4DRIA

Co-crystal structure of the ppiase domain of fkbp51, rapamycin and the frb fragment of mtor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
121
structure length
121
Chain Sequence
EQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 121
sequence length 121
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4driA00
3FAPA 1FAPA 2LGOA 4IQ2A 2KFWA 1B6CA 3KAHA 1NMVA 4LAYA 2MLXA 2RUCA 3O5PA 4LAWA 5B8IC 1A7XA 3O5RA 4W9PA 3KABA 3NRKA 4QT2A 1NMWA 3O5FA 4ODOA 4W9QA 1F40A 3UQIA 1JNTA 3EY6A 2MPHA 4TX0A 1BL4A 1J4IA 3I6CA 3O5IA 2ZQVA 2FAPA 2DG3A 4U86A 1EQ3A 4DZ3A 1FKBA 3GPKA 4FAPA 1P5QA 1KT0A 1D6OA 2K8IA 2PPOA 2PV1A 3O5KA 4J4NA 4LAXA 4ODPA 4ODKA 4NNRA 1QPFA 2PV3A 5J6EA 5DIUA 4W9OA 1Q1CA 4GIVA 1FKLA 1EYMA 1ROUA 2DG9A 4DRNA 2XP4A 3KACA 2ZQTA 3IK8A 3O5LA 3UI5A 3KAGA 3ODKA 1J6YA 1JVWA 1J4HA 4N19A 1C9HA 2ZQUA 3IKDA 1KT1A 1D7IA 4J4OA 4U84A 5HW6A 3JXVA 1FD9A 4DRMA 3RFWA 3UQAA 4TW6A 4DRQA 4ODRA 2PPNA 1JNSA 2M08A 4DRJA 4FN2A 2ZR5A 3PRBA 1FKGA 2MLZA 3UQBA 1BKFA 3CGNA 3KZ7A 1FKKA 5HW7A 2F2DA 4GGQA 4JFLA 2F21A 1FKJA 1ROTA 1Y0OA 1YW5A 2VCDA 4ODNA 5HKGA 4BF8A 2PBCA 4JFIA 4MGVA 4TNSA 1Q6UA 3UF8A 3PA7A 2UZ5A 3O5MA 2XP3A 2ZR6A 4G50A 4DH0A 2VN1A 4DRHA 4C02B 4U85A 1FKFA 2JZVA 3B7XA 1FKHA 3IHZA 4G2PA 2F4EA 2M1IA 4DT4A 1R9HA 2XP9A 3RGCA 4ODQA 3JYMA 5BXJA 4DZ2A 4O2TA 1TCOC 4DRPA 2KE0A 4TYOA 2KGJA 1FKIA 5HTGA 4DRIA 1W26A 2OFNA 3NI6A 3VAWA 1FKRA 1T11A 3O5EA 4ITZA 2RQSA 1M5YA 3OOBA 5HUAA 3H9RB 3MDYB 1QPLA 2MNTA 2RUDA 2XP7A 1J4RA 4R0XA 3O5QA 4IQCA 2PPPA 2XP8A 5I98A 4ODMA 2FKEA 1FKTA 5GPGA 3LUOA 5HT1A 1FJDA 4LAVA 2KR7A 3O5OA 2Y78A 4DROA 3O5GA 3UI6A 2XP5A 1Q6HA 4TW8A 3WH0A 3TC5A 5D75A 2LJ4A 1FKSA 2ZQSA 4JFMA 2D9FA 2L2SA 4DIPA 2RUQA 4ODLA 2XPAA 2KO7A 2PV2A 1QZ2A 3TCZA 4JYSA 3KAIA 1Q6IA 2M2AA 5HWCA 1ZCNA 1ZK6A 1NSGA 2KI3A 2IF4A 1YATA 2ZR4A 3JYJA 3CGMA 4JFKA 5HW8A 5HWBA 4QIBA 2AWGA 2XPBA 3NTPA 3TDBA 4JFJA 2N87A 1L1PA 1N1AA 1PINA 4IPXA 4DRKA 2RURA 3KADA 2XP6A 4TW7A 3PRDA 1U79A 1D7JA 1FKDA 2LKNA 1D7HA 3O5DA 3IKGA 4MSPA 2LPVA 2Q5AA 2DG4A 2MLYA 2RSEA 3KCEA 5DITA 3UI4A 1HXVA 1PBKA 3KAFA 3O5JA 5DIVA 2MF9A 1F8AB 2ITKA 4QT3A
chains in the Genus database with same CATH superfamily
1CTNA 2LGOA 4IQ2A 4R5EA 3GTYX 3O5RA 1ZBVA 3KABA 3NRKA 4Z2IA 1NMWA 4URIA 4W9QA 1JNTA 2WLYA 3I6CA 1X6NA 1IX5A 3GPKA 4ODPA 1XHGA 1QPFA 2DT2A 4W9OA 1ROUA 1O6IA 3WQWA 2ZQTA 3ODKA 1J4HA 4WKFA 3IKDA 5JH8A 1ZB5A 1JNSA 2M08A 1NWSA 4FN2A 3PRBA 1FKGA 3B8SA 3AS1A 4L3NA 1HKIA 5HW7A 1W9VA 3WL1A 1UR9A 1FKJA 4BF8A 4JFIA 4MGVA 4TNSA 4G50A 2JZVA 1HKJA 3B7XA 3IHZA 1OGGA 2XP9A 1OGBA 3RGCA 1LG1A 2DT3A 1EHNA 4DWSC 1TCOC 4DRPA 2KE0A 4TYOA 1FKIA 4KQZA 2WLZA 1EIBA 2OFNA 5DEZA 3OOBA 1QPLA 1W1VA 2MNTA 2RUDA 2PN0A 3O5QA 4IQCA 3WQVA 4MNLA 4ODMA 3B9EA 2PI6A 2DT1A 4ZPWR 5HT1A 2A3EA 2KR7A 3WH0A 3TC5A 4DIPA 2RUQA 2XPAA 1QZ2A 4JYSA 1WNOA 1Q6IA 3WD4A 1E6PA 1ZK6A 2IF4A 4WIWA 2AWGA 2XPBA 4JFJA 3CZ8A 3ALFA 2N87A 1L1PA 1KFWA 3FXYA 1U79A 3G6LA 3UI4A 1HXVA 1ITXA 2MF9A 2ITKA 4HARA 4QT3A 1FAPA 4AY1A 4WKAA 1ZBKA 2P4VA 2RUCA 1A7XA 1WB0A 2O92A 4S3KA 4W9PA 5HBFA 4Z2GA 3EY6A 2MPHA 1J4IA 2B31A 2FAPA 1FKBA 3WD2A 4LAXA 1D6OA 2IUZA 3ARZA 3O5KA 5J6EA 1Q1CA 1FKLA 4IT6A 3KACA 3O5LA 1J6YA 3AS0A 1JVWA 4N19A 1KT1A 4U84A 5HW6A 3JXVA 1GPFA 5DO2A 3UQAA 4DRJA 4Q22A 1FFRA 2ETNA 3UQBA 1SR0A 3CGNA 1FKKA 1ZU8A 4Z2KA 1GUVA 2F21A 1ROTA 5HKGA 2PBCA 1D2KA 3RM8A 1Q6UA 3PA7A 3BMBA 2WM0A 2ZR6A 3ARWA 2VN1A 4DRHA 2YBTA 1LQ0A 5DF0A 1FKHA 4MPKA 3CHFA 1NWUA 3ARYA 3EIPA 1RD6A 1ZBWA 1W26A 1EDQA 3VAWA 2RQSA 1M5YA 4Z2JA 5HUAA 2DPEA 1J4RA 4R0XA 4NZCA 2DSWA 3AS2A 1W1TA 4LAVA 3O5GA 3ARSA 3UI6A 2G41A 1FKSA 2ZQSA 2L2SA 3AQUA 2PV2A 4W5UA 1H0IA 3CHCA 1NSGA 3WIJA 4P8XA 2ZR4A 5HWBA 4QIBA 3TDBA 3PR9A 1PINA 4IPXA 3RM9A 1JCHB 4MSPA 4Z2LA 2Q5AA 2MLYA 3KCEA 1FFQA 3O5JA 3CH9A 1XRVA 1F8AB 4Q7NA 5DIVA 3FAPA 1B6CA 3KAHA 4LAYA 1OWQA 2MLXA 4LAWA 3GU0A 4HBOA 4QZVB 3O5FA 4ODOA 4TX0A 1BL4A 3O5IA 1EQ3A 2ZQVA 2DG3A 1LL4A 1K9TA 1KT0A 2PPOA 4J4NA 1W9PA 1HJVA 4ODKA 3WD1A 4DWSB 1X6LA 4GIVA 4DRNA 3IK8A 4MNJA 3UI5A 4WKHA 1VF8A 1C9HA 2ZQUA 3RFWA 2DSZA 4DRQA 4ODRA 2PPNA 2QF8A 1E44A 4P8VA 3WKZA 3ARQA 1LJYA 1BKFA 2AOSA 2F2DA 1HKMA 4GGQA 4JFLA 1Y0OA 2VCDA 2ESCA 3UF8A 3O5MA 2XP3A 3W4RA 4C02B 1ZBCA 4XAKA 2F23A 2F4EA 3ARVA 2M1IA 4DT4A 1R9HA 4HBEA 3JYMA 5BXJA 2WK2A 1JNEA 3NI6A 5GPRA 3CHEA 1FKRA 1T11A 1LG2A 1TFVA 3H9RB 3MDYB 2XP7A 5I98A 4KR0B 2FKEA 1FKTA 4MAVA 5GPGA 3WL0A 2B5UB 3RM4A 3O5OA 4TW8A 4JFMA 3PRAA 4MNMA 4ODLA 1GRJA 2G8ZA 1E9LA 3TCZA 3ARXA 2A3AA 4DWSD 4L72B 2DSVA 2KI3A 1YATA 2EULA 3JYJA 3CGMA 3CHDA 4JFKA 4UDMA 1N1AA 1WAWA 2RURA 3KADA 1D7JA 1FKDA 2LKNA 1D7HA 3O5DA 4ML4A 3BXWA 2LPVA 2RSEA 2DG4A 3ALGA 5DITA 1JNDA 1PBKA 1GOIA 1SYTA 1NH6A 4WK9A 2KFWA 4P8UA 1NMVA 3O5PA 5B8IC 3FY1A 2OLHA 3AS3A 1NWRA 3ARTA 4QT2A 3UQIA 4ZPVR 1UR8A 4U86A 1HJWA 2DT0A 3ARUA 4DZ3A 4FAPA 1P5QA 2K8IA 2PV1A 4NNRA 2PV3A 4PTMA 2DSUA 5DIUA 1EYMA 3WD3A 2DG9A 4NSBA 4IT4A 2XP4A 3KAGA 2A3CA 1W1PA 4J4OA 1D7IA 1FD9A 4DRMA 1E15A 4TW6A 4WJXA 4ZS6A 1NWTA 2ZR5A 2MLZA 3KZ7A 1E6NA 1HKKA 3B9AA 1YW5A 4ODNA 1H0GA 1LL6A 2UZ5A 4DH0A 3AROA 4U85A 1W1YA 1FKFA 4G2PA 3G6MA 3ARPA 4ODQA 1ZL1A 4DZ2A 4O2TA 3B9DA 2KGJA 5HTGA 4DRIA 1E6ZA 2YBUA 3O5EA 4DWSA 4ITZA 2FDMA 2A3BA 4S3JA 2PPPA 2XP8A 3LUOA 3WD0A 1FJDA 2O9OA 4DROA 2Y78A 2XP5A 1Q6HA 3ARRA 5D75A 4Z2HA 2LJ4A 1LL7A 2D9FA 4MTVA 2KO7A 3KAIA 2M2AA 5HWCA 1ZCNA 3QOKA 5HW8A 5GQBA 4LGXA 3NTPA 1W9UA 1E6RA 4DRKA 3OA5A 2XP6A 4P8WA 4TW7A 3PRDA 4ZPTR 1HJXA 3IKGA 3RMEA 3KAFA 4MNKA 1F40A
chains in the Genus database with same CATH topology
1CTNA 2LGOA 4IQ2A 4R5EA 3O5RA 1ZBVA 3KABA 3NRKA 4Z2IA 1NMWA 4URIA 4W9QA 1JNTA 2WLYA 3I6CA 1X6NA 1IX5A 3GPKA 4ODPA 1XHGA 1QPFA 2DT2A 4W9OA 1ROUA 1O6IA 3WQWA 2ZQTA 3ODKA 1J4HA 4WKFA 3IKDA 5JH8A 1ZB5A 1JNSA 2M08A 1NWSA 4FN2A 3PRBA 1FKGA 3B8SA 3AS1A 4L3NA 1HKIA 5HW7A 1W9VA 3WL1A 1UR9A 1FKJA 4BF8A 4JFIA 4MGVA 4TNSA 4G50A 2JZVA 1HKJA 3B7XA 3IHZA 1OGGA 2XP9A 1OGBA 3RGCA 1LG1A 2DT3A 1EHNA 4DWSC 1TCOC 4DRPA 2KE0A 4TYOA 1FKIA 4KQZA 2WLZA 1EIBA 2OFNA 5DEZA 3OOBA 1QPLA 1W1VA 2MNTA 2RUDA 3O5QA 4IQCA 3WQVA 4MNLA 4ODMA 3B9EA 2PI6A 2DT1A 4ZPWR 5HT1A 2A3EA 2KR7A 3WH0A 3TC5A 4DIPA 2RUQA 2XPAA 1QZ2A 4JYSA 1WNOA 1Q6IA 3WD4A 1E6PA 1ZK6A 2IF4A 4WIWA 2AWGA 2XPBA 4JFJA 3CZ8A 3ALFA 2N87A 1L1PA 1KFWA 3FXYA 1U79A 3G6LA 3UI4A 1HXVA 1ITXA 2MF9A 2ITKA 4HARA 4QT3A 1FAPA 4AY1A 4WKAA 1ZBKA 2RUCA 1A7XA 1WB0A 2O92A 4S3KA 4W9PA 5HBFA 4Z2GA 3EY6A 2MPHA 1J4IA 2B31A 2FAPA 1FKBA 3WD2A 4LAXA 1D6OA 2IUZA 3ARZA 3O5KA 5J6EA 1Q1CA 1FKLA 4IT6A 3KACA 3O5LA 1J6YA 3AS0A 1JVWA 4N19A 1KT1A 4U84A 5HW6A 3JXVA 1GPFA 5DO2A 3UQAA 4DRJA 4Q22A 1FFRA 3UQBA 1SR0A 3CGNA 1FKKA 1ZU8A 4Z2KA 1GUVA 2F21A 1ROTA 5HKGA 2PBCA 1D2KA 3RM8A 1Q6UA 3PA7A 2WM0A 2ZR6A 3ARWA 2VN1A 4DRHA 2YBTA 1LQ0A 5DF0A 1FKHA 4MPKA 3CHFA 1NWUA 3ARYA 1RD6A 1ZBWA 1W26A 1EDQA 3VAWA 2RQSA 1M5YA 4Z2JA 5HUAA 2DPEA 1J4RA 4R0XA 4NZCA 2DSWA 3AS2A 1W1TA 4LAVA 3O5GA 3ARSA 3UI6A 2G41A 1FKSA 2ZQSA 2L2SA 3AQUA 2PV2A 4W5UA 1H0IA 3CHCA 1NSGA 3WIJA 4P8XA 2ZR4A 5HWBA 4QIBA 3TDBA 3PR9A 1PINA 4IPXA 3RM9A 4MSPA 4Z2LA 2Q5AA 2MLYA 3KCEA 1FFQA 3O5JA 3CH9A 1XRVA 1F8AB 4Q7NA 5DIVA 3FAPA 1B6CA 3KAHA 4LAYA 1OWQA 2MLXA 4LAWA 4HBOA 4QZVB 3O5FA 4ODOA 4TX0A 1BL4A 3O5IA 1EQ3A 2ZQVA 2DG3A 1LL4A 1K9TA 1KT0A 2PPOA 4J4NA 1W9PA 1HJVA 4ODKA 3WD1A 4DWSB 1X6LA 4GIVA 4DRNA 3IK8A 4MNJA 3UI5A 4WKHA 1VF8A 1C9HA 2ZQUA 3RFWA 2DSZA 4DRQA 4ODRA 2PPNA 2QF8A 4P8VA 3WKZA 3ARQA 1LJYA 1BKFA 2AOSA 2F2DA 1HKMA 4GGQA 4JFLA 1Y0OA 2VCDA 2ESCA 3UF8A 3O5MA 2XP3A 3W4RA 4C02B 1ZBCA 4XAKA 2F4EA 3ARVA 2M1IA 4DT4A 1R9HA 4HBEA 3JYMA 5BXJA 2WK2A 1JNEA 3NI6A 5GPRA 3CHEA 1FKRA 1T11A 1LG2A 1TFVA 3H9RB 3MDYB 2XP7A 5I98A 4KR0B 2FKEA 1FKTA 4MAVA 5GPGA 3WL0A 3RM4A 3O5OA 4TW8A 4JFMA 3PRAA 4MNMA 4ODLA 2G8ZA 3TCZA 1E9LA 3ARXA 2A3AA 4DWSD 4L72B 2DSVA 2KI3A 1YATA 4JFKA 3JYJA 3CGMA 3CHDA 1N1AA 1WAWA 2RURA 3KADA 1D7JA 1FKDA 2LKNA 1D7HA 3O5DA 4ML4A 3BXWA 2LPVA 2RSEA 2DG4A 3ALGA 5DITA 1JNDA 1PBKA 1GOIA 1SYTA 1NH6A 4WK9A 2KFWA 4P8UA 1NMVA 3O5PA 5B8IC 3FY1A 2OLHA 3AS3A 1NWRA 3ARTA 4QT2A 3UQIA 4ZPVR 1UR8A 4U86A 1HJWA 2DT0A 3ARUA 4DZ3A 4FAPA 1P5QA 2K8IA 2PV1A 4NNRA 2PV3A 4PTMA 2DSUA 5DIUA 1EYMA 3WD3A 2DG9A 4NSBA 4IT4A 2XP4A 3KAGA 2A3CA 1W1PA 4J4OA 1D7IA 1FD9A 4DRMA 1E15A 4TW6A 4WJXA 4ZS6A 1NWTA 2ZR5A 2MLZA 3KZ7A 1E6NA 1HKKA 3B9AA 1YW5A 4ODNA 1H0GA 1LL6A 2UZ5A 4DH0A 3AROA 4U85A 1W1YA 1FKFA 4G2PA 3G6MA 3ARPA 4ODQA 1ZL1A 4DZ2A 4O2TA 3B9DA 2KGJA 5HTGA 4DRIA 1E6ZA 2YBUA 3O5EA 4DWSA 4ITZA 2FDMA 2A3BA 4S3JA 2PPPA 2XP8A 3LUOA 3WD0A 1FJDA 2O9OA 4DROA 2Y78A 2XP5A 1Q6HA 3ARRA 5D75A 4Z2HA 2LJ4A 1LL7A 2D9FA 4MTVA 2KO7A 3KAIA 2M2AA 5HWCA 1ZCNA 3QOKA 5HW8A 5GQBA 4LGXA 3NTPA 1W9UA 1E6RA 4DRKA 3OA5A 2XP6A 4P8WA 4TW7A 3PRDA 4ZPTR 1HJXA 3IKGA 3RMEA 3KAFA 4MNKA 1F40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAP A;  1FAP A;  2LGO A;  4IQ2 A;  2KFW A;  1B6C A;  3KAH A;  1NMV A;  4LAY A;  2MLX A;  2RUC A;  3O5P A;  4LAW A;  5B8I C;  1A7X A;  3O5R A;  4W9P A;  3KAB A;  3NRK A;  4QT2 A;  1NMW A;  3O5F A;  4ODO A;  4W9Q A;  1F40 A;  3UQI A;  1JNT A;  3EY6 A;  2MPH A;  4TX0 A;  1BL4 A;  1J4I A;  3I6C A;  3O5I A;  2ZQV A;  2FAP A;  2DG3 A;  4U86 A;  1EQ3 A;  4DZ3 A;  1FKB A;  3GPK A;  4FAP A;  1P5Q A;  1KT0 A;  1D6O A;  2K8I A;  2PPO A;  2PV1 A;  3O5K A;  4J4N A;  4LAX A;  4ODP A;  4ODK A;  4NNR A;  1QPF A;  2PV3 A;  5J6E A;  5DIU A;  4W9O A;  1Q1C A;  4GIV A;  1FKL A;  1EYM A;  1ROU A;  2DG9 A;  4DRN A;  2XP4 A;  3KAC A;  2ZQT A;  3IK8 A;  3O5L A;  3UI5 A;  3KAG A;  3ODK A;  1J6Y A;  1JVW A;  1J4H A;  4N19 A;  1C9H A;  2ZQU A;  3IKD A;  1KT1 A;  1D7I A;  4J4O A;  4U84 A;  5HW6 A;  3JXV A;  1FD9 A;  4DRM A;  3RFW A;  3UQA A;  4TW6 A;  4DRQ A;  4ODR A;  2PPN A;  1JNS A;  2M08 A;  4DRJ A;  4FN2 A;  2ZR5 A;  3PRB A;  1FKG A;  2MLZ A;  3UQB A;  1BKF A;  3CGN A;  3KZ7 A;  1FKK A;  5HW7 A;  2F2D A;  4GGQ A;  4JFL A;  2F21 A;  1FKJ A;  1ROT A;  1Y0O A;  1YW5 A;  2VCD A;  4ODN A;  5HKG A;  4BF8 A;  2PBC A;  4JFI A;  4MGV A;  4TNS A;  1Q6U A;  3UF8 A;  3PA7 A;  2UZ5 A;  3O5M A;  2XP3 A;  2ZR6 A;  4G50 A;  4DH0 A;  2VN1 A;  4DRH A;  4C02 B;  4U85 A;  1FKF A;  2JZV A;  3B7X A;  1FKH A;  3IHZ A;  4G2P A;  2F4E A;  2M1I A;  4DT4 A;  1R9H A;  2XP9 A;  3RGC A;  4ODQ A;  3JYM A;  5BXJ A;  4DZ2 A;  4O2T A;  1TCO C;  4DRP A;  2KE0 A;  4TYO A;  2KGJ A;  1FKI A;  5HTG A;  4DRI A;  1W26 A;  2OFN A;  3NI6 A;  3VAW A;  1FKR A;  1T11 A;  3O5E A;  4ITZ A;  2RQS A;  1M5Y A;  3OOB A;  5HUA A;  3H9R B;  3MDY B;  1QPL A;  2MNT A;  2RUD A;  2XP7 A;  1J4R A;  4R0X A;  3O5Q A;  4IQC A;  2PPP A;  2XP8 A;  5I98 A;  4ODM A;  2FKE A;  1FKT A;  5GPG A;  3LUO A;  5HT1 A;  1FJD A;  4LAV A;  2KR7 A;  3O5O A;  2Y78 A;  4DRO A;  3O5G A;  3UI6 A;  2XP5 A;  1Q6H A;  4TW8 A;  3WH0 A;  3TC5 A;  5D75 A;  2LJ4 A;  1FKS A;  2ZQS A;  4JFM A;  2D9F A;  2L2S A;  4DIP A;  2RUQ A;  4ODL A;  2XPA A;  2KO7 A;  2PV2 A;  1QZ2 A;  3TCZ A;  4JYS A;  3KAI A;  1Q6I A;  2M2A A;  5HWC A;  1ZCN A;  1ZK6 A;  1NSG A;  2KI3 A;  2IF4 A;  1YAT A;  2ZR4 A;  3JYJ A;  3CGM A;  4JFK A;  5HW8 A;  5HWB A;  4QIB A;  2AWG A;  2XPB A;  3NTP A;  3TDB A;  4JFJ A;  2N87 A;  1L1P A;  1N1A A;  1PIN A;  4IPX A;  4DRK A;  2RUR A;  3KAD A;  2XP6 A;  4TW7 A;  3PRD A;  1U79 A;  1D7J A;  1FKD A;  2LKN A;  1D7H A;  3O5D A;  3IKG A;  4MSP A;  2LPV A;  2Q5A A;  2DG4 A;  2MLY A;  2RSE A;  3KCE A;  5DIT A;  3UI4 A;  1HXV A;  1PBK A;  3KAF A;  3O5J A;  5DIV A;  2MF9 A;  1F8A B;  2ITK A;  4QT3 A; 
#chains in the Genus database with same CATH topology
 1CTN A;  2LGO A;  4IQ2 A;  4R5E A;  3GTY X;  3O5R A;  1ZBV A;  3KAB A;  3NRK A;  4Z2I A;  1NMW A;  4URI A;  4W9Q A;  1JNT A;  2WLY A;  3I6C A;  1X6N A;  1IX5 A;  3GPK A;  4ODP A;  1XHG A;  1QPF A;  2DT2 A;  4W9O A;  1ROU A;  1O6I A;  3WQW A;  2ZQT A;  3ODK A;  1J4H A;  4WKF A;  3IKD A;  5JH8 A;  1ZB5 A;  1JNS A;  2M08 A;  1NWS A;  4FN2 A;  3PRB A;  1FKG A;  3B8S A;  3AS1 A;  4L3N A;  1HKI A;  5HW7 A;  1W9V A;  3WL1 A;  1UR9 A;  1FKJ A;  4BF8 A;  4JFI A;  4MGV A;  4TNS A;  4G50 A;  2JZV A;  1HKJ A;  3B7X A;  3IHZ A;  1OGG A;  2XP9 A;  1OGB A;  3RGC A;  1LG1 A;  2DT3 A;  1EHN A;  4DWS C;  1TCO C;  4DRP A;  2KE0 A;  4TYO A;  1FKI A;  4KQZ A;  2WLZ A;  1EIB A;  2OFN A;  5DEZ A;  3OOB A;  1QPL A;  1W1V A;  2MNT A;  2RUD A;  2PN0 A;  3O5Q A;  4IQC A;  3WQV A;  4MNL A;  4ODM A;  3B9E A;  2PI6 A;  2DT1 A;  4ZPW R;  5HT1 A;  2A3E A;  2KR7 A;  3WH0 A;  3TC5 A;  4DIP A;  2RUQ A;  2XPA A;  1QZ2 A;  4JYS A;  1WNO A;  1Q6I A;  3WD4 A;  1E6P A;  1ZK6 A;  2IF4 A;  4WIW A;  2AWG A;  2XPB A;  4JFJ A;  3CZ8 A;  3ALF A;  2N87 A;  1L1P A;  1KFW A;  3FXY A;  1U79 A;  3G6L A;  3UI4 A;  1HXV A;  1ITX A;  2MF9 A;  2ITK A;  4HAR A;  4QT3 A;  1FAP A;  4AY1 A;  4WKA A;  1ZBK A;  2P4V A;  2RUC A;  1A7X A;  1WB0 A;  2O92 A;  4S3K A;  4W9P A;  5HBF A;  4Z2G A;  3EY6 A;  2MPH A;  1J4I A;  2B31 A;  2FAP A;  1FKB A;  3WD2 A;  4LAX A;  1D6O A;  2IUZ A;  3ARZ A;  3O5K A;  5J6E A;  1Q1C A;  1FKL A;  4IT6 A;  3KAC A;  3O5L A;  1J6Y A;  3AS0 A;  1JVW A;  4N19 A;  1KT1 A;  4U84 A;  5HW6 A;  3JXV A;  1GPF A;  5DO2 A;  3UQA A;  4DRJ A;  4Q22 A;  1FFR A;  2ETN A;  3UQB A;  1SR0 A;  3CGN A;  1FKK A;  1ZU8 A;  4Z2K A;  1GUV A;  2F21 A;  1ROT A;  5HKG A;  2PBC A;  1D2K A;  3RM8 A;  1Q6U A;  3PA7 A;  3BMB A;  2WM0 A;  2ZR6 A;  3ARW A;  2VN1 A;  4DRH A;  2YBT A;  1LQ0 A;  5DF0 A;  1FKH A;  4MPK A;  3CHF A;  1NWU A;  3ARY A;  3EIP A;  1RD6 A;  1ZBW A;  1W26 A;  1EDQ A;  3VAW A;  2RQS A;  1M5Y A;  4Z2J A;  5HUA A;  2DPE A;  1J4R A;  4R0X A;  4NZC A;  2DSW A;  3AS2 A;  1W1T A;  4LAV A;  3O5G A;  3ARS A;  3UI6 A;  2G41 A;  1FKS A;  2ZQS A;  2L2S A;  3AQU A;  2PV2 A;  4W5U A;  1H0I A;  3CHC A;  1NSG A;  3WIJ A;  4P8X A;  2ZR4 A;  5HWB A;  4QIB A;  3TDB A;  3PR9 A;  1PIN A;  4IPX A;  3RM9 A;  1JCH B;  4MSP A;  4Z2L A;  2Q5A A;  2MLY A;  3KCE A;  1FFQ A;  3O5J A;  3CH9 A;  1XRV A;  1F8A B;  4Q7N A;  5DIV A;  3FAP A;  1B6C A;  3KAH A;  4LAY A;  1OWQ A;  2MLX A;  4LAW A;  3GU0 A;  4HBO A;  4QZV B;  3O5F A;  4ODO A;  4TX0 A;  1BL4 A;  3O5I A;  1EQ3 A;  2ZQV A;  2DG3 A;  1LL4 A;  1K9T A;  1KT0 A;  2PPO A;  4J4N A;  1W9P A;  1HJV A;  4ODK A;  3WD1 A;  4DWS B;  1X6L A;  4GIV A;  4DRN A;  3IK8 A;  4MNJ A;  3UI5 A;  4WKH A;  1VF8 A;  1C9H A;  2ZQU A;  3RFW A;  2DSZ A;  4DRQ A;  4ODR A;  2PPN A;  2QF8 A;  1E44 A;  4P8V A;  3WKZ A;  3ARQ A;  1LJY A;  1BKF A;  2AOS A;  2F2D A;  1HKM A;  4GGQ A;  4JFL A;  1Y0O A;  2VCD A;  2ESC A;  3UF8 A;  3O5M A;  2XP3 A;  3W4R A;  4C02 B;  1ZBC A;  4XAK A;  2F23 A;  2F4E A;  3ARV A;  2M1I A;  4DT4 A;  1R9H A;  4HBE A;  3JYM A;  5BXJ A;  2WK2 A;  1JNE A;  3NI6 A;  5GPR A;  3CHE A;  1FKR A;  1T11 A;  1LG2 A;  1TFV A;  3H9R B;  3MDY B;  2XP7 A;  5I98 A;  4KR0 B;  2FKE A;  1FKT A;  4MAV A;  5GPG A;  3WL0 A;  2B5U B;  3RM4 A;  3O5O A;  4TW8 A;  4JFM A;  3PRA A;  4MNM A;  4ODL A;  1GRJ A;  2G8Z A;  1E9L A;  3TCZ A;  3ARX A;  2A3A A;  4DWS D;  4L72 B;  2DSV A;  2KI3 A;  1YAT A;  2EUL A;  3JYJ A;  3CGM A;  3CHD A;  4JFK A;  4UDM A;  1N1A A;  1WAW A;  2RUR A;  3KAD A;  1D7J A;  1FKD A;  2LKN A;  1D7H A;  3O5D A;  4ML4 A;  3BXW A;  2LPV A;  2RSE A;  2DG4 A;  3ALG A;  5DIT A;  1JND A;  1PBK A;  1GOI A;  1SYT A;  1NH6 A;  4WK9 A;  2KFW A;  4P8U A;  1NMV A;  3O5P A;  5B8I C;  3FY1 A;  2OLH A;  3AS3 A;  1NWR A;  3ART A;  4QT2 A;  3UQI A;  4ZPV R;  1UR8 A;  4U86 A;  1HJW A;  2DT0 A;  3ARU A;  4DZ3 A;  4FAP A;  1P5Q A;  2K8I A;  2PV1 A;  4NNR A;  2PV3 A;  4PTM A;  2DSU A;  5DIU A;  1EYM A;  3WD3 A;  2DG9 A;  4NSB A;  4IT4 A;  2XP4 A;  3KAG A;  2A3C A;  1W1P A;  4J4O A;  1D7I A;  1FD9 A;  4DRM A;  1E15 A;  4TW6 A;  4WJX A;  4ZS6 A;  1NWT A;  2ZR5 A;  2MLZ A;  3KZ7 A;  1E6N A;  1HKK A;  3B9A A;  1YW5 A;  4ODN A;  1H0G A;  1LL6 A;  2UZ5 A;  4DH0 A;  3ARO A;  4U85 A;  1W1Y A;  1FKF A;  4G2P A;  3G6M A;  3ARP A;  4ODQ A;  1ZL1 A;  4DZ2 A;  4O2T A;  3B9D A;  2KGJ A;  5HTG A;  4DRI A;  1E6Z A;  2YBU A;  3O5E A;  4DWS A;  4ITZ A;  2FDM A;  2A3B A;  4S3J A;  2PPP A;  2XP8 A;  3LUO A;  3WD0 A;  1FJD A;  2O9O A;  4DRO A;  2Y78 A;  2XP5 A;  1Q6H A;  3ARR A;  5D75 A;  4Z2H A;  2LJ4 A;  1LL7 A;  2D9F A;  4MTV A;  2KO7 A;  3KAI A;  2M2A A;  5HWC A;  1ZCN A;  3QOK A;  5HW8 A;  5GQB A;  4LGX A;  3NTP A;  1W9U A;  1E6R A;  4DRK A;  3OA5 A;  2XP6 A;  4P8W A;  4TW7 A;  3PRD A;  4ZPT R;  1HJX A;  3IKG A;  3RME A;  3KAF A;  4MNK A;  1F40 A; 
#chains in the Genus database with same CATH homology
 1CTN A;  2LGO A;  4IQ2 A;  4R5E A;  3O5R A;  1ZBV A;  3KAB A;  3NRK A;  4Z2I A;  1NMW A;  4URI A;  4W9Q A;  1JNT A;  2WLY A;  3I6C A;  1X6N A;  1IX5 A;  3GPK A;  4ODP A;  1XHG A;  1QPF A;  2DT2 A;  4W9O A;  1ROU A;  1O6I A;  3WQW A;  2ZQT A;  3ODK A;  1J4H A;  4WKF A;  3IKD A;  5JH8 A;  1ZB5 A;  1JNS A;  2M08 A;  1NWS A;  4FN2 A;  3PRB A;  1FKG A;  3B8S A;  3AS1 A;  4L3N A;  1HKI A;  5HW7 A;  1W9V A;  3WL1 A;  1UR9 A;  1FKJ A;  4BF8 A;  4JFI A;  4MGV A;  4TNS A;  4G50 A;  2JZV A;  1HKJ A;  3B7X A;  3IHZ A;  1OGG A;  2XP9 A;  1OGB A;  3RGC A;  1LG1 A;  2DT3 A;  1EHN A;  4DWS C;  1TCO C;  4DRP A;  2KE0 A;  4TYO A;  1FKI A;  4KQZ A;  2WLZ A;  1EIB A;  2OFN A;  5DEZ A;  3OOB A;  1QPL A;  1W1V A;  2MNT A;  2RUD A;  3O5Q A;  4IQC A;  3WQV A;  4MNL A;  4ODM A;  3B9E A;  2PI6 A;  2DT1 A;  4ZPW R;  5HT1 A;  2A3E A;  2KR7 A;  3WH0 A;  3TC5 A;  4DIP A;  2RUQ A;  2XPA A;  1QZ2 A;  4JYS A;  1WNO A;  1Q6I A;  3WD4 A;  1E6P A;  1ZK6 A;  2IF4 A;  4WIW A;  2AWG A;  2XPB A;  4JFJ A;  3CZ8 A;  3ALF A;  2N87 A;  1L1P A;  1KFW A;  3FXY A;  1U79 A;  3G6L A;  3UI4 A;  1HXV A;  1ITX A;  2MF9 A;  2ITK A;  4HAR A;  4QT3 A;  1FAP A;  4AY1 A;  4WKA A;  1ZBK A;  2RUC A;  1A7X A;  1WB0 A;  2O92 A;  4S3K A;  4W9P A;  5HBF A;  4Z2G A;  3EY6 A;  2MPH A;  1J4I A;  2B31 A;  2FAP A;  1FKB A;  3WD2 A;  4LAX A;  1D6O A;  2IUZ A;  3ARZ A;  3O5K A;  5J6E A;  1Q1C A;  1FKL A;  4IT6 A;  3KAC A;  3O5L A;  1J6Y A;  3AS0 A;  1JVW A;  4N19 A;  1KT1 A;  4U84 A;  5HW6 A;  3JXV A;  1GPF A;  5DO2 A;  3UQA A;  4DRJ A;  4Q22 A;  1FFR A;  3UQB A;  1SR0 A;  3CGN A;  1FKK A;  1ZU8 A;  4Z2K A;  1GUV A;  2F21 A;  1ROT A;  5HKG A;  2PBC A;  1D2K A;  3RM8 A;  1Q6U A;  3PA7 A;  2WM0 A;  2ZR6 A;  3ARW A;  2VN1 A;  4DRH A;  2YBT A;  1LQ0 A;  5DF0 A;  1FKH A;  4MPK A;  3CHF A;  1NWU A;  3ARY A;  1RD6 A;  1ZBW A;  1W26 A;  1EDQ A;  3VAW A;  2RQS A;  1M5Y A;  4Z2J A;  5HUA A;  2DPE A;  1J4R A;  4R0X A;  4NZC A;  2DSW A;  3AS2 A;  1W1T A;  4LAV A;  3O5G A;  3ARS A;  3UI6 A;  2G41 A;  1FKS A;  2ZQS A;  2L2S A;  3AQU A;  2PV2 A;  4W5U A;  1H0I A;  3CHC A;  1NSG A;  3WIJ A;  4P8X A;  2ZR4 A;  5HWB A;  4QIB A;  3TDB A;  3PR9 A;  1PIN A;  4IPX A;  3RM9 A;  4MSP A;  4Z2L A;  2Q5A A;  2MLY A;  3KCE A;  1FFQ A;  3O5J A;  3CH9 A;  1XRV A;  1F8A B;  4Q7N A;  5DIV A;  3FAP A;  1B6C A;  3KAH A;  4LAY A;  1OWQ A;  2MLX A;  4LAW A;  4HBO A;  4QZV B;  3O5F A;  4ODO A;  4TX0 A;  1BL4 A;  3O5I A;  1EQ3 A;  2ZQV A;  2DG3 A;  1LL4 A;  1K9T A;  1KT0 A;  2PPO A;  4J4N A;  1W9P A;  1HJV A;  4ODK A;  3WD1 A;  4DWS B;  1X6L A;  4GIV A;  4DRN A;  3IK8 A;  4MNJ A;  3UI5 A;  4WKH A;  1VF8 A;  1C9H A;  2ZQU A;  3RFW A;  2DSZ A;  4DRQ A;  4ODR A;  2PPN A;  2QF8 A;  4P8V A;  3WKZ A;  3ARQ A;  1LJY A;  1BKF A;  2AOS A;  2F2D A;  1HKM A;  4GGQ A;  4JFL A;  1Y0O A;  2VCD A;  2ESC A;  3UF8 A;  3O5M A;  2XP3 A;  3W4R A;  4C02 B;  1ZBC A;  4XAK A;  2F4E A;  3ARV A;  2M1I A;  4DT4 A;  1R9H A;  4HBE A;  3JYM A;  5BXJ A;  2WK2 A;  1JNE A;  3NI6 A;  5GPR A;  3CHE A;  1FKR A;  1T11 A;  1LG2 A;  1TFV A;  3H9R B;  3MDY B;  2XP7 A;  5I98 A;  4KR0 B;  2FKE A;  1FKT A;  4MAV A;  5GPG A;  3WL0 A;  3RM4 A;  3O5O A;  4TW8 A;  4JFM A;  3PRA A;  4MNM A;  4ODL A;  2G8Z A;  3TCZ A;  1E9L A;  3ARX A;  2A3A A;  4DWS D;  4L72 B;  2DSV A;  2KI3 A;  1YAT A;  4JFK A;  3JYJ A;  3CGM A;  3CHD A;  1N1A A;  1WAW A;  2RUR A;  3KAD A;  1D7J A;  1FKD A;  2LKN A;  1D7H A;  3O5D A;  4ML4 A;  3BXW A;  2LPV A;  2RSE A;  2DG4 A;  3ALG A;  5DIT A;  1JND A;  1PBK A;  1GOI A;  1SYT A;  1NH6 A;  4WK9 A;  2KFW A;  4P8U A;  1NMV A;  3O5P A;  5B8I C;  3FY1 A;  2OLH A;  3AS3 A;  1NWR A;  3ART A;  4QT2 A;  3UQI A;  4ZPV R;  1UR8 A;  4U86 A;  1HJW A;  2DT0 A;  3ARU A;  4DZ3 A;  4FAP A;  1P5Q A;  2K8I A;  2PV1 A;  4NNR A;  2PV3 A;  4PTM A;  2DSU A;  5DIU A;  1EYM A;  3WD3 A;  2DG9 A;  4NSB A;  4IT4 A;  2XP4 A;  3KAG A;  2A3C A;  1W1P A;  4J4O A;  1D7I A;  1FD9 A;  4DRM A;  1E15 A;  4TW6 A;  4WJX A;  4ZS6 A;  1NWT A;  2ZR5 A;  2MLZ A;  3KZ7 A;  1E6N A;  1HKK A;  3B9A A;  1YW5 A;  4ODN A;  1H0G A;  1LL6 A;  2UZ5 A;  4DH0 A;  3ARO A;  4U85 A;  1W1Y A;  1FKF A;  4G2P A;  3G6M A;  3ARP A;  4ODQ A;  1ZL1 A;  4DZ2 A;  4O2T A;  3B9D A;  2KGJ A;  5HTG A;  4DRI A;  1E6Z A;  2YBU A;  3O5E A;  4DWS A;  4ITZ A;  2FDM A;  2A3B A;  4S3J A;  2PPP A;  2XP8 A;  3LUO A;  3WD0 A;  1FJD A;  2O9O A;  4DRO A;  2Y78 A;  2XP5 A;  1Q6H A;  3ARR A;  5D75 A;  4Z2H A;  2LJ4 A;  1LL7 A;  2D9F A;  4MTV A;  2KO7 A;  3KAI A;  2M2A A;  5HWC A;  1ZCN A;  3QOK A;  5HW8 A;  5GQB A;  4LGX A;  3NTP A;  1W9U A;  1E6R A;  4DRK A;  3OA5 A;  2XP6 A;  4P8W A;  4TW7 A;  3PRD A;  4ZPT R;  1HJX A;  3IKG A;  3RME A;  3KAF A;  4MNK A;  1F40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...