1JNSA

Nmr structure of the e. coli peptidyl-prolyl cis/trans-isomerase parvulin 10
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
b'AKTAAALHILVKEEKLALDLLEQIKNGADFGKLAKKHSICPSGKRGGDLGEFRQGQMVPAFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE C
publication title Solution structure of Escherichia coli Par10: The prototypic member of the Parvulin family of peptidyl-prolyl cis/trans isomerases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 16
structure length 92
sequence length 92
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1jnsA00
2ZQSA 2ZR6A 4ODQA 2M1IA 1Q1CA 1QPFA 1D6OA 2XP9A 4DRIA 2XP3A 3JYMA 1FKHA 2KI3A 1N1AA 4DRMA 1A7XA 1NMWA 1W26A 2KR7A 5I98A 3O5MA 3KABA 1U79A 3KAGA 1KT0A 2OFNA 4GIVA 5HWCA 4TW8A 2XP5A 4FAPA 3O5PA 2MNTA 1B6CA 2ITKA 3WH0A 4DRKA 4DRJA 2VCDA 1J4HA 1D7HA 1ROTA 2Y78A 1F8AB 4JFJA 4TX0A 4DRQA 5HTGA 2MLXA 4ODMA 2F2DA 2D9FA 4MSPA 2PPPA 1FKDA 1EYMA 3JYJA 1BL4A 2M08A 3PRDA 1J6YA 4ODKA 2PV3A 2L2SA 2ZQVA 3IHZA 4ODPA 1JNTA 1NMVA 4G2PA 4QT2A 3UQIA 4W9QA 4MGVA 2MPHA 4U86A 1J4IA 2AWGA 2Q5AA 3RFWA 1Q6HA 2K8IA 2PV2A 3KAIA 2DG4A 2FAPA 2KE0A 3I6CA 4U85A 1HXVA 4DT4A 2DG3A 3O5RA 3LUOA 5HUAA 1ROUA 3UQAA 2XP6A 2RSEA 2N87A 4J4OA 2KFWA 1FKKA 4LAVA 3B7XA 4LAXA 5BXJA 4IQ2A 1FKTA 4DZ2A 1F40A 2FKEA 1ZCNA 5D75A 5HKGA 1FKRA 2XP8A 4DRPA 4ODNA 3ODKA 2XP7A 5J6EA 3O5GA 2F4EA 3EY6A 3NI6A 4G50A 4JFKA 1FKLA 3O5OA 2DG9A 2PV1A 4TNSA 2KO7A 2ZQUA 4IPXA 2MLYA 5DIUA 1FKGA 4JFIA 1P5QA 4DIPA 4DH0A 3KAFA 3UF8A 3IK8A 3NTPA 4TW6A 4J4NA 3MDYB 4TW7A 5GPGA 2M2AA 3O5DA 3RGCA 1ZK6A 2LGOA 1M5YA 3IKGA 3FAPA 4ODOA 1T11A 4ODRA 2XP4A 4W9OA 3PRBA 4ITZA 4U84A 3O5KA 4LAWA 1L1PA 2PBCA 1QPLA 1Y0OA 2IF4A 2ZR4A 3GPKA 2VN1A 4IQCA 4TYOA 4C02B 1FKFA 4DRNA 1PINA 1NSGA 2LPVA 2RUCA 1C9HA 3KACA 3IKDA 2ZR5A 3TDBA 4W9PA 1Q6UA 2MLZA 4JYSA 4BF8A 4QT3A 4QIBA 1FD9A 1FKIA 2RQSA 3UI6A 3O5FA 1FKBA 4DZ3A 3CGNA 2KGJA 1PBKA 2F21A 3TCZA 4DRHA 2MF9A 2PPOA 2RURA 5DITA 3UI5A 5HW8A 3KAHA 3UI4A 1FAPA 1Q6IA 2PPNA 4N19A 3UQBA 3H9RB 3O5QA 2LKNA 3KZ7A 4LAYA 4ODLA 1R9HA 1J4RA 3KCEA 3VAWA 1YATA 1EQ3A 3O5EA 1FJDA 5HW7A 3NRKA 2XPBA 5DIVA 3O5JA 2ZQTA 1JNSA 2RUQA 4JFLA 3O5LA 4NNRA 1KT1A 2XPAA 1BKFA 1QZ2A 1TCOC 2JZVA 3KADA 1JVWA 3JXVA 3O5IA 4R0XA 4FN2A 5HW6A 1YW5A 5HWBA 4JFMA 1D7JA 3CGMA 1FKJA 1FKSA 4GGQA 3OOBA 4DROA 2RUDA 5B8IC 3PA7A 4O2TA 1D7IA 2UZ5A 5HT1A 3TC5A 2LJ4A
chains in the Genus database with same CATH superfamily
2ZQSA 4ODQA 2XP3A 3JYMA 2QF8A 1W1VA 1A7XA 4P8VA 2WM0A 4WKHA 3WD1A 5HWCA 2XP5A 4MNJA 2ITKA 4DRKA 1OGGA 4DRJA 5HTGA 1D7HA 2Y78A 1F8AB 1W1PA 4TX0A 4DRQA 2IUZA 3ARVA 2ESCA 3PRAA 1EYMA 3JYJA 1BL4A 3PRDA 1J6YA 1GRJA 2L2SA 4QT2A 4MGVA 1E44A 2MPHA 1LL7A 2KE0A 4U85A 4DT4A 3LUOA 2XP6A 2N87A 1GOIA 1FKKA 4MTVA 4PTMA 3ARZA 1FKTA 1ZCNA 4LGXA 1SYTA 3QOKA 1FKLA 3O5OA 3WIJA 2KO7A 1E6NA 1UR8A 2MLYA 2A3BA 5GQBA 4ZPWR 1FFRA 3WD4A 4WIWA 4L72B 4ITZA 3O5KA 4LAWA 3ARTA 2B31A 1L1PA 1Y0OA 2IF4A 4ZS6A 3GU0A 1PINA 1NSGA 1E6ZA 3CZ8A 2MLZA 1WAWA 1ZB5A 4QIBA 1EDQA 1E6RA 1NH6A 2RQSA 3UI6A 3O5FA 1FKBA 4DZ3A 2KGJA 2MF9A 1HJVA 3FY1A 1FAPA 4N19A 3H9RB 4ODLA 1R9HA 3KCEA 1YATA 4ZPTR 1EQ3A 1HJWA 5HW7A 1CTNA 2XPBA 5DIVA 3EIPA 3O5JA 3RMEA 1W9VA 4JFLA 3O5LA 1TCOC 2JZVA 4Z2KA 4Q22A 4W5UA 2YBUA 4FN2A 4JFMA 2RUDA 4ZPVR 2LJ4A 1ZBWA 2M1IA 1HKIA 1GUVA 4KQZA 3ARXA 1FKHA 2KI3A 4DRMA 2P4VA 1NMWA 1W26A 1LJYA 1UR9A 1U79A 3KAGA 2OFNA 3WD0A 2WLZA 3BMBA 1B6CA 2VCDA 1J4HA 1HJXA 4IT4A 2F2DA 2D9FA 2PI6A 2DSVA 2PPPA 4DWSC 4DWSB 2M08A 3ARSA 3IHZA 4G2PA 2DT2A 4Q7NA 2PN0A 1E6PA 1NWUA 2Q5AA 3RFWA 1Q6HA 2FAPA 2DSZA 1HXVA 2DT3A 3CHEA 3O5RA 3ARWA 2A3AA 5HUAA 3ARUA 3UQAA 2RSEA 4J4OA 4LAVA 3B7XA 4DZ2A 1F40A 5HKGA 3CHFA 4P8UA 4DRPA 4URIA 3O5GA 4S3JA 3EY6A 4G50A 4JFKA 2ZQUA 5DIUA 3WKZA 1FKGA 1P5QA 1ZBVA 4TW6A 4TW7A 5GPGA 2M2AA 3O5DA 1M5YA 2O92A 1LL6A 4IQCA 4QZVB 5GPRA 1FKFA 3PR9A 1NWTA 3IKDA 1TFVA 3FXYA 1HKKA 4HARA 4W9PA 4Z2LA 1FKIA 1IX5A 1ZBCA 1PBKA 2F21A 1NWSA 2O9OA 2RURA 5DITA 5HW8A 3AS0A 1WNOA 3UI4A 1Q6IA 2PPNA 1RD6A 4L3NA 3UQBA 4LAYA 2LKNA 3KZ7A 2DSWA 3O5EA 2B5UB 3NRKA 4MNMA 3GTYX 1JNSA 4UDMA 4Z2IA 4MAVA 1LL4A 1ZU8A 2DPEA 2XPAA 2EULA 3KADA 1JVWA 3JXVA 1D2KA 2XP4A 2VN1A 2UZ5A 3O5PA 5HT1A 3TC5A 3KAFA 1WB0A 1D6OA 2XP9A 3ALGA 1SR0A 1N1AA 5DF0A 2KR7A 2WK2A 5I98A 3O5MA 4IT6A 3RM4A 4TW8A 2A3EA 2MNTA 4JFJA 4ODMA 1H0GA 2F23A 2PV3A 2ZQVA 2OLHA 4WK9A 2AWGA 2PV2A 2K8IA 3KAIA 4ML4A 3WD2A 3I6CA 1FFQA 4MPKA 3ARPA 2G41A 2DG3A 4S3KA 1ROUA 5DEZA 3ARRA 2KFWA 4LAXA 5BXJA 3WL1A 5HBFA 2XP8A 4ODNA 2XP7A 1EIBA 2PV1A 1X6NA 4TNSA 4IPXA 3CH9A 4JFIA 4DH0A 1NWRA 4P8WA 3UF8A 1OWQA 3NTPA 4P8XA 4J4NA 3MDYB 3RGCA 1LQ0A 3WD3A 1T11A 4W9OA 2PBCA 1ZL1A 2ZR4A 2FDMA 1VF8A 3GPKA 2RUCA 1C9HA 1HKJA 3KACA 3WQVA 3TDBA 1Q6UA 4JYSA 4BF8A 1O6IA 4QT3A 3ALFA 4HBEA 3AS3A 3TCZA 1JCHB 2DSUA 2A3CA 1W9PA 4DWSA 3AROA 3B8SA 3VAWA 1FJDA 3OA5A 3WL0A 3CHCA 1E9LA 2RUQA 4Z2GA 1W1TA 4NNRA 1XHGA 1JNDA 1BKFA 1HKMA 4R0XA 1K9TA 3O5IA 5HW6A 1YW5A 1FKJA 4GGQA 4DROA 5B8IC 1ITXA 2G8ZA 4WKAA 2ZR6A 4HBOA 1Q1CA 1QPFA 3B9AA 4DRIA 1JNEA 2WLYA 1OGBA 3AQUA 3RM9A 4Z2JA 3KABA 1KT0A 4GIVA 3CHDA 4FAPA 3ARYA 3WH0A 1ROTA 1W1YA 2ETNA 3G6LA 2MLXA 2DT0A 4AY1A 4MSPA 1FKDA 2DT1A 4ODKA 4DIPA 3UQIA 4ODPA 1JNTA 1NMVA 4W9QA 1XRVA 4U86A 1J4IA 3BXWA 2DG4A 5JH8A 3RM8A 3ARQA 4NSBA 3W4RA 5DO2A 4IQ2A 2FKEA 4WKFA 5D75A 1ZBKA 1FKRA 3ODKA 5J6EA 2F4EA 4Z2HA 3NI6A 3B9EA 2DG9A 3AS1A 4XAKA 1LG1A 4R5EA 3IK8A 2AOSA 4DWSD 1H0IA 1ZK6A 2LGOA 3IKGA 3B9DA 4WJXA 3FAPA 4ODOA 4ODRA 1EHNA 3PRBA 4U84A 4MNLA 3AS2A 1QPLA 4C02B 4TYOA 3G6MA 4DRNA 2LPVA 1GPFA 2ZR5A 1FD9A 1KFWA 3CGNA 4DRHA 3WQWA 3UI5A 2PPOA 3KAHA 2YBTA 3O5QA 1LG2A 1J4RA 4KR0B 1E15A 2ZQTA 4MNKA 1X6LA 1KT1A 1D7IA 1QZ2A 5HWBA 1D7JA 3CGMA 1FKSA 3OOBA 3PA7A 4NZCA 4O2TA 1W9UA
chains in the Genus database with same CATH topology
2ZQSA 4ODQA 2XP3A 3JYMA 2QF8A 1W1VA 1A7XA 4P8VA 2WM0A 4WKHA 3WD1A 5HWCA 2XP5A 4MNJA 2ITKA 4DRKA 1OGGA 4DRJA 5HTGA 1D7HA 2Y78A 1F8AB 1W1PA 4TX0A 4DRQA 2IUZA 3ARVA 2ESCA 3PRAA 1EYMA 3JYJA 1BL4A 3PRDA 1J6YA 2L2SA 4QT2A 4MGVA 2MPHA 1LL7A 2KE0A 4U85A 4DT4A 3LUOA 2XP6A 2N87A 1GOIA 1FKKA 4MTVA 4PTMA 3ARZA 1FKTA 1ZCNA 4LGXA 1SYTA 3QOKA 1FKLA 3O5OA 3WIJA 2KO7A 1E6NA 1UR8A 2MLYA 2A3BA 5GQBA 4ZPWR 1FFRA 3WD4A 4WIWA 4L72B 4ITZA 3O5KA 4LAWA 3ARTA 2B31A 1L1PA 1Y0OA 2IF4A 4ZS6A 1PINA 1NSGA 1E6ZA 3CZ8A 2MLZA 1WAWA 1ZB5A 4QIBA 1EDQA 1E6RA 1NH6A 2RQSA 3UI6A 3O5FA 1FKBA 4DZ3A 2KGJA 2MF9A 1HJVA 3FY1A 1FAPA 4N19A 3H9RB 4ODLA 1R9HA 3KCEA 1YATA 4ZPTR 1EQ3A 1HJWA 5HW7A 1CTNA 2XPBA 5DIVA 3O5JA 3RMEA 1W9VA 4JFLA 3O5LA 1TCOC 2JZVA 4Z2KA 4Q22A 4W5UA 2YBUA 4FN2A 4JFMA 2RUDA 4ZPVR 2LJ4A 1ZBWA 2M1IA 1HKIA 1GUVA 4KQZA 3ARXA 1FKHA 2KI3A 4DRMA 1NMWA 1W26A 1LJYA 1UR9A 1U79A 3KAGA 2OFNA 3WD0A 2WLZA 1B6CA 2VCDA 1J4HA 1HJXA 4IT4A 2F2DA 2D9FA 2PI6A 2DSVA 2PPPA 4DWSC 4DWSB 2M08A 3ARSA 3IHZA 4G2PA 2DT2A 4Q7NA 1E6PA 1NWUA 2Q5AA 3RFWA 1Q6HA 2FAPA 2DSZA 1HXVA 2DT3A 3CHEA 3O5RA 3ARWA 2A3AA 5HUAA 3ARUA 3UQAA 2RSEA 4J4OA 4LAVA 3B7XA 4DZ2A 1F40A 5HKGA 3CHFA 4P8UA 4DRPA 4URIA 3O5GA 4S3JA 3EY6A 4G50A 4JFKA 2ZQUA 5DIUA 3WKZA 1FKGA 1P5QA 1ZBVA 4TW6A 4TW7A 5GPGA 2M2AA 3O5DA 1M5YA 2O92A 1LL6A 4IQCA 4QZVB 5GPRA 1FKFA 3PR9A 1NWTA 3IKDA 1TFVA 3FXYA 1HKKA 4HARA 4W9PA 4Z2LA 1FKIA 1IX5A 1ZBCA 1PBKA 2F21A 1NWSA 2O9OA 2RURA 5DITA 5HW8A 3AS0A 1WNOA 3UI4A 1Q6IA 2PPNA 1RD6A 4L3NA 3UQBA 4LAYA 2LKNA 3KZ7A 2DSWA 3O5EA 3NRKA 4MNMA 1JNSA 4Z2IA 4MAVA 1LL4A 1ZU8A 2DPEA 2XPAA 3KADA 1JVWA 3JXVA 1D2KA 2XP4A 3O5PA 2VN1A 2UZ5A 5HT1A 3TC5A 3KAFA 1WB0A 1D6OA 2XP9A 3ALGA 1SR0A 1N1AA 5DF0A 2KR7A 2WK2A 5I98A 3O5MA 4IT6A 3RM4A 4TW8A 2A3EA 2MNTA 4JFJA 4ODMA 1H0GA 2PV3A 2ZQVA 2OLHA 4WK9A 2AWGA 2PV2A 2K8IA 3KAIA 4ML4A 3WD2A 3I6CA 1FFQA 4MPKA 3ARPA 2G41A 2DG3A 4S3KA 1ROUA 5DEZA 3ARRA 2KFWA 4LAXA 5BXJA 3WL1A 5HBFA 2XP8A 4ODNA 2XP7A 1EIBA 2PV1A 1X6NA 4TNSA 4IPXA 3CH9A 4JFIA 4DH0A 1NWRA 4P8WA 3UF8A 1OWQA 3NTPA 4P8XA 4J4NA 3MDYB 3RGCA 1LQ0A 3WD3A 1T11A 4W9OA 2PBCA 1ZL1A 2ZR4A 2FDMA 1VF8A 3GPKA 2RUCA 1C9HA 1HKJA 3KACA 3WQVA 3TDBA 1Q6UA 4JYSA 4BF8A 1O6IA 4QT3A 3ALFA 4HBEA 3AS3A 3TCZA 2DSUA 2A3CA 1W9PA 4DWSA 3AROA 3B8SA 3VAWA 1FJDA 3OA5A 3WL0A 3CHCA 1E9LA 2RUQA 4Z2GA 1W1TA 4NNRA 1XHGA 1JNDA 1BKFA 1HKMA 4R0XA 1K9TA 3O5IA 5HW6A 1YW5A 1FKJA 4GGQA 4DROA 5B8IC 1ITXA 2G8ZA 4WKAA 2ZR6A 4HBOA 1Q1CA 1QPFA 3B9AA 4DRIA 1JNEA 2WLYA 1OGBA 3AQUA 3RM9A 4Z2JA 3KABA 1KT0A 4GIVA 3CHDA 4FAPA 3ARYA 3WH0A 1ROTA 1W1YA 3G6LA 2MLXA 2DT0A 4AY1A 4MSPA 1FKDA 2DT1A 4ODKA 4DIPA 3UQIA 4ODPA 1JNTA 1NMVA 4W9QA 1XRVA 4U86A 1J4IA 3BXWA 2DG4A 5JH8A 3RM8A 3ARQA 4NSBA 3W4RA 5DO2A 4IQ2A 2FKEA 4WKFA 5D75A 1ZBKA 1FKRA 3ODKA 5J6EA 2F4EA 4Z2HA 3NI6A 3B9EA 2DG9A 3AS1A 4XAKA 1LG1A 4R5EA 3IK8A 2AOSA 4DWSD 1H0IA 1ZK6A 2LGOA 3IKGA 3B9DA 4WJXA 3FAPA 4ODOA 4ODRA 1EHNA 3PRBA 4U84A 4MNLA 3AS2A 1QPLA 4C02B 4TYOA 3G6MA 4DRNA 2LPVA 1GPFA 2ZR5A 1FD9A 1KFWA 3CGNA 4DRHA 3WQWA 3UI5A 2PPOA 3KAHA 2YBTA 3O5QA 1LG2A 1J4RA 4KR0B 1E15A 2ZQTA 4MNKA 1X6LA 1KT1A 1D7IA 1QZ2A 5HWBA 1D7JA 3CGMA 1FKSA 3OOBA 3PA7A 4NZCA 4O2TA 1W9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQS A;  2ZR6 A;  4ODQ A;  2M1I A;  1Q1C A;  1QPF A;  1D6O A;  2XP9 A;  4DRI A;  2XP3 A;  3JYM A;  1FKH A;  2KI3 A;  1N1A A;  4DRM A;  1A7X A;  1NMW A;  1W26 A;  2KR7 A;  5I98 A;  3O5M A;  3KAB A;  1U79 A;  3KAG A;  1KT0 A;  2OFN A;  4GIV A;  5HWC A;  4TW8 A;  2XP5 A;  4FAP A;  3O5P A;  2MNT A;  1B6C A;  2ITK A;  3WH0 A;  4DRK A;  4DRJ A;  2VCD A;  1J4H A;  1D7H A;  1ROT A;  2Y78 A;  1F8A B;  4JFJ A;  4TX0 A;  4DRQ A;  5HTG A;  2MLX A;  4ODM A;  2F2D A;  2D9F A;  4MSP A;  2PPP A;  1FKD A;  1EYM A;  3JYJ A;  1BL4 A;  2M08 A;  3PRD A;  1J6Y A;  4ODK A;  2PV3 A;  2L2S A;  2ZQV A;  3IHZ A;  4ODP A;  1JNT A;  1NMV A;  4G2P A;  4QT2 A;  3UQI A;  4W9Q A;  4MGV A;  2MPH A;  4U86 A;  1J4I A;  2AWG A;  2Q5A A;  3RFW A;  1Q6H A;  2K8I A;  2PV2 A;  3KAI A;  2DG4 A;  2FAP A;  2KE0 A;  3I6C A;  4U85 A;  1HXV A;  4DT4 A;  2DG3 A;  3O5R A;  3LUO A;  5HUA A;  1ROU A;  3UQA A;  2XP6 A;  2RSE A;  2N87 A;  4J4O A;  2KFW A;  1FKK A;  4LAV A;  3B7X A;  4LAX A;  5BXJ A;  4IQ2 A;  1FKT A;  4DZ2 A;  1F40 A;  2FKE A;  1ZCN A;  5D75 A;  5HKG A;  1FKR A;  2XP8 A;  4DRP A;  4ODN A;  3ODK A;  2XP7 A;  5J6E A;  3O5G A;  2F4E A;  3EY6 A;  3NI6 A;  4G50 A;  4JFK A;  1FKL A;  3O5O A;  2DG9 A;  2PV1 A;  4TNS A;  2KO7 A;  2ZQU A;  4IPX A;  2MLY A;  5DIU A;  1FKG A;  4JFI A;  1P5Q A;  4DIP A;  4DH0 A;  3KAF A;  3UF8 A;  3IK8 A;  3NTP A;  4TW6 A;  4J4N A;  3MDY B;  4TW7 A;  5GPG A;  2M2A A;  3O5D A;  3RGC A;  1ZK6 A;  2LGO A;  1M5Y A;  3IKG A;  3FAP A;  4ODO A;  1T11 A;  4ODR A;  2XP4 A;  4W9O A;  3PRB A;  4ITZ A;  4U84 A;  3O5K A;  4LAW A;  1L1P A;  2PBC A;  1QPL A;  1Y0O A;  2IF4 A;  2ZR4 A;  3GPK A;  2VN1 A;  4IQC A;  4TYO A;  4C02 B;  1FKF A;  4DRN A;  1PIN A;  1NSG A;  2LPV A;  2RUC A;  1C9H A;  3KAC A;  3IKD A;  2ZR5 A;  3TDB A;  4W9P A;  1Q6U A;  2MLZ A;  4JYS A;  4BF8 A;  4QT3 A;  4QIB A;  1FD9 A;  1FKI A;  2RQS A;  3UI6 A;  3O5F A;  1FKB A;  4DZ3 A;  3CGN A;  2KGJ A;  1PBK A;  2F21 A;  3TCZ A;  4DRH A;  2MF9 A;  2PPO A;  2RUR A;  5DIT A;  3UI5 A;  5HW8 A;  3KAH A;  3UI4 A;  1FAP A;  1Q6I A;  2PPN A;  4N19 A;  3UQB A;  3H9R B;  3O5Q A;  2LKN A;  3KZ7 A;  4LAY A;  4ODL A;  1R9H A;  1J4R A;  3KCE A;  3VAW A;  1YAT A;  1EQ3 A;  3O5E A;  1FJD A;  5HW7 A;  3NRK A;  2XPB A;  5DIV A;  3O5J A;  2ZQT A;  1JNS A;  2RUQ A;  4JFL A;  3O5L A;  4NNR A;  1KT1 A;  2XPA A;  1BKF A;  1QZ2 A;  1TCO C;  2JZV A;  3KAD A;  1JVW A;  3JXV A;  3O5I A;  4R0X A;  4FN2 A;  5HW6 A;  1YW5 A;  5HWB A;  4JFM A;  1D7J A;  3CGM A;  1FKJ A;  1FKS A;  4GGQ A;  3OOB A;  4DRO A;  2RUD A;  5B8I C;  3PA7 A;  4O2T A;  1D7I A;  2UZ5 A;  5HT1 A;  3TC5 A;  2LJ4 A; 
#chains in the Genus database with same CATH topology
 2ZQS A;  4ODQ A;  2XP3 A;  3JYM A;  2QF8 A;  1W1V A;  1A7X A;  4P8V A;  2WM0 A;  4WKH A;  3WD1 A;  5HWC A;  2XP5 A;  4MNJ A;  2ITK A;  4DRK A;  1OGG A;  4DRJ A;  5HTG A;  1D7H A;  2Y78 A;  1F8A B;  1W1P A;  4TX0 A;  4DRQ A;  2IUZ A;  3ARV A;  2ESC A;  3PRA A;  1EYM A;  3JYJ A;  1BL4 A;  3PRD A;  1J6Y A;  1GRJ A;  2L2S A;  4QT2 A;  4MGV A;  1E44 A;  2MPH A;  1LL7 A;  2KE0 A;  4U85 A;  4DT4 A;  3LUO A;  2XP6 A;  2N87 A;  1GOI A;  1FKK A;  4MTV A;  4PTM A;  3ARZ A;  1FKT A;  1ZCN A;  4LGX A;  1SYT A;  3QOK A;  1FKL A;  3O5O A;  3WIJ A;  2KO7 A;  1E6N A;  1UR8 A;  2MLY A;  2A3B A;  5GQB A;  4ZPW R;  1FFR A;  3WD4 A;  4WIW A;  4L72 B;  4ITZ A;  3O5K A;  4LAW A;  3ART A;  2B31 A;  1L1P A;  1Y0O A;  2IF4 A;  4ZS6 A;  3GU0 A;  1PIN A;  1NSG A;  1E6Z A;  3CZ8 A;  2MLZ A;  1WAW A;  1ZB5 A;  4QIB A;  1EDQ A;  1E6R A;  1NH6 A;  2RQS A;  3UI6 A;  3O5F A;  1FKB A;  4DZ3 A;  2KGJ A;  2MF9 A;  1HJV A;  3FY1 A;  1FAP A;  4N19 A;  3H9R B;  4ODL A;  1R9H A;  3KCE A;  1YAT A;  4ZPT R;  1EQ3 A;  1HJW A;  5HW7 A;  1CTN A;  2XPB A;  5DIV A;  3EIP A;  3O5J A;  3RME A;  1W9V A;  4JFL A;  3O5L A;  1TCO C;  2JZV A;  4Z2K A;  4Q22 A;  4W5U A;  2YBU A;  4FN2 A;  4JFM A;  2RUD A;  4ZPV R;  2LJ4 A;  1ZBW A;  2M1I A;  1HKI A;  1GUV A;  4KQZ A;  3ARX A;  1FKH A;  2KI3 A;  4DRM A;  2P4V A;  1NMW A;  1W26 A;  1LJY A;  1UR9 A;  1U79 A;  3KAG A;  2OFN A;  3WD0 A;  2WLZ A;  3BMB A;  1B6C A;  2VCD A;  1J4H A;  1HJX A;  4IT4 A;  2F2D A;  2D9F A;  2PI6 A;  2DSV A;  2PPP A;  4DWS C;  4DWS B;  2M08 A;  3ARS A;  3IHZ A;  4G2P A;  2DT2 A;  4Q7N A;  2PN0 A;  1E6P A;  1NWU A;  2Q5A A;  3RFW A;  1Q6H A;  2FAP A;  2DSZ A;  1HXV A;  2DT3 A;  3CHE A;  3O5R A;  3ARW A;  2A3A A;  5HUA A;  3ARU A;  3UQA A;  2RSE A;  4J4O A;  4LAV A;  3B7X A;  4DZ2 A;  1F40 A;  5HKG A;  3CHF A;  4P8U A;  4DRP A;  4URI A;  3O5G A;  4S3J A;  3EY6 A;  4G50 A;  4JFK A;  2ZQU A;  5DIU A;  3WKZ A;  1FKG A;  1P5Q A;  1ZBV A;  4TW6 A;  4TW7 A;  5GPG A;  2M2A A;  3O5D A;  1M5Y A;  2O92 A;  1LL6 A;  4IQC A;  4QZV B;  5GPR A;  1FKF A;  3PR9 A;  1NWT A;  3IKD A;  1TFV A;  3FXY A;  1HKK A;  4HAR A;  4W9P A;  4Z2L A;  1FKI A;  1IX5 A;  1ZBC A;  1PBK A;  2F21 A;  1NWS A;  2O9O A;  2RUR A;  5DIT A;  5HW8 A;  3AS0 A;  1WNO A;  3UI4 A;  1Q6I A;  2PPN A;  1RD6 A;  4L3N A;  3UQB A;  4LAY A;  2LKN A;  3KZ7 A;  2DSW A;  3O5E A;  2B5U B;  3NRK A;  4MNM A;  3GTY X;  1JNS A;  4UDM A;  4Z2I A;  4MAV A;  1LL4 A;  1ZU8 A;  2DPE A;  2XPA A;  2EUL A;  3KAD A;  1JVW A;  3JXV A;  1D2K A;  2XP4 A;  2VN1 A;  2UZ5 A;  3O5P A;  5HT1 A;  3TC5 A;  3KAF A;  1WB0 A;  1D6O A;  2XP9 A;  3ALG A;  1SR0 A;  1N1A A;  5DF0 A;  2KR7 A;  2WK2 A;  5I98 A;  3O5M A;  4IT6 A;  3RM4 A;  4TW8 A;  2A3E A;  2MNT A;  4JFJ A;  4ODM A;  1H0G A;  2F23 A;  2PV3 A;  2ZQV A;  2OLH A;  4WK9 A;  2AWG A;  2PV2 A;  2K8I A;  3KAI A;  4ML4 A;  3WD2 A;  3I6C A;  1FFQ A;  4MPK A;  3ARP A;  2G41 A;  2DG3 A;  4S3K A;  1ROU A;  5DEZ A;  3ARR A;  2KFW A;  4LAX A;  5BXJ A;  3WL1 A;  5HBF A;  2XP8 A;  4ODN A;  2XP7 A;  1EIB A;  2PV1 A;  1X6N A;  4TNS A;  4IPX A;  3CH9 A;  4JFI A;  4DH0 A;  1NWR A;  4P8W A;  3UF8 A;  1OWQ A;  3NTP A;  4P8X A;  4J4N A;  3MDY B;  3RGC A;  1LQ0 A;  3WD3 A;  1T11 A;  4W9O A;  2PBC A;  1ZL1 A;  2ZR4 A;  2FDM A;  1VF8 A;  3GPK A;  2RUC A;  1C9H A;  1HKJ A;  3KAC A;  3WQV A;  3TDB A;  1Q6U A;  4JYS A;  4BF8 A;  1O6I A;  4QT3 A;  3ALF A;  4HBE A;  3AS3 A;  3TCZ A;  1JCH B;  2DSU A;  2A3C A;  1W9P A;  4DWS A;  3ARO A;  3B8S A;  3VAW A;  1FJD A;  3OA5 A;  3WL0 A;  3CHC A;  1E9L A;  2RUQ A;  4Z2G A;  1W1T A;  4NNR A;  1XHG A;  1JND A;  1BKF A;  1HKM A;  4R0X A;  1K9T A;  3O5I A;  5HW6 A;  1YW5 A;  1FKJ A;  4GGQ A;  4DRO A;  5B8I C;  1ITX A;  2G8Z A;  4WKA A;  2ZR6 A;  4HBO A;  1Q1C A;  1QPF A;  3B9A A;  4DRI A;  1JNE A;  2WLY A;  1OGB A;  3AQU A;  3RM9 A;  4Z2J A;  3KAB A;  1KT0 A;  4GIV A;  3CHD A;  4FAP A;  3ARY A;  3WH0 A;  1ROT A;  1W1Y A;  2ETN A;  3G6L A;  2MLX A;  2DT0 A;  4AY1 A;  4MSP A;  1FKD A;  2DT1 A;  4ODK A;  4DIP A;  3UQI A;  4ODP A;  1JNT A;  1NMV A;  4W9Q A;  1XRV A;  4U86 A;  1J4I A;  3BXW A;  2DG4 A;  5JH8 A;  3RM8 A;  3ARQ A;  4NSB A;  3W4R A;  5DO2 A;  4IQ2 A;  2FKE A;  4WKF A;  5D75 A;  1ZBK A;  1FKR A;  3ODK A;  5J6E A;  2F4E A;  4Z2H A;  3NI6 A;  3B9E A;  2DG9 A;  3AS1 A;  4XAK A;  1LG1 A;  4R5E A;  3IK8 A;  2AOS A;  4DWS D;  1H0I A;  1ZK6 A;  2LGO A;  3IKG A;  3B9D A;  4WJX A;  3FAP A;  4ODO A;  4ODR A;  1EHN A;  3PRB A;  4U84 A;  4MNL A;  3AS2 A;  1QPL A;  4C02 B;  4TYO A;  3G6M A;  4DRN A;  2LPV A;  1GPF A;  2ZR5 A;  1FD9 A;  1KFW A;  3CGN A;  4DRH A;  3WQW A;  3UI5 A;  2PPO A;  3KAH A;  2YBT A;  3O5Q A;  1LG2 A;  1J4R A;  4KR0 B;  1E15 A;  2ZQT A;  4MNK A;  1X6L A;  1KT1 A;  1D7I A;  1QZ2 A;  5HWB A;  1D7J A;  3CGM A;  1FKS A;  3OOB A;  3PA7 A;  4NZC A;  4O2T A;  1W9U A; 
#chains in the Genus database with same CATH homology
 2ZQS A;  4ODQ A;  2XP3 A;  3JYM A;  2QF8 A;  1W1V A;  1A7X A;  4P8V A;  2WM0 A;  4WKH A;  3WD1 A;  5HWC A;  2XP5 A;  4MNJ A;  2ITK A;  4DRK A;  1OGG A;  4DRJ A;  5HTG A;  1D7H A;  2Y78 A;  1F8A B;  1W1P A;  4TX0 A;  4DRQ A;  2IUZ A;  3ARV A;  2ESC A;  3PRA A;  1EYM A;  3JYJ A;  1BL4 A;  3PRD A;  1J6Y A;  2L2S A;  4QT2 A;  4MGV A;  2MPH A;  1LL7 A;  2KE0 A;  4U85 A;  4DT4 A;  3LUO A;  2XP6 A;  2N87 A;  1GOI A;  1FKK A;  4MTV A;  4PTM A;  3ARZ A;  1FKT A;  1ZCN A;  4LGX A;  1SYT A;  3QOK A;  1FKL A;  3O5O A;  3WIJ A;  2KO7 A;  1E6N A;  1UR8 A;  2MLY A;  2A3B A;  5GQB A;  4ZPW R;  1FFR A;  3WD4 A;  4WIW A;  4L72 B;  4ITZ A;  3O5K A;  4LAW A;  3ART A;  2B31 A;  1L1P A;  1Y0O A;  2IF4 A;  4ZS6 A;  1PIN A;  1NSG A;  1E6Z A;  3CZ8 A;  2MLZ A;  1WAW A;  1ZB5 A;  4QIB A;  1EDQ A;  1E6R A;  1NH6 A;  2RQS A;  3UI6 A;  3O5F A;  1FKB A;  4DZ3 A;  2KGJ A;  2MF9 A;  1HJV A;  3FY1 A;  1FAP A;  4N19 A;  3H9R B;  4ODL A;  1R9H A;  3KCE A;  1YAT A;  4ZPT R;  1EQ3 A;  1HJW A;  5HW7 A;  1CTN A;  2XPB A;  5DIV A;  3O5J A;  3RME A;  1W9V A;  4JFL A;  3O5L A;  1TCO C;  2JZV A;  4Z2K A;  4Q22 A;  4W5U A;  2YBU A;  4FN2 A;  4JFM A;  2RUD A;  4ZPV R;  2LJ4 A;  1ZBW A;  2M1I A;  1HKI A;  1GUV A;  4KQZ A;  3ARX A;  1FKH A;  2KI3 A;  4DRM A;  1NMW A;  1W26 A;  1LJY A;  1UR9 A;  1U79 A;  3KAG A;  2OFN A;  3WD0 A;  2WLZ A;  1B6C A;  2VCD A;  1J4H A;  1HJX A;  4IT4 A;  2F2D A;  2D9F A;  2PI6 A;  2DSV A;  2PPP A;  4DWS C;  4DWS B;  2M08 A;  3ARS A;  3IHZ A;  4G2P A;  2DT2 A;  4Q7N A;  1E6P A;  1NWU A;  2Q5A A;  3RFW A;  1Q6H A;  2FAP A;  2DSZ A;  1HXV A;  2DT3 A;  3CHE A;  3O5R A;  3ARW A;  2A3A A;  5HUA A;  3ARU A;  3UQA A;  2RSE A;  4J4O A;  4LAV A;  3B7X A;  4DZ2 A;  1F40 A;  5HKG A;  3CHF A;  4P8U A;  4DRP A;  4URI A;  3O5G A;  4S3J A;  3EY6 A;  4G50 A;  4JFK A;  2ZQU A;  5DIU A;  3WKZ A;  1FKG A;  1P5Q A;  1ZBV A;  4TW6 A;  4TW7 A;  5GPG A;  2M2A A;  3O5D A;  1M5Y A;  2O92 A;  1LL6 A;  4IQC A;  4QZV B;  5GPR A;  1FKF A;  3PR9 A;  1NWT A;  3IKD A;  1TFV A;  3FXY A;  1HKK A;  4HAR A;  4W9P A;  4Z2L A;  1FKI A;  1IX5 A;  1ZBC A;  1PBK A;  2F21 A;  1NWS A;  2O9O A;  2RUR A;  5DIT A;  5HW8 A;  3AS0 A;  1WNO A;  3UI4 A;  1Q6I A;  2PPN A;  1RD6 A;  4L3N A;  3UQB A;  4LAY A;  2LKN A;  3KZ7 A;  2DSW A;  3O5E A;  3NRK A;  4MNM A;  1JNS A;  4Z2I A;  4MAV A;  1LL4 A;  1ZU8 A;  2DPE A;  2XPA A;  3KAD A;  1JVW A;  3JXV A;  1D2K A;  2XP4 A;  3O5P A;  2VN1 A;  2UZ5 A;  5HT1 A;  3TC5 A;  3KAF A;  1WB0 A;  1D6O A;  2XP9 A;  3ALG A;  1SR0 A;  1N1A A;  5DF0 A;  2KR7 A;  2WK2 A;  5I98 A;  3O5M A;  4IT6 A;  3RM4 A;  4TW8 A;  2A3E A;  2MNT A;  4JFJ A;  4ODM A;  1H0G A;  2PV3 A;  2ZQV A;  2OLH A;  4WK9 A;  2AWG A;  2PV2 A;  2K8I A;  3KAI A;  4ML4 A;  3WD2 A;  3I6C A;  1FFQ A;  4MPK A;  3ARP A;  2G41 A;  2DG3 A;  4S3K A;  1ROU A;  5DEZ A;  3ARR A;  2KFW A;  4LAX A;  5BXJ A;  3WL1 A;  5HBF A;  2XP8 A;  4ODN A;  2XP7 A;  1EIB A;  2PV1 A;  1X6N A;  4TNS A;  4IPX A;  3CH9 A;  4JFI A;  4DH0 A;  1NWR A;  4P8W A;  3UF8 A;  1OWQ A;  3NTP A;  4P8X A;  4J4N A;  3MDY B;  3RGC A;  1LQ0 A;  3WD3 A;  1T11 A;  4W9O A;  2PBC A;  1ZL1 A;  2ZR4 A;  2FDM A;  1VF8 A;  3GPK A;  2RUC A;  1C9H A;  1HKJ A;  3KAC A;  3WQV A;  3TDB A;  1Q6U A;  4JYS A;  4BF8 A;  1O6I A;  4QT3 A;  3ALF A;  4HBE A;  3AS3 A;  3TCZ A;  2DSU A;  2A3C A;  1W9P A;  4DWS A;  3ARO A;  3B8S A;  3VAW A;  1FJD A;  3OA5 A;  3WL0 A;  3CHC A;  1E9L A;  2RUQ A;  4Z2G A;  1W1T A;  4NNR A;  1XHG A;  1JND A;  1BKF A;  1HKM A;  4R0X A;  1K9T A;  3O5I A;  5HW6 A;  1YW5 A;  1FKJ A;  4GGQ A;  4DRO A;  5B8I C;  1ITX A;  2G8Z A;  4WKA A;  2ZR6 A;  4HBO A;  1Q1C A;  1QPF A;  3B9A A;  4DRI A;  1JNE A;  2WLY A;  1OGB A;  3AQU A;  3RM9 A;  4Z2J A;  3KAB A;  1KT0 A;  4GIV A;  3CHD A;  4FAP A;  3ARY A;  3WH0 A;  1ROT A;  1W1Y A;  3G6L A;  2MLX A;  2DT0 A;  4AY1 A;  4MSP A;  1FKD A;  2DT1 A;  4ODK A;  4DIP A;  3UQI A;  4ODP A;  1JNT A;  1NMV A;  4W9Q A;  1XRV A;  4U86 A;  1J4I A;  3BXW A;  2DG4 A;  5JH8 A;  3RM8 A;  3ARQ A;  4NSB A;  3W4R A;  5DO2 A;  4IQ2 A;  2FKE A;  4WKF A;  5D75 A;  1ZBK A;  1FKR A;  3ODK A;  5J6E A;  2F4E A;  4Z2H A;  3NI6 A;  3B9E A;  2DG9 A;  3AS1 A;  4XAK A;  1LG1 A;  4R5E A;  3IK8 A;  2AOS A;  4DWS D;  1H0I A;  1ZK6 A;  2LGO A;  3IKG A;  3B9D A;  4WJX A;  3FAP A;  4ODO A;  4ODR A;  1EHN A;  3PRB A;  4U84 A;  4MNL A;  3AS2 A;  1QPL A;  4C02 B;  4TYO A;  3G6M A;  4DRN A;  2LPV A;  1GPF A;  2ZR5 A;  1FD9 A;  1KFW A;  3CGN A;  4DRH A;  3WQW A;  3UI5 A;  2PPO A;  3KAH A;  2YBT A;  3O5Q A;  1LG2 A;  1J4R A;  4KR0 B;  1E15 A;  2ZQT A;  4MNK A;  1X6L A;  1KT1 A;  1D7I A;  1QZ2 A;  5HWB A;  1D7J A;  3CGM A;  1FKS A;  3OOB A;  3PA7 A;  4NZC A;  4O2T A;  1W9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...