4DRIA

Co-crystal structure of the ppiase domain of fkbp51, rapamycin and the frb fragment of mtor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
121
structure length
121
Chain Sequence
EQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
total genus 32
structure length 121
sequence length 121
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4driA00
3KAIA 4ODKA 2F4EA 1U79A 2XPBA 1R9HA 3KABA 3O5KA 1YATA 1W26A 2M08A 3MDYB 1J4HA 4JFJA 1TCOC 2VN1A 1NSGA 1D7HA 4DRNA 3NI6A 4MGVA 1FKLA 4JYSA 1JNSA 4JFLA 4W9OA 1L1PA 2XP8A 3O5GA 1QPLA 2F21A 4TW6A 3RGCA 3PRBA 3I6CA 4U86A 5HKGA 1ZK6A 2ZQTA 4FN2A 2OFNA 4R0XA 2KR7A 3O5QA 1J4IA 3KAGA 4ODOA 3WH0A 5HW6A 3O5FA 1JNTA 2N87A 5HW8A 3O5LA 4ODRA 3KAHA 2PPNA 3O5RA 3O5IA 4DIPA 2LGOA 2MNTA 4JFIA 4QT3A 2KE0A 2LJ4A 2M1IA 2MLYA 5DITA 3TDBA 3O5EA 4QT2A 3UQIA 4G50A 4DZ3A 4NNRA 2XP4A 2RSEA 5HWBA 2KGJA 3O5MA 1FKGA 4DROA 2RUCA 1FKDA 1YW5A 4GIVA 5HT1A 2Y78A 4TNSA 2RURA 4LAXA 1JVWA 4O2TA 3UI6A 2KFWA 3IHZA 1FKTA 1D7IA 1PBKA 4FAPA 1FKRA 3IK8A 4ODLA 4LAVA 1QPFA 4QIBA 4IQCA 2XP3A 2DG3A 4ODMA 2XPAA 1FD9A 1ZCNA 4J4OA 1FKIA 5I98A 1Q1CA 1FKJA 2MPHA 4U84A 1FKSA 1Q6UA 3KADA 5HUAA 4ODNA 4DRQA 1J6YA 5HTGA 2XP6A 2MLXA 1HXVA 2F2DA 3O5PA 2XP5A 2Q5AA 5J6EA 2ZR4A 3O5OA 4W9PA 4C02B 2ZQSA 3JXVA 4DRHA 4JFMA 4W9QA 2MLZA 2KO7A 1FKFA 2XP9A 3H9RB 3JYMA 1BL4A 2MF9A 4IQ2A 3ODKA 3UQAA 2M2AA 4ODPA 3UQBA 1NMWA 2D9FA 3TC5A 4N19A 3KCEA 3VAWA 2ITKA 2ZR5A 1D6OA 3B7XA 5GPGA 3FAPA 4J4NA 1F8AB 4DH0A 2L2SA 3CGMA 2FAPA 5HW7A 1KT1A 2PV2A 1FKBA 4IPXA 5D75A 4DT4A 2JZVA 4DRKA 5DIVA 2LPVA 1J4RA 1FKHA 1P5QA 5BXJA 3PA7A 3IKGA 2RUDA 4DRIA 2K8IA 2PV1A 5B8IC 4LAYA 5HWCA 1EQ3A 3O5JA 1ROTA 2PBCA 1KT0A 4JFKA 4TX0A 1QZ2A 4DRPA 2RUQA 2UZ5A 1Y0OA 1A7XA 3UF8A 2FKEA 2PPOA 2ZR6A 4GGQA 1ROUA 3LUOA 4DRMA 4LAWA 3EY6A 3KACA 3RFWA 1EYMA 2XP7A 3KAFA 2IF4A 1M5YA 1FAPA 4DRJA 3TCZA 3PRDA 3UI5A 2DG4A 1N1AA 2ZQVA 4BF8A 1Q6IA 2VCDA 3OOBA 4MSPA 4TW8A 4G2PA 4U85A 2PPPA 4ITZA 4ODQA 1Q6HA 1T11A 1PINA 1BKFA 2AWGA 2DG9A 1B6CA 3IKDA 2RQSA 3KZ7A 1C9HA 3NRKA 3O5DA 5DIUA 3UI4A 4TW7A 1NMVA 4DZ2A 2KI3A 3CGNA 3NTPA 1FJDA 3GPKA 2ZQUA 4TYOA 1FKKA 2PV3A 3JYJA 1D7JA 1F40A 2LKNA
chains in the Genus database with same CATH superfamily
2G8ZA 2F4EA 5DF0A 2WM0A 3KABA 3O5KA 1W26A 4JFJA 3RMEA 1TCOC 2ETNA 3ARTA 4JYSA 4P8UA 4JFLA 2XP8A 1QPLA 2PI6A 4IT4A 1XRVA 2OFNA 4NSBA 4R0XA 4ODOA 3WH0A 2A3EA 3KAGA 3CHCA 1JNTA 4WKFA 3ARVA 1KFWA 1E44A 1W9VA 4W5UA 2PPNA 4ZS6A 1K9TA 4DIPA 3WD2A 2MNTA 4Q22A 2LJ4A 1ITXA 3AS0A 1E15A 3RM8A 2RSEA 4ZPWR 3WD3A 5HT1A 2Y78A 1LL4A 2RURA 1JVWA 2KFWA 1FKRA 1E6RA 4ODLA 4LAVA 4QIBA 4IQCA 4P8XA 1ZCNA 4Z2KA 5JH8A 3WD1A 3KADA 1J6YA 4DRQA 5HTGA 2MLXA 2WK2A 2XP5A 2Q5AA 1HKJA 4DRHA 2MLZA 2KO7A 1H0IA 3UQBA 2D9FA 4AY1A 4KR0B 2G41A 2YBTA 1OGGA 5HW7A 3B9AA 1E6ZA 1FKHA 5BXJA 3AQUA 3PA7A 4Q7NA 3ARXA 4LAYA 1OGBA 5HWCA 4TX0A 4JFKA 1QZ2A 1W1TA 1Y0OA 5GPRA 4GGQA 4HBOA 3LUOA 4Z2JA 3RFWA 4DRJA 3KAFA 2DSVA 1ZBVA 3UI5A 4BF8A 1Q6IA 3OOBA 1IX5A 2WLZA 2PPPA 4ODQA 3IKDA 1T11A 1PINA 2FDMA 3O5LA 4WIWA 5DIUA 2KI3A 3G6LA 2ZQUA 4TYOA 2PV3A 1EHNA 4S3KA 3GTYX 1HJXA 1ZBWA 4DRNA 4MGVA 1FKLA 1JNSA 4W9OA 2F21A 5DO2A 3RGCA 3PRBA 3I6CA 2ZQTA 4FN2A 2KR7A 3O5QA 1J4IA 2DT1A 3O5RA 2LGOA 1HJVA 4QT3A 1E6NA 5DITA 2M1IA 3GU0A 1O6IA 4MTVA 4DROA 1YW5A 3BMBA 4TNSA 1GUVA 3UI6A 4LGXA 3IHZA 4FAPA 1VF8A 2XP3A 2O9OA 1ZU8A 5I98A 1WAWA 4KQZA 2XP6A 4ZPVR 1LL7A 3O5PA 5J6EA 3O5OA 3CH9A 4W9PA 4W9QA 4DWSB 2B5UB 2XP9A 1BL4A 1LQ0A 2MF9A 2EULA 4ODPA 4N19A 3KCEA 3VAWA 2ITKA 4DWSC 1UR8A 1D6OA 3B7XA 3AS2A 3FAPA 5GPGA 4DH0A 1F8AB 3CGMA 1GRJA 1NWRA 4P8VA 4DT4A 4DRKA 2LPVA 1J4RA 1OWQA 3ARQA 1HXVA 2RUDA 4DRIA 2K8IA 2PV1A 5B8IC 2PBCA 3QOKA 3ARSA 4L72B 1LL6A 2P4VA 2O92A 2PPOA 1ROUA 5DEZA 1LG1A 2F23A 2XP7A 3AS1A 1M5YA 1FAPA 2ZQVA 1W1VA 1X6NA 4TW8A 4G2PA 4U85A 1HKKA 5HW8A 5HUAA 1GOIA 2RQSA 3KZ7A 3CGNA 3WD4A 1NH6A 3GPKA 1FKKA 3WL1A 2UZ5A 1U79A 2XPBA 1R9HA 1W1PA 3ARWA 2M08A 3MDYB 1EIBA 2OLHA 4UDMA 1E6PA 3EIPA 3NI6A 3B9DA 1W9UA 4TW6A 4U86A 1ZK6A 3ARPA 1X6LA 4MPKA 2DPEA 2N87A 3ARYA 4Z2HA 1NWUA 3WIJA 3ALFA 1SR0A 5GQBA 3CZ8A 4XAKA 4JFIA 2PN0A 5HBFA 1W1YA 4QT2A 4MNJA 4S3JA 2XP4A 5HWBA 4PTMA 3O5MA 1FKGA 1FKDA 4GIVA 3RM9A 4LAXA 4O2TA 1D7IA 2DSUA 4P8WA 2DSWA 1QPFA 1NWTA 3B9EA 4R5EA 2DG3A 4ODMA 2DT3A 1HKIA 1FKJA 1ZB5A 1Q6UA 3WL0A 4DWSD 2ZR4A 2ZQSA 4JFMA 1FKFA 2YBUA 4URIA 4IQ2A 4QZVB 3UQAA 2M2AA 1NMWA 3ARUA 3TC5A 1WB0A 2ZR5A 1RD6A 1HKMA 4J4NA 2DSZA 2L2SA 3W4RA 1KT1A 1FKBA 5D75A 1P5QA 3ARZA 1FFQA 2DT2A 3BXWA 1NWSA 3O5JA 2ESCA 3AS3A 1A7XA 2FKEA 2ZR6A 4DRMA 3KACA 2IF4A 3ALGA 4MAVA 3TCZA 3PR9A 4Z2LA 3B8SA 2VCDA 4DWSA 4MSPA 1Q6HA 1LG2A 2DG9A 1B6CA 3O5DA 2A3BA 4TW7A 4DZ2A 2QF8A 1FJDA 1JCHB 3NTPA 4Z2GA 3CHFA 1H0GA 3KAIA 4ODKA 1UR9A 3WKZA 1YATA 1ZBCA 1J4HA 3RM4A 2VN1A 1NSGA 1D7HA 2A3AA 4HBEA 1L1PA 1JNDA 3O5GA 1ZL1A 5HKGA 4MNLA 3G6MA 3OA5A 5HW6A 3O5FA 3WQWA 1WNOA 4ZPTR 4ODRA 3KAHA 4NZCA 3O5IA 1FFRA 2KE0A 2MLYA 3TDBA 3O5EA 3FXYA 1D2KA 3UQIA 4G50A 4DZ3A 4NNRA 3PRAA 1SYTA 4ML4A 2KGJA 3ARRA 2RUCA 1ZBKA 4WK9A 4MNMA 1FKTA 1PBKA 3IK8A 2XPAA 1FD9A 4J4OA 2WLYA 1FKIA 1Q1CA 2MPHA 3AROA 4U84A 1FKSA 4ODNA 3WQVA 1JNEA 2F2DA 1W9PA 2B31A 4C02B 3JXVA 3CHDA 1HJWA 3H9RB 4WKAA 3JYMA 2IUZA 3ODKA 4WJXA 3WD0A 2FAPA 2PV2A 4IPXA 2JZVA 5DIVA 3FY1A 3IKGA 1EQ3A 1TFVA 1ROTA 1KT0A 4IT6A 4DRPA 1EDQA 2RUQA 1GPFA 3UF8A 4HARA 4LAWA 3EY6A 1EYMA 1LJYA 4L3NA 3PRDA 2DG4A 1N1AA 2AOSA 1XHGA 2DT0A 4ITZA 4Z2IA 3CHEA 2AWGA 1BKFA 4WKHA 3NRKA 3UI4A 1C9HA 4MNKA 1NMVA 1E9LA 3JYJA 1CTNA 1D7JA 1F40A 2A3CA 2LKNA
chains in the Genus database with same CATH topology
2G8ZA 2F4EA 5DF0A 2WM0A 3KABA 3O5KA 1W26A 4JFJA 3RMEA 1TCOC 3ARTA 4JYSA 4P8UA 4JFLA 2XP8A 1QPLA 2PI6A 4IT4A 1XRVA 2OFNA 4NSBA 4R0XA 4ODOA 3WH0A 2A3EA 3KAGA 3CHCA 1JNTA 4WKFA 3ARVA 1KFWA 1W9VA 4W5UA 2PPNA 4ZS6A 1K9TA 4DIPA 3WD2A 2MNTA 4Q22A 2LJ4A 1ITXA 3AS0A 1E15A 3RM8A 2RSEA 4ZPWR 3WD3A 5HT1A 2Y78A 1LL4A 2RURA 1JVWA 2KFWA 1FKRA 1E6RA 4ODLA 4LAVA 4QIBA 4IQCA 4P8XA 1ZCNA 4Z2KA 5JH8A 3WD1A 3KADA 1J6YA 4DRQA 5HTGA 2MLXA 2WK2A 2XP5A 2Q5AA 1HKJA 4DRHA 2MLZA 2KO7A 1H0IA 3UQBA 2D9FA 4AY1A 4KR0B 2G41A 2YBTA 1OGGA 5HW7A 3B9AA 1E6ZA 1FKHA 5BXJA 3AQUA 3PA7A 4Q7NA 3ARXA 4LAYA 1OGBA 5HWCA 4TX0A 4JFKA 1QZ2A 1W1TA 1Y0OA 5GPRA 4GGQA 4HBOA 3LUOA 4Z2JA 3RFWA 4DRJA 3KAFA 2DSVA 1ZBVA 3UI5A 4BF8A 1Q6IA 3OOBA 1IX5A 2WLZA 2PPPA 4ODQA 3IKDA 3O5LA 1T11A 1PINA 2FDMA 4WIWA 5DIUA 2KI3A 3G6LA 2ZQUA 4TYOA 2PV3A 1EHNA 4S3KA 1HJXA 1ZBWA 4DRNA 4MGVA 1FKLA 1JNSA 4W9OA 2F21A 5DO2A 3RGCA 3PRBA 3I6CA 2ZQTA 4FN2A 2KR7A 3O5QA 1J4IA 2DT1A 3O5RA 2LGOA 1HJVA 4QT3A 1E6NA 5DITA 2M1IA 1O6IA 4MTVA 4DROA 1YW5A 4TNSA 1GUVA 3UI6A 4LGXA 3IHZA 4FAPA 1VF8A 2XP3A 2O9OA 1ZU8A 5I98A 1WAWA 4KQZA 2XP6A 4ZPVR 1LL7A 3O5PA 5J6EA 3O5OA 3CH9A 4W9PA 4W9QA 4DWSB 2XP9A 1BL4A 1LQ0A 2MF9A 4ODPA 4N19A 3KCEA 3VAWA 2ITKA 4DWSC 1UR8A 1D6OA 3B7XA 3AS2A 3FAPA 5GPGA 4DH0A 1F8AB 3CGMA 1NWRA 4P8VA 4DT4A 4DRKA 2LPVA 1J4RA 1OWQA 3ARQA 1HXVA 2RUDA 4DRIA 2K8IA 2PV1A 5B8IC 2PBCA 3QOKA 3ARSA 4L72B 1LL6A 2O92A 2PPOA 1ROUA 5DEZA 1LG1A 2XP7A 3AS1A 1M5YA 1FAPA 2ZQVA 1W1VA 1X6NA 4TW8A 4G2PA 4U85A 1HKKA 5HW8A 5HUAA 1GOIA 2RQSA 3KZ7A 3CGNA 3WD4A 1NH6A 3GPKA 1FKKA 3WL1A 2UZ5A 1U79A 2XPBA 1R9HA 1W1PA 3ARWA 2M08A 3MDYB 1EIBA 2OLHA 1E6PA 3NI6A 3B9DA 1W9UA 4TW6A 4U86A 1ZK6A 3ARPA 1X6LA 4MPKA 2DPEA 2N87A 3ARYA 4Z2HA 1NWUA 3WIJA 3ALFA 1SR0A 5GQBA 3CZ8A 4XAKA 4JFIA 5HBFA 1W1YA 4QT2A 4MNJA 4S3JA 2XP4A 5HWBA 4PTMA 3O5MA 1FKGA 1FKDA 4GIVA 3RM9A 4LAXA 4O2TA 1D7IA 2DSUA 4P8WA 2DSWA 1QPFA 1NWTA 3B9EA 4R5EA 2DG3A 4ODMA 2DT3A 1HKIA 1FKJA 1ZB5A 1Q6UA 3WL0A 4DWSD 2ZR4A 2ZQSA 4JFMA 1FKFA 2YBUA 4URIA 4IQ2A 4QZVB 3UQAA 2M2AA 1NMWA 3ARUA 3TC5A 1WB0A 2ZR5A 1RD6A 1HKMA 4J4NA 2DSZA 2L2SA 3W4RA 1KT1A 1FKBA 5D75A 1P5QA 3ARZA 1FFQA 2DT2A 3BXWA 1NWSA 3O5JA 2ESCA 3AS3A 1A7XA 2FKEA 2ZR6A 4DRMA 3KACA 2IF4A 3ALGA 4MAVA 3TCZA 3PR9A 4Z2LA 3B8SA 2VCDA 4DWSA 4MSPA 1Q6HA 1LG2A 2DG9A 1B6CA 3O5DA 2A3BA 4TW7A 4DZ2A 2QF8A 1FJDA 3NTPA 4Z2GA 3CHFA 1H0GA 3KAIA 4ODKA 1UR9A 3WKZA 1YATA 1ZBCA 1J4HA 3RM4A 2VN1A 1NSGA 1D7HA 2A3AA 4HBEA 1L1PA 1JNDA 3O5GA 1ZL1A 5HKGA 4MNLA 3G6MA 3OA5A 5HW6A 3O5FA 3WQWA 1WNOA 4ZPTR 4ODRA 3KAHA 4NZCA 3O5IA 1FFRA 2KE0A 2MLYA 3TDBA 3O5EA 3FXYA 1D2KA 3UQIA 4G50A 4DZ3A 4NNRA 3PRAA 1SYTA 4ML4A 2KGJA 3ARRA 2RUCA 1ZBKA 4WK9A 4MNMA 1FKTA 1PBKA 3IK8A 2XPAA 1FD9A 4J4OA 2WLYA 1FKIA 1Q1CA 2MPHA 3AROA 4U84A 1FKSA 4ODNA 3WQVA 1JNEA 2F2DA 1W9PA 2B31A 4C02B 3JXVA 3CHDA 1HJWA 3H9RB 4WKAA 3JYMA 2IUZA 3ODKA 4WJXA 3WD0A 2FAPA 2PV2A 4IPXA 2JZVA 5DIVA 3FY1A 3IKGA 1EQ3A 1TFVA 1ROTA 1KT0A 4IT6A 4DRPA 1EDQA 2RUQA 1GPFA 3UF8A 4HARA 4LAWA 3EY6A 1EYMA 1LJYA 4L3NA 3PRDA 2DG4A 1N1AA 2AOSA 1XHGA 2DT0A 4ITZA 4Z2IA 3CHEA 2AWGA 1BKFA 4WKHA 3NRKA 3UI4A 1C9HA 4MNKA 1NMVA 1E9LA 3JYJA 1CTNA 1D7JA 1F40A 2A3CA 2LKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAI A;  4ODK A;  2F4E A;  1U79 A;  2XPB A;  1R9H A;  3KAB A;  3O5K A;  1YAT A;  1W26 A;  2M08 A;  3MDY B;  1J4H A;  4JFJ A;  1TCO C;  2VN1 A;  1NSG A;  1D7H A;  4DRN A;  3NI6 A;  4MGV A;  1FKL A;  4JYS A;  1JNS A;  4JFL A;  4W9O A;  1L1P A;  2XP8 A;  3O5G A;  1QPL A;  2F21 A;  4TW6 A;  3RGC A;  3PRB A;  3I6C A;  4U86 A;  5HKG A;  1ZK6 A;  2ZQT A;  4FN2 A;  2OFN A;  4R0X A;  2KR7 A;  3O5Q A;  1J4I A;  3KAG A;  4ODO A;  3WH0 A;  5HW6 A;  3O5F A;  1JNT A;  2N87 A;  5HW8 A;  3O5L A;  4ODR A;  3KAH A;  2PPN A;  3O5R A;  3O5I A;  4DIP A;  2LGO A;  2MNT A;  4JFI A;  4QT3 A;  2KE0 A;  2LJ4 A;  2M1I A;  2MLY A;  5DIT A;  3TDB A;  3O5E A;  4QT2 A;  3UQI A;  4G50 A;  4DZ3 A;  4NNR A;  2XP4 A;  2RSE A;  5HWB A;  2KGJ A;  3O5M A;  1FKG A;  4DRO A;  2RUC A;  1FKD A;  1YW5 A;  4GIV A;  5HT1 A;  2Y78 A;  4TNS A;  2RUR A;  4LAX A;  1JVW A;  4O2T A;  3UI6 A;  2KFW A;  3IHZ A;  1FKT A;  1D7I A;  1PBK A;  4FAP A;  1FKR A;  3IK8 A;  4ODL A;  4LAV A;  1QPF A;  4QIB A;  4IQC A;  2XP3 A;  2DG3 A;  4ODM A;  2XPA A;  1FD9 A;  1ZCN A;  4J4O A;  1FKI A;  5I98 A;  1Q1C A;  1FKJ A;  2MPH A;  4U84 A;  1FKS A;  1Q6U A;  3KAD A;  5HUA A;  4ODN A;  4DRQ A;  1J6Y A;  5HTG A;  2XP6 A;  2MLX A;  1HXV A;  2F2D A;  3O5P A;  2XP5 A;  2Q5A A;  5J6E A;  2ZR4 A;  3O5O A;  4W9P A;  4C02 B;  2ZQS A;  3JXV A;  4DRH A;  4JFM A;  4W9Q A;  2MLZ A;  2KO7 A;  1FKF A;  2XP9 A;  3H9R B;  3JYM A;  1BL4 A;  2MF9 A;  4IQ2 A;  3ODK A;  3UQA A;  2M2A A;  4ODP A;  3UQB A;  1NMW A;  2D9F A;  3TC5 A;  4N19 A;  3KCE A;  3VAW A;  2ITK A;  2ZR5 A;  1D6O A;  3B7X A;  5GPG A;  3FAP A;  4J4N A;  1F8A B;  4DH0 A;  2L2S A;  3CGM A;  2FAP A;  5HW7 A;  1KT1 A;  2PV2 A;  1FKB A;  4IPX A;  5D75 A;  4DT4 A;  2JZV A;  4DRK A;  5DIV A;  2LPV A;  1J4R A;  1FKH A;  1P5Q A;  5BXJ A;  3PA7 A;  3IKG A;  2RUD A;  4DRI A;  2K8I A;  2PV1 A;  5B8I C;  4LAY A;  5HWC A;  1EQ3 A;  3O5J A;  1ROT A;  2PBC A;  1KT0 A;  4JFK A;  4TX0 A;  1QZ2 A;  4DRP A;  2RUQ A;  2UZ5 A;  1Y0O A;  1A7X A;  3UF8 A;  2FKE A;  2PPO A;  2ZR6 A;  4GGQ A;  1ROU A;  3LUO A;  4DRM A;  4LAW A;  3EY6 A;  3KAC A;  3RFW A;  1EYM A;  2XP7 A;  3KAF A;  2IF4 A;  1M5Y A;  1FAP A;  4DRJ A;  3TCZ A;  3PRD A;  3UI5 A;  2DG4 A;  1N1A A;  2ZQV A;  4BF8 A;  1Q6I A;  2VCD A;  3OOB A;  4MSP A;  4TW8 A;  4G2P A;  4U85 A;  2PPP A;  4ITZ A;  4ODQ A;  1Q6H A;  1T11 A;  1PIN A;  1BKF A;  2AWG A;  2DG9 A;  1B6C A;  3IKD A;  2RQS A;  3KZ7 A;  1C9H A;  3NRK A;  3O5D A;  5DIU A;  3UI4 A;  4TW7 A;  1NMV A;  4DZ2 A;  2KI3 A;  3CGN A;  3NTP A;  1FJD A;  3GPK A;  2ZQU A;  4TYO A;  1FKK A;  2PV3 A;  3JYJ A;  1D7J A;  1F40 A;  2LKN A; 
#chains in the Genus database with same CATH topology
 2G8Z A;  2F4E A;  5DF0 A;  2WM0 A;  3KAB A;  3O5K A;  1W26 A;  4JFJ A;  3RME A;  1TCO C;  2ETN A;  3ART A;  4JYS A;  4P8U A;  4JFL A;  2XP8 A;  1QPL A;  2PI6 A;  4IT4 A;  1XRV A;  2OFN A;  4NSB A;  4R0X A;  4ODO A;  3WH0 A;  2A3E A;  3KAG A;  3CHC A;  1JNT A;  4WKF A;  3ARV A;  1KFW A;  1E44 A;  1W9V A;  4W5U A;  2PPN A;  4ZS6 A;  1K9T A;  4DIP A;  3WD2 A;  2MNT A;  4Q22 A;  2LJ4 A;  1ITX A;  3AS0 A;  1E15 A;  3RM8 A;  2RSE A;  4ZPW R;  3WD3 A;  5HT1 A;  2Y78 A;  1LL4 A;  2RUR A;  1JVW A;  2KFW A;  1FKR A;  1E6R A;  4ODL A;  4LAV A;  4QIB A;  4IQC A;  4P8X A;  1ZCN A;  4Z2K A;  5JH8 A;  3WD1 A;  3KAD A;  1J6Y A;  4DRQ A;  5HTG A;  2MLX A;  2WK2 A;  2XP5 A;  2Q5A A;  1HKJ A;  4DRH A;  2MLZ A;  2KO7 A;  1H0I A;  3UQB A;  2D9F A;  4AY1 A;  4KR0 B;  2G41 A;  2YBT A;  1OGG A;  5HW7 A;  3B9A A;  1E6Z A;  1FKH A;  5BXJ A;  3AQU A;  3PA7 A;  4Q7N A;  3ARX A;  4LAY A;  1OGB A;  5HWC A;  4TX0 A;  4JFK A;  1QZ2 A;  1W1T A;  1Y0O A;  5GPR A;  4GGQ A;  4HBO A;  3LUO A;  4Z2J A;  3RFW A;  4DRJ A;  3KAF A;  2DSV A;  1ZBV A;  3UI5 A;  4BF8 A;  1Q6I A;  3OOB A;  1IX5 A;  2WLZ A;  2PPP A;  4ODQ A;  3IKD A;  1T11 A;  1PIN A;  2FDM A;  3O5L A;  4WIW A;  5DIU A;  2KI3 A;  3G6L A;  2ZQU A;  4TYO A;  2PV3 A;  1EHN A;  4S3K A;  3GTY X;  1HJX A;  1ZBW A;  4DRN A;  4MGV A;  1FKL A;  1JNS A;  4W9O A;  2F21 A;  5DO2 A;  3RGC A;  3PRB A;  3I6C A;  2ZQT A;  4FN2 A;  2KR7 A;  3O5Q A;  1J4I A;  2DT1 A;  3O5R A;  2LGO A;  1HJV A;  4QT3 A;  1E6N A;  5DIT A;  2M1I A;  3GU0 A;  1O6I A;  4MTV A;  4DRO A;  1YW5 A;  3BMB A;  4TNS A;  1GUV A;  3UI6 A;  4LGX A;  3IHZ A;  4FAP A;  1VF8 A;  2XP3 A;  2O9O A;  1ZU8 A;  5I98 A;  1WAW A;  4KQZ A;  2XP6 A;  4ZPV R;  1LL7 A;  3O5P A;  5J6E A;  3O5O A;  3CH9 A;  4W9P A;  4W9Q A;  4DWS B;  2B5U B;  2XP9 A;  1BL4 A;  1LQ0 A;  2MF9 A;  2EUL A;  4ODP A;  4N19 A;  3KCE A;  3VAW A;  2ITK A;  4DWS C;  1UR8 A;  1D6O A;  3B7X A;  3AS2 A;  3FAP A;  5GPG A;  4DH0 A;  1F8A B;  3CGM A;  1GRJ A;  1NWR A;  4P8V A;  4DT4 A;  4DRK A;  2LPV A;  1J4R A;  1OWQ A;  3ARQ A;  1HXV A;  2RUD A;  4DRI A;  2K8I A;  2PV1 A;  5B8I C;  2PBC A;  3QOK A;  3ARS A;  4L72 B;  1LL6 A;  2P4V A;  2O92 A;  2PPO A;  1ROU A;  5DEZ A;  1LG1 A;  2F23 A;  2XP7 A;  3AS1 A;  1M5Y A;  1FAP A;  2ZQV A;  1W1V A;  1X6N A;  4TW8 A;  4G2P A;  4U85 A;  1HKK A;  5HW8 A;  5HUA A;  1GOI A;  2RQS A;  3KZ7 A;  3CGN A;  3WD4 A;  1NH6 A;  3GPK A;  1FKK A;  3WL1 A;  2UZ5 A;  1U79 A;  2XPB A;  1R9H A;  1W1P A;  3ARW A;  2M08 A;  3MDY B;  1EIB A;  2OLH A;  4UDM A;  1E6P A;  3EIP A;  3NI6 A;  3B9D A;  1W9U A;  4TW6 A;  4U86 A;  1ZK6 A;  3ARP A;  1X6L A;  4MPK A;  2DPE A;  2N87 A;  3ARY A;  4Z2H A;  1NWU A;  3WIJ A;  3ALF A;  1SR0 A;  5GQB A;  3CZ8 A;  4XAK A;  4JFI A;  2PN0 A;  5HBF A;  1W1Y A;  4QT2 A;  4MNJ A;  4S3J A;  2XP4 A;  5HWB A;  4PTM A;  3O5M A;  1FKG A;  1FKD A;  4GIV A;  3RM9 A;  4LAX A;  4O2T A;  1D7I A;  2DSU A;  4P8W A;  2DSW A;  1QPF A;  1NWT A;  3B9E A;  4R5E A;  2DG3 A;  4ODM A;  2DT3 A;  1HKI A;  1FKJ A;  1ZB5 A;  1Q6U A;  3WL0 A;  4DWS D;  2ZR4 A;  2ZQS A;  4JFM A;  1FKF A;  2YBU A;  4URI A;  4IQ2 A;  4QZV B;  3UQA A;  2M2A A;  1NMW A;  3ARU A;  3TC5 A;  1WB0 A;  2ZR5 A;  1RD6 A;  1HKM A;  4J4N A;  2DSZ A;  2L2S A;  3W4R A;  1KT1 A;  1FKB A;  5D75 A;  1P5Q A;  3ARZ A;  1FFQ A;  2DT2 A;  3BXW A;  1NWS A;  3O5J A;  2ESC A;  3AS3 A;  1A7X A;  2FKE A;  2ZR6 A;  4DRM A;  3KAC A;  2IF4 A;  3ALG A;  4MAV A;  3TCZ A;  3PR9 A;  4Z2L A;  3B8S A;  2VCD A;  4DWS A;  4MSP A;  1Q6H A;  1LG2 A;  2DG9 A;  1B6C A;  3O5D A;  2A3B A;  4TW7 A;  4DZ2 A;  2QF8 A;  1FJD A;  1JCH B;  3NTP A;  4Z2G A;  3CHF A;  1H0G A;  3KAI A;  4ODK A;  1UR9 A;  3WKZ A;  1YAT A;  1ZBC A;  1J4H A;  3RM4 A;  2VN1 A;  1NSG A;  1D7H A;  2A3A A;  4HBE A;  1L1P A;  1JND A;  3O5G A;  1ZL1 A;  5HKG A;  4MNL A;  3G6M A;  3OA5 A;  5HW6 A;  3O5F A;  3WQW A;  1WNO A;  4ZPT R;  4ODR A;  3KAH A;  4NZC A;  3O5I A;  1FFR A;  2KE0 A;  2MLY A;  3TDB A;  3O5E A;  3FXY A;  1D2K A;  3UQI A;  4G50 A;  4DZ3 A;  4NNR A;  3PRA A;  1SYT A;  4ML4 A;  2KGJ A;  3ARR A;  2RUC A;  1ZBK A;  4WK9 A;  4MNM A;  1FKT A;  1PBK A;  3IK8 A;  2XPA A;  1FD9 A;  4J4O A;  2WLY A;  1FKI A;  1Q1C A;  2MPH A;  3ARO A;  4U84 A;  1FKS A;  4ODN A;  3WQV A;  1JNE A;  2F2D A;  1W9P A;  2B31 A;  4C02 B;  3JXV A;  3CHD A;  1HJW A;  3H9R B;  4WKA A;  3JYM A;  2IUZ A;  3ODK A;  4WJX A;  3WD0 A;  2FAP A;  2PV2 A;  4IPX A;  2JZV A;  5DIV A;  3FY1 A;  3IKG A;  1EQ3 A;  1TFV A;  1ROT A;  1KT0 A;  4IT6 A;  4DRP A;  1EDQ A;  2RUQ A;  1GPF A;  3UF8 A;  4HAR A;  4LAW A;  3EY6 A;  1EYM A;  1LJY A;  4L3N A;  3PRD A;  2DG4 A;  1N1A A;  2AOS A;  1XHG A;  2DT0 A;  4ITZ A;  4Z2I A;  3CHE A;  2AWG A;  1BKF A;  4WKH A;  3NRK A;  3UI4 A;  1C9H A;  4MNK A;  1NMV A;  1E9L A;  3JYJ A;  1CTN A;  1D7J A;  1F40 A;  2A3C A;  2LKN A; 
#chains in the Genus database with same CATH homology
 2G8Z A;  2F4E A;  5DF0 A;  2WM0 A;  3KAB A;  3O5K A;  1W26 A;  4JFJ A;  3RME A;  1TCO C;  3ART A;  4JYS A;  4P8U A;  4JFL A;  2XP8 A;  1QPL A;  2PI6 A;  4IT4 A;  1XRV A;  2OFN A;  4NSB A;  4R0X A;  4ODO A;  3WH0 A;  2A3E A;  3KAG A;  3CHC A;  1JNT A;  4WKF A;  3ARV A;  1KFW A;  1W9V A;  4W5U A;  2PPN A;  4ZS6 A;  1K9T A;  4DIP A;  3WD2 A;  2MNT A;  4Q22 A;  2LJ4 A;  1ITX A;  3AS0 A;  1E15 A;  3RM8 A;  2RSE A;  4ZPW R;  3WD3 A;  5HT1 A;  2Y78 A;  1LL4 A;  2RUR A;  1JVW A;  2KFW A;  1FKR A;  1E6R A;  4ODL A;  4LAV A;  4QIB A;  4IQC A;  4P8X A;  1ZCN A;  4Z2K A;  5JH8 A;  3WD1 A;  3KAD A;  1J6Y A;  4DRQ A;  5HTG A;  2MLX A;  2WK2 A;  2XP5 A;  2Q5A A;  1HKJ A;  4DRH A;  2MLZ A;  2KO7 A;  1H0I A;  3UQB A;  2D9F A;  4AY1 A;  4KR0 B;  2G41 A;  2YBT A;  1OGG A;  5HW7 A;  3B9A A;  1E6Z A;  1FKH A;  5BXJ A;  3AQU A;  3PA7 A;  4Q7N A;  3ARX A;  4LAY A;  1OGB A;  5HWC A;  4TX0 A;  4JFK A;  1QZ2 A;  1W1T A;  1Y0O A;  5GPR A;  4GGQ A;  4HBO A;  3LUO A;  4Z2J A;  3RFW A;  4DRJ A;  3KAF A;  2DSV A;  1ZBV A;  3UI5 A;  4BF8 A;  1Q6I A;  3OOB A;  1IX5 A;  2WLZ A;  2PPP A;  4ODQ A;  3IKD A;  3O5L A;  1T11 A;  1PIN A;  2FDM A;  4WIW A;  5DIU A;  2KI3 A;  3G6L A;  2ZQU A;  4TYO A;  2PV3 A;  1EHN A;  4S3K A;  1HJX A;  1ZBW A;  4DRN A;  4MGV A;  1FKL A;  1JNS A;  4W9O A;  2F21 A;  5DO2 A;  3RGC A;  3PRB A;  3I6C A;  2ZQT A;  4FN2 A;  2KR7 A;  3O5Q A;  1J4I A;  2DT1 A;  3O5R A;  2LGO A;  1HJV A;  4QT3 A;  1E6N A;  5DIT A;  2M1I A;  1O6I A;  4MTV A;  4DRO A;  1YW5 A;  4TNS A;  1GUV A;  3UI6 A;  4LGX A;  3IHZ A;  4FAP A;  1VF8 A;  2XP3 A;  2O9O A;  1ZU8 A;  5I98 A;  1WAW A;  4KQZ A;  2XP6 A;  4ZPV R;  1LL7 A;  3O5P A;  5J6E A;  3O5O A;  3CH9 A;  4W9P A;  4W9Q A;  4DWS B;  2XP9 A;  1BL4 A;  1LQ0 A;  2MF9 A;  4ODP A;  4N19 A;  3KCE A;  3VAW A;  2ITK A;  4DWS C;  1UR8 A;  1D6O A;  3B7X A;  3AS2 A;  3FAP A;  5GPG A;  4DH0 A;  1F8A B;  3CGM A;  1NWR A;  4P8V A;  4DT4 A;  4DRK A;  2LPV A;  1J4R A;  1OWQ A;  3ARQ A;  1HXV A;  2RUD A;  4DRI A;  2K8I A;  2PV1 A;  5B8I C;  2PBC A;  3QOK A;  3ARS A;  4L72 B;  1LL6 A;  2O92 A;  2PPO A;  1ROU A;  5DEZ A;  1LG1 A;  2XP7 A;  3AS1 A;  1M5Y A;  1FAP A;  2ZQV A;  1W1V A;  1X6N A;  4TW8 A;  4G2P A;  4U85 A;  1HKK A;  5HW8 A;  5HUA A;  1GOI A;  2RQS A;  3KZ7 A;  3CGN A;  3WD4 A;  1NH6 A;  3GPK A;  1FKK A;  3WL1 A;  2UZ5 A;  1U79 A;  2XPB A;  1R9H A;  1W1P A;  3ARW A;  2M08 A;  3MDY B;  1EIB A;  2OLH A;  1E6P A;  3NI6 A;  3B9D A;  1W9U A;  4TW6 A;  4U86 A;  1ZK6 A;  3ARP A;  1X6L A;  4MPK A;  2DPE A;  2N87 A;  3ARY A;  4Z2H A;  1NWU A;  3WIJ A;  3ALF A;  1SR0 A;  5GQB A;  3CZ8 A;  4XAK A;  4JFI A;  5HBF A;  1W1Y A;  4QT2 A;  4MNJ A;  4S3J A;  2XP4 A;  5HWB A;  4PTM A;  3O5M A;  1FKG A;  1FKD A;  4GIV A;  3RM9 A;  4LAX A;  4O2T A;  1D7I A;  2DSU A;  4P8W A;  2DSW A;  1QPF A;  1NWT A;  3B9E A;  4R5E A;  2DG3 A;  4ODM A;  2DT3 A;  1HKI A;  1FKJ A;  1ZB5 A;  1Q6U A;  3WL0 A;  4DWS D;  2ZR4 A;  2ZQS A;  4JFM A;  1FKF A;  2YBU A;  4URI A;  4IQ2 A;  4QZV B;  3UQA A;  2M2A A;  1NMW A;  3ARU A;  3TC5 A;  1WB0 A;  2ZR5 A;  1RD6 A;  1HKM A;  4J4N A;  2DSZ A;  2L2S A;  3W4R A;  1KT1 A;  1FKB A;  5D75 A;  1P5Q A;  3ARZ A;  1FFQ A;  2DT2 A;  3BXW A;  1NWS A;  3O5J A;  2ESC A;  3AS3 A;  1A7X A;  2FKE A;  2ZR6 A;  4DRM A;  3KAC A;  2IF4 A;  3ALG A;  4MAV A;  3TCZ A;  3PR9 A;  4Z2L A;  3B8S A;  2VCD A;  4DWS A;  4MSP A;  1Q6H A;  1LG2 A;  2DG9 A;  1B6C A;  3O5D A;  2A3B A;  4TW7 A;  4DZ2 A;  2QF8 A;  1FJD A;  3NTP A;  4Z2G A;  3CHF A;  1H0G A;  3KAI A;  4ODK A;  1UR9 A;  3WKZ A;  1YAT A;  1ZBC A;  1J4H A;  3RM4 A;  2VN1 A;  1NSG A;  1D7H A;  2A3A A;  4HBE A;  1L1P A;  1JND A;  3O5G A;  1ZL1 A;  5HKG A;  4MNL A;  3G6M A;  3OA5 A;  5HW6 A;  3O5F A;  3WQW A;  1WNO A;  4ZPT R;  4ODR A;  3KAH A;  4NZC A;  3O5I A;  1FFR A;  2KE0 A;  2MLY A;  3TDB A;  3O5E A;  3FXY A;  1D2K A;  3UQI A;  4G50 A;  4DZ3 A;  4NNR A;  3PRA A;  1SYT A;  4ML4 A;  2KGJ A;  3ARR A;  2RUC A;  1ZBK A;  4WK9 A;  4MNM A;  1FKT A;  1PBK A;  3IK8 A;  2XPA A;  1FD9 A;  4J4O A;  2WLY A;  1FKI A;  1Q1C A;  2MPH A;  3ARO A;  4U84 A;  1FKS A;  4ODN A;  3WQV A;  1JNE A;  2F2D A;  1W9P A;  2B31 A;  4C02 B;  3JXV A;  3CHD A;  1HJW A;  3H9R B;  4WKA A;  3JYM A;  2IUZ A;  3ODK A;  4WJX A;  3WD0 A;  2FAP A;  2PV2 A;  4IPX A;  2JZV A;  5DIV A;  3FY1 A;  3IKG A;  1EQ3 A;  1TFV A;  1ROT A;  1KT0 A;  4IT6 A;  4DRP A;  1EDQ A;  2RUQ A;  1GPF A;  3UF8 A;  4HAR A;  4LAW A;  3EY6 A;  1EYM A;  1LJY A;  4L3N A;  3PRD A;  2DG4 A;  1N1A A;  2AOS A;  1XHG A;  2DT0 A;  4ITZ A;  4Z2I A;  3CHE A;  2AWG A;  1BKF A;  4WKH A;  3NRK A;  3UI4 A;  1C9H A;  4MNK A;  1NMV A;  1E9L A;  3JYJ A;  1CTN A;  1D7J A;  1F40 A;  2A3C A;  2LKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...