4ZPTR

Structure of mers-coronavirus spike receptor-binding domain (england1 strain) in complex with vaccine-elicited murine neutralizing antibody d12 (crystal form 1)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
208
structure length
208
Chain Sequence
VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRFLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords D12 Fab Heavy chain
publication title Evaluation of candidate vaccine approaches for MERS-CoV
pubmed doi rcsb
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
total genus 52
structure length 208
sequence length 208
chains with identical sequence S
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4zptR02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zptR01
3SCJE 3D0GE 4L72B 4XAKA 5DO2A 3SCLE 3BGFA 4QZVB 4ZPTR 4ZPVR 4ZS6A 3D0HE 3SCIE 2GHVC 3SCKE 2GHWA 4KR0B 2AJFE 3D0IE 4KQZA 4ZPWR 2DD8S 4L3NA
chains in the Genus database with same CATH superfamily
1FJEB 2JC0A 1M5KC 2Q79A 4YB6A 2N7CA 4DWSA 3UD4P 1D1UA 3OJUA 2H9ZA 3PX6A 1UAWA 4WK9A 2KL8A 4C0BA 1RTZA 3P45B 3T9NA 4MKYA 2NCKL 3HKZD 2CZ9A 1KVJA 2DGVA 4DR7F 4C8ZA 3HXMA 1Q78A 2B4OA 3GV8B 4P10A 3BMBA 4RNNA 2V4QA 1NO8A 3DDNA 5J6EA 1NHKL 4JI2J 4HH0A 2IM2A 2G1DA 3LH2S 3VAIA 3HZEA 3R6LB 4K8RA 1J27A 2J0WA 5BYRA 1GAOA 4WIWA 1PYTA 4DFKA 2J0XA 4IFVB 1X5TA 3PR4A 1HWJA 1WSRA 1HQEB 1VBKA 3KJQB 2F7VA 4P8WA 4YQWA 2R8JA 2KYZA 2VV5A 2ZHBA 2JFKA 2VUGA 1F1BB 2MY7A 4ANCA 4ECVA 3WQPA 1AFJA 1LFWA 3LGHA 2VA2A 4IFVA 3WQVA 1HQEA 2ZC3A 5F8LA 3IBFB 1D9AA 3O6QA 1GTHA 4QWDA 3MDYB 2KXNB 4CNYA 4WTYA 5C24B 2WVEA 5E5NA 1URRA 2CPJA 4P2SA 2G2ZA 2AGQA 1N56A 4OMFG 3NL0A 4IH5A 2BJEA 5F8HA 1I51B 3ZZZA 2B7CB 4EBCA 2P5VA 3MR3A 1GMVA 3VVUA 4DFMA 3LPEA 2HYIB 3P3DA 5C24A 5DF0A 3ARPA 2ZWOA 4QPXA 3DHWC 4OLOA 1ACMB 3UQIA 5C2CA 2MDAA 4BDPA 3IG1B 3NLCA 1NPRA 4Y0FA 3WD0A 2I8EA 1Y00A 3PX4A 5DGAA 2AJQA 3RB3A 4ZK7M 1SI9A 5IT4A 1SKSA 1HNXF 4OZ5A 3OUYB 1S97A 3GONA 4ZPTR 2F4VF 3IG1A 2DT2A 2DIVA 2EFQA 1UA1A 1FKIA 3CH9A 1HKKA 3A8KA 3ALGA 4IQMA 5EX3A 3N0VA 4V1Ak 2O92A 3UD3P 1U24A 1RSCA 1DQ8A 3CWJA 3SYZA 1ICEB 2R8IA 2W9BB 3BO2A 2ADCA 3HHLD 3OUYA 3NGUA 2CXEA 3DU6A 2MKCA 4KHPF 2QA2A 1RT1B 4KFBB 2RILA 2ROEA 5DS7A 4CT9A 4UUWA 1VQ4S 4B3MF 1KHWA 2H54B 5EN1A 3QT7A 3B9DA 3TC5A 2W9BA 3X3UA 4YB1P 4NEZA 3GQCA 1WOSA 1RT1A 4KFBA 5D0HA 8RUCA 1O6IA 4ELUA 4K2XA 3ZZRA 3OFEA 2ROGA 3W2VB 3HHDA 4ER8A 4L75A 2ILYA 3FGVA 2EI5A 4ZOSA 1X4EA 5ETMA 2C2RA 2JLEA 4GKKF 4ZITA 4F4KA 2DG3A 4QR0A 3W2VA 1IBLJ 1VIXA 2G2OA 1FKKA 1YJVA 5BR8F 2OMOA 2KM8B 1U6ZA 4FNIA 3DRRB 4XAKA 2AIRB 2D74B 3G6VA 5C25B 2XY7A 3CGNA 1OPZA 4QCLA 2XPBA 3TJ8A 1WNOA 5MAOA 5DIUA 1FKJA 3EUNA 4DF8A 3I9V9 5AE3A 1S1UB 3PNIA 1FRLA 3CO0P 3DRRA 2E5GA 5C25A 4AL6A 2X1BA 2OFNA 1S1XB 2SXLA 4ZVTB 3CD0A 1WF1A 2QFJA 1IKWB 6AT1B 4HI2A 2AF6A 1Y10A 3PHTA 4OQJA 4Q2MA 1T03B 4IKAA 2KHCA 1LK5A 1Q8IA 1S1UA 2RD5C 1BMQB 3JSYA 1S1XA 1U2FA 2NREA 5KFBA 3EMTA 2UXCF 2RRAA 3MOJB 2BW7A 1IKWA 5E41A 2HZCA 2GS8A 2OKQA 4DI6A 1T03A 2FB0A 2W4CA 3LANA 1WC3A 2HS4A 4TNOA 2J0QD 1YVFA 3D67A 2A6MA 2ZZTA 3K8VA 2FJVA 1K9MT 5HANA 3UDEA 4DPYA 1VC5A 3M8YA 3VHQA 4U8YA 1J6YA 3KUEA 1RLDA 3GJQB 4Y28C 3M32B 3JTNA 1PINA 4WK1A 3RRKA 4O44B 4PYDA 3SMZA 4A8FA 1VJQA 3ARZA 3F44A 4M5JA 4RNOA 4AL7A 2IPOB 1NZAA 3GIIA 1BGXT 3M32A 3MCOA 3G6ES 1RADB 1SIWB 3MMCB 1B99A 2PI4A 4QT2A 4KT0C 1GXTA 4PQAA 4O44A 4IDKB 3RBXA 2DH7A 2QZ8A 2DEJA 5CHCB 4A47A 1NPKA 2N7YA 1CTNA 5B7WA 2L41A 3H8YA 2NYIA 3MMCA 1N36J 1KOOA 2CPIA 4WU3A 3G8QA 4IDKA 3LF0A 2H5EA 3GYXB 5C42B 4Q8FA 1FA0A 1FKAF 4ATNA 3UF8A 1RU1A 3TJAA 3OHAA 5BYSA 4DCOB 2W9AA 4PG8A 4OI0A 2VBYA 2M9KA 3MXHP 1OQ6A 2RUDA 3KYLA 1L3SA 3OL7A 5C42A 3S8SA 2JVRA 4K2JA 1IBMF 4LVNP 2QYCA 2C1EB 4OX7A 2F8EX 3VAHA 5D4OA 5GAEI 5A8WB 5JJBA 4TQSA 2MGZB 1R27B 2C3UA 4IO9Q 3THVA 2GNKA 2ZFHA 2C2NA 4FDFA 1LQ0A 1HBNB 4WTOB 3DLBA 5L9XA 5D0EA 1RAFB 2HAFA 1VS3A 2ZITA 3HSGA 4UOHA 3CCRS 5A8WA 1R8AA 4X4NA 4LFAJ 2MGZA 3D6MB 1EX8A 2DSVA 4J7CA 3ZZOA 3PY8A 1Y9OA 2V4JB 2FKEA 3CHEA 3T5JA 1FK9B 1HBNA 3UNGC 4FZVA 4AE5A 2XM3A 4YS2A 3O5KA 3UI3A 1AUDA 3KK2B 2DH8A 2V8VA 2VHGA 4DZ6A 4WZMA 1EJ7L 2E9ZA 2DNHA 1HI0P 3H0PA 1PSDA 2V4JA 1BQMB 3ZTPA 1FK9A 2FVSA 3KTQA 4XDCA 4OX6A 5LSLA 1T9YA 1MWYA 2DBBA 3QPIA 3HD1A 1FDDA 2AWGA 1RBAA 3HX9A 4Z7CA 3M9OB 2LA4A 3KK2A 3UCZP 4TY9A 4LF4F 4KRWA 4ZLJA 3BSAA 4DUZJ 3KLEB 2HK3A 3JYJA 1F3FA 4B02A 1BQMA 3VR1A 1Y0HA 2K8GA 5F8JA 1UW9A 5HBFA 3RBZA 4NEYA 4UY85 2YBUA 3KLEA 4O3PA 5F41A 2HAIA 1M5PC 1N52B 1H2TZ 4LRDA 4FF2A 4PTMA 2CDQA 3AQUA 2P6SA 1X0PA 3K0JA 1UVMA 2HFUA 1SL2A 3D1OA 2Y0BB 1SQFA 1H2VZ 4M1KA 3HLUA 1T3NA 4HYKA 2NUHA 1UVJA 1A9NB 3B78A 1MNEA 2Z2ZA 4IFYB 3NWGA 2VASA 3AD7C 4IG3B 3RR8A 2V63A 3MPWA 4O0IA 2AZ1A 4OZNA 1T8EA 1X4CA 2OPPB 1TELA 3K5PA 4RW8B 5F3TA 2BKNA 2MJUA 4IFYA 4MAVA 1CS4B 3THPA 4IG3A 1VQNS 2HQIA 3PACA 3M6XA 1FE4A 2ZQVA 2OPPA 1UCNA 3L7PA 3H2VE 2HLUA 4RW8A 3OTCA 2DY1A 2MSSA 4IQCA 1IM6A 1CS4A 3L3CA 1TAQA 3PJWA 1DTQB 3VVTA 1VOMA 1HA1A 1Q8KA 2XMJA 4DUYF 1JNRB 4LFCJ 3UO0A 1WEZA 3UVJB 4X4RA 1GEHA 2J8AA 4ALZA 4ZVRB 4JFLA 1IUJA 2PV3A 2ZQUA 2RQCA 2V0NA 1DTQA 1WG4A 1GOIA 4Y65A 4XPEA 2ZQSA 2IYGA 2MLXA 2DR6A 3BGLA 1NJYA 3KUGA 5DDRC 5ETRA 3UVJA 4KGKA 1OY8A 1U09A 3WIVA 1SYTA 3H4DA 1Q5YA 3LP1B 2RQMA 3BO4A 3LPYA 2HSEB 4NCGB 1HJWA 4MSPA 2HLTA 5DITA 2RE1A 3KLFB 3UCGA 2ZOMA 3MECB 1CULB 5LJ5Y 4WIIA 1NAQA 2LDYA 5ETLA 3PW2A 4BWJA 1VQLS 1IXKA 1D0EA 4DX5A 2LEAA 3LP1A 4JI4J 1FX4A 2A18A 3CIMA 1XIQA 4H4KC 4NCGA 2ZBPA 3QJPA 2A3JA 3ZNUA 3JQMA 1J5EJ 4DL4A 3KLFA 4RW7B 1DRZA 4URSA 3MECA 1CULA 2RHQB 2A3BA 3NGRA 1RGVA 1KQFB 1H7XA 5IFMA 1C4AA 2E9RX 4Y2CA 4CYUB 1K44A 3L7OA 2C3YA 1RXOB 3CCTA 2XSFA 4ED0A 2ZQTA 2VFSA 2AP6A 3LP2B 5HW7A 3FMWA 3PYGA 4CCHA 4RW7A 1X9MA 4O3NA 2KR7A 2FGOA 1LNQA 2XS2A 2B4VA 4F4ZA 3AOAA 3KK1B 1UVNA 1WTFA 2P2CB 1TFYA 1Q53A 1JIHA 4CYUA 4DV7F 1MN7A 3AA9A 4ED1A 1FRIA 3PYEA 3LP2A 1ZA2B 2E5LF 1H0HB 2BKPA 4X4VA 2HHHF 4PCQA 1FFQA 3NOCA 1HKIA 1VK3A 3TWZA 3N28A 5K9FA 2JVOA 2X7IA 2XGQA 2H5JB 4OZ2A 2XTJP 2W2QP 3KK1A 3VAJA 2R2SA 3ZTRA 1ZBCA 3PR9A 3U1MA 4W92B 2K7JA 2L3MA 5KG5A 4PABA 2ZR4A 3SXLA 4FN2A 1GT8A 4PG6A 2HGLA 2GCFA 3D68A 1D7JA 4KH0B 1S57A 1AXQA 3CCZA 4IUFA 4HL9A 2PDAA 5DGBA 2JX2A 4LQ3A 4IYQA 1RE1B 1AB8A 1MLAA 2IM1A 1OYDA 4R8UB 1UFLA 3W62A 2GMHA 4A8QA 3C19A 4M94A 3AB4B 3ZO7A 2YWEA 1DBDA 1N33F 3KMQA 4ODRA 3ONQA 4LF5J 4JYAJ 3GILA 2C2KB 2FJEB 1QD1A 2X51A 3KCEA 1GPFA 3H40A 4F4XA 1PCAA 2QGFB 4UTGA 1XRVA 4KTQA 1D7HA 4R8UA 4I2PB 3HF5A 1I1GA 3K5OA 2CNLB 2A3EA 1Y11A 1WHXA 2KKHA 1HW8A 1DARA 5HN0A 5LT5A 4A8XA 1FRHA 3HHKA 2JLFA 4MIWA 2PMZD 4ZVOB 1T3OA 5AJ3J 2ZVSA 3KK3B 2ESCA 4I2PA 2YWWA 1P5QA 4FKXA 3PRVA 4ECWA 4DV5F 2WVBA 1QAXA 4DR6F 3GSDA 2OSQA 1JJHA 1UEUA 2H4YB 1YITS 3AA8A 4OHXA 3DM2B 2FAPA 5L8RC 2IVMA 4KAIA 3KK3A 1JWWA 5L1IA 2AT1B 4CLYA 2KI3A 1HW9A 4B3TJ 3QYYA 1KSPA 4ANDA 3CSKA 4TX0A 2MKYA 1FD2A 3DM2A 5HLFB 1TK8A 2Z58B 2AJ2A 5HO4A 1LWEB 4I64A 2CPXA 3MMJA 1T0TV 4TU8A 5E3PA 4L73A 3UFCX 4B9MA 5U47A 2CJYB 3Q86A 2BQUA 4DWIA 2AD9A 2UXDF 1JCHB 3L7UA 4WBFA 5J1NA 5H9FJ 3SZ2A 1HXVA 5HLFA 4ILRA 1SJ4P 1LWEA 2DNLA 2RB7A 3OXFA 4RUAA 1HHTP 3HO1A 1ROFA 2B9XA 3QWPA 2K7KA 2FHJA 2ZWPA 4GC6A 3C6TB 1W1PA 1TL1B 4X84A 1VYAA 2NZCA 3FUYA 4OYZA 4RUCA 1Y5NB 1V9OA 2RKIB 1RD6A 4WFXA 1LL4A 2XY5A 2CWXA 2QFIA 1RA6A 4NOHA 1Q1KA 2FJWA 4U86A 5ADZA 4IR9A 4W4MA 2GFFA 1S1TA 3WQWA 1PIEA 2QMXA 4DV3F 1HYSB 3C6TA 2CPYA 3HJVA 4KE5A 4J9VA 4LF1A 4JI7F 1TL1A 3P5BP 4N5SA 2DHAA 1NH8A 2RKIA 1T05B 1UA0A 4Y2AA 2C42A 3DHXA 3GTYX 1YHQS 1X31C 2LQJA 3OXLA 2NQPA 4EYHB 2J9CA 3ICLA 3GR0A 1HYSA 3TEHB 2RU9A 1P9YA 4WJXA 1LL6A 3MPUB 3MEGB 1NNDA 4OYPA 1T05A 1U1OA 1RJJA 2AEFA 1F8AB 4ELVA 4Z2XA 3PR5B 1W2IA 2W8KA 2BQ3A 1VC6A 4MK9A 5B0BA 3P4UB 2EFGA 1TU0B 3BBCA 5CQGA 4DWSC 2QLJB 3CE8A 1XEZA 2R7RA 4DDFA 5ETSA 3MEGA 1X9SA 4TYBA 2ZUAA 1T9WA 2ZNZA 4B9NA 1X7VA 3FRYA 3TNVA 1M1GA 2ZH4A 4PKDB 5F0UA 4KIAA 1ZAXA 4RUBA 3SBMA 1RYSA 4DS4A 4M63A 3JSRA 2MQPA 4FAPA 2EC2A 4ILLA 2Q3PA 1YLXA 3CTRA 3UE2A 1FRKA 3CCUS 4NXNJ 1UVIA 1RBOB 3PRBA 1Q0NA 3A8JA 3O5QA 1XC9A 3M6VA 3GPKA 2CJXB 1ITPA 4RBVA 2KZZA 2VPYB 4OI6A 1F3VA 1U45A 1UWAA 2VA3A 3OOBA 4DRMA 1WJ9A 3ZNJ1 5DG7A 4LVOP 5HMYA 1EIYB 4NLUA 2R2UA 2V2KA 1VBZA 4QYRA 3VZIA 2QC3A 2RUGA 3O44A 1T7PA 4J9LA 3MM8B 2OTLS 2P4VA 2JSXA 2KJWA 5AT1B 2IVFB 4DL0C 4N56A 2ZM6J 2OEMA 3IKDA 4NXMF 1CQNA 1YBUA 4HHHA 1ZBVA 1RA7A 3R5AA 3MM8A 3DYAB 2DNMA 2Q6BA 2XP9A 2DR7A 2Y0SD 1UVLA 5IC6B 3QNWB 1QUPA 1QTMA 4NLVA 1OJ4A 4ICLB 2RVJA 4PXCA 5KFGA 4TU7A 1XHGA 3DYAA 2XO7A 1FJCA 1QSYA 3G6LA 2LKZA 2C2MB 1Y0OA 4JI1F 4DF4A 3C14B 3R5BA 3KAFA 1O8BA 1XR5A 4ECTA 3BF4A 3OLBA 4DV2F 1BWEA 3F0NA 4DCPB 1HD1A 4Z2LA 2EKNA 4H4OB 3ZTOA 4ZJOA 4ICLA 3OJSA 3N9UC 4Z2KA 5KFOA 4KKOB 4DN0A 2PE8A 3C14A 5SZTA 2CNKB 3CC2S 1NH6A 3QWUA 2LEBA 2IBKA 4H4OA 2I2YA 5B0FA 3O5IA 1H7WA 2PO4A 2P8IA 4KKOA 3JYTB 1U1RA 1S0VA 5GADU 3HPOA 3DOKB 2LXIA 1PJ5A 3I55S 4JP8A 4QQBA 2GJ2A 1BE4A 4K5RA 1YJRA 1F2HA 3H98A 1IVZA 1Q7LB 3JYTA 3O5DA 1XN9A 4ZDNA 4RNHA 1NKCA 1NBEB 2FD2A 1C2PA 3DOKA 2BUNA 2J0SD 4DCJB 1B7FA 5E3CA 4OV1A 5LMUF 3VGUA 5I98A 2DCUB 1E9LA 3N4WA 2XP3A 1JNTA 1TKTA 3W3SA 1YJ7A 2J7WA 1U0HB 3TAMB 3TP2A 4O3QA 2HEKA 4ODKA 2RIJA 1OIAA 4LIRA 4CLUA 2AX0A 1TL7B 5E3RA 1BC6A 2I9SA 2GHVC 1U0HA 3TAMA 3CB4A 4DPOA 4K59A 4ES3A 1ZU8A 1KQGB 5GAGI 2BJ1A 1NB2A 5C2GA 1Y5LB 5AXLA 3OTDA 5JMNA 4LSNB 3KZ7A 2R7WA 1S4FA 4IOAQ 8ATCB 1TL7A 1L3KA 1OY9A 2JZVA 1X4BA 2CNOB 3HD2A 2MF9A 3RYLA 3GCWP 3N6NA 4KR0B 2XMVA 1DQ9A 1SC4B 4NASA 2O9OA 3T1YF 3PW7A 2GJIA 4JOUA 3HI9A 3IFEA 4ZVGA 3RUBL 4LSNA 5KG2A 1G1XA 4OV6A 3S7RA 4GO5X 4B17A 1IJFB 1FNOA 3AS1A 2LKNA 4ED2A 3VAKA 4C8LA 3LGMA 3T6BA 1VFJA 1Z2ZA 3RZAA 4ZVUB 2R7UA 1IN0A 4NZ0A 2ZH9A 1VQ6S 2WK2A 1KDNA 4HBOA 1EQ0A 4CLFA 1IBLF 4DUTA 3GFYA 3K59A 1GMWA 1S6UA 3R7SB 3NRBA 1B0VA 4NA3A 4FVCA 3MCMA 2FY1A 4U84A 2X1GA 2RSEA 1RHUB 3TR5A 3C3LA 4IT4A 4L74A 5GPRA 3MDFA 3S01A 7FD1A 4ED8A 2ASLA 2YKNB 2W8LA 3EGZA 3GP9A 3VV2B 5LL6d 2BJ9A 4UW2A 3OL6A 4F02A 3KNAA 3B9AA 3EY6A 4LGXA 4NLDA 5J1PA 2ZZMA 4AQYJ 1ROTA 4KHPJ 2HHUA 2XGPA 2YVSA 2YKNA 4B3MJ 1NSPA 4YUDA 4DLGA 1F5AA 4HLBA 2WZ1A 5HWBA 1SJ3P 3BSCA 2MQ8A 1N0UA 2XI2A 3PA7A 4CQ1A 2BX6A 3V5RA 2EFNA 1MU2B 4F8RA 5DG9A 2OTJS 3Q0AA 5DQIA 3RGIA 4KV8B 4RL1A 3CCES 3RMEA 1HMVB 2J5AA 2OJ3A 4UF4A 4EK2A 1K1SA 3CIZA 1W9PA 3IM9A 1UP1A 3K89A 1GX5A 5DLFA 1MU2A 1NSKL 4GKKJ 1TAUA 4XDDA 4KV8A 1TKZB 3DLKB 1HMVA 1NM2A 1XERA 2PA3A 5BR8J 1HBOB 3RM4A 4B08A 1TMJA 3W64A 1RDRA 4N8NA 3ZZTA 1H6KX 1U8SA 2FHMA 1YZ7A 2CQCA 3A1YG 4E0DA 1TKZA 1PG5B 4A8SA 4PWDB 3NGTA 2CQDA 4U95A 4FF4A 1KHVA 5KTQA 1HBOA 4C7QA 1CPZA 3ET6B 2JEFA 3U27A 1QAYA 2APOA 1BLUA 3NGDA 2RHSB 2BMBA 2GGPB 2MYFA 1DLOB 4PWDA 5E3AA 1N36F 4JI5F 5DEZA 1ZH5A 1FDAA 5FIIA 3TX8A 1SH3A 2VFTA 4Q7NA 3NGKA 4CO4A 1S77D 3OTOJ 1VQKS 2IAJB 3IRXB 3M4XA 1NPPA 5D15A 4P2XA 5J2NB 2XP4A 2V69A 3JTPA 1YRXA 4W90B 2GGPA 2UUTA 2HG4A 1DLOA 2O1PA 2WB4A 3AXKA 1WC5A 4DR3F 2IAJA 3O5RA 3IRXA 4QOTA 2IHR1 4WCEQ 3WD1A 2QF8A 1F5BA 5DZ7A 2FDNA 2YNGB 2PMHA 2VKZG 2BA9A 1E6YB 3TQ1A 5DIVA 4IQXA 2KVQE 4U8VA 3D0HE 1UEVA 3H5YA 1GXLA 3PDNA 3CCQS 2YNGA 4RW6B 1E6YA 3D6TB 2I1RA 3UQAA 2V8HA 1MROB 2YNFB 4RWXA 2ALYB 1FX2A 3FY1A 3G8TA 2UU9F 5CAAA 4N76A 2QL5B 1YBTA 4OYWA 1EYMA 2WW8A 2AU0A 3ZTQA 2VU5A 4RW6A 2FJBB 2K1RB 1S10A 4UZCA 4OYXA 2FLNA 3IBWA 1MROA 2YNFA 3T5LA 2WSCC 2ZH1A 4ZIVA 3NMAA 4IR1A 3OQ2A 1FE0A 4QIWD 4I6YA 2L9NA 2JRSA 4DR4J 1JB0C 2LVWA 4W9OA 2K1RA 4TNSA 1EZZB 3KJNB 2CQ3A 4USJC 4LRFA 2GV1A 1FJ7A 2MPUA 4FPRA 2ZEJA 2FIUA 3HKWA 3MAQA 4WKFA 1XR6A 5CXTA 1U1KA 4OFZA 2BYCA 1AROP 4LF7F 1IBMJ 3H20A 2BABA 3M05A 3O5EA 3N01A 3KLIB 2XMAA 3T6JA 3G8SA 1RKIA 2QO3A 2YKQA 5K5MA 3S6EA 3ARUA 5DRKA 2RUSA 5IOLA 1OWQA 1WC1A 3A8EA 4RKUC 3JAMY 4DR5F 2DD8S 4NLPA 2EBGA 1G3OA 3AAWB 3AXMA 4KHRA 1Q1CA 3KLIA 1F9FA 4ML4A 3E51A 2YPZA 4DV6J 3CD5A 1X6LA 2GIFA 2X1FA 2PV1A 4OL8A 2ROPA 3RBDA 4C02B 1JX4A 1TFWA 3JAMU 2JNJA 4HH1A 1V6HA 2DR8A 2DGUA 1FXLA 6FD1A 2CDRB 3KABA 3X1LB 1VQOS 4NYPA 3H5XA 3UI6A 3P96A 3TUPA 1J2VA 3DKDA 3TAQA 2DNZA 1HKJA 1LW0B 5B0GA 4KGVB 4DR2F 4RZRA 4DU8A 2IVYA 1NRKA 3BH6B 4LF4J 1FXDA 3AQPA 3ISNC 1TFVA 4KHMA 3OA5A 4TYOA 1ZS6A 4ZCKA 2ZBCA 2DT0A 1RBLA 3VQSA 2PI5A 1LW0A 1K8AT 1FKHA 4PAAA 1S49A 5KFHA 4O4GB 3Q2TC 4DV1J 2DNNA 1XWLA 1FJGF 2ZD1B 3UDVA 1S4EA 2V2VA 5DDQC 3K5MA 3JTOA 2MKIA 2BBEA 2WW4A 3I4HX 2Y78A 2VBWA 1FWPA 3KJFB 4O4GA 4FP9A 4MPKA 3RM9A 2HZAA 2ZD1A 5IC4B 4X4PA 2JL9A 1Y3JA 1IR2A 2HFOA 2YBVA 2VONA 2NS1B 2PV2A 4UDMA 2HWTA 1RCOB 4NMLA 4EEYA 1WKJA 2UUBJ 2PFDA 3AT1B 4RW4B 2B31A 2DGOA 4X2BA 3AOCA 2QT7A 2RF2A 2XWXA 2DO0A 2OUGA 4ECXA 3SCIE 1RWKB 1DZ5A 4RW4A 1APSA 4JV5J 2WBRA 1JLBB 3FCHA 1WB0A 4I1TA 4DUYJ 4B9UA 1N4LA 2HHTA 4DLEA 1GK8A 1FCAA 4WXOA 3TVKA 4NZ7A 4DRKA 5EDWA 4E2FB 2BOPA 5HKGA 1UPPA 1S72S 5ETPA 4AD6A 4CDIA 1JLBA 1W9VA 4KB7A 4A8WA 3ENVA 2DGSA 1E44A 5ETKA 4MIBA 8AT1B 1WAWA 4GIVA 5KFWA 1U48A 3FCWA 4G65A 4JI0F 2WTFA 2JLGA 3GCXP 1P6TA 4J9NA 5HQLA 3JSMB 4OI4A 2XLIA 5IM0B 5E0OA 1FRMA 3MCNA 3EVOA 4PXDA 5G0RB 4YHHF 3QOKA 2JDJA 4IOBA 3MR6A 2WOMA 5L1LA 5J2PB 1YZ6A 3Q23A 5KFLA 5IM0A 4JI3F 2L2SA 1X4AA 2RRNA 3BKUA 5G0RA 2FQQB 2M8HA 3HVRA 1MN9A 5GMEA 4OX9F 1HLWA 4ZVFA 1ZPVA 4JYAF 2C3MA 2W2PP 1SQGA 1DHMA 2VCDA 5GMDA 1QJHA 3SFUA 5J2PA 2CG4A 3KLHA 1HR0F 3IXQA 4NMXA 4KGXB 2NUUG 3E01B 3OW2R 2F40A 1YGYA 3N5FA 3O1LA 3M8WA 1WORA 4WPAA 1C0TB 2VG5B 3I96A 1Q8LA 3V6JA 3OLAA 4IRDA 2VL1A 2NPIA 1TR0A 2C22A 1ZBWA 5AJ3F 3E01A 4DV7J 1OYEA 4OZ3A 3G2XA 1C0TA 2VG5A 1U1LA 3T1HF 3G6YA 1KS2A 1NHUA 4TLQA 1FKGA 4V19J 3IMQJ 1AW0A 3M9MB 5KG1A 1CSJA 2KT2A 2VDHA 1JQGA 1S7HA 3RB6A 3MZIA 2CPHA 4O3SA 2KT5A 2EKYA 2YNHB 5HROB 4B3TF 4CM0A 1JXLA 4TW6A 1S9EB 4JV1A 4X4UA 4OZJA 4ZJLA 4NYOA 1OWXA 5G4DA 4LQ9A 5J2MB 2IRYA 3N79A 2EG2A 2R7OA 4WFBQ 4RR5A 1RT4B 3FSIA 1VDHA 2CPDA 2HVDA 2YNHA 2VQEF 5HROA 3JQKA 2D3O1 5LOQA 1HARA 4DU7A 1S9EA 3CDEA 3MUMP 2D69A 1QAIA 2KFYA 1FRXA 4R0JA 5J2MA 3NNCA 2CQGA 1X0FA 2IDEA 1FDBA 4JV2A 1RT4A 1XQIA 4J90A 2Q66A 3QBCA 4P8UA 3CJ3A 1FFSB 2HBZB 5F8IA 1K73T 4HARA 1ZCNA 5K20B 2N87A 2DGWA 1RWMB 1FWKA 2M7SA 1FVSA 1HWKA 3R1HA 3PX0A 1PC4A 3E8OA 5KG3A 2CNNB 1TP7A 3KHLA 2OPSB 3BR8A 4UT4A 1HD0A 2XULA 2YH0A 3O5JA 4KGMA 5T41A 1VHFA 2DITA 3CCLS 5KFUA 2WVFA 3I32A 4J4NA 2E1PA 4DV5J 1TUGB 4DR6J 4KPCA 3AS2A 3LA0A 1Q81T 1FEHA 2OPSA 4BC7A 1VQ9S 4L3KA 3EDQB 4OZLA 3NS5A 1RAEB 5D78A 3JXOA 3G4SS 2OD6A 3LAKA 4O4RA 3K5NA 3TZZA 2C2EA 4MNMA 1RCXB 2DPEA 3WC0A 1QUVA 4QW9A 2RDIA 3WH0A 4C4WA 3DDKA 5DDOC 1VCTA 3OSPA 2C2DA 3CJSA 2CQBA 2UXDJ 1LWXA 4OHZA 2YKMB 3EPIA 1T9XA 2BV3A 1WDDA 3FCVA 3ALFA 4LFBJ 4I2QB 2YKMA 1RTDB 2CYYA 3A12A 4FBUA 2DYAA 2KVIA 1FTCA 4ETZA 1FVQA 2CG8A 3BEGB 3SV3A 5D4LA 1SKRA 3MM5A 1U1MA 2M1IA 3H2UB 4P71A 2QE5A 4DV3J 2CADA 3NXZA 2KI2A 5HW6A 1ZTTA 4I2QA 1RTDA 1XMQF 4WYWA 2W4DA 2G9OA 2EULA 3MHYA 1ZTWA 1UFWA 2ZM6F 1UPMB 3J7ZT 2YQ3A 2DT1A 1UZDA 2HQ3A 2CJAA 4C11B 4CLTA 2KN4A 4N7TA 4O3OA 3HDSA 3QAUA 4M5NA 1IR0A 1RWUA 5F3ZA 2FLOA 4YMEA 3MM7B 1RAHB 3Q8YA 2ETNA 4QWAA 2LXUA 3MUTP 1WKKA 3R2DJ 4ED7A 5CH7B 2VFVA 3R97A 4J9RA 5ETOA 3TCZA 2H48B 2ZC4A 2U2FA 4RU9A 3GYGA 4F4AA 4CP5A 3RG6A 3QAEA 2LECA 3QSIA 2BANB 2J8SA 3MM7A 3UPFA 4DX7A 5HJXA 3BXWA 1N0VC 1WWHA 2HVHA 1YJWS 2ZH5A 3HJFA 2CJBA 1YRUA 4C3LA 2OI2A 3QO9B 1M90T 4N8OA 2BANA 2LFVA 4WYLA 3QIPB 3GFZA 4F04B 2Q6CA 2JZ5A 3GPAA 5KFXA 3QJLA 2V94A 3G82B 1RHQB 4DEZA 5KFDA 2HFNA 4NZCA 3QO9A 4OJ1A 1YATA 3QIDA 4ITZA 3HFZB 5DM7Q 1NWUA 3AJ2A 3QIPA 3R7BB 1H74A 4HTIA 3G82A 2Z8QA 1CQMA 5DQGA 4NXMJ 3K57A 2EVZA 3CGMA 4XK8C 1KRPA 2VIHA 2Z56B 2PFFB 2B8PA 4DQIA 4KSEB 2A3AA 4RW9B 1PKUA 3IHZA 1KBRA 4G2PA 3NNHA 3CHCA 1RUSA 3W60A 3MI7X 1X9WA 4LF2A 1GUVA 3GIMA 4LSZB 3WD2A 2MHNA 3MMBB 1IBKJ 2QIFA 2VFRA 4MIAA 2KU7A 1VC0A 4HR2A 2K3KA 1M1HA 2DTJA 4QWCA 1ZM3A 4ZP9A 1HQ2A 4RW9A 1EQMA 3HFKA 4NLXA 3ENAA 4DS5A 3QFHA 4JI1J 3M8SA 1B4SA 1R8HA 4ECYA 1OMSA 4HDHA 4DV2J 4A8OA 2WM0A 4F25A 3MMBA 2NR0A 3K8WA 2WRMA 1SXLA 4DL5A 3SSSA 1KP6A 2JEGA 4TQRA 3F56A 1CVJA 1QDUB 2UZ5A 2D9PA 3HCXA 3UN3A 2FC8A 1T02A 5THWA 5H9FK 3CCWA 5E7OB 2CVEA 2YQ1A 4D3GA 1D2KA 3PRAA 2B6AB 3GLJA 4C8NA 3EJMA 4ED3A 4P2MA 4RPFA 2N3OA 1QE1B 1U1QA 3ZZUA 2DSZA 2XCAA 1OSDA 3BBBA 7FDRA 2ZBQA 2B6AA 1SC3B 2RRBA 3CJQA 3Q22A 3T5HA 1QE1A 1XMBA 1XNQF 3DNCA 4ZPAA 3V81B 1NLKL 5LMUJ 2R42A 4K7QA 4ED4A 1JXEA 2IY5B 1NWRA 1JLEB 2XMTA 3KKFA 2DJWA 1CBKA 2W2OP 3V81A 1F40A 1X5PA 4MJKA 2VQFJ 4K4ZA 2V2QA 2A2DA 2HFSA 5JUMA 2AGOA 3EZUA 3TEGA 2AYEA 2PC6A 2W7OA 5F8GA 2Y1IA 1WHWA 2DR5A 3G87A 4CO3A 2KFZA 3M6UA 1M1KT 1U4BA 1FKDA 1JLEA 4F0HA 2FVQA 4AQYF 1NHVA 4I56A 2GMJA 1FKPB 3HVWA 4MTPA 3MCSA 4MYUA 1FFWB 4HTJA 4ES2A 2HQFA 2YKOA 1JXVA 2E29A 2NXUA 5GAHU 3FMBA 4HVZA 3TYTA 1LJYA 1C4CA 1S12A 3OL9A 5GVQA 1JLAB 4NYZA 5IV4A 1FKPA 3GB0A 2AJ0A 3GJRB 4LMZA 3FBBA 1DURA 3T1YJ 2Y1RI 2M08A 2DRBA 1D8ZA 1RWXB 2AX1A 4UZBA 5KOXA 2Y9HA 1YJNS 2B9YA 1KQSR 5E2QA 3CF5Q 3BN7A 2W01A 4B3RJ 1JLAA 2X3GA 2H51B 2ZHOA 1E6VB 3ARRA 2DNQA 4B9VA 5AE2A 2MQNA 3AFGA 1E6PA 1CLFA 2ZOFA 3GG1A 4LR8A 3A3NB 4ZIWA 2HK2A 2HHVA 4MNLA 3BQ1A 5HMZA 2R9LA 1JMTA 2ATCB 4G6VB 4OJHA 3KJVB 3ARTA 1F9HA 2QG9B 3H5SA 3CJKB 1B64A 4ODLA 1E6VA 3GZ7A 2ASDA 3OSNA 1RLCL 1J4RA 4DFPA 3IR5B 3TQEA 3PFOA 3MPVA 1G7CB 2N4DA 2VDIA 3KJVA 1W1TA 2R7TA 3CJKA 3HHLB 3B4DA 1NMEB 4DQQA 3J7YI 1ZAWA 1RWVB 4Y2MA 2ABYA 5HVFA 4RUHA 3L4BC 3O5LA 5E33A 2Z57B 1BQXA 3DFEA 1F60B 3PW4A 1D9FA 4LAVA 3HHLA 1HPZB 1SQEA 3BO3A 1O6XA 3FEXB 3Q2SC 3MR2A 4I4BA 3OTOF 1SKUB 1NDPA 3I6CA 5I4MA 4J9UE 2B5UB 4MMOA 2ZHAA 2BXJA 3CCSS 1SIZA 3FSYA 1ZBKA 4EI2A 3TI0A 3F41A 4I0WA 1S0OA 3AD8C 2QN6B 4Z2GA 1BKFA 1HPZA 1EKRA 4RLEA 5IQQA 4YY3F 5L39A 4MT1A 2ITKA 1OY6A 3MM6A 4LBPA 1ZETA 2AOSA 3VAWA 2ZE2B 3K7RA 4FF3A 1XMOF 2EWHA 5IT0A 3AOBA 1KONA 2CVIA 5K8OA 1TL5A 4X64J 2NPFA 4J9QA 1N34J 2DK2A 2AEMA 4DG1B 4C0OC 3FAPA 1I6JA 2E1AA 2OPQB 4TKTA 2ZE2A 2V67A 3ARSA 3VQTA 1GX6A 1FF2A 1NXIA 1TL3B 4J4OA 1S59A 5FLXY 2O67A 2UUCF 4DG1A 4NLWA 1IKVB 2AMCB 2DGXA 3A3PB 2OPQA 4QIFA 5HJYA 2WVDA 3VAMA 2BW2A 3B4MA 4F50A 1TL3A 1WELA 2DSUA 3FQKA 5B0DA 1FJDA 3TDBA 4JI5J 2EBEA 1IKVA 4ECRA 4DR4F 2GC8A 2DIUA 4GMKA 3E2EA 2GIQA 5KFFA 2KB2A 4MK7A 3R5DA 2PPNA 5CD4H 2E7WA 3VGSA 2HIQA 4A46A 1FEEA 5L38A 4C8YA 2QMUB 1UFKA 3LWMA 1R0BG 1TK0A 1N5YB 2AGPA 5BXIA 3WL0A 3H5UA 4DR3J 3RRHA 4CRJA 3AH6A 3BDPA 1NSAA 2IRUA 4GKJF 1XNRJ 2VOPA 4YFUA 1L3VA 3NTPA 2RS8A 2BQRA 4D3HA 5BXJA 3B54A 4DSEA 1N5YA 4HEA9 4E98A 4DT4A 3OFGA 4P72A 3KHGA 4KBIA 4F3OA 4AUKA 2RQKA 3ARYA 1RHRB 4NLGA 3UQBA 2IA6A 3J81Y 2EFVA 4U96A 1ZYQA 1R3NA 1A7GE 1O0PA 2UU9J 2EEYA 3J80Y 4DV6F 2V6AA 3PG9A 3BJYA 2J76E 5HTGA 1T9VA 3ODKA 1ZM2A 3PRDA 3J81U 3G96A 4LUBA 2V68A 2ALZA 2YKAA 3RFWA 1JLGB 1FERA 3ZZ0A 2M88A 3HSJA 4U7UK 1FKTA 1V5IB 2U1AA 2OMLA 2JH3A 4S0MA 2CJ9A 1LWFB 3PXGa 2YNIB 2RURA 1KR4A 4DX8H 4MAKA 3U7JA 1MSWD 3DOMB 1JLGA 4JYSA 2HS0A 1L5UA 1VIOA 2LCWA 2VZ9A 3BQ0A 2QX0A 3DN9A 3MD1A 3M8ZA 1ZBTA 1LWFA 2YNIA 1VR6A 4DV1F 3W8GA 4LF7J 3CJ5A 2ZVIA 4DN9A 2DG9A 5KT5A 3DOMA 2GAHC 1ZZNA 4PWWA 3NCRA 9ATCB 2RS2A 5T7LB 2WSEC 1VQPS 5IWAJ 2H3EB 3CDBA 4DZ2A 4W5UA 4UQTA 2KXHA 1X5OA 3C16B 1HNZJ 5KFTA 2F21A 4DR5J 4NNRA 3FC9A 3BB5A 1N32F 3KAIA 2R8GA 5LXYA 5KT2A 3UNYA 1YRTA 5T7LA 1NK8A 3D3CJ 2K06A 3IWNC 1ZOTA 2KFNA 3WD4A 4GC7A 4H4KA 3C16A 2LA6A 3M2UB 1S6PB 2UUBF 1VRTB 3R3TA 1X4FA 1F6TA 4C3KA 3D1HA 3M2RB 2HIYA 1HNWJ 4EYIB 5I3QA 4EU0A 2W2NP 1U1PA 2YXLA 2XZWA 2PN6A 3TJ9A 4K50A 4DR2J 2CIMA 2H1YA 3M2UA 1VF8A 1U25A 1S6PA 3AS3A 4OJ3A 1VRTA 1KLMB 2DXEA 4CO0A 3M2RA 3IC1A 4C8KA 4HHJA 3QLHB 4X4TA 2ATLA 4JV5F 2OFGX 4LREA 1M5HA 2HRYA 3RAXA 2ZJRQ 3EE3A 4EFAC 1NK0A 2FYXA 3U1LA 1MW7A 3J7YU 3QMQA 4P75A 1EB0A 1KLMA 4NLQA 1TUVA 5AXMA 3O5TB 2HHSA 2LQBA 3QLHA 2HURA 1FJGJ 4LSLB 4K4WA 4CO1A 3LWLA 1QVFR 3SCLE 3EGNA 4L76A 3TUIC 4B3SJ 4DRPA 2QRRA 2ERRA 4E8UA 2QV6A 4LSLA 1FAPA 3CDAA 3NG8A 2A1BA 3W7BA 3HULA 2W1BA 4J37A 3TZWA 4ZA1A 5HI7A 1AYEA 3TARA 5L1KA 2ASJA 1WUUA 1FO1A 2XI3A 4ENOA 3QZ7A 3KDNA 2AKWB 2POKA 4P52A 2CRLA 3FVYA 5A2QY 3KLGB 2V2ZA 3BDEA 1SCJB 2D3OR 2ZH2A 1WOPA 2V8GA 2MQLA 5FD1A 2OP5A 5KFYA 3LALA 1SBRA 3TOQA 2G0CA 2VC1A 1G6BA 2M4MA 4WWSA 2QEXS 4I7FA 3KLGA 1PYOB 3B9EA 2DHSA 4DQRA 3AHPA 1VISA 5D75A 1H0GA 1CJVB 2F3JA 3J7Z5 3UI4A 4FYWB 3PHEA 3CD7A 4WK3A 4IO1A 2RQ4A 4DRNA 1LOUA 1M5SA 2ZDPA 2GVZB 3EXCX 3JQJA 3MEDB 3KMSA 2OGUA 1CJVA 4U7UD 5IV3A 3FBEA 3T41A 4X65J 1VLOA 4DWSD 3W5ZA 2VF3A 4JI0J 5HP1B 3CDUA 2E5IA 2UV8G 2GVZA 1B6CA 4DZ3A 2DR9A 2E5JA 3C8YA 1EETB 4NA2A 3MEDA 2RUQA 2N4CA 4YHHJ 3BM7A 4K4XA 4ZLNA 1NK4A 4ZN3A 1RAGB 2JJ4D 2KYXA 2PN0A 1YX2A 1WF2A 1WEXA 3DRYA 5HP1A 5KFRA 3RW7A 3HHNB 1U6BA 3PKMA 1D8YA 1EETA 4JI3J 3FZBA 5GADI 2X1AA 4QU7A 4ODOA 4DIPA 3RR7A 2PGCA 2W4PA 4M5HA 3K2YA 4RBUA 3FRZA 2LYVA 2XHCA 4OX9J 3W65A 4Q5VA 4FN5A 2HS3A 1PBUA 1KNZA 3BPDA 2B51A 4M5DB 1HR0J 3L09A 1L3UA 1PJ6A 1FKRA 2JFDA 2PEBA 3PKYA 2XP8A 3NEKA 4EBEA 1UMJA 2K3IA 1A6LA 4XO0A 3UDCA 5EWEA 4IT6A 2C28A 4Q8EA 3QT5A 4M5DA 3H2LA 3G86A 5D0GA 2MSTA 1MMNA 5DQHA 4C9DA 3NBPB 2FJXA 2DH9A 3VGTA 2D1CA 2XMMA 3T1HJ 2XWYA 5KG4A 5KT3A 1FKSA 1RWOB 1NWSA 1UWBB 2V9KA 3IK8A 2BJ8A 1TV6B 1YTYA 2QLFB 2RJZA 4YDDB 3EGVA 3NBPA 1MG7A 3UW1A 4GGQA 2FHOB 3FFIB 1Z1ZA 1TZ0A 4Z2JA 2HHXA 3HMJG 2HRUA 4F36A 1DY3A 4QYZK 1UWBA 5IXUA 2E1MC 3QFWA 2VN1A 3TVZA 1TV6A 2J9EA 2DPIA 2AYMA 1HI8A 2E66A 2D3UA 1NK6A 3ELHA 5HMXA 4CNZA 2VQEJ 5D4PA 4QPTA 2HRTA 3FFIA 3R8YA 3DGPB 4LRBA 1AZSB 3R27A 2ZUGA 3JSBA 3BBFA 1I94J 4OYBA 1B0TA 2MTLA 2DG4A 1S1TB 2DRDA 4URGA 3VTIA 5H9EK 5JXSA 1BWVA 4LFBF 2AJ4A 1RK8A 2VFUA 3PEJA 4A8MP 3DGPA 3J7A1 1AZSA 2NXNA 2OSRA 1QPLA 5CYMB 4DZDA 5D6GA 2XMUA 4QBUA 1QAJA 5CCLA 2MZ1A 5HL7Q 3Q83A 4L6V3 2V8DA 3DRSB 2KE0A 3BSNA 2EPIA 2XQCA 2CQPA 3IWXA 4ODNA 4OX8A 4KPYA 4CLSA 2KXFA 4OYIA 5IT9Y 2IIHA 1EKSA 5CYMA 4R0EA 2M2BA 1S1WB 5M2UA 2QSWA 1U2RA 3R6GB 5A8KB 1PYSB 4UOCA 2D3ZA 3DRSA 2PPPA 4PPDA 4EUVA 4K4YA 5KFVA 3QSYB 1LL7A 5EX0A 2XP5A 3W63A 5IT9U 2F23A 1S1WA 3NMRA 3F73A 4AL5A 2VJUA 5GMKa 3MFHA 4DRHA 1VJWA 5A8KA 1EP4B 4WXWA 2BRKA 1N1AA 2FJAB 3V4IB 1EDQA 1Q5VA 1NDKA 2HKEA 1C9HA 2ZR6A 5AXKA 4DL7A 2G13A 5SUHA 2CAJA 4EO8A 1DFDA 2HNDB 4A8KA 1NKBA 2RU3A 1REGX 3KG4A 1EP4A 4BS2A 2HBRB 2AWZA 4PG5A 3GJTB 2YBTA 5KG6A 1UR8A 3V4IA 3ADAC 3VALA 2HGNA 4CLWA 2I38A 5K14B 2QLWA 3PIPQ 3TA0A 3G6MA 2GO9A 1IWAA 2HNDA 4URQU 4QIBA 1ELOA 2MZRA 3WBZA 2RSQA 1SJRA 2C2OB 3O5PA 4DH0A 1AT1B 2DNRA 2HMIB 1YBAA 2VKRA 1WD6A 5K14A 1LG1A 4IRKA 1UTAA 4LAWA 3NWRA 3SCKE 2XYPB 4LBIA 3R5JB 4HT7A 2EW9A 4USVA 2CPZA 2LLZA 2IJNA 4C8MA 3ARVA 1UEKA 1XMQJ 4Q44A 2KGJA 1CJUB 2ACYA 1H2UX 1YK9A 2HMIA 3Q24A 1FKBA 2UUAF 3J7AN 4RO0A 1GH8A 4C6AA 1X8DA 3ARQA 2LU1A 2HQGA 2XP6A 1KVKA 1CJUA 1N8RT 2BJ3A 3NCQA 3MF5A 4ZS6A 3HZGA 5KFSA 2HQDA 4DPWA 1WHVA 3IO1A 3GIKA 1VGYA 1IBKF 2O01C 2MHEA 5KAKA 1R8BA 4C48A 1R89A 2NYHA 1W9UA 4YB5A 1FESA 5DO2A 4GO7X 3RAMA 2HVEA 5B09A 4ECUA 4RJVA 3G71S 3R2CJ 1HL6A 1H3DA 1NKEA 4Y00A 2KDOA 3V6KA 3SIPB 1ZPWX 3GFHA 1PILA 1X60A 3JS9A 4CH1A 2RT3A 4DFJA 3CVKA 3EDRB 2WCXA 2BZ2A 1YSJA 1CG2A 1W26A 4MTVA 5HK4A 4USIA 2UXBJ 1J5OB 3WX8A 1C1BB 2EC0A 1SL1A 3QQCD 4YN3B 2B43A 1RKJA 4I69A 1NU4A 1Q4RA 2LDIA 3RAQA 4ID8A 3QJJA 2YH1A 2NXEA 1RAIB 2PT0A 3IRWP 4YEAA 5MLCV 3DLLQ 1C1CB 1J5OA 1KWMA 4P7TA 1C1BA 3BGRB 3W8PA 1WTBA 5LJ3Y 3AJDA 4JI8J 4CTAB 1WSVA 5I42B 1BD6A 3CZ8A 4EMDA 5GQBA 1TKTB 1S6OA 2B8QA 4OYOA 1WOOA 1XBWA 4Z7YA 3J81j 2D9OA 2Q1LA 1Q8BA 2HFVA 1HI1A 3CCVS 2G0IA 4Q45A 1C1CA 3BGRA 3WHIA 1P1LA 2Z30B 3MD3A 3MFIA 2FZCB 4TU9A 1P8GA 3D7SB 2J6SA 4CTAA 5I42A 5CABA 1RAOA 4OHWA 2ZKUA 4DSKA 2EK6A 4ZVPB 4KYZA 4AT1B 3CC7S 4G3IA 1L3TA 2V9WA 2N3LA 3D6HB 3BGFA 3DLGB 3U1NA 3IM8A 2VQFF 1SPBP 2ZBRA 2J7UA 2BM0A 1JK9B 1YG0A 3QGHA 2OLHA 2YKPA 1NB7A 1QZ2A 3OFFA 4ZPCA 3NCPA 3AQOA 4RNMA 3DLGA 4QR2A 4WFNQ 5LXRA 2KO7A 2C3PA 4MNJA 3MWBA 4ZP7A 4KO0B 2BJDA 1F0XA 2FDMA 3B8SA 2C3OA 1WNEA 3IBCB 4QWBA 1KQKA 1WDTA 3DMJB 3MURP 3CJ4A 2KM8C 1VQ7S 2FUG9 4QWEA 2GIRA 2G8ZA 3OR2B 5K8NA 3CO9A 2XEXA 4FF1A 1NDCA 4KO0A 1WG5A 4N41A 1OPIA 2VH7A 4WKRA 2UZAA 1HJVA 3TUJC 4EZ6A 3HHLC 3DMJA 4B3RF 3NOGA 4ZP8A 2COLA 3D0IE 2QMWA 2IM0A 4ZVQB 3OR2A 1ZM9A 1XJWB 1LWCB 5DM6Q 1XNQJ 2DCLA 4W9PA 2PIIA 1PJ7A 1D3WA 3TO8A 1L1PA 3WD3A 2ZH7A 1R6YA 2XMWA 3AROA 2HGMA 4QR1A 2V5HG 3FBCA 4NWBA 4KC5A 4DR1F 4FVMA 4DV4F 2YWGA 1WG1A 2JWNA 3EM1A 1LWCA 5F0WA 2ZOGA 1JVWA 1S0MA 5CCMA 3PCOB 3SFGA 1P27B 1N6QB 3R5CA 2Y8YA 1E15A 2BDPA 2B9WA 2QL7B 2B5JB 3IS9B 4ODPA 4AFFA 2LQ8A 5DDPC 1ZA1B 1P9QC 5CD4A 2DGQA 3CPWR 3RBEA 5HT1A 4GVBB 4HBEA 1N6QA 3EWGA 1OGBA 1KOHA 1S1VB 2QL9B 2CQ0A 5M2RA 4K4SA 2DVIA 2R7QA 5IZHA 3R9LA 1U49A 2B5JA 3ZZYA 3IS9A 3IWLA 3SV4A 4FYXB 2UVUA 3JB9k 4LF9J 5B8IC 4UQGA 2Q5AA 2CJQA 2OPRB 4ANEA 1LQ9A 1RT3B 4GVBA 3I31A 3CCJS 2UUWA 4O23A 1C0UB 2E9TA 1S1VA 2MZSA 5L9NA 2UVVA 4EGLA 1RT6B 4PR6A 2KRRA 2OPRA 1RT3A 4DL2A 3OVBA 3LO3A 5A6WA 3PZPA 2YWFA 4TXSA 3M2VB 5HAOA 1O51A 3GU0A 1PBKA 1C0UA 2XZTB 2G0JA 2P9CA 1ROUA 2VPWB 4NLYA 4X64F 3B7XA 1N34F 2K2PA 1RT6A 3W61A 1DQAA 2XNRA 1HBMB 4TN2A 3WIJA 2XBPA 4X4SA 1R8CA 1SC1B 3IAM9 3M2VA 2O66A 1S76D 2F8MA 4M8LA 1NCLA 4MK8A 2W9CB 1DTTB 3UI5A 4UOFA 2MPHA 4X66F 3ULHA 4CLLA 3G9CA 4OYAA 2AYGA 2ZDOA 4ED5A 1HBMA 3CMAS 4NCAA 2R8HA 2RDJA 2ZZNA 2BEFA 2OELA 2W9CA 1DTTA 2B7BB 4CIOA 3ISND 3MGJA 2HNZB 5F9NA 3ZZPA 1NSQA 1SKWA 4ODMA 2CPEA 4NI2B 2VPZB 3NP5A 3T5KA 1T11A 1W1VA 2XYGB 2HPUA 1HWIA 2VB6A 3IR7B 1WEYA 1ZZFA 2DNOA 1VQMS 2X3DA 1FD8A 4DJBA 1N88A 4PQUB 2HNZA 5CZVA 1RAJA 5JVHQ 1S7IA 4NI2A 2VODA 4YY3J 1PAEX 1UJ4A 1H73A 4ZPBA 4QIGA 2KZMA 1XNRF 4PEOA 3DOLB 3T3FA 1JKHB 4PQUA 5KFPA 3PVXA 1B70B 3V4MA 4TYAA 1XMOJ 4MKBA 2FVRA 1SJQA 4LF8F 1S6QB 3BYPA 2HQCA 1M5VC 4OHVA 3KLVA 3U02A 4ZKAA 1FKOB 2MZQA 3DOLA 1JKHA 1LXNA 5KFNA 2QYGA 3Q8PB 3P6YC 3DCAA 4P7VA 5IS2A 3KG0A 2F1FA 2IBOA 3OVSA 3UN2A 1GQEA 1S6QA 4ED6A 1QSSA 2GJFA 4JFJA 3CJRA 2UUCJ 3BZQA 1FKOA 1KFWA 1VRQC 3S1TA 1N5TA 2QJ3A 3L9ZA 3I9ZA 1VLYA 1E6RA 3A4TA 1N48A 1BHNA 5D77A 3MM9B 3AJ1A 4USWA 3RB0A 3OT9A 1NK7A 3SQGB 4EBDA 1HQUB 5A76A 4PZVA 2NSBA 1Q6HA 2XB2D 4J9MA 2UVWA 2HHQA 4FXWA 2ILZA 4S3KA 3MM9A 2F9DA 1B7YB 4WZQA 3FEZA 2FPHX 3FXYA 1HHSA 1LV5A 1RQ0A 1SVDA 5LSRA 3NNAA 3SQGA 2HW3A 1HQUA 4OHYA 2FZGB 2BJ7A 2DY9A 1YQHA 3EGWB 4GKJJ 4F0KA 1F5CA 2YQ0A 3OXGA 4OZ0A 1LFPA 4WFZA 5DJBA 4H4MB 4IH7A 2ADBA 5HW8A 3OTEA 1DAXA 4NLSA 3CGIA 1YJUA 1M5OC 3W5XA 5IWAF 1WKLA 2R4FA 1TQLA 2IRXA 4C8OA 1HNZF 3LTOA 4PRFA 4CLKA 4DRJA 4H4MA 1EHWA 1VBXA 3CHDA 2M0GB 4I6AA 4G50A 1N5VA 2WBMA 3D54A 2MB0B 1X6NA 4QW8A 3CNQP 1RTIB 4Q2LA 4WKAA 1W25A 1HNWF 3NS7B 4RBTA 1Z4UA 3BYRA 1U26A 4R5PB 2AJFE 4FXDA 5JH8A 1V3ZA 2BRLA 2XYHB 4ZCIA 2FLPA 2PI6A 2Z2LA 2ZBIA 4YR2A 3V6HA 1RTIA 4KY3A 4EZ9A 1JJCB 5GAEU 3D4JA 3CJ2A 5HVHA 1Q7YT 2FHJD 3UWTA 5KOWA 3ISZA 1TTHB 2F4FA 4R5PA 1SB6A 3LOUA 2HBQB 4GVLA 3C2PA 1R7IA 2EFOA 3OTBA 4I67A 1H72C 1TCOC 4N47A 4M5MA 4PWUA 1FTRA 1OO0B 1IWGA 1WC4A 5CA5A 4DSJA 3MTKA 2Y1LB 3DRPB 4MFBB 5BYQA 5LMNJ 4QYZJ 4BCAA 2CQ2A 3HSDA 4B3SF 3AY0A 4JI6F 1KT1A 5I3UB 3C66A 2Z2MA 1X5SA 1FD9A 1Y3KA 3DRPA 4MFBA 1N32J 3FSXA 5KFEA 3KXDA 3SDEB 3PW0A 1K0VA 1P1TA 1S48A 3PFEA 1B0PA 2RF2B 4ZVSB 3R5GA 2A3CA 5H9EJ 2HFZA 2YX7A 3H42A 5I3UA 1UJ6A 1U1NA 3SCJE 2IUZA 1QTNB 4CO2A 4MNKA 2KT3A 3BV8A 4F0MA 3SDEA 2OH2A 4FS1A 2FY8A 3TRGA 4I6WA 1KFDA 2XS7A 2OAUA 1IJEB 4L3NA 4J91A 3P49B 1U7LA 3D6FB 3E3XA 1IX5A 4S3JA 5A8RB 1N5SA 5C7PA 1O5JA 5ETNA 2GZOA 4DRIA 3GYNA 3O5GA 2XLKA 1NUEA 1K1QA 1NDLA 2I0XA 3N6MA 1WC6A 3MOZA 2MNTA 1YJ9S 2V50A 2B0GA 4OI1A 4DRQA 1M5YA 3ILLA 5A8RA 1NMWA 3RGCA 3CULA 2O5DA 3ARWA 4X62J 3H7HB 3UR0A 1T95A 5KFZA 3L95X 4OLPA 2MKJA 4MYTA 3GMGA 4ZN1A 4X65F 1HFEL 2QSFA 1FNXH 5I3PA 4M95A 2AV5A 5L1JA 2WOMB 4CT8A 1UL3A 1U2CA 2E7XA 3EPGA 4PYAA 3PEHA 2IF4A 3I87A 2W2MP 3HK2A 3BQ2A 1AA1B 2PA8D 4ZLPA 4I68A 4B9TA 4JFKA 5T14A 3QGGA 3SSRA 5DLGA 1BUXA 1PBAA 1JNZB 1R9HA 3VCDA 3KLHB 2ACMA 3P8BB 4NSBA 2H5IB 4G1PA 4QU6A 4ZMMA 2AHOB 2WK4A 1TL4A 3VGVA 3GE9A 2GHPA 2MQQA 3OPKA 2AEJA 4P73A 1ZK6A 3MMAB 1OGGA 5B0EA 4F4YA 2DHGA 3TZYA 1FXRA 2DHXA 1JLFB 2CQ4A 4F7VA 1GMUA 1R43A 4NRUA 4IG0B 2VICA 1NK5A 4Z2IA 4B9LA 1PGZA 4BLGA 3MMAA 4F67A 3I5AA 2RNEA 5KG7A 2P6TA 4X4OA 1JLFA 5F9LA 1RT2B 4WIQA 4RWWA 3G6XA 2IMWP 4ZPDA 2XO6A 3FNNA 4IG0A 1FFRA 4CH0S 1H0IA 2PBCA 3TANA 4Q0BB 3W4RA 5HVGA 4PXEA 4FKYA 3A13A 5ETQA 1N54B 3MEKA 2HWHA 1RT2A 2P9GA 2V4RA 3C46A 3OV7A 4Y2IA 5HQMA 2F65A 2KJVA 3QRQA 3M6WA 4A4JA 2CJKA 4Q0BA 1S5ZA 1BY9A 2Y3YA 2ZR5A 2W7AA 1D9DA 1NH7A 1KKHA 4P6QA 5B0AA 4DPUA 1NK9A 2DT3A 4RX6A 2YPYA 3FEYB 2YX1A 5RUBA 1Z2LA 3KUHA 4DOZA 4J9OA 2DO4A 3TW0A 2A6OA 4LAYA 1HBUB 1N5QA 3UD5A 1NZ8A 4TLRA 4DHVA 4LF6J 2LXFA 2XCPA 3W9JA 3IGNA 3MPYA 1I94F 1FKLA 2H65B 3UDLA 4JI2F 2ZNYA 2ZJQQ 3ETOA 2IJRA 2NLWA 4GRSA 1YW5A 1HBUA 4R25A 2F63A 3I56S 1I5OB 3PJXA 1X4DA 1RB0A 2QLXA 4J5OA 3M1VB 4Y34A 1UR9A 4NPOA 3LW5C 1UVKA 2E5HA 2G2YA 1R6VA 3T19A 3D28A 3WC2A 3ZC4A 3W2WB 1IQZA 1V5VA 2GA7A 4UUXA 1YJTA 2FC9A 1TKXB 2B9EA 2LP4A 3KWMA 3M1VA 3FDSA 2KO1A 1KC8T 2BOAA 4DV0J 4NX9A 1AFIA 4DROA 3C6UB 2J7KA 3ILJA 3BKFA 1X4HA 2RH3A 3BN4A 3W2WA 3K58A 2XS5A 3ILOA 4K0KJ 3BH7B 3EZOA 2RUCA 4ZP6A 3QGPA 5KFKA 1SH0A 2Q43A 1TKXA 2VC0A 4P8VA 1K0TA 2D41A 5HWCA 2DKOB 4FNHA 3C6UA 1Y7PA 2OO4A 3ZXWA 4Q22A 2XC9A 1T94A 3POTB 1FT8A 5GAHI 3HVTB 2IMOA 1GMWD 5KT6A 3W66A 2A0FB 4DR7J 3Q8SB 4ECZA 2IA0A 2I5JB 5J2QB 5HBMB 2VOOA 3MM5B 1TMMA 3POTA 1Q86T 2RAQA 1VMBA 3HVTA 4N19A 5AXNA 2OHDA 3CCMS 3O5OA 1F9EB 3GG0A 3NI6A 1JJ4A 3WIUA 1SJFA 3PJ9A 5DG8A 2I5JA 5J2QA 1RYRA 1V3RA 2F9JA 9RUBA 5HBMA 1QVGR 1VQYA 2UP1A 4B9SA 2DNKA 3D0GE 4O2TA 4DQSA 1WF0A 5HMWA 2R8KA 1F2GA 3KNGA 2PSZA 3M8PB 3MEEB 3CC4S 3P5TL 3KHRA 2FTRA 2BM1A 3CHFA 4ZVEA 4FYDA 2W24A 3DLHA 4TY8B 2NXCA 1BXNA 3US5A 3M8PA 3MEEA 2L9DA 1EARA 5H1SV 2B4PA 2LQ5A 3I82A 4J9KA 2VBXA 3HFVA 4USMA 3DI6B 4JFIA 1U47A 4LJMA 4ZPVR 2Y8WA 1WI8A 2VG7B 3B8HA 4TY8A 2XHWA 2LMIA 4FXVA 2QTWA 1YWXA 1RHJB 1KTVA 3VWSA 4F3MA 2MKKA 1GRJA 3DI6A 3KAHA 1H98A 5F8MA 2CQ1A 3ZFVA 2VG7A 4WE1B 5FDLB 1S9GB 3SEOA 3OR1B 2VG6B 1Y5IB 1RZMA 1H38A 2WAQD 1T9TA 2PD1A 1HNXJ 2DB1A 5KG0A 4CM2A 4BWMA 2F4VJ 2VJVA 4CH7A 4WE1A 5FDLA 4USTA 1S9GA 3OR1A 2V34A 3CDWA 2VG6A 1RTJB 2OFHX 4CLZA 3LGNA 2M5YA 3UR3C 2DNPA 2UXBF 5KFAA 4OZ1A 3THTA 4PXBA 1XK8A 3AB2B 1G2EA 3I5CA 3MPDA 1IBCB 1NJWA 3CUNA 2MMYA 3TAPA 1OQ3A 1RTJA 1GFWB 5D4NA 5B0CA 3C15B 2N82B 1OS5A 4V19X 1SJ1A 4Y6IA 2BR0A 4PG7A 4U85A 2RDDA 4KH1B 3NS6A 2UUAJ 2PEHA 4JI8F 2OIHA 3MAAB 1CEZA 3O5MA 3PW5A 1BL4A 3GWCA 1PC5A 1YKWA 3PO5A 1SV5B 2JC1A 2MKHA 2DXDA 3C15A 1QLNA 3O3LA 1LKZA 5LM7E 4IPXA 4ODQA 2CPFA 3MAAA 1NJIT 4QIVA 4K4UA 1NWTA 3HSZA 4FYVB 5K8PA 5JVGQ 4ZJQA 5LSOA 3KHHA 4MKAA 2WB1D 3BSOA 4JV0A 3PO4A 1TVRB 1SV5A 2MEWA 3JYMA 4TW7A 2WONB 2EFPA 3KAGA 2MQOA 2CZVC 3ZTSA 2W25A 1EAYC 4ERDA 3ETMA 1FI4A 3UN5A 4ZVHA 1U8WA 1RWPB 3IN5A 1KD1T 1OSCA 1TVRA 2E1RA 4TW8A 2WONA 3DLKA 2RQSA 3JXVA 3OFHA 5ETTA 3H59A 1XR7A 4R0XA 3MR7A 4OIXA 3VZHA 3PYDA 4MH8A 4F2RA 3HT3A 4OYMA 3W9IA 3I4PA 3BKTA 4BBYA 1CJTB 2R2TA 3WL1A 4WJBA 4NE9C 1S99A 2IM3A 4QJVA 2FVPA 3ET6A 2XPAA 1JLQB 2DXFA 1B3TA 2XP7A 1HWLA 1VRUB 1Q79A 1FDNA 1SUQB 4Z37A 2UXCJ 3TVYA 1KT0A 2HNYB 2EG1A 3DDIA 3B6BA 1RWNB 4CWBA 1D7IA 1CJTA 1HWUA 2DHHA 2BE9B 1S79A 7AT1B 3FKBA 3GV7B 2MKSA 3MTJA 3BGOP 4USKA 4BC9A 2E1CA 1LW2B 3LUYA 1JLQA 1HKMA 3RB4A 1KLNA 3GJSB 3TUZC 1VRUA 2CKWA 5IQ6A 3VAFA 1VQ8S 2DNGA 5J2NA 1SUQA 1NSGA 3KOAA 1RT5B 1J4IA 2HNYA 4DPXA 1MWQA 2VPXB 3PM9A 4DBQA 3DRXA 2EK1A 2HHPA 1Y4ZB 4LRCA 1LW2A 3PV8A 1QSLA 2GVDB 1S9FA 4U6PA 1WI6A 4ZPWR 2VBZA 1RT5A 3TZXA 5J1EB 5HSPA 2LJ4A 3KACA 4JB8B 2XZDB 4LFAF 3IAS9 4WF9Q 2B3TB 2E7VA 2KG1A 1E6ZA 2LEPA 1EHNA 1RACB 1R8PA 2GVDA 4KQZA 3GIJA 4LT6A 4IQ2A 1QPFA 4Q43A 4UOGA 4KJIA 5J1EA 4LF9F 2UV8A 3PYFA 2M70A 3R1LA 1K9TA 5A0YB 2GHWA 3UCUP 4DSFA 4FS2A 5CYJA 3O8WA 3EVWA 1XTZA 5EHHA 3LP0B 1KTQA 3AD9C 3I6PA 1SC6A 5A0YA 4DUZF 3HHEA 3NRKA 4DXLA 1FRJA 1JNSA 4NCBA 5L46A 2CUYA 4L72B 5KFIA 4IRCA 2L48A 5D8HB 2HZVA 4W9QA 3DXBA 3LP0A 2BE7D 3GV5B 5EWGA 1AUSL 1QY7A 1UZHA 1Q95G 2PMWA 1HIYA 4DR1J 4K4TA 4Z2HA 4DV4J 3Q8QB 5GAGU 4FPIA 4YOEA 1ULRA 3SQOP 2ZJPQ 5B08A 2DISA 4DL3A 5KT4A 3CJ0A 4PG4A 2VD3A 2M8DB 3D66A 3T9ZA 3A3OB 3KG1A 2D7SA 2LQ9A 4LR9A 2ZH8A 1SH2A 1Q6IA 4HHUA 3RU0A 1LXJA 2M2AA 2A10A 4WFAQ 3I0RB 4N77A 1RTHB 3OHBA 3O5FA 5A6PA 4OJGA 1NJZA 2FLLA 3EX7B 4MGVA 3Q8RB 2CQHA 4NLOA 2WLYA 2QA4G 2AQ4A 3MM6B 4O0NA 1LK7A 4W98A 3H90A 1NMVA 3LAMA 4YR0A 3V6DB 1GXUA 2WLZA 3I0RA 4DSIA 4RNFA 1RTHA 3DC2A 5CYQB 3NY0A 5KFCA 1ZM4A 3EXYA 4QIEA 3FQLA 3O2IA 5DETA 4ES1A 3D3BJ 2MJNA 2WHOA 3DLEB 3ILIA 2LPVA 1M0SA 4TVAB 3KDOA 3V6DA 4EWTA 4LFCF 3AODA 3FZ2A 5CYQA 3CJ8A 3SI8A 1UJ5A 4B3OB 4NL5A 3Q8UA 2L9WA 1ZAVA 1VQSA 4LAXA 1V3SA 3D9BA 5EGYA 3A8IA 3DU5A 2XSJB 1TK5A 2KHDA 1J4HA 3BS9A 2IC3B 3DLEA 2MQMA 1K47A 4DMZA 2M52A 4X66J 4A8YA 4B3OA 1X4GA 3WX4A 1UW4A 2JOQA 2ZH3A 3HVAA 4M5KA 1CC7A 1R0AB 3I5BA 4U9RA 2ZH6A 2B56A 1MWZA 2XSJA 2A2CA 4KGZB 1URNA 2IC3A 4NRTA 1SR0A 4AXJA 2P9EA 2J6UA 4ECQA 4CI0B 2MY8A 2KH9A 2R7SA 3H9RB 3CD6S 1HNVB 3PTWA 4H54A 2LU2A 5FLXU 1R0AA 1R31A 2HVZA 4A48A 1RWWB 4YR3A 3RW6A 4RU2A 4JI4F 4G1QB 1A7XA 1FWLA 2JEIA 4U67Q 1EIBA 4XPCA 2XG8A 1J5EF 1HHQA 1HNVA 3D5MA 2Z2YB 2QA1A 4DSLA 3M7VA 2G1HA 2NSCA 2J9DA 3EYZA 5KFQA 4NLTA 1IR1A 4G1QA 4YDXA 4C2MA 1U0SA 1G4CA 1S0NA 4X4QA 2M3DA 1KN6A 1GTEA 1DJ0A 4URIA 4NLRA 1UKUA 3IGVA 3WKZA 4M5GA 2EXUA 3T1AA 2JEJA 4AY1A 4LF8J 3M8RA 2K8IA 1QM9A 5DZ6A 2CFXA 2Y1JA 1ZB5A 4ZLLA 3CMES 1IQTA 1VK8A 3BGUA 3MAHA 3GIRA 3BPSP 2NZ4A 4QZVB 3KADA 2MLYA 3V2UC 3ITHB 1Q16B 3CJTA 4CZCA 4C97A 4C3MA 4BF8A 2MXYA 3EZ5A 2DEIA 3RTVA 1RHMB 3H25A 4ELTA 1PAUB 4FYYB 1RU2A 3J80U 3ITHA 3FJ2A 2FJDB 4HDGA 3JSMA 5F8NA 2XMKA 4PPZA 2R2RA 4DL6A 3QATA 3K5LA 2GQCA 5KT7A 4PUOB 2YWKA 1YI2S 1IKXB 2QA4S 1JLCB 4LF5F 1D6OA 4USUA 5CZXA 1A0OB 1I3OB 4XTTA 1JNDA 4HT5A 1FKFA 2MLZA 4J9PA 1YDLA 2O3DA 2AYBA 5EWFA 1VBYA 2DPJA 3VF0B 4PUOA 1IKXA 5E3QA 1JLCA 1W7WA 1MMDA 5LMNF 4LBHA 5K8MA 2FVCA 1HKAA 4LIWA 2WSFC 5HQ8A 4WP3A 3D1QA 1RI7A 4J9SA 2OLWA 5HUAA 4ITSA 4C98A 2E5LJ 3K17A 4HKQA 3W5YA 3RJMB 2HHHJ 1REVB 1NJXA 2HWIA 2XLJA 4WU2A 4NA1A 4C0HA 1D09B 3OBIA 4JBCA 3CXCR 3AS0A 3IP0A 4UY8T 2AJ1A 3CT9A 3QRRA 3TA2A 1TUWA 3IA0A 1REVA 3FK4A 4ILMA 1FHTA 3PIOQ 2ASYA 4CO5A 2BACA 3SSQA 4K4VA 2HVIA 4P9SA 2YX4A 1FFGB 3LUOA 4F4WA 1PO6A 2C2ZB 4ID5B 1WC0A 2ZKTA 2CA9A 2R7XA 3IKGA 3QT6A 4YB7A 2W7PA 1VHIA 2CQIA 1VQ5S 1RISA 3DXSX 2XNQA 4ZCMA 1KFSA 4IOCQ 3M8QB 1N33J 2QLBB 5ETVA 4XIUA 2J9DE 2F8HA 4OI3A 4USHA 2Z0GA 1VI7A 1RAAB 1T9UA 4HACB 1W1YA 4ID5A 5ITHA 2RMLA 1KEKA 3OVAA 2KRBA 2YWHA 4ECSA 2BVZA 1U02A 3GSIA 3ENQA 4X62F 3M8QA 1CJKB 2XY6A 1WHYA 1RT7B 4O3RA 4HACA 5FJ4A 4U7CA 1RP5A 1HNIB 3W9HA 1U6FA 3HT0A 2WVCA 4QT3A 3LQVA 1Q82T 4AYBD 4P74A 5AE1A 4JI6J 1EQ3A 2KG0A 3NAHA 2R7VA 2DT9A 1CJKA 2AZ3A 1RT7A 4Y2KA 2E44A 5D0RA 1HNIA 3QRPA 4K5SA 4Q7AA 1TKDA 1LEOA 2F2DA 2FHKA 4MKVA 3RM8A 3BREA 4F2SA 3Q8VA 3GFXA 1UETA 5KFJA 4JUZA 4I7FB 4Y3CA 4WKHA 3CW2C 3QT8A 1SL0A 5GPGA 2GMLA 2GQ2A 2KTQA 2GO8A 2GW8A 3NKYA 3VAGA 3HM9A 2BKOA 1R0CB 3DLJA 3N5BA 3Q89A 5KFMA 2L08A 4DX6A 2GX8A 2Z4PA 5A2QU 4M5IA 3MR5A 3QZ8A 4WP8A 2IYIA 3N6LA 4CLPA 3D2WA 5D3GB 3HP6A 5HATA 4JFMA 3EICA 2PPOA 3H4BA 2CWKA 2MZTA 2D9FA 2B4UA 3B82A 1IM4A 4NXNF 5EUHA 3RRGA 4YP3A 1FNMA 2R3VA 2JHEA 5C5JA 1U79A 3TX0A 3UQSA 5D3GA 2IDLA 6FDRA 4P8XA 4EO6A 3NGSA 4NZ6A 1RABB 2FGCA 2OD4A 2IFXA 2V8PA 4HI1A 4JI7J 2BE2B 1JJ2R 3DGVA 1HJXA 1MMLA 3M9NB 4LRAA 2DNYA 3CEDA 1RHKB 4OI2A 3TA1A 2NXJA 3NAIA 2G4BA 1ITXA 1IKYB 2MZJA 3IR6B 4LR7A 2DRAA 4ZHRB 2UVRA 3M30B 2GAGC 2BE2A 1KVIA 4M5LA 3WZ0A 2FZKB 1WACA 2H4WB 3CMQA 2OEKA 3BR9A 3QGIA 1IKYA 1ZL1A 3MUVP 5M2PA 4ZHRA 2IJFA 3M30A 2HHWA 4LF6F 3R7NB 4DQPA 4C11A 2AW0A 2DGTA 1W2BR 1Q6UA 2G41A 4F26A 2LGOA 4R5EA 4ZCLA 1LG2A 4WP9A 3KFWX 1NEEA 2DSWA 4F3QA 4P2FA 2YY3A 4WFYA 4G1IA 4AXIA 1GNKA 2F5GA 3OL8A 3I0SB 2KFWA 1BQNB 3OD2A 2J6TA 2F4EA 3W1YC 4BHQA 4IH6A 4FBTA 3FBFA 3WDOA 3ARXA 4WKYA 4DPTA 3ENWA 5BJRA 4DWSB 2OEJA 4DV0F 3I0SA 4ETXA 1BQNA 1JNEA 1YIJS 1E6NA 1CC8A 3EVMA 3EIPA 2GQQA 2I6WA 4K0KF 2HBYB 2YTCA 3GR1A 2CZ4A
chains in the Genus database with same CATH topology
1FJEB 2BQRA 2JC0A 1M5KC 2Q79A 4YB6A 2N7CA 3P49B 4D3HA 4DWSA 3KNAA 4F02A 1U7LA 3E3XA 3B9AA 3EY6A 4LGXA 4NLDA 5J1PA 3UD4P 1D1UA 2ZZMA 1IX5A 5BXJA 3OJUA 4DSEA 1N5YA 4HEA9 4S3JA 4E98A 5A8RB 1ROTA 4DT4A 1N5SA 2H9ZA 3OFGA 3PX6A 1UAWA 1O5JA 2HHUA 4WK9A 4K4SA 3KHGA 4DRIA 4C0BA 3GYNA 4KBIA 2XGPA 3O5GA 2YVSA 4F3OA 2YKNA 4AUKA 3T9NA 2XLKA 2RQKA 4MKYA 3ARYA 4NLGA 1K1QA 4YUDA 3UQBA 3HKZD 2I0XA 4DLGA 3N6MA 2IA6A 3J81Y 1KVJA 1F5AA 2EFVA 3MOZA 2DGVA 4HLBA 1ZYQA 1R3NA 4DR7F 2MNTA 1YJ9S 1A7GE 4C8ZA 5HWBA 2B0GA 4OI1A 3HXMA 1SJ3P 1O0PA 3BSCA 3J80Y 1Q78A 4DRQA 2B4OA 1M5YA 5A8RA 3CULA 1NMWA 3RGCA 4DV6F 3GV8B 1N0UA 3ARWA 2O5DA 3BJYA 2J76E 3UR0A 4RNNA 5HTGA 3PA7A 1T95A 2XI2A 5KFZA 4CQ1A 3V5RA 1NO8A 2V4QA 3L95X 2EFNA 1MU2B 4OLPA 4F8RA 3ODKA 2MKJA 5DG9A 1ZM2A 4MYTA 2OTJS 3GMGA 3DDNA 5J6EA 3PRDA 3Q0AA 4HH0A 5DQIA 2IM2A 4KV8B 2G1DA 3CCES 3RMEA 3LH2S 4LUBA 3G96A 1HMVB 3VAIA 3HZEA 2J5AA 4X65F 2OJ3A 1HFEL 2QSFA 1FNXH 2J0WA 5I3PA 4M95A 2ALZA 2AV5A 1GAOA 1K1SA 5BYRA 5L1JA 4WIWA 2WOMB 2YKAA 3CIZA 4DFKA 1W9PA 3RFWA 1JLGB 1UP1A 2J0XA 4CT8A 4IFVB 1FERA 1GX5A 1X5TA 1UL3A 3PR4A 5DLFA 3ZZ0A 1HWJA 2E7XA 1HQEB 3EPGA 1MU2A 2M88A 2F7VA 4P8WA 3PEHA 4YQWA 2IF4A 3I87A 1TAUA 4XDDA 4U7UK 3HK2A 3BQ2A 1FKTA 2R8JA 2U1AA 2OMLA 2PA8D 4KV8A 1TKZB 2JH3A 2KYZA 2CJ9A 2VV5A 4I68A 4ZLPA 2ZHBA 3DLKB 1LWFB 1HMVA 2JFKA 2RURA 2YNIB 3PXGa 4JFKA 2VUGA 2MY7A 5T14A 1XERA 1KR4A 2PA3A 3QGGA 3SSRA 5DLGA 4DX8H 4MAKA 4ECVA 3U7JA 1HBOB 4B3OA 1JNZB 1R9HA 3RM4A 4B08A 1MSWD 1AFJA 1LFWA 3VCDA 3KLHB 2VA2A 1JLGA 1RDRA 4N8NA 4IFVA 3ZZTA 3WQVA 4JYSA 1H6KX 1U8SA 4NSBA 2HS0A 2FHMA 1HQEA 1L5UA 2ZC3A 5F8LA 1VIOA 4G1PA 2LCWA 4QU6A 1D9AA 4ZMMA 3O6QA 2CQCA 3A1YG 2VZ9A 1GTHA 4QWDA 3BQ0A 3MDYB 3DN9A 3MD1A 2KXNB 4E0DA 1TKZA 4CNYA 2WK4A 1ZBTA 4A8SA 1LWFA 1TL4A 2YNIA 4PWDB 4DV1F 4WTYA 2CQDA 5C24B 3CJ5A 3GE9A 2GHPA 2MQQA 5E5NA 4FF4A 1KHVA 1URRA 2CPJA 3OPKA 1HBOA 4P2SA 2DG9A 4DN9A 5KTQA 5KT5A 2AGQA 1N56A 4OMFG 3DOMA 1ZZNA 3NL0A 4IH5A 4C7QA 1CPZA 2BJEA 5F8HA 1ZK6A 3ZZZA 2B7CB 3MMAB 3NCRA 4EBCA 1OGGA 5B0EA 2P5VA 2JEFA 3U27A 4F4YA 2DHGA 3MR3A 1QAYA 2APOA 1BLUA 3NGDA 1FXRA 2RS2A 2DHXA 1JLFB 5T7LB 2CQ4A 2WSEC 2GGPB 4DFMA 2MYFA 1DLOB 1VQPS 3CDBA 2HYIB 4PWDA 4DZ2A 4W5UA 5E3AA 1N36F 4JI5F 5DEZA 1R43A 2KXHA 1FDAA 1X5OA 5DF0A 3P3DA 4UQTA 5C24A 1ZH5A 5FIIA 4NRUA 3TX8A 3ARPA 4IG0B 5KFTA 4QPXA 3DHWC 2F21A 4NNRA 1SH3A 2VFTA 4Q7NA 3NGKA 4Z2IA 4CO4A 1NK5A 1S77D 3BB5A 1VQKS 4OLOA 2IAJB 3KAIA 4B9LA 3UQIA 3IRXB 1PGZA 3M4XA 2R8GA 3MMAA 5LXYA 4F67A 2MDAA 3I5AA 4BDPA 3IG1B 2RNEA 3NLCA 4Y0FA 3WD0A 2I8EA 5KG7A 5KT2A 2P6TA 5J2NB 2XP4A 1Y00A 3JTPA 1YRXA 1YRTA 4X4OA 1JLFA 3PX4A 5T7LA 5F9LA 5DGAA 1NK8A 4W90B 1RT2B 2GGPA 2UUTA 2HG4A 1DLOA 3IWNC 4RWWA 1ZOTA 3G6XA 2IMWP 4ZPDA 2KFNA 3WD4A 4GC7A 2AJQA 4H4KA 2O1PA 2WB4A 3RB3A 3FNNA 4IG0A 4ZK7M 1SI9A 1FFRA 2LA6A 4CH0S 1H0IA 3M2UB 5IT4A 1SKSA 4OZ5A 1HNXF 1S6PB 3OUYB 2PBCA 3TANA 4DR3F 3W4RA 1VRTB 1X4FA 3R3TA 2IAJA 4C3KA 3O5RA 3D1HA 3IRXA 2IHR1 3M2RB 4PXEA 4QOTA 4WCEQ 1S97A 2F4VF 4ZPTR 3WD1A 2DT2A 2QF8A 2DIVA 2EFQA 3IG1A 4EYIB 1UA1A 1FKIA 3CH9A 5I3QA 1HKKA 1F5BA 1N54B 4EU0A 3ALGA 4IQMA 5EX3A 3MEKA 1U1PA 2HWHA 1RT2A 2P9GA 3N0VA 2V4RA 3C46A 3OV7A 2O92A 4Y2IA 2FDNA 2XZWA 3UD3P 1U24A 2YNGB 1DQ8A 3CWJA 2PMHA 2KJVA 3SYZA 2VKZG 2PN6A 2BA9A 4K50A 1E6YB 2R8IA 3M6WA 2W9BB 3TQ1A 5DIVA 4A4JA 4IQXA 2CJKA 2CIMA 3M2UA 3BO2A 2ADCA 1VF8A 1U25A 3HHLD 1S6PA 3OUYA 3AS3A 4OJ3A 1VRTA 4Q0BA 3DU6A 1KLMB 1BY9A 1UEVA 3D0HE 3M2RA 4CO0A 2ZR5A 3IC1A 4C8KA 2W7AA 2MKCA 4KHPF 2QA2A 4HHJA 3QLHB 1D9DA 4X4TA 2ATLA 1RT1B 1NH7A 4JV5F 4KFBB 2OFGX 2RILA 3H5YA 4P6QA 2ROEA 5DS7A 1GXLA 5B0AA 4UUWA 4CT9A 1M5HA 1VQ4S 1NK9A 2HRYA 4B3MF 3PDNA 3CCQS 2ZJRQ 2DT3A 1KHWA 4RX6A 4EFAC 3RAXA 2YNGA 1NK0A 4RW6B 5EN1A 3FEYB 1E6YA 3B9DA 3UQAA 3TC5A 2I1RA 2V8HA 3U1LA 1MW7A 1MROB 2YX1A 3J7YU 2W9BA 2YNFB 4RWXA 1Z2LA 3QMQA 4DOZA 4J9OA 3X3UA 4YB1P 3FY1A 2DO4A 3TW0A 3G8TA 4LAYA 3GQCA 1HBUB 2UU9F 1KLMA 4NLQA 1N5QA 1TUVA 5AXMA 3O5TB 2HHSA 2LQBA 3QLHA 4TLRA 1RT1A 4DHVA 4N76A 4KFBA 2LXFA 2XCPA 3IGNA 3MPYA 1I94F 4LSLB 1O6IA 4K4WA 1EYMA 2WW8A 2AU0A 1FKLA 4RW6A 2FJBB 3UDLA 4CO1A 4ELUA 4K2XA 4JI2F 3ZZRA 2K1RB 2ZNYA 3OFEA 1S10A 3LWLA 2ZJQQ 3SCLE 1QVFR 3EGNA 3ETOA 2ROGA 3IBWA 2FLNA 3W2VB 1MROA 2YNFA 2NLWA 3T5LA 2WSCC 2ZH1A 3TUIC 3HHDA 1YW5A 4DRPA 1HBUA 4R25A 2QRRA 3I56S 2ERRA 3PJXA 3NMAA 4IR1A 1X4DA 3OQ2A 1FE0A 2QLXA 4QIWD 4I6YA 2ILYA 3FGVA 2EI5A 2L9NA 2JRSA 4J5OA 1X4EA 4ZOSA 3M1VB 4Y34A 4E8UA 2QV6A 1UR9A 4LSLA 4NPOA 1FAPA 3CDAA 1JB0C 3NG8A 2A1BA 3LW5C 3W7BA 2C2RA 1UVKA 2E5HA 2JLEA 4GKKF 2LVWA 4W9OA 4J37A 2K1RA 3T19A 3D28A 3WC2A 3ZC4A 4F4KA 2DG3A 4QR0A 4TNSA 3W2WB 4ZA1A 5HI7A 3W2VA 2CQ3A 4USJC 3TARA 1IQZA 1VIXA 2GV1A 5L1KA 1FJ7A 2GA7A 1FKKA 1YJVA 5BR8F 4UUXA 2ASJA 1YJTA 2FC9A 1TKXB 1FO1A 2OMOA 2KM8B 2XI3A 3QZ7A 1U6ZA 2MPUA 4FPRA 3KWMA 4FNIA 2POKA 2FIUA 3M1VA 3HKWA 3MAQA 3DRRB 4XAKA 3FDSA 2D74B 3G6VA 2KO1A 5C25B 1KC8T 2CRLA 3FVYA 4NX9A 1AFIA 4DROA 3C6UB 5A2QY 3KLGB 4WKFA 1XR6A 2XY7A 3CGNA 3BDEA 5CXTA 1OPZA 4QCLA 2J7KA 4TU9A 2D3OR 3BN4A 1X4HA 2RH3A 3W2WA 2ZH2A 1U1KA 3K58A 2XS5A 2V8GA 2MQLA 5FD1A 2XPBA 2OP5A 4OFZA 2RUCA 2BYCA 5KFYA 1WNOA 1AROP 4ZP6A 5MAOA 4LF7F 5DIUA 1FKJA 3EUNA 3QGPA 3H20A 5KFKA 1SH0A 4DF8A 2BABA 2Q43A 1TKXA 3I9V9 3LALA 2VC0A 4P8VA 5AE3A 1SBRA 1K0TA 3M05A 3O5EA 2D41A 3N01A 1S1UB 5HWCA 2G0CA 3PNIA 3TOQA 2VC1A 1G6BA 1FRLA 4FNHA 2M4MA 3DRRA 3KLIB 2E5GA 5C25A 4AL6A