4TX0 A;  2A3E A;  4W5U A;  1KT0 A;  3NRK A;  4TW7 A;  5I98 A;  4O2T A;  1ZB5 A;  4S3K A;  3IKG A;  3JXV A;  1WAW A;  1ROU A;  2G41 A;  2RUD A;  2PPO A;  3KAC A;  1Q1C A;  3WL0 A;  1Q6H A;  3WD2 A;  3EIP A;  3EY6 A;  1FKK A;  3O5O A;  3G6L A;  3KCE A;  3ARW A;  2FDM A;  3CHF A;  2F4E A;  1ZBV A;  3O5Q A;  1WB0 A;  4U84 A;  1LQ0 A;  2DT1 A;  2RSE A;  2O92 A;  4DRP A;  3KAH A;  5HT1 A;  2D9F A;  4GIV A;  4U86 A;  4QT3 A;  2F2D A;  1H0I A;  4MNJ A;  2ZQS A;  2AWG A;  3IKD A;  3O5K A;  4DRQ A;  4L72 B;  4DIP A;  2M2A A;  1ROT A;  1KFW A;  1D7I A;  1JCH B;  2Q5A A;  2PV2 A;  2RUR A;  1L1P A;  2G8Z A;  2PBC A;  1X6N A;  1JVW A;  3RME A;  1LJY A;  4P8W A;  4DT4 A;  3B9A A;  3UI4 A;  1JND A;  1OGB A;  3GPK A;  2L2S A;  4Q22 A;  3AS3 A;  1QPL A;  3O5P A;  4WKA A;  3GTY X;  2XP9 A;  4ZPW R;  3CZ8 A;  4MNK A;  4JFK A;  2PN0 A;  3AS2 A;  1J4H A;  1FKH A;  1UR9 A;  3QOK A;  4JFM A;  4ZPT R;  4P8V A;  4DH0 A;  5DIU A;  1LG1 A;  1HKM A;  1FKD A;  1OGG A;  2KGJ A;  3JYM A;  2DPE A;  3TDB A;  3FY1 A;  3AS0 A;  1UR8 A;  2YBT A;  1WNO A;  2RUC A;  5HW7 A;  1QZ2 A;  2AOS A;  3OA5 A;  2VN1 A;  3ARY A;  2ZR6 A;  4G50 A;  3KAI A;  4IT4 A;  4W9O A;  1HJV A;  1T11 A;  1W9U A;  1QPF A;  2O9O A;  1E6Z A;  2KE0 A;  2EUL A;  5HW6 A;  1R9H A;  4G2P A;  3KZ7 A;  5HWB A;  3ARO A;  4ODN A;  2XPB A;  4W9Q A;  2RUQ A;  1NWU A;  1KT1 A;  2WM0 A;  1NMW A;  1SR0 A;  2LPV A;  3ARV A;  4IQC A;  2PV3 A;  1XHG A;  1XRV A;  1HKJ A;  3NTP A;  2ETN A;  1FKJ A;  3RM8 A;  4Z2K A;  3LUO A;  4WIW A;  2A3A A;  3WD1 A;  3UQA A;  3OOB A;  3VAW A;  2XP4 A;  3ARU A;  2XP6 A;  3AQU A;  3FAP A;  4J4O A;  4DZ2 A;  3O5R A;  1K9T A;  3KAB A;  4IPX A;  1B6C A;  2A3B A;  2ESC A;  1E44 A;  1FKS A;  4HBO A;  1NWS A;  3RM9 A;  1J6Y A;  3O5J A;  4DWS A;  1N1A A;  1LG2 A;  4C02 B;  5GPG A;  2F23 A;  1JNE A;  4ZPV R;  3O5E A;  5DIV A;  2K8I A;  1M5Y A;  5HW8 A;  4ODO A;  4MSP A;  4NNR A;  3WL1 A;  3WQW A;  2ITK A;  3WKZ A;  4QIB A;  2MLX A;  4ML4 A;  3B8S A;  3UQB A;  1HJX A;  5JH8 A;  4KR0 B;  2WLY A;  1D7J A;  1YW5 A;  2DSU A;  4W9P A;  1X6L A;  5DIT A;  5J6E A;  3H9R B;  3PRB A;  3I6C A;  1OWQ A;  1D2K A;  4JFJ A;  4ODP A;  4QT2 A;  3ARZ A;  3RGC A;  2ZR5 A;  5B8I C;  1Q6U A;  2PI6 A;  1GUV A;  2F21 A;  2IUZ A;  4Q7N A;  2JZV A;  4DWS B;  4PTM A;  4ITZ A;  1W1T A;  3B7X A;  3PA7 A;  4MGV A;  2IF4 A;  4J4N A;  4DWS C;  3W4R A;  1PBK A;  3WD0 A;  2XP7 A;  3IHZ A;  2P4V A;  1HKI A;  3BMB A;  5HTG A;  3O5M A;  1HXV A;  1E6N A;  4MNL A;  1F40 A;  1IX5 A;  5GPR A;  1BL4 A;  2XP5 A;  4MPK A;  4Z2I A;  5DEZ A;  1D7H A;  2ZQT A;  1FJD A;  2DSV A;  2DG3 A;  1YAT A;  2DG4 A;  4LAW A;  1FD9 A;  4ZS6 A;  3O5I A;  3TC5 A;  1E6R A;  2LKN A;  3ARR A;  5BXJ A;  2KR7 A;  4DRN A;  1Y0O A;  3PRA A;  3ALF A;  4DRK A;  2KO7 A;  2N87 A;  2DSZ A;  3FXY A;  3GU0 A;  3WQV A;  2M08 A;  4Z2L A;  1E6P A;  4JFI A;  4QZV B;  4NZC A;  4P8U A;  3UI5 A;  4DRM A;  5HKG A;  4L3N A;  3ARP A;  2VCD A;  3WIJ A;  3RFW A;  2M1I A;  4IQ2 A;  2ZQV A;  4ODM A;  4MAV A;  1J4R A;  4ODQ A;  3B9D A;  1ZK6 A;  1ZBK A;  4FN2 A;  1VF8 A;  1TCO C;  2WK2 A;  1JNS A;  1FKG A;  1U79 A;  4U85 A;  3WH0 A;  5HWC A;  2PV1 A;  3G6M A;  2OFN A;  3BXW A;  3WD3 A;  1GPF A;  2ZR4 A;  1NSG A;  2PPP A;  1ZU8 A;  4KQZ A;  4WK9 A;  3NI6 A;  5DO2 A;  2PPN A;  3WD4 A;  4DRJ A;  3AS1 A;  1ZBW A;  1FAP A;  1EDQ A;  5D75 A;  4N19 A;  3O5F A;  1E9L A;  5HUA A;  3B9E A;  1FKT A;  1EHN A;  3CGM A;  1P5Q A;  4TYO A;  4S3J A;  3CHC A;  3ART A;  3PR9 A;  1W1P A;  2DSW A;  4ODK A;  2YBU A;  1W1V A;  4LGX A;  1TFV A;  3RM4 A;  2WLZ A;  4DRI A;  1W9P A;  4URI A;  1FFQ A;  1FKL A;  3ARQ A;  2MLZ A;  1EQ3 A;  4Z2H A;  1LL7 A;  2B5U B;  3O5G A;  4DRH A;  3CGN A;  1CTN A;  5DF0 A;  1D6O A;  3KAG A;  1FKB A;  4TW6 A;  3JYJ A;  2XP3 A;  2A3C A;  3CH9 A;  1F8A B;  1BKF A;  2KFW A;  4JFL A;  5GQB A;  4WJX A;  4MTV A;  1FFR A;  4HAR A;  3ARX A;  4ODR A;  2FKE A;  4R5E A;  2KI3 A;  1C9H A;  3IK8 A;  1LL4 A;  1W26 A;  4DWS D;  2DT0 A;  1HJW A;  3ALG A;  3CHD A;  4Z2J A;  2QF8 A;  1NMV A;  2DT2 A;  2DT3 A;  4FAP A;  2MPH A;  1SYT A;  1ZL1 A;  4JYS A;  3TCZ A;  4P8X A;  4DRO A;  2B31 A;  2XPA A;  3O5D A;  1NWT A;  3ODK A;  1EYM A;  1E15 A;  2MF9 A;  4TW8 A;  4WKH A;  2UZ5 A;  2FAP A;  4LAX A;  5HBF A;  1A7X A;  4LAY A;  4DZ3 A;  4TNS A;  3O5L A;  4WKF A;  4GGQ A;  1J4I A;  4IT6 A;  4XAK A;  3UQI A;  1W1Y A;  1GOI A;  1NWR A;  1O6I A;  1W9V A;  4ODL A;  1NH6 A;  4UDM A;  1LL6 A;  3UF8 A;  1Q6I A;  3UI6 A;  1PIN A;  2MNT A;  4HBE A;  4R0X A;  3CHE A;  1FKF A;  1GRJ A;  1ITX A;  2DG9 A;  2RQS A; 
#chains in the Genus database with same CATH homology
 1FKI A;  4AY1 A;  2ZQU A;  3PRD A;  1RD6 A;  3ARS A;  4Z2G A;  1H0G A;  2XP8 A;  2MLY A;  1JNT A;  1FKR A;  2OLH A;  2LJ4 A;  3MDY B;  4BF8 A;  1HKK A;  2Y78 A;  4LAV A;  1ZBC A;  1EIB A;  3KAF A;  1ZCN A;  2LGO A;  3KAD A;  4MNM A;  4NSB A;  4TX0 A;  2A3E A;  4W5U A;  1KT0 A;  3NRK A;  4TW7 A;  5I98 A;  4O2T A;  1ZB5 A;  4S3K A;  3IKG A;  3JXV A;  1WAW A;  1ROU A;  2G41 A;  2RUD A;  2PPO A;  3KAC A;  1Q1C A;  3WL0 A;  1Q6H A;  3WD2 A;  3EY6 A;  1FKK A;  3O5O A;  3G6L A;  3KCE A;  3ARW A;  2FDM A;  3CHF A;  2F4E A;  1ZBV A;  1WB0 A;  3O5Q A;  4U84 A;  1LQ0 A;  2DT1 A;  2RSE A;  2O92 A;  4DRP A;  3KAH A;  5HT1 A;  2D9F A;  4GIV A;  4U86 A;  4QT3 A;  2F2D A;  1H0I A;  4MNJ A;  2ZQS A;  2AWG A;  3IKD A;  3O5K A;  4DRQ A;  4L72 B;  4DIP A;  2M2A A;  1ROT A;  1KFW A;  1D7I A;  2Q5A A;  2PV2 A;  2RUR A;  1L1P A;  2G8Z A;  2PBC A;  1X6N A;  1JVW A;  3RME A;  1LJY A;  4P8W A;  4DT4 A;  3B9A A;  3UI4 A;  1JND A;  1OGB A;  3GPK A;  2L2S A;  4Q22 A;  3AS3 A;  1QPL A;  3O5P A;  4WKA A;  2XP9 A;  4ZPW R;  3CZ8 A;  4MNK A;  4JFK A;  3AS2 A;  1J4H A;  1FKH A;  1UR9 A;  3QOK A;  4JFM A;  4ZPT R;  4P8V A;  4DH0 A;  5DIU A;  1LG1 A;  1HKM A;  1FKD A;  1OGG A;  2KGJ A;  3JYM A;  2DPE A;  3TDB A;  3FY1 A;  3AS0 A;  1UR8 A;  2YBT A;  1WNO A;  2RUC A;  5HW7 A;  1QZ2 A;  2AOS A;  3OA5 A;  2VN1 A;  3ARY A;  2ZR6 A;  4G50 A;  3KAI A;  4IT4 A;  4W9O A;  1HJV A;  1T11 A;  1W9U A;  1QPF A;  2O9O A;  1E6Z A;  2KE0 A;  5HW6 A;  1R9H A;  4G2P A;  3KZ7 A;  5HWB A;  3ARO A;  4ODN A;  2XPB A;  4W9Q A;  2RUQ A;  1NWU A;  1KT1 A;  2WM0 A;  1NMW A;  1SR0 A;  2LPV A;  4IQC A;  3ARV A;  2PV3 A;  1XHG A;  1XRV A;  1HKJ A;  3NTP A;  3RM8 A;  1FKJ A;  4Z2K A;  3LUO A;  4WIW A;  2A3A A;  3WD1 A;  3UQA A;  3OOB A;  3VAW A;  2XP4 A;  3ARU A;  2XP6 A;  3AQU A;  3FAP A;  4J4O A;  4DZ2 A;  3O5R A;  1K9T A;  3KAB A;  4IPX A;  1B6C A;  2A3B A;  2ESC A;  1FKS A;  4HBO A;  1NWS A;  3RM9 A;  1J6Y A;  3O5J A;  4DWS A;  1N1A A;  1LG2 A;  4C02 B;  5GPG A;  1JNE A;  4ZPV R;  3O5E A;  5DIV A;  2K8I A;  1M5Y A;  5HW8 A;  4ODO A;  4MSP A;  4NNR A;  3WL1 A;  3WQW A;  2ITK A;  3WKZ A;  4QIB A;  2MLX A;  4ML4 A;  3B8S A;  3UQB A;  1HJX A;  5JH8 A;  4KR0 B;  2WLY A;  1D7J A;  1YW5 A;  2DSU A;  4W9P A;  1X6L A;  5DIT A;  5J6E A;  3H9R B;  3PRB A;  3I6C A;  1OWQ A;  1D2K A;  4JFJ A;  4ODP A;  4QT2 A;  3ARZ A;  3RGC A;  2ZR5 A;  5B8I C;  1Q6U A;  2PI6 A;  1GUV A;  2F21 A;  2IUZ A;  4Q7N A;  2JZV A;  4DWS B;  4PTM A;  4ITZ A;  1W1T A;  3B7X A;  3PA7 A;  4MGV A;  2IF4 A;  4J4N A;  4DWS C;  3W4R A;  1PBK A;  3WD0 A;  2XP7 A;  3IHZ A;  1HKI A;  5HTG A;  3O5M A;  1HXV A;  1E6N A;  4MNL A;  1F40 A;  1IX5 A;  5GPR A;  1BL4 A;  2XP5 A;  4MPK A;  4Z2I A;  5DEZ A;  1D7H A;  2ZQT A;  1FJD A;  2DSV A;  2DG3 A;  1YAT A;  2DG4 A;  4LAW A;  1FD9 A;  4ZS6 A;  3O5I A;  3TC5 A;  1E6R A;  2LKN A;  3ARR A;  5BXJ A;  2KR7 A;  4DRN A;  1Y0O A;  3PRA A;  3ALF A;  4DRK A;  2KO7 A;  2N87 A;  2DSZ A;  3FXY A;  3WQV A;  2M08 A;  4Z2L A;  1E6P A;  4JFI A;  4QZV B;  4NZC A;  4P8U A;  3UI5 A;  4DRM A;  5HKG A;  4L3N A;  3ARP A;  2VCD A;  3WIJ A;  3RFW A;  2M1I A;  4IQ2 A;  2ZQV A;  4ODM A;  4MAV A;  1J4R A;  4ODQ A;  3B9D A;  1ZK6 A;  1ZBK A;  4FN2 A;  1VF8 A;  1TCO C;  2WK2 A;  1JNS A;  1FKG A;  1U79 A;  4U85 A;  3WH0 A;  5HWC A;  2PV1 A;  3G6M A;  2OFN A;  3BXW A;  3WD3 A;  1GPF A;  2ZR4 A;  1NSG A;  2PPP A;  1ZU8 A;  4KQZ A;  4WK9 A;  3NI6 A;  5DO2 A;  2PPN A;  3WD4 A;  4DRJ A;  3AS1 A;  1ZBW A;  1FAP A;  1EDQ A;  5D75 A;  4N19 A;  3O5F A;  1E9L A;  5HUA A;  3B9E A;  1FKT A;  1EHN A;  3CGM A;  1P5Q A;  4TYO A;  4S3J A;  3CHC A;  3ART A;  3PR9 A;  1W1P A;  2DSW A;  4ODK A;  2YBU A;  1W1V A;  4LGX A;  1TFV A;  3RM4 A;  2WLZ A;  4DRI A;  1W9P A;  4URI A;  1FFQ A;  1FKL A;  3ARQ A;  2MLZ A;  1EQ3 A;  4Z2H A;  1LL7 A;  3O5G A;  4DRH A;  3CGN A;  1CTN A;  5DF0 A;  1D6O A;  3KAG A;  1FKB A;  4TW6 A;  3JYJ A;  2XP3 A;  2A3C A;  3CH9 A;  1F8A B;  1BKF A;  2KFW A;  4JFL A;  5GQB A;  4WJX A;  4MTV A;  1FFR A;  4HAR A;  3ARX A;  4ODR A;  2FKE A;  4R5E A;  2KI3 A;  1C9H A;  3IK8 A;  1LL4 A;  1W26 A;  4DWS D;  2DT0 A;  1HJW A;  3ALG A;  3CHD A;  4Z2J A;  2QF8 A;  1NMV A;  2DT2 A;  2DT3 A;  4FAP A;  2MPH A;  1SYT A;  1ZL1 A;  4JYS A;  3TCZ A;  4P8X A;  4DRO A;  2B31 A;  2XPA A;  3O5D A;  1NWT A;  3ODK A;  1EYM A;  1E15 A;  2MF9 A;  4TW8 A;  4WKH A;  2UZ5 A;  2FAP A;  4LAX A;  5HBF A;  1A7X A;  4LAY A;  4DZ3 A;  4TNS A;  3O5L A;  4WKF A;  4GGQ A;  1J4I A;  4IT6 A;  4XAK A;  3UQI A;  1W1Y A;  1GOI A;  1NWR A;  1O6I A;  1W9V A;  4ODL A;  1NH6 A;  1LL6 A;  3UF8 A;  1Q6I A;  3UI6 A;  1PIN A;  2MNT A;  4HBE A;  4R0X A;  3CHE A;  1FKF A;  1ITX A;  2DG9 A;  2RQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...