4ZPTR

Structure of mers-coronavirus spike receptor-binding domain (england1 strain) in complex with vaccine-elicited murine neutralizing antibody d12 (crystal form 1)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
208
structure length
208
Chain Sequence
VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRFLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluation of candidate vaccine approaches for MERS-CoV
pubmed doi rcsb
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
molecule tags Viral protein/immune system
molecule keywords D12 Fab Heavy chain
total genus 52
structure length 208
sequence length 208
chains with identical sequence S
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4zptR02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zptR01
3SCIE 4KQZA 3D0GE 3D0HE 3BGFA 3D0IE 4ZPWR 3SCJE 4L72B 2AJFE 4ZS6A 4ZPTR 4QZVB 4KR0B 4ZPVR 5DO2A 2GHVC 2GHWA 4L3NA 4XAKA 3SCKE 2DD8S 3SCLE
chains in the Genus database with same CATH superfamily
3MR5A 3EPIA 5I98A 2DT3A 4TYOA 3AOBA 3T5JA 4MTVA 1KS2A 3QPIA 5LM7E 4EU0A 2RQCA 1SBRA 1FKFA 2N7CA 2CKWA 1G4CA 5KFBA 2FZGB 3I5AA 5DDPC 5F8NA 3ZTQA 1CEZA 2XQCA 3G6ES 3P3DA 3LW5C 1A0OB 2XMUA 4DF8A 5AXNA 2M08A 3DNCA 3CJKA 1RYSA 4DSIA 2AJ2A 3MAQA 1EKSA 4NA1A 4C4WA 1CC7A 4JI4F 5C2GA 2IA6A 2IYIA 1HWJA 2WVEA 1X5SA 2E1AA 4USUA 4ZLJA 3KADA 3P96A 3UDEA 2PFDA 1NSGA 1C4AA 1H2TZ 1DTTA 1DURA 1U45A 2HMIA 3CJ0A 3UQAA 3CIZA 1Y5IB 1ZM2A 3O3LA 2DRBA 4FBUA 1JNSA 2WVDA 4FAPA 2C3PA 1VJWA 2KXFA 4HTJA 4DXLA 4UZCA 2G0CA 5A8KA 1AZSB 1U2FA 7AT1B 6AT1B 2V68A 1FFQA 4J4OA 3GPKA 4QCLA 2DPEA 2LP4A 1N8RT 2BANB 1BWEA 5A8KB 2I5JA 3GTYX 2QGFB 2BZ2A 2WSFC 5DRKA 2RS8A 2X1GA 1KFSA 5IQ6A 5ETMA 2UUCF 1F5AA 4U7UK 3J80Y 1N33F 4KO0B 4N76A 4IG0A 3CMAS 1VGYA 1P1LA 3FQKA 1H2UX 1H3DA 3I4HX 2B31A 2E7WA 5J2PB 3MZIA 1IVZA 3EVMA 5DLFA 2E44A 4P8WA 1AB8A 1D2KA 1SXLA 1UPPA 1XWLA 1R3NA 2VG5B 3BV8A 2ZNYA 4FYWB 2FHOB 3O5JA 4UUWA 2G0JA 1LW2B 4Q2LA 5I3PA 5IM0A 4C8ZA 4EK2A 4U9RA 3EDQB 3O1LA 4UUXA 2W7OA 2K3KA 3NWGA 2YWFA 3C8YA 2J9DA 2MY8A 3QFWA 2F8MA 1YSJA 4PG6A 3SCKE 3CCJS 4OZJA 2FB0A 3H2LA 1SKUB 1YJWS 3MM7B 5C24B 2ZITA 9ATCB 5B0DA 2LQ8A 5KT3A 1RTDA 1YJ7A 2QC3A 3WIJA 5B0GA 2L3MA 3H9RB 3SFUA 1QAJA 4WTOB 4MSPA 5T7LA 1U48A 4KAIA 3E8OA 5D0GA 3TVKA 4Q43A 4NXMJ 2BE2A 1EETA 1RHQB 4WFXA 5KFVA 3BQ1A 3OJSA 2BQUA 4NCGA 1IBMF 2M2AA 2YNGB 2ZE2B 4OYZA 3KLGB 4OZ0A 4DL2A 4ED6A 5F8JA 2CPZA 2B7BB 2HNDB 4FVCA 4CLKA 1NRKA 1ZBKA 1HNVA 4IFVA 2OD4A 4ECXA 1PC5A 2DIVA 4P7VA 5C42B 2R2RA 4ECRA 1N36F 3HCXA 2HHTA 2VFRA 1E6RA 3QNWB 2CJKA 1OMSA 1T03A 2HHHJ 5I4MA 2MJNA 3DOKB 5J1EB 2B4PA 2E5HA 3MAAB 4W4MA 1TFWA 4KIAA 4DRQA 1TV6B 2QG9B 4NEZA 4ZP9A 4KHRA 4IRKA 2OJ3A 1HYSA 3C6TA 1FKSA 1NUEA 2Y9HA 2NYIA 2ZJRQ 1C0UA 2FVPA 2VPYB 5J1NA 1VRTA 3V6KA 2G0IA 4MK9A 1KFDA 2ZDOA 3ILJA 5ETRA 5KTQA 5KG7A 3HHNB 2OGUA 4WP8A 2MKCA 2HWTA 3VV2B 3OSNA 5HP1B 2C2EA 4UTGA 2HS0A 5L1JA 3THVA 3MPUB 1WJ9A 2QLWA 2VQEF 1TKXB 3IP0A 4TNSA 3T6BA 4B9LA 1KOHA 3GB0A 4YS2A 1A6LA 2EBEA 4X2BA 1NXIA 5DF0A 1FJGJ 1JXEA 1RT4B 4URQU 2GQCA 3PM9A 1ICEB 2DRDA 2PV1A 3NBPA 3CF5Q 4ZCIA 2V8HA 5DO2A 2MLZA 2FHKA 2GHVC 4LR7A 5B0BA 3VVTA 4ANDA 4J9RA 3BREA 2GCFA 2CPFA 2FZCB 2IMWP 2YBVA 4DWSC 2UXBF 2RD5C 2OSQA 3HZGA 2HNYB 4OJ3A 3RUBL 3BSAA 3QWUA 2DNYA 3B82A 3AQPA 4I4BA 1WEXA 4BBYA 1ZM3A 2D41A 3R5BA 1YITS 3UCZP 4LGXA 2Q3PA 2ZUGA 3NNAA 3ZZTA 4ITZA 1MU2B 2DK2A 4ZPDA 3G71S 3D66A 1M1HA 1O51A 4H4MB 5C7PA 3ILOA 4CDIA 4ZN1A 5JUMA 1ZAXA 3C46A 5HI7A 1S97A 3HJFA 2RRBA 2OLHA 1TL1B 2XZTB 3IM8A 2XYPB 2JEFA 3MURP 1J4HA 1FKOB 4NZ0A 2R8GA 4B9SA 1YBUA 2KDOA 1JLCA 1HLWA 2RURA 5GQBA 1Z2LA 2WK4A 2Y0BB 4MIAA 3BKFA 3D1OA 3UPFA 1Q7YT 2AGOA 4YHHJ 4PYDA 2BQRA 1XNQF 5DLGA 1IKYA 3KLIA 2OPQA 3Q22A 2LA6A 2HS4A 5LMNJ 2GGPA 3KABA 3D67A 3R9LA 4ZCLA 1SL0A 3U1MA 3KJVB 5L9NA 1D7HA 3ETMA 2K1RB 4MK7A 2QL7B 3I31A 3VGVA 2BW7A 4EGLA 2B43A 1LW2A 2BJEA 1IM6A 1CJKA 1FKPB 1WG4A 3ARVA 1VQSA 1UJ5A 2MQLA 2Z57B 1S9EA 3HHKA 3LP2B 4KPCA 4TLRA 4CLZA 3RBEA 4DWIA 1U2RA 4DR7J 1HBNA 3PJ9A 2ASYA 2FJAB 4L73A 3VAWA 1O8BA 3DHXA 3IAS9 1U47A 4Y2MA 1EKRA 2B51A 2D3ZA 3WL0A 4RWXA 3NXZA 4DWSA 2F1FA 3JAMY 2F21A 4EWTA 1ZTWA 3OTDA 5I3UB 3W7BA 1HBNB 4ZS6A 2N3LA 3NCRA 4KV8B 5GMEA 3HXMA 1UVLA 4ZLNA 4DV5F 1W1PA 2VH7A 1KQKA 2CZ9A 2E5GA 1Q78A 1ROUA 2ZE2A 4MIWA 4OYPA 3BQ0A 2DGQA 4ZVTB 3EIPA 5E2QA 4EEYA 1FD9A 4ZCKA 4M94A 1HBMA 1XQIA 4QIEA 3Q0AA 4DV6J 1T11A 3FAPA 4B3TF 3MMCB 3QMQA 3ARWA 5KFWA 2Y78A 2MEWA 1U0HA 1WOPA 2UXCF 4IUFA 2DPIA 1FVSA 3D5MA 5E0OA 3Q8VA 2LKZA 4U96A 2VUGA 4A8QA 1M0SA 2F9JA 1FTRA 3JAMU 4DRMA 2QFIA 4A8KA 1RD6A 4RW7B 2IHR1 3N4WA 3LUYA 5DQHA 3CUNA 1W9UA 1B7YB 2PA3A 4B9TA 1S6PA 2W4DA 4KV8A 2CVEA 1SJFA 2P8IA 3UD5A 2F40A 2M7SA 3VGTA 3RR8A 1H72C 4N77A 1NH7A 4LBHA 3EGZA 1C0TB 1T9WA 2XSFA 2M1IA 4HTIA 5J2NA 3KKFA 3K17A 4LVNP 4YB7A 5IFMA 2I6WA 2ZH3A 1W26A 2NXEA 4Z7CA 5GAGU 4W90B 2FLOA 2XP8A 2V4RA 1JQGA 3AD9C 4ETXA 2JEIA 1SIWB 1ZYQA 1MSWD 2DG4A 1RJJA 1J4RA 3WD1A 1FDAA 2XMKA 2WLZA 4ZJOA 3SCIE 5L1IA 4CM0A 4DL6A 4I6AA 2DO0A 4LFCF 3ISZA 1WG5A 2WAQD 5C2CA 1OIAA 3G6MA 4C02B 3EXCX 3UN2A 1IBLF 3RR7A 2IA0A 4JI4J 1S1WB 1S76D 1RT7A 1UWBA 4X62J 1D09B 5JVHQ 1MMNA 2CQPA 3H7HB 4ZCMA 1S1XB 3MR2A 1BLUA 2WZ1A 2J7KA 4LF9J 1XNRF 2P4VA 3ARYA 1WOSA 3B4MA 1FKLA 5CCLA 1TU0B 2F8EX 3PO4A 1VQNS 3J7AN 3MXHP 1RCXB 3PCOB 2NQPA 1HIYA 4PAAA 3RW7A 2B5UB 5IT0A 5J2NB 4RUCA 2VHGA 2E1CA 4ATNA 1T05A 1WSVA 2DY1A 2NZCA 3L7OA 1WC3A 3UR3C 3DRSB 5GAEI 4M5JA 5J1PA 2HHHF 1ITPA 3UWTA 4DL0C 2GV1A 4NLUA 4CLUA 2FD2A 1YGYA 4IT4A 1VFJA 3JB9k 3T1YJ 1NHVA 2JVOA 3BSOA 3CJ3A 4RPFA 2JNJA 3KZ7A 3OLBA 1TL1A 2J6UA 2C42A 4ZIWA 3U1NA 2MKIA 4KBIA 4PQUA 3RAQA 2QTWA 3KWMA 2HFOA 1HA1A 2O9OA 2FPHX 1YG0A 1HWUA 3I0RA 3OXFA 2HHVA 5EN1A 1W25A 2IRXA 4ZJLA 4X4QA 2R9LA 2ZVIA 1TL7A 3DGVA 3QAUA 5GPRA 3PW4A 1WAWA 5DIVA 1FKRA 2GAHC 2HKEA 2QE5A 2Z58B 3TO8A 1TKTA 1Q7LB 5LSRA 1NKBA 4BDPA 4WF9Q 3C6UA 4WKRA 3F0NA 3CO9A 1LWEA 4J9VA 1HBOB 2VDHA 2LDYA 1N5SA 2CPDA 1RHJB 2DSWA 4ODQA 2IDEA 2DNQA 4I6YA 5KG2A 2XS7A 4RBVA 3TANA 1PJ7A 1ZAVA 2C2MB 1Q53A 2HZCA 3EX7B 2MSSA 3UDLA 1FFSB 3BGRB 4DPXA 1YJUA 1JK9B 3UQIA 2BW2A 2ZKTA 3J7A1 4OL8A 3PR5B 2HVHA 2YNIA 2NXUA 4DZ3A 3ZZZA 5KAKA 2VG7B 4OIXA 2V8VA 1Y0OA 1YVFA 2BANA 2DXDA 2RDJA 4U7UD 2WW8A 5J2QB 4WU2A 3W5YA 2ZWOA 1HNVB 2D9PA 3I0SA 3KXDA 4P75A 4QIVA 1RUSA 1EX8A 4BC9A 4DG1B 3K5NA 1OSDA 2J9CA 4P10A 3PA7A 3KJQB 2W9AA 4J9NA 2Y8WA 1WF2A 3UNGC 1T94A 2BJ9A 3I6CA 2GHWA 4OZ1A 1GAOA 1X4BA 5AE3A 2FZKB 3BH6B 3GE9A 5HBFA 4DV2J 4ES3A 4ZK7M 3AB4B 5KFNA 2DJWA 4MKVA 1XMQJ 3R2CJ 2CNNB 1SH2A 2RQSA 1OY8A 2MPHA 4QPXA 1RK8A 3H2VE 3L4BC 5F3TA 2O92A 5HLFA 1Y4ZB 2G8ZA 2HQDA 1VR6A 1W2IA 2HYIB 1IKVB 3J7YU 4FN2A 3K5OA 1UMJA 3M8PB 4ZPWR 1HHTP 1S7HA 4JI7F 1HKMA 4N41A 3WD4A 1Q95G 1VBKA 1VLYA 1H0GA 1LFPA 2AZ1A 3B7XA 2F8HA 3N6MA 4RW7A 4RZRA 3RJMB 1U4BA 2WM0A 2KGJA 5FDLA 4AT1B 4IQXA 4L6V3 3UR0A 4ETZA 2RU3A 1EETB 1RGVA 1FK9B 4CCHA 2OMLA 3C19A 4DX6A 3HVTB 8AT1B 1DY3A 2JFKA 1FE4A 3CTRA 4EUVA 5GAEU 2NR0A 5HW8A 4HI2A 4KRWA 4RU9A 3GIIA 2A3CA 1KP6A 1PYSB 3TJ9A 4F0HA 4QWCA 3GJTB 3ZZ0A 1T8EA 2ITKA 1RTIB 1TUGB 2OAUA 4DRHA 3GJQB 2KVQE 2QYCA 5BR8J 1K9MT 4DSKA 2AJQA 2W8LA 1VI7A 3O5LA 2CA9A 2XP4A 5AJ3F 4W9PA 3AH6A 4LR8A 1RTHB 4DV0J 3IG1A 1NM2A 3DMJA 3KHHA 4F0KA 4HYKA 1IKWB 1HQUB 2UUWA 4J9SA 4EFAC 4U8VA 3CD7A 1VC5A 1UJ6A 1FXLA 4PUOB 1S0OA 2NXCA 2F9DA 3DFEA 3WIUA 4NLSA 1FEHA 1XBWA 4DUZF 4DOZA 3DXSX 1WEYA 1FDDA 5CYQB 3SQGB 4YY3F 2CQ4A 1S1VA 1K8AT 1RB0A 2QSFA 2PV3A 3DLKB 2X51A 1WC6A 2OPPA 1WUUA 3HHLA 4O44B 4K50A 3TQEA 2BE7D 2C2DA 2FLLA 2VBYA 1X31C 3AROA 4F26A 2DNRA 1TL7B 1RCOB 1I5OB 4QWAA 4DFMA 1T05B 2R8JA 3AA8A 4O3SA 3MFHA 1Z4UA 2JSXA 3N9UC 2N3OA 2VBWA 3IS9B 1C1CA 1RTJA 3IR6B 4CTAA 5KFZA 5K8PA 1VQLS 3BYPA 6FDRA 4JBCA 1FEEA 1NZ8A 2IPOB 2MTLA 1Q4RA 1D9DA 1OYEA 2QYGA 2VF3A 5F8MA 2EFVA 3CJKB 1QSYA 2V9WA 3CWJA 1PBUA 4C6AA 3VQSA 4NA2A 1SCJB 1S99A 4A4JA 4EMDA 5CD4A 3D3BJ 1C2PA 2XLKA 2VONA 4DR2F 4AL6A 2PEBA 1OQ6A 4DCPB 4OYXA 2XLJA 1W1VA 2G2OA 3RAMA 3MMBB 3GCXP 1NH6A 3GYNA 3AOCA 1KLNA 5GADI 2QMWA 3QT6A 2DHGA 1KONA 2FJXA 1RXOB 1PO6A 1NWTA 2XYHB 1RWUA 3HFVA 1R6VA 4YUDA 2CNLB 3CCSS 3GR1A 4MYTA 2ZEJA 2KXNB 3WQPA 4BS2A 4PPDA 2LPVA 1FWLA 5E41A 4HKQA 2DNPA 4S3JA 1W7WA 2YVSA 3V5RA 1CJTB 3CH9A 1JLEB 2ZKUA 3CCTA 2VG7A 3VAKA 2J76E 4K5RA 2VKZG 5CABA 1HNZJ 1TFYA 3T1YF 4DRJA 2AWZA 2YNIB 3EZOA 2MZJA 4TKTA 4N8NA 2ZC4A 3M2VA 1S1TB 3AAWB 3FCVA 3MUVP 3JS9A 2HW3A 2KT3A 1MN7A 5IM0B 2MQNA 1KT0A 5T41A 1S0NA 1R31A 1ZTTA 3W9HA 1OQ3A 2WCXA 1S7IA 4KYZA 4LREA 5D4LA 1TFVA 3WQVA 2IVYA 3MOZA 1Q6UA 5ETTA 3KLEB 3ADAC 3OSPA 5E3RA 4C98A 1SKWA 1IKXB 2DNHA 3GQCA 4WP3A 2CQ1A 4BWMA 1DLOB 1HKKA 3MTKA 4C7QA 2VC1A 4J9KA 3WKZA 3CE8A 4AE5A 4B9VA 3PRBA 1WKLA 2LA4A 5KG6A 3W8GA 3NS7B 3V4MA 4CZCA 2JWNA 5LMNF 1LG2A 5DG9A 1P9YA 2C1EB 4CYUA 4DQPA 2GFFA 3OUYA 3KLHB 4DU8A 1X6NA 5D0EA 4OX9F 5KG0A 4NCGB 2APOA 2DEJA 4R8UB 1SQFA 2KKHA 3OR1B 4ZN3A 4C8NA 4RUAA 3TX8A 1NDLA 3N0VA 4JI2J 3FRZA 3FZBA 4WZQA 1IBCB 4W98A 4DR4J 3KHGA 4F3MA 3EJMA 1FK9A 1VHFA 3MM7A 1NSKL 1ZPVA 2JDJA 3BYRA 4IH6A 4MAKA 3B54A 5C24A 4DCJB 1G2EA 3WIVA 2ZUAA 4DR5J 3ISND 4LJMA 2J7WA 1UEKA 3IA0A 4HR2A 1SC3B 3CHEA 1OO0B 4UOCA 3ILIA 5HWCA 1RABB 2ZFHA 2KG1A 2QMUB 2DNNA 3W60A 1IM4A 5IT9U 3CO0P 1X6LA 2AZ3A 3KG0A 4E98A 3MM6B 2CVIA 2DNZA 3IRXA 1L5UA 2JH3A 5ETKA 5E3QA 4KGXB 1U1KA 3QRRA 3U1LA 1M5OC 4H4OB 2C2KB 2VPZB 4ZVGA 2K8IA 5HQLA 2AYBA 2MZSA 2Y1LB 2MLYA 2YKMB 3MM9A 1FFWB 3G6LA 2MQ8A 5HL7Q 3J81U 2Z4PA 4ZMMA 2KHDA 3Q8RB 2B5JA 3UI5A 3JQKA 3BS9A 5D4OA 4DT4A 3ALGA 1TCOC 5GAHU 1C1BA 2RHSB 3C14B 2DEIA 4FXWA 5DQGA 3CZ8A 3KFWX 3W5ZA 4CNZA 1QLNA 4E0DA 3X1LB 1NO8A 5BR8F 1IR1A 4A8OA 2PI4A 1W9PA 4K4WA 3HHLD 3NGKA 3R1HA 1QTMA 2YWHA 2IRYA 3DOMB 4N5SA 3WD0A 4FVMA 3VVUA 2ESCA 2R7VA 1UL3A 2YPYA 3WC0A 3HHLC 2LU1A 4ELVA 2ROEA 2X1BA 1ZZFA 3KJVA 4Q8FA 1SI9A 3Q2SC 3H2UB 3QLHA 1S10A 1EP4A 4WE1A 4DQSA 4J37A 2BOAA 5IZHA 4BHQA 3T9ZA 3GONA 2EG2A 1XMOF 1FKDA 3BPSP 4MYUA 2FUG9 3EM1A 3B9DA 4DUZJ 3WL1A 4KE5A 4F4ZA 1QAIA 1F9HA 4P8XA 2BM1A 2F23A 2A2DA 1U02A 2HIQA 2YKAA 4Y2KA 1N54B 5DZ7A 1OWXA 3DGPA 2OH2A 2ZD1A 3D4JA 3QFHA 2UUAJ 4FYXB 4B3SJ 1XNRJ 4DS5A 2RQMA 3QT8A 4LIRA 5KT4A 2D3OR 3LPEA 3MI7X 3MECB 3UD3P 1AROP 2ZD1B 2ZH1A 1SC6A 4A8XA 3D6TB 3VAJA 4QYZK 1SUQB 1N88A 2MZ1A 2IM2A 2BQ3A 2CPIA 1JNRB 2F5GA 1WHXA 1J4IA 3MPYA 4JOUA 4C3MA 3VAMA 3IWXA 1FT8A 1GMVA 2DCLA 3NGSA 5E3PA 3PEJA 7FD1A 1VRUB 3NAIA 1FKGA 2DGOA 2OPSB 5I3UA 2J9EA 2XP3A 4TU8A 1CQNA 2DH9A 4C8KA 5E3AA 1VISA 2R7XA 1UETA 2KO1A 2K2PA 3OFFA 1N1AA 2XMMA 3I0SB 2KB2A 4CRJA 4QYZJ 1XN9A 2CPHA 4O0NA 3W63A 2BVZA 3X3UA 2RT3A 4CO1A 4RNFA 4RW9A 1WC5A 1HFEL 4GO5X 2ZJQQ 2PGCA 2YH0A 3LTOA 1Y11A 2QL5B 4L3KA 2V2VA 4HH0A 2FVRA 1NK8A 1W1YA 3MMAA 1X9MA 1Y9OA 1LK7A 2HFUA 2CWKA 5CD4H 4NLWA 2MYFA 2ERRA 2J8SA 1HD1A 1B70B 2BABA 4P8VA 3FFIB 4FP9A 1NLKL 1D3WA 1URRA 1OY6A 5ETLA 2DVIA 3CDBA 2GMJA 3T41A 4DR6F 3HD1A 2H5JB 3VZHA 3GV7B 2F3JA 4OZ2A 4R5PB 3IKDA 2M9KA 3H4BA 4K4XA 4KB7A 3LGNA 3GV8B 1N0VC 1UFKA 4DL4A 5EHHA 1JCHB 4L75A 1LJYA 2P9GA 1HHQA 2IM0A 5KT2A 3OVBA 4CI0B 5D3GB 3PW5A 2CYYA 4USWA 3HMJG 3R5DA 1VBXA 3MEGB 1RLCL 1D0EA 4K59A 1HI8A 1Q81T 4LF4F 3EUNA 2LQ5A 3R5JB 3S1TA 4I2PB 4DV4F 2DPJA 4JV5J 2OTJS 4JI3J 1R8HA 5G0RB 2AW0A 2LDIA 2ABYA 3CJTA 5D75A 1A7XA 1RTJB 2E7VA 4Q7AA 5ETSA 3O44A 4CH1A 2AGQA 4BLGA 1ZETA 1C1BB 4KGKA 2WSEC 3ENVA 1KWMA 4G1PA 2IAJB 1HARA 3AQOA 4OLOA 3FSYA 1HJXA 4DROA 3L9ZA 3QGPA 4KGZB 5IT4A 2HHWA 5KG1A 1X4CA 1PBKA 4KSEB 2B4UA 4DWSD 3KLFB 4CO3A 2OEMA 2Q43A 2FHJA 3GCWP 5JH8A 4QIGA 2YKNA 3EMTA 3M8QB 4I2QA 1B0TA 5CHCB 3QRPA 1FCAA 1FRIA 4Y0FA 3VR1A 3BGOP 4XDDA 3OL6A 2LXFA 2LYVA 1TKDA 1FE0A 2IYGA 2MPUA 1E6VA 1TTHB 3M2UA 4LR9A 2FY1A 3MUTP 4JV1A 5DDRC 2GMLA 1IXKA 4DV7J 1NPPA 1HNWJ 1V6HA 2WSCC 3CJRA 5KOWA 3HK2A 3Q8UA 1BGXT 2LEAA 3GG1A 3VZIA 3ZTRA 4K4VA 4KJIA 1K0TA 2HQFA 2H51B 3IG1B 1MLAA 3Q8QB 3DI6A 3MM9B 1NWSA 1L3SA 4I64A 3SCJE 4KH0B 1ZCNA 1QJHA 3M6VA 3EZUA 4K7QA 3TVYA 5KFCA 4IRCA 4S3KA 1OSCA 4ZHRA 1Y00A 3V6HA 4GKKJ 2WK2A 3LP1A 4O4GA 4ECYA 1SH3A 1GXTA 1VLOA 3FC9A 2MKJA 2WVCA 4PTMA 2CQCA 2HAFA 3N5FA 4NWBA 3QGGA 1B6CA 3D3CJ 3R7SB 4X4TA 1QY7A 4U95A 4HDGA 2E66A 1ZS6A 2VICA 2PSZA 5M2RA 1TMJA 1R8PA 2AP6A 1EQ3A 4ODPA 2D74B 4IR9A 2UXDJ 4GVBA 3NAHA 3N79A 1LKZA 1JJCB 3E3XA 1CBKA 4DX7A 4CT8A 4ECVA 3HSGA 2A3AA 3OXGA 1YKWA 2QLJB 4AXIA 5AE2A 3BGFA 3PY8A 2QSWA 5A6WA 2EFQA 3HJVA 1B64A 4F4WA 2LKNA 2DR9A 3QOKA 2QA1A 4IDKA 1UVMA 2UP1A 1M1KT 2YX4A 3EZ5A 1JB0C 5KG4A 4KHPF 4ILRA 2I9SA 2FTRA 4QWDA 4ED1A 3PRAA 2ZBIA 4KY3A 4RNOA 3BGUA 4QU7A 2EFNA 2L41A 2I8EA 3LUOA 1GMWD 2HQ3A 1DQ8A 1U8SA 2V8GA 4BWJA 3IBFB 3PACA 3SDEB 3NGRA 1VC0A 1S49A 4XAKA 1VCTA 3DRRB 5B0FA 2R2TA 4DR2J 5L39A 3HM9A 1IBMJ 3C2PA 4OI4A 3MDFA 4CLLA 1HD0A 5THWA 3PX0A 2IVMA 2RHQB 1RKJA 4I7FB 4BF8A 4KGMA 1HR0F 3WD3A 4WXOA 2RUDA 2H5EA 1PBAA 2LQ9A 4OV6A 5IV3A 4X65J 1Q6HA 4ZVUB 2A0FB 3OL8A 2VU5A 1NJXA 2QFJA 4X84A 1DTQA 5EWFA 1C9HA 4A8WA 1V3ZA 3I82A 2M8DB 5AE1A 1PGZA 3W5XA 2GQ2A 2VIHA 4OHVA 3F41A 4P7TA 5C42A 2X1FA 2AJ1A 3CCWA 3M6XA 2VL1A 3QWPA 3SFGA 4EBCA 3DYAB 4NZ6A 1G7CB 3BSCA 1HNZF 3NL0A 3H5YA 1U1RA 1ZOTA 3TAMA 4OZLA 2GO9A 1YIJS 2CQHA 2RS2A 3V6DB 2KI3A 4DU7A 5GPGA 4UOGA 2HHPA 3QRQA 4F2SA 3DRXA 3CXCR 4Z2GA 1S6QB 2FJWA 3MMCA 3D7SB 3J81j 5HW7A 1N6QA 1BQNB 3D0GE 3HT3A 2DGWA 3MM5A 4BCAA 1J5OB 4FYYB 2WONB 1N34J 1NCLA 4R5PA 4WFZA 5B09A 2RUQA 1KHVA 3TCZA 4ED5A 3M9NB 1SL1A 4ZVQB 3QLHB 2ACYA 3KYLA 4AXJA 1WORA 4FPRA 4CIOA 3SZ2A 1N48A 1AW0A 2IRUA 1WI8A 4NNRA 1TL3B 3B4DA 2HPUA 3BBBA 2C2RA 2BKNA 2VPWB 4ZVPB 3K8VA 2XP9A 3DCAA 3E2EA 1FAPA 1LWCB 3SBMA 1RT4A 2F4VJ 1RWNB 2E1RA 4IFYB 4YQWA 4YR2A 3HFKA 2MKKA 1XJWB 1RWMB 4RW6B 2MGZB 3UO0A 3O5PA 4ED2A 4F50A 3CNQP 5HSPA 3NI6A 2MKSA 1FF2A 3IBCB 5K20B 1BKFA 1YJVA 4EO8A 5KFOA 1FXDA 1MWYA 1ZA2B 2EWHA 3DI6B 2DT2A 1DAXA 3LWMA 3ITHA 3MFIA 4JV5F 1I3OB 4WKAA 1S1VB 2O3DA 3GMGA 3L7UA 2RDIA 2FGCA 4F8RA 1CQMA 3A3PB 3PFOA 1X5OA 3C66A 1WNEA 2X3DA 3MWBA 4WIQA 1YQHA 1ZAWA 3RRKA 1RT3B 2V0NA 3ENWA 4QR2A 1OGBA 1JLCB 1X4AA 1Y5LB 2OFGX 1LNQA 4M8LA 5HMYA 4X4OA 3JSMA 2ZH2A 2DG9A 4NRTA 4LAYA 1F5BA 1GX5A 2U2FA 3QZ8A 1EP4B 5CYMA 2V69A 4CO0A 4QT2A 2HHQA 1HQ2A 3C15B 5F3ZA 1F5CA 2G9OA 4CLPA 1GXUA 2UZ5A 2L08A 4ZP8A 2HFNA 2NPIA 4G65A 1MN9A 1PAEX 4USTA 3IM9A 2MF9A 2DNLA 2XCAA 3HVAA 4HHHA 2HGMA 2YNFA 1L3UA 2XNRA 3CGMA 1T0TV 1TKTB 1VDHA 2FVSA 2ASLA 2OPRA 3T6JA 2E9TA 3KOAA 4XPEA 4X64J 1GRJA 1Q8KA 2FVCA 2XY6A 1FDBA 4HLBA 2UUBF 5LL6d 3MCNA 1XK8A 2K7JA 3B78A 1FFGB 4I69A 2J0QD 3OTOJ 5E7OB 2MQQA 3FKBA 4DPUA 3KLGA 3BSNA 3ARQA 1TAUA 1D6OA 3POTA 2ZOFA 3CCES 1D1UA 2F7VA 2IIHA 5A2QY 1F8AB 3HULA 1R9HA 3EVOA 3RM4A 2ZH8A 2JC0A 4OJGA 2O5DA 2QEXS 4GKKF 3G82B 1UKUA 1FRKA 1MWZA 1LFWA 1XERA 2PO4A 4F0MA 2J6SA 2XG8A 1BXNA 2EI5A 4OYBA 8RUCA 1FRMA 4XDCA 2LVWA 4HT5A 5IC4B 3DLLQ 1NMEB 1U79A 3M1VA 5U47A 5JVGQ 3PIOQ 1Q16B 2VC0A 5SUHA 4DV3J 1KTQA 2ACMA 3EXYA 3H5SA 5IQQA 3TI0A 1T3NA 2IF4A 3IO1A 1BL4A 4RX6A 1X4HA 4Y3CA 1VQMS 5FJ4A 3KJNB 4M95A 2MKYA 1NBEB 2BACA 4PXBA 4I7FA 5A6PA 3T19A 2G4BA 2AEFA 2FHMA 2QA4G 2QLXA 3CJSA 3DLJA 3P4UB 5KFAA 4DPOA 1KRPA 1F6TA 1EZZB 2HVEA 2O66A 3UI6A 4LRFA 4O3QA 4HH1A 1Y5NB 3NS5A 4NZ7A 2N87A 1UFWA 1BQNA 3SDEA 3TUJC 3BO4A 1MNEA 1NU4A 1RT6B 4B3MJ 3KK2A 4DV1F 1WI6A 2N7YA 3FXYA 4YR0A 5H9EJ 3OHAA 3PXGa 4AL7A 2XNQA 4WJXA 2KRBA 3OFHA 4C11B 4QPTA 2NSBA 1OPZA 1ZBTA 3OVSA 2M5YA 1T9UA 1CULA 1HBUA 5H9FK 2V50A 3N28A 4QJVA 1FD8A 2U1AA 1E9LA 3HKWA 1F9FA 5CH7B 3TR5A 1H6KX 5K8NA 1OY9A 3HVRA 1QPLA 1S1UA 4PXCA 1EAYC 3O6QA 2UV8G 4CLWA 1N5TA 1N6QB 1QPFA 1UJ4A 4Z2JA 1JLFA 1RA7A 2MNTA 1TQLA 2K8GA 3FBBA 3PHTA 5KFFA 4PXEA 3SIPB 3T9NA 5MLCV 4X4UA 2QJ3A 2JJ4D 2AIRB 1NJIT 4IH7A 1U1PA 3V6DA 2VB6A 2B6AA 2OIHA 2DH8A 3KK2B 4JB8B 3C16A 3PIPQ 3O8WA 3RAXA 2HFZA 5B0CA 5K14A 4QWBA 5GAGI 1UR8A 5HWBA 1BQMB 1S9GA 1DQAA 3CDUA 3FBFA 3IFEA 4OMFG 2H1YA 1YATA 2PE8A 3M2RB 4OI2A 4RW4B 1QDUB 4ZLPA 4N7TA 3R27A 5L9XA 5A0YB 3KAGA 2LECA 2OPPB 4F4XA 1V5IB 3RGIA 2GVDA 4OI0A 3OLAA 1JLAA 4MMOA 2I38A 1FO1A 3DDNA 4H4OA 4Z2HA 1VRTB 4B3OB 2JZVA 2AD9A 3VHQA 2X7IA 1H74A 1I94F 4GKJF 1WDDA 2GIRA 2XP6A 3ONQA 2GVDB 3CHCA 3GFZA 4Z7YA 2DGUA 2V4JB 4DL5A 3RB6A 4M5KA 5I3QA 4YP3A 1T9TA 2NREA 1MMLA 4LFBJ 1HL6A 3DDIA 4NA3A 3IHZA 4OV1A 4DF4A 2IM1A 2KM8C 1T9YA 3HVWA 2Y8YA 1WF1A 2ZZNA 2UZAA 3QZ7A 1TL4A 3FJ2A 3MM8B 5HO4A 5HQ8A 2PDAA 3M8SA 3E01B 2DGSA 4NZCA 3DDKA 4TYAA 2MQOA 4Q8EA 5D6GA 1RU1A 2L48A 3HF5A 4ZP7A 1CG2A 4IKAA 3ULHA 1KQGB 4M5IA 1NDKA 4QW8A 1U1LA 2YWGA 4FF4A 2R7WA 1GNKA 5BXJA 1K1QA 4OX8A 4GRSA 3CPWR 4MGVA 2E7XA 3OV7A 2CJYB 2RUGA 4I56A 2KFNA 2BKOA 4PG7A 4ZJQA 3J80U 1R0AA 2LCWA 4RKUC 1D9FA 2W9CB 1ROFA 3CCUS 1Z2ZA 3MR3A 4JI1J 5F9NA 2FVQA 1UZHA 3G86A 2Z2YB 1FD2A 1SH0A 2KTQA 3NNCA 1QE1B 3AODA 1CJVB 1JXVA 1RQ0A 1FKIA 2CZ4A 1RWKB 1MG7A 2AX1A 4KGVB 3Q8SB 3M1VB 3A8JA 3IR7B 3NGUA 3TZZA 1X0FA 1N5YA 4JI6J 4FKXA 1Q1CA 4MIBA 1N34F 4USHA 2ATCB 2R7UA 1PKUA 3H8YA 4IOAQ 3ET6A 5F41A 3Q23A 2IC3B 2WOMA 2ZBPA 2NSCA 3DLGB 3VCDA 2V4QA 3D68A 1FRXA 2DH7A 4YFUA 4NSBA 5J2QA 5I42A 1PJ6A 4JI5J 4UW2A 3WDOA 3FDSA 4LF5J 5B08A 2E9ZA 2CDRB 2HG4A 3M30B 2H48B 4IH5A 1H7WA 1RU2A 3HHEA 1WC0A 4PG5A 1H98A 2OUGA 3LANA 4USVA 4DL3A 1KQFB 1HWIA 4DX8H 4F25A 3HI9A 5KT6A 3V4IB 3RBXA 5CXTA 4TU7A 1S1UB 2IM3A 3MCSA 4FDFA 4NLOA 2DGXA 4ECSA 2KVIA 2OD6A 1NHKL 4QIWD 2CPYA 3PO5A 2FAPA 1SB6A 1CJVA 3CCVS 5JJBA 2A18A 5HMXA 3CJ8A 5AJ3J 3M8RA 3I9ZA 3HHDA 5D3GA 1B0PA 4LSNB 3JYTB 3TEGA 1SJ1A 3M8PA 1GK8A 4ZA1A 1NPKA 5KFKA 2KI2A 2WW4A 3CSKA 3DOKA 3S6EA 5J1EA 2ZH4A 1NK9A 1S4EA 5HAOA 1HMVB 2YXLA 4YEAA 4XO0A 1OJ4A 4DV3F 3LA0A 2P6TA 2F65A 2B4OA 4J4NA 2B9WA 2BM0A 2NPFA 3RBDA 1SL2A 4YY3J 4IFVB 3KUHA 3KK1A 2Y0SD 5LXYA 4FYVB 3IWLA 4YR3A 1HMVA 4Q0BA 4CYUB 3D6FB 1HPZA 1HWKA 2CJAA 5DS7A 1SIZA 1M5KC 4B9NA 3NMAA 4WE1B 3JSBA 4G1IA 3G4SS 3QYYA 4ECTA 1DQ9A 3IS9A 5M2PA 5CQGA 4Y34A 2ZM6F 1REGX 1Y3JA 1BC6A 4TU9A 1YX2A 1NDCA 2RF2B 3QIDA 2V9KA 3G6XA 1IBKF 4ENOA 4I1TA 4B3MF 5DETA 3RTVA 4FF2A 2DXEA 4O3PA 3OVAA 4KTQA 2KXHA 3M2UB 4LT6A 4WK9A 2YQ3A 4CLFA 3V81B 3AS1A 2O1PA 4CNYA 4DRKA 2DXFA 3D6HB 5F0UA 2EFOA 2W9BB 1B3TA 2DNMA 2GJ2A 1YW5A 4ZKAA 3HPOA 2XS5A 2LXUA 3GG0A 3CDAA 5C5JA 1P8GA 3LAMA 5KFMA 4LFAJ 2W2MP 4ALZA 3KK1B 4PXDA 1RWOB 3B6BA 3N01A 3QSIA 2BUNA 2DBBA 1RBAA 5AXMA 3VWSA 1KBRA 3O2IA 1J27A 2GGPB 1WACA 5LT5A 2L9DA 3CEDA 5ADZA 4WFBQ 1S1WA 4C0OC 1LW0A 3DN9A 4GMKA 3I5BA 3QJJA 2AV5A 4MNKA 4DRNA 1LXNA 1RT7B 1JNZB 2JC1A 2ZHBA 1L3KA 3B8HA 5D8HB 4DUYJ 2Z2ZA 4ZPTR 1CJTA 1JLEA 2M8HA 1H0HB 2H54B 3CD5A 3FUYA 3ISNC 4GO7X 2HGNA 4WJBA 2Z0GA 3L95X 3VQTA 1B0VA 1S9FA 3TX0A 4PQUB 1RACB 3F73A 3W9JA 2CPJA 2OPQB 2V2ZA 4IDKB 3D1QA 5DDOC 3JXVA 3TQ1A 1VHIA 3BR8A 1NKEA 4QBUA 1MU2A 2W01A 3GYXB 1N32J 1RAEB 2YKQA 4L76A 5CYMB 2ZQSA 3AOAA 2AOSA 4M1KA 4UY8T 2D9FA 3M05A 1JJHA 3CVKA 3MCOA 2ZH5A 1LL7A 4ODOA 2SXLA 4P73A 4GC7A 2Q5AA 1F9EB 3PYGA 2R8HA 4GVBB 1WOOA 5KG5A 4YOEA 3KAIA 2KR7A 1B4SA 4NLPA 3J81Y 2A10A 2GO8A 2FYXA 2VV5A 3BF4A 4GKJJ 1RYRA 3TOQA 4YB5A 5JMNA 1NNDA 3DRPA 4ZOSA 3W8PA 4IQCA 2W2OP 4HDHA 4WP9A 4FBTA 1HKJA 4P9SA 1U1OA 2ZJPQ 2E9RX 2B4VA 3D6MB 1PYOB 1YBAA 4OZ3A 5KFXA 2F4FA 3GIRA 4NYOA 4KR0B 2H9ZA 2KJWA 1M5HA 2CAJA 3EE3A 3I5CA 3GJRB 1X8DA 1DLOA 2VFUA 1TUVA 3W2VB 4ES2A 1D7JA 4I67A 4NLYA 3G8SA 2IFXA 3KACA 2C28A 1K44A 5KFTA 2KFZA 3ODKA 1LWFA 4QR0A 3US5A 3TAPA 3CCQS 1ZZNA 1O6IA 2GIQA 2HVIA 3K57A 2HVZA 1SJQA 2ZDPA 1RT1B 2L9WA 5K14B 3CDWA 4WK1A 2Y1RI 4LRDA 1NSQA 1XR5A 2GX8A 1FXRA 4K2XA 2W24A 4OI1A 3O5FA 4CO2A 2R7OA 3PR4A 3Q2TC 4DR4F 4Y65A 4H54A 1B99A 4J7CA 4OHWA 4DPWA 5EWGA 1LEOA 3D9BA 2CNKB 2EG1A 3IGNA 4IG0B 4MK8A 3K2YA 2ZR5A 1U7LA 3BMBA 3B9EA 5FD1A 4JV0A 1FJDA 3QO9A 4X64F 2ZM6J 4JI1F 4K4SA 4HACB 2EFGA 1YK9A 2JX2A 1H0IA 3OBIA 1JXLA 3M8QA 1WHYA 3NEKA 2LQJA 2ZQUA 1F60B 3H98A 3SMZA 4R0XA 3VAGA 4DL7A 3T1HJ 4MNJA 1S72S 1TMMA 3LP0B 1RWPB 1RT2B 2EKYA 4NI2B 5AT1B 2HBRB 3DXBA 1HKIA 3TAMB 4K4ZA 3KAFA 3UD4P 4G2PA 2MZQA 1JWWA 4IO1A 4R0EA 4PWWA 1JVWA 2W25A 4Q0BB 2PN6A 1X4FA 2EK6A 4DR7F 2X3GA 2DG3A 3BB5A 2XZDB 1Q6IA 1YBTA 3AB2B 5KOXA 2JZ5A 4MNLA 3CJ5A 4KFBB 4RUBA 3V2UC 3THTA 5HBMA 2E1MC 3MMJA 4KH1B 3M9OB 4F36A 2Q66A 2C2ZB 4MAVA 3R97A 3CCZA 4FS2A 1JJ4A 4AD6A 3IMQJ 2N4DA 3FGVA 2ZVSA 1H7XA 1R8BA 2RB7A 3MGJA 2HK2A 5KFIA 1U6FA 2DYAA 1FKTA 1W1TA 4RW8A 2K7KA 3T5KA 1FRHA 3JTNA 1YJNS 3FEYB 2YQ1A 3M7VA 5GADU 1OWQA 3CCLS 3LPYA 3PZPA 1NB7A 3FSIA 3C14A 4FXDA 3MEKA 4DN9A 1AUDA 3PRVA 1E6PA 2A1BA 2D9OA 3TNVA 4UDMA 1FERA 2DT1A 3DRYA 2DSVA 3OTCA 3KDNA 3UFCX 3ICLA 3UNYA 4O23A 3TWZA 2XY7A 3ZTPA 1GT8A 4RR5A 1ZM9A 4OYOA 1XMOJ 4PWDA 1R43A 4U7CA 2RKIA 2KM8B 3FBEA 4ZITA 2FLPA 4TQSA 3TEHB 4Y00A 3H25A 1T3OA 1OPIA 2BDPA 3KUEA 3UN5A 1A9NB 1IWGA 2ZZTA 2R7RA 5CZVA 4QIFA 4DWSB 4B3SF 1FESA 4WFYA 3I4PA 4IFYA 4RNHA 4B9UA 2AF6A 1E6YB 9RUBA 3G96A 4H4KA 3RM8A 1KEKA 2CQ2A 1L3TA 4PQAA 1WDTA 3I87A 4HEA9 4LSLA 4Y6IA 5F8LA 5L1LA 3VAHA 2D3UA 4W92B 4JYAF 2DNOA 1H73A 1AUSL 3CMQA 3KJFB 5T14A 5FLXY 1X5PA 1E6NA 1ZB5A 4PKDB 4I68A 3ZTOA 1KSPA 3PX6A 5HK4A 1ZU8A 1CJUB 2R7QA 3DRRA 2ZNZA 3C6UB 3G6YA 1IKYB 1VRQC 3KG1A 6FD1A 2Q6CA 3U7JA 4A47A 1U24A 3I0RB 2E5LF 4P2SA 3TC5A 2RKIB 1M5YA 1F40A 1FKBA 1SUQA 4CQ1A 4LFAF 4URIA 2FC8A 4P74A 5K8OA 1HQEB 1NK0A 2EK1A 4WKFA 4NYPA 3OTBA 3BJYA 3TUPA 3FVYA 3K5PA 1RAAB 3SYZA 5H9EK 1ULRA 3LWLA 2AWGA 1H2VZ 2XULA 2CFXA 1K73T 3W62A 2MXYA 1YRTA 5T7LB 3IN5A 3GWCA 1I94J 4Z37A 1P27B 2OFHX 3TUIC 2LFVA 4X66J 5KT7A 3CC7S 1SC4B 2OPRB 2AJ4A 3I96A 2FDNA 1KTVA 4V1Ak 1NKCA 2DGTA 4WU3A 2W8KA 4LAXA 2A2CA 4MPKA 1VQ7S 4OJHA 2V2KA 3PDNA 1CLFA 2VCDA 2OEKA 2M2BA 1FWPA 3OW2R 3A3NB 1XHGA 5KFSA 5A2QU 5J2PA 1WTBA 4QT3A 3V4IA 2AT1B 3MAAA 5DM7Q 3OHBA 2HZAA 2DNGA 3PTWA 4NLTA 3PW7A 2GS8A 3GIKA 3RB4A 4B9MA 3UF8A 4M5NA 1YWXA 4ODNA 3VF0B 1UWBB 3VAIA 3MEDB 1NJYA 1KNZA 2DSZA 4EYHB 1WB0A 1RDRA 3GIJA 1RTHA 3GPAA 3KTQA 1UPMB 4JV2A 4JFJA 1BWVA 3PVXA 2BBEA 1XIQA 1JLBB 5HP1A 2HNDA 4LF4J 4G1QB 5C25A 2VPXB 4DV4J 4F3OA 3KCEA 1NK5A 3L09A 2HNZA 2UVUA 1KOOA 2GHPA 3GLJA 2KFYA 1SPBP 3CIMA 3JSRA 4Y2CA 1DZ5A 3SQOP 1XNQJ 2QL9B 2W2QP 1RADB 1NWRA 3ZZRA 3NNHA 3SCLE 2BJDA 5HANA 4CLYA 4DRPA 5HUAA 3MR6A 1LL4A 4EI2A 4OHYA 4DFJA 1RSCA 1D9AA 5KFDA 3AQUA 2R3VA 2R2UA 2AYEA 3O5KA 3FSXA 2ADBA 1TELA 1XMBA 1S6QA 5L38A 3AJ1A 4ILMA 1CVJA 2F4EA 5HBMB 5EWEA 1HWLA 3HKZD 1CULB 1HBUB 3K89A 2LQBA 4MFBA 1C1CB 3S8SA 4LF1A 4OYMA 1R89A 4TQRA 4ELUA 5RUBA 4P6QA 3OFEA 5J6EA 4YDXA 1HNWF 2PPPA 2QIFA 4I0WA 4X4PA 2PI5A 2V5HG 1EQ0A 3TARA 2HNZB 3GZ7A 2A6MA 1V3RA 2VZ9A 4NL5A 4G50A 2XCPA 1R7IA 2G13A 3CGNA 3ENAA 5B0EA 2G2YA 3W9IA 3MM8A 4X4RA 2DHHA 1ITXA 3NCPA 1N33J 1RWWB 1JNDA 3O5EA 2N82B 2XY5A 1SQGA 2EBGA 3TJAA 2YWEA 4C8LA 4LSZB 4RW6A 4IR1A 2HRYA 2CJ9A 1S79A 2XWXA 2JFDA 4ZVEA 2AGPA 4YB6A 4J90A 3UI4A 1HHSA 1F3VA 1UFLA 2QX0A 3TA1A 3O5QA 1URNA 4PRFA 2V4JA 1YLXA 4J9LA 2OO4A 2ZR6A 3HLUA 3W65A 1LXJA 4JUZA 2PT0A 4A8SA 2DCUB 5KFRA 3EPGA 2XHWA 1VQKS 2QRRA 4P2MA 4D3GA 2AHOB 1AYEA 1J2VA 5ITHA 2PMWA 3N6LA 5DG8A 3O5DA 3BKUA 2A3JA 2YKOA 1GTHA 1WG1A 4ZVOB 1UR9A 4JI5F 3CULA 2OKQA 2HIYA 2YPZA 5SZTA 1V9OA 2HVDA 1RHKB 3KHRA 2MGZA 5K8MA 3WQWA 2DD8S 4IRDA 1RISA 3OT9A 4DV0F 4JI8J 3A8KA 3IRWP 3M32B 2HQGA 3T5LA 2PEHA 1RP5A 3D28A 3G87A 1K1SA 1TKZB 1WHWA 1IJEB 2DGVA 2W2NP 3DRPB 3H5UA 1DFDA 3BN7A 4WBFA 1U49A 2DIUA 1F3FA 3RYLA 4LFCJ 4DSFA 3HDSA 4FF1A 2DTJA 3AXMA 4LQ9A 1HNIA 3KG4A 4DG1A 2XSJB 3EGWB 3P49B 2MJUA 3U27A 1NAQA 1BD6A 2J0SD 2VN1A 1YRXA 2CG8A 3EGNA 4X62F 4HACA 4DZ6A 4GC6A 3RRGA 4FNIA 3FK4A 1NH8A 3RBZA 2XC9A 4MNMA 4U67Q 3LALA 3M4XA 2KT2A 2I2YA 4OHZA 2ZH6A 3PR9A 3DKDA 5LJ5Y 5HROA 5GVQA 1RHRB 4TXSA 4J9QA 2CQ3A 4WYLA 2PI6A 4R8UA 3MPWA 3UE2A 3NCQA 2UUTA 2YKPA 3UDCA 3Q89A 2BR0A 1D8ZA 5ETNA 2L2SA 4M5LA 2CPEA 2AYGA 1T02A 2V2QA 3M32A 3M8ZA 2WHOA 3SV4A 4K0KF 3MDYB 2XTJP 4F04B 5L8RC 5LXRA 2C3UA 4RW9B 2J7UA 3QT5A 4RL1A 4FKYA 4OX6A 3HSDA 5AXKA 5CYJA 2HLTA 1GMUA 3JYMA 3RB0A 1YTYA 1TKXA 1DHMA 3NOCA 1N5YB 1TVRB 3LP0A 3PX4A 2DY9A 4LAVA 2RRAA 2IBKA 5KFJA 2YNHA 3SV3A 2Y1JA 2FQQB 4CO5A 1DBDA 1JIHA 4BC7A 2GQQA 3IXQA 4JFMA 2VA3A 3QO9B 1UA1A 1N52B 4DJBA 4DQIA 3JSYA 1HKAA 1C0TA 3ARSA 1UTAA 2P9CA 3PJWA 4WXWA 1PYTA 3FNNA 3SSQA 4DZDA 1FNXH 5KFPA 2CADA 4J9UE 2BV3A 5HJXA 1EDQA 1X4EA 2FJBB 2M4MA 2WONA 2R8KA 1FFRA 1AA1B 3P5BP 2XMJA 3EY6A 1CS4B 5B7WA 5HMWA 1YI2S 2P9EA 3WC2A 3KLFA 1ZK6A 4ML4A 5IWAF 2KZMA 1AT1B 1ZBCA 4ID5B 2EVZA 1RBOB 4Z2XA 5AXLA 1Q8BA 4PWUA 1OS5A 5A8RA 3UQSA 2BKPA 5HKGA 3QJPA 3KK3B 4LQ3A 1JLFB 4OQJA 1U1NA 1M5PC 2VJUA 2ADCA 1NPRA 1UW9A 1F2HA 1UZDA 2Q1LA 4HHJA 3S7RA 5A8RB 5GAHI 1G6BA 3CCMS 1NK4A 2DR8A 3MD3A 3CMES 4FF3A 1SQEA 1KT1A 2W4PA 4ICLA 3MPVA 2VBXA 2RQ4A 1CJUA 4FXVA 5L1KA 4ECWA 1HI1A 3DHWC 2FHJD 3DOLA 4DV2F 5E3CA 1K9TA 3CT9A 3EWGA 1S77D 5EX0A 3T1HF 3NG8A 4J9MA 3NTPA 2J0XA 1Q5VA 4E2FB 5KFHA 2Z2MA 3IGVA 2YBUA 3AY0A 4LVOP 4O0IA 4ED3A 1APSA 2ZC3A 2UVVA 4DPYA 2HNYA 3VAFA 4FNHA 3AFGA 1HXVA 3OFGA 4LF7J 2RQKA 2B5JB 3W3SA 2VFTA 4C0BA 4H4KC 4B3OA 5K9FA 1T9XA 2NCKL 1N0UA 2IMOA 2AX0A 4RLEA 5KFLA 1R6YA 2EKNA 2I5JB 2XGQA 4DR3F 2NS1B 4ZVSB 4V19J 1CTNA 3MOJB 5K5MA 2HS3A 3LO3A 2DHAA 2OSRA 1RAJA 3RZAA 4ZPVR 4WKYA 5CAAA 4C8MA 3BQ2A 1JKHB 4DR5F 2YWWA 4NMXA 4O3RA 2GJIA 5H1SV 4URGA 2PV2A 1FJ7A 1WEZA 2MQMA 3SXLA 4E8UA 1DTTB 3TZXA 1IR2A 2MZTA 3EYZA 1D8YA 1JNTA 1FKHA 2BJ7A 4OZ5A 2YTCA 3L7PA 2QT7A 1LQ0A 4OLPA 4QOTA 3TA0A 5J2MB 3RW6A 2W2PP 1VYAA 2ILYA 1SJ4P 4DLGA 4R25A 2GNKA 2KN4A 4P52A 2G1DA 4LRAA 1S1TA 1GTEA 2AMCB 2K1RA 5ETPA 5CZXA 4ODMA 1PIEA 2LJ4A 1K47A 5ETVA 3H40A 3R1LA 3QQCD 2W7PA 4RU2A 5HATA 1PAUB 2VFSA 3WZ0A 1SR0A 1X7VA 3J7YI 1IR0A 2FC9A 4PCQA 1SJ3P 1PCAA 4QR1A 4ZPBA 1QVGR 4NCBA 5DGAA 1M1GA 1R0BG 2CJQA 2M52A 2BMBA 2VFVA 1JKHA 3LGMA 1ZM4A 4UQTA 4NLVA 5ETQA 3VGSA 4B3RJ 3BKTA 3DM2A 4K4UA 2BE9B 2EXUA 2GW8A 3FY1A 3D54A 4AUKA 3I32A 3T3FA 3K8WA 1VQYA 4WFAQ 5HN0A 4JYAJ 2J5AA 3PG9A 3T1AA 3R5CA 4KC5A 3TZWA 5EGYA 3TRGA 4JFKA 1GMWA 5CCMA 2YWKA 3ET6B 4DV1J 1YRUA 4A8FA 3QIPA 3PW2A 3AHPA 2CDQA 2G1HA 1IX5A 2BYCA 1WTFA 1X0PA 2BX6A 2J8AA 3H5XA 2QF8A 2R2SA 2VASA 3A13A 4XIUA 1YZ7A 4X4SA 3R5GA 2DHSA 1YZ6A 3DMJB 2E5JA 2WTFA 2E5LJ 3ARZA 1NMWA 3ARUA 1Y3KA 4KHMA 4LAWA 4ANEA 2Y1IA 3Q8YA 3RMEA 2YBTA 2HWIA 3FQLA 3JQMA 3PHEA 2NYHA 1S0MA 2PN0A 5IOLA 1F0XA 2MHEA 3MMAB 2DT0A 1RTIA 1ZL1A 2POKA 3CCRS 1E15A 4C3KA 2NLWA 4ED4A 2WBRA 2UV8A 3BN4A 3M9MB 4DIPA 2D7SA 1ZA1B 4HBEA 1W9VA 3PRDA 4EBDA 1N36J 4X66F 2RU9A 2KT5A 1FI4A 1X4DA 2IJFA 4LRCA 2KL8A 3M6WA 4I2PA 3A8EA 5HW6A 5DEZA 3MR7A 3K59A 2FJDB 2FKEA 4IO9Q 2V8PA 4ID5A 4ZIVA 1D7IA 1NJWA 2RILA 2QN6B 4KKOA 3A4TA 3DOLB 4DFPA 2CRLA 2JRSA 3PYEA 1Z1ZA 4ODLA 3EDRB 3CJ4A 5KG3A 4A8MP 3TYTA 1IJFB 4USJC 3UN3A 1S48A 1WELA 2ROPA 3FZ2A 2D3O1 4ER8A 1BQXA 4MKBA 1I51B 3DRSA 3THPA 4DEZA 4RW8B 2NXNA 5E5NA 2BEFA 3N5BA 3RG6A 4TY8B 1IN0A 1JNEA 2HBQB 4Q5VA 2EC0A 4LSNA 3JYTA 1WHVA 2AEMA 2PMHA 2Z30B 4YDDB 4QWEA 5BXIA 2KZZA 2NUUG 2CG4A 4RNNA 2ZQTA 2AYMA 3OA5A 1J5EF 4IOCQ 5IV4A 4W9QA 2DRAA 4Z2IA 2XPBA 2D69A 1V3SA 3ZC4A 2XO7A 2CQIA 2M70A 2QA2A 3JTPA 3K7RA 3QGHA 4UOHA 4KPYA 4Z2KA 3H4DA 1N4LA 4WK3A 3BH7B 2HURA 1YJTA 4ODKA 3BM7A 4K4TA 4TW6A 3G9CA 4OZNA 1SKSA 2MSTA 3RGCA 1BQMA 3MAHA 3HHLB 1MMDA 4O44A 5IWAJ 2AEJA 4QW9A 3P6YC 4ED8A 1TL5A 3H59A 4LBIA 4RBTA 3AD7C 3VTIA 1LQ9A 4URSA 4ZVHA 3BPDA 2ALZA 3NGDA 4NCAA 1UA0A 3NGTA 3E01A 1RA6A 3LH2S 4DQQA 8ATCB 1GX6A 4JI7J 2VG5A 1VS3A 3AJDA 2W7AA 5GMDA 3KMSA 4X4NA 1S59A 5F9LA 4U86A 2WLYA 2UU9F 4LRBA 2XHCA 2V94A 3V81A 2B8QA 2DSUA 4L3NA 3NWRA 4MKYA 1Y0HA 1S57A 3BGRA 4MT1A 1EHNA 3O5MA 1QE1A 2I0XA 2JLFA 4J91A 2VDIA 1LOUA 3LP2A 4UF4A 2YQ0A 5I42B 5EDWA 3BO2A 3PW0A 1X9WA 1VQ8S 2RDDA 5IS2A 4JI0J 2C3YA 2R8IA 3M8YA 3POTB 4DR1F 1UP1A 1YJRA 2P2CB 3D0IE 1QAXA 4Y2IA 2VKRA 4WKHA 4M63A 4USKA 2IC3A 2W9CA 1HQEA 2K06A 2HHXA 3W61A 1TKZA 3E51A 2AU0A 1WWHA 3KLIB 4ZPAA 2CWXA 2V63A 4FPIA 4FN5A 5BYQA 1RHUB 1PILA 3HT0A 3HVTA 4UZBA 3PYFA 3CJ2A 3DLEA 3TA2A 2XGPA 4QU6A 1WKJA 4PG8A 2R42A 3OUYB 3KLHA 3V6JA 1GH8A 4NI2A 3TJ8A 2GC8A 1LWEB 3OOBA 1IKVA 1FKKA 4IPXA 2O67A 3DYAA 4DV5J 2E1PA 1UWAA 1UVNA 3R5AA 5JXSA 3DU6A 1RI7A 1NK7A 1R0AB 5HT1A 2XPAA 2M88A 5LSLA 1YJ9S 1U0HB 3HX9A 1E44A 3R2DJ 3ZZPA 3CDEA 3Q8PB 1X60A 4O2TA 1VIOA 3ARTA 3AT1B 3FEXB 3M6UA 4DV6F 2RVJA 1U2CA 3M30A 3QATA 4JI8F 1HNIB 2RSEA 1FX2A 4CP5A 2EULA 1RT1A 2CJXB 2QZ8A 3EICA 2PPOA 4Q2MA 5E33A 1JMTA 2JOQA 3ETOA 1P5QA 2OI2A 1RT2A 2OEJA 2VD3A 4G1QA 3GJSB 2I1RA 5C25B 1M5SA 1L3VA 3NMRA 2R7TA 1O6XA 2WOMB 1TUWA 2WVBA 3DLGA 4NLRA 3UVJA 1KVJA 1JLBA 3H0PA 2KHCA 2AJ0A 3I6PA 2MLXA 2HRUA 1S0VA 4RW4A 1R0CB 2GZOA 2BOPA 3JYJA 1NK6A 1AXQA 3R7BB 4MKAA 3HO1A 2UUAF 3UVJB 4B3RF 1RT5A 1NHUA 3MTJA 3UCGA 2UXDF 3OJUA 2RMLA 3MF5A 1MROA 1SV5A 4JYSA 2GVZA 2HQIA 4MJKA 4CLSA 3DLHA 1K0VA 2BJ1A 1JLQB 1R8CA 1T95A 4ED0A 1G1XA 2LXIA 3ILLA 5KFQA 2HHUA 3MEGA 4O4RA 1TV6A 4JP8A 4PR6A 3NLCA 2W1BA 4C3LA 5CYQA 2W9BA 1S12A 1IBKJ 3BGLA 4ANCA 5A76A 3HD2A 5M2UA 3FCWA 2QA4S 4GIVA 2VJVA 2R7SA 2HHSA 1KFWA 2PMZD 2XI3A 4YMEA 4LF8J 4OHXA 4ICLB 4K0KJ 2CQGA 2ZBCA 4OYIA 2IAJA 1NDPA 3PYDA 1BY9A 4TNOA 2MQPA 3TAQA 4J5OA 3TW0A 1VQPS 4FZVA 4LMZA 3GFYA 2XO6A 4QZVB 2FLNA 4WPAA 3ZZOA 1CSJA 4TYBA 4R5EA 3J7Z5 1SKRA 4DX5A 1KLMA 3KK3A 3MEEA 2B6AB 1BHNA 4N47A 2GA7A 3CHDA 2IUZA 3N6NA 1RAHB 5D77A 4C0HA 3AS2A 1QD1A 2CZVC 3MCMA 1U09A 2UVWA 3Q83A 3GYGA 4TY9A 5DDQC 4AFFA 1KLMB 1HR0J 2BRLA 4JFIA 2KU7A 2WB4A 3WBZA 4A48A 3I55S 3C15A 2VQFF 2J6TA 4DUYF 2MMYA 4ZHRB 2KFWA 3HP6A 4N19A 1XC9A 1NWUA 2QV6A 2IJRA 2EW9A 2RRNA 4DRIA 4M5HA 1GOIA 4AYBD 5DZ6A 4ES1A 5KFEA 3IC1A 4IYQA 2KH9A 2FGOA 2VBZA 4LF6F 4UT4A 1N32F 4U84A 3R6LB 4NX9A 4U8YA 3SQGA 1REVB 5KFYA 3ALFA 3FEZA 1Y10A 1VK3A 4DH0A 1VQ5S 3CC2S 2OLWA 3SI8A 4KO0A 3GV5B 4TN2A 1DARA 3Q24A 1LWXA 1V5VA 3LP1B 4O4GB 3M2RA 4J9OA 1KQSR 3CD6S 2KYZA 3GR0A 2HBYB 2Q79A 1AFIA 1HBMB 1S9EB 4TX0A 4ZP6A 3IR5B 3R8YA 2DO4A 4IQMA 1LW0B 1P1TA 1ZH5A 4RBUA 3DC2A 4IOBA 4PWDB 3MECA 4MH8A 1AZSA 1J5EJ 4Z2LA 2WRMA 3CC4S 2XMAA 3P5TL 3OPKA 1UVJA 2XEXA 2XWYA 3IK8A 2XP7A 4GVLA 4H4MA 5CA5A 2NZ4A 3AJ2A 2ATLA 3MEDA 4UY85 1VBZA 2IJNA 2ASDA 2LEBA 1VOMA 1CC8A 2MDAA 1WF0A 3VGUA 1RLDA 4B08A 3RRHA 3WX4A 2HMIB 4V19X 5G4DA 1FKOA 3RB3A 3HSJA 2DKOB 3NRBA 4C48A 2YNFB 5KFGA 2F4VF 3NKYA 1A7GE 4QIBA 2HSEB 4LF7F 2ZHAA 2ILZA 1AFJA 1B7FA 3FFIA 3QSYB 4G3IA 1M5VC 3KMQA 2GJFA 2MB0B 4W5UA 3FBCA 1RAFB 4EZ6A 3OL9A 2EFPA 1PG5B 4DR3J 1OYDA 3CW2C 1RTDB 1TP7A 4ID8A 2CUYA 2VG6A 5F8GA 4RO0A 5J2MA 4NE9C 4C11A 5LMUF 1VF8A 2GIFA 4DV7F 3O5GA 3MM5B 3PNIA 3UW1A 4Q45A 4I6WA 1N5VA 2MY7A 4OYWA 2C2OB 2RH3A 4DI6A 3MUMP 3PFEA 2XP5A 3OR1A 4TLQA 4DFKA 1XMQF 1N56A 2CIMA 2VG6B 2G2ZA 3GSDA 2AQ4A 4ZVFA 2GMHA 4F02A 5L46A 3QBCA 3NP5A 4C8OA 1KHWA 4F3QA 4RNMA 2XLIA 5A8WA 1YHQS 1Q8LA 2CQBA 4NLXA 1U25A 1R27B 3RM9A 2CJBA 2YKMA 2IVFB 1CS4A 3K5LA 5D15A 4PABA 5KT5A 2IY5B 1VJQA 4AQYF 2C3MA 1ZBWA 1HNXJ 3ZXWA 3K58A 4U85A 2IBOA 1KR4A 1U8WA 2A3EA 2RE1A 4HI1A 2X1AA 3PV8A 4W9OA 5DIUA 2DB1A 1EHWA 1WC1A 1OGGA 3H20A 4P72A 2DITA 3W66A 1TZ0A 4IG3A 4ZDNA 3O5OA 2YKNB 4I2QB 3W2WB 4DN0A 2B0GA 4WFNQ 2XM3A 1TAQA 4Q22A 1HQUA 3NBPB 2UUBJ 4RJVA 3ZFVA 2OHDA 1HYSB 2H3EB 1ZBVA 1XEZA 3H90A 3ITHB 1QUVA 3LAKA 4LBPA 1ELOA 3G8QA 4P2XA 5D78A 4A8YA 5A0YA 1PINA 1Q5YA 2JEGA 2VOPA 3R6GB 2DT9A 4NYZA 5HMZA 1HI0P 2QLBB 4L72B 4WIWA 4M5GA 1H38A 1DRZA 2B8PA 1ACMB 1RTZA 5HQMA 3OTEA 3IRXB 2ZH7A 4AQYJ 4TW8A 5LJ3Y 4NXNJ 1U6ZA 4ILLA 2PD1A 3A1YG 4DHVA 4USMA 3BDPA 1FDNA 1HW9A 4KHPJ 4NMLA 4PZVA 5G0RA 4F4YA 1C0UB 4HL9A 4ECZA 1FNMA 1VMBA 1TL3A 2CXEA 4OJ1A 5BYSA 1X9SA 2V8DA 4ERDA 4K2JA 1BE4A 4CLTA 3OXLA 4F4KA 5DJBA 3TZYA 3GP9A 3FMWA 3ARPA 4FYDA 2MHNA 2HFVA 4TY8A 2KG0A 2XS2A 1T03B 3EGVA 2B9EA 3MMBA 4IQ2A 5EX3A 3PKYA 2IDLA 2GAGC 1RT3A 3KHLA 1NB2A 3MPDA 4N8OA 3QAEA 3RU0A 1QVFR 3JSMB 2EPIA 2WB1D 1WC4A 4X65F 1X4GA 4K4YA 2CQDA 4CT9A 1R8AA 1U1QA 5FIIA 5IXUA 1UEUA 1EIBA 1RWXB 1FX4A 4LSLB 1T9VA 1RAOA 2B7CB 3R7NB 1FKJA 1YDLA 4F7VA 4X4VA 4WIIA 1E6YA 1WKKA 2CQ0A 1EARA 5H9FJ 2HK3A 3NOGA 4CWBA 4LF8F 2E5IA 2XMVA 4NPOA 4P71A 4F2RA 1Q79A 2XYGB 3WH0A 1J6YA 1S6UA 3CD0A 3P8BB 1NZAA 3AXKA 1RAIB 4CH7A 1LL6A 1FNOA 2L9NA 2V6AA 1F2GA 4HBOA 1S5ZA 3KNAA 2Y3YA 1VBYA 4YN3B 2H4WB 1FHTA 4IT6A 4ELTA 3SEOA 2ETNA 1WD6A 3QGIA 5KFUA 3DOMA 1SYTA 4O3OA 2ASJA 1HBOA 1REVA 2KO7A 1CJKB 1FKPA 1UW4A 2Q6BA 5GMKa 2VQFJ 5D0HA 4OI3A 4UOFA 1BUXA 3KDOA 2FDMA 3IBWA 4XPCA 1TK8A 1VQ9S 3UDVA 4G6VB 2FJVA 3M8WA 4PYAA 1UVIA 2AJFE 3D2WA 2MZRA 2QLFB 4RWWA 3HSZA 2HFSA 5LSOA 5F8IA 1KN6A 3JXOA 4LF6J 3AA9A 1U26A 4WWSA 4FS1A 4ECQA 2ZZMA 3LGHA 1SJRA 1KD1T 1XRVA 1HW8A 1IWAA 1HJVA 2A3BA 1FTCA 2FY8A 2J0WA 2OELA 3DM2B 1FA0A 4C8YA 4NXNF 3U02A 1UVKA 1LG1A 4A46A 5A8WB 1FJEB 4CH0S 3ENQA 3ZO7A 2H4YB 2RIJA 2RUSA 1RZMA 3DLEB 3P45B 1C4CA 2JL9A 2BE2B 2VQEJ 1FKAF 4HT7A 3WX8A 4DPTA 1NJZA 2BJ8A 1SVDA 2UU9J 1MW7A 5FDLB 3A3OB 5F8HA 4HVZA 1GFWB 3SSSA 2M3DA 1FJGF 1UCNA 1RHMB 2ROGA 4RUHA 4LFBF 2RSQA 2XBPA 5HVHA 2C3OA 3PEHA 1EIYB 3AD8C 2B56A 2YX1A 2XSJA 1DTQB 1F1BB 3NRKA 4JI0F 3MD1A 3Q86A 4Q7NA 1XR6A 4U6PA 5DG7A 2OMOA 1VRUA 1JLGB 2ZOGA 5HVGA 4DR1J 2XB2D 5HVFA 4NLQA 1O5JA 5D0RA 3GFHA 2O01C 1RT5B 1TVRA 1QUPA 2AKWB 2R4FA 1QTNB 1SV5B 1FWKA 1MROB 2GVZB 3SSRA 4UQGA 1O0PA 3WD2A 1S1XA 2ZWPA 2FJEB 4KT0C 3WHIA 4OX9J 3QIPB 4GGQA 4TW7A 2XI2A 3FCHA 1N5QA 1IKWA 3OQ2A 4PEOA 4B17A 1NSAA 3JTOA 1U6BA 1WSRA 3O5IA 5HTGA 2PA8D 4JI2F 1TR0A 3K5MA 1NEEA 1FVQA 1LWFB 3CB4A 5MAOA 3HZEA 2DR7A 2PC6A 4EO6A 2ZQVA 3UI3A 3PJXA 5LMUJ 1NMVA 3B8SA 2Z8QA 3KUGA 1KDNA 2DISA 2HEKA 1XR7A 4PG4A 3GIMA 1E6ZA 1VQOS 1JX4A 1JJ2R 4Q44A 3MM6A 4CM2A 1LK5A 3FRYA 2XMWA 3GSIA 2KRRA 4HHUA 3OTOF 3GU0A 3F44A 2H5IB 4OX7A 5LOQA 1MWQA 1VK8A 3G2XA 1KC8T 2LMIA 1BMQB 1PSDA 5IT9Y 1JLGA 1LWCA 1KVKA 4MFBB 4JI6F 3BZQA 2CNOB 1I1GA 1U1MA 1EB0A 2RF2A 1X5TA 1Y7PA 3A12A 1GPFA 2D1CA 5D4NA 3C3LA 2F2DA 2COLA 2HAIA 3H42A 4NASA 5BYRA 1I6JA 1HNXF 2DR5A 4WYWA 2EEYA 2HQCA 4J9PA 1HPZB 2YY3A 3A8IA 4L74A 2HBZB 3MEEB 2A6OA 2HWHA 3DGPB 4LF5F 2PFFB 2QO3A 3W4RA 2B9XA 3KLVA 3LOUA 1KVIA 1T7PA 2KJVA 5DITA 1XTZA 3F56A 3TP2A 4N56A 4TVAB 2UUCJ 2PBCA 2JLEA 4DLEA 4YB1P 4QYRA 3KAHA 3ZZUA 4OFZA 3NY0A 2RUCA 1SC1B 3KNGA 4WCEQ 4CO4A 4F67A 2RAQA 3OL7A 1Q1KA 2RNEA 2ZBRA 5D4PA 3RFWA 3OD2A 4ED7A 3VALA 1CPZA 4ODRA 4ZLLA 3DLBA 3ARXA 4B3TJ 4DSLA 7FDRA 2V34A 3OR2A 1IQZA 3G6VA 4M5MA 3AS3A 2J9DE 5IC6B 2VA2A 2UXCJ 3UQBA 2HGLA 4QQBA 3KLEA 3T5HA 4LUBA 2VODA 3QJLA 2JEJA 1E6VB 2ZBQA 2M0GB 3I9V9 3OR2B 3G82A 5DQIA 1QSLA 2F63A 4NLGA 1QAYA 1JLAB 1S4FA 4NXMF 4KQZA 3BO3A 2C22A 1TK0A 2UVRA 3TDBA 3D0HE 1FRJA 5B8IC 4NRUA 4CTAB 4C2MA 4DSEA 4XTTA 1RE1B 3W2VA 3M2VB 2ZR4A 4DZ2A 1PC4A 2C2NA 3IAM9 3ZZYA 1QM9A 1UAWA 1S6OA 3LF0A 1VIXA 3W1YC 1IQTA 2KE0A 1ZPWX 3JQJA 3MHYA 2LEPA 2QMXA 4O3NA 2LU2A 4EYIB 1TK5A 1DJ0A 4DQRA 4ITSA 3CHFA 4JFLA 1IUJA 2ZHOA 1EYMA 2MKHA 3D1HA 2BJ3A 2DHXA 4B02A 2BXJA 3BBFA 2E29A 2Z56B 4LIWA 4WTYA 2OPSA 1QZ2A 4DSJA 4DDFA 3IKGA 1NSPA 2Z2LA 3J7ZT 4AY1A 3BDEA 3LQVA 5HROB 5DM6Q 1IBLJ 2KYXA 2BA9A 3S01A 3NS6A 4NEYA 3CJQA 1VQ4S 3W64A 2PPNA 3TUZC 5HLFB 4AL5A 4K5SA 1EJ7L 2FIUA 4LF9F 2NUHA 1M90T 1VQ6S 3BEGB 1J5OA 2G41A 2N4CA 4XK8C 4WZMA 5B0AA 4OI6A 4NLDA 4K8RA 3DU5A 2HRTA 1WNOA 2YX7A 4EZ9A 3PKMA 3UCUP 3ELHA 2CPXA 4KKOB 3GILA 1LV5A 4ECUA 3IWNC 4ZVRB 1EQMA 4R0JA 4DMZA 1KKHA 4DUTA 3HFZB 2LLZA 1RAGB 2YNGA 1ROTA 2B3TB 2DR6A 3FMBA 3BR9A 2K3IA 4C97A 4F4AA 4DS4A 2YH1A 2OFNA 3EVWA 1U0SA 2XZWA 4Y2AA 1RT6A 1FJCA 5BJRA 3K0JA 2ZH9A 2NXJA 3AS0A 2W4CA 1GEHA 3CGIA 4Y28C 2OP5A 2JLGA 2OTLS 1QSSA 1L1PA 2ALYB 3ZNUA 5HJYA 4EBEA 3QT7A 2UXBJ 2XMTA 4DR6J 2LGOA 1IKXA 2WBMA 1Q8IA 3BBCA 2BRKA 5F0WA 1Q86T 3DLKA 4ZPCA 4DBQA 1GXLA 1RBLA 2DNKA 4M5DA 4D3HA 1PJ5A 2P6SA 4LF2A 4HARA 3B9AA 1FRLA 3C6TB 2JVRA 2HLUA 4IG3B 3G8TA 3ARRA 1JLQA 1Q0NA 2YNHB 4P2FA 2WVFA 3W2WA 2ZOMA 4M5DB 1RKIA 2EC2A 1HJWA 2P5VA 4USIA 4OYAA 4JI3F 3O5RA 3R3TA 3ZTSA 2V67A 5EUHA 3L3CA 4PUOA 4PPZA 2VOOA 3I56S 1S6PB 4NOHA 3ZNJ1 2RJZA 4YHHF 1S9GB 2PIIA 1UEVA 3O5TB 4DCOB 5DGBA 4P8UA 3C16B 1G3OA 1P6TA 3BXWA 1GQEA 1Q82T 3TVZA 3GFXA 1GUVA 2HZVA 2H65B 2B9YA 5FLXU 5ETOA 4C9DA 2JHEA 4KFBA 1VC6A 4S0MA 1W2BR 1RWVB 1P9QC 4MTPA
chains in the Genus database with same CATH topology
3MR5A 3EPIA 5I98A 2DT3A 4TYOA 3T5JA 4MTVA 1KS2A 3QPIA 4EU0A 1SBRA 1FKFA 2CKWA 5KFBA 3I5AA 5DDPC 1CEZA 3G6ES 3P3DA 3LW5C 2XMUA 4DF8A 5AXNA 2M08A 3DNCA 3CJKA 1RYSA 4DSIA 3MAQA 4NA1A 4C4WA 1CC7A 4JI4F 2IA6A 2IYIA 1HWJA 1X5SA 2E1AA 3KADA 3P96A 1NSGA 1C4AA 1H2TZ 1DTTA 1DURA 1U45A 2HMIA 3CJ0A 3UQAA 3CIZA 1Y5IB 1ZM2A 3O3LA 2DRBA 4FBUA 1JNSA 5A8KA 4FAPA 2C3PA 1VJWA 2KXFA 4HTJA 5BJRA 4AQYF 2G0CA 1U2FA 1FFQA 4J4OA 3GPKA 4QCLA 2DPEA 1N8RT 2BANB 1BWEA 5A8KB 2I5JA 2BZ2A 2WSFC 5DRKA 2RS8A 2X1GA 1KFSA 5IQ6A 1N33F 2UUCF 1F5AA 4U7UK 3J80Y 4KO0B 4N76A 4IG0A 3CMAS 1VGYA 1P1LA 3FQKA 1H2UX 1H3DA 3I4HX 2B31A 2E7WA 5J2PB 3MZIA 5DLFA 2E44A 4P8WA 1SXLA 1D2KA 1XWLA 2N7CA 2RQCA 1R3NA 2VG5B 4UUWA 2ZNYA 2FHOB 3O5JA 5I3PA 5IM0A 1LW2B 4Q2LA 4C8ZA 4U9RA 3O1LA 4UUXA 2W7OA 2K3KA 3NWGA 2YWFA 3C8YA 2J9DA 2MY8A 3SCKE 2F8MA 1YSJA 4PG6A 3CCJS 4OZJA 2FB0A 3H2LA 1YJWS 3MM7B 5C24B 2ZITA 1RTDA 5B0DA 4CCHA 5KT3A 4W92B 5B0GA 5D8HB 3WIJA 3SFUA 2L3MA 3H9RB 1QAJA 4MSPA 5T7LA 1U48A 4KAIA 3E8OA 3TVKA 4Q43A 2BE2A 1EETA 4WFXA 5KFVA 3BQ1A 2BQUA 3OJSA 1IBMF 4NCGA 2M2AA 2YNGB 2ZE2B 3KLGB 4OZ0A 4DL2A 4ED6A 5F8JA 2CPZA 2B7BB 2HNDB 4FVCA 1NRKA 1ZBKA 1HNVA 4IFVA 2OD4A 4ECXA 1PC5A 2DIVA 4P7VA 5C42B 2R2RA 4ECRA 1N36F 2HHTA 2VFRA 1E6RA 2CJKA 1T03A 5I4MA 2MJNA 3DOKB 5J1EB 2B4PA 2E5HA 1TFWA 4KIAA 4DRQA 1TV6B 4ZP9A 4KHRA 4IRKA 2OJ3A 1HYSA 3C6TA 1FKSA 2NYIA 2ZJRQ 1C0UA 2FVPA 2VPYB 5J1NA 1VRTA 3V6KA 4MK9A 5KTQA 1KFDA 2ZDOA 5KG7A 3HHNB 5HP1B 3OSNA 2MKCA 2HWTA 2C2EA 5L1JA 2HS0A 3THVA 2QLWA 2VQEF 1TKXB 4TNSA 3T6BA 4B9LA 1KOHA 3GB0A 1A6LA 2EBEA 4X2BA 5DF0A 1JXEA 1RT4B 4URQU 2GQCA 3PM9A 2PV1A 3NBPA 3CF5Q 4ZCIA 2V8HA 5DO2A 2MLZA 2FHKA 2GHVC 5B0BA 4J9RA 3BREA 2GCFA 2CPFA 2UXBF 2IMWP 4DWSC 2RD5C 2OSQA 3HZGA 2HNYB 4OJ3A 3BSAA 3QWUA 2DNYA 3B82A 3AQPA 4I4BA 1WEXA 4BBYA 1ZM3A 2D41A 3R5BA 1YITS 3UCZP 4LGXA 2Q3PA 2ZUGA 3NNAA 3ZZTA 4ITZA 1MU2B 2DK2A 4ZPDA 3G71S 4H4MB 1O51A 5JUMA 1ZAXA 3C46A 5HI7A 1S97A 3HJFA 2RRBA 2OLHA 1TL1B 3MURP 1J4HA 1FKOB 4NZ0A 2R8GA 4B9SA 2KDOA 1JLCA 2RURA 5GQBA 1Z2LA 2WK4A 1Q7YT 4MIAA 3UPFA 3D1OA 2AGOA 2BQRA 1XNQF 5DLGA 1IKYA 3KLIA 2OPQA 3Q22A 2LA6A 2HS4A 2GGPA 3KABA 1SL0A 4ZCLA 3U1MA 3KJVB 5L9NA 1D7HA 2K1RB 4MK7A 3I31A 4EGLA 2B43A 1LW2A 2BJEA 1FKPB 1WG4A 1UJ5A 1VQSA 3ARVA 2MQLA 3LP2B 3S7RA 3HHKA 1S9EA 4TLRA 3RBEA 5FJ4A 4DWIA 1U2RA 1HBNA 2ASYA 2FJAB 3VAWA 1O8BA 3DHXA 3IAS9 1U47A 4Y2MA 2B51A 2D3ZA 3WL0A 4RWXA 1ZTWA 4DWSA 2F1FA 3JAMY 2F21A 4EWTA 3OTDA 5I3UB 3W7BA 1HBNB 4ZS6A 2N3LA 3NCRA 4KV8B 3HXMA 1UVLA 4DV5F 1W1PA 2VH7A 1KQKA 2E5GA 1Q78A 1ROUA 2ZE2A 4MIWA 3BQ0A 2DGQA 5E2QA 4EEYA 1FD9A 4ZCKA 4M94A 1HBMA 4QIEA 3Q0AA 1T11A 3FAPA 4B3TF 3MMCB 3QMQA 3ARWA 5KFWA 2Y78A 2UXCF 4IUFA 2DPIA 1FVSA 3D5MA 5E0OA 2LKZA 2VUGA 4A8QA 1M0SA 2F9JA 1FTRA 4DRMA 4A8KA 1RD6A 4RW7B 2IHR1 3N4WA 3LUYA 5DQHA 3CUNA 1W9UA 4B9TA 2PA3A 1S6PA 2W4DA 4KV8A 2CVEA 1SJFA 2F40A 2M7SA 3RR8A 4N77A 1NH7A 3EGZA 1C0TB 2XSFA 2M1IA 4HTIA 5J2NA 3KKFA 4LVNP 4YB7A 5IFMA 2ZH3A 1W26A 5GAGU 4W90B 2FLOA 2XP8A 2V4RA 4ETXA 2JEIA 1SIWB 1MSWD 2DG4A 1RJJA 1J4RA 3WD1A 1FDAA 2XMKA 2WLZA 3SCIE 5L1IA 4DL6A 4I6AA 2DO0A 4LFCF 3ISZA 1WG5A 2WAQD 1OIAA 3G6MA 4C02B 3EXCX 1IBLF 3RR7A 2IA0A 1S1WB 1S76D 1RT7A 1UWBA 5JVHQ 1MMNA 2CQPA 3MR2A 4ZCMA 1S1XB 1XNRF 1BLUA 2J7KA 3ARYA 3B4MA 1FKLA 5CCLA 3PO4A 2F8EX 1VQNS 3MXHP 2NQPA 3RW7A 2E1CA 5IT0A 5J2NB 4RUCA 4ATNA 3L7OA 5J1PA 2HHHF 3UR3C 3DRSB 5GAEI 3UWTA 4DL0C 2GV1A 4NLUA 2FD2A 1YGYA 4IT4A 1VFJA 3JB9k 1NHVA 2JVOA 3BSOA 3CJ3A 3KZ7A 3OLBA 1TL1A 2J6UA 2C42A 3U1NA 2MKIA 4KBIA 4PQUA 3RAQA 3KWMA 2HFOA 1HA1A 2O9OA 2FPHX 1YG0A 1HWUA 3I0RA 3OXFA 2HHVA 5EN1A 1W25A 2IRXA 4X4QA 2R9LA 3QAUA 5GPRA 3PW4A 1WAWA 5DIVA 1FKRA 2QE5A 3TO8A 4PG8A 5LSRA 1ZTTA 1Q7LB 1TKTA 1NKBA 4BDPA 4WF9Q 3C6UA 4WKRA 3CO9A 1LWEA 1HBOB 2LDYA 1N5SA 2CPDA 2DSWA 4ODQA 2DNQA 4I6YA 5KG2A 2XS7A 4RBVA 3TANA 1ZAVA 2HZCA 1Q53A 3EX7B 2MSSA 3UDLA 4OL8A 3BGRB 1YJUA 1JK9B 3UQIA 2BW2A 2ZKTA 3J7A1 2HVHA 3PR5B 2YNIA 2NXUA 4DZ3A 3ZZZA 5KAKA 2VG7B 4OIXA 2V8VA 1Y0OA 1YVFA 2BANA 2RDJA 2WW8A 5J2QB 4WU2A 3I0SA 1HNVB 2D9PA 4QIVA 4BC9A 3K5NA 4F4XA 1OSDA 2J9CA 3PA7A 4J9NA 2W9AA 1WF2A 3UNGC 1T94A 3I6CA 2GHWA 4OZ1A 1GAOA 1X4BA 5AE3A 4LQ3A 3GE9A 2VOOA 5HBFA 4ES3A 4ZK7M 3AB4B 5KFNA 2DJWA 1SH2A 2RQSA 2MPHA 4QPXA 1RK8A 3H2VE 5F3TA 2O92A 5HLFA 1Y4ZB 2G8ZA 2HYIB 1W2IA 1IKVB 3J7YU 4FN2A 3K5OA 1UMJA 3M8PB 4ZPWR 4JI7F 1S7HA 4N41A 1HKMA 3WD4A 3N6MA 1VLYA 1H0GA 1LFPA 4RW7A 3B7XA 2F8HA 4RZRA 2WM0A 2KGJA 5FDLA 4IQXA 4L6V3 3UR0A 4ETZA 2RU3A 1EETB 1RGVA 1FK9B 2OMLA 3HVTB 2JFKA 3CTRA 1FE4A 4EUVA 2NR0A 5GAEU 5HW8A 4HI2A 4KRWA 4RU9A 3GIIA 2A3CA 4QWCA 1T8EA 3ZZ0A 2ITKA 1RTIB 2OAUA 4DRHA 1K9MT 2QYCA 4DSKA 2AJQA 2W8LA 1VI7A 3O5LA 2XP4A 5AJ3F 4W9PA 3AH6A 1RTHB 3IG1A 3DMJA 3KHHA 4HYKA 1IKWB 1HQUB 2UUWA 4J9SA 4EFAC 3CD7A 1VC5A 1UJ6A 4PUOB 1S0OA 2F9DA 3DFEA 4NLSA 1FEHA 1XBWA 4DUZF 4DOZA 3DXSX 1WEYA 1FDDA 5CYQB 3SQGB 4YY3F 2CQ4A 1S1VA 1K8AT 2QSFA 2PV3A 3DLKB 2X51A 2OPPA 3HHLA 4O44B 4K50A 2C2DA 2FLLA 2VBYA 3AROA 4F26A 2DNRA 4QWAA 4DFMA 4O3SA 1T05B 2R8JA 3AA8A 3MFHA 1Z4UA 2JSXA 3N9UC 2N3OA 2VBWA 3IS9B 1C1CA 1RTJA 3IR6B 4CTAA 5KFZA 5K8PA 6FDRA 4JBCA 1FEEA 1D9DA 1Q4RA 5F8MA 2EFVA 3CJKB 1QSYA 2V9WA 3CWJA 3VAIA 3VQSA 4NA2A 1S99A 4A4JA 2XLKA 2VONA 1C2PA 4DR2F 4AL6A 1OQ6A 2XLJA 1W1VA 3RAMA 3MMBB 1NH6A 3GYNA 1KLNA 5GADI 2QMWA 2DHGA 1KONA 2FJXA 1PO6A 1NWTA 1RWUA 4YUDA 3GR1A 4MYTA 2KXNB 4BS2A 4HKQA 4PPDA 2LPVA