4DRIA

Co-crystal structure of the ppiase domain of fkbp51, rapamycin and the frb fragment of mtor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
121
structure length
121
Chain Sequence
EQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 32
structure length 121
sequence length 121
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4driA00
2PV1A 3O5MA 4QIBA 4DZ2A 5HWCA 2LGOA 4TW6A 2F2DA 2ZR6A 3PRDA 5HUAA 1ZCNA 1D7HA 4DROA 1A7XA 2KFWA 2MPHA 3IK8A 4JFKA 4IPXA 1J6YA 3JYJA 4TW7A 2XP5A 4U85A 3RGCA 1D7JA 3RFWA 3IKDA 1TCOC 1QPFA 4LAYA 3JYMA 3KACA 3KADA 2XP9A 2RUCA 1FJDA 2OFNA 4JFJA 3TCZA 4DRIA 5DIUA 2XP3A 3UI4A 2UZ5A 5J6EA 5DIVA 4W9OA 1QZ2A 3PRBA 4JFLA 1FKTA 2K8IA 4ODQA 2D9FA 4MGVA 2Y78A 2ZQTA 5HWBA 1BKFA 5HT1A 3KZ7A 2ITKA 2M08A 1FKFA 1W26A 4W9PA 3O5LA 1N1AA 5BXJA 1Q1CA 1YW5A 2IF4A 4TW8A 3O5KA 3LUOA 4LAXA 4TX0A 2RQSA 3O5GA 4ODMA 3CGNA 3O5EA 4ODPA 3O5IA 2N87A 3VAWA 4DRMA 2DG3A 3NI6A 4G2PA 3UI6A 4ODNA 2KE0A 4DZ3A 3KAIA 2MNTA 1FD9A 1FKKA 2KO7A 2MF9A 1PBKA 3UQBA 2PBCA 1Q6HA 1FKSA 4DRQA 4DRNA 3O5DA 4DT4A 3UF8A 5HTGA 2ZR4A 2AWGA 5GPGA 3UI5A 1D6OA 5HW6A 1Q6IA 4TNSA 4ITZA 3JXVA 3FAPA 3KAGA 4GIVA 3NTPA 4TYOA 2XP8A 4DRKA 1F8AB 1FAPA 4MSPA 4DRJA 5DITA 3O5QA 1ROTA 2XPBA 1NMWA 1JNTA 1J4RA 2LKNA 2FAPA 5HKGA 2LJ4A 5HW8A 2PPNA 3O5JA 4BF8A 2PV2A 2VN1A 1QPLA 4ODRA 4W9QA 1ZK6A 3OOBA 1R9HA 1EQ3A 3GPKA 4NNRA 2F21A 2JZVA 4J4NA 4R0XA 3UQIA 4C02B 1JNSA 2DG4A 1FKBA 1J4HA 4IQ2A 3TC5A 1KT0A 4ODLA 3ODKA 2ZQUA 2ZQVA 4DIPA 3O5PA 4LAVA 4JFMA 2XP4A 4O2TA 1Q6UA 2KI3A 4FN2A 3MDYB 3O5OA 1FKHA 4ODOA 1FKLA 2F4EA 4IQCA 1ROUA 1EYMA 4G50A 4ODKA 1J4IA 3KAFA 2RUDA 4JFIA 4U84A 1FKDA 1C9HA 4J4OA 3IHZA 3IKGA 2XPAA 2KR7A 4FAPA 5B8IC 2FKEA 2Q5AA 1NMVA 1F40A 2KGJA 3O5RA 1KT1A 2RSEA 2LPVA 1FKIA 2L2SA 1T11A 2MLYA 1P5QA 2PV3A 1FKGA 2M1IA 3CGMA 3KAHA 1JVWA 1YATA 3TDBA 2RUQA 2DG9A 4QT2A 3H9RB 4DRPA 4N19A 2ZQSA 2PPOA 1BL4A 3I6CA 1FKRA 4QT3A 2RURA 1U79A 5D75A 1FKJA 3PA7A 3KABA 4DRHA 1PINA 1L1PA 1HXVA 4U86A 2MLXA 1B6CA 2MLZA 3WH0A 4DH0A 5HW7A 2M2AA 1D7IA 4JYSA 3O5FA 3UQAA 3KCEA 4LAWA 2ZR5A 1Y0OA 1NSGA 1M5YA 2PPPA 4GGQA 5I98A 2XP7A 3EY6A 3B7XA 2XP6A 3NRKA 2VCDA
chains in the Genus database with same CATH superfamily
4WK9A 1XRVA 4QIBA 3CHCA 3WKZA 5HUAA 4P8WA 1D7HA 3ARXA 2DSWA 1J6YA 4TW7A 1W1VA 1D7JA 2G8ZA 1QPFA 3JYMA 2OFNA 4JFJA 3TCZA 2O92A 4L72B 4MPKA 5DO2A 2D9FA 4MGVA 2ITKA 3GU0A 1W26A 3O5LA 1YW5A 2IF4A 3RM9A 3O5KA 1E6RA 3LUOA 2RQSA 4ODMA 3CGNA 1GOIA 3O5IA 2N87A 1H0GA 3NI6A 3UI6A 3KAIA 2KO7A 1FKSA 1LJYA 1HXVA 3UF8A 3UI5A 3JXVA 1F8AB 2DSZA 1TFVA 4Q7NA 5DITA 4DRJA 2XPBA 1LQ0A 4ZPTR 4IT6A 1J4RA 3ALGA 5DF0A 4W5UA 5HKGA 2LJ4A 4Q22A 1W9VA 5GPRA 1EQ3A 3GPKA 3UQIA 1J4HA 1KT0A 3ODKA 4WKFA 2O9OA 4JFMA 2F4EA 1GUVA 4IQCA 3WQVA 3G6LA 1UR8A 4JFIA 2KR7A 2A3BA 1NMVA 3O5RA 1FKIA 3AROA 2F23A 1VF8A 4ZPVR 1JCHB 1ZBKA 2DG9A 3H9RB 3I6CA 4QT3A 2G41A 1L1PA 3ARYA 1PINA 4U86A 1B6CA 3UQAA 3G6MA 2ZR5A 5I98A 4AY1A 1JNEA 4TW6A 2AOSA 2EULA 2DT0A 2MPHA 1NWTA 3CZ8A 3PR9A 3RM8A 2ETNA 2XP5A 3RFWA 1TCOC 4LAYA 1ZBWA 3B9DA 2XP9A 4NZCA 5HBFA 4DRIA 1NWSA 3AS3A 2XP3A 5DIVA 4W9OA 1E15A 2Y78A 1WAWA 4NSBA 2OLHA 1SYTA 1N1AA 1ZL1A 1KFWA 1ZBCA 4TX0A 1HKKA 3O5GA 4ODPA 2YBUA 4MNLA 4ODNA 1W1PA 4L3NA 1FD9A 4DT4A 3O5DA 2ZR4A 5GPGA 3WD0A 1Q6IA 4TNSA 4ITZA 4DWSC 3NTPA 4WKHA 1HKMA 2DSVA 2WM0A 4PTMA 3W4RA 4HBEA 1OGBA 1LL4A 2FAPA 5HW8A 2PPNA 4BF8A 4Z2GA 1ZK6A 3ARWA 2F21A 1RD6A 2ZQVA 4DIPA 3O5PA 3RM4A 3O5OA 1FKHA 3ARZA 4G50A 4MNKA 3BXWA 3WIJA 4FAPA 1OWQA 1ZB5A 2Q5AA 1F40A 2RSEA 1HKJA 1HJWA 1ZU8A 1FKGA 2M1IA 1E6NA 1YATA 3WD2A 2A3EA 4QT2A 4S3JA 4N19A 2PPOA 1SR0A 2RURA 1U79A 4DRHA 3AS2A 3WD3A 3WH0A 5HW7A 4JYSA 2A3CA 2B5UB 5JH8A 1NSGA 4GGQA 2XP7A 3EY6A 2XP6A 2PV1A 3O5MA 5HWCA 4P8VA 4DZ2A 2LGOA 4WKAA 1EIBA 2F2DA 2ZR6A 3ARUA 1A7XA 3IK8A 1W9PA 4ML4A 4MNJA 4JFKA 4IPXA 3JYJA 2B31A 2WLZA 4U85A 3WD4A 3GTYX 5DEZA 3KACA 1H0IA 2RUCA 3CHFA 2QF8A 2PI6A 2UZ5A 3UI4A 5J6EA 1LG1A 3PRBA 4JFLA 4XAKA 2K8IA 1NWRA 1E44A 2ZQTA 4MTVA 1BKFA 5HT1A 5HWBA 3KZ7A 4W9PA 5GQBA 3ARVA 3WL0A 5BXJA 1Q1CA 4TW8A 1E9LA 4HBOA 2DG3A 3EIPA 4URIA 4DZ3A 2KE0A 3UQBA 2MF9A 2PBCA 1Q6HA 2PN0A 1LL7A 4DRQA 4DRNA 1W1YA 5HW6A 4ZS6A 3KAGA 2XP8A 4DRKA 1FAPA 3O5QA 2VCDA 4UDMA 1ROTA 4LGXA 1ITXA 2VN1A 2DT1A 1QPLA 1D2KA 4ODRA 4W9QA 4QZVB 2JZVA 4R0XA 3FY1A 2DG4A 4MAVA 2ZQUA 3PRAA 4LAVA 1NH6A 1Q6UA 1W1TA 4O2TA 4FN2A 2A3AA 3BMBA 3MDYB 1NWUA 1WNOA 3AS0A 1ROUA 1EYMA 4P8UA 3KAFA 1ZBVA 2KGJA 2LPVA 1EDQA 1T11A 2MLYA 1P5QA 2PV3A 1GRJA 3KAHA 4IT4A 4Z2LA 1JVWA 3OA5A 1HJXA 3WL1A 4DRPA 1W9UA 2ZQSA 1BL4A 3CHEA 5D75A 1FKJA 3ARSA 3KABA 3PA7A 3RMEA 4DH0A 3CH9A 3KCEA 4Z2IA 4LAWA 1JNDA 2IUZA 1Y0OA 1M5YA 2DT3A 3B7XA 1FFQA 3B9EA 4HARA 3PRDA 1ZCNA 4DROA 2KFWA 4KQZA 1OGGA 1HJVA 1HKIA 3RGCA 4P8XA 3IKDA 1E6ZA 1X6LA 3KADA 1FJDA 3B9AA 5DIUA 3QOKA 1GPFA 1QZ2A 1XHGA 3AQUA 1FKTA 4ODQA 2M08A 1FKFA 4S3KA 4LAXA 3VAWA 4DRMA 3O5EA 4MNMA 4G2PA 1E6PA 1K9TA 2MNTA 1FKKA 2P4VA 1PBKA 5HTGA 2AWGA 1D6OA 3FAPA 4GIVA 4TYOA 4MSPA 2ESCA 3FXYA 1NMWA 4R5EA 1JNTA 2LKNA 3O5JA 2PV2A 1WB0A 3ARRA 4DWSA 3OOBA 1R9HA 4WJXA 4NNRA 4C02B 4J4NA 1JNSA 1FKBA 2WLYA 4IQ2A 1X6NA 3TC5A 4Z2JA 4ODLA 2FDMA 4DWSB 4ZPWR 4DWSD 3AS1A 2XP4A 4Z2HA 2KI3A 4ODOA 2WK2A 3WD1A 1FKLA 3ARTA 1FFRA 3ARQA 4ODKA 1J4IA 2RUDA 3WQWA 4U84A 1FKDA 1C9HA 4J4OA 3IHZA 3IKGA 1LL6A 2XPAA 5B8IC 2FKEA 1KT1A 1O6IA 4Z2KA 2L2SA 2DT2A 2DSUA 1UR9A 3CGMA 2YBTA 1EHNA 3TDBA 2DPEA 2RUQA 1IX5A 1LG2A 4KR0B 3B8SA 1FKRA 2MLXA 2MLZA 2M2AA 1D7IA 1CTNA 3O5FA 4WIWA 3ALFA 3ARPA 2PPPA 3CHDA 3NRKA
chains in the Genus database with same CATH topology
4WK9A 1XRVA 4QIBA 3CHCA 3WKZA 5HUAA 4P8WA 1D7HA 3ARXA 2DSWA 1J6YA 4TW7A 1W1VA 1D7JA 2G8ZA 1QPFA 3JYMA 2OFNA 4JFJA 3TCZA 2O92A 4L72B 4MPKA 5DO2A 2D9FA 4MGVA 2ITKA 1W26A 3O5LA 1YW5A 2IF4A 3RM9A 3O5KA 1E6RA 3LUOA 2RQSA 4ODMA 3CGNA 1GOIA 3O5IA 2N87A 1H0GA 3NI6A 3UI6A 3KAIA 2KO7A 1FKSA 1LJYA 1HXVA 3UF8A 3UI5A 3JXVA 1F8AB 2DSZA 1TFVA 4Q7NA 5DITA 4DRJA 2XPBA 1LQ0A 4ZPTR 4IT6A 1J4RA 3ALGA 5DF0A 4W5UA 5HKGA 2LJ4A 4Q22A 1W9VA 5GPRA 1EQ3A 3GPKA 3UQIA 1J4HA 1KT0A 3ODKA 4WKFA 2O9OA 4JFMA 2F4EA 1GUVA 4IQCA 3WQVA 3G6LA 1UR8A 4JFIA 2KR7A 2A3BA 1NMVA 3O5RA 1FKIA 3AROA 1VF8A 4ZPVR 1ZBKA 2DG9A 3H9RB 3I6CA 4QT3A 2G41A 1L1PA 3ARYA 1PINA 4U86A 1B6CA 3UQAA 3G6MA 2ZR5A 5I98A 4AY1A 1JNEA 4TW6A 2AOSA 2DT0A 2MPHA 1NWTA 3CZ8A 3PR9A 3RM8A 2XP5A 3RFWA 1TCOC 4LAYA 1ZBWA 3B9DA 2XP9A 4NZCA 5HBFA 4DRIA 1NWSA 3AS3A 2XP3A 5DIVA 4W9OA 1E15A 2Y78A 1WAWA 4NSBA 2OLHA 1SYTA 1N1AA 1ZL1A 1KFWA 1ZBCA 4TX0A 1HKKA 3O5GA 4ODPA 2YBUA 4MNLA 4ODNA 1W1PA 4L3NA 1FD9A 4DT4A 3O5DA 2ZR4A 5GPGA 3WD0A 1Q6IA 4TNSA 4ITZA 4DWSC 3NTPA 4WKHA 1HKMA 2DSVA 2WM0A 4PTMA 3W4RA 4HBEA 1OGBA 1LL4A 2FAPA 5HW8A 2PPNA 4BF8A 4Z2GA 1ZK6A 3ARWA 2F21A 1RD6A 2ZQVA 4DIPA 3O5PA 3RM4A 3O5OA 1FKHA 3ARZA 4G50A 4MNKA 3BXWA 3WIJA 4FAPA 1OWQA 1ZB5A 2Q5AA 1F40A 2RSEA 1HKJA 1HJWA 1ZU8A 1FKGA 2M1IA 1E6NA 1YATA 3WD2A 2A3EA 4QT2A 4S3JA 4N19A 2PPOA 1SR0A 2RURA 1U79A 4DRHA 3AS2A 3WD3A 3WH0A 5HW7A 4JYSA 2A3CA 5JH8A 1NSGA 4GGQA 2XP7A 3EY6A 2XP6A 2PV1A 3O5MA 5HWCA 4P8VA 4DZ2A 2LGOA 4WKAA 1EIBA 2F2DA 2ZR6A 3ARUA 1A7XA 3IK8A 1W9PA 4ML4A 4MNJA 4JFKA 4IPXA 3JYJA 2B31A 2WLZA 4U85A 3WD4A 5DEZA 3KACA 1H0IA 2RUCA 3CHFA 2QF8A 2PI6A 2UZ5A 3UI4A 5J6EA 1LG1A 3PRBA 4JFLA 4XAKA 2K8IA 1NWRA 2ZQTA 5HWBA 4MTVA 1BKFA 5HT1A 3KZ7A 4W9PA 5GQBA 3ARVA 3WL0A 5BXJA 1Q1CA 4TW8A 1E9LA 4HBOA 2DG3A 4URIA 4DZ3A 2KE0A 3UQBA 2MF9A 2PBCA 1Q6HA 1LL7A 4DRQA 4DRNA 1W1YA 5HW6A 4ZS6A 3KAGA 2XP8A 4DRKA 1FAPA 3O5QA 2VCDA 1ROTA 4LGXA 1ITXA 2VN1A 2DT1A 1QPLA 1D2KA 4ODRA 4W9QA 4QZVB 2JZVA 4R0XA 3FY1A 2DG4A 4MAVA 2ZQUA 3PRAA 4LAVA 1NH6A 1Q6UA 1W1TA 4O2TA 4FN2A 2A3AA 3MDYB 1NWUA 1WNOA 3AS0A 1ROUA 1EYMA 4P8UA 3KAFA 1ZBVA 2KGJA 2LPVA 1EDQA 1T11A 2MLYA 1P5QA 2PV3A 3KAHA 4IT4A 4Z2LA 1JVWA 3OA5A 1HJXA 3WL1A 4DRPA 1W9UA 2ZQSA 1BL4A 3CHEA 5D75A 1FKJA 3ARSA 3KABA 3PA7A 3RMEA 4DH0A 3CH9A 3KCEA 4Z2IA 4LAWA 1JNDA 2IUZA 1Y0OA 1M5YA 2DT3A 3B7XA 1FFQA 3B9EA 4HARA 3PRDA 1ZCNA 4DROA 2KFWA 4KQZA 1OGGA 1HJVA 1HKIA 3RGCA 4P8XA 3IKDA 1E6ZA 1X6LA 3KADA 1FJDA 3B9AA 5DIUA 3QOKA 1GPFA 1QZ2A 1XHGA 3AQUA 1FKTA 4ODQA 2M08A 1FKFA 4S3KA 4LAXA 3VAWA 4DRMA 3O5EA 4MNMA 4G2PA 1E6PA 1K9TA 2MNTA 1FKKA 1PBKA 5HTGA 2AWGA 1D6OA 3FAPA 4GIVA 4TYOA 4MSPA 2ESCA 3FXYA 1NMWA 4R5EA 1JNTA 2LKNA 3O5JA 2PV2A 1WB0A 3ARRA 4DWSA 3OOBA 1R9HA 4WJXA 4NNRA 4C02B 4J4NA 1JNSA 1FKBA 2WLYA 4IQ2A 1X6NA 3TC5A 4Z2JA 4ODLA 2FDMA 4DWSB 4ZPWR 4DWSD 3AS1A 2XP4A 4Z2HA 2KI3A 4ODOA 2WK2A 3WD1A 1FKLA 3ARTA 1FFRA 3ARQA 4ODKA 1J4IA 2RUDA 3WQWA 4U84A 1FKDA 1C9HA 4J4OA 3IHZA 3IKGA 1LL6A 2XPAA 5B8IC 2FKEA 1KT1A 1O6IA 4Z2KA 2L2SA 2DT2A 2DSUA 1UR9A 3CGMA 2YBTA 1EHNA 3TDBA 2DPEA 2RUQA 1IX5A 1LG2A 4KR0B 3B8SA 1FKRA 2MLXA 2MLZA 2M2AA 1D7IA 1CTNA 3O5FA 4WIWA 3ALFA 3ARPA 2PPPA 3CHDA 3NRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PV1 A;  3O5M A;  4QIB A;  4DZ2 A;  5HWC A;  2LGO A;  4TW6 A;  2F2D A;  2ZR6 A;  3PRD A;  5HUA A;  1ZCN A;  1D7H A;  4DRO A;  1A7X A;  2KFW A;  2MPH A;  3IK8 A;  4JFK A;  4IPX A;  1J6Y A;  3JYJ A;  4TW7 A;  2XP5 A;  4U85 A;  3RGC A;  1D7J A;  3RFW A;  3IKD A;  1TCO C;  1QPF A;  4LAY A;  3JYM A;  3KAC A;  3KAD A;  2XP9 A;  2RUC A;  1FJD A;  2OFN A;  4JFJ A;  3TCZ A;  4DRI A;  5DIU A;  2XP3 A;  3UI4 A;  2UZ5 A;  5J6E A;  5DIV A;  4W9O A;  1QZ2 A;  3PRB A;  4JFL A;  1FKT A;  2K8I A;  4ODQ A;  2D9F A;  4MGV A;  2Y78 A;  2ZQT A;  5HWB A;  1BKF A;  5HT1 A;  3KZ7 A;  2ITK A;  2M08 A;  1FKF A;  1W26 A;  4W9P A;  3O5L A;  1N1A A;  5BXJ A;  1Q1C A;  1YW5 A;  2IF4 A;  4TW8 A;  3O5K A;  3LUO A;  4LAX A;  4TX0 A;  2RQS A;  3O5G A;  4ODM A;  3CGN A;  3O5E A;  4ODP A;  3O5I A;  2N87 A;  3VAW A;  4DRM A;  2DG3 A;  3NI6 A;  4G2P A;  3UI6 A;  4ODN A;  2KE0 A;  4DZ3 A;  3KAI A;  2MNT A;  1FD9 A;  1FKK A;  2KO7 A;  2MF9 A;  1PBK A;  3UQB A;  2PBC A;  1Q6H A;  1FKS A;  4DRQ A;  4DRN A;  3O5D A;  4DT4 A;  3UF8 A;  5HTG A;  2ZR4 A;  2AWG A;  5GPG A;  3UI5 A;  1D6O A;  5HW6 A;  1Q6I A;  4TNS A;  4ITZ A;  3JXV A;  3FAP A;  3KAG A;  4GIV A;  3NTP A;  4TYO A;  2XP8 A;  4DRK A;  1F8A B;  1FAP A;  4MSP A;  4DRJ A;  5DIT A;  3O5Q A;  1ROT A;  2XPB A;  1NMW A;  1JNT A;  1J4R A;  2LKN A;  2FAP A;  5HKG A;  2LJ4 A;  5HW8 A;  2PPN A;  3O5J A;  4BF8 A;  2PV2 A;  2VN1 A;  1QPL A;  4ODR A;  4W9Q A;  1ZK6 A;  3OOB A;  1R9H A;  1EQ3 A;  3GPK A;  4NNR A;  2F21 A;  2JZV A;  4J4N A;  4R0X A;  3UQI A;  4C02 B;  1JNS A;  2DG4 A;  1FKB A;  1J4H A;  4IQ2 A;  3TC5 A;  1KT0 A;  4ODL A;  3ODK A;  2ZQU A;  2ZQV A;  4DIP A;  3O5P A;  4LAV A;  4JFM A;  2XP4 A;  4O2T A;  1Q6U A;  2KI3 A;  4FN2 A;  3MDY B;  3O5O A;  1FKH A;  4ODO A;  1FKL A;  2F4E A;  4IQC A;  1ROU A;  1EYM A;  4G50 A;  4ODK A;  1J4I A;  3KAF A;  2RUD A;  4JFI A;  4U84 A;  1FKD A;  1C9H A;  4J4O A;  3IHZ A;  3IKG A;  2XPA A;  2KR7 A;  4FAP A;  5B8I C;  2FKE A;  2Q5A A;  1NMV A;  1F40 A;  2KGJ A;  3O5R A;  1KT1 A;  2RSE A;  2LPV A;  1FKI A;  2L2S A;  1T11 A;  2MLY A;  1P5Q A;  2PV3 A;  1FKG A;  2M1I A;  3CGM A;  3KAH A;  1JVW A;  1YAT A;  3TDB A;  2RUQ A;  2DG9 A;  4QT2 A;  3H9R B;  4DRP A;  4N19 A;  2ZQS A;  2PPO A;  1BL4 A;  3I6C A;  1FKR A;  4QT3 A;  2RUR A;  1U79 A;  5D75 A;  1FKJ A;  3PA7 A;  3KAB A;  4DRH A;  1PIN A;  1L1P A;  1HXV A;  4U86 A;  2MLX A;  1B6C A;  2MLZ A;  3WH0 A;  4DH0 A;  5HW7 A;  2M2A A;  1D7I A;  4JYS A;  3O5F A;  3UQA A;  3KCE A;  4LAW A;  2ZR5 A;  1Y0O A;  1NSG A;  1M5Y A;  2PPP A;  4GGQ A;  5I98 A;  2XP7 A;  3EY6 A;  3B7X A;  2XP6 A;  3NRK A;  2VCD A; 
#chains in the Genus database with same CATH topology
 4WK9 A;  1XRV A;  4QIB A;  3CHC A;  3WKZ A;  5HUA A;  4P8W A;  1D7H A;  3ARX A;  2DSW A;  1J6Y A;  4TW7 A;  1W1V A;  1D7J A;  2G8Z A;  1QPF A;  3JYM A;  2OFN A;  4JFJ A;  3TCZ A;  2O92 A;  4L72 B;  4MPK A;  5DO2 A;  2D9F A;  4MGV A;  2ITK A;  3GU0 A;  1W26 A;  3O5L A;  1YW5 A;  2IF4 A;  3RM9 A;  3O5K A;  1E6R A;  3LUO A;  2RQS A;  4ODM A;  3CGN A;  1GOI A;  3O5I A;  2N87 A;  1H0G A;  3NI6 A;  3UI6 A;  3KAI A;  2KO7 A;  1FKS A;  1LJY A;  1HXV A;  3UF8 A;  3UI5 A;  3JXV A;  1F8A B;  2DSZ A;  1TFV A;  4Q7N A;  5DIT A;  4DRJ A;  2XPB A;  1LQ0 A;  4ZPT R;  4IT6 A;  1J4R A;  3ALG A;  5DF0 A;  4W5U A;  5HKG A;  2LJ4 A;  4Q22 A;  1W9V A;  5GPR A;  1EQ3 A;  3GPK A;  3UQI A;  1J4H A;  1KT0 A;  3ODK A;  4WKF A;  2O9O A;  4JFM A;  2F4E A;  1GUV A;  4IQC A;  3WQV A;  3G6L A;  1UR8 A;  4JFI A;  2KR7 A;  2A3B A;  1NMV A;  3O5R A;  1FKI A;  3ARO A;  2F23 A;  1VF8 A;  4ZPV R;  1JCH B;  1ZBK A;  2DG9 A;  3H9R B;  3I6C A;  4QT3 A;  2G41 A;  1L1P A;  3ARY A;  1PIN A;  4U86 A;  1B6C A;  3UQA A;  3G6M A;  2ZR5 A;  5I98 A;  4AY1 A;  1JNE A;  4TW6 A;  2AOS A;  2EUL A;  2DT0 A;  2MPH A;  1NWT A;  3CZ8 A;  3PR9 A;  3RM8 A;  2ETN A;  2XP5 A;  3RFW A;  1TCO C;  4LAY A;  1ZBW A;  3B9D A;  2XP9 A;  4NZC A;  5HBF A;  4DRI A;  1NWS A;  3AS3 A;  2XP3 A;  5DIV A;  4W9O A;  1E15 A;  2Y78 A;  1WAW A;  4NSB A;  2OLH A;  1SYT A;  1N1A A;  1ZL1 A;  1KFW A;  1ZBC A;  4TX0 A;  1HKK A;  3O5G A;  4ODP A;  2YBU A;  4MNL A;  4ODN A;  1W1P A;  4L3N A;  1FD9 A;  4DT4 A;  3O5D A;  2ZR4 A;  5GPG A;  3WD0 A;  1Q6I A;  4TNS A;  4ITZ A;  4DWS C;  3NTP A;  4WKH A;  1HKM A;  2DSV A;  2WM0 A;  4PTM A;  3W4R A;  4HBE A;  1OGB A;  1LL4 A;  2FAP A;  5HW8 A;  2PPN A;  4BF8 A;  4Z2G A;  1ZK6 A;  3ARW A;  2F21 A;  1RD6 A;  2ZQV A;  4DIP A;  3O5P A;  3RM4 A;  3O5O A;  1FKH A;  3ARZ A;  4G50 A;  4MNK A;  3BXW A;  3WIJ A;  4FAP A;  1OWQ A;  1ZB5 A;  2Q5A A;  1F40 A;  2RSE A;  1HKJ A;  1HJW A;  1ZU8 A;  1FKG A;  2M1I A;  1E6N A;  1YAT A;  3WD2 A;  2A3E A;  4QT2 A;  4S3J A;  4N19 A;  2PPO A;  1SR0 A;  2RUR A;  1U79 A;  4DRH A;  3AS2 A;  3WD3 A;  3WH0 A;  5HW7 A;  4JYS A;  2A3C A;  2B5U B;  5JH8 A;  1NSG A;  4GGQ A;  2XP7 A;  3EY6 A;  2XP6 A;  2PV1 A;  3O5M A;  5HWC A;  4P8V A;  4DZ2 A;  2LGO A;  4WKA A;  1EIB A;  2F2D A;  2ZR6 A;  3ARU A;  1A7X A;  3IK8 A;  1W9P A;  4ML4 A;  4MNJ A;  4JFK A;  4IPX A;  3JYJ A;  2B31 A;  2WLZ A;  4U85 A;  3WD4 A;  3GTY X;  5DEZ A;  3KAC A;  1H0I A;  2RUC A;  3CHF A;  2QF8 A;  2PI6 A;  2UZ5 A;  3UI4 A;  5J6E A;  1LG1 A;  3PRB A;  4JFL A;  4XAK A;  2K8I A;  1NWR A;  1E44 A;  2ZQT A;  4MTV A;  1BKF A;  5HT1 A;  5HWB A;  3KZ7 A;  4W9P A;  5GQB A;  3ARV A;  3WL0 A;  5BXJ A;  1Q1C A;  4TW8 A;  1E9L A;  4HBO A;  2DG3 A;  3EIP A;  4URI A;  4DZ3 A;  2KE0 A;  3UQB A;  2MF9 A;  2PBC A;  1Q6H A;  2PN0 A;  1LL7 A;  4DRQ A;  4DRN A;  1W1Y A;  5HW6 A;  4ZS6 A;  3KAG A;  2XP8 A;  4DRK A;  1FAP A;  3O5Q A;  2VCD A;  4UDM A;  1ROT A;  4LGX A;  1ITX A;  2VN1 A;  2DT1 A;  1QPL A;  1D2K A;  4ODR A;  4W9Q A;  4QZV B;  2JZV A;  4R0X A;  3FY1 A;  2DG4 A;  4MAV A;  2ZQU A;  3PRA A;  4LAV A;  1NH6 A;  1Q6U A;  1W1T A;  4O2T A;  4FN2 A;  2A3A A;  3BMB A;  3MDY B;  1NWU A;  1WNO A;  3AS0 A;  1ROU A;  1EYM A;  4P8U A;  3KAF A;  1ZBV A;  2KGJ A;  2LPV A;  1EDQ A;  1T11 A;  2MLY A;  1P5Q A;  2PV3 A;  1GRJ A;  3KAH A;  4IT4 A;  4Z2L A;  1JVW A;  3OA5 A;  1HJX A;  3WL1 A;  4DRP A;  1W9U A;  2ZQS A;  1BL4 A;  3CHE A;  5D75 A;  1FKJ A;  3ARS A;  3KAB A;  3PA7 A;  3RME A;  4DH0 A;  3CH9 A;  3KCE A;  4Z2I A;  4LAW A;  1JND A;  2IUZ A;  1Y0O A;  1M5Y A;  2DT3 A;  3B7X A;  1FFQ A;  3B9E A;  4HAR A;  3PRD A;  1ZCN A;  4DRO A;  2KFW A;  4KQZ A;  1OGG A;  1HJV A;  1HKI A;  3RGC A;  4P8X A;  3IKD A;  1E6Z A;  1X6L A;  3KAD A;  1FJD A;  3B9A A;  5DIU A;  3QOK A;  1GPF A;  1QZ2 A;  1XHG A;  3AQU A;  1FKT A;  4ODQ A;  2M08 A;  1FKF A;  4S3K A;  4LAX A;  3VAW A;  4DRM A;  3O5E A;  4MNM A;  4G2P A;  1E6P A;  1K9T A;  2MNT A;  1FKK A;  2P4V A;  1PBK A;  5HTG A;  2AWG A;  1D6O A;  3FAP A;  4GIV A;  4TYO A;  4MSP A;  2ESC A;  3FXY A;  1NMW A;  4R5E A;  1JNT A;  2LKN A;  3O5J A;  2PV2 A;  1WB0 A;  3ARR A;  4DWS A;  3OOB A;  1R9H A;  4WJX A;  4NNR A;  4C02 B;  4J4N A;  1JNS A;  1FKB A;  2WLY A;  4IQ2 A;  1X6N A;  3TC5 A;  4Z2J A;  4ODL A;  2FDM A;  4DWS B;  4ZPW R;  4DWS D;  3AS1 A;  2XP4 A;  4Z2H A;  2KI3 A;  4ODO A;  2WK2 A;  3WD1 A;  1FKL A;  3ART A;  1FFR A;  3ARQ A;  4ODK A;  1J4I A;  2RUD A;  3WQW A;  4U84 A;  1FKD A;  1C9H A;  4J4O A;  3IHZ A;  3IKG A;  1LL6 A;  2XPA A;  5B8I C;  2FKE A;  1KT1 A;  1O6I A;  4Z2K A;  2L2S A;  2DT2 A;  2DSU A;  1UR9 A;  3CGM A;  2YBT A;  1EHN A;  3TDB A;  2DPE A;  2RUQ A;  1IX5 A;  1LG2 A;  4KR0 B;  3B8S A;  1FKR A;  2MLX A;  2MLZ A;  2M2A A;  1D7I A;  1CTN A;  3O5F A;  4WIW A;  3ALF A;  3ARP A;  2PPP A;  3CHD A;  3NRK A; 
#chains in the Genus database with same CATH homology
 4WK9 A;  1XRV A;  4QIB A;  3CHC A;  3WKZ A;  5HUA A;  4P8W A;  1D7H A;  3ARX A;  2DSW A;  1J6Y A;  4TW7 A;  1W1V A;  1D7J A;  2G8Z A;  1QPF A;  3JYM A;  2OFN A;  4JFJ A;  3TCZ A;  2O92 A;  4L72 B;  4MPK A;  5DO2 A;  2D9F A;  4MGV A;  2ITK A;  1W26 A;  3O5L A;  1YW5 A;  2IF4 A;  3RM9 A;  3O5K A;  1E6R A;  3LUO A;  2RQS A;  4ODM A;  3CGN A;  1GOI A;  3O5I A;  2N87 A;  1H0G A;  3NI6 A;  3UI6 A;  3KAI A;  2KO7 A;  1FKS A;  1LJY A;  1HXV A;  3UF8 A;  3UI5 A;  3JXV A;  1F8A B;  2DSZ A;  1TFV A;  4Q7N A;  5DIT A;  4DRJ A;  2XPB A;  1LQ0 A;  4ZPT R;  4IT6 A;  1J4R A;  3ALG A;  5DF0 A;  4W5U A;  5HKG A;  2LJ4 A;  4Q22 A;  1W9V A;  5GPR A;  1EQ3 A;  3GPK A;  3UQI A;  1J4H A;  1KT0 A;  3ODK A;  4WKF A;  2O9O A;  4JFM A;  2F4E A;  1GUV A;  4IQC A;  3WQV A;  3G6L A;  1UR8 A;  4JFI A;  2KR7 A;  2A3B A;  1NMV A;  3O5R A;  1FKI A;  3ARO A;  1VF8 A;  4ZPV R;  1ZBK A;  2DG9 A;  3H9R B;  3I6C A;  4QT3 A;  2G41 A;  1L1P A;  3ARY A;  1PIN A;  4U86 A;  1B6C A;  3UQA A;  3G6M A;  2ZR5 A;  5I98 A;  4AY1 A;  1JNE A;  4TW6 A;  2AOS A;  2DT0 A;  2MPH A;  1NWT A;  3CZ8 A;  3PR9 A;  3RM8 A;  2XP5 A;  3RFW A;  1TCO C;  4LAY A;  1ZBW A;  3B9D A;  2XP9 A;  4NZC A;  5HBF A;  4DRI A;  1NWS A;  3AS3 A;  2XP3 A;  5DIV A;  4W9O A;  1E15 A;  2Y78 A;  1WAW A;  4NSB A;  2OLH A;  1SYT A;  1N1A A;  1ZL1 A;  1KFW A;  1ZBC A;  4TX0 A;  1HKK A;  3O5G A;  4ODP A;  2YBU A;  4MNL A;  4ODN A;  1W1P A;  4L3N A;  1FD9 A;  4DT4 A;  3O5D A;  2ZR4 A;  5GPG A;  3WD0 A;  1Q6I A;  4TNS A;  4ITZ A;  4DWS C;  3NTP A;  4WKH A;  1HKM A;  2DSV A;  2WM0 A;  4PTM A;  3W4R A;  4HBE A;  1OGB A;  1LL4 A;  2FAP A;  5HW8 A;  2PPN A;  4BF8 A;  4Z2G A;  1ZK6 A;  3ARW A;  2F21 A;  1RD6 A;  2ZQV A;  4DIP A;  3O5P A;  3RM4 A;  3O5O A;  1FKH A;  3ARZ A;  4G50 A;  4MNK A;  3BXW A;  3WIJ A;  4FAP A;  1OWQ A;  1ZB5 A;  2Q5A A;  1F40 A;  2RSE A;  1HKJ A;  1HJW A;  1ZU8 A;  1FKG A;  2M1I A;  1E6N A;  1YAT A;  3WD2 A;  2A3E A;  4QT2 A;  4S3J A;  4N19 A;  2PPO A;  1SR0 A;  2RUR A;  1U79 A;  4DRH A;  3AS2 A;  3WD3 A;  3WH0 A;  5HW7 A;  4JYS A;  2A3C A;  5JH8 A;  1NSG A;  4GGQ A;  2XP7 A;  3EY6 A;  2XP6 A;  2PV1 A;  3O5M A;  5HWC A;  4P8V A;  4DZ2 A;  2LGO A;  4WKA A;  1EIB A;  2F2D A;  2ZR6 A;  3ARU A;  1A7X A;  3IK8 A;  1W9P A;  4ML4 A;  4MNJ A;  4JFK A;  4IPX A;  3JYJ A;  2B31 A;  2WLZ A;  4U85 A;  3WD4 A;  5DEZ A;  3KAC A;  1H0I A;  2RUC A;  3CHF A;  2QF8 A;  2PI6 A;  2UZ5 A;  3UI4 A;  5J6E A;  1LG1 A;  3PRB A;  4JFL A;  4XAK A;  2K8I A;  1NWR A;  2ZQT A;  5HWB A;  4MTV A;  1BKF A;  5HT1 A;  3KZ7 A;  4W9P A;  5GQB A;  3ARV A;  3WL0 A;  5BXJ A;  1Q1C A;  4TW8 A;  1E9L A;  4HBO A;  2DG3 A;  4URI A;  4DZ3 A;  2KE0 A;  3UQB A;  2MF9 A;  2PBC A;  1Q6H A;  1LL7 A;  4DRQ A;  4DRN A;  1W1Y A;  5HW6 A;  4ZS6 A;  3KAG A;  2XP8 A;  4DRK A;  1FAP A;  3O5Q A;  2VCD A;  1ROT A;  4LGX A;  1ITX A;  2VN1 A;  2DT1 A;  1QPL A;  1D2K A;  4ODR A;  4W9Q A;  4QZV B;  2JZV A;  4R0X A;  3FY1 A;  2DG4 A;  4MAV A;  2ZQU A;  3PRA A;  4LAV A;  1NH6 A;  1Q6U A;  1W1T A;  4O2T A;  4FN2 A;  2A3A A;  3MDY B;  1NWU A;  1WNO A;  3AS0 A;  1ROU A;  1EYM A;  4P8U A;  3KAF A;  1ZBV A;  2KGJ A;  2LPV A;  1EDQ A;  1T11 A;  2MLY A;  1P5Q A;  2PV3 A;  3KAH A;  4IT4 A;  4Z2L A;  1JVW A;  3OA5 A;  1HJX A;  3WL1 A;  4DRP A;  1W9U A;  2ZQS A;  1BL4 A;  3CHE A;  5D75 A;  1FKJ A;  3ARS A;  3KAB A;  3PA7 A;  3RME A;  4DH0 A;  3CH9 A;  3KCE A;  4Z2I A;  4LAW A;  1JND A;  2IUZ A;  1Y0O A;  1M5Y A;  2DT3 A;  3B7X A;  1FFQ A;  3B9E A;  4HAR A;  3PRD A;  1ZCN A;  4DRO A;  2KFW A;  4KQZ A;  1OGG A;  1HJV A;  1HKI A;  3RGC A;  4P8X A;  3IKD A;  1E6Z A;  1X6L A;  3KAD A;  1FJD A;  3B9A A;  5DIU A;  3QOK A;  1GPF A;  1QZ2 A;  1XHG A;  3AQU A;  1FKT A;  4ODQ A;  2M08 A;  1FKF A;  4S3K A;  4LAX A;  3VAW A;  4DRM A;  3O5E A;  4MNM A;  4G2P A;  1E6P A;  1K9T A;  2MNT A;  1FKK A;  1PBK A;  5HTG A;  2AWG A;  1D6O A;  3FAP A;  4GIV A;  4TYO A;  4MSP A;  2ESC A;  3FXY A;  1NMW A;  4R5E A;  1JNT A;  2LKN A;  3O5J A;  2PV2 A;  1WB0 A;  3ARR A;  4DWS A;  3OOB A;  1R9H A;  4WJX A;  4NNR A;  4C02 B;  4J4N A;  1JNS A;  1FKB A;  2WLY A;  4IQ2 A;  1X6N A;  3TC5 A;  4Z2J A;  4ODL A;  2FDM A;  4DWS B;  4ZPW R;  4DWS D;  3AS1 A;  2XP4 A;  4Z2H A;  2KI3 A;  4ODO A;  2WK2 A;  3WD1 A;  1FKL A;  3ART A;  1FFR A;  3ARQ A;  4ODK A;  1J4I A;  2RUD A;  3WQW A;  4U84 A;  1FKD A;  1C9H A;  4J4O A;  3IHZ A;  3IKG A;  1LL6 A;  2XPA A;  5B8I C;  2FKE A;  1KT1 A;  1O6I A;  4Z2K A;  2L2S A;  2DT2 A;  2DSU A;  1UR9 A;  3CGM A;  2YBT A;  1EHN A;  3TDB A;  2DPE A;  2RUQ A;  1IX5 A;  1LG2 A;  4KR0 B;  3B8S A;  1FKR A;  2MLX A;  2MLZ A;  2M2A A;  1D7I A;  1CTN A;  3O5F A;  4WIW A;  3ALF A;  3ARP A;  2PPP A;  3CHD A;  3NRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...