4DRIA

Co-crystal structure of the ppiase domain of fkbp51, rapamycin and the frb fragment of mtor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
121
structure length
121
Chain Sequence
b'EQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
total genus 32
structure length 121
sequence length 121
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4driA00
5HKGA 1BL4A 5D75A 5HW6A 1ROTA 3O5LA 4JFKA 3JYJA 2DG3A 5HWCA 1D7JA 3RFWA 2PBCA 3KZ7A 3O5GA 3O5FA 3I6CA 3OOBA 3O5KA 4JFMA 3KABA 4ODLA 1FAPA 3PA7A 3GPKA 4DRIA 1J6YA 2KE0A 1FKTA 2OFNA 2ZR4A 2ZR5A 1ZCNA 1YATA 4TX0A 3B7XA 1PBKA 2XP5A 2XP7A 2ZR6A 4JFJA 3EY6A 4TNSA 2UZ5A 4TW6A 1QZ2A 3UI6A 2VCDA 3O5JA 4N19A 4DZ3A 2IF4A 3IKGA 3KACA 2MNTA 4ODPA 5DITA 1C9HA 1P5QA 3O5DA 1FKBA 3O5OA 4DZ2A 4DROA 4ODOA 2F2DA 1QPLA 3UQBA 3NTPA 1NSGA 4DRMA 3KAHA 3PRBA 2RURA 2ZQVA 2RUQA 5BXJA 3NRKA 4G2PA 1F40A 4ODMA 2DG4A 3ODKA 3KADA 1Q1CA 1Q6IA 1ZK6A 4ODKA 4DRKA 1EQ3A 1Y0OA 2LJ4A 2PV2A 1PINA 1FJDA 4R0XA 2F21A 4QT2A 2MLXA 1ROUA 3IKDA 1NMWA 2XPBA 3CGNA 1J4RA 3UQIA 2ITKA 1TCOC 5HWBA 2K8IA 5I98A 2PV3A 1B6CA 4JFLA 4ODQA 4J4NA 3UI4A 1HXVA 4DH0A 4JFIA 4FAPA 1BKFA 2M1IA 1FKSA 2FAPA 2KFWA 1T11A 3FAPA 4LAXA 1A7XA 2PPPA 3UQAA 1L1PA 4FN2A 4ODNA 1FD9A 3UF8A 1M5YA 4QT3A 4U84A 2KGJA 1FKFA 1J4IA 1EYMA 1W26A 2ZQTA 3H9RB 3O5PA 4O2TA 1KT1A 1D7IA 2Y78A 3O5RA 4C02B 4TW7A 2RUCA 4BF8A 4TW8A 5HUAA 2LPVA 1FKJA 2KR7A 4GIVA 2PPOA 1D6OA 4DT4A 3O5EA 4DRNA 4DIPA 2RQSA 1QPFA 2XP8A 1JNSA 4DRPA 2KI3A 3NI6A 5J6EA 5GPGA 2RUDA 4IPXA 3O5IA 1FKKA 3CGMA 2L2SA 3MDYB 4U85A 5HT1A 3UI5A 3TC5A 5B8IC 2XPAA 4DRJA 1JVWA 5HW7A 1FKRA 1FKIA 2N87A 4JYSA 2LKNA 2M08A 2MF9A 4LAYA 4DRHA 3O5MA 5HW8A 4QIBA 3IHZA 3IK8A 2M2AA 2ZQSA 1Q6UA 1JNTA 1J4HA 2F4EA 4DRQA 4LAVA 4MSPA 1R9HA 4NNRA 2D9FA 3KAFA 3LUOA 4IQ2A 3TCZA 3KAIA 2MPHA 4IQCA 4LAWA 3O5QA 2Q5AA 5DIUA 3RGCA 4W9OA 2XP3A 1YW5A 1KT0A 2VN1A 3JXVA 2AWGA 1D7HA 4W9QA 4W9PA 1F8AB 2MLYA 1FKGA 2JZVA 2XP6A 1FKHA 4G50A 1FKLA 2KO7A 2RSEA 3KCEA 4ITZA 2DG9A 3TDBA 2ZQUA 4U86A 2PV1A 5HTGA 3VAWA 4ODRA 1Q6HA 2PPNA 4J4OA 2LGOA 1FKDA 2MLZA 4GGQA 1NMVA 3KAGA 2XP9A 4MGVA 5DIVA 1N1AA 2FKEA 3WH0A 4TYOA 3PRDA 3JYMA 2XP4A 1U79A
chains in the Genus database with same CATH superfamily
3ARWA 4R5EA 1ROTA 3JYJA 2DT1A 4LGXA 3WD3A 2PBCA 4HBEA 3OOBA 3I6CA 3O5KA 4DRIA 1W9PA 4P8UA 1SYTA 2OFNA 3CHDA 1YATA 4TX0A 3B7XA 2UZ5A 4DZ3A 2DSVA 4Z2JA 1HKKA 3O5OA 3ALFA 3WIJA 4DZ2A 1HKJA 4DRMA 2RURA 1GOIA 2A3CA 2ZQVA 5BXJA 1F40A 4ODKA 4DRKA 1EQ3A 4MTVA 2PI6A 3CH9A 1ROUA 3CGNA 1J4RA 1E6RA 3UQIA 1XRVA 5I98A 1HXVA 1FKSA 1T11A 3FAPA 2DSZA 1VF8A 1FD9A 1LJYA 4QT3A 2KGJA 1EYMA 1KT1A 1D7IA 4KR0B 2YBTA 4C02B 3FY1A 4Z2LA 4TW8A 2LPVA 1LG1A 2PPOA 3PR9A 1UR9A 4DRPA 2P4VA 2QF8A 2RUDA 4DWSA 2OLHA 5HT1A 5DF0A 3TC5A 5HW7A 3ARVA 1RD6A 2N87A 2MF9A 4LAYA 1NWRA 4QIBA 2M2AA 1E44A 3ARUA 4DRQA 4LAVA 4MSPA 2A3BA 4NNRA 4MAVA 3KAIA 3B9DA 4IQCA 3O5QA 1GRJA 1D2KA 4W9OA 1YW5A 4P8WA 1TFVA 1D7HA 4MNJA 2MLYA 2XP6A 1FKHA 3KCEA 4ITZA 3AROA 3ARTA 1HJWA 4WIWA 2PPNA 4J4OA 3ALGA 2MLZA 1NMVA 1LL4A 4WKFA 3JYMA 2XP4A 4DRJA 4P8XA 3G6MA 1BL4A 1EDQA 1W1PA 2DG3A 2A3EA 1D7JA 4WKAA 3RFWA 3KABA 1HJVA 3PA7A 3GPKA 1LG2A 1LL7A 1ZCNA 3WL1A 1ZBKA 1PBKA 3CHFA 4TW6A 3UI6A 3O5JA 4N19A 3ARZA 4HARA 4ODPA 3RM4A 1P5QA 3O5DA 2DSUA 1W9VA 3RM8A 2A3AA 4DROA 1W1YA 3NTPA 1E6ZA 1O6IA 3B9EA 4L72B 4G2PA 2DT0A 4ODMA 2DG4A 1JCHB 2DT3A 4QT2A 4MPKA 3IKDA 1NMWA 2AOSA 2ITKA 2K8IA 1ZBVA 2PV3A 3ARSA 4WJXA 1NWSA 1ZL1A 3UI4A 4DH0A 4MNKA 1BKFA 4FAPA 1IX5A 4LAXA 3AS1A 3CHEA 1XHGA 1L1PA 4WKHA 1M5YA 1GUVA 2FDMA 1ITXA 1J4IA 3O5PA 3H9RB 4O2TA 1EIBA 3CZ8A 4TW7A 3EIPA 1FKJA 4ZPTR 1W1VA 3O5EA 4DIPA 1JNSA 4Q7NA 2KI3A 5J6EA 3WD0A 4IPXA 4IT6A 3O5IA 3CGMA 3MDYB 2L2SA 4U85A 4ZPVR 5B8IC 4JYSA 3IHZA 2ZQSA 3RM9A 1ZU8A 1JNTA 2F4EA 1ZBWA 2D9FA 1HKMA 3TCZA 2MPHA 2B31A 3WQWA 5GPRA 1X6LA 2PV1A 3OA5A 3VAWA 4ODRA 1Q6HA 3ARQA 1E9LA 1FKDA 3RMEA 4MGVA 5DIVA 3PRDA 1OWQA 1U79A 1HJXA 5HKGA 5D75A 5HW6A 3O5LA 1W9UA 5HBFA 4ML4A 5HWCA 3BMBA 2G41A 3O5GA 3KZ7A 4URIA 5DEZA 4S3KA 4ODLA 1FAPA 5JH8A 2KE0A 2ZR4A 3WKZA 2ZR5A 2XP5A 2XP7A 4JFJA 4IT4A 4TNSA 3EY6A 1QZ2A 4XAKA 2VCDA 3B8SA 3IKGA 3KACA 2DSWA 3AQUA 1FKBA 4ODOA 2B5UB 2F2DA 2F23A 1QPLA 1FFQA 3GU0A 3KAHA 3PRBA 5DO2A 2RUQA 1HKIA 3ODKA 2WK2A 1FJDA 4R0XA 2F21A 4Z2GA 4AY1A 2XPBA 5HWBA 1B6CA 4JFLA 4J4NA 4JFIA 2M1IA 2FAPA 1A7XA 1OGBA 4MNLA 4ODNA 1H0GA 4DWSB 1FKFA 1W26A 4PTMA 2Y78A 3O5RA 2RUCA 1H0IA 1NWTA 1WNOA 5HUAA 2KR7A 3ARPA 3WD2A 1D6OA 4DT4A 4DRNA 2RQSA 1QPFA 2O92A 2XP8A 3NI6A 4W5UA 1LQ0A 1JVWA 2YBUA 1FKIA 2DT2A 2LKNA 1W1TA 3ARYA 3IK8A 1FFRA 3GTYX 1J4HA 2WM0A 1E15A 1R9HA 3KAFA 3LUOA 4IQ2A 3W4RA 4LAWA 3ARXA 2Q5AA 1JNEA 4S3JA 5DIUA 4DWSC 2WLYA 2XP3A 4KQZA 2VN1A 1LL6A 4W9PA 1GPFA 4Z2IA 4G50A 1FKGA 2JZVA 1FKLA 2KO7A 2RSEA 2EULA 2DG9A 2ZQUA 5HTGA 2LGOA 4L3NA 2XP9A 3AS2A 4TYOA 2O9OA 4JFKA 2ETNA 3B9AA 5GQBA 1E6PA 3O5FA 4JFMA 2ESCA 4Z2HA 2G8ZA 1J6YA 3WL0A 1FKTA 4ZPWR 2ZR6A 4P8VA 1SR0A 4UDMA 2IF4A 3BXWA 2MNTA 5DITA 1EHNA 4Z2KA 1C9HA 1X6NA 2IUZA 3PRAA 3UQBA 1NSGA 3NRKA 3WD4A 3KADA 1Q1CA 1Q6IA 1ZK6A 1FKRA 3ARRA 1Y0OA 2LJ4A 2PV2A 1PINA 2MLXA 1E6NA 1CTNA 4MNMA 3QOKA 1TCOC 4ODQA 1JNDA 3CHCA 4ZS6A 1NWUA 3WQVA 2KFWA 2PPPA 3UQAA 4FN2A 3UF8A 2PN0A 4U84A 2ZQTA 1WAWA 4QZVB 4BF8A 3AS3A 1ZBCA 4GIVA 1OGGA 1UR8A 1K9TA 2DPEA 5GPGA 1FKKA 4Q22A 3UI5A 2XPAA 1ZB5A 2M08A 4DRHA 3O5MA 5HW8A 3FXYA 4WK9A 1Q6UA 4DWSD 3AS0A 3RGCA 1KT0A 3JXVA 3WD1A 2AWGA 4NZCA 2WLZA 4W9QA 1F8AB 1NH6A 3TDBA 1WB0A 4U86A 4NSBA 4GGQA 1KFWA 3KAGA 3G6LA 2FKEA 3WH0A 4HBOA 1N1AA
chains in the Genus database with same CATH topology
3ARWA 4R5EA 1ROTA 3JYJA 2DT1A 4LGXA 3WD3A 2PBCA 4HBEA 3OOBA 3I6CA 3O5KA 4DRIA 1W9PA 4P8UA 1SYTA 2OFNA 3CHDA 1YATA 4TX0A 3B7XA 2UZ5A 4DZ3A 2DSVA 4Z2JA 1HKKA 3O5OA 3ALFA 3WIJA 4DZ2A 1HKJA 4DRMA 2RURA 1GOIA 2A3CA 2ZQVA 5BXJA 1F40A 4ODKA 4DRKA 1EQ3A 4MTVA 2PI6A 3CH9A 1ROUA 3CGNA 1J4RA 1E6RA 3UQIA 1XRVA 5I98A 1HXVA 1FKSA 1T11A 3FAPA 2DSZA 1VF8A 1FD9A 1LJYA 4QT3A 2KGJA 1EYMA 1KT1A 1D7IA 4KR0B 2YBTA 4C02B 3FY1A 4Z2LA 4TW8A 2LPVA 1LG1A 2PPOA 3PR9A 1UR9A 4DRPA 2QF8A 2RUDA 4DWSA 2OLHA 5HT1A 5DF0A 3TC5A 5HW7A 3ARVA 1RD6A 2N87A 2MF9A 4LAYA 1NWRA 4QIBA 2M2AA 3ARUA 4DRQA 4LAVA 4MSPA 2A3BA 4NNRA 4MAVA 3KAIA 3B9DA 4IQCA 3O5QA 1D2KA 4W9OA 1YW5A 4P8WA 1TFVA 1D7HA 4MNJA 2MLYA 2XP6A 1FKHA 3KCEA 4ITZA 3AROA 3ARTA 1HJWA 4WIWA 2PPNA 4J4OA 3ALGA 2MLZA 1NMVA 1LL4A 4WKFA 3JYMA 2XP4A 4DRJA 4P8XA 3G6MA 1BL4A 1EDQA 1W1PA 2DG3A 2A3EA 1D7JA 4WKAA 3RFWA 3KABA 1HJVA 3PA7A 3GPKA 1LG2A 1LL7A 1ZCNA 3WL1A 1ZBKA 1PBKA 3CHFA 4TW6A 3UI6A 3O5JA 4N19A 3ARZA 4HARA 4ODPA 3RM4A 1P5QA 3O5DA 2DSUA 1W9VA 3RM8A 2A3AA 4DROA 1W1YA 3NTPA 1E6ZA 1O6IA 3B9EA 4L72B 4G2PA 2DT0A 4ODMA 2DG4A 2DT3A 4QT2A 4MPKA 3IKDA 1NMWA 2AOSA 2ITKA 2K8IA 1ZBVA 2PV3A 3ARSA 4WJXA 1NWSA 1ZL1A 3UI4A 4DH0A 4MNKA 1BKFA 4FAPA 1IX5A 4LAXA 3AS1A 3CHEA 1XHGA 1L1PA 4WKHA 1M5YA 1GUVA 2FDMA 1ITXA 1J4IA 3O5PA 3H9RB 4O2TA 1EIBA 3CZ8A 4TW7A 1FKJA 4ZPTR 1W1VA 3O5EA 4DIPA 1JNSA 4Q7NA 2KI3A 5J6EA 3WD0A 4IPXA 4IT6A 3O5IA 3CGMA 3MDYB 2L2SA 4U85A 4ZPVR 5B8IC 4JYSA 3IHZA 2ZQSA 3RM9A 1ZU8A 1JNTA 2F4EA 1ZBWA 2D9FA 1HKMA 3TCZA 2MPHA 2B31A 3WQWA 5GPRA 1X6LA 2PV1A 3OA5A 3VAWA 4ODRA 1Q6HA 3ARQA 1E9LA 1FKDA 3RMEA 4MGVA 5DIVA 3PRDA 1OWQA 1U79A 1HJXA 5HKGA 5D75A 5HW6A 3O5LA 1W9UA 5HBFA 4ML4A 5HWCA 2G41A 3O5GA 3KZ7A 4URIA 5DEZA 4S3KA 4ODLA 1FAPA 5JH8A 2KE0A 2ZR4A 3WKZA 2ZR5A 2XP5A 2XP7A 4JFJA 4IT4A 4TNSA 3EY6A 1QZ2A 4XAKA 2VCDA 3B8SA 3IKGA 3KACA 2DSWA 3AQUA 1FKBA 4ODOA 2F2DA 1QPLA 1FFQA 3KAHA 3PRBA 5DO2A 2RUQA 1HKIA 3ODKA 2WK2A 1FJDA 4R0XA 2F21A 4Z2GA 4AY1A 2XPBA 5HWBA 1B6CA 4JFLA 4J4NA 4JFIA 2M1IA 2FAPA 1A7XA 1OGBA 4MNLA 4ODNA 1H0GA 4DWSB 1FKFA 1W26A 4PTMA 2Y78A 3O5RA 2RUCA 1H0IA 1NWTA 1WNOA 5HUAA 2KR7A 3ARPA 3WD2A 1D6OA 4DT4A 4DRNA 2RQSA 1QPFA 2O92A 2XP8A 3NI6A 4W5UA 1LQ0A 1JVWA 2YBUA 1FKIA 2DT2A 2LKNA 1W1TA 3ARYA 3IK8A 1FFRA 1J4HA 2WM0A 1E15A 1R9HA 3KAFA 3LUOA 4IQ2A 3W4RA 4LAWA 3ARXA 2Q5AA 1JNEA 4S3JA 5DIUA 4DWSC 2WLYA 2XP3A 4KQZA 2VN1A 1LL6A 4W9PA 1GPFA 4Z2IA 4G50A 1FKGA 2JZVA 1FKLA 2KO7A 2RSEA 2DG9A 2ZQUA 5HTGA 2LGOA 4L3NA 2XP9A 3AS2A 4TYOA 2O9OA 4JFKA 3B9AA 5GQBA 1E6PA 3O5FA 4JFMA 2ESCA 4Z2HA 2G8ZA 1J6YA 3WL0A 1FKTA 4ZPWR 2ZR6A 4P8VA 1SR0A 2IF4A 3BXWA 2MNTA 5DITA 1EHNA 4Z2KA 1C9HA 1X6NA 2IUZA 3PRAA 3UQBA 1NSGA 3NRKA 3WD4A 3KADA 1Q1CA 1Q6IA 1ZK6A 1FKRA 3ARRA 1Y0OA 2LJ4A 2PV2A 1PINA 2MLXA 1E6NA 1CTNA 4MNMA 3QOKA 1TCOC 4ODQA 1JNDA 3CHCA 4ZS6A 1NWUA 3WQVA 2KFWA 2PPPA 3UQAA 4FN2A 3UF8A 4U84A 2ZQTA 1WAWA 4QZVB 4BF8A 3AS3A 1ZBCA 4GIVA 1OGGA 1UR8A 1K9TA 2DPEA 5GPGA 1FKKA 4Q22A 3UI5A 2XPAA 1ZB5A 2M08A 4DRHA 3O5MA 5HW8A 3FXYA 4WK9A 1Q6UA 4DWSD 3AS0A 3RGCA 1KT0A 3JXVA 3WD1A 2AWGA 4NZCA 2WLZA 4W9QA 1F8AB 1NH6A 3TDBA 1WB0A 4U86A 4NSBA 4GGQA 1KFWA 3KAGA 3G6LA 2FKEA 3WH0A 4HBOA 1N1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKG A;  1BL4 A;  5D75 A;  5HW6 A;  1ROT A;  3O5L A;  4JFK A;  3JYJ A;  2DG3 A;  5HWC A;  1D7J A;  3RFW A;  2PBC A;  3KZ7 A;  3O5G A;  3O5F A;  3I6C A;  3OOB A;  3O5K A;  4JFM A;  3KAB A;  4ODL A;  1FAP A;  3PA7 A;  3GPK A;  4DRI A;  1J6Y A;  2KE0 A;  1FKT A;  2OFN A;  2ZR4 A;  2ZR5 A;  1ZCN A;  1YAT A;  4TX0 A;  3B7X A;  1PBK A;  2XP5 A;  2XP7 A;  2ZR6 A;  4JFJ A;  3EY6 A;  4TNS A;  2UZ5 A;  4TW6 A;  1QZ2 A;  3UI6 A;  2VCD A;  3O5J A;  4N19 A;  4DZ3 A;  2IF4 A;  3IKG A;  3KAC A;  2MNT A;  4ODP A;  5DIT A;  1C9H A;  1P5Q A;  3O5D A;  1FKB A;  3O5O A;  4DZ2 A;  4DRO A;  4ODO A;  2F2D A;  1QPL A;  3UQB A;  3NTP A;  1NSG A;  4DRM A;  3KAH A;  3PRB A;  2RUR A;  2ZQV A;  2RUQ A;  5BXJ A;  3NRK A;  4G2P A;  1F40 A;  4ODM A;  2DG4 A;  3ODK A;  3KAD A;  1Q1C A;  1Q6I A;  1ZK6 A;  4ODK A;  4DRK A;  1EQ3 A;  1Y0O A;  2LJ4 A;  2PV2 A;  1PIN A;  1FJD A;  4R0X A;  2F21 A;  4QT2 A;  2MLX A;  1ROU A;  3IKD A;  1NMW A;  2XPB A;  3CGN A;  1J4R A;  3UQI A;  2ITK A;  1TCO C;  5HWB A;  2K8I A;  5I98 A;  2PV3 A;  1B6C A;  4JFL A;  4ODQ A;  4J4N A;  3UI4 A;  1HXV A;  4DH0 A;  4JFI A;  4FAP A;  1BKF A;  2M1I A;  1FKS A;  2FAP A;  2KFW A;  1T11 A;  3FAP A;  4LAX A;  1A7X A;  2PPP A;  3UQA A;  1L1P A;  4FN2 A;  4ODN A;  1FD9 A;  3UF8 A;  1M5Y A;  4QT3 A;  4U84 A;  2KGJ A;  1FKF A;  1J4I A;  1EYM A;  1W26 A;  2ZQT A;  3H9R B;  3O5P A;  4O2T A;  1KT1 A;  1D7I A;  2Y78 A;  3O5R A;  4C02 B;  4TW7 A;  2RUC A;  4BF8 A;  4TW8 A;  5HUA A;  2LPV A;  1FKJ A;  2KR7 A;  4GIV A;  2PPO A;  1D6O A;  4DT4 A;  3O5E A;  4DRN A;  4DIP A;  2RQS A;  1QPF A;  2XP8 A;  1JNS A;  4DRP A;  2KI3 A;  3NI6 A;  5J6E A;  5GPG A;  2RUD A;  4IPX A;  3O5I A;  1FKK A;  3CGM A;  2L2S A;  3MDY B;  4U85 A;  5HT1 A;  3UI5 A;  3TC5 A;  5B8I C;  2XPA A;  4DRJ A;  1JVW A;  5HW7 A;  1FKR A;  1FKI A;  2N87 A;  4JYS A;  2LKN A;  2M08 A;  2MF9 A;  4LAY A;  4DRH A;  3O5M A;  5HW8 A;  4QIB A;  3IHZ A;  3IK8 A;  2M2A A;  2ZQS A;  1Q6U A;  1JNT A;  1J4H A;  2F4E A;  4DRQ A;  4LAV A;  4MSP A;  1R9H A;  4NNR A;  2D9F A;  3KAF A;  3LUO A;  4IQ2 A;  3TCZ A;  3KAI A;  2MPH A;  4IQC A;  4LAW A;  3O5Q A;  2Q5A A;  5DIU A;  3RGC A;  4W9O A;  2XP3 A;  1YW5 A;  1KT0 A;  2VN1 A;  3JXV A;  2AWG A;  1D7H A;  4W9Q A;  4W9P A;  1F8A B;  2MLY A;  1FKG A;  2JZV A;  2XP6 A;  1FKH A;  4G50 A;  1FKL A;  2KO7 A;  2RSE A;  3KCE A;  4ITZ A;  2DG9 A;  3TDB A;  2ZQU A;  4U86 A;  2PV1 A;  5HTG A;  3VAW A;  4ODR A;  1Q6H A;  2PPN A;  4J4O A;  2LGO A;  1FKD A;  2MLZ A;  4GGQ A;  1NMV A;  3KAG A;  2XP9 A;  4MGV A;  5DIV A;  1N1A A;  2FKE A;  3WH0 A;  4TYO A;  3PRD A;  3JYM A;  2XP4 A;  1U79 A; 
#chains in the Genus database with same CATH topology
 3ARW A;  4R5E A;  1ROT A;  3JYJ A;  2DT1 A;  4LGX A;  3WD3 A;  2PBC A;  4HBE A;  3OOB A;  3I6C A;  3O5K A;  4DRI A;  1W9P A;  4P8U A;  1SYT A;  2OFN A;  3CHD A;  1YAT A;  4TX0 A;  3B7X A;  2UZ5 A;  4DZ3 A;  2DSV A;  4Z2J A;  1HKK A;  3O5O A;  3ALF A;  3WIJ A;  4DZ2 A;  1HKJ A;  4DRM A;  2RUR A;  1GOI A;  2A3C A;  2ZQV A;  5BXJ A;  1F40 A;  4ODK A;  4DRK A;  1EQ3 A;  4MTV A;  2PI6 A;  3CH9 A;  1ROU A;  3CGN A;  1J4R A;  1E6R A;  3UQI A;  1XRV A;  5I98 A;  1HXV A;  1FKS A;  1T11 A;  3FAP A;  2DSZ A;  1VF8 A;  1FD9 A;  1LJY A;  4QT3 A;  2KGJ A;  1EYM A;  1KT1 A;  1D7I A;  4KR0 B;  2YBT A;  4C02 B;  3FY1 A;  4Z2L A;  4TW8 A;  2LPV A;  1LG1 A;  2PPO A;  3PR9 A;  1UR9 A;  4DRP A;  2P4V A;  2QF8 A;  2RUD A;  4DWS A;  2OLH A;  5HT1 A;  5DF0 A;  3TC5 A;  5HW7 A;  3ARV A;  1RD6 A;  2N87 A;  2MF9 A;  4LAY A;  1NWR A;  4QIB A;  2M2A A;  1E44 A;  3ARU A;  4DRQ A;  4LAV A;  4MSP A;  2A3B A;  4NNR A;  4MAV A;  3KAI A;  3B9D A;  4IQC A;  3O5Q A;  1GRJ A;  1D2K A;  4W9O A;  1YW5 A;  4P8W A;  1TFV A;  1D7H A;  4MNJ A;  2MLY A;  2XP6 A;  1FKH A;  3KCE A;  4ITZ A;  3ARO A;  3ART A;  1HJW A;  4WIW A;  2PPN A;  4J4O A;  3ALG A;  2MLZ A;  1NMV A;  1LL4 A;  4WKF A;  3JYM A;  2XP4 A;  4DRJ A;  4P8X A;  3G6M A;  1BL4 A;  1EDQ A;  1W1P A;  2DG3 A;  2A3E A;  1D7J A;  4WKA A;  3RFW A;  3KAB A;  1HJV A;  3PA7 A;  3GPK A;  1LG2 A;  1LL7 A;  1ZCN A;  3WL1 A;  1ZBK A;  1PBK A;  3CHF A;  4TW6 A;  3UI6 A;  3O5J A;  4N19 A;  3ARZ A;  4HAR A;  4ODP A;  3RM4 A;  1P5Q A;  3O5D A;  2DSU A;  1W9V A;  3RM8 A;  2A3A A;  4DRO A;  1W1Y A;  3NTP A;  1E6Z A;  1O6I A;  3B9E A;  4L72 B;  4G2P A;  2DT0 A;  4ODM A;  2DG4 A;  1JCH B;  2DT3 A;  4QT2 A;  4MPK A;  3IKD A;  1NMW A;  2AOS A;  2ITK A;  2K8I A;  1ZBV A;  2PV3 A;  3ARS A;  4WJX A;  1NWS A;  1ZL1 A;  3UI4 A;  4DH0 A;  4MNK A;  1BKF A;  4FAP A;  1IX5 A;  4LAX A;  3AS1 A;  3CHE A;  1XHG A;  1L1P A;  4WKH A;  1M5Y A;  1GUV A;  2FDM A;  1ITX A;  1J4I A;  3O5P A;  3H9R B;  4O2T A;  1EIB A;  3CZ8 A;  4TW7 A;  3EIP A;  1FKJ A;  4ZPT R;  1W1V A;  3O5E A;  4DIP A;  1JNS A;  4Q7N A;  2KI3 A;  5J6E A;  3WD0 A;  4IPX A;  4IT6 A;  3O5I A;  3CGM A;  3MDY B;  2L2S A;  4U85 A;  4ZPV R;  5B8I C;  4JYS A;  3IHZ A;  2ZQS A;  3RM9 A;  1ZU8 A;  1JNT A;  2F4E A;  1ZBW A;  2D9F A;  1HKM A;  3TCZ A;  2MPH A;  2B31 A;  3WQW A;  5GPR A;  1X6L A;  2PV1 A;  3OA5 A;  3VAW A;  4ODR A;  1Q6H A;  3ARQ A;  1E9L A;  1FKD A;  3RME A;  4MGV A;  5DIV A;  3PRD A;  1OWQ A;  1U79 A;  1HJX A;  5HKG A;  5D75 A;  5HW6 A;  3O5L A;  1W9U A;  5HBF A;  4ML4 A;  5HWC A;  3BMB A;  2G41 A;  3O5G A;  3KZ7 A;  4URI A;  5DEZ A;  4S3K A;  4ODL A;  1FAP A;  5JH8 A;  2KE0 A;  2ZR4 A;  3WKZ A;  2ZR5 A;  2XP5 A;  2XP7 A;  4JFJ A;  4IT4 A;  4TNS A;  3EY6 A;  1QZ2 A;  4XAK A;  2VCD A;  3B8S A;  3IKG A;  3KAC A;  2DSW A;  3AQU A;  1FKB A;  4ODO A;  2B5U B;  2F2D A;  2F23 A;  1QPL A;  1FFQ A;  3GU0 A;  3KAH A;  3PRB A;  5DO2 A;  2RUQ A;  1HKI A;  3ODK A;  2WK2 A;  1FJD A;  4R0X A;  2F21 A;  4Z2G A;  4AY1 A;  2XPB A;  5HWB A;  1B6C A;  4JFL A;  4J4N A;  4JFI A;  2M1I A;  2FAP A;  1A7X A;  1OGB A;  4MNL A;  4ODN A;  1H0G A;  4DWS B;  1FKF A;  1W26 A;  4PTM A;  2Y78 A;  3O5R A;  2RUC A;  1H0I A;  1NWT A;  1WNO A;  5HUA A;  2KR7 A;  3ARP A;  3WD2 A;  1D6O A;  4DT4 A;  4DRN A;  2RQS A;  1QPF A;  2O92 A;  2XP8 A;  3NI6 A;  4W5U A;  1LQ0 A;  1JVW A;  2YBU A;  1FKI A;  2DT2 A;  2LKN A;  1W1T A;  3ARY A;  3IK8 A;  1FFR A;  3GTY X;  1J4H A;  2WM0 A;  1E15 A;  1R9H A;  3KAF A;  3LUO A;  4IQ2 A;  3W4R A;  4LAW A;  3ARX A;  2Q5A A;  1JNE A;  4S3J A;  5DIU A;  4DWS C;  2WLY A;  2XP3 A;  4KQZ A;  2VN1 A;  1LL6 A;  4W9P A;  1GPF A;  4Z2I A;  4G50 A;  1FKG A;  2JZV A;  1FKL A;  2KO7 A;  2RSE A;  2EUL A;  2DG9 A;  2ZQU A;  5HTG A;  2LGO A;  4L3N A;  2XP9 A;  3AS2 A;  4TYO A;  2O9O A;  4JFK A;  2ETN A;  3B9A A;  5GQB A;  1E6P A;  3O5F A;  4JFM A;  2ESC A;  4Z2H A;  2G8Z A;  1J6Y A;  3WL0 A;  1FKT A;  4ZPW R;  2ZR6 A;  4P8V A;  1SR0 A;  4UDM A;  2IF4 A;  3BXW A;  2MNT A;  5DIT A;  1EHN A;  4Z2K A;  1C9H A;  1X6N A;  2IUZ A;  3PRA A;  3UQB A;  1NSG A;  3NRK A;  3WD4 A;  3KAD A;  1Q1C A;  1Q6I A;  1ZK6 A;  1FKR A;  3ARR A;  1Y0O A;  2LJ4 A;  2PV2 A;  1PIN A;  2MLX A;  1E6N A;  1CTN A;  4MNM A;  3QOK A;  1TCO C;  4ODQ A;  1JND A;  3CHC A;  4ZS6 A;  1NWU A;  3WQV A;  2KFW A;  2PPP A;  3UQA A;  4FN2 A;  3UF8 A;  2PN0 A;  4U84 A;  2ZQT A;  1WAW A;  4QZV B;  4BF8 A;  3AS3 A;  1ZBC A;  4GIV A;  1OGG A;  1UR8 A;  1K9T A;  2DPE A;  5GPG A;  1FKK A;  4Q22 A;  3UI5 A;  2XPA A;  1ZB5 A;  2M08 A;  4DRH A;  3O5M A;  5HW8 A;  3FXY A;  4WK9 A;  1Q6U A;  4DWS D;  3AS0 A;  3RGC A;  1KT0 A;  3JXV A;  3WD1 A;  2AWG A;  4NZC A;  2WLZ A;  4W9Q A;  1F8A B;  1NH6 A;  3TDB A;  1WB0 A;  4U86 A;  4NSB A;  4GGQ A;  1KFW A;  3KAG A;  3G6L A;  2FKE A;  3WH0 A;  4HBO A;  1N1A A; 
#chains in the Genus database with same CATH homology
 3ARW A;  4R5E A;  1ROT A;  3JYJ A;  2DT1 A;  4LGX A;  3WD3 A;  2PBC A;  4HBE A;  3OOB A;  3I6C A;  3O5K A;  4DRI A;  1W9P A;  4P8U A;  1SYT A;  2OFN A;  3CHD A;  1YAT A;  4TX0 A;  3B7X A;  2UZ5 A;  4DZ3 A;  2DSV A;  4Z2J A;  1HKK A;  3O5O A;  3ALF A;  3WIJ A;  4DZ2 A;  1HKJ A;  4DRM A;  2RUR A;  1GOI A;  2A3C A;  2ZQV A;  5BXJ A;  1F40 A;  4ODK A;  4DRK A;  1EQ3 A;  4MTV A;  2PI6 A;  3CH9 A;  1ROU A;  3CGN A;  1J4R A;  1E6R A;  3UQI A;  1XRV A;  5I98 A;  1HXV A;  1FKS A;  1T11 A;  3FAP A;  2DSZ A;  1VF8 A;  1FD9 A;  1LJY A;  4QT3 A;  2KGJ A;  1EYM A;  1KT1 A;  1D7I A;  4KR0 B;  2YBT A;  4C02 B;  3FY1 A;  4Z2L A;  4TW8 A;  2LPV A;  1LG1 A;  2PPO A;  3PR9 A;  1UR9 A;  4DRP A;  2QF8 A;  2RUD A;  4DWS A;  2OLH A;  5HT1 A;  5DF0 A;  3TC5 A;  5HW7 A;  3ARV A;  1RD6 A;  2N87 A;  2MF9 A;  4LAY A;  1NWR A;  4QIB A;  2M2A A;  3ARU A;  4DRQ A;  4LAV A;  4MSP A;  2A3B A;  4NNR A;  4MAV A;  3KAI A;  3B9D A;  4IQC A;  3O5Q A;  1D2K A;  4W9O A;  1YW5 A;  4P8W A;  1TFV A;  1D7H A;  4MNJ A;  2MLY A;  2XP6 A;  1FKH A;  3KCE A;  4ITZ A;  3ARO A;  3ART A;  1HJW A;  4WIW A;  2PPN A;  4J4O A;  3ALG A;  2MLZ A;  1NMV A;  1LL4 A;  4WKF A;  3JYM A;  2XP4 A;  4DRJ A;  4P8X A;  3G6M A;  1BL4 A;  1EDQ A;  1W1P A;  2DG3 A;  2A3E A;  1D7J A;  4WKA A;  3RFW A;  3KAB A;  1HJV A;  3PA7 A;  3GPK A;  1LG2 A;  1LL7 A;  1ZCN A;  3WL1 A;  1ZBK A;  1PBK A;  3CHF A;  4TW6 A;  3UI6 A;  3O5J A;  4N19 A;  3ARZ A;  4HAR A;  4ODP A;  3RM4 A;  1P5Q A;  3O5D A;  2DSU A;  1W9V A;  3RM8 A;  2A3A A;  4DRO A;  1W1Y A;  3NTP A;  1E6Z A;  1O6I A;  3B9E A;  4L72 B;  4G2P A;  2DT0 A;  4ODM A;  2DG4 A;  2DT3 A;  4QT2 A;  4MPK A;  3IKD A;  1NMW A;  2AOS A;  2ITK A;  2K8I A;  1ZBV A;  2PV3 A;  3ARS A;  4WJX A;  1NWS A;  1ZL1 A;  3UI4 A;  4DH0 A;  4MNK A;  1BKF A;  4FAP A;  1IX5 A;  4LAX A;  3AS1 A;  3CHE A;  1XHG A;  1L1P A;  4WKH A;  1M5Y A;  1GUV A;  2FDM A;  1ITX A;  1J4I A;  3O5P A;  3H9R B;  4O2T A;  1EIB A;  3CZ8 A;  4TW7 A;  1FKJ A;  4ZPT R;  1W1V A;  3O5E A;  4DIP A;  1JNS A;  4Q7N A;  2KI3 A;  5J6E A;  3WD0 A;  4IPX A;  4IT6 A;  3O5I A;  3CGM A;  3MDY B;  2L2S A;  4U85 A;  4ZPV R;  5B8I C;  4JYS A;  3IHZ A;  2ZQS A;  3RM9 A;  1ZU8 A;  1JNT A;  2F4E A;  1ZBW A;  2D9F A;  1HKM A;  3TCZ A;  2MPH A;  2B31 A;  3WQW A;  5GPR A;  1X6L A;  2PV1 A;  3OA5 A;  3VAW A;  4ODR A;  1Q6H A;  3ARQ A;  1E9L A;  1FKD A;  3RME A;  4MGV A;  5DIV A;  3PRD A;  1OWQ A;  1U79 A;  1HJX A;  5HKG A;  5D75 A;  5HW6 A;  3O5L A;  1W9U A;  5HBF A;  4ML4 A;  5HWC A;  2G41 A;  3O5G A;  3KZ7 A;  4URI A;  5DEZ A;  4S3K A;  4ODL A;  1FAP A;  5JH8 A;  2KE0 A;  2ZR4 A;  3WKZ A;  2ZR5 A;  2XP5 A;  2XP7 A;  4JFJ A;  4IT4 A;  4TNS A;  3EY6 A;  1QZ2 A;  4XAK A;  2VCD A;  3B8S A;  3IKG A;  3KAC A;  2DSW A;  3AQU A;  1FKB A;  4ODO A;  2F2D A;  1QPL A;  1FFQ A;  3KAH A;  3PRB A;  5DO2 A;  2RUQ A;  1HKI A;  3ODK A;  2WK2 A;  1FJD A;  4R0X A;  2F21 A;  4Z2G A;  4AY1 A;  2XPB A;  5HWB A;  1B6C A;  4JFL A;  4J4N A;  4JFI A;  2M1I A;  2FAP A;  1A7X A;  1OGB A;  4MNL A;  4ODN A;  1H0G A;  4DWS B;  1FKF A;  1W26 A;  4PTM A;  2Y78 A;  3O5R A;  2RUC A;  1H0I A;  1NWT A;  1WNO A;  5HUA A;  2KR7 A;  3ARP A;  3WD2 A;  1D6O A;  4DT4 A;  4DRN A;  2RQS A;  1QPF A;  2O92 A;  2XP8 A;  3NI6 A;  4W5U A;  1LQ0 A;  1JVW A;  2YBU A;  1FKI A;  2DT2 A;  2LKN A;  1W1T A;  3ARY A;  3IK8 A;  1FFR A;  1J4H A;  2WM0 A;  1E15 A;  1R9H A;  3KAF A;  3LUO A;  4IQ2 A;  3W4R A;  4LAW A;  3ARX A;  2Q5A A;  1JNE A;  4S3J A;  5DIU A;  4DWS C;  2WLY A;  2XP3 A;  4KQZ A;  2VN1 A;  1LL6 A;  4W9P A;  1GPF A;  4Z2I A;  4G50 A;  1FKG A;  2JZV A;  1FKL A;  2KO7 A;  2RSE A;  2DG9 A;  2ZQU A;  5HTG A;  2LGO A;  4L3N A;  2XP9 A;  3AS2 A;  4TYO A;  2O9O A;  4JFK A;  3B9A A;  5GQB A;  1E6P A;  3O5F A;  4JFM A;  2ESC A;  4Z2H A;  2G8Z A;  1J6Y A;  3WL0 A;  1FKT A;  4ZPW R;  2ZR6 A;  4P8V A;  1SR0 A;  2IF4 A;  3BXW A;  2MNT A;  5DIT A;  1EHN A;  4Z2K A;  1C9H A;  1X6N A;  2IUZ A;  3PRA A;  3UQB A;  1NSG A;  3NRK A;  3WD4 A;  3KAD A;  1Q1C A;  1Q6I A;  1ZK6 A;  1FKR A;  3ARR A;  1Y0O A;  2LJ4 A;  2PV2 A;  1PIN A;  2MLX A;  1E6N A;  1CTN A;  4MNM A;  3QOK A;  1TCO C;  4ODQ A;  1JND A;  3CHC A;  4ZS6 A;  1NWU A;  3WQV A;  2KFW A;  2PPP A;  3UQA A;  4FN2 A;  3UF8 A;  4U84 A;  2ZQT A;  1WAW A;  4QZV B;  4BF8 A;  3AS3 A;  1ZBC A;  4GIV A;  1OGG A;  1UR8 A;  1K9T A;  2DPE A;  5GPG A;  1FKK A;  4Q22 A;  3UI5 A;  2XPA A;  1ZB5 A;  2M08 A;  4DRH A;  3O5M A;  5HW8 A;  3FXY A;  4WK9 A;  1Q6U A;  4DWS D;  3AS0 A;  3RGC A;  1KT0 A;  3JXV A;  3WD1 A;  2AWG A;  4NZC A;  2WLZ A;  4W9Q A;  1F8A B;  1NH6 A;  3TDB A;  1WB0 A;  4U86 A;  4NSB A;  4GGQ A;  1KFW A;  3KAG A;  3G6L A;  2FKE A;  3WH0 A;  4HBO A;  1N1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...