4ZPTR

Structure of mers-coronavirus spike receptor-binding domain (england1 strain) in complex with vaccine-elicited murine neutralizing antibody d12 (crystal form 1)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
208
structure length
208
Chain Sequence
VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRFLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D12 Fab Heavy chain
publication title Evaluation of candidate vaccine approaches for MERS-CoV
pubmed doi rcsb
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
molecule tags Viral protein/immune system
total genus 52
structure length 208
sequence length 208
chains with identical sequence S
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4zptR02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zptR01
4ZPWR 3SCIE 4L3NA 4XAKA 4ZS6A 2DD8S 3SCLE 4ZPTR 2GHVC 4KQZA 5DO2A 3D0HE 3D0GE 4QZVB 3D0IE 3SCJE 4ZPVR 2AJFE 4KR0B 2GHWA 3SCKE 3BGFA 4L72B
chains in the Genus database with same CATH superfamily
5BR8F 2V4QA 1NJZA 3MEKA 5HJXA 4CRJA 2POKA 5F41A 5LT5A 2VHGA 4JI8J 2KXHA 4E0DA 1S6PA 3RMEA 3PYFA 2N87A 3ILOA 3JYMA 1IBKJ 5AE2A 2H51B 1O6XA 3THTA 5HANA 4L6V3 4LSLA 2DYAA 2KU7A 3TQ1A 3BPDA 2IA6A 3T1HF 5I3UB 2GJIA 6AT1B 1LNQA 1EQ0A 3M8YA 3DGPA 4RW9A 2UUCF 2X3DA 3MM9B 4E2FB 4JBCA 3QAEA 2UUAJ 4F25A 4U84A 2MQOA 3IRWP 4LRBA 2JJ4D 2EG1A 4RW7B 3R6GB 2W4DA 2JC0A 4W9PA 3IM9A 4ECQA 3CW2C 4LBPA 4OX9J 1HJVA 2DEIA 4NZ0A 2R8JA 1FX2A 1REGX 2Z8QA 2MKJA 1ZM3A 1BLUA 3WBZA 4EI2A 5DM7Q 2GJ2A 2AOSA 1IKXA 5KFLA 1LWFB 3VGVA 2Q3PA 1SQFA 5L1LA 1N6QB 4PYDA 1NBEB 3BBFA 2W24A 1RTJA 1JNDA 4PQUA 1QD1A 2KFNA 2MYFA 3QT6A 1ZAXA 3S6EA 1D7IA 2UUTA 4JFMA 3TEHB 1IJFB 2WW4A 2DIUA 2VFSA 3ZC4A 2CJXB 4EFAC 3GR0A 2DR9A 2E7XA 5KFJA 3PX6A 2BABA 1JLEB 1PAEX 1S0OA 4A8FA 2DNOA 1FWKA 3OTOF 4Z2HA 4YP3A 1Q78A 1Q1KA 1VC5A 2ACYA 4ILLA 1UL3A 1LK7A 4HACB 3H8YA 2E44A 5I42A 3I0RA 4ELVA 3C3LA 1IQZA 3CD5A 3KOAA 3DYAB 2XULA 5HMXA 2HHQA 1W1VA 3CHFA 1O6IA 3H42A 4DSIA 1FJ7A 1XTZA 4W4MA 2VFUA 2R7QA 4WTYA 4WKHA 3ENWA 2ZZTA 4MK9A 1NEEA 4TXSA 4LFBF 1LFWA 4ZVRB 1FXRA 1PO6A 3HVRA 3NAIA 4RW4B 3VTIA 2CNLB 1HBOB 2KT2A 2NXJA 5H1SV 1FX4A 3LA0A 4I1TA 4W98A 3WD3A 4Q8FA 3D0HE 1OPIA 1WTBA 4IQMA 2AIRB 1Y9OA 4ID5B 4NZ7A 3HMJG 4ZPBA 2OD6A 2Y1LB 4YDDB 4CDIA 1RTDB 3PX0A 3IBCB 5KFIA 3O1LA 4QWCA 1SH2A 4ODNA 2HAIA 4DWSA 2LA4A 2FLPA 3NOGA 4HDGA 3B8HA 2BANB 1UAWA 1DRZA 1FRIA 2KJVA 3GYGA 3MD3A 1TMMA 1MN9A 2XMAA 1ZBWA 3R9LA 4X65F 2JC1A 2Z0GA 1JLGA 4DR7F 4KJIA 2DNKA 1C0UA 4ED6A 5KG0A 4KTQA 4IFYA 1D9DA 1GMUA 2XYPB 2YPYA 3BF4A 3CB4A 4A8KA 2MY8A 1N52B 3KG1A 2RH3A 1RU2A 1HIYA 2Q6CA 4DSJA 4KE5A 1NH7A 2UXDJ 2MZSA 2XS2A 2IM3A 3GYXB 4D3GA 3M2UB 3HSZA 3QFHA 2RKIB 2BA9A 4FF1A 2P6SA 3RW7A 2WRMA 5L38A 4FF2A 1E6PA 4N47A 2M2AA 3UF8A 3EZOA 3ALGA 3PW5A 3KHRA 1TKDA 4Q43A 1JKHB 4GVBA 4ID8A 4UZBA 1BL4A 2BW2A 2C3UA 4L74A 5IQQA 4CLKA 1FE4A 2SXLA 3HT3A 4C97A 4KO0B 3HLUA 2ASYA 4RU2A 3R5BA 3QJLA 4Z2IA 4DR6F 4RU9A 1KKHA 5EUHA 1YLXA 3MCNA 3LP0A 5IOLA 2RE1A 4LF9F 4H4OB 3NG8A 3VAIA 1IXKA 1TTHB 1UEVA 2G4BA 3E3XA 4KAIA 4QIGA 2WVBA 2CQBA 1VHIA 2XWYA 1FKHA 4HI1A 3M30A 3BSCA 2IM1A 3FEZA 1UP1A 3W62A 4OYBA 2HVHA 4FKYA 2GS8A 3WH0A 3O2IA 2FKEA 1Y0HA 2DG4A 3SFGA 4F4YA 1XNRJ 1PAUB 1ZB5A 3MEGA 1GOIA 3KK1A 4URIA 2PI4A 3BGLA 4CZCA 3J80U 4OYAA 1IWGA 3M32A 2F8EX 1D09B 2OI2A 2YKNB 3JSYA 4FVMA 2ADBA 4GO5X 1ZBKA 2W7OA 1L3KA 1DBDA 2CQCA 5L39A 5DDQC 2P8IA 4PG6A 2Y8YA 2GC8A 2MQLA 2DISA 2XC9A 1OYDA 2MQ8A 3QIDA 4NMXA 2VB6A 3ARVA 4PG5A 5EX0A 1FEHA 4JI5F 1D1UA 3GE9A 1C1CA 4OZNA 1AW0A 3P45B 3O6QA 4C8KA 2N3OA 5A8RA 1NWRA 4DV3J 5LMNJ 4F4ZA 3W3SA 3ZFVA 4NLUA 1CULB 1G1XA 3TW0A 1WD6A 2IFXA 4W90B 5KFXA 2IUZA 4MSPA 3JQKA 5F0WA 2M4MA 2XTJP 5IM0A 3KLGA 3HO1A 4OLOA 5AJ3F 3DI6B 1U2CA 2MZJA 4C11A 1LXJA 3MMCB 2JEFA 3LGHA 3AB2B 1HNZJ 1LEOA 3UD5A 4K5SA 2OPQB 4GMKA 2B7CB 2VQFF 1C0TB 3LP2B 2CQPA 2X1FA 1YJ9S 3SIPB 1VFJA 3PJWA 3THPA 3BS9A 3IGVA 2KZMA 2JZ5A 3AD8C 5KG7A 1Q5VA 1RAEB 2HLUA 3VGTA 3ULHA 1HJXA 3PYEA 2UZAA 1ZM4A 3RGCA 3MURP 1VI7A 1OSCA 1YHQS 1SQEA 2FIUA 2BQUA 2ZH7A 2J76E 4K4YA 2VCDA 1VQNS 3KLIB 3AROA 1L3TA 3O5PA 4RPFA 3HHNB 2MHEA 2VFRA 1SH3A 4LREA 4C0OC 3CD6S 2WHOA 4WCEQ 2XS7A 3EGVA 3GIRA 3A3NB 1TFVA 2I38A 3UDLA 5GMKa 4M5HA 2CQDA 3KTQA 1LWCA 1CS4B 2PMWA 3PA7A 3RW6A 1W9VA 4D3HA 5T14A 4CH1A 4B3SF 1VYAA 2COLA 3O5GA 2QSFA 3CDUA 3WHIA 4X84A 1S7IA 4JV2A 4NXMJ 1BQNA 1X4CA 2HRYA 2VDIA 1VLYA 1WC4A 3S7RA 2IM2A 5HLFB 1LKZA 1L5UA 2AEJA 4MKAA 2A2CA 3CJKB 2N7CA 2CAJA 3VAHA 3WX8A 1NB2A 3RJMB 2MPHA 3ALFA 5F8HA 1QVGR 1KN6A 1L1PA 1SC3B 4FYWB 4NWBA 2UU9J 1QAYA 2X7IA 3LANA 1R89A 2LDIA 1YBTA 2HNZA 4DR2J 3HVWA 4F04B 4PWDB 2HVIA 1TKZB 1B0PA 3OTEA 5JMNA 4CI0B 3NOCA 2QYCA 1ITPA 1QE1A 5ETPA 2CQ1A 2YWFA 4DIPA 5IT9U 4JI8F 1LW2A 1Y0OA 1VLOA 1RDRA 3Q8YA 3N79A 5CH7B 3UI5A 5KT5A 1IBKF 2BJ7A 3VGUA 1A6LA 3ARZA 4P9SA 1EKRA 4HBEA 2K2PA 3HHEA 1N1AA 3V4MA 2BW7A 3EVOA 5EWEA 1NRKA 4Q44A 2DT1A 4ENOA 3OVSA 5G4DA 3BBBA 5D3GA 4NCAA 5J1EB 2FPHX 2G0CA 3U7JA 2UUAF 3M8QB 3ARPA 2GW8A 1NPPA 2E1PA 1Q0NA 4CIOA 2BMBA 5E41A 4ECRA 3GILA 2FHJA 4WP8A 2XYHB 4KV8A 2KZZA 4OX9F 3T3FA 1M90T 5KFZA 4K8RA 5L1IA 2J9DE 1X4HA 2AU0A 3PO5A 2ZD1B 2FDMA 4BLGA 2CG4A 5B08A 3THVA 4DUYJ 2NXCA 2UUBJ 1N48A 2WLYA 1FKFA 1EQMA 4ALZA 2DKOB 2JHEA 3W5YA 2QYGA 2HBRB 5GADU 3J7ZT 2VG7B 2IF4A 2K7JA 5HAOA 1CC7A 1E6NA 4J5OA 1QTNB 3C8YA 3OFEA 5F3TA 2FUG9 4DDFA 4FPRA 5EWGA 3BSOA 3DKDA 4UTGA 4DV0J 4O3QA 2DR6A 4PXDA 2MQPA 4XPCA 4O3NA 5DRKA 5KFCA 5I3UA 1ZZNA 1TL4A 2QN6B 4DRIA 3D6HB 1FRMA 1TV6B 1JXLA 4NCGB 3MM9A 2KKHA 1BE4A 5I98A 4P7VA 3VAGA 3RBEA 3NGRA 2AWZA 3W63A 4F0HA 4RW7A 4MAKA 1FRKA 4JP8A 1R8HA 3IKDA 1OY9A 3JYTB 4WWSA 2APOA 1M5OC 1VJQA 2CNNB 1EKSA 1X60A 2KN4A 3TX8A 1U1QA 1V5VA 2B9WA 5K14B 4CYUB 2V0NA 3MHYA 2JDJA 2B7BB 3QGPA 5LOQA 1FF2A 4IYQA 2ZM6J 1T7PA 3TCZA 4ZPTR 3MDYB 1KHWA 2A18A 4QOTA 1IKWB 3UE2A 4WJXA 1LWFA 1N6QA 3W2VB 2Q43A 1JMTA 5KFUA 5A6PA 4CLUA 2MSSA 1SJRA 3R5DA 3NWGA 3ZZZA 3L7OA 3C2PA 5KFDA 2JFKA 1C4CA 4A8YA 3SSQA 3UN2A 2ZBQA 2UVWA 3KJQB 2WBRA 4A46A 1WHWA 3JS9A 1YKWA 4WXWA 4OI0A 1BHNA 1JLEA 3CJQA 4UDMA 2V9KA 1D0EA 4N8OA 5IV3A 2Y0SD 3DN9A 2AEMA 4ZVOB 2VU5A 2AZ3A 2CYYA 4ZLJA 2RSEA 2J9EA 4LMZA 4ZA1A 4NLTA 2VC1A 4USHA 2EFGA 2V67A 3DYAA 1TK0A 4IOCQ 2AW0A 4FKXA 2W2NP 4OMFG 1URRA 2XMUA 4Q0BB 4X4UA 2RQ4A 1MWYA 4C0HA 2VUGA 3RB0A 1BD6A 1MSWD 2UXDF 4OJHA 4K4XA 3HP6A 3I82A 3SMZA 3MPVA 1W9PA 5GAGI 4RW4A 4ECXA 2NXEA 3BQ2A 1HBOA 4OJGA 1WKLA 2F40A 1RXOB 2WAQD 3TOQA 2XI2A 2D74B 2IYIA 5AXNA 4ID5A 3JAMU 4W9QA 1F60B 1RAIB 4KGKA 4QIWD 3DLEB 4FP9A 1TU0B 3IAS9 3I87A 3PVXA 4GKKJ 1KHVA 4USUA 1TP7A 2BANA 3X1LB 4WKAA 2J8AA 2E5GA 2YPZA 1FERA 1KOHA 5DO2A 2L41A 3TUZC 4IRKA 2HKEA 2Q1LA 4IO1A 3ARUA 2HYIB 4KB7A 1FO1A 3SYZA 2DY1A 2Z2LA 4OI1A 4JFKA 4HKQA 1XNRF 2V2ZA 5SUHA 3PW4A 9ATCB 3D66A 4ZN1A 1T95A 4I6YA 4FF3A 1ZL1A 2V9WA 3M2UA 2RKIA 2RD5C 3LUYA 1T0TV 2UZ5A 4B02A 2HFVA 2AJ1A 1RWVB 2DPIA 2FVCA 2JLEA 1S6QB 3W64A 2HFOA 1JKHA 2ILZA 1WEZA 1PBKA 3IO1A 3UFCX 5GMEA 2MB0B 1CVJA 1YK9A 2VPYB 4KO0A 2C2DA 3PO4A 1P1LA 3D4JA 4USJC 3UNYA 2GIRA 4DV3F 5LMNF 2KR7A 2WM0A 2LEAA 2U1AA 3MPDA 4H4OA 3KDNA 3CJSA 4FZVA 3U1LA 1WAWA 3O5MA 4C8ZA 1NLKL 5DQIA 4QR2A 1NH6A 1E6YB 5B09A 1P8GA 2FVQA 1XJWB 1KLNA 1WF1A 1Z2ZA 3O5DA 1Y3KA 4V1Ak 1HNZF 3BJYA 1YWXA 2ZVIA 4P8VA 2B9EA 1Q7YT 4M8LA 4K59A 3CMES 3MZIA 3RAQA 4RJVA 1FD2A 2JH3A 4ECYA 1JQGA 3J7A1 1X4FA 1RCXB 1K8AT 5HK4A 2X1BA 1D8ZA 1FI4A 5GQBA 5AXLA 1SIZA 3M2VB 4DG1B 5KT4A 1EIYB 2HFUA 2MHNA 3KZ7A 1NH8A 1SKWA 2HWTA 4ZPAA 3KCEA 2PT0A 2V34A 1RKJA 2BACA 4I69A 4QYRA 4CLTA 2LXUA 1E6ZA 4DZ6A 1EJ7L 1X5SA 2RHSB 2D3UA 2H9ZA 3LP1B 1CULA 1GH8A 1K1QA 3H2LA 4Y2IA 3OFGA 4LRFA 4DRHA 4MK7A 1T9UA 2RQSA 3ZTRA 1PKUA 1CEZA 3CO9A 2HMIB 1R8PA 4UY8T 3DI6A 3W5XA 2C2MB 1RABB 2W4PA 4DR3J 3MMCA 4DL0C 5DZ6A 3LTOA 4AXJA 3TR5A 4LQ9A 5CYJA 2YBVA 4NCBA 1WHXA 4NXMF 2OPQA 5IQ6A 4DQPA 2MQMA 1RCOB 1N5SA 1C0TA 4XK8C 3LP2A 2PD1A 2D69A 4J9RA 3QZ7A 3KK3B 1HD0A 3CCZA 2XMTA 4MKVA 5HATA 1HD1A 5GAHU 4P7TA 1S9EB 4NYPA 4U67Q 1UEKA 2CPHA 5F8JA 2UU9F 3HHDA 5GMDA 2E9RX 3M6XA 1NKEA 3PDNA 3PTWA 3RYLA 3KUGA 4A47A 4J9PA 3DRYA 4DR2F 4CO2A 2DRAA 3KLFB 5HBFA 4V19X 4DRMA 1RAAB 3KLIA 1GX6A 3ARXA 3J81Y 4ZOSA 1WC6A 2FC9A 2IIHA 3TRGA 5D0RA 1W1PA 3SZ2A 1PJ5A 1NK8A 4DCJB 4H4MB 2E5JA 5A8WB 4PR6A 2D9PA 3IAM9 3DOLB 3TVZA 1CS4A 5IC6B 1HHTP 4CLPA 2R9LA 4IT4A 3L09A 1N32J 4QQBA 5L46A 5DS7A 3T6JA 4C98A 4ODRA 3GSDA 5B0CA 3SBMA 1Q5YA 1YATA 1HI8A 3DDNA 4USVA 4OHXA 3IK8A 1U0SA 4NLPA 3MGJA 4IPXA 5L9NA 4MYTA 5HLFA 3KAIA 4A48A 3EGWB 3CJKA 4QWBA 3VAFA 4NA1A 1LQ9A 1TR0A 3MPUB 4ZDNA 4NXNJ 1FTCA 2W4CA 2RU3A 3HSJA 4OL8A 3JTPA 4KGVB 4QWDA 4DUYF 2UUBF 1F5AA 1PGZA 4PWDA 1TKZA 3OTBA 3G6MA 2VODA 5KFTA 3KNAA 3K5PA 1BGXT 1PCAA 1VOMA 3PX4A 3FEXB 2NLWA 4Z2JA 2ZQSA 4ZP6A 1G6BA 4ELTA 4MYUA 2HK2A 1FKJA 3FDSA 3W9JA 2VL1A 2MLZA 2HQDA 3RRHA 4F02A 5ETQA 4Y2KA 1HA1A 2KXNB 4ZVSB 3E2EA 3IR5B 4DV0F 4CO5A 2LEBA 1DJ0A 1W7WA 4KT0C 4FBTA 1TMJA 2WB4A 1RBAA 2KTQA 2EFVA 2C3YA 2A6MA 2BJ3A 4G50A 4K0KJ 4YY3J 4O4RA 2GAHC 5D0EA 3V4IB 5J1EA 3GFHA 3M8QA 3H20A 3AB4B 4OZLA 5KFBA 2VASA 3D5MA 3FSIA 3SI8A 4ZPWR 2QZ8A 1U1RA 2F23A 4MNLA 4L3KA 4B9LA 5KOXA 2HNYB 2C2NA 2QFJA 2NCKL 2ZD1A 1I94J 1P6TA 2RQMA 3KWMA 3AQOA 2ZM6F 5C24B 4FS2A 3LAKA 2HK3A 4OHWA 2FVPA 3MFIA 1QAXA 4LIRA 2CPXA 2VG7A 3HULA 3MUMP 3MR6A 4I6WA 3FMBA 3MOJB 3DC2A 2HHPA 2XSJB 1GRJA 3DNCA 4MGVA 3D3BJ 1S97A 3KLHB 3FUYA 4WFAQ 2KT5A 2XLIA 3CCMS 1IKYB 1FE0A 5DGAA 2G2ZA 4K4UA 1QSSA 2AJ2A 5L9XA 2MKKA 3CCES 3ZZPA 1TV6A 4NCGA 2DR5A 4WKFA 4QIEA 4UZCA 3F56A 3D0IE 1X0FA 4NYOA 3GYNA 1KFWA 3AJDA 4ML4A 4LAVA 3V6DB 1ZETA 3WD4A 1HWJA 1VIOA 5CCLA 1JVWA 3JYTA 5J1PA 2G0JA 5F8GA 4YQWA 1WI8A 2IDEA 2ITKA 4ZCIA 5K14A 4CYUA 4EBDA 5K8PA 2Z30B 2IMOA 3BDEA 3GQCA 1S57A 1IKWA 3HSDA 2DRDA 1NCLA 3W2VA 4A8QA 4R0JA 3OL6A 2BOAA 2XMJA 5H9FK 1Q81T 3MWBA 4FVCA 4GKKF 5J1NA 3SCLE 2PI6A 1VRQC 4RNNA 1S10A 4HYKA 3PCOB 1ACMB 1SQGA 1NSGA 1UR9A 4AQYJ 1R3NA 3A1YG 1VBKA 1N8RT 1UVIA 1RWXB 5I4MA 2LQ9A 2QRRA 1JLCB 2HZAA 3C6UB 3QBCA 5FLXU 3ADAC 2WZ1A 4Z2GA 4LUBA 1O51A 3QATA 4FXVA 4DR5J 4YHHJ 4ZVFA 2V2QA 5BYSA 2QLJB 5GAEI 1Z4UA 3NGUA 1TL1B 3CDWA 2H3EB 4Q0BA 1Q82T 1X5OA 1S0VA 2E1MC 2RVJA 3RFWA 3HI9A 3NXZA 3GLJA 4DEZA 3TAQA 5DITA 1GFWB 1T9WA 2ZDOA 4P6QA 3V5RA 4M95A 4DQSA 2BZ2A 3Q24A 3L4BC 3NTPA 3DXSX 2WSFC 3CJ8A 4IRCA 4DS4A 3EUNA 4EYHB 3TVYA 3DLEA 1VISA 2HHWA 3DRXA 2DG9A 3SCKE 4CM2A 4JFLA 3AOAA 2BXJA 4QJVA 4JI1J 4CO1A 4RBUA 1W2BR 4TY8B 3D28A 2KI2A 4QT2A 3WX4A 4C2MA 2JNJA 1CQMA 4RZRA 5CXTA 2QSWA 2HURA 5KFQA 2DNNA 4DPXA 3IKGA 4CLLA 2XP3A 1YX2A 2F8MA 3BKUA 4DQQA 4HBOA 1QUPA 2HS3A 3TZYA 4LBHA 2PPOA 3NGKA 4FN5A 3OT9A 1KQFB 4G1QB 1SL1A 1UVNA 4ZJQA 4OZ3A 3DDIA 1T05B 1AUSL 4C8MA 1B7FA 3MMJA 2HIQA 3AOBA 4F3QA 4U6PA 5HBMB 4N76A 1ROFA 4U96A 4RNHA 2DHGA 1K1SA 4WU2A 3O5IA 5CQGA 2HFSA 4OYXA 1CG2A 4Y3CA 4OYZA 3LGMA 1ULRA 4ZJLA 1VMBA 1S6QA 2RHQB 1RLDA 1SC1B 1YVFA 3QNWB 2GHVC 2YBUA 4XPEA 2WCXA 1RT3B 1NKBA 2DT3A 3M2RB 3PJXA 2PBCA 4DWIA 4TYAA 4UT4A 2HHHJ 2DNMA 4M5GA 1U47A 4IOAQ 3H59A 3KAHA 1RT1B 4X4PA 4RNOA 2YQ3A 4DV2J 2YNHB 2UXBJ 2E1CA 3FZ2A 1TL7B 1BQMB 3M6VA 1FESA 1PSDA 3H2VE 3MM5B 5KFPA 1E6YA 3B9EA 1JLQB 1F2GA 1TUGB 2JLGA 3H5UA 1UJ5A 3QSIA 4DR3F 3U27A 1Q53A 2FJVA 1AA1B 3HJVA 3CH9A 5F0UA 3H40A 4DSEA 1RBLA 4ZP7A 2ALZA 2JOQA 3E8OA 1LL7A 1QUVA 3NL0A 2DEJA 3NNCA 1VQYA 2DNGA 1H7XA 4ZVEA 3OTCA 1S79A 1WC5A 4TW7A 2R4FA 2E7WA 3TWZA 2H5JB 1KSPA 3M2VA 3D6FB 4DG1A 4ED7A 2JVRA 4Q7NA 1F0XA 4OYPA 3I0SB 3NGDA 4WIIA 1R8BA 2IJRA 2CQ0A 3GG1A 1ZM9A 3T5JA 2BKPA 2ADCA 2K3KA 1H0HB 4DRNA 2YXLA 3LP1A 4OYOA 3OBIA 3ODKA 3OJSA 1MW7A 2WVFA 2ZKUA 1S1UB 1HR0J 2P2CB 3A3OB 1QAJA 4QR0A 2P6TA 1YRTA 2K8GA 5DDPC 3JXOA 2FZKB 3TAMB 2HMIA 1N32F 2K3IA 3TZWA 2CWKA 4I67A 4P2SA 4K4ZA 2R3VA 3KKFA 1Y10A 3I6PA 2LU1A 2CPZA 4PTMA 4UOHA 2DCLA 3P5BP 2M88A 1TKTB 2WSCC 1LWXA 5CYMB 3HK2A 3L9ZA 4ODMA 4YOEA 4TU7A 2G41A 2A10A 1FXDA 3VV2B 1K0VA 3L7PA 1WF2A 2PFDA 1ZZFA 1BMQB 1JJ2R 1YITS 3B4MA 2B4PA 3KK3A 2L3MA 1UVLA 1OWXA 3LWLA 1S9EA 5EDWA 2KHDA 3LPEA 3P6YC 5IWAJ 3G6YA 4ER8A 4NXNF 5HO4A 2FHKA 1DQ8A 2MY7A 2Z4PA 4FBUA 4K4SA 5B0BA 3SEOA 3W66A 2PV1A 3KLFA 5M2PA 2FJWA 4USTA 1X0PA 1MG7A 4QR1A 3ZNUA 2I2YA 4R5EA 5KT3A 1SL2A 4DZ2A 3CCJS 3GCXP 3G6LA 1U6BA 1Q79A 1NK9A 1R6YA 4LT6A 1RT4B 1XC9A 1DZ5A 1TELA 4H4MA 5A8WA 3RRGA 3K58A 3DOLA 4O3RA 2MMYA 4HH1A 1XEZA 5HMZA 2LYVA 2C22A 2XGPA 1UW9A 5IT0A 1QSLA 1SJ4P 1ELOA 3I96A 3QRQA 4QBUA 2C2RA 4ED3A 2IPOB 1MWZA 3WDOA 4K0KF 2QLBB 4YY3F 3FNNA 1ZPWX 4CLWA 5FDLB 1SYTA 4TX0A 5IV4A 3K89A 5E3QA 5IFMA 4YMEA 1VBZA 5M2RA 4PXCA 1RJJA 2B8QA 1WACA 4TLRA 1FT8A 1GXLA 1TL3B 1SIWB 3T1YJ 1S6UA 1I94F 3UDVA 2YWHA 2XSFA 3NLCA 1GTEA 3MR7A 4HEA9 4LF5J 3FBCA 3A8KA 4AYBD 3KJFB 1RD6A 2FHMA 4CH0S 1RT7A 3M4XA 4NLGA 3HJFA 3VZIA 2DXDA 4GC7A 4XDDA 3CTRA 3BXWA 2ZUGA 3OPKA 2F8HA 3RU0A 3ZZ0A 2JFDA 1XMQJ 4H4KA 2CDRB 4W92B 3GIJA 1BWVA 1YSJA 4C9DA 5CD4H 1WF0A 1UFWA 2IRYA 1S48A 2O66A 1XRVA 3D68A 4ES2A 4Z37A 4DLGA 5HROB 2XZTB 3MOZA 4OI3A 2W9AA 3LAMA 5CZVA 2DRBA 4WFBQ 2E1RA 3V4IA 4P10A 4ED0A 1KR4A 3N28A 3D7SB 1U45A 1UTAA 4JI2J 4ED2A 3Q8UA 3OVAA 3LF0A 5LSRA 1S9GB 5E3AA 4J4OA 1Q8BA 1EDQA 3G96A 1RE1B 2DPEA 5DDOC 2HNYA 4XAKA 2WVCA 3TP2A 1H3DA 4DROA 1FDAA 3QO9B 1MWQA 4NEYA 3POTB 2P5VA 2QMWA 2RUQA 1KS2A 3HSGA 2MZTA 3AS0A 1GT8A 4DL3A 5C24A 2PO4A 2CQGA 3MUTP 2GO8A 1KDNA 1GAOA 1F6TA 4HT7A 4LFCJ 2MKYA 4EBCA 2CADA 3QGHA 1WKKA 1NKCA 2FQQB 4MNJA 4URGA 5CABA 3DLKB 4HL9A 3IBFB 1B0TA 2VPXB 4FXWA 2R8GA 3AD7C 2GCFA 2XBPA 2RT3A 3GPAA 2A6OA 2H4YB 2XSJA 3D54A 4QT3A 2FY1A 1S7HA 3KLHA 3GR1A 3QFWA 2MKHA 1IKYA 3M6WA 4AQYF 3OSNA 4ECUA 1SJFA 3HHKA 4F8RA 3GSIA 1NDCA 2J0WA 1RU1A 3QT7A 1FKBA 1R8CA 1FVQA 4J9OA 2RILA 3AAWB 4DR5F 4RNMA 4YHHF 4B08A 3MR2A 4L76A 4KKOB 4ECTA 2DNLA 4ODPA 3V6DA 3Q8RB 3ILLA 4V19J 3PKMA 2CNOB 1NHVA 5F8MA 1FD8A 2R7SA 1WG5A 2PGCA 2PEBA 4YB1P 5B8IC 1OS5A 4WE1B 1W9UA 2LJ4A 4R5PB 4CLZA 1U2RA 1VBXA 4FNIA 2J5AA 1WDTA 5HTGA 5ETLA 2JL9A 1FKDA 4G1IA 4B3MF 4J9KA 3CJ5A 5KG3A 1XR5A 3EZ5A 2PI5A 1RHUB 1J5OB 2B4OA 1IJEB 1PYSB 2I9SA 1RWUA 4YUDA 1H0GA 4RUAA 4N5SA 4JI1F 2QL9B 2CJKA 3KJVA 1SJ1A 3B9DA 2F9DA 3W7BA 3HPOA 1RWWB 9RUBA 5J2PB 2LVWA 3JYJA 2LQ5A 4QIVA 3CCWA 2M9KA 2J9DA 1JLCA 3C6UA 3FZBA 3CEDA 3Q83A 1R7IA 1FKOB 1MN7A 3FQLA 1NWTA 4I2PB 2J7UA 1X7VA 2B5UB 1S99A 4CQ1A 5E2QA 2H65B 2CJ9A 3DLGB 1TL1A 1VQMS 2B5JB 3GJSB 3I55S 1YTYA 3R7SB 1R6VA 1GXUA 1HNXJ 4NLQA 3CWJA 1GXTA 4ETZA 2EKYA 1EZZB 2Z2YB 3NS6A 2A3AA 5H9EK 4RW8B 3IFEA 4QW8A 2EBEA 1JNZB 3CDAA 4AXIA 4DX8H 2NPFA 3AY0A 4NEZA 2IC3B 4QWAA 4LR9A 1AZSB 2ZH2A 3Q23A 3Q2SC 1GPFA 1JX4A 1L3VA 4UW2A 1NDKA 4LVOP 4TY8A 2HHHF 3I5CA 4DBQA 2ZQUA 3BR8A 1JK9B 1H72C 4PG8A 4DV2F 4FS1A 3WKZA 3UPFA 2UXBF 2BQRA 4XTTA 1IBLJ 5L1KA 1LL6A 5BXIA 4DF8A 4EBEA 1M1KT 3DRPB 5K8OA 3GTYX 1RAJA 5DDRC 4F4XA 4G1QA 1FKTA 2VBXA 4O3PA 2VV5A 3QWPA 3DOMB 1T05A 4NE9C 2BOPA 1QM9A 2EC0A 1KFSA 4F26A 3K5NA 2MF9A 5HBMA 1Q95G 5KT6A 2DJWA 4DSFA 4BS2A 1ZAVA 3M7VA 1EARA 1S12A 1CSJA 1E6VB 1RAHB 4LBIA 4OYWA 4B3TJ 2JEIA 2F65A 1X4AA 2ZUAA 3QT8A 2O92A 3FGVA 3E51A 4J9SA 5D15A 4ZCLA 3T1AA 4JFJA 3AXMA 4Z2XA 1RT3A 5F3ZA 1FTRA 4NLRA 3M2RA 2C28A 1SVDA 3U1NA 3OD2A 2DNRA 2M2BA 3TYTA 4C8LA 3WC2A 2VQEJ 1L3SA 3GP9A 4DV4J 2DT0A 3IXQA 3ELHA 2OHDA 1PYOB 1RT1A 1DQAA 5HW7A 3PIPQ 2YNHA 4DL6A 1HR0F 1NSPA 2P9CA 1TL7A 4Q2MA 3ARTA 2LXFA 5G0RB 3MM5A 3MM7B 2ZNYA 1S76D 3PRVA 3J7Z5 3MAQA 3S1TA 4JFIA 4Y2CA 3ONQA 3AJ1A 1T94A 3I4PA 4IG0B 1NO8A 2IBKA 4GIVA 1TKXB 2IDLA 5DF0A 1LL4A 5D4PA 3MAAB 3HXMA 2CZVC 4G65A 3K5OA 2L9DA 3NCQA 3L7UA 3TA1A 1YIJS 4ODQA 1F5CA 1FWLA 3I4HX 1FFWB 2YX4A 4O4GB 2DGOA 1S77D 5IWAF 4Z2KA 2YX1A 4Y00A 1JCHB 2W2MP 3HHLC 4XDCA 3FAPA 1JWWA 3T9NA 1TFWA 1JNEA 1X4DA 3I0SA 1D9FA 1XMBA 1U1NA 1U25A 5J2MB 3TA0A 1F1BB 4MIAA 4AUKA 1S6OA 3GFXA 3EMTA 3SXLA 3VVTA 1R0CB 2KI3A 4F2SA 3QWUA 2ZBCA 4OHVA 4WP9A 2ALYB 1KFDA 2VIHA 3O8WA 1FJDA 2OELA 4TYOA 1Q1CA 1VIXA 3BB5A 1S1UA 1VQKS 1W2IA 3O5TB 3MPWA 4LAWA 1WDDA 3TAMA 3BQ0A 1RYRA 4EU0A 2HPUA 4YR2A 4TU8A 5KFKA 3A3PB 3GV5B 3J81U 3CE8A 1TKTA 5D75A 1Q86T 1KT0A 5CYMA 4M5LA 4U7CA 3BEGB 1S5ZA 1K73T 1WHYA 4YEAA 4DFPA 3WD1A 4BCAA 2KHCA 1NPKA 2DNHA 4H54A 5KTQA 3CHDA 2E1AA 2QC3A 4CO3A 2ROGA 3F73A 2VBYA 2YKMB 2BE7D 3DRSB 2PFFB 3VQTA 1ZU8A 4LR7A 4ED1A 2ZJRQ 3NWRA 4WK1A 2WK4A 5T41A 2DPJA 4Q45A 3T1YF 5KFGA 3G6XA 4YR3A 1P9YA 3FMWA 4LF5F 6FDRA 1U1MA 2HHVA 3WIVA 3LUOA 3DHXA 3IG1B 2ZHAA 2QE5A 1F2HA 1SV5B 5C42B 5IT4A 2HZCA 3MEDB 3AJ2A 1LJYA 3UI4A 5KFFA 3J81j 1XK8A 1RT4A 4C8NA 3ICLA 4CP5A 5D8HB 1XMQF 3CVKA 2Z56B 2HW3A 1TUWA 4JI6J 2PE8A 3SQOP 1M0SA 2DGXA 1ZH5A 2O9OA 5FLXY 4R8UB 3IWXA 3H25A 1VDHA 4IR1A 3OJUA 1EAYC 3AHPA 1CJVB 4FXDA 4DUTA 3S01A 3KHGA 5FDLA 1QPFA 4Y2AA 4M5DB 4KPYA 2HGMA 2QGFB 1UVMA 2RUGA 4JI2F 5HWBA 4O44B 2OSQA 1MU2B 2N4DA 2IVFB 3CC4S 2KFZA 2FLLA 1RHJB 1B3TA 2CQHA 2C3OA 2D3OR 3PIOQ 3CIMA 3QLHB 1TL3A 4K5RA 3HM9A 3VAJA 2GGPB 2HQ3A 2ACMA 2UXCJ 2O5DA 2KO7A 4LFCF 3E01B 2FB0A 3OL7A 2I6WA 1RQ0A 5AT1B 1HBNA 3Q2TC 5GAEU 5F9LA 4JV5J 4DH0A 5CA5A 2W8LA 4JB8B 2IJNA 3CJ2A 4J9MA 5DG7A 4FN2A 1KQKA 2AGOA 2OIHA 1X4GA 4NA2A 4DRKA 1LW0B 3KMQA 4X66J 4HI2A 3CDBA 5HROA 5JUMA 1UMJA 4RW9B 2L08A 1OGGA 2VF3A 2AYGA 3H2UB 5BYRA 1TK8A 3ZNJ1 4HHJA 2OFHX 2GZOA 2DNYA 3M8WA 4L72B 1J6YA 2I5JB 3US5A 5DG9A 4KY3A 3R5JB 1SC6A 4F36A 3D3CJ 1X6LA 1KEKA 3H7HB 3NCRA 4P8UA 3ETOA 1QY7A 2AX1A 1S9GA 2CQIA 3IS9B 2DHAA 3AS3A 3MF5A 2HAFA 2AWGA 1WELA 3O5QA 1KTVA 4WZMA 3Q8QB 3TX0A 3RB6A 3QO9A 3POTA 5A6WA 4U8YA 1GEHA 3TZZA 4IT6A 3G8TA 1IKXB 4PZVA 4HT5A 4LF7J 2DO0A 1F40A 2VZ9A 3UD3P 2DSZA 2E5IA 3MMBB 3CHEA 4LQ3A 3C46A 2BKOA 5LXRA 3DLKA 1DTTB 2RNEA 4CH7A 2GIQA 1V3ZA 1AYEA 1K0TA 3CJTA 3CGIA 2KVIA 3DLHA 4RBVA 1KBRA 2GHWA 3PKYA 3B7XA 5HI7A 2WSEC 4I64A 2DT9A 2B43A 5E3RA 1RZMA 3FCWA 2HSEB 3FBBA 3TUIC 3GJTB 3K57A 1H98A 1WEXA 3M9NB 4C02B 4RW6B 4ZLPA 3QRPA 2GFFA 3CC2S 1TK5A 1F8AB 3V6KA 2L2SA 1PIEA 4KSEB 1QPLA 1LWEB 4P75A 1GNKA 3RAMA 3RBDA 4KKOA 1F9EB 2UP1A 2ZR5A 4ES1A 2MDAA 1VK8A 2OPSB 1FKAF 2R2RA 3CDEA 1RWOB 4FYYB 1U1KA 1N36J 4UY85 2AQ4A 3ENQA 2GMHA 1HNXF 1UVKA 4DV5J 3BYRA 1NK0A 4AL5A 1FFRA 4WXOA 3R97A 4WJBA 4WE1A 4WF9Q 3CO0P 3NY0A 4R5PA 1SB6A 3DU6A 3ILIA 2LLZA 1YQHA 3NKYA 1FRXA 1NJIT 3NBPA 4BWJA 1D7JA 3HDSA 3P5TL 4QW9A 4TQSA 4K7QA 4P73A 5EWFA 4WIWA 2EW9A 2RUCA 4C8OA 4C8YA 1NU4A 1J5OA 1U6FA 1FEEA 4LSZB 1DURA 1U09A 4AD6A 1CJKB 2D9FA 3M8SA 1IBCB 2V63A 2AV5A 4RL1A 5J2PA 2XCPA 2XLKA 2YQ0A 2OFNA 2C3PA 5BXJA 4QYZK 1HL6A 1N5YB 2L9WA 4ODLA 3IN5A 2FYXA 4MPKA 2XYGB 1IBLF 2MZRA 2XP8A 1FKOA 1NNDA 5KFYA 1RAOA 3EVWA 4I2PA 1JJCB 2W01A 3PW0A 2LP4A 2ZEJA 5GADI 2KVQE 4WYWA 3GIMA 4MKYA 4QPXA 3DLGA 2B5JA 3WL0A 4DQIA 4RUBA 5D6GA 2MEWA 1N5QA 2RJZA 4FYDA 2YTCA 2OMOA 2KM8B 1QLNA 2J7WA 1P1TA 1R8AA 2OD4A 1IUJA 3FBEA 2ZDPA 2UV8G 4OHZA 4B3TF 1WTFA 3IR7B 3P8BB 1WG1A 4Y34A 2CFXA 3GMGA 3T6BA 1C4AA 1IM6A 2OUGA 2NYIA 4DT4A 1JLAB 2IC3A 2N3LA 1AZSA 3I31A 2KG1A 2FVSA 5DQGA 5E0OA 3G82A 3NS7B 1F9FA 2VFTA 2M3DA 1XN9A 3TJ9A 4CNYA 2VQEF 3EICA 4DV4F 2DGSA 1EX8A 3EX7B 1G3OA 1HBMB 3MMAB 5KT7A 2R7XA 2E5LJ 2GVDB 4ZPCA 3AQPA 4KC5A 2KH9A 2O1PA 3OOBA 3CPWR 2NR0A 2ZH6A 2PMZD 2KDOA 3ARSA 4DN9A 3DRPA 5HKGA 4MMOA 2W25A 4X64J 1R43A 2VPWB 1NJWA 3DOMA 1RUSA 1P9QC 5IZHA 4PPZA 1IR2A 2ZJPQ 2XP5A 1ITXA 3CMAS 1V9OA 2AD9A 2EFNA 4U7UD 1E6VA 3VALA 1B70B 3D67A 3H0PA 1WC0A 3HZEA 2RRBA 5LXYA 4ZLLA 1FRLA 4ETXA 2A3CA 2QEXS 4HR2A 4N56A 4ZMMA 3MXHP 4ZVPB 2YVSA 2DK2A 4CT8A 3BGUA 2LPVA 3MCMA 2CPEA 1XMOJ 2DGTA 4JI0F 2RU9A 3G6VA 1P27B 2DH7A 5BYQA 1RKIA 4ZVGA 4WK9A 1VC6A 2HGLA 5KG1A 1WOPA 2OKQA 1IR0A 4AFFA 3UN5A 5G0RA 3MM7A 2RUDA 4GKJJ 2LQJA 2ASDA 5E3CA 2W7PA 2BX6A 2CXEA 3R7BB 4EUVA 2HHUA 1KVJA 4N7TA 3ISND 4IG0A 3OXFA 4KH1B 3K0JA 1TKXA 4PCQA 2XZWA 3BQ1A 3RB3A 3PR5B 2PMHA 3MAAA 3B8SA 3EDRB 2LQ8A 1IKVB 4Y0FA 2QA1A 1RTIB 4ES3A 3I56S 2CIMA 2XPAA 4O4GA 2NZ4A 1CJUB 5HT1A 1BWEA 4LF8J 3ILJA 1UJ4A 4Q22A 5DIVA 3K17A 1YI2S 4Q2LA 4PXBA 4IRDA 1A7XA 2QMUB 3H98A 1HXVA 2G13A 2IRXA 4KHMA 1UZDA 1XBWA 3HVTB 2Y1RI 5HN0A 2K7KA 2CUYA 4Z2LA 3UDEA 3U02A 3FBFA 3D1OA 3DLLQ 2DTJA 1C2PA 1XNQJ 2F9JA 5L8RC 1GMVA 2PN0A 1JNSA 1HYSB 3OL9A 1TVRB 2L9NA 2AMCB 4O23A 1JJ4A 3BN4A 1S1XB 2DT2A 4NLYA 2B0GA 2GQCA 5LSOA 2CPFA 3OR2B 3MTKA 1FFQA 1IWAA 2VD3A 4NX9A 4JI6F 2GQQA 1HKMA 1M5YA 4P8XA 4ZK7M 2DSUA 4NLOA 2DHSA 2YNGB 1IBMJ 2UV8A 1VC0A 3QPIA 3KG4A 1VQSA 4PWUA 1HKKA 1CLFA 1QDUB 4ECSA 4DPWA 1VF8A 4URQU 2XO6A 2XP9A 1YBUA 5ETVA 1HI0P 2XZDB 4ED4A 2V4RA 2I1RA 2ZH4A 3FFIB 2YKMA 4OZJA 3DRSA 5KFVA 2HNZB 4A8SA 2OGUA 2GVZB 3BZQA 1E15A 3KJNB 4HACA 4GO7X 2RRNA 1NSAA 5E5NA 1FRJA 3TJ8A 1PG5B 3X3UA 3R27A 5DQHA 5D0GA 1VK3A 1E6RA 5HUAA 2UXCF 2WONB 4F0MA 1EIBA 2FJXA 3UQIA 3IG1A 2XO7A 1S1TB 5C42A 4JV5F 3MEDA 2V50A 5DJBA 4IQCA 4C3LA 4DL4A 4FNHA 4M5NA 2V68A 2OTJS 4X66F 1NK4A 2ERRA 4R8UA 2HQCA 1Q8LA 4P71A 7FD1A 1AUDA 2IYGA 2RF2B 1W26A 3VAKA 2O67A 1RTDA 3TARA 2C42A 4HTIA 3ZTQA 1ZPVA 1U8SA 3B82A 4OI6A 4NYZA 3TC5A 1CJVA 3BGRB 5HQLA 4M5IA 4DMZA 1WEYA 3FY1A 3ENAA 2FVRA 4M5DA 4X4NA 4DRJA 1GTHA 1OJ4A 1B4SA 4O44A 1MU2A 4KBIA 3IBWA 1T03B 2EG2A 2HRUA 3KG0A 2BJDA 1PINA 4J9LA 5JJBA 4ZJOA 3QLHA 3O44A 1WNEA 1S72S 2CJAA 4ERDA 1S49A 3C19A 4ANEA 4F0KA 1IM4A 4ZKAA 4PPDA 2GGPA 2R8KA 1U1LA 4LF7F 3W9HA 3W61A 2YX7A 3E01A 4ILRA 4DCOB 4EO6A 1TFYA 1SH0A 3UR0A 1WWHA 1T9YA 1YDLA 4B3OB 1F3FA 1DLOB 2DGVA 2J8SA 5GAHI 1NM2A 4UOFA 1U0HB 2Y78A 3JSBA 1LW0A 2XHWA 3FJ2A 1YBAA 3HKWA 5H9FJ 3GFZA 3FCVA 4F67A 4AT1B 1IVZA 2E9ZA 1RGVA 5K20B 3QT5A 2ZBIA 4HTJA 4ZHRB 3V81B 2E9TA 1C1BB 4USIA 2HVEA 1S59A 4M1KA 2V8DA 2IAJB 1HFEL 2I5JA 4NI2B 4YB7A 2DR8A 1KWMA 1D3WA 4PUOB 2QX0A 1SPBP 2R2TA 4NZCA 4DPOA 3QOKA 2U2FA 3JQMA 3ET6B 1N36F 3IS9A 3OR1B 1OGBA 2ZQTA 4DV5F 2V8GA 4M94A 1U7LA 3FSYA 4DR4J 4RUCA 4RWXA 5CHCB 3IGNA 2HBQB 4K50A 3UDCA 4J37A 2EEYA 2HS4A 3ZZTA 2DGWA 3MMBA 1WOOA 4U9RA 5C2CA 4DFKA 2ATCB 3HHLD 4MNMA 2B3TB 3DXBA 3LPYA 1UVJA 1H7WA 3DRRB 1DTTA 3PXGa 2GA7A 1S4EA 4IFVB 2YKNA 3WIUA 3W9IA 2DNZA 4J90A 2OTLS 2UUWA 2AJQA 2A3BA 5CAAA 2QF8A 1X4EA 1UW4A 2MJNA 4M63A 2DGQA 3FEYB 2MKSA 1UETA 4MTPA 4I56A 4RW6A 2HQGA 2M0GB 2C2KB 3C16B 3LWMA 1MLAA 3CIZA 2H54B 2HHXA 2AHOB 2BRLA 2C2OB 3VAMA 2HLTA 1LWEA 4EGLA 3RR8A 4ED8A 3W8GA 2OPSA 1RAFB 1NHUA 3PR4A 2PPPA 4BWMA 3CULA 4RKUC 4WKRA 4C48A 1LFPA 3UQAA 4TNOA 1Y00A 1FXLA 4EK2A 2ZH5A 4UUWA 3RB4A 3BKTA 2EULA 3CCTA 2N82B 4OIXA 2QLWA 2LEPA 3S8SA 3PW2A 5F8IA 1UR8A 3KFWX 1KVIA 2FGCA 3SSRA 1DQ9A 2M5YA 4BDPA 2RMLA 3O3LA 5I3PA 4R25A 2BDPA 3OFFA 1IR1A 2IHR1 2HFNA 4KGXB 1N4LA 2I0XA 2R7UA 4CLFA 1A9NB 4RUHA 2QIFA 4G6VB 2XP6A 1CJKA 1B7YB 1RTHB 2E5LF 2KGJA 3TJAA 4OJ3A 3BPSP 4HDHA 5KG6A 2HWIA 4TKTA 4RWWA 4CM0A 4UQTA 1U48A 3M8PB 4WFNQ 4CLSA 1N5YA 2XQCA 2AP6A 1RWKB 2NXUA 4JI7J 3JXVA 3N6LA 2PSZA 1ICEB 4USKA 2XM3A 4O2TA 4X64F 3HVAA 4P74A 2KRBA 5A2QY 3HFVA 5M2UA 2YNFB 3BO4A 3EVMA 4KIAA 4JV1A 2OPPB 3M1VB 2AJ4A 1V5IB 5KG5A 2ZC4A 4J9QA 5A8KB 3DHWC 1CBKA 2OLWA 2QG9B 1XERA 4WFXA 1BQXA 3EWGA 4OZ5A 4ZPVR 4U86A 4NLVA 3AA8A 2RDDA 4WIQA 5DIUA 5K5MA 1WB0A 3ARYA 4PXEA 3RR7A 1Q7LB 4QU7A 1Q8IA 4WBFA 1BC6A 1XR6A 1JLAA 2ASLA 1PILA 1HWIA 2ATLA 2D7SA 1XMOF 3ZZOA 2MQNA 2ZOFA 5E7OB 1J4RA 4TYBA 2GX8A 2ZC3A 2BJ9A 4ZIWA 4U8VA 2PIIA 1Y5IB 4S0MA 1HBMA 3MMAA 4X62J 2GVDA 4J7CA 3K5LA 1LK5A 3GONA 2ASJA 4NNRA 2G2YA 3VCDA 3KUHA 2VG6B 3NRBA 1FK9B 4GKJF 4F3MA 1P5QA 5DM6Q 2ETNA 2K1RB 1G7CB 1RT2B 5LMUJ 5KFWA 2E29A 1G2EA 4P2FA 3LH2S 2RAQA 3MCSA 1FKSA 3FVYA 1EQ3A 3DGVA 2XMVA 2MJUA 5EX3A 1DARA 4IG3B 4LF8F 4C3MA 2CG8A 3B78A 5LM7E 2J9CA 1AFIA 3G71S 4CNZA 4YR0A 3VZHA 3BV8A 2CVIA 3IRXB 4DL5A 2QA2A 3OLAA 1JB0C 2XP7A 4PG4A 4PYAA 4B9VA 2IVMA 4DF4A 4QWEA 2F21A 4I6AA 2C2EA 3R5AA 1F9HA 4G1PA 1XNQF 2K06A 5E33A 3VWSA 4DJBA 2E66A 4DZ3A 2WBMA 4RNFA 1H74A 2DIVA 5K8MA 3T9ZA 3GV7B 2OMLA 2Q66A 3UCGA 1VQPS 1KONA 3QSYB 2A2DA 4I0WA 4ECVA 4HVZA 5J2QB 1LQ0A 3KXDA 2RSQA 4YS2A 1IBMF 5C25B 2QA4S 1D6OA 3EDQB 4TNSA 1EHWA 5KOWA 3WQVA 2M1IA 1M5HA 1NJYA 1IKVA 2R7TA 3NMRA 2J6UA 1YJTA 3HCXA 1RTIA 2B9XA 2F2DA 3Q8VA 1TUVA 1CJUA 2EC2A 4JI3J 2BE9B 3BYPA 2XG8A 1S4FA 3DLJA 3JQJA 5A0YB 3H4DA 4HH0A 2HHTA 2N4CA 2FTRA 1HQEB 4JOUA 4NMLA 2NUHA 4R0EA 4OV1A 5FIIA 4ZVHA 3HVTA 1XR7A 1VQ8S 3R2CJ 1NDLA 4LSNB 4O3SA 1HYSA 1TVRA 3HHLB 1ZCNA 1HMVB 3U1MA 1S1XA 2E5HA 3D1QA 3MDFA 1M5KC 4X4TA 3FRZA 5HP1B 2EPIA 1RTZA 1URNA 1VBYA 4DWSC 3OR2A 2VG5B 2E7VA 3GJRB 1ZAWA 3DLBA 3PACA 3M8ZA 4TU9A 3QJJA 2R2UA 4DV7J 3C66A 4X4OA 4K2XA 4LFAJ 1VQ9S 1Y5NB 2XNRA 1S1VB 2YNGA 2HZVA 4ODOA 2PA8D 2VICA 3QGGA 5B0AA 4OI4A 3WQPA 2XPBA 2MTLA 4F4KA 3T5KA 1SUQB 1YG0A 1HNIB 3W4RA 1D2KA 1HQ2A 2JEJA 4OZ0A 1KQGB 3FQKA 2YKOA 3M6UA 1O5JA 3L95X 4R0XA 2QO3A 3FFIA 3WIJA 3CCRS 1RISA 3RZAA 3Q0AA 1WSVA 4DRQA 4HHUA 3Q8SB 2EI5A 2PC6A 2V6AA 1NB7A 2GVZA 1Y4ZB 3R6LB 1VRTB 4JV0A 1RA7A 2VC0A 4X4VA 2KM8C 4GC6A 3BH7B 2J0QD 3MM8B 1UWBB 3TZXA 2WONA 4DZDA 3QIPB 2QV6A 4LIWA 1S1TA 4U7UK 1X5TA 1UZHA 4IUFA 4QCLA 3CMQA 2GJFA 2XB2D 5BJRA 2LGOA 2ZH9A 5B0EA 1C9HA 3OHBA 3Q89A 3O5LA 1Y3JA 4GRSA 3N6MA 2OEKA 4DUZJ 4CLYA 4TLQA 1WG4A 4MT1A 2ZH3A 1FVSA 2V2KA 4B3MJ 3JB9k 2XEXA 1DFDA 4DCPB 2GO9A 4J4NA 1NAQA 3C15B 4I2QB 2RF2A 2D1CA 2PDAA 4O3OA 1F5BA 3BGRA 3RM4A 1NZAA 2VPZB 3VQSA 4DPUA 3UW1A 1R27B 2BJ1A 3Q8PB 2CDQA 4BF8A 1MMDA 4ZP8A 1X8DA 3W8PA 3VHQA 4Y65A 2RDIA 1T03A 1YZ6A 4DHVA 2KG0A 5KFHA 1PJ6A 2J7KA 4DR4F 3VF0B 1RWNB 1WOSA 3SSSA 5HW6A 1SJ3P 2AZ1A 3BGFA 3JTOA 4RBTA 1OY8A 2GNKA 1L3UA 4ED5A 3EYZA 4B3OA 2HS0A 2HQIA 1DLOA 3W60A 2OFGX 2BVZA 1JXEA 2CRLA 3DOKB 5ITHA 1UCNA 2ZBRA 1U0HA 2FLNA 1D7HA 4YDXA 2ZE2B 2V5HG 1RADB 2IJFA 1E44A 3DM2B 1CJTB 2VN1A 3R5GA 2AYEA 5JVHQ 3O5KA 3ZXWA 2IM0A 3EGNA 4ZHRA 5J2NB 2WOMB 3WZ0A 3NAHA 3V81A 2XMWA 1C1BA 1BY9A 2F1FA 2ZR4A 1FKPB 4LVNP 2R2SA 1TL5A 2IAJA 1Y11A 1J2VA 4NI2A 4EZ6A 4Q7AA 4F3OA 5MAOA 3I9ZA 4PUOA 1FKRA 4LR8A 2F4EA 2CQ4A 1M1GA 4IQ2A 4WFZA 3ET6A 1Q8KA 2B6AB 3GFYA 1RACB 3OR1A 5HMYA 3UWTA 2PN6A 3AOCA 2QL5B 4AL7A 5LSLA 3NMAA 3ARRA 3OSPA 1LG1A 4BC9A 3G6ES 4P2XA 4X4QA 1RHKB 3DRRA 1YJVA 3BO3A 5ETNA 3B9AA 3R1LA 5H9EJ 3A8EA 4C6AA 1WNOA 4IFVA 1OMSA 2VOPA 2XY6A 4LJMA 4CO4A 1GMWD 1J27A 4G3IA 3W2WB 5I3QA 3QAUA 1U1PA 3DMJB 3ZZYA 3OUYB 3CCUS 4RR5A 4ITSA 2DH9A 3MUVP 1Z1ZA 1FJCA 1HBUB 1LG2A 2FJDB 5ADZA 3ARWA 2RB7A 3C16A 3ITHB 2AGQA 1KD1T 4JI7F 1ZK6A 4TN2A 2Q79A 5A76A 3PFEA 3CC7S 3P49B 2V69A 5U47A 1W25A 1RSCA 4ZCMA 5EHHA 2R8HA 2XCAA 4LAXA 3BDPA 5SZTA 3J7YI 2CVEA 3TANA 3MM6B 2NPIA 5DEZA 3FXYA 3SCIE 3KABA 5D4OA 4KYZA 4HARA 1N0UA 1TZ0A 1OQ6A 4ZS6A 1VJWA 4OYMA 4MJKA 3PEHA 1FKLA 2C2ZB 2DO4A 3NGTA 4CTAB 1BKFA 3EPGA 4IOBA 2F4VJ 3C6TB 1RT5B 2RUSA 2RQKA 1JLBB 3IHZA 4IKAA 7FDRA 2VJVA 1RTHA 4X62F 5D78A 4OX6A 4C3KA 1HKAA 1S0NA 2M8HA 2MZQA 1J5EJ 2DD8S 3K7RA 3M8PA 4ZCKA 3OXLA 3TDBA 2BE2B 3O5EA 3TA2A 2IVYA 4B9UA 2QLFB 1B6CA 3AH6A 2A3EA 2G0IA 3PRDA 1SCJB 3CJRA 5AXKA 2PA3A 4K4WA 2YNFA 1ZBVA 3NS5A 5LMUF 1DY3A 3CHCA 2ZWOA 2OPPA 3M1VA 4L73A 1OPZA 4U85A 2KYZA 1I3OB 1N5VA 3CJ4A 5A8KA 2V94A 1X9MA 1T9VA 4WKYA 3Q22A 2FLOA 1Q6HA 4K4VA 1H2UX 2BBEA 1QVFR 2Q5AA 1SL0A 3N5FA 2J0SD 2HVZA 1HKJA 3TUJC 2VJUA 1H2VZ 1HARA 3RM8A 1UJ6A 8AT1B 2HWHA 1KLMB 3G2XA 4IDKB 4Z7YA 4DXLA 2DB1A 1HW9A 2ZHOA 3HD1A 1T3NA 1NK5A 2Y8WA 2Y3YA 2YY3A 2X51A 3AODA 4AY1A 5AXMA 2WLZA 1SBRA 2JWNA 2L48A 1OWQA 1EYMA 1RHMB 1WHVA 2N7YA 3O5RA 5JH8A 5ETSA 1R9HA 2BKNA 5KFMA 2HBZB 3CJ0A 2QL7B 3R5CA 3UCUP 2YWKA 2QFIA 2VG6A 1WSRA 4FPIA 1FK9A 2YNIB 3NNAA 1FKGA 4ICLB 1ZBTA 1EP4B 5KFEA 3VR1A 5L1JA 2ROPA 4PEOA 2K1RA 4J9UE 1NPRA 4KPCA 3DFEA 2G9OA 1RT2A 1FJGJ 4E98A 4A8OA 5GAGU 3HFKA 2C1EB 3GIIA 3MI7X 1U02A 1SR0A 3ZTOA 2IA0A 5FJ4A 3RUBL 4DL2A 2V4JB 1A7GE 4JI3F 5LJ3Y 4IG3A 4KFBB 4ZPDA 3CJ3A 4C0BA 3A13A 2VONA 1ROTA 3IRXA 1HQUB 2W2PP 3OQ2A 1GK8A 2WVEA 5KG4A 1AXQA 4PABA 3KAGA 2ZZNA 3BN7A 2FJBB 1OY6A 1O8BA 5D0HA 1VHFA 2B8PA 4N77A 2W9BB 1KTQA 1N5TA 3WC0A 1JIHA 2OH2A 1FD9A 4F7VA 2JLFA 2DNPA 1M1HA 5CD4A 2RS2A 1HPZB 4YFUA 1SKSA 4I68A 4AL6A 2CZ4A 4QIBA 1T3OA 4WP3A 2ZJQQ 3IA0A 4DV7F 5J2QA 1DTQB 2VA2A 2D9OA 3KYLA 5MLCV 3H5SA 5JVGQ 4RO0A 4DOZA 4LFAF 2RQCA 2A0FB 5C25A 5KFOA 1H6KX 2DSVA 1VCTA 3KADA 2NSCA 3BM7A 1I51B 2XMKA 4MFBB 1NJXA 3FC9A 3BKFA 4U95A 3HX9A 1N34J 2LXIA 1PJ7A 3OV7A 1UPMB 3ISNC 1ZA2B 2G1HA 2R8IA 4MIWA 1ZOTA 1HW8A 5A0YA 4OI2A 1UKUA 2XMMA 4OYIA 4JYSA 1VQ7S 1HQEA 4LF2A 3LOUA 2AYMA 4HLBA 4ZN3A 1UA1A 3BGOP 2ZVSA 4FAPA 5RUBA 1Q4RA 4YN3B 3I9V9 4NRUA 2M7SA 4LSNA 3CUNA 2DXFA 4A4JA 5CCMA 3BBCA 3HHLA 5JXSA 1HMVA 2DCUB 2FDNA 5HL7Q 3F44A 3EZUA 4LAYA 4ITZA 4CCHA 1MROB 4DV1J 5HP1A 3UI6A 2VG5A 4IH5A 2EFQA 4MK8A 3AQUA 4MKBA 2XNQA 2W2QP 4AE5A 2B9YA 2XGQA 4DUZF 1JJHA 4OX7A 2M8DB 1RK8A 2HRTA 5J6EA 3ZZUA 1RB0A 5CZXA 1I1GA 3KHLA 1S1VA 3N4WA 3ENVA 1TCOC 2W9CB 1S1WB 1W1YA 5ETOA 4P72A 4ZVUB 5KFRA 2DSWA 1SUQA 3D6TB 1HNIA 2MLYA 1NMVA 4EZ9A 2G8ZA 5FD1A 1WORA 1V3SA 1HLWA 2RDJA 1U79A 1LXNA 4X4SA 1NSQA 3SQGB 1VRTA 3F0NA 2R7OA 4DS5A 2ZWPA 3KNGA 3GZ7A 3VVUA 4QU6A 3MM8A 3OXGA 3AA9A 1VQ4S 3GJQB 3IM8A 1UWBA 3PG9A 2IMWP 4CT9A 1RT7B 3UR3C 4W5UA 2MZ1A 1H2TZ 2GV1A 4MIBA 4DX5A 3QIPA 1Q6UA 2H5IB 2QTWA 1SC4B 1UFLA 2CJYB 4F2RA 1X9SA 2VA3A 2GMLA 2QJ3A 4BBYA 1NMWA 2D3ZA 1U8WA 2MGZB 4KHPJ 3UQBA 1LOUA 1SKUB 4EWTA 1VQ6S 3EM1A 3C15A 1V6HA 4I2QA 1UWAA 1FFGB 2OP5A 2WB1D 1X31C 1CQNA 3HD2A 3UVJB 1LV5A 2C3MA 1EETB 4NL5A 2JVOA 1WKJA 4ECWA 3BSAA 3K5MA 2NXNA 2NS1B 4OV6A 1YZ7A 3RGIA 4DN0A 2CPJA 3PR9A 4LGXA 1AB8A 3KMSA 2AF6A 4TY9A 2OJ3A 2EVZA 4ELUA 2Y1IA 2R7RA 3R8YA 3EE3A 4UOGA 1R0BG 2GIFA 3D2WA 2R7WA 1ROUA 2DY9A 2XLJA 3MECB 2AGPA 3OTDA 3SDEB 4EO8A 3MD1A 3KK2B 4DPTA 3R1HA 3DCAA 2ZNZA 4J91A 3N01A 4NSBA 1SI9A 4OHYA 2LQBA 1ZS6A 1VRUB 1KOOA 2BM1A 4PWWA 2OAUA 3O5OA 3DOKA 3B4DA 2JX2A 2YH0A 1J4IA 4B9NA 4NA3A 2ZE2A 4M5MA 5B0FA 3DM2A 1CJTA 2B51A 4DR1J 3V6HA 3RBZA 2K8IA 1WC3A 5LL6d 2JRSA 3G87A 5J2NA 2WOMA 3SCJE 4RX6A 2MPUA 4ZIVA 1VQOS 1FKPA 4ZVTB 2FJAB 3J80Y 3KUEA 2YWGA 4LRDA 5HVFA 1KNZA 4QYZJ 3ETMA 2LKNA 3IMQJ 2QT7A 1BQMA 4KR0B 2B6AA 3KHHA 1JLQA 3LW5C 2LA6A 3CD0A 1RI7A 2VKZG 3VAWA 1UPPA 3CF5Q 3DDKA 3IWNC 1N54B 3F41A 1M5VC 1AROP 2ZH1A 2JSXA 2CJQA 2FZCB 4WK3A 4WZQA 2LKZA 2DVIA 2EK6A 1T8EA 2F4VF 4GGQA 2DGUA 2RRAA 2IY5B 5KG2A 3WD0A 5HVHA 1XWLA 1N33J 3BO2A 3KJVB 5T7LB 2WTFA 3W2WA 1CTNA 4LF4J 2UVVA 2CQ2A 3DMJA 1N0VC 2CPDA 3MPYA 3OUYA 4NOHA 5CYQB 1FNXH 1NDPA 2W7AA 4KQZA 5D4NA 4XIUA 3M9MB 4QZVB 4DWSD 2B31A 2ILYA 3AXKA 3D9BA 1J5EF 3IC1A 4JI0J 1HBUA 3PW7A 2OPRB 3HZGA 3ITHA 3BSNA 2KT3A 1NWUA 3W5ZA 3MR5A 2DXEA 1HHSA 3C14B 1NXIA 4G2PA 1D9AA 2UVUA 2DR7A 4ZLNA 3GCWP 5HVGA 2GAGC 1JLFB 4O0NA 1CPZA 1KVKA 3UI3A 2ZH8A 2FY8A 2G1DA 3WL1A 3MM6A 1I6JA 4TW8A 1MMNA 2XY7A 1NWSA 3ZTSA 1HNVB 2YKPA 4DV6J 1NK7A 1M5PC 1REVB 4IR9A 2UVRA 1K44A 3MAHA 1RHRB 4K2JA 3ARQA 3MTJA 3JTNA 3N5BA 4KGZB 4JI4J 3P96A 2EFPA 1KC8T 1WC1A 4CTAA 4UUXA 3PYDA 5KFNA 5A2QU 4N41A 2YBTA 4UF4A 4TQRA 2EK1A 3MCOA 4OZ1A 3M8RA 4GVLA 3C6TA 5KAKA 1RT5A 1FWPA 4FF4A 1JLBA 3M05A 3QRRA 1YJNS 3FRYA 1FRHA 2P4VA 1ZYQA 5ETKA 2LDYA 3KLEB 4B3RJ 3EJMA 1I5OB 1K47A 8ATCB 4JUZA 2KJWA 2D41A 2BE2A 4M5JA 2DH8A 1K9MT 1YGYA 3HF5A 5EGYA 1R0AB 3JSMB 2HNDB 1VQ5S 3O5JA 1RT6B 1BUXA 2NYHA 4EEYA 2M70A 3MFHA 3SV3A 5HQMA 2W1BA 1D8YA 4DQRA 3RRKA 2V2VA 2HQFA 3PEJA 1WI6A 1HNWJ 4TW6A 3O5FA 4TVAB 3A4TA 3BR9A 1FJGF 3AFGA 1H73A 3GG0A 4FDFA 1FDDA 1SKRA 1PBAA 5ETMA 3FSXA 2P9GA 2MSTA 2WK2A 2BJEA 3OA5A 4UOCA 4B9TA 4Q8EA 3T41A 5C2GA 2WW8A 1EB0A 4WPAA 4YB6A 3ZZRA 1W1TA 2BR0A 4A8WA 5IT9Y 5DGBA 4OLPA 1Z2LA 3SV4A 2ZOMA 1Q6IA 1KLMA 4IDKA 4LF6J 4DSKA 4DFMA 1Y7PA 3CCQS 1XIQA 4UQGA 3QZ8A 4FYVB 1MNEA 2HVDA 3NEKA 2Y0BB 3QJPA 2X1GA 3FKBA 3SFUA 3MR3A 4I7FB 1B64A 2ZITA 3MEEB 1ZA1B 3P4UB 2KFYA 5C7PA 2NZCA 3KAFA 3EXYA 4L75A 3I32A 4OX8A 1OSDA 4DPYA 1RBOB 1GUVA 3PY8A 1S6PB 2YNIA 3NRKA 1QJHA 1FHTA 1PBUA 3BH6B 2BUNA 4ICLA 2QMXA 4IQXA 1EP4A 1HI1A 4EMDA 2B4UA 2YQ1A 2PV2A 3CT9A 4LSLB 3DU5A 2JZVA 5D77A 2NREA 1F3VA 4HHHA 1HWKA 4I4BA 3NCPA 3H5YA 3NP5A 2LU2A 1N34F 4DX7A 3M9OB 3DGPB 5GPRA 1S0MA 2V4JA 4NPOA 4N8NA 2BYCA 3RBXA 5EN1A 4KFBA 1RWMB 4YB5A 1SXLA 1J4HA 3TQEA 4K4TA 1HQUA 3PRBA 1JXVA 3L3CA 4ZP9A 3AD9C 2LCWA 4A8MP 1QSYA 1NUEA 3G86A 1BXNA 3W65A 1JNTA 2ZZMA 3RG6A 2KXFA 4MNKA 3R7NB 4CO0A 2W9BA 4MH8A 2CPYA 5B0DA 2KE0A 3HFZB 4NLXA 4JYAJ 4DV1F 1HPZA 1H38A 1TQLA 4MTVA 3PHEA 1FKKA 3OHAA 3A12A 2ZKTA 5BR8J 1RYSA 3N0VA 1DAXA 1G4CA 2AJFE 4USMA 1RTJB 4PQUB 3H90A 1DTQA 4QIFA 1X4BA 1NMEB 3NGSA 2V8PA 1B0VA 5B7WA 1T9TA 2ZHBA 2FAPA 1RA6A 3GPKA 2VBZA 2BQ3A 3LQVA 2D3O1 3CSKA 5LJ5Y 1KP6A 2VBWA 2J0XA 3AS1A 1FDBA 4MFBA 1FNMA 4J9VA 4PAAA 3T1HJ 2DNQA 2JEGA 1GQEA 1FDNA 4QPTA 4F50A 1U49A 2EKNA 3PRAA 2X1AA 2IBOA 2LMIA 3K8VA 2UUCJ 3TUPA 2H4WB 3LO3A 3FK4A 1FKIA 2HG4A 5AE3A 3D6MB 3G9CA 2G2OA 2IRUA 1RLCL 5I42B 3I0RB 2YKQA 2OSRA 2AYBA 4NLDA 3UO0A 4ANCA 2Z58B 3OFHA 3I5AA 1QTMA 5HSPA 1YJ7A 1YJWS 2AJ0A 1RHQB 3A8JA 1QAIA 3NNHA 5THWA 3R2DJ 3H4BA 1IN0A 2RIJA 2V8HA 2DHHA 2B4VA 1N56A 1MROA 1UFKA 2EXUA 4DL7A 5B0GA 1DHMA 2HGNA 1FNOA 1IX5A 2FJEB 2Q6BA 1YW5A 1GMWA 2ZFHA 3PNIA 1EHNA 2FD2A 4KHPF 3RM9A 4X4RA 2OLHA 1Q16B 5HW8A 2BEFA 1QZ2A 2BV3A 3BMBA 4DWSB 3D0GE 2FC8A 4LRCA 3OW2R 3B54A 3CD7A 3IP0A 2ZBPA 3ZO7A 3GV8B 5HWCA 4URSA 4B17A 1S1WA 2W9CA 2KB2A 4PQAA 2F7VA 1U4BA 1OO0B 1R31A 2W2OP 3GWCA 2J6TA 2Y1JA 4DRPA 2FGOA 1RAGB 2XS5A 3QMQA 2YKAA 3OLBA 1JLGB 4WYLA 3OTOJ 2V8VA 3TVKA 1C0UB 3K8WA 4OQJA 5KT2A 4PG7A 1U26A 4IFYB 3KACA 4IH7A 3A8IA 3T19A 2HFZA 3V2UC 4CWBA 1V3RA 3SQGA 1B99A 4LRAA 2FHJD 4DLEA 2CWXA 4FYXB 4DU8A 2H5EA 3JAMY 2ZQVA 3ISZA 3CCSS 5K9FA 3WQWA 3GU0A 1HBNB 4WFYA 2M08A 3OVBA 2GQ2A 4IH6A 2LECA 4LFBJ 2BM0A 2EWHA 2H48B 2ZR6A 2GMJA 4WTOB 1U1OA 4NASA 1VQLS 1NHKL 4DX6A 4RW8A 3J7YU 3RAXA 2LFVA 4GVBB 2VKRA 4MAVA 4IO9Q 5F8LA 2MGZA 2ABYA 1U6ZA 2PV3A 4KHRA 3R3TA 4M5KA 4P8WA 2CKWA 2QA4G 4DR1F 2NUUG 2MKIA 1FAPA 2CA9A 1OIAA 4ATNA 3JSRA 3LP0B 3UVJA 1HJWA 1RP5A 3HKZD 1H0IA 1EETA 3LGNA 4ANDA 1ZTTA 2ESCA 4NLWA 2EFOA 3PM9A 5KFAA 7AT1B 5ETRA 3G4SS 4X65J 3M30B 4DR7J 2MXYA 1OQ3A 1KT1A 4B9SA 4ILMA 2Z2MA 1X5PA 3ZTPA 3NI6A 2AT1B 2W8KA 3N6NA 2KRRA 1T9XA 1A0OB 2HEKA 2XY5A 3MEGB 3KK1B 2CPIA 1YRUA 3MECA 3UCZP 3UNGC 4KRWA 2CJBA 3SDEA 4ODKA 2PEHA 1Y5LB 2F5GA 3KK2A 3M32B 4OFZA 1ZBCA 1U24A 1FCAA 4WU3A 2XHCA 1VRUA 2R42A 5GPGA 3EIPA 3G8QA 5IXUA 2WVDA 2CZ9A 1N33F 1X9WA 2NQPA 3TI0A 4LF4F 3TEGA 3B6BA 1TAUA 1VGYA 3LALA 3PV8A 2RURA 2YH1A 1E9LA 2HIYA 4S3JA 3Q86A 5HQ8A 4P2MA 2YWEA 1C1CB 5C5JA 1KQSR 2HBYB 3EY6A 4DR6J 4E8UA 5A8RB 3I5BA 4Z7CA 4Y28C 4LF9J 2KYXA 2A1BA 4A8XA 3BREA 5F9NA 2R7VA 1VR6A 5KFSA 5IM0B 5HJYA 3KLGB 3TO8A 2AEFA 4DU7A 4ZITA 4W9OA 4F4WA 2VOOA 4C11B 3N9UC 4USWA 2FZGB 3VGSA 3CXCR 4S3KA 4ZVQB 3UN3A 1WJ9A 4LF1A 3CGMA 4EYIB 3PYGA 4DV6F 1AT1B 3NBPB 2XWXA 3K2YA 5DLGA 4NLSA 4JI4F 2P9EA 3RTVA 4Y6IA 4PRFA 3PHTA 5IS2A 4KGMA 2BRKA 2X3GA 3QQCD 4O0IA 1PC5A 1YJRA 2H1YA 3UQSA 8RUCA 1GX5A 1IQTA 3AS2A 5T7LA 4BC7A 3I6CA 1OYEA 4BHQA 1ZM2A 5DLFA 6FD1A 3EPIA 1XHGA 5D4LA 2F3JA 3CNQP 5CYQA 4JI5J 2MLXA 2DHXA 4B3RF 3KDOA 2BJ8A 2MQQA 1YJUA 5J2MA 3PZPA 1TAQA 4C7QA 2OPRA 2PPNA 3H9RB 2AX0A 3W1YC 3C14A 1T02A 3QYYA 3QGIA 1T11A 2F63A 1LWCB 3J7AN 2DBBA 4RLEA 5DETA 1JLFA 1HNWF 2YWWA 2DG3A 2AKWB 3K59A 2Y9HA 1UA0A 1FJEB 5AJ3J 5AE1A 1HHQA 2KO1A 2RS8A 4B9MA 2B56A 1MMLA 2OEJA 4C4WA 1HNVA 2QLXA 2Z2ZA 1S9FA 3CCLS 1BQNB 4OZ2A 3KLVA 1REVA 2CNKB 2VQFJ 1NSKL 2OO4A 1VS3A 2HHSA 2OEMA 1JNRB 1X6NA 4DFJA 1HWUA 5GVQA 3TAPA 5DG8A 2ROEA 2EBGA 3HT0A 3G82B 2I8EA 4LF6F 1HWLA 4NZ6A 4NRTA 1FFSB 2VH7A 2NSBA 4DSLA 3PJ9A 3D1HA 3V6JA 1HKIA 2CQ3A 5F8NA 1NZ8A 3AT1B 4ECZA 3KLEA 5K8NA 1QE1B 1U2FA 4H4KC 2GHPA 4X2BA 1ZTWA 4PKDB 3IR6B 5E3PA 1LW2B 3PFOA 5IC4B 3GIKA 1SV5A 2VDHA 1O0PA 1R0AA 3JSMA 2HNDA 3H5XA 1RT6A 2MKCA 1SJQA 3OL8A 2FHOB 3TNVA 2J6SA 1NK6A 4F4AA 1RWPB 5ETTA 3CGNA 3CZ8A 4L3NA 2ZOGA 1UEUA 4B3SJ 4XO0A 2O3DA 3UD4P 3FCHA 1KRPA 3G8SA 3GB0A 5D3GB 2A3JA 3EXCX 2KL8A 5HMWA 3IWLA 1N88A 1CC8A 3CCVS 3WD2A 1M5SA 1XQIA 4OJ1A 2DITA 2M52A 4Q5VA 2MNTA 2VFVA 4Y2MA 2F4FA 4DI6A 2KFWA 1YRXA 1FA0A 2O01C 4KV8B 4N19A 4P52A 1K9TA 3P3DA 5DZ7A 2XI3A 1PC4A 2XP4A 1PYTA 1WUUA 3T5LA 1AFJA 1APSA 3T5HA 4I7FA 4KH0B 4JYAF 3EGZA 4J9NA 2Z57B 3MEEA
chains in the Genus database with same CATH topology
5A8KA 1FEEA 2V94A 5BR8F 2V4QA 1NJZA 3MEKA 1X9MA 3V6DB 1DURA 3WD4A 1U09A 2POKA 5F41A 1ZETA 1HWJA 1VIOA 5CCLA 5LT5A 1JVWA 4WKYA 3Q22A 2FLOA 3JYTA 2D9FA 1Q6HA 2KXHA 4E0DA 3M8SA 4K4VA 1H2UX 1S6PA 3RMEA 2AV5A 2BBEA 5J1PA 5J2PA 2XCPA 2XLKA 1QVFR 2OFNA 5F8GA 1WI8A 2Q5AA 4YQWA 2ITKA 2N87A 4ZCIA 5K14A 1SL0A 2C3PA 3N5FA 2J0SD 3JYMA 5BXJA 4EBDA 1HL6A 1N5YB 2HVZA 2L9WA 4ODLA 5AE2A 1HKJA 3TUJC 5K8PA 3IN5A 4MPKA 1IBLF 1H2VZ 1HARA 3THTA 2MZRA 2XP8A 3RM8A 4L6V3 1FKOA 2IMOA 1NNDA 1UJ6A 4LSLA 2KU7A 5KFYA 3BDEA 2HWHA 1KLMB 3GQCA 3TQ1A 2IA6A 4IDKB 3T1HF 4I2PA 5I3UB 2DB1A 1HW9A 2GJIA 2ZHOA 3PW0A 1IKWA 1T3NA 1NK5A 5GADI 2YY3A 2X51A 4AY1A 4WYWA 5AXMA 3DGPA 2WLZA 4RW9A 4R0JA 3W2VA 1SBRA 2JWNA 3GIMA 2L48A 3DLGA 4QPXA 1OWQA 3OL6A 3MM9B 2UUCF 2B5JA 2XMJA 4JBCA 1EYMA 3WL0A 3QAEA 4DQIA 4F25A 1Q81T 4U84A 3MWBA 2MQOA 5D6GA 1WHVA 2N7YA 1N5QA 2RJZA 3O5RA 5JH8A 4FYDA 4FVCA 3IRWP 1R9HA 4GKKF 5KFMA 5J1NA 2YTCA 3CJ0A 3SCLE 2PI6A 2JJ4D 2OMOA 2KM8B 2EG1A 3R5CA 4RW7B 1QLNA 4RNNA 3UCUP 2J7WA 2W4DA 2JC0A 2YWKA 1P1TA 1R8AA 4W9PA 2OD4A 1S10A 1IUJA 4ECQA 4DQQA 2VG6A 2ZDPA 4HYKA 1FK9A 2UV8G 4OHZA 4B3TF 2YNIB 1NSGA 1UR9A 1HJVA 2R8JA 4NZ0A 3NNAA 1R3NA 1FKGA 1WTFA 3A1YG 3IR7B 1N8RT 2Z8QA 1UVIA 1WG1A 2MKJA 5I4MA 4ICLB 2LQ9A 1ZBTA 2QRRA 4Y34A 1EP4B 1JLCB 2CFXA 3GMGA 1ZM3A 1C4AA 3T6BA 3C6UB 3VR1A 5KFEA 2ROPA 5L1JA 4Z2GA 1BLUA 3WBZA 2NYIA 2K1RA 4LUBA 4DT4A 5DM7Q 1JLAB 1O51A 2GJ2A 4FXVA 3DFEA 2IC3A 2G9OA 1RT2A 2N3LA 2AOSA 3I31A 2KG1A 4E98A 2FVSA 4A8OA 5GAGU 5DQGA 5E0OA 3HFKA 1IKXA 5KFLA 4ZVFA 3GIIA 1F9FA 1LWFB 2Q3PA 2VFTA 3MI7X 5BYSA 5L1LA 1N6QB 5FIIA 1SR0A 2M3DA 5GAEI 1Z4UA 1XN9A 4CNYA 2IA0A 5FJ4A 2W24A 1TL1B 2VQEF 4DV4F 3CDWA 4DL2A 2V4JB 1A7GE 1RTJA 2DGSA 4Q0BA 4JI3F 1JNDA 5LJ3Y 4IG3A 1G3OA 3EX7B 4KFBB 4ZPDA 4PQUA 1Q82T 1X5OA 1HBMB 1S0VA 3MMAB 2KFNA 5KT7A 2MYFA 2R7XA 2E1MC 2RVJA 3RFWA 3HI9A 3CJ3A 1ZAXA 3S6EA 1D7IA 2UUTA 4C0BA 4ZPCA 4DEZA 3TAQA 4JFMA 2VONA 1ROTA 3AQPA 1HQUB 3IRXA 4KC5A 5DITA 2KH9A 2O1PA 3OQ2A 3OOBA 1IJFB 3CPWR 2NR0A 2ZH6A 5KG4A 2DIUA 2ZDOA 2PMZD 1AXQA 2VFSA 2KDOA 4P6QA 3ZC4A 3V5RA 4M95A 3ARSA 4EFAC 3GR0A 4DQSA 3KAGA 2BZ2A 4DN9A 2ZZNA 3DRPA 5HKGA 2FJBB 3BN7A 2DR9A 3Q24A 2E7XA 4MMOA 1O8BA 5KFJA 3PX6A 3NTPA 1VHFA 2BABA 1JLEB 3DXSX 4N77A 2W9BB 1S0OA 4A8FA 2W25A 1KTQA 2WSFC 2DNOA 4IRCA 1N5TA 1R43A 1JIHA 3WC0A 4DS4A 3OTOF 4Z2HA 2VPWB 1NJWA 4YP3A 2OH2A 3DOMA 1Q78A 1FD9A 1Q1KA 2JLFA 3EUNA 2DNPA 4EYHB 1P9QC 1VC5A 2ACYA 5IZHA 4ILLA 1UL3A 1LK7A 3TVYA 3H8YA 2RS2A 1HPZB 2E44A 3DLEA 4YFUA 4PPZA 3I0RA 5I42A 1SKSA 4ELVA 3C3LA 2HHWA 3DRXA 1IQZA 4I68A 3CD5A 2ZJPQ 3KOAA 3DYAB 2XULA 4AL6A 2DG9A 2XP5A 3SCKE 4JFLA 4QJVA 2BXJA 1ITXA 5HMXA 2CZ4A 4QIBA 3CMAS 1V9OA 1W1VA 2HHQA 4CO1A 3CHFA 1T3OA 4RBUA 1O6IA 3IA0A 2ZJQQ 1W2BR 2AD9A 2EFNA 4TY8B 3D28A 4DV7F 5J2QA 1DTQB 1E6VA 2D9OA 2VA2A 4DSIA 1FJ7A 2KI2A 3KYLA 4QT2A 3WX4A 3VALA 5MLCV 3H5SA 4C2MA 5JVGQ 1XTZA 2VFUA 1CQMA 4DOZA 2R7QA 4RZRA 3HZEA 2QSWA 4WTYA 5CXTA 4WKHA 3ENWA 4LFAF 2RRBA 5KFQA 5LXYA 2DNNA 4MK9A 1FRLA 4ETXA 1NEEA 2RQCA 4TXSA 5C25A 3IKGA 4LFBF 2A3CA 5KFOA 2QEXS 4N56A 1LFWA 4ZMMA 1H6KX 2DSVA 1FXRA 3MXHP 1PO6A 3HVRA 3NAIA 2XP3A 4RW4B 3VTIA 3KADA 2F8MA 2NSCA 2YVSA 2DK2A 3BM7A 4HBOA 1QUPA 1HBOB 2XMKA 2KT2A 4MFBB 2HS3A 3BGUA 4CT8A 1NJXA 2LPVA 2CPEA 5H1SV 2DGTA 3HX9A 2PPOA 3NGKA 4JI0F 2RU9A 3G6VA 4FN5A 1P27B 4I1TA 3WD3A 2LXIA 1KQFB 2DH7A 4Q8FA 4G1QB 3D0HE 1OPIA 5BYQA 3OV7A 1RKIA 4ZVGA 4IQMA 1WTBA 1Y9OA 4WK9A 4ID5B 1SL1A 4NZ7A 3ISNC 1UVNA 3HMJG 2R8IA 4MIWA 2OD6A 4ZPBA 1VC6A 4YDDB 1ZOTA 2HGLA 5KG1A 1T05B 1HW8A 1RTDB 5A0YA 4C8MA 1B7FA 3PX0A 2OKQA 3MMJA 2HIQA 4OI2A 1UKUA 2XMMA 1IR0A 3O1LA 4JYSA 5KFIA 4QWCA 4F3QA 1SH2A 4U6PA 5HBMB 4ODNA 4AFFA 1VQ7S 1HQEA 2HAIA 4DWSA 4N76A 3LOUA 2AYMA 1ROFA 4RNHA 4HLBA 2DHGA 2LA4A 2FLPA 1K1SA 4HDGA 4WU2A 3B8HA 1UA1A 2BANB 3O5IA 2ZVSA 5G0RA 5CQGA 4FAPA 1UAWA 3MM7A 1DRZA 2RUDA 1CG2A 4Y3CA 1FRIA 1Q4RA 2LQJA 2ASDA 5E3CA 2KJVA 3MD3A 3LGMA 1ULRA 3I9V9 2W7PA 1VMBA 4NRUA 2M7SA 4LSNA 1S6QA 3CUNA 1ZBWA 4X65F 2JC1A 2Z0GA 4EUVA 4K50A 4A4JA 5CCMA 2HHUA 1JLGA 1KVJA 3HHLA 3ISND 4DR7F 5JXSA 4IG0A 4KJIA 1HMVA 2DCUB 2DNKA 3OXFA 2FDNA 1YVFA 1C0UA 4ED6A 2GHVC 5KG0A 3K0JA 2YBUA 5HL7Q 3F44A 1TKXA 1RT3B 2WCXA 4PCQA 3EZUA 4LAYA 2XZWA 4XPEA 2DT3A 3BQ1A 1NKBA 3M2RB 3RB3A 4IFYA 3PR5B 4ITZA 2PMHA 1MROB 1D9DA 5HP1A 4CCHA 3B8SA 3BF4A 3PJXA 3UI6A 3CB4A 1IKVB 4A8KA 2VG5A 2MY8A 2EFQA 4IH5A 4Y0FA 2QA1A 4MK8A 3AQUA 1N52B 4MKBA 3KG1A 2XNQA 2RH3A 1RTIB 4ES3A 4AE5A 2B9YA 2PBCA 2XGQA 3I56S 4DUZF 4DWIA 2CIMA 1JJHA 2XPAA 4OX7A 2M8DB 4TYAA 2Q6CA 4O4GA 4DSJA 2NZ4A 1RK8A 5HT1A 2DNMA 1BWEA 1U47A 4KE5A 5J6EA 1UJ4A 4Q22A 4IOAQ 5DIVA 3H59A 3ZZUA 1YI2S 3KAHA 1RT1B 4Q2LA 4X4PA 4RNOA 2YQ3A 1I1GA 5CZXA 1NH7A 3KHLA 2MZSA 2YNHB 2XS2A 2IM3A 4PXBA 4IRDA 1A7XA 1S1VA 3N4WA 2E1CA 3GYXB 3FZ2A 4D3GA 3H98A 1HXVA 1BQMB 2G13A 2IRXA 3ENVA 3M2UB 3M6VA 4KHMA 1FESA 1PSDA 3H2VE 1XBWA 1TCOC 2BA9A 2RKIB 3HVTB 2P6SA 1S1WB 2Y1RI 3MM5B 2K7KA 5HN0A 1E6YA 5KFPA 2W9CB 1W1YA 4Z2LA 3B9EA 3RW7A 3U02A 2WRMA 1JLQB 3D1OA 3DLLQ 2JLGA 1F2GA 3H5UA 2DTJA 5L38A 4FF2A 1E6PA 1UJ5A 1C2PA 4N47A 5KFRA 2M2AA 2DSWA 2F9JA 3UF8A 1SUQA 1HNIA 2MLYA 5L8RC 3ALGA 4DR3F 3PW5A 3KHRA 1TKDA 4Q43A 1JKHB 1JNSA 3U27A 1HYSB 3OL9A 4ID8A 1NMVA 1TVRB 2L9NA 4EZ9A 2G8ZA 5FD1A 1BL4A 1Q53A 4O23A 2FJVA 1JJ4A 2BW2A 2C3UA 3BN4A 1S1XB 5IQQA 2DT2A 3CH9A 1FE4A 2SXLA 4NLYA 5F0UA 3H40A 4DSEA 1V3SA 3HT3A 2B0GA 2GQCA 4C97A 2RDJA