1JNSA

Nmr structure of the e. coli peptidyl-prolyl cis/trans-isomerase parvulin 10
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
AKTAAALHILVKEEKLALDLLEQIKNGADFGKLAKKHSICPSGKRGGDLGEFRQGQMVPAFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE C
publication title Solution structure of Escherichia coli Par10: The prototypic member of the Parvulin family of peptidyl-prolyl cis/trans isomerases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 16
structure length 92
sequence length 92
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1jnsA00
3IKGA 3CGMA 4LAWA 2MLXA 1J4RA 3KACA 4DZ2A 3O5DA 4QT3A 3GPKA 2M08A 1C9HA 4JFLA 3JYMA 2VCDA 4J4NA 3UQIA 4MSPA 4TX0A 1B6CA 3KAFA 4DROA 5HWCA 3O5MA 2PBCA 2M1IA 3RGCA 2MLYA 1F8AB 1QPLA 2KI3A 2UZ5A 3I6CA 4QIBA 3UQBA 4TYOA 4FAPA 4ODRA 1FAPA 2ITKA 5HW6A 3O5QA 1Q1CA 2XPBA 3OOBA 3NTPA 1L1PA 3NRKA 3IKDA 4U84A 2LJ4A 1TCOC 2XP4A 1EQ3A 1FKJA 2ZQSA 2JZVA 3IK8A 2RUDA 3NI6A 5HW7A 4JFKA 2ZR4A 2XP6A 1ZK6A 3MDYB 2ZR6A 1PINA 4TNSA 3WH0A 1T11A 1HXVA 3IHZA 2KFWA 2DG3A 2MPHA 1R9HA 4G50A 2LKNA 2XP3A 5I98A 1FJDA 3O5RA 2N87A 5BXJA 1Y0OA 2DG9A 4GIVA 3UF8A 3B7XA 1FKRA 1PBKA 4ODOA 3TC5A 4TW7A 2M2AA 1J4HA 3KABA 4DRMA 4LAXA 3O5GA 1FKDA 2K8IA 2VN1A 4DH0A 1FKKA 1Q6UA 1ROUA 2XP7A 4BF8A 4J4OA 3O5KA 3O5PA 4DIPA 4LAVA 1P5QA 2KO7A 1YW5A 3UI5A 1U79A 4DRKA 1JVWA 2Y78A 1W26A 4G2PA 5B8IC 1NMVA 2D9FA 3RFWA 1Q6IA 5HW8A 5HWBA 3VAWA 2PPPA 1EYMA 2Q5AA 4ODNA 3PA7A 1FKBA 2ZQTA 2FKEA 4NNRA 4C02B 3CGNA 4DZ3A 2RSEA 4ODQA 5HKGA 1A7XA 1NMWA 2XP8A 4JFJA 2PV3A 3KAIA 1BKFA 2PPNA 3H9RB 4ODKA 4GGQA 2KGJA 4IPXA 2F21A 1FKLA 3O5LA 3KZ7A 2F4EA 3KCEA 4ODMA 4U85A 3PRDA 1D7HA 3PRBA 4TW6A 1QZ2A 3TDBA 4DRIA 1NSGA 4ODPA 1FKTA 3KAGA 1D6OA 4DT4A 1KT0A 1ROTA 2RQSA 3EY6A 4ODLA 5GPGA 1FKIA 2PV2A 1FKFA 2AWGA 2LGOA 2OFNA 2KR7A 2RUQA 3KAHA 3ODKA 4IQ2A 4ITZA 4W9OA 1J4IA 1M5YA 4QT2A 1JNTA 3JXVA 2MF9A 4JFMA 4TW8A 5DIVA 4R0XA 3JYJA 2XP9A 3UI4A 4DRJA 2MNTA 4W9QA 5HUAA 3O5JA 2PV1A 4N19A 2IF4A 3KADA 2MLZA 5DIUA 1FKHA 5J6EA 4O2TA 2XPAA 4W9PA 2ZQUA 3LUOA 2ZQVA 2ZR5A 3TCZA 1F40A 2KE0A 5DITA 2PPOA 4LAYA 2RURA 2RUCA 2LPVA 2L2SA 1BL4A 1N1AA 3UI6A 4IQCA 4DRQA 4DRPA 5HT1A 4U86A 4DRNA 1D7JA 1JNSA 4DRHA 3O5EA 3FAPA 1J6YA 3O5OA 1D7IA 1KT1A 4JYSA 1FKGA 1FKSA 4MGVA 1Q6HA 3O5FA 3UQAA 3O5IA 1ZCNA 4FN2A 5D75A 1YATA 1FD9A 1QPFA 2F2DA 2XP5A 4JFIA 2DG4A 5HTGA 2FAPA
chains in the Genus database with same CATH superfamily
1GOIA 3KACA 3BMBA 2WM0A 2VCDA 4MNKA 3AS3A 3B9AA 3KAFA 3O5MA 3B9DA 3CHDA 2KI3A 4Z2GA 2B31A 3WD4A 2IUZA 4ODRA 1FAPA 3NTPA 1L1PA 1X6LA 5DEZA 2XP4A 3GTYX 5HW7A 3WH0A 1W9VA 1HXVA 3IHZA 1XRVA 1R9HA 2ETNA 3PRAA 1ZL1A 4AY1A 1W9UA 4GIVA 4QZVB 1FKRA 3TC5A 1E6NA 1J4HA 3WL1A 3ARXA 3O5KA 4P8VA 4DIPA 4LAVA 2KO7A 1LL4A 4DRKA 1GPFA 5B8IC 1ZBCA 2D9FA 4HBOA 1E6PA 2O9OA 1GRJA 3ARPA 1EDQA 3CGNA 4ODQA 2PPNA 2YBTA 2KGJA 1JNDA 3O5LA 2F4EA 1RD6A 4DRIA 1NSGA 4ODPA 4DT4A 1KT0A 2RQSA 3W4RA 2PV2A 1LL6A 2LGOA 1E6ZA 4W9OA 3JXVA 4DRJA 5HW8A 1SR0A 1KFWA 4W9QA 2IF4A 3ARTA 3KADA 5J6EA 5GQBA 2DSZA 4O2TA 4DWSB 5DITA 4LAYA 1OWQA 2RUCA 2A3EA 3CH9A 3UI6A 3WQVA 3ARQA 1JNSA 1D7JA 4L3NA 1SYTA 1W1VA 1YATA 1FD9A 3B9EA 1HKKA 1HJVA 3RMEA 2PN0A 4LAWA 4DZ2A 3O5DA 4PTMA 1C9HA 1VF8A 4J4NA 3UQIA 4TX0A 1B6CA 5HWCA 3WKZA 1W1TA 3RGCA 5GPRA 4WIWA 1QPLA 4ZPWR 3WD0A 4WKFA 5HW6A 3O5QA 1Q1CA 2QF8A 4U84A 4URIA 3ALFA 4ZPTR 2JZVA 3IK8A 2RUDA 2ZR4A 1ZK6A 3MDYB 1PINA 1X6NA 4MNJA 4P8WA 4IT6A 2KFWA 1O6IA 4Q22A 3RM8A 2LKNA 1EIBA 1IX5A 3O5RA 5BXJA 4W5UA 3UF8A 1CTNA 1LG2A 2DT1A 4DRMA 1ZB5A 1K9TA 2VN1A 4MTVA 1ROUA 4IT4A 3AS2A 3RM9A 4J4OA 1P5QA 1YW5A 2Y78A 1W26A 2O92A 4G2PA 4ZS6A 3RFWA 3G6LA 2PPPA 2DSVA 2DT2A 1FKBA 2AOSA 4MPKA 3AROA 4NNRA 4DWSA 1NMWA 3WIJA 4JFJA 2P4VA 1BKFA 4Z2JA 4IPXA 1NH6A 4ODMA 3PRDA 1D7HA 1LJYA 1W1YA 1NWTA 3KAGA 3ARWA 4Z2KA 5GPGA 2AWGA 4IQ2A 5DF0A 1M5YA 3FXYA 3CHFA 2MF9A 4R0XA 3UI4A 4N19A 1JCHB 1H0GA 2XPAA 4W9PA 4WKAA 4Z2LA 1F40A 2KE0A 4HBEA 2PPOA 2RURA 3WD3A 4DRQA 1BL4A 1N1AA 4IQCA 4R5EA 4DRPA 4U86A 4DRNA 1ZBKA 2DSUA 3O5OA 1D7IA 1KT1A 4JYSA 1W1PA 1E44A 1FKSA 4LGXA 1ZCNA 2PI6A 4L72B 2F2DA 2XP5A 1HKIA 1TFVA 2A3BA 1JNEA 3CGMA 2YBUA 1HJXA 4QT3A 3GPKA 4JFLA 3JYMA 3WL0A 3ARVA 2A3AA 4ZPVR 2M1IA 4TYOA 2ITKA 4Z2IA 3OOBA 1ZBWA 3IKDA 3NI6A 2ZQSA 1LQ0A 2XP6A 2ZR6A 1T11A 2MPHA 4P8UA 2G8ZA 3ARSA 2N87A 3ARYA 3B7XA 1PBKA 4ODOA 4TW7A 4HARA 2M2AA 3PR9A 2DT0A 3KABA 4LAXA 4NSBA 1FKDA 2K8IA 4MNLA 4WK9A 1FKKA 4DH0A 1E9LA 4Z2HA 3UI5A 1JVWA 1NMVA 1Q6IA 4UDMA 5HWBA 1EYMA 2F23A 2ZQTA 4C02B 2FKEA 4DZ3A 5HKGA 2XP8A 1ITXA 5HBFA 4GGQA 4S3KA 1FKLA 3QOKA 4U85A 3AS0A 3KZ7A 3BXWA 3B8SA 1NWSA 4KQZA 3TDBA 2WLZA 1D6OA 1E6RA 3EY6A 4ITZA 3GU0A 1J4IA 1JNTA 4JFMA 5I98A 1UR8A 4KR0B 2MNTA 5HUAA 3O5JA 2PV1A 3ARUA 5DIUA 1FKHA 3FY1A 2ZQUA 3AQUA 3WD1A 2L2SA 1NWRA 3O5EA 1WB0A 4DWSC 1EHNA 1WNOA 1HKJA 4MGVA 1ZU8A 5JH8A 5D75A 4JFIA 1LL7A 4NZCA 3IKGA 4DWSD 2DPEA 1WAWA 3WD2A 2MLXA 1J4RA 2M08A 4MSPA 1LG1A 4DROA 2PBCA 2MLYA 1F8AB 2UZ5A 3I6CA 4QIBA 1OGGA 3UQBA 1E15A 4FAPA 3OA5A 4MNMA 3CZ8A 2XPBA 3NRKA 2LJ4A 1TCOC 1EQ3A 1FFRA 1FKJA 2G41A 4JFKA 4TNSA 4WKHA 1HKMA 1FFQA 2DG3A 3CHCA 4G50A 2XP3A 1FJDA 1ZBVA 3G6MA 3WQWA 1Y0OA 2DG9A 1H0IA 3O5GA 2DSWA 1Q6UA 2XP7A 4ML4A 4BF8A 3O5PA 1OGBA 1U79A 2A3CA 2B5UB 3VAWA 4ODNA 2Q5AA 4S3JA 3ALGA 3PA7A 2RSEA 1A7XA 2PV3A 2DT3A 3KAIA 3AS1A 3H9RB 4ODKA 2F21A 4Q7NA 1UR9A 3KCEA 3ARRA 3RM4A 1W9PA 3PRBA 1XHGA 4TW6A 1QZ2A 2OLHA 1FKTA 2FDMA 1ROTA 2ESCA 4ODLA 5DO2A 1GUVA 1FKIA 1FKFA 3EIPA 2OFNA 2RUQA 2KR7A 3ODKA 3KAHA 4P8XA 3CHEA 4QT2A 2WK2A 4TW8A 5DIVA 3JYJA 2XP9A 1HJWA 2EULA 2MLZA 3LUOA 3TCZA 2ZQVA 2ZR5A 3ARZA 2LPVA 4XAKA 4MAVA 5HT1A 4DRHA 3FAPA 4WJXA 1J6YA 1D2KA 1FKGA 1Q6HA 2WLYA 3O5FA 3O5IA 3UQAA 1NWUA 4FN2A 1QPFA 2DG4A 5HTGA 2FAPA
chains in the Genus database with same CATH topology
1GOIA 3KACA 2WM0A 2VCDA 4MNKA 3AS3A 3B9AA 3KAFA 3O5MA 3B9DA 3CHDA 2KI3A 4Z2GA 2B31A 3WD4A 2IUZA 4ODRA 1FAPA 3NTPA 1L1PA 1X6LA 5DEZA 2XP4A 5HW7A 3WH0A 1W9VA 1HXVA 3IHZA 1XRVA 1R9HA 3PRAA 1ZL1A 4AY1A 1W9UA 4GIVA 4QZVB 1FKRA 3TC5A 1E6NA 1J4HA 3WL1A 3ARXA 3O5KA 4P8VA 4DIPA 4LAVA 2KO7A 1LL4A 4DRKA 1GPFA 5B8IC 1ZBCA 2D9FA 4HBOA 1E6PA 2O9OA 3ARPA 1EDQA 3CGNA 4ODQA 2PPNA 2YBTA 2KGJA 1JNDA 3O5LA 2F4EA 1RD6A 4DRIA 1NSGA 4ODPA 4DT4A 1KT0A 2RQSA 3W4RA 2PV2A 1LL6A 2LGOA 1E6ZA 4W9OA 3JXVA 4DRJA 5HW8A 1SR0A 1KFWA 4W9QA 2IF4A 3ARTA 3KADA 5J6EA 5GQBA 2DSZA 4O2TA 4DWSB 5DITA 4LAYA 1OWQA 2RUCA 2A3EA 3CH9A 3UI6A 3WQVA 3ARQA 1JNSA 1D7JA 4L3NA 1SYTA 1W1VA 1YATA 1FD9A 3B9EA 1HKKA 1HJVA 3RMEA 4LAWA 4DZ2A 3O5DA 4PTMA 1C9HA 1VF8A 4J4NA 3UQIA 4TX0A 1B6CA 5HWCA 3WKZA 1W1TA 3RGCA 5GPRA 4WIWA 1QPLA 4ZPWR 3WD0A 4WKFA 5HW6A 3O5QA 1Q1CA 2QF8A 4U84A 4URIA 3ALFA 4ZPTR 2JZVA 3IK8A 2RUDA 2ZR4A 1ZK6A 3MDYB 1PINA 1X6NA 4MNJA 4P8WA 4IT6A 2KFWA 1O6IA 4Q22A 3RM8A 2LKNA 1EIBA 1IX5A 3O5RA 5BXJA 4W5UA 3UF8A 1CTNA 1LG2A 2DT1A 4DRMA 1ZB5A 1K9TA 2VN1A 4MTVA 1ROUA 4IT4A 3AS2A 3RM9A 4J4OA 1P5QA 1YW5A 2Y78A 1W26A 2O92A 4G2PA 4ZS6A 3RFWA 3G6LA 2PPPA 2DSVA 2DT2A 1FKBA 2AOSA 4MPKA 3AROA 4NNRA 4DWSA 1NMWA 3WIJA 4JFJA 1BKFA 4Z2JA 4IPXA 1NH6A 4ODMA 3PRDA 1D7HA 1LJYA 1W1YA 1NWTA 3KAGA 3ARWA 4Z2KA 5GPGA 2AWGA 4IQ2A 5DF0A 1M5YA 3FXYA 3CHFA 2MF9A 4R0XA 3UI4A 4N19A 1H0GA 2XPAA 4W9PA 4WKAA 4Z2LA 1F40A 2KE0A 4HBEA 2PPOA 2RURA 3WD3A 4DRQA 1BL4A 1N1AA 4IQCA 4R5EA 4DRPA 4U86A 4DRNA 1ZBKA 2DSUA 3O5OA 1D7IA 1KT1A 4JYSA 1W1PA 1FKSA 4LGXA 1ZCNA 2PI6A 4L72B 2F2DA 2XP5A 1HKIA 1TFVA 2A3BA 1JNEA 3CGMA 2YBUA 1HJXA 4QT3A 3GPKA 4JFLA 3JYMA 3WL0A 3ARVA 2A3AA 4ZPVR 2M1IA 4TYOA 2ITKA 4Z2IA 3OOBA 1ZBWA 3IKDA 3NI6A 2ZQSA 1LQ0A 2XP6A 2ZR6A 1T11A 2MPHA 4P8UA 2G8ZA 3ARSA 2N87A 3ARYA 3B7XA 1PBKA 4ODOA 4TW7A 4HARA 2M2AA 3PR9A 2DT0A 3KABA 4LAXA 4NSBA 1FKDA 2K8IA 4MNLA 4WK9A 1FKKA 4DH0A 1E9LA 4Z2HA 3UI5A 1JVWA 1NMVA 1Q6IA 5HWBA 1EYMA 2ZQTA 4C02B 2FKEA 4DZ3A 5HKGA 2XP8A 1ITXA 5HBFA 4GGQA 4S3KA 1FKLA 3QOKA 4U85A 3AS0A 3KZ7A 3BXWA 3B8SA 1NWSA 4KQZA 3TDBA 2WLZA 1D6OA 1E6RA 3EY6A 4ITZA 1J4IA 1JNTA 4JFMA 5I98A 1UR8A 4KR0B 2MNTA 5HUAA 3O5JA 2PV1A 3ARUA 5DIUA 1FKHA 3FY1A 2ZQUA 3AQUA 3WD1A 2L2SA 1NWRA 3O5EA 1WB0A 4DWSC 1EHNA 1WNOA 1HKJA 4MGVA 1ZU8A 5JH8A 5D75A 4JFIA 1LL7A 4NZCA 3IKGA 4DWSD 2DPEA 1WAWA 3WD2A 2MLXA 1J4RA 2M08A 4MSPA 1LG1A 4DROA 2PBCA 2MLYA 1F8AB 2UZ5A 3I6CA 4QIBA 1OGGA 3UQBA 1E15A 4FAPA 3OA5A 4MNMA 3CZ8A 2XPBA 3NRKA 2LJ4A 1TCOC 1EQ3A 1FFRA 1FKJA 2G41A 4JFKA 4TNSA 4WKHA 1HKMA 1FFQA 2DG3A 3CHCA 4G50A 2XP3A 1FJDA 1ZBVA 3G6MA 3WQWA 1Y0OA 2DG9A 1H0IA 3O5GA 2DSWA 1Q6UA 2XP7A 4ML4A 4BF8A 3O5PA 1OGBA 1U79A 2A3CA 3VAWA 4ODNA 2Q5AA 4S3JA 3ALGA 3PA7A 2RSEA 1A7XA 2PV3A 2DT3A 3KAIA 3AS1A 3H9RB 4ODKA 2F21A 4Q7NA 1UR9A 3KCEA 3ARRA 3RM4A 1W9PA 3PRBA 1XHGA 4TW6A 1QZ2A 2OLHA 1FKTA 2FDMA 1ROTA 2ESCA 4ODLA 5DO2A 1GUVA 1FKIA 1FKFA 2OFNA 2RUQA 2KR7A 3ODKA 3KAHA 4P8XA 3CHEA 4QT2A 2WK2A 4TW8A 5DIVA 3JYJA 2XP9A 1HJWA 2MLZA 3LUOA 3TCZA 2ZQVA 2ZR5A 3ARZA 2LPVA 4XAKA 4MAVA 5HT1A 4DRHA 3FAPA 4WJXA 1J6YA 1D2KA 1FKGA 1Q6HA 2WLYA 3O5FA 3O5IA 3UQAA 1NWUA 4FN2A 1QPFA 2DG4A 5HTGA 2FAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IKG A;  3CGM A;  4LAW A;  2MLX A;  1J4R A;  3KAC A;  4DZ2 A;  3O5D A;  4QT3 A;  3GPK A;  2M08 A;  1C9H A;  4JFL A;  3JYM A;  2VCD A;  4J4N A;  3UQI A;  4MSP A;  4TX0 A;  1B6C A;  3KAF A;  4DRO A;  5HWC A;  3O5M A;  2PBC A;  2M1I A;  3RGC A;  2MLY A;  1F8A B;  1QPL A;  2KI3 A;  2UZ5 A;  3I6C A;  4QIB A;  3UQB A;  4TYO A;  4FAP A;  4ODR A;  1FAP A;  2ITK A;  5HW6 A;  3O5Q A;  1Q1C A;  2XPB A;  3OOB A;  3NTP A;  1L1P A;  3NRK A;  3IKD A;  4U84 A;  2LJ4 A;  1TCO C;  2XP4 A;  1EQ3 A;  1FKJ A;  2ZQS A;  2JZV A;  3IK8 A;  2RUD A;  3NI6 A;  5HW7 A;  4JFK A;  2ZR4 A;  2XP6 A;  1ZK6 A;  3MDY B;  2ZR6 A;  1PIN A;  4TNS A;  3WH0 A;  1T11 A;  1HXV A;  3IHZ A;  2KFW A;  2DG3 A;  2MPH A;  1R9H A;  4G50 A;  2LKN A;  2XP3 A;  5I98 A;  1FJD A;  3O5R A;  2N87 A;  5BXJ A;  1Y0O A;  2DG9 A;  4GIV A;  3UF8 A;  3B7X A;  1FKR A;  1PBK A;  4ODO A;  3TC5 A;  4TW7 A;  2M2A A;  1J4H A;  3KAB A;  4DRM A;  4LAX A;  3O5G A;  1FKD A;  2K8I A;  2VN1 A;  4DH0 A;  1FKK A;  1Q6U A;  1ROU A;  2XP7 A;  4BF8 A;  4J4O A;  3O5K A;  3O5P A;  4DIP A;  4LAV A;  1P5Q A;  2KO7 A;  1YW5 A;  3UI5 A;  1U79 A;  4DRK A;  1JVW A;  2Y78 A;  1W26 A;  4G2P A;  5B8I C;  1NMV A;  2D9F A;  3RFW A;  1Q6I A;  5HW8 A;  5HWB A;  3VAW A;  2PPP A;  1EYM A;  2Q5A A;  4ODN A;  3PA7 A;  1FKB A;  2ZQT A;  2FKE A;  4NNR A;  4C02 B;  3CGN A;  4DZ3 A;  2RSE A;  4ODQ A;  5HKG A;  1A7X A;  1NMW A;  2XP8 A;  4JFJ A;  2PV3 A;  3KAI A;  1BKF A;  2PPN A;  3H9R B;  4ODK A;  4GGQ A;  2KGJ A;  4IPX A;  2F21 A;  1FKL A;  3O5L A;  3KZ7 A;  2F4E A;  3KCE A;  4ODM A;  4U85 A;  3PRD A;  1D7H A;  3PRB A;  4TW6 A;  1QZ2 A;  3TDB A;  4DRI A;  1NSG A;  4ODP A;  1FKT A;  3KAG A;  1D6O A;  4DT4 A;  1KT0 A;  1ROT A;  2RQS A;  3EY6 A;  4ODL A;  5GPG A;  1FKI A;  2PV2 A;  1FKF A;  2AWG A;  2LGO A;  2OFN A;  2KR7 A;  2RUQ A;  3KAH A;  3ODK A;  4IQ2 A;  4ITZ A;  4W9O A;  1J4I A;  1M5Y A;  4QT2 A;  1JNT A;  3JXV A;  2MF9 A;  4JFM A;  4TW8 A;  5DIV A;  4R0X A;  3JYJ A;  2XP9 A;  3UI4 A;  4DRJ A;  2MNT A;  4W9Q A;  5HUA A;  3O5J A;  2PV1 A;  4N19 A;  2IF4 A;  3KAD A;  2MLZ A;  5DIU A;  1FKH A;  5J6E A;  4O2T A;  2XPA A;  4W9P A;  2ZQU A;  3LUO A;  2ZQV A;  2ZR5 A;  3TCZ A;  1F40 A;  2KE0 A;  5DIT A;  2PPO A;  4LAY A;  2RUR A;  2RUC A;  2LPV A;  2L2S A;  1BL4 A;  1N1A A;  3UI6 A;  4IQC A;  4DRQ A;  4DRP A;  5HT1 A;  4U86 A;  4DRN A;  1D7J A;  1JNS A;  4DRH A;  3O5E A;  3FAP A;  1J6Y A;  3O5O A;  1D7I A;  1KT1 A;  4JYS A;  1FKG A;  1FKS A;  4MGV A;  1Q6H A;  3O5F A;  3UQA A;  3O5I A;  1ZCN A;  4FN2 A;  5D75 A;  1YAT A;  1FD9 A;  1QPF A;  2F2D A;  2XP5 A;  4JFI A;  2DG4 A;  5HTG A;  2FAP A; 
#chains in the Genus database with same CATH topology
 1GOI A;  3KAC A;  3BMB A;  2WM0 A;  2VCD A;  4MNK A;  3AS3 A;  3B9A A;  3KAF A;  3O5M A;  3B9D A;  3CHD A;  2KI3 A;  4Z2G A;  2B31 A;  3WD4 A;  2IUZ A;  4ODR A;  1FAP A;  3NTP A;  1L1P A;  1X6L A;  5DEZ A;  2XP4 A;  3GTY X;  5HW7 A;  3WH0 A;  1W9V A;  1HXV A;  3IHZ A;  1XRV A;  1R9H A;  2ETN A;  3PRA A;  1ZL1 A;  4AY1 A;  1W9U A;  4GIV A;  4QZV B;  1FKR A;  3TC5 A;  1E6N A;  1J4H A;  3WL1 A;  3ARX A;  3O5K A;  4P8V A;  4DIP A;  4LAV A;  2KO7 A;  1LL4 A;  4DRK A;  1GPF A;  5B8I C;  1ZBC A;  2D9F A;  4HBO A;  1E6P A;  2O9O A;  1GRJ A;  3ARP A;  1EDQ A;  3CGN A;  4ODQ A;  2PPN A;  2YBT A;  2KGJ A;  1JND A;  3O5L A;  2F4E A;  1RD6 A;  4DRI A;  1NSG A;  4ODP A;  4DT4 A;  1KT0 A;  2RQS A;  3W4R A;  2PV2 A;  1LL6 A;  2LGO A;  1E6Z A;  4W9O A;  3JXV A;  4DRJ A;  5HW8 A;  1SR0 A;  1KFW A;  4W9Q A;  2IF4 A;  3ART A;  3KAD A;  5J6E A;  5GQB A;  2DSZ A;  4O2T A;  4DWS B;  5DIT A;  4LAY A;  1OWQ A;  2RUC A;  2A3E A;  3CH9 A;  3UI6 A;  3WQV A;  3ARQ A;  1JNS A;  1D7J A;  4L3N A;  1SYT A;  1W1V A;  1YAT A;  1FD9 A;  3B9E A;  1HKK A;  1HJV A;  3RME A;  2PN0 A;  4LAW A;  4DZ2 A;  3O5D A;  4PTM A;  1C9H A;  1VF8 A;  4J4N A;  3UQI A;  4TX0 A;  1B6C A;  5HWC A;  3WKZ A;  1W1T A;  3RGC A;  5GPR A;  4WIW A;  1QPL A;  4ZPW R;  3WD0 A;  4WKF A;  5HW6 A;  3O5Q A;  1Q1C A;  2QF8 A;  4U84 A;  4URI A;  3ALF A;  4ZPT R;  2JZV A;  3IK8 A;  2RUD A;  2ZR4 A;  1ZK6 A;  3MDY B;  1PIN A;  1X6N A;  4MNJ A;  4P8W A;  4IT6 A;  2KFW A;  1O6I A;  4Q22 A;  3RM8 A;  2LKN A;  1EIB A;  1IX5 A;  3O5R A;  5BXJ A;  4W5U A;  3UF8 A;  1CTN A;  1LG2 A;  2DT1 A;  4DRM A;  1ZB5 A;  1K9T A;  2VN1 A;  4MTV A;  1ROU A;  4IT4 A;  3AS2 A;  3RM9 A;  4J4O A;  1P5Q A;  1YW5 A;  2Y78 A;  1W26 A;  2O92 A;  4G2P A;  4ZS6 A;  3RFW A;  3G6L A;  2PPP A;  2DSV A;  2DT2 A;  1FKB A;  2AOS A;  4MPK A;  3ARO A;  4NNR A;  4DWS A;  1NMW A;  3WIJ A;  4JFJ A;  2P4V A;  1BKF A;  4Z2J A;  4IPX A;  1NH6 A;  4ODM A;  3PRD A;  1D7H A;  1LJY A;  1W1Y A;  1NWT A;  3KAG A;  3ARW A;  4Z2K A;  5GPG A;  2AWG A;  4IQ2 A;  5DF0 A;  1M5Y A;  3FXY A;  3CHF A;  2MF9 A;  4R0X A;  3UI4 A;  4N19 A;  1JCH B;  1H0G A;  2XPA A;  4W9P A;  4WKA A;  4Z2L A;  1F40 A;  2KE0 A;  4HBE A;  2PPO A;  2RUR A;  3WD3 A;  4DRQ A;  1BL4 A;  1N1A A;  4IQC A;  4R5E A;  4DRP A;  4U86 A;  4DRN A;  1ZBK A;  2DSU A;  3O5O A;  1D7I A;  1KT1 A;  4JYS A;  1W1P A;  1E44 A;  1FKS A;  4LGX A;  1ZCN A;  2PI6 A;  4L72 B;  2F2D A;  2XP5 A;  1HKI A;  1TFV A;  2A3B A;  1JNE A;  3CGM A;  2YBU A;  1HJX A;  4QT3 A;  3GPK A;  4JFL A;  3JYM A;  3WL0 A;  3ARV A;  2A3A A;  4ZPV R;  2M1I A;  4TYO A;  2ITK A;  4Z2I A;  3OOB A;  1ZBW A;  3IKD A;  3NI6 A;  2ZQS A;  1LQ0 A;  2XP6 A;  2ZR6 A;  1T11 A;  2MPH A;  4P8U A;  2G8Z A;  3ARS A;  2N87 A;  3ARY A;  3B7X A;  1PBK A;  4ODO A;  4TW7 A;  4HAR A;  2M2A A;  3PR9 A;  2DT0 A;  3KAB A;  4LAX A;  4NSB A;  1FKD A;  2K8I A;  4MNL A;  4WK9 A;  1FKK A;  4DH0 A;  1E9L A;  4Z2H A;  3UI5 A;  1JVW A;  1NMV A;  1Q6I A;  4UDM A;  5HWB A;  1EYM A;  2F23 A;  2ZQT A;  4C02 B;  2FKE A;  4DZ3 A;  5HKG A;  2XP8 A;  1ITX A;  5HBF A;  4GGQ A;  4S3K A;  1FKL A;  3QOK A;  4U85 A;  3AS0 A;  3KZ7 A;  3BXW A;  3B8S A;  1NWS A;  4KQZ A;  3TDB A;  2WLZ A;  1D6O A;  1E6R A;  3EY6 A;  4ITZ A;  3GU0 A;  1J4I A;  1JNT A;  4JFM A;  5I98 A;  1UR8 A;  4KR0 B;  2MNT A;  5HUA A;  3O5J A;  2PV1 A;  3ARU A;  5DIU A;  1FKH A;  3FY1 A;  2ZQU A;  3AQU A;  3WD1 A;  2L2S A;  1NWR A;  3O5E A;  1WB0 A;  4DWS C;  1EHN A;  1WNO A;  1HKJ A;  4MGV A;  1ZU8 A;  5JH8 A;  5D75 A;  4JFI A;  1LL7 A;  4NZC A;  3IKG A;  4DWS D;  2DPE A;  1WAW A;  3WD2 A;  2MLX A;  1J4R A;  2M08 A;  4MSP A;  1LG1 A;  4DRO A;  2PBC A;  2MLY A;  1F8A B;  2UZ5 A;  3I6C A;  4QIB A;  1OGG A;  3UQB A;  1E15 A;  4FAP A;  3OA5 A;  4MNM A;  3CZ8 A;  2XPB A;  3NRK A;  2LJ4 A;  1TCO C;  1EQ3 A;  1FFR A;  1FKJ A;  2G41 A;  4JFK A;  4TNS A;  4WKH A;  1HKM A;  1FFQ A;  2DG3 A;  3CHC A;  4G50 A;  2XP3 A;  1FJD A;  1ZBV A;  3G6M A;  3WQW A;  1Y0O A;  2DG9 A;  1H0I A;  3O5G A;  2DSW A;  1Q6U A;  2XP7 A;  4ML4 A;  4BF8 A;  3O5P A;  1OGB A;  1U79 A;  2A3C A;  2B5U B;  3VAW A;  4ODN A;  2Q5A A;  4S3J A;  3ALG A;  3PA7 A;  2RSE A;  1A7X A;  2PV3 A;  2DT3 A;  3KAI A;  3AS1 A;  3H9R B;  4ODK A;  2F21 A;  4Q7N A;  1UR9 A;  3KCE A;  3ARR A;  3RM4 A;  1W9P A;  3PRB A;  1XHG A;  4TW6 A;  1QZ2 A;  2OLH A;  1FKT A;  2FDM A;  1ROT A;  2ESC A;  4ODL A;  5DO2 A;  1GUV A;  1FKI A;  1FKF A;  3EIP A;  2OFN A;  2RUQ A;  2KR7 A;  3ODK A;  3KAH A;  4P8X A;  3CHE A;  4QT2 A;  2WK2 A;  4TW8 A;  5DIV A;  3JYJ A;  2XP9 A;  1HJW A;  2EUL A;  2MLZ A;  3LUO A;  3TCZ A;  2ZQV A;  2ZR5 A;  3ARZ A;  2LPV A;  4XAK A;  4MAV A;  5HT1 A;  4DRH A;  3FAP A;  4WJX A;  1J6Y A;  1D2K A;  1FKG A;  1Q6H A;  2WLY A;  3O5F A;  3O5I A;  3UQA A;  1NWU A;  4FN2 A;  1QPF A;  2DG4 A;  5HTG A;  2FAP A; 
#chains in the Genus database with same CATH homology
 1GOI A;  3KAC A;  2WM0 A;  2VCD A;  4MNK A;  3AS3 A;  3B9A A;  3KAF A;  3O5M A;  3B9D A;  3CHD A;  2KI3 A;  4Z2G A;  2B31 A;  3WD4 A;  2IUZ A;  4ODR A;  1FAP A;  3NTP A;  1L1P A;  1X6L A;  5DEZ A;  2XP4 A;  5HW7 A;  3WH0 A;  1W9V A;  1HXV A;  3IHZ A;  1XRV A;  1R9H A;  3PRA A;  1ZL1 A;  4AY1 A;  1W9U A;  4GIV A;  4QZV B;  1FKR A;  3TC5 A;  1E6N A;  1J4H A;  3WL1 A;  3ARX A;  3O5K A;  4P8V A;  4DIP A;  4LAV A;  2KO7 A;  1LL4 A;  4DRK A;  1GPF A;  5B8I C;  1ZBC A;  2D9F A;  4HBO A;  1E6P A;  2O9O A;  3ARP A;  1EDQ A;  3CGN A;  4ODQ A;  2PPN A;  2YBT A;  2KGJ A;  1JND A;  3O5L A;  2F4E A;  1RD6 A;  4DRI A;  1NSG A;  4ODP A;  4DT4 A;  1KT0 A;  2RQS A;  3W4R A;  2PV2 A;  1LL6 A;  2LGO A;  1E6Z A;  4W9O A;  3JXV A;  4DRJ A;  5HW8 A;  1SR0 A;  1KFW A;  4W9Q A;  2IF4 A;  3ART A;  3KAD A;  5J6E A;  5GQB A;  2DSZ A;  4O2T A;  4DWS B;  5DIT A;  4LAY A;  1OWQ A;  2RUC A;  2A3E A;  3CH9 A;  3UI6 A;  3WQV A;  3ARQ A;  1JNS A;  1D7J A;  4L3N A;  1SYT A;  1W1V A;  1YAT A;  1FD9 A;  3B9E A;  1HKK A;  1HJV A;  3RME A;  4LAW A;  4DZ2 A;  3O5D A;  4PTM A;  1C9H A;  1VF8 A;  4J4N A;  3UQI A;  4TX0 A;  1B6C A;  5HWC A;  3WKZ A;  1W1T A;  3RGC A;  5GPR A;  4WIW A;  1QPL A;  4ZPW R;  3WD0 A;  4WKF A;  5HW6 A;  3O5Q A;  1Q1C A;  2QF8 A;  4U84 A;  4URI A;  3ALF A;  4ZPT R;  2JZV A;  3IK8 A;  2RUD A;  2ZR4 A;  1ZK6 A;  3MDY B;  1PIN A;  1X6N A;  4MNJ A;  4P8W A;  4IT6 A;  2KFW A;  1O6I A;  4Q22 A;  3RM8 A;  2LKN A;  1EIB A;  1IX5 A;  3O5R A;  5BXJ A;  4W5U A;  3UF8 A;  1CTN A;  1LG2 A;  2DT1 A;  4DRM A;  1ZB5 A;  1K9T A;  2VN1 A;  4MTV A;  1ROU A;  4IT4 A;  3AS2 A;  3RM9 A;  4J4O A;  1P5Q A;  1YW5 A;  2Y78 A;  1W26 A;  2O92 A;  4G2P A;  4ZS6 A;  3RFW A;  3G6L A;  2PPP A;  2DSV A;  2DT2 A;  1FKB A;  2AOS A;  4MPK A;  3ARO A;  4NNR A;  4DWS A;  1NMW A;  3WIJ A;  4JFJ A;  1BKF A;  4Z2J A;  4IPX A;  1NH6 A;  4ODM A;  3PRD A;  1D7H A;  1LJY A;  1W1Y A;  1NWT A;  3KAG A;  3ARW A;  4Z2K A;  5GPG A;  2AWG A;  4IQ2 A;  5DF0 A;  1M5Y A;  3FXY A;  3CHF A;  2MF9 A;  4R0X A;  3UI4 A;  4N19 A;  1H0G A;  2XPA A;  4W9P A;  4WKA A;  4Z2L A;  1F40 A;  2KE0 A;  4HBE A;  2PPO A;  2RUR A;  3WD3 A;  4DRQ A;  1BL4 A;  1N1A A;  4IQC A;  4R5E A;  4DRP A;  4U86 A;  4DRN A;  1ZBK A;  2DSU A;  3O5O A;  1D7I A;  1KT1 A;  4JYS A;  1W1P A;  1FKS A;  4LGX A;  1ZCN A;  2PI6 A;  4L72 B;  2F2D A;  2XP5 A;  1HKI A;  1TFV A;  2A3B A;  1JNE A;  3CGM A;  2YBU A;  1HJX A;  4QT3 A;  3GPK A;  4JFL A;  3JYM A;  3WL0 A;  3ARV A;  2A3A A;  4ZPV R;  2M1I A;  4TYO A;  2ITK A;  4Z2I A;  3OOB A;  1ZBW A;  3IKD A;  3NI6 A;  2ZQS A;  1LQ0 A;  2XP6 A;  2ZR6 A;  1T11 A;  2MPH A;  4P8U A;  2G8Z A;  3ARS A;  2N87 A;  3ARY A;  3B7X A;  1PBK A;  4ODO A;  4TW7 A;  4HAR A;  2M2A A;  3PR9 A;  2DT0 A;  3KAB A;  4LAX A;  4NSB A;  1FKD A;  2K8I A;  4MNL A;  4WK9 A;  1FKK A;  4DH0 A;  1E9L A;  4Z2H A;  3UI5 A;  1JVW A;  1NMV A;  1Q6I A;  5HWB A;  1EYM A;  2ZQT A;  4C02 B;  2FKE A;  4DZ3 A;  5HKG A;  2XP8 A;  1ITX A;  5HBF A;  4GGQ A;  4S3K A;  1FKL A;  3QOK A;  4U85 A;  3AS0 A;  3KZ7 A;  3BXW A;  3B8S A;  1NWS A;  4KQZ A;  3TDB A;  2WLZ A;  1D6O A;  1E6R A;  3EY6 A;  4ITZ A;  1J4I A;  1JNT A;  4JFM A;  5I98 A;  1UR8 A;  4KR0 B;  2MNT A;  5HUA A;  3O5J A;  2PV1 A;  3ARU A;  5DIU A;  1FKH A;  3FY1 A;  2ZQU A;  3AQU A;  3WD1 A;  2L2S A;  1NWR A;  3O5E A;  1WB0 A;  4DWS C;  1EHN A;  1WNO A;  1HKJ A;  4MGV A;  1ZU8 A;  5JH8 A;  5D75 A;  4JFI A;  1LL7 A;  4NZC A;  3IKG A;  4DWS D;  2DPE A;  1WAW A;  3WD2 A;  2MLX A;  1J4R A;  2M08 A;  4MSP A;  1LG1 A;  4DRO A;  2PBC A;  2MLY A;  1F8A B;  2UZ5 A;  3I6C A;  4QIB A;  1OGG A;  3UQB A;  1E15 A;  4FAP A;  3OA5 A;  4MNM A;  3CZ8 A;  2XPB A;  3NRK A;  2LJ4 A;  1TCO C;  1EQ3 A;  1FFR A;  1FKJ A;  2G41 A;  4JFK A;  4TNS A;  4WKH A;  1HKM A;  1FFQ A;  2DG3 A;  3CHC A;  4G50 A;  2XP3 A;  1FJD A;  1ZBV A;  3G6M A;  3WQW A;  1Y0O A;  2DG9 A;  1H0I A;  3O5G A;  2DSW A;  1Q6U A;  2XP7 A;  4ML4 A;  4BF8 A;  3O5P A;  1OGB A;  1U79 A;  2A3C A;  3VAW A;  4ODN A;  2Q5A A;  4S3J A;  3ALG A;  3PA7 A;  2RSE A;  1A7X A;  2PV3 A;  2DT3 A;  3KAI A;  3AS1 A;  3H9R B;  4ODK A;  2F21 A;  4Q7N A;  1UR9 A;  3KCE A;  3ARR A;  3RM4 A;  1W9P A;  3PRB A;  1XHG A;  4TW6 A;  1QZ2 A;  2OLH A;  1FKT A;  2FDM A;  1ROT A;  2ESC A;  4ODL A;  5DO2 A;  1GUV A;  1FKI A;  1FKF A;  2OFN A;  2RUQ A;  2KR7 A;  3ODK A;  3KAH A;  4P8X A;  3CHE A;  4QT2 A;  2WK2 A;  4TW8 A;  5DIV A;  3JYJ A;  2XP9 A;  1HJW A;  2MLZ A;  3LUO A;  3TCZ A;  2ZQV A;  2ZR5 A;  3ARZ A;  2LPV A;  4XAK A;  4MAV A;  5HT1 A;  4DRH A;  3FAP A;  4WJX A;  1J6Y A;  1D2K A;  1FKG A;  1Q6H A;  2WLY A;  3O5F A;  3O5I A;  3UQA A;  1NWU A;  4FN2 A;  1QPF A;  2DG4 A;  5HTG A;  2FAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...