4DRIA

Co-crystal structure of the ppiase domain of fkbp51, rapamycin and the frb fragment of mtor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
121
structure length
121
Chain Sequence
EQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 32
structure length 121
sequence length 121
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4driA00
2LJ4A 4GGQA 1D6OA 4IQCA 3JYJA 2ZQUA 2ITKA 4IPXA 1FD9A 1NMVA 3JYMA 4U84A 2MPHA 5DITA 2MNTA 3IKGA 4ODNA 2XP9A 1D7JA 1FKLA 4O2TA 1PBKA 4QT3A 2M2AA 3O5EA 4LAYA 4TX0A 4IQ2A 4C02B 2LKNA 4JFIA 4QT2A 3H9RB 2F21A 1M5YA 4NNRA 4TW7A 3O5OA 4DH0A 5HKGA 1F40A 2ZR6A 4ODKA 2XP6A 1Q6UA 3IHZA 2PV2A 4DRQA 1J4HA 4JFKA 1J4RA 2PV3A 3OOBA 3KZ7A 3KAFA 3FAPA 1J4IA 3KAIA 3PRDA 3MDYB 4DIPA 3O5MA 2PPOA 3NRKA 3TC5A 2VN1A 4W9OA 1BL4A 3VAWA 4G2PA 3LUOA 5B8IC 1C9HA 4FN2A 2RUCA 1JVWA 2DG9A 3B7XA 4R0XA 1A7XA 1FKFA 1EYMA 3UQIA 3O5IA 1YW5A 2XPAA 3JXVA 3TCZA 3KCEA 2K8IA 1F8AB 1JNTA 5I98A 5HW7A 3O5DA 4U85A 3UQBA 2KI3A 1FAPA 4TW8A 1KT0A 1T11A 2KE0A 2LGOA 2PPNA 4J4OA 4DRMA 3NTPA 1QZ2A 4ODMA 1TCOC 1U79A 4ODOA 5GPGA 2JZVA 3O5JA 1Q6HA 1ZCNA 4DRKA 1HXVA 2XP7A 4DT4A 3PRBA 2VCDA 1N1AA 2ZQTA 3O5RA 1P5QA 2XPBA 4QIBA 3TDBA 5BXJA 1Y0OA 2DG3A 4U86A 3I6CA 2ZR4A 1R9HA 4ITZA 4N19A 4J4NA 1ROTA 4W9PA 4DZ2A 2KR7A 1BKFA 3O5LA 1FKKA 4ODPA 5DIVA 4DRPA 2FKEA 1JNSA 3RFWA 1D7HA 4DZ3A 3PA7A 5HW8A 3UQAA 3O5KA 3CGNA 2LPVA 1FJDA 1PINA 4MSPA 1FKTA 5HT1A 4LAWA 4ODLA 2Q5AA 3O5PA 4DRNA 2PV1A 4JYSA 2AWGA 2F4EA 2N87A 4G50A 1KT1A 3UI6A 4DRJA 3O5GA 2MF9A 5HTGA 1B6CA 4BF8A 1FKSA 4JFJA 5D75A 1NSGA 4FAPA 2Y78A 2KFWA 2IF4A 4DROA 2KO7A 1FKIA 2MLYA 1EQ3A 1ROUA 1ZK6A 3NI6A 4MGVA 2ZQSA 5HWBA 2PBCA 1L1PA 2DG4A 4DRIA 1QPFA 3CGMA 1J6YA 3EY6A 2M08A 2RURA 4TW6A 1YATA 1FKHA 5J6EA 3KADA 4TYOA 2RUDA 3UI5A 2KGJA 1FKRA 2XP4A 3KAHA 4GIVA 1FKGA 4LAVA 3KACA 5HW6A 1FKJA 2D9FA 4JFLA 4JFMA 2F2DA 2FAPA 2OFNA 2UZ5A 3O5FA 4TNSA 2M1IA 2XP5A 3O5QA 1NMWA 4ODRA 2MLZA 1Q6IA 3UF8A 3KAGA 4ODQA 5HWCA 5DIUA 1Q1CA 2PPPA 5HUAA 3IK8A 3RGCA 2ZQVA 3GPKA 3IKDA 4W9QA 2RUQA 4DRHA 1FKDA 3ODKA 3UI4A 2RQSA 2XP8A 1W26A 2XP3A 1QPLA 2RSEA 2ZR5A 3WH0A 2MLXA 4LAXA 1FKBA 2L2SA 3KABA 1D7IA
chains in the Genus database with same CATH superfamily
4MAVA 4S3JA 1D6OA 1GRJA 4IQCA 2DSVA 3G6MA 4HBOA 5DITA 5JH8A 3WD0A 4Z2HA 5HBFA 2QF8A 1EHNA 3WIJA 2YBUA 1M5YA 2OLHA 4DWSB 1LL6A 4ODKA 1Q6UA 1ITXA 4MNMA 3AQUA 2EULA 3FAPA 1HJXA 3MDYB 4DIPA 3O5MA 3TC5A 3WL0A 4W9OA 3QOKA 5B8IC 3CHFA 1C9HA 5DEZA 2RUCA 2DG9A 3UQIA 1W9UA 3B7XA 5I98A 1YW5A 1F8AB 1E6ZA 3BXWA 4L3NA 2KE0A 2PPNA 4J4OA 4DRMA 1D2KA 4IT6A 1TCOC 5GPGA 2JZVA 3O5JA 1Q6HA 1ZCNA 4DRKA 3B8SA 4P8UA 2VCDA 3TDBA 1P5QA 1E6RA 3CHDA 2ZR4A 4N19A 4W9PA 1ROTA 3O5LA 4Z2JA 5DIVA 4KQZA 1EDQA 2FKEA 4DRPA 2G41A 1OWQA 3CGNA 1FKTA 4ODLA 4URIA 1HKMA 2O9OA 4LGXA 2F4EA 1E44A 4DRJA 3O5GA 1FKSA 1W1PA 2IF4A 4DROA 2KO7A 4MPKA 1ROUA 2A3AA 1XHGA 4DRIA 4L72B 4TW6A 5J6EA 2RUDA 3ARQA 2AOSA 3AS2A 1TFVA 1NWRA 4LAVA 2FAPA 2OFNA 2A3BA 3WD2A 1OGBA 2DT3A 2PI6A 5HWCA 5HUAA 4W9QA 1NH6A 1IX5A 1HKJA 2ZR5A 2RSEA 2ESCA 4LAXA 2XP8A 3WD3A 1VF8A 4GGQA 3JYJA 1NWUA 1FD9A 1UR9A 2MPHA 2MNTA 1HJWA 1FKLA 4KR0B 4O2TA 2M2AA 3O5EA 4IQ2A 1WNOA 4TW7A 4DH0A 5HKGA 3O5OA 2ZR6A 1XRVA 2PV2A 1J4HA 4P8WA 2B5UB 2PV3A 2PN0A 4P8VA 3KZ7A 1J4IA 4IT4A 3B9EA 4AY1A 3LUOA 1WB0A 2G8ZA 4FN2A 3JXVA 3TCZA 1JNTA 5HW7A 2DT0A 1WAWA 1GOIA 1KT0A 1QZ2A 4ODMA 2WK2A 1NWSA 3WD1A 1N1AA 4U86A 3G6LA 4J4NA 1UR8A 1BKFA 1JNSA 4ODPA 3BMBA 3RM8A 1ZBVA 4DZ3A 5HW8A 1FJDA 4Q7NA 1PINA 3WD4A 5HT1A 3W4RA 2Q5AA 1ZBKA 2IUZA 1JNEA 4ML4A 2PV1A 1RD6A 1E15A 3UI6A 2FDMA 3WQWA 4WJXA 4FAPA 1NSGA 1ZK6A 3NI6A 3EIPA 3WKZA 3CGMA 2DT1A 5DF0A 2M08A 4UDMA 1YATA 1E9LA 3KADA 3ALGA 3B9DA 3KAHA 1SR0A 4DT4A 4JFLA 4TNSA 4JFMA 2F2DA 1EIBA 5GPRA 1NMWA 4ODRA 1Q1CA 2PPPA 3IKDA 3ARPA 2RQSA 1H0IA 1W26A 4Z2GA 3WH0A 3ARUA 1FKBA 2L2SA 4P8XA 4WK9A 1D7IA 3CZ8A 3ARSA 2WLYA 2LJ4A 1GUVA 2ZQUA 1NMVA 3IKGA 4ODNA 2A3EA 4R5EA 4LAYA 4C02B 4JFIA 4DWSA 4QT2A 4Z2KA 1X6LA 2XP6A 4NZCA 4XAKA 4WKFA 4JFKA 3PRAA 4ZPTR 3OOBA 3KAFA 2PPOA 4WKAA 1BL4A 4MNJA 3VAWA 4G2PA 4R0XA 1FKFA 1EYMA 2XPAA 1SYTA 4PTMA 3O5DA 1FAPA 4TW8A 1T11A 2DSWA 1U79A 1X6NA 2XP7A 3PRBA 2XPBA 3ARZA 5BXJA 2DG3A 3I6CA 1HJVA 3ARYA 4ITZA 1NWTA 3RM9A 3AS0A 3CHCA 1W1VA 2YBTA 3PA7A 1CTNA 3CH9A 2LPVA 1E6PA 4QZVB 2P4VA 1ZBCA 3O5PA 4DRNA 4JYSA 1KT1A 2MF9A 3ARRA 1B6CA 4BF8A 3AS1A 4JFJA 5D75A 4MTVA 4WIWA 2Y78A 4ZS6A 4Z2LA 2ETNA 2ZQSA 1L1PA 3PR9A 2DG4A 5DO2A 1J6YA 3RM4A 4DWSC 1FKHA 4TYOA 3UI5A 1FKRA 1ZBWA 1FKGA 3KACA 1FKJA 2M1IA 2XP5A 2DPEA 3O5QA 1LL7A 2MLZA 4ODQA 5DIUA 2DSUA 3RGCA 2ZQVA 3GPKA 4Z2IA 1FKDA 3ODKA 3ARTA 4HBEA 3UI4A 4S3KA 1QPLA 3WQVA 4NSBA 1LL4A 2ITKA 1E6NA 4IPXA 3JYMA 4U84A 2XP9A 1D7JA 1GPFA 1PBKA 1JNDA 4QT3A 4TX0A 1LQ0A 2LKNA 1H0GA 3H9RB 2F21A 2WLZA 4NNRA 1F40A 3OA5A 4Q22A 3IHZA 3AS3A 4DRQA 1J4RA 1FFQA 3KAIA 3PRDA 1ZU8A 1FFRA 3RMEA 3NRKA 2VN1A 2WM0A 1JVWA 1A7XA 3O5IA 4ZPWR 3KCEA 2K8IA 3UQBA 4U85A 2A3CA 2KI3A 2DT2A 1JCHB 2LGOA 3NTPA 3ALFA 5GQBA 2DSZA 4ODOA 4HARA 3B9AA 3ARWA 1HXVA 2ZQTA 3O5RA 4QIBA 1Y0OA 1LJYA 1R9HA 2B31A 4DZ2A 2KR7A 1FKKA 3GTYX 1W1TA 3WL1A 3RFWA 1D7HA 3UQAA 3O5KA 1W9PA 4MSPA 1HKIA 4LAWA 1OGGA 1K9TA 2AWGA 2N87A 3FXYA 4G50A 5HTGA 2KFWA 1FKIA 2MLYA 3CHEA 1EQ3A 5HWBA 4MGVA 4MNLA 2PBCA 4DWSD 1ZB5A 3FY1A 4WKHA 1LG1A 1QPFA 3EY6A 2RURA 4W5UA 1KFWA 2KGJA 2XP4A 3GU0A 4GIVA 5HW6A 2D9FA 4MNKA 2UZ5A 3O5FA 1ZL1A 3ARXA 1Q6IA 1LG2A 3ARVA 3UF8A 3AROA 1O6IA 2O92A 3KAGA 3IK8A 2RUQA 4DRHA 4ZPVR 2XP3A 2MLXA 1HKKA 1W1YA 3KABA 2F23A 1W9VA
chains in the Genus database with same CATH topology
4MAVA 4S3JA 1D6OA 4IQCA 2DSVA 3G6MA 4HBOA 5DITA 5JH8A 3WD0A 4Z2HA 5HBFA 2QF8A 1EHNA 3WIJA 2YBUA 1M5YA 2OLHA 4DWSB 1LL6A 4ODKA 1Q6UA 1ITXA 4MNMA 3AQUA 3FAPA 1HJXA 3MDYB 4DIPA 3O5MA 3TC5A 3WL0A 4W9OA 3QOKA 5B8IC 3CHFA 1C9HA 5DEZA 2RUCA 2DG9A 3UQIA 1W9UA 3B7XA 5I98A 1YW5A 1F8AB 1E6ZA 3BXWA 4L3NA 2KE0A 2PPNA 4J4OA 4DRMA 1D2KA 4IT6A 1TCOC 5GPGA 2JZVA 3O5JA 1Q6HA 1ZCNA 4DRKA 3B8SA 4P8UA 2VCDA 3TDBA 1P5QA 1E6RA 3CHDA 2ZR4A 4N19A 4W9PA 1ROTA 3O5LA 4Z2JA 5DIVA 4KQZA 1EDQA 2FKEA 4DRPA 2G41A 1OWQA 3CGNA 1FKTA 4ODLA 4URIA 1HKMA 2O9OA 4LGXA 2F4EA 4DRJA 3O5GA 1FKSA 1W1PA 2IF4A 4DROA 2KO7A 4MPKA 1ROUA 2A3AA 1XHGA 4DRIA 4L72B 4TW6A 5J6EA 2RUDA 3ARQA 2AOSA 3AS2A 1TFVA 1NWRA 4LAVA 2FAPA 2OFNA 2A3BA 3WD2A 1OGBA 2DT3A 2PI6A 5HWCA 5HUAA 4W9QA 1NH6A 1IX5A 1HKJA 2ZR5A 2RSEA 2ESCA 4LAXA 2XP8A 3WD3A 1VF8A 4GGQA 3JYJA 1NWUA 1FD9A 1UR9A 2MPHA 2MNTA 1HJWA 1FKLA 4KR0B 4O2TA 2M2AA 3O5EA 4IQ2A 1WNOA 4TW7A 4DH0A 5HKGA 3O5OA 2ZR6A 1XRVA 2PV2A 1J4HA 4P8WA 2PV3A 4P8VA 3KZ7A 1J4IA 4IT4A 3B9EA 4AY1A 3LUOA 1WB0A 2G8ZA 4FN2A 3JXVA 3TCZA 1JNTA 5HW7A 2DT0A 1WAWA 1GOIA 1KT0A 1QZ2A 4ODMA 2WK2A 1NWSA 3WD1A 1N1AA 4U86A 3G6LA 4J4NA 1UR8A 1BKFA 1JNSA 4ODPA 3RM8A 1ZBVA 4DZ3A 5HW8A 1FJDA 4Q7NA 1PINA 3WD4A 5HT1A 3W4RA 2Q5AA 1ZBKA 2IUZA 1JNEA 4ML4A 2PV1A 1RD6A 1E15A 3UI6A 2FDMA 3WQWA 4WJXA 4FAPA 1NSGA 1ZK6A 3NI6A 3WKZA 3CGMA 2DT1A 5DF0A 2M08A 1YATA 1E9LA 3KADA 3ALGA 3B9DA 3KAHA 1SR0A 4DT4A 4JFLA 4TNSA 4JFMA 2F2DA 1EIBA 5GPRA 1NMWA 4ODRA 1Q1CA 2PPPA 3IKDA 3ARPA 2RQSA 1H0IA 1W26A 4Z2GA 3WH0A 3ARUA 1FKBA 2L2SA 4P8XA 4WK9A 1D7IA 3CZ8A 3ARSA 2WLYA 2LJ4A 1GUVA 2ZQUA 1NMVA 3IKGA 4ODNA 2A3EA 4R5EA 4LAYA 4C02B 4JFIA 4DWSA 4QT2A 4Z2KA 1X6LA 2XP6A 4NZCA 4XAKA 4WKFA 4JFKA 3PRAA 4ZPTR 3OOBA 3KAFA 2PPOA 4WKAA 1BL4A 4MNJA 3VAWA 4G2PA 4R0XA 1FKFA 1EYMA 2XPAA 1SYTA 4PTMA 3O5DA 1FAPA 4TW8A 1T11A 2DSWA 1U79A 1X6NA 2XP7A 3PRBA 2XPBA 3ARZA 5BXJA 2DG3A 3I6CA 1HJVA 3ARYA 4ITZA 1NWTA 3RM9A 3AS0A 3CHCA 1W1VA 2YBTA 3PA7A 1CTNA 3CH9A 2LPVA 1E6PA 4QZVB 1ZBCA 3O5PA 4DRNA 4JYSA 1KT1A 2MF9A 3ARRA 1B6CA 4BF8A 3AS1A 4JFJA 5D75A 4MTVA 4WIWA 2Y78A 4ZS6A 4Z2LA 2ZQSA 1L1PA 3PR9A 2DG4A 5DO2A 1J6YA 3RM4A 4DWSC 1FKHA 4TYOA 3UI5A 1FKRA 1ZBWA 1FKGA 3KACA 1FKJA 2M1IA 2XP5A 2DPEA 3O5QA 1LL7A 2MLZA 4ODQA 5DIUA 2DSUA 3RGCA 2ZQVA 3GPKA 4Z2IA 1FKDA 3ODKA 3ARTA 4HBEA 3UI4A 4S3KA 1QPLA 3WQVA 4NSBA 1LL4A 2ITKA 1E6NA 4IPXA 3JYMA 4U84A 2XP9A 1D7JA 1GPFA 1PBKA 1JNDA 4QT3A 4TX0A 1LQ0A 2LKNA 1H0GA 3H9RB 2F21A 2WLZA 4NNRA 1F40A 3OA5A 4Q22A 3IHZA 3AS3A 4DRQA 1J4RA 1FFQA 3KAIA 3PRDA 1ZU8A 1FFRA 3RMEA 3NRKA 2VN1A 2WM0A 1JVWA 1A7XA 3O5IA 4ZPWR 3KCEA 2K8IA 3UQBA 4U85A 2A3CA 2KI3A 2DT2A 2LGOA 3NTPA 3ALFA 5GQBA 2DSZA 4ODOA 4HARA 3B9AA 3ARWA 1HXVA 2ZQTA 3O5RA 4QIBA 1Y0OA 1LJYA 1R9HA 2B31A 4DZ2A 2KR7A 1FKKA 3WL1A 1W1TA 3RFWA 1D7HA 3UQAA 3O5KA 1W9PA 4MSPA 1HKIA 4LAWA 1OGGA 1K9TA 2AWGA 2N87A 3FXYA 4G50A 5HTGA 2KFWA 1FKIA 2MLYA 3CHEA 1EQ3A 5HWBA 4MGVA 4MNLA 2PBCA 4DWSD 1ZB5A 3FY1A 4WKHA 1LG1A 1QPFA 3EY6A 2RURA 4W5UA 1KFWA 2KGJA 2XP4A 4GIVA 5HW6A 2D9FA 4MNKA 2UZ5A 3O5FA 1ZL1A 3ARXA 1Q6IA 1LG2A 3ARVA 3UF8A 3AROA 1O6IA 2O92A 3KAGA 3IK8A 2RUQA 4DRHA 4ZPVR 2XP3A 2MLXA 1HKKA 1W1YA 3KABA 1W9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJ4 A;  4GGQ A;  1D6O A;  4IQC A;  3JYJ A;  2ZQU A;  2ITK A;  4IPX A;  1FD9 A;  1NMV A;  3JYM A;  4U84 A;  2MPH A;  5DIT A;  2MNT A;  3IKG A;  4ODN A;  2XP9 A;  1D7J A;  1FKL A;  4O2T A;  1PBK A;  4QT3 A;  2M2A A;  3O5E A;  4LAY A;  4TX0 A;  4IQ2 A;  4C02 B;  2LKN A;  4JFI A;  4QT2 A;  3H9R B;  2F21 A;  1M5Y A;  4NNR A;  4TW7 A;  3O5O A;  4DH0 A;  5HKG A;  1F40 A;  2ZR6 A;  4ODK A;  2XP6 A;  1Q6U A;  3IHZ A;  2PV2 A;  4DRQ A;  1J4H A;  4JFK A;  1J4R A;  2PV3 A;  3OOB A;  3KZ7 A;  3KAF A;  3FAP A;  1J4I A;  3KAI A;  3PRD A;  3MDY B;  4DIP A;  3O5M A;  2PPO A;  3NRK A;  3TC5 A;  2VN1 A;  4W9O A;  1BL4 A;  3VAW A;  4G2P A;  3LUO A;  5B8I C;  1C9H A;  4FN2 A;  2RUC A;  1JVW A;  2DG9 A;  3B7X A;  4R0X A;  1A7X A;  1FKF A;  1EYM A;  3UQI A;  3O5I A;  1YW5 A;  2XPA A;  3JXV A;  3TCZ A;  3KCE A;  2K8I A;  1F8A B;  1JNT A;  5I98 A;  5HW7 A;  3O5D A;  4U85 A;  3UQB A;  2KI3 A;  1FAP A;  4TW8 A;  1KT0 A;  1T11 A;  2KE0 A;  2LGO A;  2PPN A;  4J4O A;  4DRM A;  3NTP A;  1QZ2 A;  4ODM A;  1TCO C;  1U79 A;  4ODO A;  5GPG A;  2JZV A;  3O5J A;  1Q6H A;  1ZCN A;  4DRK A;  1HXV A;  2XP7 A;  4DT4 A;  3PRB A;  2VCD A;  1N1A A;  2ZQT A;  3O5R A;  1P5Q A;  2XPB A;  4QIB A;  3TDB A;  5BXJ A;  1Y0O A;  2DG3 A;  4U86 A;  3I6C A;  2ZR4 A;  1R9H A;  4ITZ A;  4N19 A;  4J4N A;  1ROT A;  4W9P A;  4DZ2 A;  2KR7 A;  1BKF A;  3O5L A;  1FKK A;  4ODP A;  5DIV A;  4DRP A;  2FKE A;  1JNS A;  3RFW A;  1D7H A;  4DZ3 A;  3PA7 A;  5HW8 A;  3UQA A;  3O5K A;  3CGN A;  2LPV A;  1FJD A;  1PIN A;  4MSP A;  1FKT A;  5HT1 A;  4LAW A;  4ODL A;  2Q5A A;  3O5P A;  4DRN A;  2PV1 A;  4JYS A;  2AWG A;  2F4E A;  2N87 A;  4G50 A;  1KT1 A;  3UI6 A;  4DRJ A;  3O5G A;  2MF9 A;  5HTG A;  1B6C A;  4BF8 A;  1FKS A;  4JFJ A;  5D75 A;  1NSG A;  4FAP A;  2Y78 A;  2KFW A;  2IF4 A;  4DRO A;  2KO7 A;  1FKI A;  2MLY A;  1EQ3 A;  1ROU A;  1ZK6 A;  3NI6 A;  4MGV A;  2ZQS A;  5HWB A;  2PBC A;  1L1P A;  2DG4 A;  4DRI A;  1QPF A;  3CGM A;  1J6Y A;  3EY6 A;  2M08 A;  2RUR A;  4TW6 A;  1YAT A;  1FKH A;  5J6E A;  3KAD A;  4TYO A;  2RUD A;  3UI5 A;  2KGJ A;  1FKR A;  2XP4 A;  3KAH A;  4GIV A;  1FKG A;  4LAV A;  3KAC A;  5HW6 A;  1FKJ A;  2D9F A;  4JFL A;  4JFM A;  2F2D A;  2FAP A;  2OFN A;  2UZ5 A;  3O5F A;  4TNS A;  2M1I A;  2XP5 A;  3O5Q A;  1NMW A;  4ODR A;  2MLZ A;  1Q6I A;  3UF8 A;  3KAG A;  4ODQ A;  5HWC A;  5DIU A;  1Q1C A;  2PPP A;  5HUA A;  3IK8 A;  3RGC A;  2ZQV A;  3GPK A;  3IKD A;  4W9Q A;  2RUQ A;  4DRH A;  1FKD A;  3ODK A;  3UI4 A;  2RQS A;  2XP8 A;  1W26 A;  2XP3 A;  1QPL A;  2RSE A;  2ZR5 A;  3WH0 A;  2MLX A;  4LAX A;  1FKB A;  2L2S A;  3KAB A;  1D7I A; 
#chains in the Genus database with same CATH topology
 4MAV A;  4S3J A;  1D6O A;  1GRJ A;  4IQC A;  2DSV A;  3G6M A;  4HBO A;  5DIT A;  5JH8 A;  3WD0 A;  4Z2H A;  5HBF A;  2QF8 A;  1EHN A;  3WIJ A;  2YBU A;  1M5Y A;  2OLH A;  4DWS B;  1LL6 A;  4ODK A;  1Q6U A;  1ITX A;  4MNM A;  3AQU A;  2EUL A;  3FAP A;  1HJX A;  3MDY B;  4DIP A;  3O5M A;  3TC5 A;  3WL0 A;  4W9O A;  3QOK A;  5B8I C;  3CHF A;  1C9H A;  5DEZ A;  2RUC A;  2DG9 A;  3UQI A;  1W9U A;  3B7X A;  5I98 A;  1YW5 A;  1F8A B;  1E6Z A;  3BXW A;  4L3N A;  2KE0 A;  2PPN A;  4J4O A;  4DRM A;  1D2K A;  4IT6 A;  1TCO C;  5GPG A;  2JZV A;  3O5J A;  1Q6H A;  1ZCN A;  4DRK A;  3B8S A;  4P8U A;  2VCD A;  3TDB A;  1P5Q A;  1E6R A;  3CHD A;  2ZR4 A;  4N19 A;  4W9P A;  1ROT A;  3O5L A;  4Z2J A;  5DIV A;  4KQZ A;  1EDQ A;  2FKE A;  4DRP A;  2G41 A;  1OWQ A;  3CGN A;  1FKT A;  4ODL A;  4URI A;  1HKM A;  2O9O A;  4LGX A;  2F4E A;  1E44 A;  4DRJ A;  3O5G A;  1FKS A;  1W1P A;  2IF4 A;  4DRO A;  2KO7 A;  4MPK A;  1ROU A;  2A3A A;  1XHG A;  4DRI A;  4L72 B;  4TW6 A;  5J6E A;  2RUD A;  3ARQ A;  2AOS A;  3AS2 A;  1TFV A;  1NWR A;  4LAV A;  2FAP A;  2OFN A;  2A3B A;  3WD2 A;  1OGB A;  2DT3 A;  2PI6 A;  5HWC A;  5HUA A;  4W9Q A;  1NH6 A;  1IX5 A;  1HKJ A;  2ZR5 A;  2RSE A;  2ESC A;  4LAX A;  2XP8 A;  3WD3 A;  1VF8 A;  4GGQ A;  3JYJ A;  1NWU A;  1FD9 A;  1UR9 A;  2MPH A;  2MNT A;  1HJW A;  1FKL A;  4KR0 B;  4O2T A;  2M2A A;  3O5E A;  4IQ2 A;  1WNO A;  4TW7 A;  4DH0 A;  5HKG A;  3O5O A;  2ZR6 A;  1XRV A;  2PV2 A;  1J4H A;  4P8W A;  2B5U B;  2PV3 A;  2PN0 A;  4P8V A;  3KZ7 A;  1J4I A;  4IT4 A;  3B9E A;  4AY1 A;  3LUO A;  1WB0 A;  2G8Z A;  4FN2 A;  3JXV A;  3TCZ A;  1JNT A;  5HW7 A;  2DT0 A;  1WAW A;  1GOI A;  1KT0 A;  1QZ2 A;  4ODM A;  2WK2 A;  1NWS A;  3WD1 A;  1N1A A;  4U86 A;  3G6L A;  4J4N A;  1UR8 A;  1BKF A;  1JNS A;  4ODP A;  3BMB A;  3RM8 A;  1ZBV A;  4DZ3 A;  5HW8 A;  1FJD A;  4Q7N A;  1PIN A;  3WD4 A;  5HT1 A;  3W4R A;  2Q5A A;  1ZBK A;  2IUZ A;  1JNE A;  4ML4 A;  2PV1 A;  1RD6 A;  1E15 A;  3UI6 A;  2FDM A;  3WQW A;  4WJX A;  4FAP A;  1NSG A;  1ZK6 A;  3NI6 A;  3EIP A;  3WKZ A;  3CGM A;  2DT1 A;  5DF0 A;  2M08 A;  4UDM A;  1YAT A;  1E9L A;  3KAD A;  3ALG A;  3B9D A;  3KAH A;  1SR0 A;  4DT4 A;  4JFL A;  4TNS A;  4JFM A;  2F2D A;  1EIB A;  5GPR A;  1NMW A;  4ODR A;  1Q1C A;  2PPP A;  3IKD A;  3ARP A;  2RQS A;  1H0I A;  1W26 A;  4Z2G A;  3WH0 A;  3ARU A;  1FKB A;  2L2S A;  4P8X A;  4WK9 A;  1D7I A;  3CZ8 A;  3ARS A;  2WLY A;  2LJ4 A;  1GUV A;  2ZQU A;  1NMV A;  3IKG A;  4ODN A;  2A3E A;  4R5E A;  4LAY A;  4C02 B;  4JFI A;  4DWS A;  4QT2 A;  4Z2K A;  1X6L A;  2XP6 A;  4NZC A;  4XAK A;  4WKF A;  4JFK A;  3PRA A;  4ZPT R;  3OOB A;  3KAF A;  2PPO A;  4WKA A;  1BL4 A;  4MNJ A;  3VAW A;  4G2P A;  4R0X A;  1FKF A;  1EYM A;  2XPA A;  1SYT A;  4PTM A;  3O5D A;  1FAP A;  4TW8 A;  1T11 A;  2DSW A;  1U79 A;  1X6N A;  2XP7 A;  3PRB A;  2XPB A;  3ARZ A;  5BXJ A;  2DG3 A;  3I6C A;  1HJV A;  3ARY A;  4ITZ A;  1NWT A;  3RM9 A;  3AS0 A;  3CHC A;  1W1V A;  2YBT A;  3PA7 A;  1CTN A;  3CH9 A;  2LPV A;  1E6P A;  4QZV B;  2P4V A;  1ZBC A;  3O5P A;  4DRN A;  4JYS A;  1KT1 A;  2MF9 A;  3ARR A;  1B6C A;  4BF8 A;  3AS1 A;  4JFJ A;  5D75 A;  4MTV A;  4WIW A;  2Y78 A;  4ZS6 A;  4Z2L A;  2ETN A;  2ZQS A;  1L1P A;  3PR9 A;  2DG4 A;  5DO2 A;  1J6Y A;  3RM4 A;  4DWS C;  1FKH A;  4TYO A;  3UI5 A;  1FKR A;  1ZBW A;  1FKG A;  3KAC A;  1FKJ A;  2M1I A;  2XP5 A;  2DPE A;  3O5Q A;  1LL7 A;  2MLZ A;  4ODQ A;  5DIU A;  2DSU A;  3RGC A;  2ZQV A;  3GPK A;  4Z2I A;  1FKD A;  3ODK A;  3ART A;  4HBE A;  3UI4 A;  4S3K A;  1QPL A;  3WQV A;  4NSB A;  1LL4 A;  2ITK A;  1E6N A;  4IPX A;  3JYM A;  4U84 A;  2XP9 A;  1D7J A;  1GPF A;  1PBK A;  1JND A;  4QT3 A;  4TX0 A;  1LQ0 A;  2LKN A;  1H0G A;  3H9R B;  2F21 A;  2WLZ A;  4NNR A;  1F40 A;  3OA5 A;  4Q22 A;  3IHZ A;  3AS3 A;  4DRQ A;  1J4R A;  1FFQ A;  3KAI A;  3PRD A;  1ZU8 A;  1FFR A;  3RME A;  3NRK A;  2VN1 A;  2WM0 A;  1JVW A;  1A7X A;  3O5I A;  4ZPW R;  3KCE A;  2K8I A;  3UQB A;  4U85 A;  2A3C A;  2KI3 A;  2DT2 A;  1JCH B;  2LGO A;  3NTP A;  3ALF A;  5GQB A;  2DSZ A;  4ODO A;  4HAR A;  3B9A A;  3ARW A;  1HXV A;  2ZQT A;  3O5R A;  4QIB A;  1Y0O A;  1LJY A;  1R9H A;  2B31 A;  4DZ2 A;  2KR7 A;  1FKK A;  3GTY X;  1W1T A;  3WL1 A;  3RFW A;  1D7H A;  3UQA A;  3O5K A;  1W9P A;  4MSP A;  1HKI A;  4LAW A;  1OGG A;  1K9T A;  2AWG A;  2N87 A;  3FXY A;  4G50 A;  5HTG A;  2KFW A;  1FKI A;  2MLY A;  3CHE A;  1EQ3 A;  5HWB A;  4MGV A;  4MNL A;  2PBC A;  4DWS D;  1ZB5 A;  3FY1 A;  4WKH A;  1LG1 A;  1QPF A;  3EY6 A;  2RUR A;  4W5U A;  1KFW A;  2KGJ A;  2XP4 A;  3GU0 A;  4GIV A;  5HW6 A;  2D9F A;  4MNK A;  2UZ5 A;  3O5F A;  1ZL1 A;  3ARX A;  1Q6I A;  1LG2 A;  3ARV A;  3UF8 A;  3ARO A;  1O6I A;  2O92 A;  3KAG A;  3IK8 A;  2RUQ A;  4DRH A;  4ZPV R;  2XP3 A;  2MLX A;  1HKK A;  1W1Y A;  3KAB A;  2F23 A;  1W9V A; 
#chains in the Genus database with same CATH homology
 4MAV A;  4S3J A;  1D6O A;  4IQC A;  2DSV A;  3G6M A;  4HBO A;  5DIT A;  5JH8 A;  3WD0 A;  4Z2H A;  5HBF A;  2QF8 A;  1EHN A;  3WIJ A;  2YBU A;  1M5Y A;  2OLH A;  4DWS B;  1LL6 A;  4ODK A;  1Q6U A;  1ITX A;  4MNM A;  3AQU A;  3FAP A;  1HJX A;  3MDY B;  4DIP A;  3O5M A;  3TC5 A;  3WL0 A;  4W9O A;  3QOK A;  5B8I C;  3CHF A;  1C9H A;  5DEZ A;  2RUC A;  2DG9 A;  3UQI A;  1W9U A;  3B7X A;  5I98 A;  1YW5 A;  1F8A B;  1E6Z A;  3BXW A;  4L3N A;  2KE0 A;  2PPN A;  4J4O A;  4DRM A;  1D2K A;  4IT6 A;  1TCO C;  5GPG A;  2JZV A;  3O5J A;  1Q6H A;  1ZCN A;  4DRK A;  3B8S A;  4P8U A;  2VCD A;  3TDB A;  1P5Q A;  1E6R A;  3CHD A;  2ZR4 A;  4N19 A;  4W9P A;  1ROT A;  3O5L A;  4Z2J A;  5DIV A;  4KQZ A;  1EDQ A;  2FKE A;  4DRP A;  2G41 A;  1OWQ A;  3CGN A;  1FKT A;  4ODL A;  4URI A;  1HKM A;  2O9O A;  4LGX A;  2F4E A;  4DRJ A;  3O5G A;  1FKS A;  1W1P A;  2IF4 A;  4DRO A;  2KO7 A;  4MPK A;  1ROU A;  2A3A A;  1XHG A;  4DRI A;  4L72 B;  4TW6 A;  5J6E A;  2RUD A;  3ARQ A;  2AOS A;  3AS2 A;  1TFV A;  1NWR A;  4LAV A;  2FAP A;  2OFN A;  2A3B A;  3WD2 A;  1OGB A;  2DT3 A;  2PI6 A;  5HWC A;  5HUA A;  4W9Q A;  1NH6 A;  1IX5 A;  1HKJ A;  2ZR5 A;  2RSE A;  2ESC A;  4LAX A;  2XP8 A;  3WD3 A;  1VF8 A;  4GGQ A;  3JYJ A;  1NWU A;  1FD9 A;  1UR9 A;  2MPH A;  2MNT A;  1HJW A;  1FKL A;  4KR0 B;  4O2T A;  2M2A A;  3O5E A;  4IQ2 A;  1WNO A;  4TW7 A;  4DH0 A;  5HKG A;  3O5O A;  2ZR6 A;  1XRV A;  2PV2 A;  1J4H A;  4P8W A;  2PV3 A;  4P8V A;  3KZ7 A;  1J4I A;  4IT4 A;  3B9E A;  4AY1 A;  3LUO A;  1WB0 A;  2G8Z A;  4FN2 A;  3JXV A;  3TCZ A;  1JNT A;  5HW7 A;  2DT0 A;  1WAW A;  1GOI A;  1KT0 A;  1QZ2 A;  4ODM A;  2WK2 A;  1NWS A;  3WD1 A;  1N1A A;  4U86 A;  3G6L A;  4J4N A;  1UR8 A;  1BKF A;  1JNS A;  4ODP A;  3RM8 A;  1ZBV A;  4DZ3 A;  5HW8 A;  1FJD A;  4Q7N A;  1PIN A;  3WD4 A;  5HT1 A;  3W4R A;  2Q5A A;  1ZBK A;  2IUZ A;  1JNE A;  4ML4 A;  2PV1 A;  1RD6 A;  1E15 A;  3UI6 A;  2FDM A;  3WQW A;  4WJX A;  4FAP A;  1NSG A;  1ZK6 A;  3NI6 A;  3WKZ A;  3CGM A;  2DT1 A;  5DF0 A;  2M08 A;  1YAT A;  1E9L A;  3KAD A;  3ALG A;  3B9D A;  3KAH A;  1SR0 A;  4DT4 A;  4JFL A;  4TNS A;  4JFM A;  2F2D A;  1EIB A;  5GPR A;  1NMW A;  4ODR A;  1Q1C A;  2PPP A;  3IKD A;  3ARP A;  2RQS A;  1H0I A;  1W26 A;  4Z2G A;  3WH0 A;  3ARU A;  1FKB A;  2L2S A;  4P8X A;  4WK9 A;  1D7I A;  3CZ8 A;  3ARS A;  2WLY A;  2LJ4 A;  1GUV A;  2ZQU A;  1NMV A;  3IKG A;  4ODN A;  2A3E A;  4R5E A;  4LAY A;  4C02 B;  4JFI A;  4DWS A;  4QT2 A;  4Z2K A;  1X6L A;  2XP6 A;  4NZC A;  4XAK A;  4WKF A;  4JFK A;  3PRA A;  4ZPT R;  3OOB A;  3KAF A;  2PPO A;  4WKA A;  1BL4 A;  4MNJ A;  3VAW A;  4G2P A;  4R0X A;  1FKF A;  1EYM A;  2XPA A;  1SYT A;  4PTM A;  3O5D A;  1FAP A;  4TW8 A;  1T11 A;  2DSW A;  1U79 A;  1X6N A;  2XP7 A;  3PRB A;  2XPB A;  3ARZ A;  5BXJ A;  2DG3 A;  3I6C A;  1HJV A;  3ARY A;  4ITZ A;  1NWT A;  3RM9 A;  3AS0 A;  3CHC A;  1W1V A;  2YBT A;  3PA7 A;  1CTN A;  3CH9 A;  2LPV A;  1E6P A;  4QZV B;  1ZBC A;  3O5P A;  4DRN A;  4JYS A;  1KT1 A;  2MF9 A;  3ARR A;  1B6C A;  4BF8 A;  3AS1 A;  4JFJ A;  5D75 A;  4MTV A;  4WIW A;  2Y78 A;  4ZS6 A;  4Z2L A;  2ZQS A;  1L1P A;  3PR9 A;  2DG4 A;  5DO2 A;  1J6Y A;  3RM4 A;  4DWS C;  1FKH A;  4TYO A;  3UI5 A;  1FKR A;  1ZBW A;  1FKG A;  3KAC A;  1FKJ A;  2M1I A;  2XP5 A;  2DPE A;  3O5Q A;  1LL7 A;  2MLZ A;  4ODQ A;  5DIU A;  2DSU A;  3RGC A;  2ZQV A;  3GPK A;  4Z2I A;  1FKD A;  3ODK A;  3ART A;  4HBE A;  3UI4 A;  4S3K A;  1QPL A;  3WQV A;  4NSB A;  1LL4 A;  2ITK A;  1E6N A;  4IPX A;  3JYM A;  4U84 A;  2XP9 A;  1D7J A;  1GPF A;  1PBK A;  1JND A;  4QT3 A;  4TX0 A;  1LQ0 A;  2LKN A;  1H0G A;  3H9R B;  2F21 A;  2WLZ A;  4NNR A;  1F40 A;  3OA5 A;  4Q22 A;  3IHZ A;  3AS3 A;  4DRQ A;  1J4R A;  1FFQ A;  3KAI A;  3PRD A;  1ZU8 A;  1FFR A;  3RME A;  3NRK A;  2VN1 A;  2WM0 A;  1JVW A;  1A7X A;  3O5I A;  4ZPW R;  3KCE A;  2K8I A;  3UQB A;  4U85 A;  2A3C A;  2KI3 A;  2DT2 A;  2LGO A;  3NTP A;  3ALF A;  5GQB A;  2DSZ A;  4ODO A;  4HAR A;  3B9A A;  3ARW A;  1HXV A;  2ZQT A;  3O5R A;  4QIB A;  1Y0O A;  1LJY A;  1R9H A;  2B31 A;  4DZ2 A;  2KR7 A;  1FKK A;  3WL1 A;  1W1T A;  3RFW A;  1D7H A;  3UQA A;  3O5K A;  1W9P A;  4MSP A;  1HKI A;  4LAW A;  1OGG A;  1K9T A;  2AWG A;  2N87 A;  3FXY A;  4G50 A;  5HTG A;  2KFW A;  1FKI A;  2MLY A;  3CHE A;  1EQ3 A;  5HWB A;  4MGV A;  4MNL A;  2PBC A;  4DWS D;  1ZB5 A;  3FY1 A;  4WKH A;  1LG1 A;  1QPF A;  3EY6 A;  2RUR A;  4W5U A;  1KFW A;  2KGJ A;  2XP4 A;  4GIV A;  5HW6 A;  2D9F A;  4MNK A;  2UZ5 A;  3O5F A;  1ZL1 A;  3ARX A;  1Q6I A;  1LG2 A;  3ARV A;  3UF8 A;  3ARO A;  1O6I A;  2O92 A;  3KAG A;  3IK8 A;  2RUQ A;  4DRH A;  4ZPV R;  2XP3 A;  2MLX A;  1HKK A;  1W1Y A;  3KAB A;  1W9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...