1JNSA

Nmr structure of the e. coli peptidyl-prolyl cis/trans-isomerase parvulin 10
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
AKTAAALHILVKEEKLALDLLEQIKNGADFGKLAKKHSICPSGKRGGDLGEFRQGQMVPAFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE C
publication title Solution structure of Escherichia coli Par10: The prototypic member of the Parvulin family of peptidyl-prolyl cis/trans isomerases.
pubmed doi rcsb
source organism Escherichia coli
total genus 16
structure length 92
sequence length 92
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1jnsA00
3KAFA 1HXVA 1FKLA 1QZ2A 5GPGA 3TDBA 1JNTA 2PBCA 2DG3A 1BL4A 1R9HA 3GPKA 4QT2A 5HT1A 2ZR5A 3O5EA 4LAVA 4U86A 2AWGA 4LAXA 5D75A 2VCDA 2LKNA 1P5QA 2ZR4A 3O5QA 4JFKA 4JFLA 4U84A 4QT3A 1FKKA 2IF4A 2RUQA 3CGMA 3IKGA 3KADA 3O5RA 4ODLA 4MSPA 4G50A 3B7XA 5HTGA 1NMWA 2PV3A 3RFWA 2DG9A 3PRDA 2KO7A 1FKHA 2VN1A 2KFWA 3NI6A 4ODMA 1FKSA 3NTPA 1YATA 1JVWA 2PV1A 3OOBA 2KE0A 1FKFA 1Q6UA 1QPFA 4IQ2A 2RSEA 1FKJA 1NSGA 3KAIA 4U85A 4W9QA 1PBKA 3PRBA 5DITA 2D9FA 2F21A 3PA7A 2ITKA 3UI6A 2MPHA 5HKGA 2OFNA 4IQCA 2MF9A 2MLXA 3O5DA 3UQBA 1FKBA 4ODKA 1B6CA 1J4RA 5HWCA 4DRNA 2L2SA 3O5LA 3UI5A 1JNSA 2XP9A 4DRPA 2MNTA 4MGVA 4R0XA 4C02B 3O5PA 1QPLA 4DIPA 1D7HA 1PINA 3UF8A 4GIVA 4DRHA 4GGQA 2RUDA 3JYMA 2JZVA 2ZQTA 1ZCNA 3MDYB 4JYSA 4DZ3A 1F8AB 1FKDA 2MLYA 2Y78A 3O5JA 2ZR6A 3KAGA 3KCEA 2FAPA 2XP5A 4G2PA 4ODRA 2PPOA 4TW6A 5DIUA 1M5YA 4DROA 3UQAA 2ZQVA 2RQSA 3IKDA 3I6CA 2RURA 2XPAA 4FN2A 4DH0A 5BXJA 1D7IA 3KAHA 1FKRA 4ITZA 4DRKA 1FD9A 3KACA 4TW7A 1U79A 1Q6IA 2XP7A 3O5IA 4ODPA 4TYOA 4W9PA 3UQIA 4JFIA 2Q5AA 4J4OA 1A7XA 3EY6A 4W9OA 3IHZA 4LAYA 4ODQA 1W26A 1N1AA 1L1PA 1KT0A 3O5OA 2XPBA 2ZQUA 1FKTA 3WH0A 2M2AA 3KZ7A 2PPPA 3IK8A 2XP4A 2KGJA 2XP8A 4N19A 1C9HA 4ODNA 4DRJA 4TX0A 1J6YA 3O5GA 3UI4A 1NMVA 2LPVA 2LGOA 5HWBA 2LJ4A 1BKFA 3TC5A 4QIBA 1J4IA 1FAPA 4NNRA 1FKGA 4TW8A 2PV2A 5I98A 5HW7A 5J6EA 1FKIA 4TNSA 3FAPA 5HW6A 5HUAA 1KT1A 1TCOC 2K8IA 2UZ5A 2XP3A 4FAPA 4JFJA 2XP6A 3VAWA 4BF8A 2KI3A 3CGNA 4DRQA 4DRIA 2F4EA 4O2TA 3JYJA 1YW5A 4J4NA 1J4HA 4ODOA 2PPNA 4JFMA 2M1IA 3LUOA 3O5KA 1D7JA 1Q1CA 1F40A 4DZ2A 1ZK6A 1D6OA 1T11A 3ODKA 1EYMA 2MLZA 4DT4A 3JXVA 2ZQSA 5HW8A 2N87A 5B8IC 1ROUA 2KR7A 4IPXA 1Y0OA 5DIVA 2F2DA 3TCZA 1ROTA 2DG4A 2FKEA 1Q6HA 3H9RB 3O5FA 4DRMA 3NRKA 1FJDA 4LAWA 2RUCA 3O5MA 1EQ3A 3KABA 2M08A 3RGCA
chains in the Genus database with same CATH superfamily
1FKLA 1LL6A 1QZ2A 5GPGA 3TDBA 2DG3A 3GPKA 3B9DA 4QT2A 3ARSA 3O5EA 4ZPTR 5D75A 1LJYA 2VCDA 4R5EA 2ETNA 2ZR4A 3B9AA 4JFLA 3IKGA 3O5RA 4MSPA 4MNMA 1FKHA 4ODMA 1FKSA 1JVWA 4P8XA 2KE0A 1Q6UA 1WAWA 1FKJA 1NSGA 3KAIA 5DITA 3PRBA 2F21A 2DPEA 2MPHA 2OFNA 4IQCA 3GU0A 1UR9A 1FKBA 1HKMA 3WD1A 4DRNA 3CH9A 3UI5A 4DRPA 1W9PA 2MNTA 1IX5A 4QZVB 4R0XA 1EDQA 2PN0A 1OGGA 1QPLA 4DIPA 1D7HA 1PINA 1HJVA 2ZQTA 4JYSA 2Y78A 3WQVA 4G2PA 5GPRA 1M5YA 3UQAA 2ZQVA 3I6CA 2RURA 2XPAA 1X6NA 1FKRA 4DRKA 4TW7A 2XP7A 1Q6IA 3O5IA 2ESCA 4LGXA 3G6LA 3EY6A 4W9OA 3CHFA 1VF8A 1W26A 3ARUA 4DWSD 3KZ7A 1GUVA 2XP4A 1C9HA 4ODNA 4TX0A 3AROA 1NMVA 5HWBA 2LJ4A 1FAPA 1FKGA 4TW8A 5J6EA 4WIWA 3B8SA 2XP3A 1W1TA 2XP6A 3VAWA 1H0GA 4DRIA 4J4NA 1ZBKA 3LUOA 1F40A 2DT2A 1XRVA 1OWQA 3ODKA 1EYMA 2QF8A 2A3BA 3JXVA 3ARVA 3AS2A 4IPXA 1FJDA 1Q6HA 2DT0A 1E6NA 4LAWA 2RUCA 4S3JA 3ALFA 1W9VA 3GTYX 3KAFA 3FY1A 2PBCA 1BL4A 1R9HA 3OA5A 5HT1A 2ZR5A 4LAXA 1NWSA 2LKNA 3O5QA 4U84A 1FKKA 3CGMA 3KADA 4ZPWR 3RM8A 1NMWA 2PV3A 1HKIA 2KO7A 5DO2A 1YATA 1EIBA 2PV1A 2DSZA 3BMBA 4U85A 4W9QA 1E9LA 2D9FA 4S3KA 2DSWA 1TFVA 2WLYA 1KFWA 1J4RA 2DSUA 4Z2LA 3O5PA 4GGQA 2RUDA 3JYMA 2JZVA 4P8UA 3ARRA 4IT4A 4XAKA 1FKDA 1FFRA 4ODRA 3O5JA 4U86A 3KAGA 4TW6A 2FAPA 1NWRA 5DIUA 5DEZA 2PPOA 1W9UA 4DH0A 1X6LA 3KAHA 4ITZA 2A3AA 2AOSA 1W1YA 4ODPA 2DT1A 4J4OA 4L3NA 4MPKA 1NH6A 2XPBA 3WH0A 1LL4A 5JH8A 1OGBA 1LQ0A 3IK8A 2XP8A 1J6YA 3CHEA 2G41A 1GPFA 3TC5A 4QIBA 4NNRA 2FDMA 5HW7A 4ML4A 5HW6A 1KT1A 4WKHA 4URIA 4FAPA 3CGNA 4MNKA 4DRQA 2F4EA 1YW5A 2O9OA 1J4HA 4ODOA 2M1IA 3B9EA 1Q1CA 3EIPA 3WD2A 1ZK6A 2ZQSA 5HW8A 2N87A 2KR7A 5DIVA 4P8WA 1FFQA 3CZ8A 3O5MA 3PR9A 2MF9A 2M08A 3WL0A 4NSBA 1JNTA 4WJXA 2AWGA 2YBUA 2DSVA 2O92A 4QT3A 4ODLA 4G50A 4WK9A 5HTGA 1JNDA 2WK2A 1GRJA 2DG9A 4Q22A 2VN1A 3NTPA 1NWUA 1WNOA 3FXYA 4IQ2A 4DWSA 2RSEA 2DT3A 1O6IA 3UI6A 1D2KA 3WD3A 1JCHB 1E6ZA 4HBOA 3O5DA 1ZBVA 4ODKA 5HWCA 1XHGA 3O5LA 3AS0A 1UR8A 3ARQA 4GIVA 1ZL1A 4UDMA 1WB0A 1ZCNA 1H0IA 3MDYB 1ITXA 1F8AB 4DZ3A 4ZS6A 3KCEA 2XP5A 3ARWA 1SR0A 1JNEA 2RQSA 1E6RA 4FN2A 3WQWA 1SYTA 4WKFA 4Z2HA 4Z2IA 4W9PA 2A3CA 3WIJA 1E15A 2Q5AA 4Z2KA 3W4RA 1A7XA 4ODQA 1L1PA 2ZQUA 1FKTA 2IUZA 3O5GA 3ARXA 1J4IA 3ARPA 1FKIA 1ZU8A 1NWTA 4TNSA 3RMEA 2G8ZA 5HUAA 1TCOC 3RM9A 3WD4A 4JFJA 4PTMA 4BF8A 3WD0A 4O2TA 1ZBCA 4WKAA 2A3EA 4HBEA 3ARZA 1D7JA 4MNJA 2F23A 3CHDA 1GOIA 1HKJA 2MLZA 4NZCA 3QOKA 5GQBA 2B31A 4DT4A 5B8IC 1ROUA 1E6PA 1Y0OA 1ROTA 2FKEA 3H9RB 3O5FA 4DRMA 3NRKA 1HXVA 1EQ3A 3KABA 4MNLA 1LG2A 1HKKA 4LAVA 1LG1A 1P5QA 4JFKA 3WL1A 4Z2JA 2IF4A 2RUQA 4DWSC 3ALGA 3B7XA 5DF0A 4KQZA 3RFWA 3PRDA 2KFWA 2OLHA 3NI6A 1E44A 3AS1A 1RD6A 3OOBA 1FKFA 1QPFA 4DRJA 1PBKA 3PA7A 3PRAA 2ITKA 4MAVA 5HKGA 1K9TA 2MLXA 3UQBA 3ARTA 1B6CA 2L2SA 1JNSA 2XP9A 3WKZA 4MGVA 1CTNA 4C02B 3BXWA 4DRHA 3UF8A 4ZPVR 3CHCA 1W1PA 2B5UB 2MLYA 2ZR6A 4Q7NA 4DROA 3IKDA 2P4VA 2EULA 3ARYA 4L72B 3RM4A 1D7IA 5BXJA 4W5UA 4DWSB 1FD9A 3KACA 1U79A 4TYOA 4IT6A 3UQIA 4HARA 4JFIA 4KR0B 3IHZA 4LAYA 1HJXA 1N1AA 1KT0A 3O5OA 2M2AA 2PPPA 2KGJA 4N19A 4MTVA 3UI4A 2LPVA 2LGOA 2YBTA 1BKFA 1ZBWA 2PV2A 5I98A 3FAPA 2UZ5A 1ZB5A 2K8IA 4AY1A 3AQUA 2KI3A 3JYJA 2PPNA 4JFMA 3O5KA 4Z2GA 5HBFA 1EHNA 2WLZA 4DZ2A 1D6OA 1T11A 3AS3A 1LL7A 2WM0A 2F2DA 3G6MA 3TCZA 2DG4A 1W1VA 2PI6A 1HJWA 4P8VA 3RGCA
chains in the Genus database with same CATH topology
1FKLA 1LL6A 1QZ2A 5GPGA 3TDBA 2DG3A 3GPKA 3B9DA 4QT2A 3ARSA 3O5EA 4ZPTR 5D75A 1LJYA 2VCDA 4R5EA 2ZR4A 3B9AA 4JFLA 3IKGA 3O5RA 4MSPA 4MNMA 1FKHA 4ODMA 1FKSA 1JVWA 4P8XA 2KE0A 1Q6UA 1WAWA 1FKJA 1NSGA 3KAIA 5DITA 3PRBA 2F21A 2DPEA 2MPHA 2OFNA 4IQCA 1UR9A 1FKBA 1HKMA 3WD1A 4DRNA 3CH9A 3UI5A 4DRPA 1W9PA 2MNTA 1IX5A 4QZVB 4R0XA 1EDQA 1OGGA 1QPLA 4DIPA 1D7HA 1PINA 1HJVA 2ZQTA 4JYSA 2Y78A 3WQVA 4G2PA 5GPRA 1M5YA 3UQAA 2ZQVA 3I6CA 2RURA 2XPAA 1X6NA 1FKRA 4DRKA 4TW7A 2XP7A 1Q6IA 3O5IA 2ESCA 4LGXA 3G6LA 3EY6A 4W9OA 3CHFA 1VF8A 1W26A 3ARUA 4DWSD 3KZ7A 1GUVA 2XP4A 1C9HA 4ODNA 4TX0A 3AROA 1NMVA 5HWBA 2LJ4A 1FAPA 1FKGA 4TW8A 5J6EA 4WIWA 3B8SA 2XP3A 1W1TA 2XP6A 3VAWA 1H0GA 4DRIA 4J4NA 1ZBKA 3LUOA 1F40A 2DT2A 1XRVA 1OWQA 3ODKA 1EYMA 2QF8A 2A3BA 3JXVA 3ARVA 3AS2A 4IPXA 1FJDA 1Q6HA 2DT0A 1E6NA 4LAWA 2RUCA 4S3JA 3ALFA 1W9VA 3KAFA 3FY1A 2PBCA 1BL4A 1R9HA 3OA5A 5HT1A 2ZR5A 4LAXA 1NWSA 2LKNA 3O5QA 4U84A 1FKKA 3CGMA 3KADA 4ZPWR 3RM8A 1NMWA 2PV3A 1HKIA 2KO7A 5DO2A 1YATA 1EIBA 2PV1A 2DSZA 4U85A 4W9QA 1E9LA 2D9FA 4S3KA 2DSWA 1TFVA 2WLYA 1KFWA 1J4RA 2DSUA 4Z2LA 3O5PA 4GGQA 2RUDA 3JYMA 2JZVA 4P8UA 3ARRA 4IT4A 4XAKA 1FKDA 1FFRA 4ODRA 3O5JA 4U86A 3KAGA 4TW6A 2FAPA 1NWRA 5DIUA 5DEZA 2PPOA 1W9UA 4DH0A 1X6LA 3KAHA 4ITZA 2A3AA 2AOSA 1W1YA 4ODPA 2DT1A 4J4OA 4L3NA 4MPKA 1NH6A 2XPBA 3WH0A 1LL4A 5JH8A 1OGBA 1LQ0A 3IK8A 2XP8A 1J6YA 3CHEA 2G41A 1GPFA 3TC5A 4QIBA 4NNRA 2FDMA 5HW7A 4ML4A 5HW6A 1KT1A 4WKHA 4URIA 4FAPA 3CGNA 4MNKA 4DRQA 2F4EA 1YW5A 2O9OA 1J4HA 4ODOA 2M1IA 3B9EA 1Q1CA 3WD2A 1ZK6A 2ZQSA 5HW8A 2N87A 2KR7A 5DIVA 4P8WA 1FFQA 3CZ8A 3O5MA 3PR9A 2MF9A 2M08A 3WL0A 4NSBA 1JNTA 4WJXA 2AWGA 2YBUA 2DSVA 2O92A 4QT3A 4ODLA 4G50A 4WK9A 5HTGA 1JNDA 2WK2A 2DG9A 4Q22A 2VN1A 3NTPA 1NWUA 1WNOA 3FXYA 4IQ2A 4DWSA 2RSEA 2DT3A 1O6IA 3UI6A 1D2KA 3WD3A 1E6ZA 4HBOA 3O5DA 1ZBVA 4ODKA 5HWCA 1XHGA 3O5LA 3AS0A 1UR8A 3ARQA 4GIVA 1ZL1A 1WB0A 1ZCNA 1H0IA 3MDYB 1ITXA 1F8AB 4DZ3A 4ZS6A 3KCEA 2XP5A 3ARWA 1SR0A 1JNEA 2RQSA 1E6RA 4FN2A 3WQWA 1SYTA 4WKFA 4Z2HA 4Z2IA 4W9PA 2A3CA 3WIJA 1E15A 2Q5AA 4Z2KA 3W4RA 1A7XA 4ODQA 1L1PA 2ZQUA 1FKTA 2IUZA 3O5GA 3ARXA 1J4IA 3ARPA 1FKIA 1ZU8A 1NWTA 4TNSA 3RMEA 2G8ZA 5HUAA 1TCOC 3RM9A 3WD4A 4JFJA 4PTMA 4BF8A 3WD0A 4O2TA 1ZBCA 4WKAA 2A3EA 4HBEA 3ARZA 1D7JA 4MNJA 3CHDA 1GOIA 1HKJA 2MLZA 4NZCA 3QOKA 5GQBA 2B31A 4DT4A 5B8IC 1ROUA 1E6PA 1Y0OA 1ROTA 2FKEA 3H9RB 3O5FA 4DRMA 3NRKA 1HXVA 1EQ3A 3KABA 4MNLA 1LG2A 1HKKA 4LAVA 1LG1A 1P5QA 4JFKA 3WL1A 4Z2JA 2IF4A 2RUQA 4DWSC 3ALGA 3B7XA 5DF0A 4KQZA 3RFWA 3PRDA 2KFWA 2OLHA 3NI6A 3AS1A 1RD6A 3OOBA 1FKFA 1QPFA 4DRJA 1PBKA 3PA7A 3PRAA 2ITKA 4MAVA 5HKGA 1K9TA 2MLXA 3UQBA 3ARTA 1B6CA 2L2SA 1JNSA 2XP9A 3WKZA 4MGVA 1CTNA 4C02B 3BXWA 4DRHA 3UF8A 4ZPVR 3CHCA 1W1PA 2MLYA 2ZR6A 4Q7NA 4DROA 3IKDA 3ARYA 4L72B 3RM4A 1D7IA 5BXJA 4W5UA 4DWSB 1FD9A 3KACA 1U79A 4TYOA 4IT6A 3UQIA 4HARA 4JFIA 4KR0B 3IHZA 4LAYA 1HJXA 1N1AA 1KT0A 3O5OA 2M2AA 2PPPA 2KGJA 4N19A 4MTVA 3UI4A 2LPVA 2LGOA 2YBTA 1BKFA 1ZBWA 2PV2A 5I98A 3FAPA 2UZ5A 1ZB5A 2K8IA 4AY1A 3AQUA 2KI3A 3JYJA 2PPNA 4JFMA 3O5KA 4Z2GA 5HBFA 1EHNA 2WLZA 4DZ2A 1D6OA 1T11A 3AS3A 1LL7A 2WM0A 2F2DA 3G6MA 3TCZA 2DG4A 1W1VA 2PI6A 1HJWA 4P8VA 3RGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAF A;  1HXV A;  1FKL A;  1QZ2 A;  5GPG A;  3TDB A;  1JNT A;  2PBC A;  2DG3 A;  1BL4 A;  1R9H A;  3GPK A;  4QT2 A;  5HT1 A;  2ZR5 A;  3O5E A;  4LAV A;  4U86 A;  2AWG A;  4LAX A;  5D75 A;  2VCD A;  2LKN A;  1P5Q A;  2ZR4 A;  3O5Q A;  4JFK A;  4JFL A;  4U84 A;  4QT3 A;  1FKK A;  2IF4 A;  2RUQ A;  3CGM A;  3IKG A;  3KAD A;  3O5R A;  4ODL A;  4MSP A;  4G50 A;  3B7X A;  5HTG A;  1NMW A;  2PV3 A;  3RFW A;  2DG9 A;  3PRD A;  2KO7 A;  1FKH A;  2VN1 A;  2KFW A;  3NI6 A;  4ODM A;  1FKS A;  3NTP A;  1YAT A;  1JVW A;  2PV1 A;  3OOB A;  2KE0 A;  1FKF A;  1Q6U A;  1QPF A;  4IQ2 A;  2RSE A;  1FKJ A;  1NSG A;  3KAI A;  4U85 A;  4W9Q A;  1PBK A;  3PRB A;  5DIT A;  2D9F A;  2F21 A;  3PA7 A;  2ITK A;  3UI6 A;  2MPH A;  5HKG A;  2OFN A;  4IQC A;  2MF9 A;  2MLX A;  3O5D A;  3UQB A;  1FKB A;  4ODK A;  1B6C A;  1J4R A;  5HWC A;  4DRN A;  2L2S A;  3O5L A;  3UI5 A;  1JNS A;  2XP9 A;  4DRP A;  2MNT A;  4MGV A;  4R0X A;  4C02 B;  3O5P A;  1QPL A;  4DIP A;  1D7H A;  1PIN A;  3UF8 A;  4GIV A;  4DRH A;  4GGQ A;  2RUD A;  3JYM A;  2JZV A;  2ZQT A;  1ZCN A;  3MDY B;  4JYS A;  4DZ3 A;  1F8A B;  1FKD A;  2MLY A;  2Y78 A;  3O5J A;  2ZR6 A;  3KAG A;  3KCE A;  2FAP A;  2XP5 A;  4G2P A;  4ODR A;  2PPO A;  4TW6 A;  5DIU A;  1M5Y A;  4DRO A;  3UQA A;  2ZQV A;  2RQS A;  3IKD A;  3I6C A;  2RUR A;  2XPA A;  4FN2 A;  4DH0 A;  5BXJ A;  1D7I A;  3KAH A;  1FKR A;  4ITZ A;  4DRK A;  1FD9 A;  3KAC A;  4TW7 A;  1U79 A;  1Q6I A;  2XP7 A;  3O5I A;  4ODP A;  4TYO A;  4W9P A;  3UQI A;  4JFI A;  2Q5A A;  4J4O A;  1A7X A;  3EY6 A;  4W9O A;  3IHZ A;  4LAY A;  4ODQ A;  1W26 A;  1N1A A;  1L1P A;  1KT0 A;  3O5O A;  2XPB A;  2ZQU A;  1FKT A;  3WH0 A;  2M2A A;  3KZ7 A;  2PPP A;  3IK8 A;  2XP4 A;  2KGJ A;  2XP8 A;  4N19 A;  1C9H A;  4ODN A;  4DRJ A;  4TX0 A;  1J6Y A;  3O5G A;  3UI4 A;  1NMV A;  2LPV A;  2LGO A;  5HWB A;  2LJ4 A;  1BKF A;  3TC5 A;  4QIB A;  1J4I A;  1FAP A;  4NNR A;  1FKG A;  4TW8 A;  2PV2 A;  5I98 A;  5HW7 A;  5J6E A;  1FKI A;  4TNS A;  3FAP A;  5HW6 A;  5HUA A;  1KT1 A;  1TCO C;  2K8I A;  2UZ5 A;  2XP3 A;  4FAP A;  4JFJ A;  2XP6 A;  3VAW A;  4BF8 A;  2KI3 A;  3CGN A;  4DRQ A;  4DRI A;  2F4E A;  4O2T A;  3JYJ A;  1YW5 A;  4J4N A;  1J4H A;  4ODO A;  2PPN A;  4JFM A;  2M1I A;  3LUO A;  3O5K A;  1D7J A;  1Q1C A;  1F40 A;  4DZ2 A;  1ZK6 A;  1D6O A;  1T11 A;  3ODK A;  1EYM A;  2MLZ A;  4DT4 A;  3JXV A;  2ZQS A;  5HW8 A;  2N87 A;  5B8I C;  1ROU A;  2KR7 A;  4IPX A;  1Y0O A;  5DIV A;  2F2D A;  3TCZ A;  1ROT A;  2DG4 A;  2FKE A;  1Q6H A;  3H9R B;  3O5F A;  4DRM A;  3NRK A;  1FJD A;  4LAW A;  2RUC A;  3O5M A;  1EQ3 A;  3KAB A;  2M08 A;  3RGC A; 
#chains in the Genus database with same CATH topology
 1FKL A;  1LL6 A;  1QZ2 A;  5GPG A;  3TDB A;  2DG3 A;  3GPK A;  3B9D A;  4QT2 A;  3ARS A;  3O5E A;  4ZPT R;  5D75 A;  1LJY A;  2VCD A;  4R5E A;  2ETN A;  2ZR4 A;  3B9A A;  4JFL A;  3IKG A;  3O5R A;  4MSP A;  4MNM A;  1FKH A;  4ODM A;  1FKS A;  1JVW A;  4P8X A;  2KE0 A;  1Q6U A;  1WAW A;  1FKJ A;  1NSG A;  3KAI A;  5DIT A;  3PRB A;  2F21 A;  2DPE A;  2MPH A;  2OFN A;  4IQC A;  3GU0 A;  1UR9 A;  1FKB A;  1HKM A;  3WD1 A;  4DRN A;  3CH9 A;  3UI5 A;  4DRP A;  1W9P A;  2MNT A;  1IX5 A;  4QZV B;  4R0X A;  1EDQ A;  2PN0 A;  1OGG A;  1QPL A;  4DIP A;  1D7H A;  1PIN A;  1HJV A;  2ZQT A;  4JYS A;  2Y78 A;  3WQV A;  4G2P A;  5GPR A;  1M5Y A;  3UQA A;  2ZQV A;  3I6C A;  2RUR A;  2XPA A;  1X6N A;  1FKR A;  4DRK A;  4TW7 A;  2XP7 A;  1Q6I A;  3O5I A;  2ESC A;  4LGX A;  3G6L A;  3EY6 A;  4W9O A;  3CHF A;  1VF8 A;  1W26 A;  3ARU A;  4DWS D;  3KZ7 A;  1GUV A;  2XP4 A;  1C9H A;  4ODN A;  4TX0 A;  3ARO A;  1NMV A;  5HWB A;  2LJ4 A;  1FAP A;  1FKG A;  4TW8 A;  5J6E A;  4WIW A;  3B8S A;  2XP3 A;  1W1T A;  2XP6 A;  3VAW A;  1H0G A;  4DRI A;  4J4N A;  1ZBK A;  3LUO A;  1F40 A;  2DT2 A;  1XRV A;  1OWQ A;  3ODK A;  1EYM A;  2QF8 A;  2A3B A;  3JXV A;  3ARV A;  3AS2 A;  4IPX A;  1FJD A;  1Q6H A;  2DT0 A;  1E6N A;  4LAW A;  2RUC A;  4S3J A;  3ALF A;  1W9V A;  3GTY X;  3KAF A;  3FY1 A;  2PBC A;  1BL4 A;  1R9H A;  3OA5 A;  5HT1 A;  2ZR5 A;  4LAX A;  1NWS A;  2LKN A;  3O5Q A;  4U84 A;  1FKK A;  3CGM A;  3KAD A;  4ZPW R;  3RM8 A;  1NMW A;  2PV3 A;  1HKI A;  2KO7 A;  5DO2 A;  1YAT A;  1EIB A;  2PV1 A;  2DSZ A;  3BMB A;  4U85 A;  4W9Q A;  1E9L A;  2D9F A;  4S3K A;  2DSW A;  1TFV A;  2WLY A;  1KFW A;  1J4R A;  2DSU A;  4Z2L A;  3O5P A;  4GGQ A;  2RUD A;  3JYM A;  2JZV A;  4P8U A;  3ARR A;  4IT4 A;  4XAK A;  1FKD A;  1FFR A;  4ODR A;  3O5J A;  4U86 A;  3KAG A;  4TW6 A;  2FAP A;  1NWR A;  5DIU A;  5DEZ A;  2PPO A;  1W9U A;  4DH0 A;  1X6L A;  3KAH A;  4ITZ A;  2A3A A;  2AOS A;  1W1Y A;  4ODP A;  2DT1 A;  4J4O A;  4L3N A;  4MPK A;  1NH6 A;  2XPB A;  3WH0 A;  1LL4 A;  5JH8 A;  1OGB A;  1LQ0 A;  3IK8 A;  2XP8 A;  1J6Y A;  3CHE A;  2G41 A;  1GPF A;  3TC5 A;  4QIB A;  4NNR A;  2FDM A;  5HW7 A;  4ML4 A;  5HW6 A;  1KT1 A;  4WKH A;  4URI A;  4FAP A;  3CGN A;  4MNK A;  4DRQ A;  2F4E A;  1YW5 A;  2O9O A;  1J4H A;  4ODO A;  2M1I A;  3B9E A;  1Q1C A;  3EIP A;  3WD2 A;  1ZK6 A;  2ZQS A;  5HW8 A;  2N87 A;  2KR7 A;  5DIV A;  4P8W A;  1FFQ A;  3CZ8 A;  3O5M A;  3PR9 A;  2MF9 A;  2M08 A;  3WL0 A;  4NSB A;  1JNT A;  4WJX A;  2AWG A;  2YBU A;  2DSV A;  2O92 A;  4QT3 A;  4ODL A;  4G50 A;  4WK9 A;  5HTG A;  1JND A;  2WK2 A;  1GRJ A;  2DG9 A;  4Q22 A;  2VN1 A;  3NTP A;  1NWU A;  1WNO A;  3FXY A;  4IQ2 A;  4DWS A;  2RSE A;  2DT3 A;  1O6I A;  3UI6 A;  1D2K A;  3WD3 A;  1JCH B;  1E6Z A;  4HBO A;  3O5D A;  1ZBV A;  4ODK A;  5HWC A;  1XHG A;  3O5L A;  3AS0 A;  1UR8 A;  3ARQ A;  4GIV A;  1ZL1 A;  4UDM A;  1WB0 A;  1ZCN A;  1H0I A;  3MDY B;  1ITX A;  1F8A B;  4DZ3 A;  4ZS6 A;  3KCE A;  2XP5 A;  3ARW A;  1SR0 A;  1JNE A;  2RQS A;  1E6R A;  4FN2 A;  3WQW A;  1SYT A;  4WKF A;  4Z2H A;  4Z2I A;  4W9P A;  2A3C A;  3WIJ A;  1E15 A;  2Q5A A;  4Z2K A;  3W4R A;  1A7X A;  4ODQ A;  1L1P A;  2ZQU A;  1FKT A;  2IUZ A;  3O5G A;  3ARX A;  1J4I A;  3ARP A;  1FKI A;  1ZU8 A;  1NWT A;  4TNS A;  3RME A;  2G8Z A;  5HUA A;  1TCO C;  3RM9 A;  3WD4 A;  4JFJ A;  4PTM A;  4BF8 A;  3WD0 A;  4O2T A;  1ZBC A;  4WKA A;  2A3E A;  4HBE A;  3ARZ A;  1D7J A;  4MNJ A;  2F23 A;  3CHD A;  1GOI A;  1HKJ A;  2MLZ A;  4NZC A;  3QOK A;  5GQB A;  2B31 A;  4DT4 A;  5B8I C;  1ROU A;  1E6P A;  1Y0O A;  1ROT A;  2FKE A;  3H9R B;  3O5F A;  4DRM A;  3NRK A;  1HXV A;  1EQ3 A;  3KAB A;  4MNL A;  1LG2 A;  1HKK A;  4LAV A;  1LG1 A;  1P5Q A;  4JFK A;  3WL1 A;  4Z2J A;  2IF4 A;  2RUQ A;  4DWS C;  3ALG A;  3B7X A;  5DF0 A;  4KQZ A;  3RFW A;  3PRD A;  2KFW A;  2OLH A;  3NI6 A;  1E44 A;  3AS1 A;  1RD6 A;  3OOB A;  1FKF A;  1QPF A;  4DRJ A;  1PBK A;  3PA7 A;  3PRA A;  2ITK A;  4MAV A;  5HKG A;  1K9T A;  2MLX A;  3UQB A;  3ART A;  1B6C A;  2L2S A;  1JNS A;  2XP9 A;  3WKZ A;  4MGV A;  1CTN A;  4C02 B;  3BXW A;  4DRH A;  3UF8 A;  4ZPV R;  3CHC A;  1W1P A;  2B5U B;  2MLY A;  2ZR6 A;  4Q7N A;  4DRO A;  3IKD A;  2P4V A;  2EUL A;  3ARY A;  4L72 B;  3RM4 A;  1D7I A;  5BXJ A;  4W5U A;  4DWS B;  1FD9 A;  3KAC A;  1U79 A;  4TYO A;  4IT6 A;  3UQI A;  4HAR A;  4JFI A;  4KR0 B;  3IHZ A;  4LAY A;  1HJX A;  1N1A A;  1KT0 A;  3O5O A;  2M2A A;  2PPP A;  2KGJ A;  4N19 A;  4MTV A;  3UI4 A;  2LPV A;  2LGO A;  2YBT A;  1BKF A;  1ZBW A;  2PV2 A;  5I98 A;  3FAP A;  2UZ5 A;  1ZB5 A;  2K8I A;  4AY1 A;  3AQU A;  2KI3 A;  3JYJ A;  2PPN A;  4JFM A;  3O5K A;  4Z2G A;  5HBF A;  1EHN A;  2WLZ A;  4DZ2 A;  1D6O A;  1T11 A;  3AS3 A;  1LL7 A;  2WM0 A;  2F2D A;  3G6M A;  3TCZ A;  2DG4 A;  1W1V A;  2PI6 A;  1HJW A;  4P8V A;  3RGC A; 
#chains in the Genus database with same CATH homology
 1FKL A;  1LL6 A;  1QZ2 A;  5GPG A;  3TDB A;  2DG3 A;  3GPK A;  3B9D A;  4QT2 A;  3ARS A;  3O5E A;  4ZPT R;  5D75 A;  1LJY A;  2VCD A;  4R5E A;  2ZR4 A;  3B9A A;  4JFL A;  3IKG A;  3O5R A;  4MSP A;  4MNM A;  1FKH A;  4ODM A;  1FKS A;  1JVW A;  4P8X A;  2KE0 A;  1Q6U A;  1WAW A;  1FKJ A;  1NSG A;  3KAI A;  5DIT A;  3PRB A;  2F21 A;  2DPE A;  2MPH A;  2OFN A;  4IQC A;  1UR9 A;  1FKB A;  1HKM A;  3WD1 A;  4DRN A;  3CH9 A;  3UI5 A;  4DRP A;  1W9P A;  2MNT A;  1IX5 A;  4QZV B;  4R0X A;  1EDQ A;  1OGG A;  1QPL A;  4DIP A;  1D7H A;  1PIN A;  1HJV A;  2ZQT A;  4JYS A;  2Y78 A;  3WQV A;  4G2P A;  5GPR A;  1M5Y A;  3UQA A;  2ZQV A;  3I6C A;  2RUR A;  2XPA A;  1X6N A;  1FKR A;  4DRK A;  4TW7 A;  2XP7 A;  1Q6I A;  3O5I A;  2ESC A;  4LGX A;  3G6L A;  3EY6 A;  4W9O A;  3CHF A;  1VF8 A;  1W26 A;  3ARU A;  4DWS D;  3KZ7 A;  1GUV A;  2XP4 A;  1C9H A;  4ODN A;  4TX0 A;  3ARO A;  1NMV A;  5HWB A;  2LJ4 A;  1FAP A;  1FKG A;  4TW8 A;  5J6E A;  4WIW A;  3B8S A;  2XP3 A;  1W1T A;  2XP6 A;  3VAW A;  1H0G A;  4DRI A;  4J4N A;  1ZBK A;  3LUO A;  1F40 A;  2DT2 A;  1XRV A;  1OWQ A;  3ODK A;  1EYM A;  2QF8 A;  2A3B A;  3JXV A;  3ARV A;  3AS2 A;  4IPX A;  1FJD A;  1Q6H A;  2DT0 A;  1E6N A;  4LAW A;  2RUC A;  4S3J A;  3ALF A;  1W9V A;  3KAF A;  3FY1 A;  2PBC A;  1BL4 A;  1R9H A;  3OA5 A;  5HT1 A;  2ZR5 A;  4LAX A;  1NWS A;  2LKN A;  3O5Q A;  4U84 A;  1FKK A;  3CGM A;  3KAD A;  4ZPW R;  3RM8 A;  1NMW A;  2PV3 A;  1HKI A;  2KO7 A;  5DO2 A;  1YAT A;  1EIB A;  2PV1 A;  2DSZ A;  4U85 A;  4W9Q A;  1E9L A;  2D9F A;  4S3K A;  2DSW A;  1TFV A;  2WLY A;  1KFW A;  1J4R A;  2DSU A;  4Z2L A;  3O5P A;  4GGQ A;  2RUD A;  3JYM A;  2JZV A;  4P8U A;  3ARR A;  4IT4 A;  4XAK A;  1FKD A;  1FFR A;  4ODR A;  3O5J A;  4U86 A;  3KAG A;  4TW6 A;  2FAP A;  1NWR A;  5DIU A;  5DEZ A;  2PPO A;  1W9U A;  4DH0 A;  1X6L A;  3KAH A;  4ITZ A;  2A3A A;  2AOS A;  1W1Y A;  4ODP A;  2DT1 A;  4J4O A;  4L3N A;  4MPK A;  1NH6 A;  2XPB A;  3WH0 A;  1LL4 A;  5JH8 A;  1OGB A;  1LQ0 A;  3IK8 A;  2XP8 A;  1J6Y A;  3CHE A;  2G41 A;  1GPF A;  3TC5 A;  4QIB A;  4NNR A;  2FDM A;  5HW7 A;  4ML4 A;  5HW6 A;  1KT1 A;  4WKH A;  4URI A;  4FAP A;  3CGN A;  4MNK A;  4DRQ A;  2F4E A;  1YW5 A;  2O9O A;  1J4H A;  4ODO A;  2M1I A;  3B9E A;  1Q1C A;  3WD2 A;  1ZK6 A;  2ZQS A;  5HW8 A;  2N87 A;  2KR7 A;  5DIV A;  4P8W A;  1FFQ A;  3CZ8 A;  3O5M A;  3PR9 A;  2MF9 A;  2M08 A;  3WL0 A;  4NSB A;  1JNT A;  4WJX A;  2AWG A;  2YBU A;  2DSV A;  2O92 A;  4QT3 A;  4ODL A;  4G50 A;  4WK9 A;  5HTG A;  1JND A;  2WK2 A;  2DG9 A;  4Q22 A;  2VN1 A;  3NTP A;  1NWU A;  1WNO A;  3FXY A;  4IQ2 A;  4DWS A;  2RSE A;  2DT3 A;  1O6I A;  3UI6 A;  1D2K A;  3WD3 A;  1E6Z A;  4HBO A;  3O5D A;  1ZBV A;  4ODK A;  5HWC A;  1XHG A;  3O5L A;  3AS0 A;  1UR8 A;  3ARQ A;  4GIV A;  1ZL1 A;  1WB0 A;  1ZCN A;  1H0I A;  3MDY B;  1ITX A;  1F8A B;  4DZ3 A;  4ZS6 A;  3KCE A;  2XP5 A;  3ARW A;  1SR0 A;  1JNE A;  2RQS A;  1E6R A;  4FN2 A;  3WQW A;  1SYT A;  4WKF A;  4Z2H A;  4Z2I A;  4W9P A;  2A3C A;  3WIJ A;  1E15 A;  2Q5A A;  4Z2K A;  3W4R A;  1A7X A;  4ODQ A;  1L1P A;  2ZQU A;  1FKT A;  2IUZ A;  3O5G A;  3ARX A;  1J4I A;  3ARP A;  1FKI A;  1ZU8 A;  1NWT A;  4TNS A;  3RME A;  2G8Z A;  5HUA A;  1TCO C;  3RM9 A;  3WD4 A;  4JFJ A;  4PTM A;  4BF8 A;  3WD0 A;  4O2T A;  1ZBC A;  4WKA A;  2A3E A;  4HBE A;  3ARZ A;  1D7J A;  4MNJ A;  3CHD A;  1GOI A;  1HKJ A;  2MLZ A;  4NZC A;  3QOK A;  5GQB A;  2B31 A;  4DT4 A;  5B8I C;  1ROU A;  1E6P A;  1Y0O A;  1ROT A;  2FKE A;  3H9R B;  3O5F A;  4DRM A;  3NRK A;  1HXV A;  1EQ3 A;  3KAB A;  4MNL A;  1LG2 A;  1HKK A;  4LAV A;  1LG1 A;  1P5Q A;  4JFK A;  3WL1 A;  4Z2J A;  2IF4 A;  2RUQ A;  4DWS C;  3ALG A;  3B7X A;  5DF0 A;  4KQZ A;  3RFW A;  3PRD A;  2KFW A;  2OLH A;  3NI6 A;  3AS1 A;  1RD6 A;  3OOB A;  1FKF A;  1QPF A;  4DRJ A;  1PBK A;  3PA7 A;  3PRA A;  2ITK A;  4MAV A;  5HKG A;  1K9T A;  2MLX A;  3UQB A;  3ART A;  1B6C A;  2L2S A;  1JNS A;  2XP9 A;  3WKZ A;  4MGV A;  1CTN A;  4C02 B;  3BXW A;  4DRH A;  3UF8 A;  4ZPV R;  3CHC A;  1W1P A;  2MLY A;  2ZR6 A;  4Q7N A;  4DRO A;  3IKD A;  3ARY A;  4L72 B;  3RM4 A;  1D7I A;  5BXJ A;  4W5U A;  4DWS B;  1FD9 A;  3KAC A;  1U79 A;  4TYO A;  4IT6 A;  3UQI A;  4HAR A;  4JFI A;  4KR0 B;  3IHZ A;  4LAY A;  1HJX A;  1N1A A;  1KT0 A;  3O5O A;  2M2A A;  2PPP A;  2KGJ A;  4N19 A;  4MTV A;  3UI4 A;  2LPV A;  2LGO A;  2YBT A;  1BKF A;  1ZBW A;  2PV2 A;  5I98 A;  3FAP A;  2UZ5 A;  1ZB5 A;  2K8I A;  4AY1 A;  3AQU A;  2KI3 A;  3JYJ A;  2PPN A;  4JFM A;  3O5K A;  4Z2G A;  5HBF A;  1EHN A;  2WLZ A;  4DZ2 A;  1D6O A;  1T11 A;  3AS3 A;  1LL7 A;  2WM0 A;  2F2D A;  3G6M A;  3TCZ A;  2DG4 A;  1W1V A;  2PI6 A;  1HJW A;  4P8V A;  3RGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...