4ZPTR

Structure of mers-coronavirus spike receptor-binding domain (england1 strain) in complex with vaccine-elicited murine neutralizing antibody d12 (crystal form 1)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
208
structure length
208
Chain Sequence
VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRFLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluation of candidate vaccine approaches for MERS-CoV
pubmed doi rcsb
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
molecule tags Viral protein/immune system
molecule keywords D12 Fab Heavy chain
total genus 52
structure length 208
sequence length 208
chains with identical sequence S
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4zptR02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zptR01
2GHVC 3SCLE 5DO2A 3BGFA 3SCKE 4L3NA 4QZVB 4KQZA 4KR0B 3SCIE 4XAKA 3D0HE 4ZPVR 4L72B 3SCJE 3D0GE 2GHWA 4ZS6A 4ZPWR 4ZPTR 2AJFE 2DD8S 3D0IE
chains in the Genus database with same CATH superfamily
2KRBA 4C02B 2ZDOA 2ALYB 1FJDA 4JFKA 1VIOA 2M52A 5KFGA 2W2OP 2DVIA 2VBXA 3GTYX 4LQ3A 1H7XA 2RSEA 1KVKA 1YJTA 2WOMA 6FDRA 2FHJD 3FFIB 5EN1A 2AU0A 1FXLA 3OSPA 1V3ZA 2HGMA 4FZVA 2D7SA 3W1YC 4LMZA 2MNTA 4C4WA 3UI4A 3HHNB 5ITHA 2J9CA 1ZBTA 2HHXA 1WB0A 2J76E 2WVFA 5GMDA 4ANEA 4NYOA 2F8MA 1HNWF 3I87A 4DRPA 2CXEA 2MZSA 4RKUC 4NNRA 3AD7C 1T11A 2W2QP 2YX1A 1HBNB 2MZJA 2DGQA 4KO0B 3FMBA 1H3DA 1BQXA 3S01A 3CXCR 1LW0A 2VPXB 1XNQF 1BXNA 2LKNA 1UFLA 1M5YA 1MU2B 2NREA 2IRUA 7FD1A 4CT8A 2RRAA 4LAYA 2NSCA 4ZVSB 3R5GA 2PI6A 5A2QY 1CJKA 1ZBKA 2VOOA 3JQMA 4MH8A 2W9AA 2NXCA 2FB0A 4LIWA 5AXKA 2JEGA 2HQFA 3R6GB 1N34J 4K2XA 1RT6B 1ZCNA 2RJZA 4IOCQ 4G1PA 3MPYA 1C1CA 2L41A 2EC0A 4Q7NA 1B0PA 1VQ7S 5B0DA 3VAMA 3ET6A 2WBRA 4L6V3 2EFGA 3MECB 4C98A 4F7VA 4NLTA 2LEBA 3CJ0A 2UXCF 2C2KB 4AL6A 3DOLA 1HA1A 2BEFA 5D6GA 1TVRA 1UJ4A 3OFFA 4O4GA 4FYVB 2CQ1A 5HN0A 3LQVA 4BDPA 3O5LA 1H0HB 2PGCA 4IFYA 1KR4A 3M30A 4DL2A 1RT5B 1XWLA 4M95A 2EW9A 2BVZA 2GVZB 1R43A 3DOKA 3W66A 1KQSR 2FY1A 3MEKA 4PWDB 3WL1A 2EKNA 1C9HA 2FDMA 1S1VA 1U24A 2RF2B 2QLXA 2RQSA 3IAM9 3QGPA 3VQSA 1YQHA 3ZZUA 4UY85 2D3O1 2RKIA 1B3TA 4Q2MA 4X66F 2B4OA 3CD5A 3UF8A 4I2QB 1CBKA 1J5OB 3J81U 1QSLA 1PBUA 2DIVA 3OHBA 3V81A 1PC5A 1U1RA 1K0VA 4J4NA 1FRXA 1Y5IB 1WHVA 4PG4A 2DCLA 4ZHRB 5HVFA 3D6HB 2ADCA 2FJVA 1VDHA 4YS2A 1N6QB 2HFOA 3KXDA 1XIQA 1SBRA 2ZNYA 1J5EF 3CDUA 4JUZA 3ARQA 5CAAA 5J1EA 3GG1A 5DM6Q 1T3NA 1APSA 1RWKB 4USVA 1M5SA 2B6AA 3IXQA 2FQQB 3JXOA 2G8ZA 1C1CB 2GW8A 3TJ9A 4NLGA 2PBCA 2F4FA 3HI9A 4RBUA 4H54A 4X4TA 2CQCA 3C14B 2GVDA 2AV5A 2ZKTA 3EXYA 2GAGC 4LRFA 5AXLA 1DTTB 5IQ6A 1WAWA 5L46A 4Z2IA 1PGZA 2RNEA 2HBQB 4XDDA 4BLGA 1C1BA 2YQ0A 4P8WA 3DU5A 4JI1F 5HVGA 1LWEA 2HQDA 2ATCB 2ZQVA 1IKWB 2QLFB 3CNQP 3F41A 4IH5A 4KGZB 1PJ6A 4OYOA 2J6SA 3WQWA 2OTLS 2DB1A 3RRKA 3PX0A 4DSJA 3J7AN 2Z4PA 2HBZB 3AD8C 3BMBA 2C1EB 4RW4A 5GPGA 1R31A 3DDIA 1X4AA 1TELA 1UPPA 2LFVA 2GAHC 2OKQA 2XP8A 3QO9A 2HNDA 3TVKA 3ZFVA 4CYUB 1CEZA 2HW3A 4R5EA 5KFLA 4NX9A 4ZVHA 5KOWA 5LOQA 1M5OC 3RR7A 4MPKA 1CSJA 4P8XA 1EQMA 1SC6A 1YJRA 2C2OB 2VICA 2BX6A 3TNVA 5C2CA 3EXCX 2HWTA 4K5RA 3ZNJ1 2UUWA 5KT3A 2APOA 2XY6A 1IM6A 3S1TA 5IC4B 2I6WA 4W90B 4RUAA 1H73A 2GGPB 1WEXA 4WYLA 4IOAQ 5AE2A 4DUZF 2R7OA 3HSJA 4DPUA 2NLWA 4JYAF 3J81j 1QAIA 2COLA 4JBCA 2P9EA 1ULRA 3MMBA 5D3GA 1KHVA 2FZCB 4DQPA 1S77D 1U48A 1SH2A 2MQLA 4YB1P 2OEMA 1YZ6A 4CNZA 3H5YA 1QVGR 4I68A 3M8QA 4KH0B 1FRHA 2DNMA 4C9DA 4ZVQB 5T7LA 4O3RA 2YPYA 2K3IA 2BANB 1XC9A 2EEYA 3QAUA 3D68A 1VQPS 1C1BB 3ZZRA 1JX4A 2DO4A 3QJPA 1F5CA 1ZA2B 3DHWC 3D54A 3DU6A 1OIAA 3HULA 5F0UA 2OAUA 1O0PA 1ACMB 4NLOA 3P49B 2MZQA 1HJXA 4GO7X 3L09A 3J7Z5 1EHNA 2C42A 4TYOA 2IVMA 5FIIA 2VG5B 2ZJPQ 2FVPA 4I67A 1S72S 3GSDA 2V4QA 2VFSA 3N6LA 3KMSA 1WG1A 1ZYQA 4JV2A 2L9NA 2QMWA 2VC0A 6AT1B 1TK5A 1KKHA 3O8WA 3PW4A 2B7CB 4YUDA 2DT0A 2AJ2A 6FD1A 2XEXA 4FAPA 4JFMA 1MWQA 3ODKA 3GIKA 3PEHA 5EHHA 2W24A 1N36J 3CO9A 2EFVA 1F8AB 1N32F 3KADA 1S9GA 2M7SA 3M2RB 1RE1B 1N88A 2JDJA 4IDKB 4IKAA 3GR0A 4ZPAA 3Q8QB 1YRUA 3I0RA 3JTNA 5EX0A 2OPSA 4P10A 3O5GA 1GXLA 1NDLA 3FZBA 1SIWB 3HHKA 1FX4A 3PW5A 4KH1B 2CPYA 4Y65A 3GFYA 3GIJA 2UUCJ 2M2BA 3MF5A 5LSLA 3R97A 1ZBVA 3UI6A 3TC5A 1VQMS 5GAEI 1VISA 3MWBA 3P5BP 3UI5A 3U1LA 4R8UB 3DRRA 3FXYA 1NJXA 4LSZB 1XEZA 4I7FB 5CCMA 7FDRA 5L1KA 3JSBA 3PO5A 3PZPA 3LPYA 4L76A 5KFXA 3CHCA 3OTDA 3MUVP 2DK2A 3KG1A 1S1TA 4NEZA 3VGVA 1VRQC 2ZOGA 5MAOA 4ED1A 1IBCB 3A8IA 2DGSA 3HF5A 2LA4A 2EC2A 2HNYA 3R5BA 1UZDA 2CPJA 3J80Y 1Y3JA 4OJ3A 1BKFA 1LWCB 1RWWB 2XYGB 4FPIA 3HVRA 1BQNB 1ZZNA 3I5CA 1WD6A 2P5VA 5KFRA 4J9SA 3B7XA 4D3GA 4ECWA 3M7VA 1IBMF 4LAVA 2GMJA 3TQEA 2UUTA 2VD3A 3KK2B 3H4BA 1NK8A 2H51B 2QGFB 3MMCA 3VTIA 1AROP 1KLMB 3CJ3A 5F8LA 2JWNA 4QT2A 1N5YA 1FXRA 2WBMA 3BF4A 1B6CA 4ECYA 2ZOMA 3ARZA 1C0UA 4ALZA 3LW5C 2ADBA 2Y9HA 4LR9A 2OMOA 3MAHA 3AA8A 5KFTA 1SC3B 4A8YA 4TLQA 2G13A 2ITKA 4G50A 4OI2A 4XK8C 2QC3A 3IKDA 2XULA 5SUHA 1JLCB 1UJ6A 1R89A 1TUGB 3PRVA 1UL3A 3MEEA 1OWQA 1K9TA 2DSWA 4IG0B 4IFVB 3TYTA 4OYAA 5SZTA 3NRKA 1HNWJ 2G9OA 2Y1JA 3MMAA 2HHSA 1JNTA 2C3YA 2G1HA 4RW6A 4DX8H 3LUOA 4CTAA 5DS7A 1S7HA 1RTZA 3QOKA 2DH9A 3IHZA 1RWPB 4J5OA 2HLUA 3ARUA 5DZ6A 4LF8J 2FLLA 4B3MJ 5DIVA 3QZ7A 1VIXA 1Q7LB 2VFTA 1SL0A 2MHEA 1RLDA 2MKJA 3C2PA 3I5BA 4UDMA 5L8RC 4YR0A 1UWBA 1FRIA 1HQEA 2KDOA 1RWVB 2HZCA 3SXLA 3OTCA 3CHFA 4DN9A 2A3EA 3MMCB 1LXJA 1HNIB 3BGRB 3Q23A 4Z2HA 3KLFB 1WDTA 2H5JB 4DSIA 2X1BA 1RT3A 1HBMA 2H48B 2RE1A 3IRXB 4YQWA 3HHDA 4DI6A 3C46A 4B08A 3RB4A 1S10A 3FQKA 4F25A 4KQZA 1E6YB 3MPWA 3O2IA 3WC0A 1JNEA 2QJ3A 3EWGA 3R1HA 4ODLA 2BKPA 5E3QA 2XMKA 1HWUA 4K4WA 4K5SA 2ZH2A 1G4CA 4IFVA 3KHHA 4ECQA 4DV5J 2HHHJ 2M08A 3KHGA 1UP1A 3JYJA 2YTCA 3SCJE 4J9NA 3FY1A 2DEIA 1NK0A 3MMAB 3CZ8A 5HT1A 1FEHA 3QT5A 3LWLA 3MUMP 2VBYA 2FHKA 3BSAA 3ET6B 2YH0A 1D7HA 1WHWA 2GIFA 1NPPA 4O4RA 1FD2A 3Q0AA 2PEBA 5J2QA 4ZP9A 1YX2A 1D3WA 2PFDA 3HVTB 5DITA 2W7PA 4CQ1A 4B3MF 2LVWA 5KT6A 1L1PA 3M2VA 2WSCC 4NLWA 1XMQF 4Y34A 2RU9A 2RSQA 3CCTA 1W2IA 2J9EA 4PG6A 2GVZA 4LQ9A 3DKDA 4O3NA 3W65A 1YITS 2R7VA 1LW2B 1KRPA 5KG7A 2L48A 3B82A 3AFGA 2VFRA 4M1KA 4PPDA 1E6NA 3SQGA 3UN5A 2VDIA 5AJ3F 4EWTA 2D9OA 3EVOA 4Q44A 2K7JA 1BL4A 3FCWA 3VAWA 3I4PA 4DZ2A 3PKMA 2DHXA 4X84A 1J5OA 1WNOA 2J7UA 4IG0A 1GMWD 3UW1A 1ZB5A 2B4PA 2DG3A 1NO8A 4RJVA 2LA6A 2V9WA 2RIJA 3RJMB 2AOSA 3PXGa 4AY1A 4FS2A 4ED2A 4ILLA 1VFJA 1JJHA 1NMEB 2BBEA 3M1VA 4KPCA 1T9UA 1NK5A 1N6QA 4LAXA 4UUWA 3PVXA 4DWIA 3NCRA 4QWCA 1RCXB 1Q6IA 3DRXA 2WW4A 3AROA 4ZPBA 2AF6A 2I38A 1LQ0A 1N5YB 4LF5J 4OI6A 3SEOA 2CJBA 4EI2A 4B3RJ 1K44A 2PDAA 4JI0J 2GIQA 3OFEA 5A8RA 4I6WA 4UW2A 3TW0A 4E98A 2FC9A 1R8BA 2B4VA 3QAEA 3IGNA 1Q82T 1ROUA 1Q8BA 2C2NA 3FJ2A 4CLWA 5L1LA 1X60A 3ZTSA 2FLNA 1HPZA 4JV5F 2JC1A 4KJIA 1TAQA 1YZ7A 3CJ4A 1JLFA 2CVIA 2KN4A 3KLFA 2NR0A 5L38A 3B8HA 3LTOA 1REVA 5KFUA 4EZ9A 4WJXA 4J9RA 4A8MP 4NLXA 3TO8A 5HAOA 1DQ8A 2QA2A 3I31A 3EGVA 2NZCA 3RAMA 3TAMA 2GMHA 4DCOB 4K4XA 2EWHA 2V34A 2YWHA 4QIWD 4AT1B 1NJIT 3ONQA 3KAGA 2VDHA 3QIDA 4N8NA 2XZWA 2VL1A 4X62J 2XMAA 4G2PA 3PR9A 3CWJA 1P8GA 4DL3A 3GJRB 3UD4P 1FJGF 2WCXA 1A7GE 4Q7AA 4Y6IA 4H4OA 4R5PB 3MOZA 1REGX 4BCAA 3TZYA 3OHAA 2ZH9A 4HARA 1F9FA 3CCSS 3D5MA 4CCHA 1FDNA 2BJ1A 4GKKF 3SV4A 5J2QB 4DFJA 1LKZA 1HIYA 1RT7A 4HT7A 4LRBA 3HMJG 2FLPA 2DT3A 3BO4A 3WQPA 2Q6BA 1BQMB 2BJ7A 2QYCA 3R9LA 3VWSA 1RI7A 3GIRA 4YOEA 3V6KA 4URGA 2Q3PA 1ZM4A 3LALA 5H1SV 5HK4A 2CJ9A 5GAGI 1KP6A 4TN2A 4JOUA 3CCLS 1CJUA 3CCJS 2A3BA 4URIA 4LSLA 1U49A 2D3OR 4DL7A 2K06A 1NJZA 1XN9A 4NXNF 4O3PA 4DCJB 2OPPA 1DBDA 5D8HB 1W9PA 2PO4A 3PDNA 4Z7YA 5KFKA 2V2KA 4X2BA 3Q8UA 4Z2LA 2E29A 4JI0F 5J2PB 3MUTP 2DR5A 3BZQA 3KFWX 3MHYA 2EXUA 2QLJB 3MFIA 1NJWA 4QIGA 1UW4A 3I9ZA 2DR9A 2D69A 3O5OA 4LGXA 3I6PA 3PR4A 4B3SJ 2DHSA 1YG0A 3HVTA 1RKIA 2G41A 4W98A 2RILA 4X4OA 3UVJA 3UCZP 3M8ZA 2R8HA 1FE0A 2Y0SD 1YSJA 4L72B 1NH8A 1OJ4A 1YWXA 3V6DB 2F4EA 3I4HX 3OPKA 2QSFA 3KK1A 2V2VA 1FKFA 2HEKA 4U8YA 4OL8A 3MM9A 4G65A 4DG1A 5JJBA 2CZ4A 1FT8A 1HI8A 1GT8A 2GVDB 3GJQB 1QAYA 2QTWA 1VBKA 5KFIA 5DDPC 3OUYA 4K4YA 3LGNA 4AQYJ 5FJ4A 4AD6A 2LYVA 3O5DA 1JLFB 3AOCA 2QL5B 4UOHA 3ZTOA 2QFJA 4UY8T 1RT4A 3PEJA 1VHFA 2KHCA 3DLGA 4ZJLA 1HHTP 5CHCB 2ZR5A 4ICLA 4RNFA 4G1IA 4IO1A 4QYRA 3JB9k 4JI2J 4GKJF 1M0SA 5KFBA 2UXDJ 1MLAA 3H25A 3TUZC 4MSPA 5KFYA 2IM3A 2IMOA 2OI2A 5IZHA 3KACA 3EGNA 5HJYA 2O5DA 3CIZA 5DJBA 2XNQA 1D9FA 2AEFA 2XMJA 4O44B 4B17A 2XO7A 1DQAA 4DQIA 3KOAA 5BXIA 2ZFHA 2VG6B 4A4JA 3RB6A 1LNQA 4QPTA 5KG1A 4LF8F 1MMDA 2I9SA 4RW8A 3C15A 3IWXA 4MK7A 1JLAA 4ZPTR 4AXIA 3C6UB 4PCQA 4RLEA 5B7WA 4YR3A 1FESA 2HKEA 2J0WA 3NBPB 3MDYB 3P6YC 3CW2C 3NS5A 3RM4A 2JVRA 3T1HJ 2PPOA 1FKTA 1MW7A 2DNHA 1WG4A 2N4CA 2KM8C 2QRRA 4MKAA 1Q1CA 3TZZA 2XP5A 4EYHB 4DBQA 1D8ZA 4QCLA 1AFJA 5DG8A 4I69A 1VMBA 3ITHA 3KJNB 4NCGA 4CO1A 3G4SS 1ZBCA 1JMTA 4OHVA 2OUGA 1JLCA 2CDQA 2W2PP 2XLIA 4XPCA 5H9EK 2MMYA 2J0QD 2AMCB 4P8VA 2D9PA 2YX7A 3IKGA 1NMVA 1SH0A 3CT9A 3OL8A 1NK7A 1I94F 1VQ9S 2XP9A 3MGJA 3UPFA 3FSIA 2MQNA 5IT0A 2FAPA 1MWYA 4HKQA 3DLLQ 1PKUA 2M9KA 1R3NA 4IQ2A 2IAJA 3N0VA 5F0WA 3E01A 3TX0A 5DLFA 3EGZA 2CQPA 3GQCA 3D66A 3TZXA 2P9CA 3RBEA 2LMIA 4WIQA 1WTBA 4O44A 4I2PA 2BRKA 2CQ3A 2HRYA 2PD1A 2CA9A 3H42A 1X6LA 2XS7A 3ISND 1B7FA 3DGPA 3CCUS 1U4BA 3TRGA 1IVZA 1Y10A 2PIIA 3GE9A 4DUTA 1X31C 3W9JA 5K20B 1Q4RA 1RADB 3MM7B 2IYIA 1C2PA 4LJMA 5CABA 1A7XA 3O5TB 4J9LA 2BKOA 3FBFA 2AX1A 1SPBP 3H5UA 4ELVA 1HMVB 4ZOSA 3W2WB 1QLNA 5K5MA 3HHEA 2AT1B 3PR5B 5C42B 1HBMB 2VH7A 3IRXA 2OHDA 3KLGB 2NSBA 3N28A 2KR7A 3TP2A 4OI4A 3TAPA 1HQUA 3IFEA 1VC6A 1SYTA 2CYYA 2VG5A 3IWLA 3GCXP 5H9FK 5CD4H 3TANA 3DLEB 2V4RA 1TMJA 4QPXA 1EJ7L 2YKNB 4PWUA 3SDEA 3L3CA 1QZ2A 2RAQA 3FGVA 3NGSA 4UOFA 2MQQA 2ZQUA 2LP4A 1YBUA 2XMMA 3Q8YA 5DG9A 3LH2S 1CVJA 5RUBA 4F67A 1TCOC 1K1QA 5KFMA 3IM9A 4OZNA 3VHQA 3VAKA 4OFZA 4GKJJ 5HLFA 3ARVA 3D3CJ 4IDKA 4KFBA 2K8IA 3AY0A 5HW6A 3FFIA 3HJVA 4OX9F 2FZKB 3G6MA 4PR6A 3W5ZA 1RKJA 4USUA 4DG1B 1JLAB 5E0OA 1SJRA 1EETB 1SJQA 2DNGA 4ECTA 1L5UA 3K58A 3SZ2A 3FVYA 2XCPA 4KB7A 5IT4A 1SKWA 4B9TA 4PZVA 2Q66A 1LWXA 4O4GB 5KFZA 2PN0A 3S6EA 2KU7A 4JV1A 2E1MC 2FJAB 2XP4A 5D77A 1ZM9A 2CQGA 4DV2J 2ASLA 1RTDB 1KOOA 4RW7A 4PG7A 3I6CA 1Y0OA 3W5YA 2VJVA 5CZXA 1YJUA 5EUHA 1UPMB 1VQ8S 5KT5A 1FI4A 2MQ8A 1VRTB 2ZBPA 4IT4A 5L39A 2C2EA 3H7HB 1KFWA 3TJAA 2XP6A 1YHQS 1GUVA 2FJEB 1J27A 1NH7A 3LANA 3ARYA 2OFGX 1BWVA 2W01A 1X4EA 1AT1B 4ZPDA 5C5JA 5KFNA 2RQCA 4TLRA 3RBZA 3G6XA 2R2SA 1RJJA 3C3LA 4N77A 1W25A 2POKA 3VQTA 2CPFA 3K5OA 4B9VA 1Y0HA 1DAXA 4DU7A 2PC6A 3WX4A 3GIIA 2VPYB 2G0CA 4V1Ak 1PAEX 3M9NB 5I3UB 1TR0A 1HKJA 1VI7A 3CUNA 2GCFA 3SMZA 4DN0A 1W9UA 5F3ZA 3M8RA 3JYTA 3UNGC 3M30B 1RGVA 1U79A 3CSKA 3MM5A 5IS2A 2PSZA 3T6BA 3NGDA 1NHUA 4J7CA 3JSMB 4JI4J 1NUEA 1JLGB 4QIVA 3UFCX 4F2RA 1XR7A 1TL3A 1M5PC 2OH2A 1CC8A 2HFVA 4DR6J 4KTQA 3RBXA 2CKWA 2WM0A 1HMVA 2ALZA 1IKYA 3QGIA 2OPRB 2LU1A 1QD1A 2RUSA 1RB0A 4ATNA 1U6ZA 5C25B 1R8CA 2RVJA 5I42B 3RB3A 3DM2A 4USKA 4RPFA 4OX9J 4OZ2A 2DGOA 2DG4A 3P3DA 2MZ1A 4QWDA 2BE2A 4XTTA 5CXTA 2KZMA 4NYZA 2PI5A 2DEJA 1WC1A 2IHR1 2V68A 1D09B 1F2HA 3EVMA 4PKDB 2LDIA 1J4RA 4ODQA 3I82A 1G3OA 5HO4A 2ZQSA 3D0HE 3BSNA 4RBTA 2ZZNA 2CZ9A 3DXBA 3R3TA 4OQJA 3BXWA 4CRJA 2HHHF 2F4VF 4ZK7M 2CJKA 2XS2A 1YDLA 4BHQA 3AA9A 2YKOA 4MKVA 3GR1A 4IT6A 4ZN1A 5ETOA 4NXMJ 2MQMA 2MYFA 4ZCKA 2VPWB 4F2SA 2UXBF 1PG5B 4NWBA 2K3KA 4R0JA 4I1TA 3SFUA 5HROA 4ODPA 1LQ9A 2KL8A 2LXUA 4HEA9 4PQUB 4JI8F 2O3DA 2DPJA 4NLRA 1UAWA 1RWXB 2MSSA 2OMLA 4FKXA 4DJBA 4ZIVA 2C3OA 1AYEA 2OGUA 3MM5B 4CZCA 2CQDA 2YY3A 3SIPB 3VAHA 4OYPA 2DYAA 2NPFA 3TZWA 4DV0J 1RAGB 1FJEB 2RU3A 3GIMA 1IJFB 5ETTA 2XPBA 5D4NA 1G7CB 3BBFA 4CM0A 1VQLS 4WP8A 4ECRA 4WKAA 4CO2A 1DTQB 1LV5A 5BXJA 1PBAA 3F56A 5KT7A 5CYQA 4DFKA 4LFAJ 1O6XA 1WACA 4IQXA 2DXFA 1MN9A 2DNPA 3K17A 1WSRA 1TL7A 3DGVA 4QOTA 5D4PA 3CCQS 3UN3A 2GO8A 5DG7A 4X4SA 1MROB 2UUAF 2PEHA 1GTHA 4NCBA 3EZUA 4DV1F 2ZVIA 4Y2CA 3OL9A 2MHNA 2KFYA 4WF9Q 3BS9A 3M1VB 4IUFA 2G2OA 5E3AA 4NRTA 4WFYA 3V2UC 2E1AA 3CJRA 3THTA 2B4UA 2NXNA 5I3UA 2H1YA 3T41A 2FC8A 2F9JA 1R0AA 1DY3A 2IC3A 2BA9A 1N0UA 5CZVA 5KFQA 3CULA 5DQHA 2AYEA 5FLXY 1S1XB 5AJ3J 1U1QA 2J0XA 1D1UA 2CPXA 3LP0B 3CGIA 4CLZA 1NZAA 4XPEA 2R7XA 2E7WA 4LRAA 2BMBA 3M8PA 4DZDA 4WFZA 2DR7A 4R25A 1EKRA 1S99A 1G1XA 2KYZA 2P4VA 4HL9A 3HJFA 1S1WB 4U67Q 1RU2A 3MD3A 1AA1B 4N47A 1VLOA 1B0VA 3AJDA 4WXOA 3BSCA 4J9KA 4DR4J 3HO1A 2A3JA 3KK3B 4FYDA 5LMNF 4UZCA 2C2RA 4YB6A 4USIA 1LEOA 2ASJA 2LKZA 1Z2ZA 4LR7A 4NLSA 4QJVA 5LMUF 1FKOB 1T9WA 3DYAA 3A8EA 2ZR6A 1MN7A 4GMKA 4KGXB 1Q78A 1U26A 4QR0A 3BPSP 4ZMMA 5C7PA 2IRYA 2JLGA 3HSDA 7AT1B 1CJVB 4KR0B 2YQ3A 1X4CA 4O3QA 1FKPA 5ETLA 3W8PA 3KAHA 3KK2A 1QAXA 2ZM6F 4PQUA 5F8JA 3DFEA 5I42A 3ARPA 4KKOB 4RUHA 3AAWB 2Z58B 3RZAA 2WK4A 1L3KA 1U25A 1OPIA 1SUQB 4PTMA 1IN0A 1BE4A 1QUVA 1S6OA 2LQ5A 2V8VA 3GFZA 2DXDA 3PCOB 4Y28C 4FF2A 1LW0B 1T3OA 2OEJA 4FXWA 4ZKAA 4I7FA 4X4RA 4PQAA 4K7QA 2VFUA 3DRRB 1B64A 4U7UK 1X8DA 1ZAXA 3PRAA 5AXMA 3MM8A 4CLYA 4C11B 4ED7A 3CC7S 3CD7A 4MAVA 2YPZA 4NZ0A 1KFSA 4CLSA 3QIPB 4K4TA 3V6HA 4OIXA 1YIJS 1CC7A 1FJGJ 2B51A 1NZ8A 3NOGA 3M6WA 1QSSA 3MXHP 1MMNA 4WJBA 4QW9A 1SJ1A 3AS2A 3D3BJ 3WD4A 4ZVEA 2ZWOA 3NKYA 2HVEA 4P2XA 5J1NA 4OZ1A 1T9VA 5EWEA 3KG4A 4WCEQ 1WF2A 4ZPVR 4IQMA 2AGOA 4ERDA 1WEZA 2QA4G 1FK9B 1YKWA 2ZHBA 1IKVA 1Q79A 3NCPA 4QW8A 3D6MB 2RURA 4F04B 2GJ2A 2QYGA 3Q24A 1VQKS 1DFDA 3R5DA 4E2FB 2N82B 2IA6A 5CA5A 3Q22A 1HWKA 2WONA 5BR8F 1S1VB 2ZR4A 3MM9B 4RX6A 1GFWB 1UEKA 2E1PA 2H54B 1Q81T 3ISZA 1UVJA 5C42A 1F5BA 4YB5A 3HVAA 3MEEB 3MZIA 2Y8YA 1XHGA 1QJHA 3H98A 4Z7CA 1XMQJ 1S6PA 3KHRA 5HW7A 1RACB 4ZLJA 3DLGB 2MJUA 1NK9A 4KGVB 1X9MA 1H0GA 2ESCA 1NWRA 2MLZA 1OPZA 1WHXA 4DL4A 1G6BA 1H2TZ 2R7UA 1WC0A 3OXFA 2CWKA 4C8KA 3T1HF 1R8AA 1QSYA 5HUAA 3OLBA 1EHWA 3FK4A 2XPAA 1PINA 3KK3A 1S9EA 2H5EA 2F4VJ 3NNCA 3H59A 5HLFB 4MK8A 1JB0C 1E6RA 2HSEB 2ERRA 1B4SA 3BR9A 4DV6J 2CG8A 4A8XA 2IC3B 3QGHA 4N8OA 1VK8A 1WNEA 2VASA 5J2NA 3CCWA 4QU7A 1LFWA 1P9YA 4W5UA 5IXUA 5U47A 2FHOB 2NQPA 1Y00A 4RL1A 2J5AA 1DRZA 1FKPB 2DRBA 2YBVA 3NL0A 3FBCA 2KI2A 3TA0A 3PACA 3FRYA 3ALGA 2KE0A 2UXDF 4KHPF 1GXTA 3Q8PB 5E5NA 2MGZA 4ZHRA 1ZU8A 3KUHA 3PIOQ 1WHYA 3RM9A 1UCNA 5GMKa 4U85A 2RS2A 4DR2F 4GKKJ 1NHVA 2W9BB 4CLUA 2KGJA 5D0RA 3G82B 2ATLA 5K8PA 2X51A 3MEDB 1OY6A 1J5EJ 1PILA 1TFWA 2VOPA 1TK8A 3BH6B 3J7YI 3M05A 4DV5F 3RM8A 1FKSA 2DNNA 4EYIB 2FTRA 4RW8B 2DY1A 4DS4A 4Y2KA 3O5PA 2IAJB 2W4PA 1HQ2A 1S6QB 1NBEB 5DDRC 4RNOA 2R7RA 4DV7J 1ITPA 3PW2A 3CJKA 2CQIA 1NWTA 5IOLA 4M8LA 1PJ7A 1U1MA 4TNOA 4FNIA 1W1VA 3KLIA 2GJIA 2HG4A 4DR7F 3QO9B 4TW7A 1EB0A 1KONA 4WP3A 2QMUB 3SSRA 2PMZD 3UE2A 4JFJA 1FRJA 3PG9A 4OYWA 2KXFA 4OYZA 3V4MA 3QFWA 3WDOA 4U6PA 1K9MT 3QQCD 4MKYA 1XTZA 4X62F 2KG1A 2L9WA 3F73A 1Q8KA 3AB2B 2HQIA 3HSZA 2HHWA 4ZN3A 4B9NA 1NDCA 2W4CA 2CDRB 4W4MA 1NSQA 1FWLA 2KYXA 3QT6A 2M8DB 2V9KA 4K4UA 1HHQA 2HAIA 1IKXA 3GG0A 2LCWA 3DNCA 3ZZ0A 4DRKA 3H40A 1WOSA 2OIHA 2C22A 3JXVA 1JLQA 1WTFA 3EGWB 1XMOJ 4W92B 4WZQA 1P1TA 5B09A 1AW0A 1LOUA 1YW5A 5DEZA 1XJWB 4CDIA 4DV3F 5AT1B 1TV6A 2YKNA 5D0HA 3SDEB 4MYUA 2N7CA 4F4ZA 1RK8A 3MEDA 1T9YA 3FRZA 5LM7E 5A0YB 1N36F 1S9EB 3QFHA 1Q8IA 4ILMA 5LMUJ 1M5HA 1RZMA 4A8OA 2HGLA 4R0EA 1HKMA 3JAMU 2YBTA 2ZBCA 1RHRB 3KUEA 4O0NA 5F8GA 4I4BA 2HZAA 2XTJP 2KO1A 3CCMS 4IFYB 2AKWB 2EK1A 3TUJC 3WD3A 2UV8A 4ZCLA 1VHIA 2XI3A 5B0FA 1Q86T 3UQBA 2KTQA 1F60B 1NLKL 1K8AT 3ENAA 1FKLA 1PC4A 1N1AA 1I51B 1YRTA 4ECUA 3EPIA 3ILLA 3P96A 3A3NB 4I2QA 4DRJA 1U0HA 1RU1A 3HZGA 2M4MA 3MPDA 3R7BB 3G87A 2MGZB 2UXBJ 4O23A 4ODKA 2E9TA 1WDDA 4WIWA 2KI3A 1E6VB 1BLUA 3D0IE 4FYYB 3IR7B 1J2VA 4TNSA 1K1SA 1X4HA 2CUYA 3G71S 3V4IA 1H2UX 1E44A 4FBTA 1X5SA 1ZOTA 2E5IA 1U09A 1IUJA 1VRTA 1RAOA 3KZ7A 3CE8A 5F8NA 4P2FA 1WC4A 1S49A 3QATA 3LP1A 1T0TV 2J7KA 2FKEA 1FEEA 1X4FA 1CJTB 3DOMB 3PHTA 3PY8A 1V5VA 2B8QA 2MDAA 3D1OA 2KJVA 1KS2A 2P6SA 3A12A 1EZZB 5HKGA 1HW8A 5ETPA 2BXJA 3FUYA 3UD5A 9ATCB 3EM1A 3UVJB 5F8MA 2B9XA 5G0RB 1YJVA 2GHPA 1S0VA 1LWEB 3AS0A 4J4OA 4NL5A 2LJ4A 4UQTA 4H4KC 4AFFA 2K8GA 2V8PA 2LQBA 2AJ4A 5A76A 4DV4J 3H2LA 3TCZA 2B43A 4I56A 4KBIA 5J6EA 5BR8J 2AP6A 1N56A 2IBKA 3LP0A 5IT9U 3LUYA 2KG0A 2IVYA 4P8UA 2Q1LA 3GWCA 2EKYA 1Y5LB 1IBKJ 3VCDA 2IJNA 5HSPA 1FFGB 4EBDA 2BZ2A 1D7JA 1TL5A 2OPRA 1NPRA 5ETSA 2PN6A 3ENWA 4IH7A 1GH8A 4LF7F 4J9UE 5J2PA 1KLNA 2GGPA 2DNQA 2Y1LB 4CTAB 1RT1B 2Z8QA 4TVAB 1TL1A 1ZPVA 1UR8A 2UVWA 3CH9A 3ILIA 5HMWA 5A0YA 1NKEA 4X4NA 1HNVA 3DYAB 3RW6A 1H72C 1C0UB 1WJ9A 1FKRA 3D6TB 2DRAA 3MAAA 3PO4A 4K4SA 3A3OB 5H9FJ 4DR6F 3D2WA 3BGUA 3VAFA 5DDOC 3CCRS 1HR0F 1M5KC 2WTFA 3NGKA 2YBUA 2RHQB 4IO9Q 1CTNA 2HNZB 2OPQB 5E41A 2ILYA 3MTJA 4J9QA 4ZLNA 4MKBA 5IFMA 2AEJA 5GAEU 4DPWA 3T5JA 3TARA 4F4KA 1PYSB 4AQYF 4RR5A 1EIBA 1GPFA 8RUCA 3Q83A 3EUNA 1S4FA 2FGCA 4NLUA 1FKHA 1FERA 3QT7A 1UETA 2MQOA 2FVCA 1EAYC 1JLBA 2VZ9A 1KOHA 5LT5A 2BE2B 3OTBA 5HQMA 3BQ0A 3K59A 4Y2IA 2O92A 4M5MA 4RW9B 2DBBA 4QWBA 2RS8A 4ANDA 1YJ9S 3CIMA 3J7A1 3D1QA 5HTGA 2E5LJ 1CJKB 4CH1A 1HNZF 3AH6A 2ZWPA 5KFPA 1HNZJ 4A46A 1I6JA 4P2MA 2O9OA 2KT2A 3R5AA 4OJGA 1K47A 2IJFA 2B0GA 2WSEC 5MLCV 4MJKA 1IWAA 2J8AA 3VAIA 4DLEA 3KLHA 1RT1A 4B9MA 3IBFB 2Y78A 4YEAA 4CP5A 5JVGQ 3F0NA 2I1RA 1VQ6S 2GQQA 1NEEA 1WORA 3BH7B 2GQCA 5K8OA 4NEYA 1HNVB 1T05A 4NLQA 2DY9A 1IKVB 1YRXA 2DGVA 4K8RA 3B4MA 4FXVA 1GTEA 1RHUB 2BJ9A 5LSRA 1SL1A 4MIAA 4FYWB 1UFKA 4CIOA 2YKAA 1PSDA 1RCOB 2XMWA 2HBYB 2CVEA 2YNIA 3IP0A 4TYBA 4EU0A 5C24B 2X1GA 4OYIA 2R4FA 2VU5A 2KM8B 1Q1KA 2PE8A 4GVLA 5B0EA 1RAJA 2E5GA 1VYAA 2HHPA 1S0MA 3PJ9A 3I0SA 2ZH4A 3MM6B 5GAGU 2DR8A 2H9ZA 4F4AA 1N48A 1DHMA 4OZ5A 2XSFA 3BREA 2QN6B 2JRSA 1A6LA 1NSGA 4OV1A 4M5DB 1TTHB 4V19J 1X5OA 3E01B 4ZVFA 4DR1F 3NMRA 1U1PA 3HSGA 4J9OA 1P1LA 1AZSB 1S1WA 1W7WA 1WI6A 3AJ1A 3C6UA 4DV1J 5GADI 4DRQA 4J9VA 2CNOB 2BJDA 3BBBA 1R27B 3CVKA 1FD9A 2DISA 1N32J 2Z57B 2ZD1B 3RRHA 4ED0A 4RU2A 4NA1A 3H9RB 4C8MA 3M4XA 3LA0A 3OR1B 3QT8A 2IFXA 2X1AA 1U8WA 2JZ5A 3OVSA 3V6DA 2F23A 1S1XA 1IQZA 2F63A 5IT9Y 2OD4A 3G6YA 4DWSC 2A0FB 2MKCA 1NB7A 3M32A 1UZHA 2B3TB 1TKZA 2DIUA 3KJQB 3OVBA 1MNEA 4U8VA 1IKWA 2DG9A 1WI8A 3QMQA 2B8PA 1RWOB 3AS3A 1P27B 1NSPA 1ZA1B 3L9ZA 4KKOA 2VN1A 4MTPA 1OSDA 5F8IA 3OTOF 2DPIA 4C3LA 1NH6A 4RO0A 5HBMB 2DT2A 3QLHB 2CJAA 1CULB 5E2QA 5HMYA 2RQ4A 3U02A 2VJUA 3DLEA 4GC6A 3UQSA 3G82A 4OI0A 2UVRA 4KV8B 4B9SA 4EMDA 2OLHA 3FEYB 3KYLA 4A8QA 1FNOA 2QZ8A 1W1PA 4DPTA 2XNRA 1V5IB 5B0GA 5KG6A 3K2YA 4WFBQ 2AQ4A 5KT4A 2RUGA 4Q43A 2CPIA 2Q6CA 5HI7A 4ITZA 4WKFA 1OY8A 5CYMA 4C8NA 3Q8RB 4PWDA 4Q0BA 1NDKA 1CJVA 3BM7A 3IC1A 4FN5A 4DRNA 2EI5A 3M8YA 3ISNC 1SQEA 1Y11A 4PXDA 4WXWA 5ETRA 5GMEA 3S8SA 2E66A 2RHSB 1UR9A 3NTPA 4YDXA 2KFZA 1U1NA 1I94J 3EE3A 4HHHA 4ODMA 1U2FA 2P8IA 3QBCA 2HS4A 1Q6UA 1ZL1A 4NA2A 3TA2A 4BC7A 4EFAC 4DV4F 2YNIB 4V19X 2V0NA 2HWIA 1HKKA 3OJSA 4DR5J 2IDEA 2F40A 2H4YB 4ECXA 4JI5J 1Q0NA 1X4GA 4AL5A 4CWBA 2YWFA 2G2ZA 4FF4A 1F0XA 2NYIA 3K5PA 5HMXA 4JB8B 2HK2A 4R5PA 2R3VA 3ZZOA 2Y1RI 3H2VE 2UP1A 1S6PB 3LO3A 2DT1A 1UFWA 5KOXA 1VOMA 5ETQA 4OX7A 3WBZA 2YKMA 2KJWA 3KLVA 3RW7A 4ZITA 3WKZA 3O5FA 3FSXA 3KHLA 4B9LA 1FCAA 1QTMA 5DRKA 4ED5A 1V9OA 1DLOA 5H9EJ 3GONA 1BQMA 3NWGA 4E0DA 3QGGA 4PPZA 2OFNA 3KDNA 4IG3A 2UU9J 1KNZA 2ZD1A 2G4BA 1NCLA 3R2DJ 4C8YA 1R0BG 3BN7A 2RUDA 2I5JB 1ITXA 2ZNZA 4LVOP 4OHWA 4C3KA 4UQGA 3EYZA 3QSYB 2VC1A 5LL6d 2E1CA 1NKBA 3BDPA 1HYSB 4LUBA 1LWFB 4PABA 4IRDA 3PNIA 1D2KA 3NCQA 2WONB 2ZH5A 2ZH6A 1J4HA 3RMEA 1JLGA 1BHNA 1OO0B 1RXOB 3MM6A 1VQNS 4DHVA 2VONA 1NKCA 1HXVA 2HPUA 4NRUA 3SBMA 5HVHA 3I5AA 1W9VA 3FZ2A 2R7WA 1Q6HA 3BO3A 1XNRJ 1W1YA 4MIWA 2ZZTA 2ZHOA 3TWZA 2L2SA 4LFBF 1FVSA 2W7OA 4TQRA 1BUXA 2A3CA 1AZSA 4U86A 1V3SA 1OYEA 3ZTQA 1S4EA 1ROTA 4Y00A 2HBRB 2RH3A 1KEKA 4TW6A 2OP5A 2V8HA 3AOAA 1RTJB 3EDQB 4NASA 5E3CA 3US5A 1JNRB 3W64A 3GV8B 3WIJA 1UVLA 2R8GA 1W1TA 2XSJB 4CT9A 3OV7A 4UTGA 4WIIA 2NPIA 4DPXA 2LQ8A 3I0RB 4MNMA 2CJYB 4LF1A 3ZTRA 4F36A 4C8OA 3HD1A 4OZ0A 3FC9A 5J2NB 5EWGA 1BQNA 1D9DA 5A8RB 1LG2A 1NK4A 1DLOB 2ROEA 1VF8A 4W9OA 2CQHA 3EY6A 1R6YA 3W62A 1KDNA 3MD1A 1GRJA 3O5QA 3FBBA 4HR2A 1R0AB 2QIFA 4DU8A 3KLIB 1HBOA 3ADAC 2FJBB 2V6AA 3DC2A 4OI3A 4U96A 1URRA 1N8RT 1JXLA 2L3MA 2HFSA 4N7TA 3NGRA 4NCGB 1N33F 3AB4B 4LF4F 1MU2A 3DCAA 3HHLC 1RTHB 2BQ3A 1L3SA 3Q2TC 1SV5B 1YATA 2RD5C 1DTQA 2ZM6J 4WE1A 4O0IA 1SH3A 5GPRA 5CH7B 2KT3A 1MROA 4ED8A 2UUAJ 5K9FA 1JWWA 5DLGA 2DHHA 4ZCIA 4OHXA 3ZZZA 5KFSA 3ICLA 1CQNA 1UMJA 4MFBA 3GPKA 4JYSA 2PV1A 2B9YA 3NBPA 3QWPA 1HLWA 4N19A 1S6QA 4DX7A 3DLHA 1YJNS 1ZS6A 1LL4A 4HH0A 4NZ6A 2VA3A 2WVDA 2DJWA 3IBWA 2V63A 2W2NP 4MMOA 4M94A 1XNRF 3BGOP 2MKYA 2AGQA 2DSUA 3MAQA 1D8YA 4HBEA 3KLEA 2Y3YA 2HFUA 2K2PA 3CJSA 3FBEA 4HDHA 3C19A 1KT0A 1HKAA 1LWFA 2AX0A 2V4JA 4NOHA 5K14B 2X3GA 2ZH8A 2R2TA 3ZXWA 1TMMA 1FA0A 1RYSA 4WKRA 4ETZA 2WVCA 3IBCB 2A18A 2RKIB 4ZA1A 1F3FA 5BJRA 5A8WB 1X9WA 1FNXH 4A8KA 5LSOA 2JZVA 1X6NA 1C0TA 4JI6J 4GO5X 3SI8A 4F0HA 4PYDA 1YK9A 4PWWA 2XLJA 4ZS6A 1JLQB 2MF9A 2BV3A 2EG2A 2K1RB 3W7BA 4DV3J 2DD8S 5I3QA 1NJYA 1RTHA 5CYJA 1I5OB 2D3ZA 3AXKA 1N54B 2KB2A 3BBCA 1PCAA 1RHKB 4TXSA 5E3RA 2XP3A 3DOLB 4DR2J 3PJWA 5LMNJ 1U6BA 1RDRA 3BN4A 2IA0A 1ICEB 4CLLA 1SVDA 4WYWA 3RG6A 4PXEA 1YTYA 2WK2A 1U2CA 2BKNA 3R7NB 5KFVA 2QSWA 2HZVA 3K5LA 2OO4A 3LP1B 4I64A 4WK1A 3FMWA 1T7PA 4IRKA 1EKSA 4CNYA 1VQSA 5JH8A 2LEAA 3CCZA 4C48A 2CNLB 2PA3A 3DI6A 4M5HA 2CNKB 1EQ3A 5I3PA 4BWMA 3T19A 3D7SB 1FVQA 3H90A 4IH6A 4DROA 4LFAF 4GC7A 1H7WA 3KLGA 4G3IA 1ZETA 4L74A 3GYXB 3TJ8A 1QUPA 2QV6A 1U0HB 3CMAS 2H5IB 4C8LA 2Y8WA 2OD6A 2EPIA 3PFOA 3RU0A 3JS9A 2X7IA 5KG3A 2QMXA 2V4JB 2ACMA 3G6ES 1L3TA 1RAAB 2HNDB 3B6BA 4FBUA 1NPKA 2FZGB 2HVZA 3GFXA 4M5KA 1YLXA 3A8JA 4M5NA 4YY3F 1ZTTA 1C4AA 5B08A 3OXGA 2O67A 4ID5B 1UVMA 4JI8J 3CEDA 2OSQA 4USMA 1AB8A 4TU7A 1JNSA 3HXMA 1Q53A 3MEGB 1EP4A 2E7XA 2VG6A 4FYXB 4Q45A 2I2YA 5HANA 1FKOA 1QTNB 1LL7A 3QWUA 1PAUB 2LLZA 3CPWR 5JXSA 2J7WA 5DIUA 4MAKA 3O5JA 5E3PA 3KMQA 2PFFB 2BM0A 5C2GA 1DURA 3QJJA 2KXHA 3KNAA 4QQBA 1ROFA 4S3JA 2ASYA 2G0JA 3D6FB 3K8WA 4G6VB 3E3XA 3H5XA 1GX5A 1U2RA 2FHMA 3M2UB 3K5NA 2Q5AA 5A8KA 2ZKUA 4JI5F 1S59A 2V94A 1RBOB 3AQPA 3N01A 4NMXA 3O1LA 3WC2A 1S48A 4EBEA 2PV2A 1TL4A 2HMIB 3R2CJ 3IG1B 4QWAA 1RWMB 5KG4A 2EFOA 2RMLA 1F40A 1LFPA 4ED4A 3CC4S 1R8PA 5F8HA 2BQUA 3QJLA 3B4DA 2IM0A 3ULHA 1RAEB 3ARXA 5A8WA 2VQEF 4DUYJ 1REVB 4ILRA 2W7AA 4L3KA 4LF7J 2X1FA 4RUCA 1C4CA 2HRTA 5HQLA 1FFQA 2YH1A 1T9XA 2FIUA 2OFHX 2RRNA 1SXLA 3EICA 1RWUA 3C8YA 3I55S 2LPVA 2OSRA 2V2QA 2XYHB 2YKQA 4AL7A 4B3SF 2E5LF 4ZIWA 5KFFA 1JNDA 1FRKA 2YWKA 4Y2AA 1WC5A 1UKUA 1VQ5S 1LK7A 1HKIA 3R1LA 1VBYA 1NU4A 1RQ0A 1IM4A 2FGOA 3IMQJ 5T7LB 4H4OB 3DDNA 3ILOA 1WOPA 4HI2A 2FJDB 4DWSA 3OOBA 3IAS9 4JI4F 4X4UA 4NE9C 3KCEA 3VAGA 1Z4UA 2XB2D 1M90T 2MY7A 1HJWA 4FXDA 3DLKB 1NSAA 3M2UA 2RUCA 1KLMA 3PV8A 3CB4A 4IRCA 1FHTA 3GZ7A 2D3UA 3T6JA 2CPHA 3ARRA 1RABB 3ZC4A 5FD1A 3TUPA 2AEMA 2FLOA 4S3KA 2MLYA 5D75A 2HFNA 4G1QB 1Q16B 3SCKE 3CCES 1N0VC 2I0XA 4L3NA 2AJQA 1RA6A 2DO0A 2WLYA 2RB7A 2VG7A 2V50A 1FKKA 2ZITA 3ETOA 3N4WA 3THPA 4RZRA 2W9BA 1S9FA 3MCNA 2F8EX 3R7SB 1WF0A 1HD1A 2XWYA 1T95A 2CG4A 2XMTA 5GADU 3VAJA 3EX7B 2DHAA 2QF8A 4LSNA 4FNHA 1FTCA 4RUBA 1S1TB 3MDFA 1KT1A 4MNJA 2YQ1A 2BDPA 1RT6A 1EYMA 4P2SA 1GMWA 2HHUA 5HP1A 4QR2A 1T8EA 3GLJA 4KRWA 4U7UD 1FWKA 4YHHJ 4EBCA 4ZPWR 3HFVA 2BYCA 4IPXA 2DNZA 2GV1A 4ML4A 2HK3A 2V8DA 2IRXA 4USTA 4P75A 3KLHB 3NGUA 1S79A 2WVEA 4KC5A 3LOUA 1VJQA 4PYAA 2FJXA 1X5PA 1N34F 1IBKF 3VR1A 1EETA 1KSPA 1ZH5A 4IG3B 3BQ1A 2HGNA 4LRCA 2VQEJ 2BR0A 1WUUA 4OHYA 2A2CA 2C2ZB 3WX8A 3BKUA 2WVBA 2FHJA 4DCPB 2HQ3A 3K89A 5HL7Q 4Q5VA 3OL6A 2DCUB 2W9CB 4DFPA 2FUG9 5M2RA 4DV0F 2ILZA 1YBAA 3HHLA 4F3MA 8AT1B 2GJFA 1IBMJ 1R0CB 3BGRA 3OT9A 5KG0A 4WKYA 3NXZA 2B9EA 2ZE2B 5G4DA 3PFEA 1TFYA 2J9DA 3K5MA 2HRUA 4DZ6A 2HHQA 1EP4B 1SC1B 1UEUA 2YKPA 3VALA 1IXKA 3EVWA 3FDSA 5T41A 3IA0A 3MR6A 4DQRA 5HBMA 2KFNA 1JJCB 4QYZK 2BJ8A 1ZK6A 3M6XA 2P9GA 1KBRA 2DTJA 2Y1IA 4Z2XA 1LG1A 2WW8A 3AT1B 1VQOS 1S0OA 1UVKA 2F3JA 2HQCA 5IM0B 4RNNA 4X64F 3SV3A 3HT3A 2JEFA 2CPDA 1Y4ZB 4OLPA 2MKKA 4DUYF 3NG8A 1HD0A 2F9DA 2HURA 2BE9B 3OR1A 2R7QA 4QIFA 5D0EA 4JI2F 4DX5A 3G9CA 2QLBB 2YWEA 4LAWA 2H4WB 1Y3KA 3WH0A 3L7PA 5LJ5Y 4DWSB 2O66A 5IWAJ 3CC2S 2W1BA 2C28A 2BQRA 2QFIA 4S0MA 1V6HA 1R7IA 3POTB 3BSOA 3TVZA 3O5MA 4DR3J 4ECVA 1NB2A 3KAFA 3DXSX 1U1OA 2AW0A 2F5GA 2UUCF 5B0BA 2F2DA 1XR5A 1PYOB 4P52A 3NP5A 4DXLA 1DZ5A 1SUQA 3TDBA 1H74A 1NDPA 1VQ4S 3QLHA 4NA3A 1HJVA 4OYMA 1ZTWA 2EFQA 3MR7A 2ZH3A 1VS3A 3SSQA 1UVNA 1UTAA 1UW9A 4WE1B 5LXRA 1B0TA 2ZQTA 4USHA 1KN6A 3T5HA 3QIPA 2AIRB 4FS1A 4YN3B 3SFGA 2JEIA 3W60A 2G0IA 4L75A 1JJ2R 4PG8A 5GAHI 2J6TA 4P6QA 2ROGA 1U6FA 3O5IA 2IVFB 2WAQD 1QE1A 2QLWA 3GJTB 1M1HA 4W9PA 3W4RA 4H4MA 3MURP 1U8SA 5CYMB 2CPEA 3PA7A 2LGOA 4LF4J 5HJXA 3T9NA 2YKMB 1N33J 4CO0A 2DGXA 5IM0A 4F0KA 1PO6A 3PYGA 4ZDNA 1HI1A 3TAQA 3EDRB 5ADZA 3M2VB 1S12A 5J1PA 1AXQA 3ZZTA 3MAAB 2XM3A 3IR6B 3LF0A 2ZJRQ 4OX6A 3FEZA 3HPOA 4GIVA 3NAIA 2GS8A 1NXIA 3NLCA 4TY8B 2VFVA 3JTPA 5J2MA 1M5VC 3ARTA 4FF1A 4LR8A 2BM1A 3R6LB 4FVCA 4DH0A 1N5TA 1JK9B 4MTVA 4CM2A 4Q8FA 3GYNA 5HWCA 3HLUA 1F9EB 1O6IA 1B99A 2ZBQA 4LREA 4EEYA 2ZE2A 4M5IA 4F8RA 1TU0B 2KVQE 2XHCA 2ASDA 3GB0A 2FVRA 3T3FA 5HP1B 4IOBA 1YJWS 4Z2JA 1I1GA 2AJ1A 1EX8A 2XY5A 1JLBB 5DDQC 1XR6A 2HWHA 2B5JB 3DHXA 3FEXB 3OQ2A 3CJ8A 1OY9A 3UCGA 5DETA 4ECZA 1TL1B 3PJXA 4PXCA 3W61A 2J6UA 2DNOA 2JJ4D 2PT0A 1RD6A 2R7TA 3PW0A 3BEGB 4NPOA 4EUVA 4Y0FA 5T14A 1IBLF 1TP7A 1TVRB 2HVDA 3EJMA 3JQKA 2A1BA 4JI6F 2JHEA 3HKWA 3UDCA 3IGVA 3O5EA 3DRPA 3ALFA 1NAQA 3CJ2A 3IM8A 4DEZA 1NM2A 4N5SA 2CNNB 3NWRA 2LXFA 4WFXA 3AODA 1D6OA 2Z2MA 4K2JA 3K57A 4FPRA 1RT7B 3LGMA 4CH7A 4PG5A 5ETMA 1Z1ZA 4ES2A 5K8MA 2CPZA 1FDAA 4B3TJ 4J9MA 1FFWB 2JL9A 4HVZA 5D4OA 5KFDA 1OGGA 3L7OA 3D67A 4NLDA 3U27A 4B3RF 1OQ3A 4LF5F 4FN2A 5F9LA 2LQJA 3A4TA 2Q43A 2XMUA 1RUSA 4O2TA 1WKKA 4YB7A 2KH9A 3CTRA 2Z2LA 2N4DA 3G8QA 3QPIA 4LSLB 2AJ0A 4NZ7A 4OLOA 3SCIE 3AQOA 5KFCA 3T1YF 3ELHA 3CMQA 3B54A 3ARSA 2AZ3A 3OR2B 4CLFA 4ES1A 4X4VA 4Y2MA 2B6AB 3HK2A 4ZVOB 2EFPA 1HFEL 4W9QA 3V6JA 1N5QA 3HKZD 1ZAWA 2QA4S 4Z2GA 2HIQA 3D28A 2A6MA 2HAFA 1IX5A 1E6PA 4NSBA 2YNFA 1DTTA 3POTA 3IN5A 1ZZFA 4DR5F 2YWGA 2VODA 3PRDA 3J80U 4ES3A 4L73A 1RBAA 4NYPA 2HYIB 3CDWA 4NXNJ 4URSA 3AS1A 3M9OB 1YVFA 3RYLA 4RWXA 2JOQA 3H4DA 1JKHA 2F7VA 3NEKA 2RQKA 4JP8A 3BR8A 4HI1A 1EIYB 1FO1A 3EMTA 1GMVA 4ZP8A 4HACA 3OL7A 3MR3A 1T03A 4LVNP 1S76D 2U2FA 1TK0A 3C16A 4I6AA 1FWPA 3UDEA 1U1KA 1H6KX 1R8HA 3JQJA 4DFMA 4H4KA 4BC9A 2BJEA 1PIEA 3LP2B 5C25A 3NNHA 1ZM2A 2VV5A 5GQBA 3VZIA 1FTRA 2KFWA 1RHMB 2W2MP 2VUGA 5EGYA 4NI2A 3H20A 1CULA 4MK9A 3MCSA 4YFUA 1WF1A 3BB5A 1XMOF 5DGBA 4JYAJ 2M70A 1TKTB 3LAMA 4KT0C 4F26A 2UZ5A 3M8SA 1DJ0A 2RDIA 3MCOA 3GILA 4KV8A 2EK6A 1WG5A 2JFDA 2Q79A 4BF8A 4OX8A 2DH8A 3H8YA 2VBWA 3I9V9 4PAAA 3JYTB 3PYDA 1FX2A 3J7YU 4JFIA 2XBPA 4R0XA 3KJVB 4TX0A 3CCVS 1B70B 3CHEA 2IPOB 4RWWA 5B0CA 1BGXT 4C0OC 2QX0A 3OW2R 3R8YA 3GCWP 2N7YA 1CJUB 2PV3A 4E8UA 3GU0A 4DRHA 2ZHAA 4QR1A 2IM1A 5AXNA 5K8NA 2AYBA 4G1QA 1IBLJ 5THWA 1JKHB 2VPZB 2DSZA 3G2XA 2Z56B 3Q8VA 3NS6A 3JSRA 1JVWA 5D15A 1C0TB 2SXLA 2P6TA 5E7OB 3U7JA 1X4BA 2FVQA 3QRPA 1JIHA 2C3PA 1YBTA 1S1UA 1FAPA 1X4DA 2AWZA 3HM9A 2DSVA 4NZCA 4TY9A 1HR0J 5KAKA 1E15A 5KFWA 5HWBA 4ANCA 4ZJQA 2W8KA 4Q2LA 4JI7F 1YI2S 3LP2A 1WEYA 3LAKA 4CLKA 2KHDA 3CDAA 2MLXA 1QPLA 2WOMB 1F5AA 4JV0A 5GAHU 1W2BR 4DT4A 3C6TA 4ETXA 3RRGA 4JI1J 1UVIA 2CFXA 2MB0B 2HHTA 1TZ0A 3FKBA 3N9UC 2MKIA 3P5TL 5KFAA 3OUYB 3V5RA 3M32B 1WWHA 3DGPB 2GQ2A 4O3SA 3J7ZT 2B56A 2VA2A 4K4ZA 2RQMA 5L9XA 3WZ0A 2YX4A 4F4XA 1P6TA 3DRYA 3TOQA 9RUBA 2XGQA 2JEJA 4ZVUB 4DSLA 3H0PA 1IWGA 4CO3A 4Z2KA 1HBNA 2FY8A 2JFKA 1E6VA 3HFKA 3IR5B 3P8BB 1ZAVA 4HTIA 4R8UA 2HHVA 3BDEA 3PYFA 4K59A 3O44A 3THVA 2VKZG 3W2WA 2FD2A 4TQSA 1FXDA 2IDLA 3C16B 1RTIA 2YNHB 3CHDA 2L9DA 3W9IA 4LF6F 1RHQB 2VB6A 2C3MA 1O5JA 2XP7A 4UOGA 1F9HA 2GNKA 1TL7B 2O01C 1TKXA 1CJTA 1CS4A 2CJXB 2OELA 4KGKA 2XMVA 1XBWA 2PMWA 3NMAA 1IR1A 2RT3A 2V2ZA 2WSFC 4YMEA 2LU2A 4DSKA 1G2EA 1YGYA 3MPUB 3CJTA 4YDDB 4RW6B 2G1DA 4LBHA 4J91A 4XAKA 1DQ9A 3MPVA 5D4LA 2N87A 3N6MA 1OWXA 3NOCA 2CQ0A 3X3UA 2MXYA 3Q8SB 1X5TA 1IR0A 2D41A 4ELUA 1P5QA 2D74B 2WB1D 1FFSB 2JSXA 1OQ6A 4KO0A 1S57A 3DOKB 2FJWA 3B9EA 3WD1A 2DNRA 1HPZB 2M1IA 2Z2ZA 3Q2SC 2NXJA 3RGCA 2B7BB 2ZDPA 4OZ3A 1XMBA 3M8PB 1RT2B 2F1FA 1HWLA 1BWEA 4OZJA 4DQQA 2KKHA 2E7VA 5M2PA 4P71A 1HBOB 4DLGA 4NMLA 1HI0P 1BY9A 3HFZB 4GGQA 1Q5YA 1S5ZA 1S6UA 1Z2LA 5FDLB 4C0BA 3GV5B 4A8SA 2UZAA 4EO8A 4JI7J 1MSWD 4WBFA 3EZ5A 2DXEA 1F6TA 3CDEA 1TV6B 3A1YG 3PIPQ 2B31A 2C2MB 5F3TA 3A3PB 1CS4B 3T1AA 3BGLA 5BYQA 3UDVA 2NS1B 2W25A 3N5BA 3OTOJ 3AQUA 2I5JA 2ZC3A 2DNLA 2BUNA 3FCVA 4KFBB 5A6PA 1JLEB 3MCMA 4MFBB 3BO2A 2VHGA 2Z2YB 1HNXJ 3DLJA 4OMFG 2CRLA 2NUHA 3IRWP 4QWEA 5DZ7A 3TI0A 1LXNA 1YJ7A 4LT6A 3SSSA 3PTWA 2GIRA 1JXEA 3AD9C 3MMBB 4FVMA 4LF2A 2XCAA 3CGMA 1U1LA 3X1LB 2WB4A 2MEWA 1FKAF 3AJ2A 1RAIB 3IS9A 2Z30B 4ODOA 4NLYA 3J81Y 5CCLA 2ZJQQ 3UI3A 2BABA 1KHWA 2DGUA 2QO3A 2ZUAA 3G8SA 4F50A 4CYUA 4WK9A 1K0TA 1TAUA 3VVUA 5B8IC 2MSTA 4WTYA 1TL3B 3RFWA 1E6YA 4ZVGA 1UWAA 1VJWA 4RW9A 1NK6A 1PBKA 1Q8LA 2DITA 3H5SA 1FFRA 1IKYB 1OYDA 4M5GA 3MM8B 4WK3A 3SQGB 5IV3A 1M1KT 1RT2A 2MTLA 3PRBA 2PI4A 2OPPB 5DQIA 2OJ3A 1N4LA 4K0KJ 4CLPA 2JLEA 1VBZA 4GVBB 3KAIA 1FKGA 3WQVA 1TKXB 4QIBA 5D0GA 4J9PA 3UWTA 2AWGA 1QM9A 2PA8D 3HDSA 2QE5A 1X9SA 1QY7A 4ZPCA 3T9ZA 3CJ5A 3WIUA 4U7CA 1RLCL 2ZUGA 3KWMA 3N5FA 5BYRA 1HBUA 2NCKL 3W2VA 5D3GB 4LF6J 4YY3J 2MPUA 1GNKA 1KQKA 4X66J 2BRLA 2HVHA 2P2CB 3O6QA 4DS5A 3U1MA 4CLTA 1T94A 3TX8A 4DL6A 3CMES 3QYYA 2BOAA 2QL7B 2QEXS 1JLEA 4LBIA 4DSFA 3M8QB 3VV2B 1AUSL 2R8JA 1VK3A 1LW2A 4QU6A 1KD1T 1RAFB 1XQIA 2B9WA 2HLTA 2V69A 2JH3A 5AE3A 4ZP7A 5I98A 2BJ3A 2C3UA 2N3LA 4M5JA 4ER8A 1TKZB 4FF3A 1SKUB 4WU3A 3IS9B 2LXIA 2XI2A 4UF4A 4C11A 3ZZYA 1PYTA 4AE5A 2E9RX 1VR6A 5L1JA 4WFAQ 2Z0GA 3BKFA 2H65B 3NGTA 2HQGA 2K1RA 1IJEB 1VC0A 3QRQA 3O5KA 2M8HA 5F41A 1GEHA 4HHUA 3LWMA 1URNA 2KO7A 2XY7A 4KE5A 4WZMA 1EDQA 2M88A 2A2DA 4A47A 4ID5A 3OR2A 2GC8A 1JNZB 3W5XA 2QT7A 4C6AA 2C2DA 4EZ6A 4OHZA 2ACYA 4LFBJ 3VVTA 4AUKA 3VGTA 4X4PA 5JUMA 4QZVB 4X65J 4WWSA 3KLEB 3EPGA 1WC3A 3QRRA 2XS5A 3KNGA 4KAIA 5ETVA 2FDNA 1HWIA 1GQEA 4FKYA 2LEPA 3ZO7A 1D0EA 4HTJA 4N56A 4DV2F 4XO0A 2D1CA 4B3OA 4DOZA 1FJCA 3IK8A 3CDBA 1O8BA 3DN9A 5AE1A 1SKRA 4I0WA 3BV8A 1FNMA 1CQMA 1VRUB 2R8KA 3G86A 4OJHA 1KQFB 4TYAA 4Z37A 3IG1A 1FKJA 3DMJA 2DRDA 5D78A 1S97A 1Y5NB 5F9NA 4DV7F 4DL5A 1JCHB 4EGLA 2ZOFA 2GFFA 1U0SA 4CO4A 1A9NB 5CYQB 2WLZA 4ED6A 3KABA 3UD3P 3RB0A 2KT5A 3TEGA 3GSIA 4EO6A 5KTQA 1XK8A 3PM9A 2RUQA 2BE7D 1S9GB 3M2RA 3A8KA 2HNYB 3P45B 4RNHA 1ZBWA 5A2QU 4Q0BB 3NY0A 5KFHA 2IMWP 1H0IA 4BBYA 1FKDA 2GX8A 5DM7Q 4FDFA 5FLXU 4LRDA 1D9AA 3IWNC 2XGPA 2PPPA 2IJRA 2OLWA 2PMHA 3CD0A 5KFJA 1V3RA 2A10A 3MI7X 4P72A 5A8KB 5B0AA 2FVSA 3K0JA 2ETNA 4DRIA 4ECSA 2UVUA 3AHPA 2JC0A 3LPEA 3KJFB 1BMQB 4K4VA 2CQBA 2E5HA 5IV4A 2GHWA 2A6OA 4DSEA 4YP3A 3R5CA 3PX6A 5L9NA 1NMWA 3O3LA 4DWSD 3B9AA 3FNNA 3M8WA 4JI3J 2HMIA 3GJSB 1WKLA 2GHVC 2CQ4A 4WP9A 1HNIA 2MZRA 3I0SB 3CO0P 3GFHA 4DIPA 2JVOA 3OFGA 3I56S 5JVHQ 3UR0A 1U47A 4B3OB 2YNGA 1IKXB 4HLBA 4AYBD 5DO2A 1QAJA 5DGAA 1KTQA 3W63A 1JJ4A 3L7UA 4DPOA 3V81B 5HMZA 2UVVA 2QA1A 1LWCA 4F3OA 2VCDA 2B5JA 3MECA 2CADA 1VGYA 3PYEA 2CJQA 2LECA 3W2VB 2VQFF 1QPFA 4UUXA 4TW8A 4ZCMA 1R9HA 4LSNB 2CAJA 3BKTA 3GYGA 5ETKA 2ZZMA 3CJQA 2GA7A 4WU2A 3UO0A 5J1EB 4DPYA 2RDJA 4B9UA 1B7YB 1P9QC 2FYXA 1RT5A 1LJYA 3C6TB 1FD8A 1SJFA 1HYSA 2HIYA 3C14A 2ZBRA 1SB6A 1FRMA 1SR0A 1RHJB 4MT1A 4KGMA 2F65A 4P7TA 2YNFB 4B3TF 1BD6A 1VLYA 4KHRA 2ZC4A 1IQTA 3DLKA 1NSKL 2V5HG 4MYTA 1U45A 1NRKA 2MKHA 2GMLA 1KWMA 3M6UA 3KUGA 2VBZA 5KG5A 1HWJA 2DNYA 3SYZA 3B9DA 2W9CA 1RT3B 2HS3A 2HS0A 2J9DE 2HFZA 4ICLB 4ZP6A 4CH0S 1SKSA 1S0NA 4ED3A 1GMUA 1WKJA 4NLPA 4X65F 2UUBF 3HHLD 4IYQA 3OA5A 1AUDA 3E51A 4OYBA 3T5KA 3JSYA 3HZEA 1RTJA 3EZOA 3NRBA 1SV5A 4MNKA 4YR2A 3CF5Q 3MOJB 2QG9B 2YNGB 1KC8T 2J0SD 3QNWB 2M2AA 4DZ3A 1L3VA 4LBPA 4OV6A 1K73T 1SL2A 3PHEA 3WIVA 4A48A 2VF3A 3QSIA 4DR1J 3DOMA 3KDOA 3UN2A 4C97A 1NNDA 4ODNA 1Y9OA 1SQGA 1JQGA 2CIMA 2JX2A 2JNJA 4DUZJ 1XNQJ 1SI9A 3WD0A 1H38A 8ATCB 1HHSA 1HQEB 3M6VA 3RUBL 5E33A 1Q5VA 3MR5A 3SCLE 1AFIA 2ZH7A 4A8WA 3G96A 1UJ5A 3RGIA 3L95X 4PUOB 2EULA 4ZVRB 4Y3CA 4RW4B 4LIRA 3FSYA 1KQGB 1WC6A 2H3EB 2MKSA 2VKRA 4DRMA 2XC9A 3JSMA 3I96A 1RSCA 3N6NA 4N41A 4DR7J 3EIPA 1RAHB 3VZHA 2CWXA 2DR6A 4O3OA 4HACB 2ABYA 4PXBA 3OLAA 1MG7A 4LF9J 2MZTA 4ZLLA 2E5JA 2N3OA 3V4IB 1WSVA 1UA0A 3A13A 3ZNUA 1FJ7A 4MIBA 2AYGA 2UU9F 4DDFA 3DM2B 3D9BA 3DLBA 2ZVSA 4ELTA 1H2VZ 4QT3A 1X7VA 4RU9A 1DARA 5IQQA 1GX6A 5FDLA 2R2UA 3MTKA 4OYXA 1HQUB 3DRSA 3GPAA 5HATA 5LXYA 1UEVA 4QYZJ 3PW7A 2DT9A 1KTVA 1PJ5A 2W4DA 1TKTA 4OI1A 2MQPA 2Y0BB 2AYMA 2E9ZA 2OEKA 5HBFA 1SIZA 2UUBJ 4DR4F 2RRBA 2XO6A 4U84A 5I4MA 1UA1A 1F2GA 2IYGA 1FK9A 1GXUA 3W9HA 3OSNA 4X64J 2BOPA 3UDLA 3BJYA 5L1IA 4M63A 2M5YA 2R9LA 1I3OB 3WHIA 3TEHB 4ODRA 5K14A 3MM7A 2OPSB 4UT4A 2XZDB 4K50A 2R2RA 3D4JA 4ZLPA 3BYRA 3IO1A 2AHOB 3HHLB 1KVIA 3TQ1A 3SQOP 4IQCA 4DR3F 1W26A 3WD2A 4F0MA 2MY8A 4M5LA 3G6VA 3RAXA 2YXLA 3HP6A 4DV6F 4C3MA 4WKHA 1RYRA 3R27A 2HVIA 2NXEA 1CLFA 2IF4A 3R5JB 4MGVA 1HNXF 4WTOB 4RW7B 4URQU 4USJC 3N79A 3PX4A 5KFOA 1Q95G 4TKTA 2XQCA 1NWUA 1LL6A 4IR1A 4P7VA 1L3UA 4GVBA 1RTIB 2AZ1A 2YNHA 1ZPWX 5CQGA 4UOCA 3MFHA 1WOOA 4CI0B 3FQLA 1HW9A 3BGFA 4M5DA 4BS2A 2XSJA 3OD2A 3TA1A 4AXJA 1QE1B 4H4MB 4USWA 4LFCJ 2E44A 2IBOA 4PEOA 1X0PA 1E9LA 4C7QA 2CZVC 2DGWA 3HD2A 4C0HA 1HBUB 3KG0A 2UV8G 3HVWA 1VQYA 3TR5A 2XLKA 2KZZA 1CPZA 2HNZA 2OPQA 2NZ4A 1T05B 2BW7A 2R7SA 1J4IA 3U1NA 3RR8A 1FF2A 4F3QA 3B78A 4P74A 4PUOA 1HL6A 2DH7A 2KVIA 1FRLA 2PPNA 2R8IA 2IUZA 3DRPB 2RDDA 1E6ZA 3HX9A 5EWFA 2AD9A 4N76A 2WZ1A 2JLFA 5J2MB 4JV5J 3AOBA 3T5LA 1IR2A 3TAMB 4HT5A 1QVFR 3HCXA 1TUVA 1F3VA 4TY8A 4D3HA 3B8SA 2IIHA 3C66A 4NLVA 2GO9A 4RNMA 3Q89A 3UCUP 3JYMA 3MEGA 1VC5A 1OMSA 4FP9A 1O51A 5A6WA 5M2UA 4ZVPB 5EDWA 3ENVA 3UNYA 3OJUA 5DF0A 1OS5A 3W3SA 3JAMY 2OTJS 5IC6B 2BACA 1MWZA 1GOIA 4I6YA 4EK2A 3MR2A 4ZJOA 5DQGA 3TVYA 2MJNA 3VGSA 5LJ3Y 1FKIA 4PRFA 3ZZPA 2B5UB 4IR9A 3NAHA 2ROPA 3CJKB 2VQFJ 3KKFA 3L4BC 4P9SA 3ARWA 3S7RA 2KXNB 3NI6A 1J6YA 4DQSA 1U02A 1R6VA 5GVQA 1JXVA 4J90A 3OVAA 2V8GA 4HDGA 4F02A 1T9TA 1RBLA 3D0GE 1H98A 2A3AA 3C15B 3LGHA 1FE4A 5C24A 4X4QA 3KK1B 2VIHA 2AJFE 1UWBB 1SQFA 2BANA 4ZVTB 3G8TA 2F21A 4F4WA 2NXUA 4XDCA 3OXLA 4JI3F 3DDKA 3P4UB 1SC4B 1VCTA 1RT4B 2AGPA 1N52B 2NYHA 4KHPJ 2QL9B 3HT0A 4C2MA 3RBDA 1VRUA 3DRSB 2EFNA 2VG7B 5IWAF 3RTVA 3G6LA 3O5RA 3PKYA 1ZM3A 2EBGA 3E8OA 3I32A 4TU8A 3BYPA 2DPEA 4U95A 4CO5A 1WELA 1FDBA 2XYPB 4ID8A 1FKBA 4B02A 3GV7B 4K0KF 2D9FA 3MMJA 3NS7B 1EQ0A 3UQAA 2F8HA 2KRRA 4KHMA 4TU9A 3T1YJ 3H2UB 3ILJA 5BYSA 3TUIC 3M9MB 2EG1A 2BW2A 2YWWA 3ZTPA 1F1BB 2FPHX 3QZ8A 1SJ3P 1RA7A 1Q7YT 3JTOA 4QBUA 5HROB 5CD4A 2G2YA 2WHOA 2EBEA 5HW8A 2EVZA 1MMLA 2GZOA 2J8SA 3DI6B 1KFDA 1LK5A 3FCHA 4WPAA 3K7RA 5G0RA 3W8GA 2IY5B 1SCJB 1FDDA 2DGTA 2XHWA 3KTQA 1KVJA 5HQ8A 1D7IA 5EX3A 2IM2A 3KJVA 2MPHA 3OBIA 4KSEB 3NNAA 2M3DA 2DKOB 2YVSA 4KY3A 1SJ4P 4BWJA 3UR3C 3BPDA 4LFCF 2NUUG 1A0OB 5KG2A 1EARA 1N5SA 1T03B 5JMNA 2UXCJ 2RF2A 4LF9F 1RISA 1U7LA 2R42A 3CD6S 4DF4A 1RP5A 1XRVA 2LQ9A 1HARA 3Q86A 4J37A 4U9RA 5KFEA 4Q8EA 3ETMA 4NI2B 3VF0B 1TKDA 2U1AA 5ETNA 4WFNQ 1NWSA 1GK8A 1GAOA 1S1UB 2W8LA 4YHHF 4KYZA 4UZBA 2L08A 2M0GB 4A8FA 1ELOA 3K8VA 3OFHA 4I2PB 1T02A 2I8EA 1S7IA 2CQ2A 4ITSA 2XZTB 4QIEA 4RBVA 3ENQA 1QDUB 3OTEA 4KIAA 1NHKL 1TFVA 2X3DA 4DF8A 1RWNB 4DL0C 4HH1A 4DX6A 1BC6A 4XIUA 2LDYA 5KT2A 2ZEJA 3RAQA 3GMGA 4KPYA 3FAPA 4HHJA 2K7KA 2V67A 1Y7PA 1N5VA 2DHGA 4OJ1A 4NCAA 3E2EA 1OGBA 2XWXA 4HYKA 3AXMA 1CG2A 4JFLA 1TQLA 2XG8A 4HBOA 1OSCA 3D1HA 3F44A 3ITHB 4OZLA 4P73A 3VGUA 4F4YA 1XERA 1VBXA 3CGNA 2O1PA 4GRSA 4DMZA 4C8ZA 2DNKA 2ZBIA 4NXMF 1X0FA 2E1RA 1M1GA 1RTDA 4ENOA 3BQ2A 4MNLA 3WL0A 3UQIA 1TUWA 2WRMA 4Q22A 3GP9A 2ZH1A 3DMJB
chains in the Genus database with same CATH topology
2KRBA 4C02B 2ZDOA 1FJDA 4JFKA 1VIOA 2M52A 5KFGA 2VBXA 4LQ3A 1H7XA 2RSEA 1YJTA 6FDRA 2WOMA 2FHJD 3FFIB 5EN1A 2AU0A 1FXLA 3OSPA 1V3ZA 2HGMA 4FZVA 2D7SA 4C4WA 2MNTA 3UI4A 3HHNB 5ITHA 2J9CA 1ZBTA 2HHXA 1WB0A 2J76E 4NYOA 2F8MA 1HNWF 3I87A 4DRPA 4RKUC 2MZSA 4NNRA 1T11A 2YX1A 1HBNB 2MZJA 2DGQA 4KO0B 3FMBA 1H3DA 1BQXA 3S01A 3CXCR 1LW0A 2VPXB 1XNQF 2LKNA 1UFLA 1M5YA 1MU2B 2IRUA 7FD1A 4CT8A 2RRAA 4LAYA 2NSCA 2PI6A 5A2QY 1ZBKA 2VOOA 4MH8A 2W9AA 2FB0A 4LIWA 5AXKA 2JEGA 4K2XA 1RT6B 1ZCNA 2RJZA 4IOCQ 4G1PA 3MPYA 1C1CA 2L41A 2EC0A 4Q7NA 1B0PA 1VQ7S 5B0DA 3VAMA 4L6V3 2WBRA 4C98A 2EFGA 3MECB 2LEBA 4NLTA 3CJ0A 2UXCF 4AL6A 3DOLA 1HA1A 5D6GA 1TVRA 1UJ4A 3OFFA 4O4GA 2CQ1A 5HN0A 3LQVA 4BDPA 3O5LA 1H0HB 2PGCA 4IFYA 1KR4A 3M30A 4DL2A 1RT5B 1XWLA 4M95A 2EW9A 2BVZA 3DOKA 1R43A 1KQSR 2FY1A 2XS7A 4PWDB 3MEKA 3WL1A 1C9HA 2FDMA 1S1VA 1U24A 2RF2B 2QLXA 2RQSA 3IAM9 3QGPA 3VQSA 1YQHA 3ZZUA 4UY85 2RKIA 4Q2MA 4X66F 2B4OA 3CD5A 3UF8A 4I2QB 1J5OB 1QSLA 1K0VA 2DIVA 3OHBA 3V81A 1PC5A 1U1RA 4J4NA 1FRXA 1WHVA 1Y5IB 4PG4A 2DCLA 4ZHRB 2ADCA 2FJVA 1N6QB 2HFOA 1SBRA 2ZNYA 1J5EF 3CDUA 4JUZA 3ARQA 5J1EA 3GG1A 5DM6Q 1T3NA 1M5SA 2B6AA 3IXQA 2G8ZA 1C1CB 2GW8A 4NLGA 2PBCA 3HI9A 4RBUA 4X4TA 4H54A 3NNAA 2CQCA 2AV5A 2ZKTA 3EXYA 5IQ6A 5AXLA 4JI5F 1DTTB 1PGZA 1WAWA 4DR6F 4Z2IA 2RNEA 4XDDA 1C1BA 3DU5A 4P8WA 1LWEA 3SV4A 4IH5A 2ZQVA 1IKWB 3F41A 2J6SA 4DSJA 2OTLS 3WQWA 2DB1A 3RRKA 3PX0A 2Z4PA 1KVIA 4RW4A 3BSOA 5GPGA 1R31A 3QO9A 1X4AA 2OKQA 3ZFVA 3TVKA 2XP8A 2HNDA 1CEZA 2HW3A 4R5EA 5KFLA 4NX9A 4ZVHA 5KOWA 3RR7A 1M5OC 2HHWA 4MPKA 1CSJA 4P8XA 1SC6A 1YJRA 4FF1A 3TNVA 3UCUP 3EXCX 2HWTA 4K5RA 5KT3A 2UUWA 2XY6A 2APOA 4W90B 3S1TA 4RUAA 2GGPB 1WEXA 4WYLA 4IOAQ 5AE2A 4DUZF 2R7OA 2NLWA 4JYAF 1QAIA 2COLA 4JBCA 2P9EA 1ULRA 3MMBA 5D3GA 1KHVA 4DQPA 1S77D 1U48A 1SH2A 2MQLA 4YB1P 1QVGR 4CNZA 3H5YA 4I68A 3M8QA 1FRHA 2DNMA 4C9DA 5T7LA 4O3RA 2K3IA 2BANB 1XC9A 3QAUA 1VQPS 1C1BB 3ZZRA 2DO4A 1F5CA 3DHWC 5F0UA 3D54A 3DU6A 1OIAA 2OAUA 1O0PA 4NLOA 3P49B 2MZQA 1HJXA 4GO7X 3L09A 3J7Z5 1EHNA 2C42A 4TYOA 2IVMA 5FIIA 2VG5B 2ZJPQ 2FVPA 4I67A 1S72S 3GSDA 2V4QA 2VFSA 3N6LA 3KMSA 1WG1A 1ZYQA 4JV2A 2L9NA 2QMWA 2VC0A 1TK5A 3O8WA 3PW4A 2B7CB 4YUDA 2DT0A 6FD1A 2XEXA 4FAPA 4JFMA 3ODKA 3PEHA 5EHHA 2W24A 3CO9A 2EFVA 1F8AB 1N32F 3KADA 1S9GA 2M7SA 3M2RB 1N88A 2JDJA 4IDKB 4IKAA 3GR0A 4ZPAA 3Q8QB 1YRUA 3I0RA 3JTNA 5EX0A 2OPSA 3O5GA 1GXLA 3FZBA 1SIWB 3HHKA 3PW5A 2CPYA 4Y65A 3GFYA 3GIJA 2M2BA 3MF5A 5LSLA 1ZBVA 3UI6A 3TC5A 1VQMS 5GAEI 3MWBA 4R8UB 3UI5A 3U1LA 3DRRA 3FXYA 1NJXA 1XEZA 4I7FB 5CCMA 7FDRA 5L1KA 3JSBA 3PO5A 3PZPA 3LPYA 5KFXA 3CHCA 3OTDA 3MUVP 2DK2A 3KG1A 1S1TA 2DRAA 5MAOA 2ZOGA 4ED1A 3PX4A 3HF5A 2DGSA 2LA4A 3R5BA 2HNYA 2CPJA 3J80Y 1Y3JA 4OJ3A 1BKFA 1LWCB 3HVRA 1BQNB 1ZZNA 3I5CA 1WD6A 2P5VA 5KFRA 4J9SA 3B7XA 4D3GA 4ECWA 1IBMF 4LAVA 2GMJA 2UUTA 2VD3A 3KK2B 3H4BA 1NK8A 3MMCA 3VTIA 1AROP 1KLMB 3CJ3A 5F8LA 2JWNA 4QT2A 1N5YA 1FXRA 2WBMA 3BF4A 1B6CA 4ECYA 2ZOMA 3ARZA 1C0UA 4ALZA 3LW5C 2ADBA 2OMOA 3MAHA 3AA8A 5KFTA 4A8YA 4TLQA 2G13A 2ITKA 4G50A 4OI2A 4XK8C 3IKDA 2XULA 5SUHA 1JLCB 1UJ6A 1R89A 4IG0B 1UL3A 3MEEA 1OWQA 1K9TA 2DSWA 4IFVB 3TYTA 5SZTA 3NRKA 2G9OA 2Y1JA 3MMAA 2HHSA 2C3YA 1JNTA 4RW6A 4DX8H 3LUOA 4CTAA 5DS7A 1S7HA 3QOKA 2DH9A 3IHZA 4J5OA 2HLUA 3ARUA 2FLLA 5DIVA 3QZ7A 1VIXA 1Q7LB 2VFTA 1SL0A 2MHEA 2MKJA 3C2PA 3I5BA 5L8RC 4YR0A 1UWBA 1FRIA 1HQEA 2KDOA 2HZCA 3SXLA 4DN9A 3OTCA 3CHFA 3Q23A 2A3EA 3MMCB 1LXJA 1HNIB 3BGRB 4Z2HA 3KLFB 4DSIA 2X1BA 1RT3A 1HBMA 2RE1A 3IRXB 4YQWA 3C46A 3HHDA 4B08A 3RB4A 1S10A 3FQKA 4F25A 4KQZA 1E6YB 3MPWA 3O2IA 3WC0A 1JNEA 3R1HA 4ODLA 5E3QA 2XMKA 1HWUA 4K4WA 4K5SA 2ZH2A 4IFVA 4ECQA 3KHHA 2M08A 3KHGA 1UP1A 3JYJA 2YTCA 3SCJE 4J9NA 3FY1A 1NK0A 3MMAB 3CZ8A 5HT1A 1FEHA 3LWLA 3MUMP 2VBYA 2FHKA 3BSAA 4O4RA 2YH0A 1D7HA 1WHWA 1FD2A 3Q0AA 5J2QA 4ZP9A 1D3WA 3HVTB 5DITA 2W7PA 4CQ1A 4B3MF 2LVWA 5KT6A 1L1PA 3M2VA 2WSCC 4NLWA 1XMQF 4Y34A 2RU9A 2RSQA 3CCTA 1W2IA 2J9EA 4PG6A 4LQ9A 4O3NA 2R7VA 1YITS 1LW2B 1KRPA 5KG7A 2L48A 3B82A 4M1KA 2VFRA 4PPDA 1E6NA 3SQGA 5AJ3F 4EWTA 2D9OA 4Q44A 2K7JA 1BL4A 3VAWA 3I4PA 4DZ2A 3PKMA 2DHXA 4X84A 1J5OA 1WNOA 2J7UA 4IG0A 3UW1A 1ZB5A 2B4PA 2DG3A 1NO8A 2V9WA 2LA6A 2RIJA 2AOSA 3PXGa 4AY1A 4FS2A 4ILLA 1VFJA 1JJHA 3M1VA 2BBEA 1NK5A 1N6QA 4LAXA 4UUWA 4DWIA 3NCRA 4QWCA 1Q6IA 3DRXA 1N5YB 3AROA 4ZPBA 2AF6A 2I38A 1LQ0A 4OI6A 3SEOA 2CJBA 2PDAA 2GIQA 3OFEA 5A8RA 4I6WA 4UW2A 3TW0A 4E98A 2FC9A 1R8BA 2B4VA 3QAEA 3IGNA 1Q82T 1ROUA 1Q8BA 3FJ2A 5L1LA 2FLNA 1HPZA 2JC1A 4KJIA 1TAQA 3CJ4A 1JLFA 2CVIA 2KN4A 3KLFA 2NR0A 5L38A 3B8HA 1REVA 5KFUA 4EZ9A 4WJXA 4J9RA 4A8MP 4NLXA 3TO8A 1DQ8A 2QA2A 3I31A 3RAMA 3TAMA 2GMHA 4K4XA 2EWHA 2YWHA 1NJIT 4QIWD 3ONQA 3KAGA 3QIDA 4N8NA 2XZWA 2VL1A 4G2PA 3PR9A 3CWJA 1P8GA 4DL3A 3UD4P 1FJGF 2WCXA 1A7GE 4Q7AA 4Y6IA 4H4OA 4R5PB 3MOZA 3OHAA 4BCAA 2ZH9A 4HARA 1F9FA 3CCSS 3D5MA 4CCHA 1FDNA 4GKKF 4DFJA 5J2QB 1LKZA 4HT7A 1RT7A 2FLPA 3HMJG 2DT3A 3BO4A 2Q6BA 1BQMB 2QYCA 3VWSA 1RI7A 4YOEA 3V6KA 4URGA 2Q3PA 1ZM4A 3LALA 5H1SV 2CJ9A 5GAGI 4TN2A 3CCLS 4JOUA 3CCJS 2A3BA 4URIA 4LSLA 1U49A 2D3OR 4DL7A 1NJZA 4NXNF 1XN9A 5D8HB 4O3PA 2OPPA 1DBDA 1W9PA 2PO4A 3PDNA 5KFKA 2V2KA 5J2PB 4Z2LA 2E29A 4JI0F 3MUTP 2DR5A 3BZQA 3KFWX 3MHYA 1NJWA 3MFIA 4QIGA 1UW4A 3I9ZA 2DR9A 3I6PA 3O5OA 4LGXA 3PR4A 2DHSA 1YG0A 3HVTA 1RKIA 2G41A 4X4OA 2RILA 3UCZP 2R8HA 1FE0A 2Y0SD 1YSJA 4L72B 1NH8A 1YWXA 3V6DB 2F4EA 3I4HX 3OPKA