4ZPTR

Structure of mers-coronavirus spike receptor-binding domain (england1 strain) in complex with vaccine-elicited murine neutralizing antibody d12 (crystal form 1)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
208
structure length
208
Chain Sequence
b'VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRFLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D12 Fab Heavy chain
publication title Evaluation of candidate vaccine approaches for MERS-CoV
pubmed doi rcsb
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
molecule tags Viral protein/immune system
total genus 52
structure length 208
sequence length 208
chains with identical sequence S
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4zptR02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zptR01
2GHVC 2DD8S 4ZPVR 4L3NA 4XAKA 3SCKE 4ZPWR 3D0HE 4QZVB 3SCLE 5DO2A 3D0IE 2GHWA 4L72B 3BGFA 2AJFE 3SCJE 4KR0B 4ZPTR 4ZS6A 3SCIE 4KQZA 3D0GE
chains in the Genus database with same CATH superfamily
1GOIA 1S9EA 2H5EA 1LEOA 2DO4A 5A6PA 3BGRA 3S01A 1I5OB 4ZS6A 2UXDF 1CULB 3LP0A 4W9PA 1PBUA 4QU7A 2RQ4A 2VQFJ 3THTA 3PXGa 4TW7A 4ZPWR 3PYEA 4CM2A 4ECQA 2FY1A 2H3EB 2CVIA 5KAKA 1N33J 3C14B 3VGUA 4JI8J 1KRPA 2PN0A 3H4BA 2GFFA 1O8BA 4DR7J 2ZHBA 4FPIA 3VAJA 1GX5A 1M1KT 2V50A 3OTCA 3JSRA 5A0YB 2HFUA 4TU7A 4ZVUB 4Y2AA 2RSEA 4EBEA 1VR6A 4UY85 2QLBB 4JYSA 3LGHA 1X5SA 2L48A 2Z2YB 4FXVA 3CJQA 2DNLA 1EB0A 3DRSA 4OQJA 1RLDA 2NR0A 2MGZB 1NMWA 4RZRA 2EFOA 1XNRJ 3V2UC 2BRKA 2MPUA 3PX0A 1JKHB 1KQKA 1G7CB 3OR2A 2QL7B 2WB1D 4OYZA 2I6WA 3TAQA 3IRXB 4CTAB 4DPXA 4C48A 2M70A 2WOMB 1X8DA 4LREA 2FZCB 5HKGA 1ZA2B 4JI7F 3K17A 2RDIA 1AUDA 3OXLA 3DGPA 4MH8A 4CCHA 3RR7A 2ZNYA 4EFAC 3X3UA 3KJFB 2IYGA 3T5KA 2XP9A 4A8YA 4MFBB 4RR5A 2RS2A 4LRCA 2NLWA 4K4SA 4ANCA 2VKRA 4ZP7A 4DFJA 3W4RA 1RTZA 1YJVA 1XK8A 3BPSP 1T9UA 3EWGA 1U47A 1AYEA 1IQTA 3AODA 2NXUA 1T9WA 3M8QA 4HDGA 5A2QU 2B0GA 1TP7A 1HNXJ 5HP1A 5HL7Q 3GSIA 3LOUA 1N4LA 3QWPA 2XGPA 1QPFA 1FEEA 1R8AA 1HHSA 4NL5A 2RSQA 4KBIA 5KFJA 1BKFA 3MM8A 2MKHA 5KG7A 2XC9A 3J7A1 1KEKA 3U02A 1KOOA 3QT7A 5A8WB 4DFMA 1FKLA 2VFVA 4I2PA 4IFVB 4LT6A 2ACYA 5J2NA 1YZ6A 4BC7A 3QGIA 5K8PA 3GIMA 2W9CB 2OSRA 3MECB 3I0SA 1TKZB 3C6TB 3ICLA 2OGUA 4IG0B 5CABA 3GLJA 3C66A 4ZP9A 1DARA 2WW8A 5CXTA 1RTIB 4ZLJA 3DYAB 2R2SA 2FLPA 4TLRA 2YNIA 4HT5A 2FQQB 3SCJE 2DNOA 4K5SA 1FJEB 1PYOB 1SQEA 3K5PA 4A47A 1RWMB 2L9NA 4C8KA 4X66F 3C46A 3TYTA 3HHDA 3U7JA 1K9TA 3RU0A 1Q82T 4KRWA 3CSKA 4DR3F 2CWXA 5AJ3F 2BM0A 1OSDA 1OQ3A 2WLYA 3BREA 2CPZA 4FVMA 5BR8J 4NE9C 2LMIA 2M1IA 2JOQA 2K3KA 2DPJA 2ZQTA 4A8SA 2XP5A 2DNHA 3JYTB 2E7XA 1WHVA 2K7KA 4AQYJ 2DGSA 2ZBIA 2YWGA 3E01B 3MF5A 2ACMA 1UA0A 5D0HA 2ZD1A 4PAAA 1U0SA 1EETB 2MKKA 2PA3A 3SMZA 4LF7F 3VVUA 3ZZPA 2EFGA 1KTQA 3VV2B 3I87A 2WONB 4KGZB 2ZE2B 4RUAA 3H9RB 2DNYA 4B9MA 1N5YA 1REGX 4ECRA 2AYMA 4K4WA 3N9UC 3W3SA 2YNGA 1QY7A 1JWWA 1IBMJ 1HI1A 2YKNA 3JAMU 3ZTSA 1EQMA 3MCMA 1NMVA 1RT7B 2IRUA 2XCPA 2YNFA 2XPBA 3F73A 2HBZB 4P71A 3J7ZT 2HMIB 5KFEA 3WBZA 4N41A 1KKHA 3FQLA 2F5GA 4MKYA 2AEFA 1NNDA 4DUTA 1HWKA 3VCDA 1LNQA 4I6YA 4Q8EA 2PI4A 1YG0A 1TU0B 3S6EA 5F9NA 4KC5A 4LVNP 4M5DA 1SIZA 1TZ0A 1LFPA 2EKYA 1IR1A 2CPFA 2P6TA 2XMAA 2H65B 3QIPA 4L3KA 1QAXA 3CC4S 4PG5A 1X60A 3NBPB 1OGGA 2R2TA 5CZVA 1LG2A 4HI2A 4X62F 2HWHA 1NB7A 2WSEC 4DX8H 3K0JA 1XRVA 1U8SA 2F2DA 4OJHA 2YBVA 2GO9A 3NL0A 4C3KA 4GO7X 4KKOA 2GVZB 2OPSB 1FKSA 1ZM4A 1K8AT 1FTCA 3SBMA 2XI3A 1E6VA 2NQPA 2D3OR 4WIWA 5FLXU 4WFBQ 2JH3A 4ZVPB 2RDJA 3FBBA 5IT4A 2Z4PA 3PVXA 2QX0A 1SUQB 2B7CB 3RGIA 1SR0A 2BOAA 3MTJA 3KADA 3MM5A 2DHHA 3LTOA 4KJIA 1O6XA 3N79A 2NPIA 3CHCA 2NSCA 3Q8YA 4O3OA 1EJ7L 1BXNA 2JDJA 5E33A 1HI0P 5ETMA 3W5ZA 2BACA 4PPZA 1IKYA 1H73A 1I1GA 1VRUB 1WDDA 2FLLA 4LF4F 2KH9A 2VZ9A 3B9EA 3OT9A 3AD8C 2AJ0A 2KO1A 2R7WA 4EWTA 1ULRA 2RB7A 1FE4A 3BH6B 2F4FA 3PDNA 4DPUA 5KOWA 3CW2C 2E5HA 2IHR1 3HHLC 1FRJA 4I4BA 1UEVA 2XY5A 1FVQA 4NASA 1M1GA 4R5EA 1ZOTA 2D74B 2R7UA 4I7FA 4ZITA 5B8IC 1L5UA 2OPRA 4H4OB 3EDRB 4ID8A 1VC6A 4DRQA 4Z2HA 4Z37A 1XEZA 2R7OA 4X4SA 1AT1B 1NK8A 2CQCA 2QRRA 3UN2A 3WD1A 3RJMB 2CQDA 2K7JA 2RU3A 2QT7A 4GC6A 4JI1J 3LGNA 4V19J 1DHMA 1W2IA 3BM7A 3AFGA 1TVRA 2QLWA 1NMEB 3WD4A 4WP3A 2WVDA 1VQOS 1XJWB 5HQLA 3H90A 3CC2S 4DL6A 3M6XA 1CQMA 4NLUA 3OTEA 3R8YA 5GMEA 2IJNA 2CNNB 2IC3A 4AE5A 4UT4A 3GP9A 5CYJA 5EX3A 3V6DA 3HZEA 2Q43A 2C3MA 3I9ZA 5A76A 3T19A 3KK3B 3ALFA 4WE1B 2H4WB 3ITHB 1FKHA 4MNMA 1FFSB 3SDEB 1GT8A 1TL3B 1Y0HA 2KL8A 2PN6A 4LSNA 2E66A 1XERA 4AUKA 3WC0A 4NYPA 4ED4A 5F8JA 5L39A 5HMXA 4NMXA 3F44A 3TX0A 2I0XA 3POTB 4U9RA 5RUBA 1LXJA 4U96A 2AEMA 2OD4A 3IXQA 3HKWA 4QR2A 1CS4B 4L74A 1S6QB 1HBMB 2OMLA 4DF4A 1Y11A 3D6MB 4PEOA 2Y0BB 1VOMA 4RNOA 1FJGJ 5DZ7A 1VIXA 2HHQA 2XB2D 1W7WA 5DG8A 1ZTWA 1T03A 3JTOA 1M90T 1RJJA 2IRYA 4LBIA 4LQ9A 4DUZJ 1IKXA 4C7QA 4DV2J 2CQ3A 1K73T 3CJ4A 5CH7B 1JCHB 2DR6A 2RRAA 4USKA 1UCNA 4C8NA 4CO3A 3NNAA 5K14B 2EFNA 1U1MA 1C9HA 5GMDA 3MPYA 2KVIA 1NKEA 3NP5A 2VC0A 1SH3A 2NXJA 2L9WA 3SQGA 3FZBA 1TKXA 1N52B 4G6VB 1UR9A 4X62J 3WC2A 2PDAA 4MT1A 3VAHA 5KT4A 4NEYA 2FVSA 4BCAA 3KK2B 2W9AA 1YLXA 2MSSA 1WB0A 2HBYB 4ZOSA 4K4UA 2J76E 2N3LA 5E3RA 4C8OA 1NKBA 1M1HA 4IT4A 3O5KA 1U25A 4WU3A 1K9MT 2MHEA 4OL8A 4DEZA 1M0SA 3FEXB 2UUCJ 2DEIA 4ECVA 1JMTA 1VJWA 1HWLA 3BXWA 2YXLA 4EGLA 1Q5YA 4DF8A 4KFBA 3DOLA 3NS6A 3MMJA 3ZZYA 4USJC 2HS0A 2OAUA 2H54B 1K1SA 2WHOA 3MEGB 3AJ2A 2B5JB 1GTEA 2N7CA 4PQAA 4WK9A 3OA5A 1UZHA 4LSLA 3IR7B 4PQUB 4KO0A 2LP4A 4RW9B 1QSYA 1DQAA 3K5OA 3NS5A 3MTKA 4PWDA 3QYYA 4W4MA 4HTIA 1M5HA 3ET6A 1AZSB 1AW0A 3BSCA 2A3EA 5KG6A 1U6ZA 3CUNA 3QGPA 4Y0FA 4USTA 3BMBA 4RKUC 3EPGA 1W1PA 4N7TA 5HAOA 5HANA 4GVLA 3PYDA 2XMTA 2XO6A 3TUJC 1SJQA 2O9OA 2N3OA 4IOAQ 2V4JA 2XSJA 2HQGA 2O92A 4LF2A 5F3ZA 3O5MA 2OLHA 3GFXA 4ZLPA 3NCQA 3CJKB 4LR8A 1O0PA 3FSYA 1N34F 3O5QA 4LFAJ 1NK4A 1X4DA 4DQSA 4V1Ak 4B3OA 2F4VF 2M0GB 4CWBA 2ITKA 1JLGB 3DNCA 1P5QA 5LXRA 2K8IA 1YK9A 4X65J 3LH2S 1T8EA 2OD6A 4OZ0A 1LK7A 3D7SB 3FJ2A 3HSGA 3WKZA 3FUYA 4PYAA 3H2LA 4YY3F 1X0PA 3PYFA 2H51B 2C3YA 1M5VC 1WD6A 1W26A 5A8KB 5BXJA 2ZHAA 3C3LA 5ETLA 2KE0A 3KLIB 3RB6A 4OJ3A 4MTPA 1S10A 2QGFB 3KG4A 4DRNA 2CQPA 2EBGA 4GRSA 2CA9A 3VAMA 4PG7A 3QT8A 1G6BA 1CULA 1N32J 1YTYA 3BB5A 5D0GA 3JSYA 1P9YA 1JJCB 3T6BA 1OPZA 1RHMB 4FDFA 4M63A 2FLOA 1LW0A 3KHHA 4ZJQA 4C11B 2ZBPA 3RAXA 4W90B 1Y5LB 5GVQA 2DGOA 2JVOA 4IOCQ 4JI3F 4I68A 5A0YA 3G8QA 1S6UA 5L1KA 5KFKA 4U95A 4FKYA 2BUNA 2CG4A 1T3NA 5ETRA 3W1YC 4U8VA 4WZMA 1KLNA 4IFYB 4ZPTR 4LGXA 2DRDA 4XK8C 2VOPA 5IXUA 2ZUAA 3KNGA 5EWFA 1I6JA 2HRYA 3DGVA 4OX8A 3K5NA 2DGQA 5HJXA 3GE9A 4PUOB 3OVAA 1X4HA 2WOMA 3AHPA 1LWXA 4Z2KA 1VF8A 4WFAQ 1U4BA 1RWVB 4WPAA 5AXKA 4Y2CA 1YJRA 3PO5A 5HJYA 3V81A 3WZ0A 1NHUA 1RT3B 5L1IA 4LQ3A 2IDEA 4J4NA 2MQMA 5HTGA 3MMCB 3PHEA 1WSRA 4MFBA 1U1LA 5D75A 2VASA 3MFIA 1HHTP 4S3KA 2Y9HA 2BW2A 4U7UD 1NH7A 3ARSA 2UU9J 2AV5A 3PW4A 1WDTA 1KFWA 1F6TA 1BQMB 5GAEU 4ZPAA 2F21A 5H9FK 3TUZC 3IP0A 3P4UB 4CI0B 3UQIA 3TQ1A 2U2FA 3BGFA 3FBCA 5AE1A 2O5DA 2BJ9A 1N54B 4QPTA 2JEFA 1Q78A 4Q43A 4LF9J 1NKCA 3AQPA 1LL4A 5HWCA 5FIIA 3UI3A 5KFCA 1RE1B 1U2RA 1KWMA 4NA2A 2M7SA 4ODRA 1VK3A 2YWKA 3KNAA 3CCWA 4NWBA 4J9PA 4XTTA 3OFGA 2W7AA 4OIXA 2GC8A 4CQ1A 4WFZA 4JFMA 3D0IE 3MURP 2XP6A 2W2PP 5CYQB 4LVOP 3PY8A 2W9CA 3DM2B 1SL2A 3MECA 2OEMA 1TKZA 3C6TA 5KT5A 5IM0B 4IG0A 5IZHA 1YBTA 2GMHA 4QYZK 1IBKF 2WM0A 1F3VA 1RTIA 3DYAA 4DRHA 1VRTA 5I4MA 1L3KA 3VZHA 4FN5A 2W1BA 4ITSA 3DMJB 1LL7A 1RUSA 4NA3A 2AT1B 3A4TA 2ASDA 1IBLJ 1EHWA 1WC5A 1PGZA 3ZZTA 3BJYA 2OLWA 2RE1A 4LAVA 4MKVA 4DDFA 2ASLA 4C0BA 1N34J 1W1TA 3QSYB 4OV6A 5B09A 3RGCA 2GNKA 5IC6B 4EK2A 1VBZA 3UFCX 1WNEA 2C2KB 2KXHA 4DQIA 3Q8PB 3NEKA 1LKZA 1XMQF 1V3ZA 5KFHA 3EE3A 3JYTA 4IT6A 4LUBA 3NCPA 5I3PA 2J0XA 1SXLA 1FRIA 5DDRC 1D0EA 5C2GA 4CLUA 4KH1B 5F8HA 1EETA 4YR2A 3FEZA 1WSVA 4YOEA 3TX8A 3K89A 1IR0A 1U1PA 2JRSA 2WRMA 1GFWB 1FT8A 1LW2B 2ZE2A 2J9DE 4DSLA 2PV1A 1OWQA 2DNQA 3TA0A 4U67Q 2V8GA 2AYEA 2UUTA 2J8AA 3CGMA 2H5IB 4WJBA 3QIDA 2J0WA 2Y1RI 3CIMA 2VQEF 3K8WA 1RT7A 1SJ3P 3LP1A 1BQNB 4CH0S 2HMIA 1JLQB 3VVTA 3CMES 1DLOB 2HVEA 4NCAA 4OI6A 4IPXA 1SV5B 1EIYB 4LF5J 3E3XA 3GIRA 4DQQA 3QNWB 1A0OB 4DJBA 3LANA 4J9VA 3LPYA 2VB6A 1XWLA 2CXEA 3CJRA 5ETOA 3PR4A 3VQTA 4NZCA 3VGSA 2C22A 3PZPA 5FJ4A 5A8RB 5J1PA 2VCDA 3O5TB 3NBPA 2G41A 4GVBA 4UOHA 3CDAA 2BBEA 2KZMA 3UR0A 3MOJB 4ED6A 1CJUB 1DQ9A 2HS3A 1UVLA 4DR4J 3RRGA 4USMA 2KVQE 4PG8A 4ZVOB 4QBUA 2QYCA 2ZJPQ 5LMUJ 3C8YA 2B9WA 3TI0A 3M8YA 4ZIVA 1EYMA 3I56S 3PACA 3AH6A 2CQHA 1JK9B 4QR1A 4DV7J 1VQ7S 2QMWA 1VRQC 4C8LA 4A8QA 2LGOA 4OLOA 5J1EB 2DR9A 4I0WA 5IFMA 1HNWJ 2HGNA 1FDDA 2HQCA 2YVSA 1TK5A 2KGJA 1ZB5A 3MAHA 3WD2A 4USHA 1RAJA 1VRUA 4ZHRB 1ROTA 1NLKL 2EWHA 3WIUA 2OTLS 2AD9A 5E2QA 1HNZF 3KFWX 2CPIA 1W9PA 2ESCA 2XG8A 3I5CA 4ELVA 4N47A 5I3UB 2P5VA 4QIBA 5HWBA 1CBKA 1PG5B 3OVSA 4LFCJ 1SQGA 3CJTA 4DV6F 1Z2LA 1GMWD 3CJ0A 3C15B 3CJ8A 1FKKA 5DJBA 1TR0A 2W7PA 5C24B 3Q86A 2MQPA 4Q0BB 1RDRA 4P8VA 5DIUA 1S1WA 4RU9A 2BXJA 3GYNA 4QT2A 5SUHA 2IVYA 2JWNA 4H4OA 2B43A 4OYPA 4UZBA 3TVKA 4OYOA 2ZEJA 2X3GA 2CJAA 1V3SA 5L8RC 3UI5A 4DWSD 1J5OB 3CTRA 1WHWA 1D9DA 1IBKJ 3MMBA 4ICLB 4YDXA 4R5PB 3KMQA 1LOUA 5G0RB 3KJQB 4DMZA 2PSZA 2HFOA 1FK9B 4Q7AA 3RG6A 1FDBA 3ISND 5HBMB 1JJ2R 5DDPC 3UD3P 1NDKA 4ZVSB 5HW7A 2W2NP 1U1QA 4OYIA 3CIZA 2VFRA 3RBXA 5AT1B 4DT4A 5IWAJ 2C2DA 2ROGA 2MQLA 2RHSB 3S8SA 2D9FA 4EBCA 4CO2A 1T05B 4OZJA 5DLGA 3W8PA 2E9TA 3H98A 4E98A 2I2YA 2VFTA 2W2MP 4Z2JA 4WE1A 3D54A 1IJFB 3ITHA 2KT3A 4ZJLA 1NHVA 3SDEA 3M32A 1G3OA 2ZH2A 1F0XA 1D8YA 2N7YA 2YKOA 1V3RA 1HJXA 2GCFA 3HVRA 4Q45A 5LMNF 2AU0A 2Z58B 4NOHA 1S9GB 2FHMA 4ZPBA 4DSFA 2VD3A 3HT3A 5KFAA 1MN9A 2GA7A 2OHDA 2DNRA 1I51B 1D9FA 2Q3PA 1B6CA 4B9NA 2U1AA 3NKYA 2VC1A 1RAHB 1S6QA 1HBMA 2C2NA 4KTQA 2YBTA 5H9EJ 2DGWA 3HXMA 1FWLA 3WX8A 4H4MB 3NNCA 3HSDA 3JAMY 1NK9A 1RTHB 1HBUB 5D3GA 2HGLA 2DK2A 3ISZA 4ANEA 5LL6d 1BQXA 4YEAA 3RB0A 2DXEA 3PKYA 1RT5A 1UFKA 4FXWA 1WOOA 2H5JB 3RFWA 4TY8B 2JNJA 5K14A 3ENVA 1LWCA 2F9JA 4G1PA 3CJ3A 2XZTB 2KR7A 3T1AA 3RYLA 2YPZA 3QT6A 3M7VA 1OY8A 1JLEA 1JLCA 2EG2A 1SJRA 5G4DA 3UCUP 3SEOA 4O23A 3KDOA 1QE1B 5IOLA 3DLGB 1RAFB 2PMHA 1IN0A 2ATLA 2J8SA 2GHVC 5E3PA 1Q86T 4DU7A 3KUEA 2G8ZA 4FN2A 3THPA 1FDAA 1RBLA 2IA6A 3ILOA 2HWTA 3QAEA 4KHMA 2OPPB 2FJEB 3SQOP 3ONQA 3IKDA 3P6YC 1CC8A 2PE8A 3LAMA 4F0MA 2GX8A 3QO9A 2VFSA 5FLXY 2VPZB 3CHDA 3M6UA 1U49A 2KDOA 4F02A 1RHQB 1ZBVA 3DDIA 3HT0A 3GTYX 3KYLA 1HNIA 4HYKA 4RLEA 2XBPA 4TYOA 3GPAA 4RX6A 2G0JA 3QLHB 4UQGA 2DR7A 2M5YA 1Y0OA 2KKHA 3W64A 3NRKA 5GAHI 3MEGA 2LU1A 1H3DA 3K5LA 1FFQA 4PQUA 4QWAA 3PFEA 2OIHA 1SC4B 2DT2A 2XM3A 2CG8A 3BGUA 1PYTA 2BJ8A 2LDYA 5HMZA 1V5IB 1D6OA 1UAWA 3FZ2A 4CDIA 1WF2A 3QFHA 5HATA 4WYWA 2UUAJ 1Y5NB 3KXDA 3UPFA 3H59A 3R3TA 3MM9A 3I6CA 2JLGA 2DRAA 1GX6A 1TMJA 2QE5A 4FP9A 1SC3B 2EK1A 1HJWA 3UI4A 3I0RB 4IKAA 4OHZA 7FDRA 3CCSS 5EDWA 3IWNC 4P52A 1NK7A 3CJKA 1Q5VA 3DLBA 3PR9A 2KB2A 1YJ9S 4FBUA 2B56A 2BOPA 4CLSA 3TANA 3Q23A 3A8KA 4OI0A 5J2PB 2GAHC 3OTOF 1JLGA 4NYOA 3V4IB 3OD2A 2AF6A 5T7LB 4FF1A 1BL4A 2EPIA 4OYXA 1X4AA 4NCBA 3B9DA 4TQRA 1WF1A 1VGYA 4QIVA 3H40A 1RCOB 3PV8A 1FKAF 2I5JB 4DHVA 2BW7A 4I69A 3DI6B 1TFVA 3KAGA 1TUGB 5A8KA 1ZM9A 3QGHA 2HURA 3KLIA 3NI6A 1T9TA 3H7HB 4Y00A 4CH1A 4DFKA 3W5YA 1TFWA 1M5KC 4HDHA 2DR5A 3O5JA 3H5YA 1D7HA 4M5GA 3IWLA 3M8PB 2RILA 1IX5A 1JQGA 2RNEA 1S1TB 1RHUB 2XYGB 2J9DA 1YW5A 2NXCA 3UN3A 4DL0C 3IA0A 1JXEA 1U1OA 3VF0B 3TC5A 2XULA 4X4NA 2D1CA 3GIJA 4B3SJ 4C11A 4WU2A 1RTJB 4YQWA 1R43A 4K5RA 1Y3JA 3AJDA 3PHTA 3FAPA 3CCVS 5CHCB 2ASJA 3BKTA 4YDDB 2N82B 4C3MA 2CJBA 4DL2A 3BO4A 2OMOA 4YHHJ 4A8WA 2E1PA 3L7OA 1BE4A 3PEJA 2DD8S 4IFYA 4DR5F 1M5OC 3ZTRA 1L3SA 4JV1A 5BJRA 4MKBA 2UUBJ 4P2MA 3T1HJ 5HSPA 2JEGA 5KFWA 2ZQUA 3FBFA 1X9MA 1WORA 1TL7A 3LALA 5J2QB 2UXBF 2DXDA 3EPIA 4NLGA 2YH0A 4PUOA 1FVSA 2DGXA 2FTRA 3OLBA 1RWUA 3BSNA 1PJ5A 2ZQVA 1XTZA 4JFJA 4B9LA 4RWXA 3TVYA 3D68A 1YIJS 1UPPA 2IVMA 3O5EA 1P27B 1ROUA 3MMCA 4DV0F 4RJVA 2Z2LA 4Y3CA 4FZVA 1UPMB 2CVEA 1R6VA 3P3DA 2Y3YA 2J6UA 1NPRA 2EI5A 3G6VA 5HVFA 2M2AA 3D66A 2ZH7A 2BV3A 4O4GB 4DZ6A 2QC3A 2V2QA 1MROB 5DQHA 2NPFA 1FKDA 2WBRA 2Z30B 3WDOA 3OBIA 3F56A 2RUQA 1Y4ZB 1SPBP 4NSBA 3MEDB 2W4PA 2CJKA 5F3TA 4GKKF 3T1YF 2AJFE 2B31A 1CLFA 5LJ5Y 4UOGA 2J7WA 2UZ5A 5B0FA 3OL7A 4F4WA 2ZUGA 5CYQA 2LU2A 4WCEQ 1Y5IB 2PGCA 4DSJA 2R8IA 5THWA 1R0CB 3MR5A 4U7CA 1S0NA 3D4JA 3L7PA 1S76D 1KVJA 5IM0A 2BKOA 5KFUA 2ZH9A 4O3PA 1JNRB 5IC4B 3PCOB 2B9XA 2FKEA 1Q6IA 3DMJA 2DH7A 1KS2A 4N19A 5IV3A 4OFZA 3PFOA 1FF2A 2YQ1A 1M5YA 1NDLA 4H4KC 4HH1A 4Y28C 1FFWB 2DTJA 2XEXA 3NGKA 2ZM6F 2DNKA 3RW6A 1DAXA 5D77A 2HK2A 5HMWA 1LQ9A 3CCLS 3HVAA 3HVTB 3F41A 2PPPA 4L72B 4B9VA 1EQ0A 3ALGA 3IFEA 3QPIA 3TWZA 2HHVA 2M8DB 3I4PA 3T5JA 4KGVB 3ZC4A 2WVBA 1HPZB 4X4UA 1R89A 5K5MA 1ZBKA 3KJNB 2HHWA 2A6OA 3V6HA 3PRBA 1E6RA 3TZYA 2UVUA 5DS7A 5CQGA 1N36J 1HL6A 3L09A 1YZ7A 1TFYA 2CPHA 1CJKB 1G2EA 3KWMA 2LEPA 2NSBA 2CNKB 4YR0A 2HHHJ 1J5EJ 4CYUB 1LW2A 2XLIA 3M6WA 4YUDA 2FHJD 3GFYA 3G87A 1UVIA 1VS3A 4DL7A 4AD6A 3P8BB 4OJGA 4C8YA 2FC9A 5DO2A 3E51A 4DV5F 1U02A 4QWCA 1S0MA 4MIBA 4BC9A 4ED0A 4ODPA 4Q2LA 1BQNA 5D4LA 4HKQA 1DLOA 4JBCA 1SV5A 2UVWA 1FKTA 1RAIB 3AQOA 3GG0A 1JNDA 4IO9Q 3HHLD 1S6PB 1B99A 3DRYA 3TZXA 4CNYA 4TN2A 5DF0A 2QYGA 5F8NA 3NAIA 1FERA 3J7YI 2P4VA 3ARZA 3OL6A 3MUVP 4K4ZA 1IM6A 4C0HA 4GKJF 1N1AA 1DBDA 4ED5A 1SH0A 2J9CA 5A8RA 4WTYA 3CHFA 3DLJA 1ZCNA 1U8WA 3C16B 9ATCB 2HNDB 1EX8A 3LPEA 2HQDA 3Q83A 2PBCA 1CJUA 2ROEA 4PG6A 3PYGA 3CVKA 3O5PA 5D78A 2HRTA 1K47A 5HW6A 3NY0A 3M2UB 2QFJA 4C8ZA 5GADU 3SZ2A 2AP6A 2M3DA 1UETA 1BMQB 1Q8BA 2GIQA 3RTVA 4ED2A 1FFRA 5KFVA 1KR4A 1P6TA 1K1QA 5A6WA 1T7PA 4JP8A 1GAOA 1S57A 3EJMA 4O3NA 3PW7A 5C42B 1WNOA 3V6KA 3HULA 4Z2LA 5J1EA 2K3IA 1L1PA 4F67A 1Q16B 2R7RA 5K8MA 4ZVTB 9RUBA 3AB4B 3PJXA 3HD1A 2NYHA 3CCMS 2VBZA 4ZHRA 4M5KA 1F5CA 4MK8A 2AX0A 3FEYB 5J6EA 1UZDA 5E41A 2HHSA 1NJWA 4DL4A 3G6LA 1SI9A 1OSCA 4DR2J 2HWIA 5CCLA 4ZN3A 1K44A 2C2EA 1FFGB 2VQFF 4JI6J 4F7VA 2GIRA 1RU1A 1N33F 3BBBA 1NO8A 5DLFA 1HD0A 4DQRA 4DH0A 3FMWA 4JI8F 3IBWA 1N0VC 1XNQJ 4A8KA 2LQ8A 4DR7F 4NXMJ 1HIYA 4WKHA 2IFXA 1BHNA 4ZCKA 5LOQA 4J5OA 1J5OA 4NLPA 3H42A 1DRZA 6AT1B 1FKPB 2HNYB 3R6GB 4K8RA 2HLTA 1UJ6A 2X51A 2JJ4D 4JI2J 1KBRA 4KHPF 4ICLA 2FZKB 3TEGA 1N5QA 5LSLA 4QU6A 2KJWA 1RGVA 1FK9A 1PJ7A 4A8MP 5MAOA 1R8HA 2A3BA 4OHWA 4OLPA 3QATA 1S1VA 2B9YA 4M5HA 3EVWA 5AE3A 1SJ1A 2HEKA 3UDCA 1XNRF 4M8LA 1QUVA 3KK1B 1N6QB 2ZM6J 1YJUA 4AL6A 2C1EB 2LECA 1G4CA 1T94A 1XR7A 4P73A 3HFZB 2WB4A 3M2VA 3G2XA 3GMGA 2ZKTA 2QMUB 4USIA 5GPGA 1T05A 5KFXA 4X4OA 2A1BA 2MF9A 3GFZA 1PBAA 5F41A 4PTMA 3SXLA 1YHQS 4LRBA 3QRRA 3GYGA 2VJUA 3KLHA 1WF0A 1ZM3A 2EBEA 2HBQB 2UXCJ 2PPNA 2V8DA 5I42A 1JLAA 1HR0J 4MK7A 1HFEL 4DXLA 1XMOJ 1B70B 3ENWA 2RDDA 1ZK6A 4RW6B 3Q8VA 1WKJA 4DUYJ 5JH8A 1SKRA 5SZTA 3PW2A 4C2MA 1HXVA 1GH8A 1Q0NA 4B3MJ 3KKFA 2R7XA 1WEZA 3JQMA 1D2KA 1ROFA 3HI9A 2B9EA 2I9SA 2V4QA 1HNXF 2BZ2A 1HBNA 2BR0A 1Q53A 3IR6B 4LMZA 4OZ2A 1KFSA 2J0SD 1JLBB 2IMOA 1NAQA 3WL0A 4FS1A 4YB1P 3IC1A 1MMDA 1RTHA 2F23A 2B6AB 4TNSA 2H1YA 2CJ9A 1UFWA 2W2QP 4DRIA 1LQ0A 3WX4A 2OELA 3KAFA 3HCXA 4I2QA 2MZJA 3W62A 2WLZA 3QRQA 2KI3A 4TY8A 4DLEA 2ZH8A 1RAOA 1NK0A 1RTDB 3GZ7A 4QCLA 1U0HB 2J0QD 3FMBA 4WWSA 2PPOA 2OFGX 3AJ1A 2OFNA 4NZ6A 2XMVA 2SXLA 3KLGB 4LSZB 2DPEA 3L4BC 4JUZA 1QE1A 2DR8A 3BBCA 1Q1KA 3DLGA 2VA2A 2K2PA 1NZ8A 4EZ9A 5HVHA 3R27A 4PPDA 1E6PA 1VFJA 5JXSA 2FPHX 4Z2XA 2DNMA 1HLWA 2FVQA 1B64A 4HBOA 2UUWA 2DGTA 2HZVA 5J2MA 4NA1A 4C9DA 1ZYQA 1FCAA 5GAEI 2GS8A 2FUG9 2OPPA 1SKUB 3CULA 3TJ9A 4PR6A 2VHGA 5E0OA 1S59A 3HHNB 3IM8A 3KJVB 3VGTA 4AQYF 2RS8A 1U1NA 4DSEA 3IG1B 3L7UA 1X6NA 1ZBTA 2R8JA 3RRHA 5LSRA 2LKZA 3OTDA 3CGIA 3AAWB 3QLHA 2KO7A 5B0DA 1U26A 1UVMA 2C3UA 3FKBA 4O4RA 1RT6A 3OR1A 1X31C 4BS2A 4MAVA 3VAKA 3RUBL 3DOKA 1IBMF 2FGCA 2ZOFA 2Y1JA 5DRKA 1NRKA 3MOZA 2YKQA 4FBTA 3B54A 1HMVA 2HVIA 1KLMB 4XAKA 4M5MA 1GMUA 4Q8FA 5DG9A 1S12A 3FQKA 4RW4A 1TK0A 1R8CA 5HQ8A 4F3OA 2GJIA 2P6SA 4OZNA 2XYHB 2K8GA 2WVFA 5JUMA 4F36A 2GIFA 5DQGA 3F0NA 1LL6A 1HNVB 4P8WA 2YNHB 3A1YG 4BDPA 2VOOA 1S1UB 2ZZMA 1FTRA 3R7BB 2XY7A 2JX2A 2AJQA 3BS9A 2VG7A 2W8KA 3I0RA 4KHPJ 3Q22A 5DIVA 3R7NB 2F7VA 1QDUB 1N5SA 3WD3A 3NGRA 4X84A 2P2CB 5KOXA 4KV8B 4B3RJ 1PJ6A 2HVDA 2XMUA 2EKNA 1C4AA 4RUHA 3OVBA 2GQQA 2R2UA 2BQRA 5J2PA 3MFHA 5HW8A 4DCPB 4RNNA 4X4QA 3V4IA 1JJHA 2H4YB 5T7LA 1FKRA 4X64J 5E3AA 4RNMA 2EW9A 1O6IA 4ZK7M 5KTQA 3DDKA 1S9EB 3HM9A 2QEXS 3HSZA 1S77D 4U7UK 3SFGA 1Y9OA 2O66A 1ZAWA 2MMYA 2UV8G 3PA7A 3S7RA 3PW0A 3H5SA 1PO6A 3VAFA 4LIRA 4UOCA 4CO1A 1FJ7A 4QWBA 1Q7LB 3WL1A 5E5NA 4DBQA 4TLQA 1ZTTA 3KCEA 4XDDA 1ZETA 5KFGA 4HI1A 4G2PA 1RYRA 1S1TA 4OZ1A 1WC1A 5H9FJ 2CZ9A 1UVJA 3RM8A 3THVA 3NWRA 1RTJA 2QA1A 3GILA 4QQBA 3C6UA 4B3TJ 2KU7A 3EVMA 1S0VA 2V68A 1NU4A 3R5AA 4S0MA 4LAXA 5D4NA 2AKWB 2AJ4A 5KG3A 1UW9A 1UTAA 4U8YA 2IAJB 2KRBA 2IY5B 5GAHU 3OR2B 1NPKA 2R8KA 4O3RA 1B0VA 1WELA 4ETZA 2ETNA 4EU0A 3PJ9A 2KXFA 3I9V9 4QYZJ 2CFXA 4ZP8A 1B4SA 1A9NB 3JS9A 1TMMA 1RADB 2R4FA 3BO3A 4MNJA 1EQ3A 3KHGA 3TOQA 4J9UE 4JI1F 3KLEB 4ECYA 3B82A 5EGYA 4CM0A 5J2QA 3BF4A 2D69A 2APOA 4OJ1A 2W25A 1NSAA 3N0VA 3OSNA 1DTQA 2HS4A 3QRPA 2Q6CA 3MCSA 2BANA 1H0GA 4QWEA 2JL9A 2AHOB 3T3FA 1P8GA 2XMMA 2DG3A 1YJNS 3IMQJ 2DRBA 2ZC3A 1UL3A 2MJNA 4QIGA 4FYDA 3IN5A 2CQ0A 4ZVQB 1TAUA 2QL5B 1KDNA 2HVHA 5JMNA 2VDIA 4B9TA 1S48A 2ZVIA 1F9HA 3DCAA 2K06A 4DZ2A 2KJVA 4ECXA 3W5XA 1T0TV 1RACB 2VG5B 1IWGA 3G71S 1YJWS 2Y1LB 1DZ5A 4EBDA 4N56A 1VQ6S 3OOBA 2PEHA 1NXIA 4W98A 1FE0A 3MEDA 1GQEA 1FKFA 4Y2KA 3GIIA 1HKIA 1N0UA 2EC0A 3I0SB 3RW7A 2DBBA 4OI2A 2E9RX 2AWZA 4NMLA 4UUWA 4HLBA 2HBRB 3R5CA 5KFIA 1FX2A 2QZ8A 4O0IA 3NOCA 2YNIB 3Q8UA 3IAM9 4DG1B 1FJGF 2MJUA 4C98A 3BKUA 2PEBA 2B7BB 4U6PA 3FNNA 1D09B 5KT2A 1FJCA 3R7SB 4DUZF 4DV2F 4DV1F 2KFNA 3H5XA 2FHOB 1YVFA 4ECUA 1RKIA 1P9QC 2YPYA 3AS2A 3BSOA 2Y1IA 2QLXA 1H2UX 4KHRA 4OZ3A 4ODOA 2HFNA 2NCKL 4HL9A 1H72C 4NNRA 1MSWD 3EGWB 4WKAA 2JLEA 1DTTB 3HVTA 5D8HB 3OFEA 1WG1A 3TW0A 4DR1J 1FDNA 2X1GA 5KFSA 3NOGA 1T02A 2PFDA 3AOBA 1HPZA 4PYDA 2IA0A 1WC4A 4BLGA 1UW4A 3P5TL 2DSUA 3K58A 2LQBA 1N5YB 1RWKB 2DO0A 4AT1B 2RURA 1O5JA 4FNHA 2YKNB 2UUCF 5B0CA 1JB0C 4CYUA 1HW9A 1UR8A 3DRPA 1VIOA 2VUGA 1KQSR 3OQ2A 2FZGB 3M2RB 2E5IA 3FC9A 2VN1A 4JI0J 2NXEA 2BJ7A 3CCRS 1X4CA 2KFZA 3PIOQ 1IXKA 3QOKA 2CPDA 1U1RA 2BYCA 1IUJA 5EUHA 1UWBA 1APSA 2R7TA 2BJ1A 1TKDA 1NSKL 1J4RA 2I38A 2GGPA 1EARA 1FXDA 1CJVB 4ITZA 2BABA 2C42A 4DZ3A 2W4DA 1YATA 4FAPA 2MYFA 2NREA 1Z1ZA 1KVIA 1F2GA 1PBKA 1QSSA 1S6OA 2DB1A 4R0JA 2XWYA 3T9NA 3C16A 3GB0A 2MZRA 1B0PA 2HNDA 1SB6A 4R0EA 2G13A 1UJ5A 1B7FA 1M5PC 4M94A 4DR6J 2CIMA 2KYXA 1U2FA 2W7OA 1KFDA 3TAMB 5E3CA 3KHRA 4DV4J 3W9HA 4LFAF 1WOPA 2COLA 5KFTA 5CCMA 1TV6B 3M2UA 2CWKA 3W7BA 2F3JA 4ODMA 2A3JA 4L73A 3JQJA 3N01A 3SV3A 4X65F 3O8WA 5DETA 4P9SA 2HAIA 5C42A 3M1VB 3GPKA 1H0HB 3CD0A 3BPDA 5BYSA 1WJ9A 4ED8A 3OJUA 1WOSA 1RT1A 5CAAA 1Q6HA 2LQ9A 4B9UA 4DS5A 1KHVA 3Q24A 2VICA 5HO4A 4IO1A 3K7RA 3TR5A 4C6AA 5BXIA 4F50A 2XPAA 4J9NA 1N48A 3FCVA 8ATCB 4WXWA 2XMJA 5HMYA 2WAQD 4KY3A 2V8HA 3H20A 3NAHA 3LA0A 5ITHA 1T3OA 4ES1A 1N32F 2DGVA 2PD1A 4YR3A 3B4DA 3B4MA 2M2BA 4ZVFA 2DHXA 2G1HA 3CCTA 4NCGA 3ULHA 4TNOA 3RB3A 2EFVA 3IK8A 1AB8A 4ODLA 3ELHA 1KQFB 5IQ6A 3MPDA 3BQ2A 4TX0A 2MDAA 1N5VA 5EX0A 4KE5A 4UY8T 4IOBA 4NLWA 4JI4J 1RT4A 2N4DA 1FKPA 3ILIA 1RT2B 3MHYA 4HHJA 1VBKA 3VZIA 4DV1J 1HWJA 1FWPA 2DPIA 4LIWA 5KFNA 1FNOA 3V6DB 3D1QA 3ARRA 2WBMA 3KK1A 4ZVEA 3RBDA 1N6QA 2Z57B 5B08A 4PRFA 1RWOB 3ETMA 1VC5A 3VALA 2PI6A 4J91A 2XS5A 1WKKA 2HNZB 3K8VA 3R2CJ 2LVWA 5B0GA 2J5AA 2MSTA 4LSNB 2R7SA 3J7YU 4BWMA 4JOUA 2WSFC 4L75A 2GMLA 3RBZA 2MKSA 4Y2IA 1DY3A 1HARA 2DT3A 4IUFA 2DITA 2GJ2A 5D4OA 3BR8A 4DN9A 5EWEA 3ARXA 4RW6A 4JI5J 2GHPA 4BF8A 2RIJA 2LFVA 2YQ3A 1MNEA 2UU9F 2VPWB 1HWIA 1BD6A 1AFJA 4DWSC 3BSAA 3EZUA 4LBPA 2KZZA 3PX4A 4WXOA 1O51A 4MK9A 4KR0B 1DURA 4DROA 1HYSB 4LF9F 3J7Z5 4AYBD 1JLBA 1JNEA 2ZH3A 3SV4A 4I1TA 2AGOA 2B6AA 3PM9A 2W2OP 3B9AA 4P8UA 4CT8A 3HP6A 2DSZA 3SCIE 3ZTPA 1UEKA 2VL1A 3HDSA 1S97A 1MW7A 1FXRA 2WK4A 2MQOA 4P7TA 1TL1B 1Y00A 3UF8A 3SQGB 4OYMA 4X4PA 2EXUA 2VH7A 1RTDA 1SQFA 3K59A 3B7XA 2R8HA 4N77A 4TXSA 3MEKA 3MEEA 4USVA 4Q7NA 3R5DA 2F40A 2RAQA 1SVDA 1NK6A 3ZZOA 2CKWA 1D8ZA 3BGOP 3L3CA 1D9AA 3O5DA 1IBLF 1RI7A 4CIOA 2HQIA 4F2RA 4G50A 3EM1A 5KG1A 1B3TA 4F4XA 3N5FA 2B8QA 1GK8A 5IV4A 4IQMA 2PC6A 4IRCA 1IKVB 3R5GA 3RRKA 2PA8D 1SL0A 1VQPS 5ETNA 4CO0A 5ETPA 3DLEB 2FIUA 1SC1B 4RNFA 5F9LA 3UO0A 1FWKA 4KFBB 2E5LJ 4YFUA 3VAGA 3HVWA 5DITA 4DN0A 3VAIA 1VHFA 1MWYA 2RU9A 4JV2A 3CJ2A 2CZ4A 4K2XA 5H9EK 3SSSA 3CCQS 4LSLB 4Q22A 3FBEA 3I32A 2B4OA 2WVCA 4IDKB 4BHQA 3MWBA 4RBVA 3OTBA 1QUPA 3Q8RB 1C1BB 3S1TA 5ETVA 1YDLA 2ROPA 3KG1A 2CAJA 1HHQA 3AA9A 2VG6B 2YWFA 5KFDA 3GV8B 4FYVB 4LBHA 5HUAA 4PCQA 2MKCA 2F8EX 5E7OB 1KLMA 1H7XA 1HKAA 1U1KA 2V67A 3H0PA 3DRRB 3OHBA 1DJ0A 2CADA 4WFNQ 3C14A 3E2EA 4LF5F 2RJZA 3HKZD 1JLFB 2YKAA 2R42A 3I55S 1HNVA 3IGNA 2YNHA 2LKNA 1Q8IA 1Q8KA 4EO8A 1S1UA 1LWEB 4XDCA 4XO0A 2ZH4A 2DH9A 2GMJA 3G6MA 4URGA 4G1QB 1HD1A 3CGNA 4JB8B 4B3OB 1UWAA 3DC2A 5M2PA 4KIAA 4Q2MA 2ZZTA 4YMEA 3IR5B 3HX9A 1VQ8S 4KV8A 2VODA 1OPIA 1XIQA 3HFVA 2MGZA 4DV3J 1DFDA 4C97A 2P9EA 2HIYA 2VV5A 4ECWA 3BGLA 3O5OA 1GXUA 2BE2B 3WIVA 1JKHA 1Q79A 5ETTA 1Z2ZA 4NPOA 5DM7Q 3LO3A 3BV8A 1YRUA 2DH8A 4DR4F 1FNXH 4NXNJ 3GYXB 1AA1B 2ZITA 3RAMA 3IRXA 4CTAA 5LMUF 4CLWA 2DY1A 5CYMB 4LF6J 3CMQA 1E6YB 3Q89A 4E0DA 1NDPA 4OMFG 3G6XA 2R8GA 5LT5A 3KAHA 4DV7F 2E7VA 2RT3A 3FFIB 1YX2A 3B6BA 1BY9A 1R8BA 4K0KJ 2HSEB 3UVJB 4WBFA 2LQ5A 3DRXA 2XO7A 3HPOA 1HNWF 2XMWA 1TAQA 3FSXA 1VI7A 1QVFR 1K0VA 3BEGB 2KTQA 1LW0B 3A3PB 4GIVA 8RUCA 3QZ8A 3LWLA 3CNQP 2NZ4A 4EYIB 1BLUA 4WP9A 4NLTA 1OJ4A 2OH2A 1UA1A 2FJAB 5DZ6A 3M05A 4LFCF 3I96A 4EO6A 2G1DA 4PXDA 5KFZA 2GO8A 3R5JB 3HFKA 3L95X 2QSFA 3MUMP 2DVIA 3IBFB 1YJTA 3PRAA 4MJKA 3VR1A 4ZVRB 5A8WA 2FJWA 4KPYA 2XS7A 4J9SA 3G86A 4TY9A 3O44A 4IFVA 2HFZA 3DOMB 2IAJA 4LF8J 3ILJA 3RM4A 2Z8QA 4ODKA 5DM6Q 4KH0B 4X2BA 3N4WA 2CNOB 5GADI 4DZDA 2CPEA 2HFVA 3O5IA 2WCXA 3KTQA 4WKRA 4MNKA 3N6MA 3D1HA 3KLEA 3AS0A 2QA4G 1NH6A 1VLOA 4J7CA 1RB0A 3DU6A 2QSWA 3V81B 2ZDOA 3QGGA 5HVGA 4DX6A 1NPPA 5IWAF 2ABYA 1F5AA 3BDPA 4DQPA 3RZAA 1FA0A 3V6JA 3CCES 2GJFA 4RW8B 2IYIA 4LFBJ 2AZ3A 2K1RB 5KT3A 5T41A 4K4TA 2E7WA 3J7AN 3P96A 2JZ5A 2HFSA 2DCUB 2DIVA 1OGBA 1D7IA 2BQ3A 2ZWPA 1CTNA 3SCKE 4MAKA 1FNMA 3E01A 3ILLA 4QJVA 1L3VA 2GHWA 2C3PA 2JZVA 1R0BG 2VG5A 2JEIA 2A2CA 3ARTA 1AXQA 1NUEA 3DKDA 1NSPA 2WONA 4TQSA 1ITPA 2VBWA 1F3FA 3Q8SB 3ENAA 3HSJA 3OHAA 4PG4A 4ZKAA 1U79A 2CYYA 3MR7A 1RABB 4YN3B 2QL9B 2EK6A 2KHDA 4PXBA 3ZXWA 1HBOB 1VYAA 2DHAA 2LA4A 1WEXA 4QIWD 3EUNA 4MNLA 2YQ0A 1VRTB 1X9SA 4DSKA 4U86A 4RW7B 4DG1A 1QTNB 3CDEA 1R0AB 3K5MA 1YRTA 1HQUB 3BYRA 5L46A 3O1LA 1KSPA 1N88A 1LXNA 4JYAJ 4LAYA 3W2VB 3R2DJ 4N8NA 5L9XA 4MTVA 2IRXA 2RKIB 2ZZNA 4FF2A 5B7WA 5IT9U 6FD1A 1NJYA 2QLFB 5D15A 2MY7A 2E5GA 1A7GE 4QW9A 3UI6A 1KTVA 4PWWA 1DTTA 4LR9A 3VWSA 2IM1A 2RUDA 1FD9A 3GSDA 4RUBA 3O3LA 1QZ2A 2D41A 1OS5A 1MN7A 2NUHA 2BEFA 4WIQA 3DLHA 4DCOB 2XMKA 4M5IA 2GVZA 2OPSA 5L1LA 4W9QA 1ZAXA 1S4FA 1FRHA 1RWXB 2UP1A 4AL7A 4OX9J 4M5LA 4A4JA 2J6SA 1REVB 1WTFA 3ADAC 1U7LA 1SUQA 2LXFA 1VLYA 1HKMA 2XP7A 1VC0A 3KACA 4ZVHA 3KG0A 2FJXA 2UXDJ 1R9HA 1H38A 3NMRA 2DT9A 4Z2IA 2XQCA 1WC0A 3HMJG 3VAWA 3LP1B 3A13A 3ZFVA 3M2RA 2HAFA 4S3JA 3NS7B 4NI2B 2D3UA 5C7PA 2DJWA 3MD3A 1H2VZ 3CDWA 4TYBA 4CP5A 3I31A 4RPFA 2OI2A 2O3DA 1Y7PA 3QT5A 4KGKA 4I6AA 1D3WA 2FVPA 4R8UB 2QA4S 2RVJA 1FX4A 1PIEA 5A2QY 3IS9B 2Z2ZA 1KC8T 1SKWA 4WKYA 1CJVA 4HVZA 3CB4A 1PILA 2QA2A 4FF3A 1RZMA 1YJ7A 1WC3A 2KI2A 2F4EA 1Q6UA 4GVBB 2UUAF 3EYZA 1SL1A 4MYUA 2LYVA 3W61A 1MMLA 4GGQA 2DSVA 2KHCA 3UDEA 3LUOA 2Z0GA 3AA8A 1GEHA 1SIWB 2GVDB 4X4RA 1RAEB 2DNZA 2FYXA 4HHHA 4ILRA 4HBEA 4JI7J 3TAMA 4DCJB 2XI2A 3H5UA 1S1XB 3L9ZA 4ZP6A 2MZSA 2BDPA 1TV6A 1U24A 2OTJS 3SFUA 1QAYA 1G1XA 4HR2A 4A48A 4CRJA 4G3IA 4UDMA 4BBYA 3O5FA 3E8OA 2XP4A 1H7WA 1MMNA 1NB2A 3GCXP 4OYBA 3AXMA 3M1VA 4ENOA 4M5JA 2G2YA 1T95A 4K59A 3KK3A 2X1FA 4WTOB 2CNLB 3SIPB 3UN5A 4C02B 1TL3A 2BJDA 3CE8A 4NZ0A 1HKKA 3H2UB 4ATNA 4E2FB 5CA5A 1RKJA 1S1WB 2JSXA 2EG1A 3POTA 4OX7A 2J9EA 4F8RA 3RMEA 4FVCA 1KNZA 2V2VA 3TA1A 4AL5A 1XHGA 4IG3B 5LSOA 3N28A 3CMAS 4B3SF 5KG0A 4H4KA 5CD4A 2F1FA 1CS4A 3DU5A 3MMBB 1T11A 4FYWB 3G82B 3O5GA 1JNTA 2BE7D 2Q79A 3NXZA 1RCXB 2XZWA 1ZL1A 2AGPA 1RT2A 4YHHF 1ZBWA 4RL1A 3DFEA 4X66J 4QOTA 3PNIA 3NGSA 3CJSA 4DR3J 2OEKA 5AJ3J 1R3NA 3T6JA 4FNIA 4F25A 2D9PA 5HQMA 3EVOA 2UUBF 3T1HF 2AW0A 1R8PA 5KFMA 4F3MA 2HHPA 1X4EA 2JVRA 1XBWA 1KQGB 2DIUA 1HW8A 1A6LA 1FKBA 4A8XA 3QFWA 2V2ZA 5JVGQ 1F1BB 4DRMA 1A7XA 2XY6A 2HNZA 2RHQB 4J9LA 2VF3A 3M32B 1WG4A 3GQCA 3KK2A 1VJQA 1S7HA 2RUGA 4LF7J 2LQJA 3HJVA 4F4ZA 4MKAA 1RYSA 3FCWA 2IM3A 1ZAVA 5DEZA 4OI4A 4EYHB 4DL5A 4HTJA 1NEEA 2BJ3A 2A18A 2B8PA 3NRBA 3JXVA 5I3QA 2CQ2A 1UJ4A 4O44B 3P49B 3O2IA 3D2WA 3MMAB 4F04B 4ED1A 3BH7B 1NK5A 1HQ2A 5D6GA 3EZOA 2RF2B 3TUPA 1JNSA 2FC8A 2YKPA 2X1AA 2WW4A 5L1JA 5D3GB 2PO4A 1UVNA 1HYSA 2YWHA 2VPYB 2BA9A 3DDNA 1URRA 2B5JA 3NMAA 3BN7A 2VONA 2JEJA 1NSGA 1F60B 2ZNZA 1RT5B 3HD2A 2L08A 2V9KA 1YI2S 2AX1A 2H48B 4RW9A 3PJWA 2AMCB 1I94F 1GUVA 3KMSA 3C19A 1RHRB 1YITS 1LWCB 1ELOA 3IAS9 2M4MA 1AZSA 1TL1A 1JLEB 3R97A 3Q0AA 1JLCB 3W63A 4PKDB 4ZPVR 4ODQA 4D3GA 3KUHA 2XTJP 2CZVC 4WK1A 4LRDA 2YX1A 1ZZNA 2XNQA 3NGDA 3MZIA 3UW1A 1KONA 3PG9A 2J7KA 3EGVA 2UVRA 4C4WA 3G96A 4OYAA 2KG0A 2V6AA 3D0HE 1CJTB 3TZWA 3QO9B 1PKUA 4P75A 2RUSA 1N5TA 5GAGU 1IKVA 3DLKB 1C4CA 4IYQA 4WP8A 2B4UA 4ECZA 1WC6A 3D6TB 3DLEA 1FO1A 1ICEB 1HNIB 5EN1A 3D6HB 1X9WA 2RQCA 4OZLA 1FKGA 4AFFA 1RLCL 4LF4J 4DPOA 3NTPA 1N36F 2ZHOA 4TVAB 2AYGA 3KZ7A 3QJPA 1NWRA 4UTGA 2HHHF 4IDKA 2GQCA 1Z4UA 1J5EF 4MSPA 3OL8A 2VBXA 2VKZG 1VMBA 5F0UA 2DHGA 1TTHB 3EMTA 4KYZA 1C1BA 1B7YB 2QFIA 2VG6A 1HA1A 3P45B 2MLXA 1S72S 5B0AA 4EUVA 2KFYA 3V5RA 2Y8YA 3D3CJ 3MDYB 3MM9B 3AOAA 5L38A 4RU2A 3UE2A 3DRRA 4CO5A 1BGXT 2A3AA 3MCNA 3ARVA 2HPUA 3J80U 4P72A 5F8MA 2BQUA 1JLFA 1RK8A 3HHEA 3M9MB 1LWEA 2ZDPA 2Q6BA 4UW2A 3CJ5A 3KUGA 5GQBA 3KLVA 1CVJA 3M30B 4G1QA 3MAQA 5IQQA 2HZAA 2XZDB 4KAIA 2MB0B 4QT3A 1GTHA 3GIKA 4O3SA 1IWAA 2RUCA 1FRKA 4XPCA 5KFBA 4DX5A 3CO9A 2EFPA 2E1CA 2VPXB 5K8NA 5KT7A 2V34A 2BE2A 3AS3A 3UNGC 3I5BA 3CD6S 2YX4A 2KN4A 2L2SA 2MKIA 2BX6A 2MQNA 3OL9A 5ETSA 5CYMA 2GZOA 4CLFA 4OX6A 1E6YA 1MLAA 3LUYA 1NHKL 2WTFA 4RUCA 2ZBQA 3QQCD 4HACB 4DWSB 2CDRB 1AROP 5HT1A 3QJJA 2QG9B 4ILMA 1RT3A 3FFIA 4HEA9 3PR5B 4P10A 2GAGC 4ZLLA 3UVJA 2B51A 2Y78A 4R0XA 4GO5X 1NJIT 1IKWB 4DPWA 1PC4A 1RWNB 2QTWA 3NNHA 3FVYA 1VQ5S 3IWXA 3PX6A 4O2TA 4WFYA 3UQSA 2F65A 4IQXA 6FDRA 1X4BA 1E15A 3GV7B 4TKTA 2QN6B 1BQMA 5KFQA 3GJSB 4URQU 1BC6A 4W5UA 2PMWA 2ERRA 4DR2F 3KABA 4ECSA 3ZNJ1 3ZZ0A 1FKJA 2QF8A 3B8SA 4JI6F 3PKMA 1C0TB 4ERDA 1WAWA 3PO4A 1R27B 1X5PA 3G8TA 4P7VA 1I94J 3EXYA 4NRUA 3DOMA 4NLQA 4JV5F 1XC9A 3G6ES 1XNQF 2C3OA 3DN9A 3DM2A 2MLZA 3BN4A 5JVHQ 1U6FA 4NXMF 2LEAA 4F26A 3WH0A 3VGVA 4EZ6A 2B4VA 3CCJS 1TL7B 4UUXA 2C28A 3OFHA 4JI2F 4OI3A 2A0FB 3TJAA 4QPXA 1PSDA 2AJ1A 3T41A 3CH9A 3M8WA 1NZAA 1NWTA 2CQ4A 1X4FA 5D0RA 1UVKA 3I5AA 2IF4A 3QWUA 3EXCX 4P2XA 2E9ZA 5KT6A 4TU9A 4Z2GA 4RW8A 3FY1A 1IQZA 3UNYA 2FVRA 2RH3A 4K7QA 2K1RA 1EKSA 3SYZA 3UD5A 4J9MA 4MPKA 2C2MB 1NDCA 1QJHA 2LCWA 2AIRB 2VFUA 4QIEA 4JV0A 1ZM2A 3IGVA 3G4SS 5LJ3Y 1LG1A 2UXCF 3BO2A 1HR0F 3OUYB 1KT1A 1XMOF 4R25A 2MZ1A 3MGJA 4M95A 2HK3A 1HJVA 2IMWP 2NZCA 1OYDA 4DUYF 2MHNA 2KXNB 2ZOMA 2MXYA 4DLGA 1H74A 4B3MF 3W2WB 1U09A 4NLYA 2X1BA 2Y8WA 5F8LA 4USWA 4DI6A 5C2CA 1T9YA 2W9BB 1OY6A 1F9FA 3LGMA 1E6ZA 2V63A 2P9GA 2A6MA 2E1AA 2OP5A 2DISA 1HBOA 2ZBRA 3UDVA 2BKPA 4J37A 2JC0A 5HROB 4P2SA 2RQMA 2XCAA 4RW7A 2OPQB 5GMKa 1R0AA 4KSEB 1JLQA 1HQUA 7FD1A 5M2UA 2I8EA 4OV1A 3IO1A 2VDHA 2KM8C 4Y6IA 4FXDA 2AOSA 1LWFB 3W2VA 2RKIA 2B5UB 4CLYA 3DXSX 1PC5A 4A46A 3OXGA 2IPOB 3PIPQ 4URSA 4KGMA 3GR0A 5KFOA 4URIA 2F4VJ 2AJ2A 1VHIA 3ZO7A 4RBUA 1OIAA 3T5LA 4CLPA 3TVZA 4TU8A 3TP2A 1EZZB 1EHNA 3GCWP 1RP5A 3GONA 4Z7YA 1F8AB 1WHYA 4CZCA 2Q5AA 1RU2A 4MGVA 5C25B 3UQAA 4Q5VA 1WEYA 4ZIWA 3TJ8A 5HLFB 1GRJA 2LDIA 2DNNA 3MPUB 3CWJA 1TUVA 4FPRA 2KRRA 4YY3J 1ITXA 3BDEA 2FJBB 4CLLA 2P8IA 1ZU8A 3MM7B 4I56A 4ES2A 2CPJA 4G1IA 1MG7A 1WKLA 3TEHB 1REVA 3BBFA 2XNRA 4IH7A 1NH8A 3NWGA 2FAPA 3RB4A 4WFXA 4AXIA 5EWGA 3T9ZA 3UR3C 3M6VA 2G0CA 5D4PA 5L9NA 2YWWA 1KP6A 4X4TA 2E1RA 3PEHA 4NI2A 3DLLQ 1V6HA 1CEZA 5GPRA 4E8UA 1QAJA 1UMJA 1RQ0A 1TL4A 1URNA 2NS1B 4KPCA 3IHZA 5F8IA 1J2VA 4J90A 1D1UA 5KFRA 4JI3J 5I3UA 1EP4B 4R8UA 2XP8A 3CDBA 3IS9A 4P8XA 2ADBA 3FSIA 3Q2SC 3BYPA 3C15A 4IR9A 2KT5A 4DOZA 3ARPA 1PAUB 5C24A 1H0IA 4Q0BA 2D9OA 2ZOGA 1IBCB 1RAAB 4W9OA 4JFIA 3I4HX 1QLNA 3J81U 3ZZRA 2QLJB 4JV5J 3ARQA 4NLDA 3KDNA 3UCZP 1JIHA 2M8HA 4NYZA 2KT2A 2YKMB 2QO3A 4LRAA 2GVDA 2XLJA 3D67A 4R5PA 1ZA1B 5G0RA 4W92B 2ZJRQ 2IJFA 1XR5A 3WD0A 2UZAA 3W9IA 4N8OA 4UQTA 4B3RF 1S1XA 2L9DA 2ZR5A 3D28A 5HBMA 3JSMB 2MKJA 4K4VA 2C2RA 2DHSA 5KG5A 3U1NA 3TCZA 2A3CA 3TA2A 2FHKA 2YWEA 2C2OB 3MAAB 4IRKA 2I1RA 1TUWA 1FKOB 4F3QA 2CJYB 3NG8A 4X64F 2ZJQQ 1P1LA 4HH0A 3PRDA 8AT1B 3OSPA 5LM7E 1R31A 4L6V3 1TKTB 3QBCA 2QV6A 3TO8A 3HJFA 4ID5B 4P2FA 5HBFA 1C1CB 2L41A 1QTMA 3CDUA 4JFLA 2G9OA 2LXIA 2G2ZA 2MLYA 3D9BA 2ZR4A 2IM2A 2ZFHA 3H8YA 4XIUA 2N4CA 1FD8A 3LAKA 3OLAA 1KVKA 1S9GA 2HKEA 1PAEX 3UCGA 4K4XA 2C2ZB 1RAGB 4IG3A 1RD6A 3GJTB 4XPEA 4C8MA 1N56A 4ED3A 1HKJA 2ZQSA 3G82A 3MR2A 4B3TF 5MLCV 3LQVA 2E29A 1WWHA 2OEJA 4H4MA 1HQEB 1NJXA 4K2JA 3LP2B 4DPTA 3P5BP 1S1VB 1HBUA 2F9DA 1C0UB 3IRWP 2DEJA 1YQHA 2HQFA 3H2VE 4OHXA 3D5MA 1VQ4S 2NYIA 5JJBA 3DHXA 1LFWA 2POKA 2V9WA 3M2VB 1MWZA 3DXBA 1RSCA 4DL3A 1PCAA 2ATCB 3M8SA 3LWMA 1YGYA 1W1YA 4ED7A 1EAYC 1NM2A 5IT9Y 4NX9A 5K9FA 2XHWA 4KGXB 4ZA1A 3BQ1A 4GMKA 3MM6B 4B02A 2EC2A 4F0KA 1V5VA 4DRJA 1XMQJ 2XSFA 3KLHB 1RHJB 4EMDA 2EVZA 3QAUA 5I42B 3Q2TC 1JLAB 1WACA 4GC7A 1QD1A 2DGUA 3CD7A 5E3QA 2OFHX 5M2RA 4C0OC 2HGMA 1SKSA 3BZQA 3TARA 3SSRA 4I64A 5FD1A 4A8OA 4O44A 1NWUA 3W8GA 3ARUA 1F2HA 4J9OA 1FEHA 3MMAA 1HBNB 3WQPA 3NGTA 1QSLA 5FDLB 2CPYA 2RF2A 2VQEJ 4J9RA 3FK4A 1ZS6A 5HN0A 3RM9A 2XWXA 4QR0A 2AZ1A 3CZ8A 1VQKS 2KYZA 3FDSA 3KHLA 1E6NA 1S79A 2M08A 3G6YA 2HIQA 2O1PA 1VDHA 2YY3A 4I2QB 2ALYB 3KLFB 1ZBCA 1K0TA 5AXLA 2XS2A 4TYAA 4MIWA 1SBRA 2ZWOA 4G65A 2J6TA 3MXHP 2AGQA 1J4HA 1MU2B 2V4RA 4NZ7A 3TZZA 1R6YA 1VQSA 3NCRA 1X7VA 2G2OA 4N76A 4PWUA 4PXEA 2CPXA 1FKIA 3GV5B 4ODNA 4J9QA 5DGAA 2NUUG 2G4BA 1Q8LA 1P1TA 3WHIA 3LW5C 5J2MB 1GXTA 1NJZA 1WHXA 1VQYA 2CJXB 4F4AA 1CJTA 3HZGA 2M88A 4O3QA 4F0HA 3AT1B 4K4YA 3DLKA 5D0EA 4DR1F 4RO0A 1FJDA 1VBYA 3HHLB 2MQ8A 5K20B 4YS2A 5KFPA 1N8RT 4AXJA 3GJQB 4OHVA 3CO0P 2RMLA 2V0NA 2YH1A 1E9LA 3GU0A 1F40A 1MWQA 2FY8A 3IBCB 3M9NB 1RT6B 3OR1B 1HNZJ 5K8OA 2I5JA 3DOKB 5I98A 3EICA 5LXYA 2OO4A 3BGRB 2GV1A 3DI6A 4WF9Q 3LP0B 1S7IA 3UDLA 4DV6J 2PMZD 2DNPA 4DSIA 2M9KA 1HMVB 3MUTP 4OYWA 4QYRA 4TW8A 5F0WA 4DWIA 1XN9A 3ODKA 3M8PA 2DKOB 4RW4B 4JI0F 3AOCA 3GJRB 2LEBA 2NXNA 2JFKA 4ZPDA 4ELTA 1Q81T 3RBEA 1W2BR 1LJYA 1OWXA 2DYAA 2HQ3A 3PTWA 1UFLA 3DHWC 4IQCA 2VG7B 3N6LA 3TNVA 4AY1A 3IM9A 2IIHA 3DRSB 2B4PA 3O6QA 1QAIA 1J4IA 3M30A 3VTIA 2HRUA 1AUSL 3T5HA 3RR8A 2BE9B 4ETXA 3AS1A 2EFQA 4DU8A 1E44A 3EGNA 4WK3A 4JFKA 3SI8A 4ALZA 2X7IA 1XR6A 2AQ4A 4MYTA 1TL5A 1GMWA 2DY9A 1YBAA 5F8GA 4DR6F 4FS2A 1KHWA 2XGQA 2O01C 1CQNA 1X4GA 4USUA 4DV4F 1ZZFA 3DGPB 1BWEA 3OW2R 2DNGA 2LXUA 4CT9A 1OO0B 2ZBCA 1FESA 1FXLA 4I6WA 5BYQA 5IS2A 1FI4A 1T9VA 4IQ2A 4CO4A 1IR2A 2ILYA 3EZ5A 3HHKA 4HACA 4DWSA 2JLFA 1SH2A 3CF5Q 3SCLE 4Q44A 4NEZA 4BWJA 5LMNJ 1RWPB 1IM4A 3SSQA 1NWSA 1U6BA 2Z2MA 4YB5A 2WK2A 1IKWA 2DT1A 3VHQA 2BM1A 4L76A 2BJEA 3M8QB 3GWCA 5HP1B 3CC7S 3HF5A 4UZCA 4O4GA 2MPHA 1BUXA 4DFPA 1MROA 3C6UB 3MM8B 2VU5A 4RBTA 2ALZA 3OPKA 1CC7A 1EKRA 3FCHA 3US5A 1H6KX 2CUYA 4I2PB 5J2NB 2MY8A 3BKFA 1FHTA 2WSCC 1WI6A 1DQ8A 5ETQA 1C0TA 3D1OA 3AY0A 4DPYA 4LRFA 2FDMA 1GMVA 1VK8A 1RBAA 1RA6A 3H25A 1J27A 1QPLA 1I3OB 4ML4A 1HWUA 2MEWA 5H1SV 1WG5A 1EDQA 5KFFA 4IRDA 3FRZA 4ZDNA 4JI4F 2HHUA 4HHUA 2FDNA 1DTQB 1OYEA 3CHEA 2BANB 3I82A 4IR1A 2BRLA 4FYXB 3MCOA 4V19X 2VA3A 3TDBA 2AEJA 2RRNA 1KD1T 4M5NA 4M1KA 3WQWA 2XYPB 1F9EB 1LK5A 4QIFA 1R7IA 3X1LB 3N5BA 4ES3A 1SYTA 4CNZA 4U84A 1XMBA 4UOFA 2DCLA 5U47A 5DDOC 1ZPWX 2Q66A 1NSQA 3QZ7A 1W9VA 3A8IA 2ZD1B 3ZTOA 2OSQA 2ILZA 4H54A 2QMXA 2CQGA 3CXCR 2V8PA 5AXMA 2CQ1A 2UV8A 2DG4A 3OUYA 2V5HG 3R5BA 2FJDB 2R9LA 2IDLA 3NGUA 1CJKA 3MD1A 2DSWA 4J4OA 4JI5F 5HI7A 2YNGB 2V2KA 1W1VA 2XP3A 1S9FA 1GXLA 4UF4A 3OV7A 4F4YA 3W2WA 1X0FA 2CRLA 2YNFB 3VQSA 2W9BA 1BWVA 1X5OA 3GG1A 1PYSB 4TW6A 3PRVA 4CLZA 2ZH1A 1CPZA 5T14A 1WI8A 5HROA 1S0OA 3ARYA 3MR3A 2IBOA 3C2PA 2KG1A 2OPQA 2PV3A 4M5DB 4ELUA 4YB6A 3WIJA 1LWFA 1JXVA 1S6PA 3QIPB 2HLUA 2F63A 4B9SA 3TRGA 1ACMB 4MIAA 3QJLA 2EULA 3J80Y 2AYBA 2UVVA 1ZPVA 2IM0A 4P74A 4F4KA 3FXYA 4DRPA 2V94A 4EI2A 1S5ZA 4DRKA 1T9XA 2D7SA 2H9ZA 4NLXA 4YP3A 5KFLA 3OXFA 3OTOJ 3IKGA 1J6YA 3W9JA 4D3HA 3ZZUA 2PFFB 3ZNUA 4KKOB 4NLOA 2HHXA 3HLUA 2CQIA 1UP1A 1Q7YT 2FVCA 1E6VB 4PXCA 3TQEA 2E44A 3TUIC 1FRMA 4QW8A 1TQLA 5C25A 4ZN1A 5HLFA 1CG2A 4LF1A 4ZVGA 3B8HA 4B17A 1M5SA 1B0TA 3O5RA 3A12A 3WQVA 4ILLA 3M8ZA 1RBOB 2HVZA 2MTLA 2RRBA 3TAPA 3MM7A 1FD2A 3MM5B 4NLRA 5CZXA 5AE2A 1L3UA 3PW5A 5DG7A 3DRPB 2LA6A 1JX4A 4L3NA 3EDQB 1V9OA 3QSIA 2E5LF 1YRXA 5EHHA 2LPVA 1IVZA 2W01A 2MKYA 1IKYB 1QVGR 1VQ9S 4OI1A 5ETKA 1KT0A 2ZH5A 1ZH5A 2R7QA 1JXLA 2FB0A 1UWBB 3OFFA 3ETOA 4Y2MA 4FYYB 3ARWA 2Y0SD 5KFYA 1TK8A 1IJEB 3G9CA 4ECTA 4A8FA 3M8RA 2MNTA 1X5TA 4LJMA 2V8VA 2D3O1 2BMBA 2GGPB 1EIBA 4ZLNA 1JJ4A 3MR6A 1X6LA 1HI8A 1AFIA 5IT0A 2LJ4A 1EP4A 4WYLA 3JB9k 1XQIA 4NLVA 4I7FB 3CD5A 4CH7A 3OJSA 1C2PA 2OPRB 3CCZA 2ZR6A 5HK4A 1VISA 5KG4A 1RWWB 2CQBA 2W8LA 1FAPA 1JVWA 4CLTA 2EEYA 3JSBA 3NLCA 2W4CA 4DR5J 3EGZA 3CCUS 3I6PA 1SJFA 2CJQA 4Z7CA 2N87A 5B0BA 5GAGI 1S49A 3AD7C 1VQNS 1YBUA 1SCJB 2UXBJ 3JYMA 1TVRB 3BQ0A 2HNYA 2YKMA 2RQSA 2X3DA 3M4XA 2JC1A 2ASYA 3MI7X 4YB7A 2PIIA 4WJXA 3D3BJ 2HZCA 2HW3A 5AXNA 1GNKA 2D3ZA 5DGBA 3K2YA 3W65A 3KOAA 2LLZA 3CEDA 2WZ1A 1S4EA 1GPFA 3G8SA 2IC3B 4DV3F 3JSMA 4KT0C 1RA7A 4P6QA 2ZVSA 4DV0J 3ZZZA 5C5JA 2HYIB 2WVEA 3MAAA 4OHYA 4NXNF 2IVFB 3QMQA 1RT1B 3AQUA 1FKOA 3U1MA 2FJVA 2VBYA 2YX7A 4LF6F 2RD5C 3UQBA 1Q95G 4ZPCA 1SJ4P 4K50A 3MPVA 3UWTA 1U45A 2JHEA 1TKTA 4ID5A 1C1CA 3JXOA 4HARA 3W66A 4K0KF 2O67A 5DQIA 5ADZA 4KB7A 2E5JA 4PABA 1RISA 4GKKJ 3T1YJ 4NCGB 4F2SA 1YKWA 3GR1A 3V4MA 2HG4A 3H4DA 2AWGA 4WIIA 2VJVA 2KM8B 1Q4RA 1FRLA 1H98A 1OQ6A 4FF4A 1RT4B 2PI5A 4QWDA 2RQKA 4B08A 3Q8QB 2F8MA 4LAWA 2QIFA 1T03B 2OJ3A 1WUUA 1U48A 3EX7B 4ANDA 7AT1B 1IKXB 1PINA 1Y3KA 3ISNC 1HQEA 4NLSA 3MDFA 3LP2A 2MZTA 1W25A 4RWWA 1C0UA 1YSJA 1D7JA 1KN6A 4LF8F 3AD9C 2R7VA 3ENQA 3D0GE 3KAIA 3FGVA 3R1HA 2ZC4A 4ER8A 1W9UA 2GW8A 1FRXA 2MZQA 4DIPA 3JYJA 3D6FB 1TKXB 2YBUA 2G0IA 4DS4A 2OUGA 1U0HA 4N5SA 1LV5A 4C3LA 2PT0A 4X4VA 3CT9A 2PV2A 5DDQC 2MQQA 4Y65A 1S99A 3KLGA 3MM6A 1SC6A 5J1NA 2FLNA 5B0EA 2BVZA 2A2DA 2XLKA 2GQ2A 4OZ5A 5KG2A 2L3MA 4LFBF 4J9KA 2DG9A 4ZCMA 4NRTA 3B78A 1VBXA 2Q1LA 2W24A 3M9OB 1U2CA 2J7UA 2BKNA 3DOLB 3FRYA 3K57A 3U1LA 3HK2A 2V69A 2E1MC 3KJVA 3AROA 2CDQA 4ZJOA 3W60A 1Y10A 1OMSA 3EIPA 4DV5J 2IBKA 3IG1A 2FGOA 5FDLA 1H2TZ 1NCLA 2YTCA 3R1LA 4IH5A 4LR7A 3AXKA 2B3TB 3JTPA 3JQKA 2R3VA 4CLKA 4KO0B 2DXFA 1JNZB 3R9LA 3A8EA 3EY6A 2QJ3A 4PWDB 3ET6B 3KLFA 2R2RA 5BYRA 5CD4H 4EEYA 2JFDA 4Y34A 3JTNA 3O5LA 4O0NA 2OKQA 1F5BA 4GKJJ 3MEEB 2VIHA 3J81j 1RXOB 1WTBA 1UKUA 3N6NA 2IUZA 1MU2A 2IJRA 1TELA 3R6LB 1NBEB 2ADCA 4FKXA 2ZKUA 2V4JB 2XSJB 4MMOA 1UEUA 1RHKB 1QM9A 4U85A 2HHTA 2KFWA 2FHJA 4JYAF 1VQMS 3ZTQA 2P9CA 2A10A 1KOHA 2FD2A 3UD4P 3J81Y 3AB2B 1L3TA 4WZQA 3U27A 2XHCA 2M52A 1TCOC 4HT7A 1OY9A 2F8HA 1YWXA 5BR8F 4WKFA 4DX7A 3GFHA 4QZVB 3LF0A 4ZCIA 1VQLS 4RNHA 4PZVA 4IH6A 1CSJA 4ZCLA 3A3OB 1Q1CA 4KQZA 3A8JA 2ZH6A 3RAQA 3HHLA 3A3NB 4ZMMA 3MPWA 3HO1A 1VCTA 4I67A 2Z56B 3BR9A 2DT0A 4OX9F 3CPWR
chains in the Genus database with same CATH topology
3QWUA 1GOIA 1S6QA 1PBKA 1HBMA 1S9EA 3EXCX 4KTQA 2YBTA 2H5EA 5H9EJ 2DGWA 3HXMA 1QSSA 1S6OA 2DO4A 2E9ZA 4H4MB 2DB1A 4R0JA 5KT6A 3NNCA 3JAMY 4TU9A 2XWYA 4Z2GA 4RW8A 1NK9A 3T9NA 1RTHB 5A6PA 3GB0A 2MZRA 1B0PA 1HBUB 5D3GA 2HGLA 2HNDA 3BGRA 1SB6A 4R0EA 2G13A 3S01A 3FY1A 1IQZA 2FVRA 4ZS6A 2DK2A 1UJ5A 2RH3A 3ISZA 2K1RA 3LP0A 2UXDF 1B7FA 5LL6d 3SYZA 4W9PA 4J9MA 1BQXA 4YEAA 1M5PC 4QU7A 3RB0A 2RQ4A 4M94A 4MPKA 3PKYA 2CIMA 2KYXA 1RT5A 1U2FA 1QJHA 3THTA 2LCWA 2W7OA 1KFDA 3TAMB 4FXWA 3PXGa 5E3CA 3KHRA 4TW7A 4ZPWR 4LFAF 2VFUA 3RFWA 4QIEA 4TY8B 4JV0A 4ECQA 2FY1A 1ZM2A 2COLA 5KFTA 5CCMA 5K14A 2CVIA 3IGVA 1TV6B 3ENVA 5KAKA 3G4SS 5LJ3Y 1LG1A 3M2UA 2UXCF 3W7BA 3BO2A 1KRPA 1HR0F 1LWCA 3OUYB 2F3JA 1KT1A 3H4BA 1XMOF 2GFFA 4ODMA 1O8BA 2ZHBA 2F9JA 4G1PA 4R25A 1GX5A 2A3JA 3VAJA 1M1KT 3CJ3A 2MZ1A 2KR7A 3T1AA 3RYLA 3OTCA 3JSRA 3MGJA 3N01A 4M95A 1JLEA 3SV3A 5A0YB 1JLCA 4TU7A 1HJVA 2IMWP 4X65F 3O8WA 2EG2A 1SJRA 2MHNA 4Y2AA 5DETA 2KXNB 4DUYF 2RSEA 4EBEA 5G4DA 2HAIA 5C42A 3UCUP 3M1VB 4O23A 3SEOA 4UY85 1QE1B 2ZOMA 4JYSA 2MXYA 1X5SA 2L48A 3GPKA 4DLGA 1H0HB 3W2WB 4B3MF 3DLGB 3CD0A 1U09A 2PMHA 1IN0A 4FXVA 4NLYA 5BYSA 2X1BA 2ATLA 5F8LA 5E3PA 2DNLA 2GHVC 4ED8A 3OJUA 1Q86T 4OQJA 3DRSA 1RT1A 2W9BB 1Q6HA 2LQ9A 2G8ZA 2NR0A 4B9UA 1F9FA 4DS5A 4FN2A 1E6ZA 1KHVA 3LGMA 3Q24A 5HO4A 2MGZB 2P9GA 3THPA 1NMWA 1FDAA 4IO1A 2E1AA 4RZRA 2EFOA 2OP5A 2DISA 2IA6A 2HWTA 3K7RA 1HBOA 2BRKA 3V2UC 2MPUA 3QAEA 3TR5A 4KHMA 4F50A 3PX0A 1JKHB 4J37A 2JC0A 2XPAA 2OPPB 4P2SA 5HROB 4J9NA 2FJEB 1KQKA 2RQMA 1N48A 3ONQA 3IKDA 4RW7A 2XCAA 3P6YC 1CC8A 2PE8A 1G7CB 3OR2A 4WXWA 3LAMA 2GX8A 3QO9A 2WB1D 2OPQB 2VFSA 2XMJA 2WAQD 5HMYA 5GMKa 3TAQA 1R0AA 4KSEB 1JLQA 2V8HA 1HQUA 3H20A 3NAHA 5FLXY 2VPZB 3CHDA 7FD1A 3IRXB 5M2UA 4CTAB 2I8EA 2M70A 5ITHA 3M6UA 1T3OA 4OV1A 2KDOA 3IO1A 4ES1A 1U49A 4F02A 1N32F 1ZBVA 2KM8C 2WOMB 1X8DA 4Y6IA 4FXDA 2AOSA 3KYLA 1LWFB 2DGVA 2PD1A 4YR3A 3B4DA 1HNIA 3B4MA 2M2BA 4ZVFA 5HKGA 2DHXA 3W2VA 4RLEA 2XBPA 4HYKA 4TYOA 3CCTA 4NCGA 2RKIA 3ULHA 4JI7F 2RDIA 3DXSX 4TNOA 1AUDA 1PC5A 3OXLA 4RX6A 3RB3A 3DGPA 4MH8A 4A46A 3OXGA 3QLHB 4CCHA 4UQGA 3PIPQ 2DR7A 2EFVA 2M5YA 4URSA 3IK8A 1Y0OA 4KGMA 2KKHA 3NRKA 4ODLA 3GR0A 5KFOA 3RR7A 4URIA 2ZNYA 5GAHI 1KQFB 5IQ6A 4EFAC 3MEGA 3X3UA 2IYGA 4RBUA 1OIAA 2LU1A 3BQ2A 3T5KA 3T5LA 2XP9A 3TVZA 4A8YA 4TX0A 1H3DA 4TU8A 2MDAA 4MFBB 1N5VA 2RS2A 3TP2A 3K5LA 2NLWA 4K4SA 5EX0A 2VKRA 4KE5A 4UY8T 4ZP7A 1EHNA 4DFJA 3W4RA 1RP5A 4IOBA 4NLWA 1FFQA 1RT4A 4PQUA 4QWAA 1YJVA 1XK8A 1FKPA 2N4DA 3PFEA 1F8AB 1RT2B 2OIHA 1WHYA 4CZCA 2Q5AA 3MHYA 4HHJA 4MGVA 2DT2A 3UQAA 5C25B 4Q5VA 1U47A 1WEYA 1IQTA 5HLFB 2LDIA 3VZIA 3BGUA 1HWJA 2NXUA 2DNNA 3M8QA 3CWJA 4HDGA 2LDYA 1TUVA 2DPIA 4LIWA 4FPRA 5HMZA 2B0GA 1D6OA 1TP7A 1UAWA 5KFNA 3FZ2A 1WF2A 2KRRA 5HP1A 5HL7Q 1ITXA 3BDEA 1FNOA 2FJBB 3LOUA 3V6DB 3D1QA 1N4LA 3ARRA 3QWPA 2WBMA 2XGPA 3KK1A 1QPFA 1FEEA 1ZU8A 1R8AA 3MM7B 1HHSA 4WYWA 4ZVEA 3RBDA 4NL5A 1N6QA 1Y5NB 2RSQA 4KBIA 5KFJA 4I56A 5B08A 1BKFA 3MM8A 4ES2A 2MKHA 3UPFA 4PRFA 2CPJA 4G1IA 3H59A 3R3TA 5KG7A 2XC9A 3MM9A 3I6CA 1REVA 1VC5A 2JLGA 3J7A1 2XNRA 2DRAA 1KEKA 3VALA 4IH7A 1NH8A 2PI6A 1KOOA 2FAPA 3NWGA 3U02A 5A8WB 2XS5A 1GX6A 2QE5A 4DFMA 1FKLA 4FP9A 3RB4A 2EK1A 1HJWA 4WFXA 2HNZB 3UI4A 2VFVA 3I0RB 3K8VA 4I2PA 4IFVB 4IKAA 2LVWA 2ACYA 4LT6A 4OHZA 5B0GA 7FDRA 5J2NA 2J5AA 2MSTA 4BC7A 3QGIA 5K8PA 3T9ZA 4LSNB 3UR3C 3GIMA 3CCSS 2R7SA 2W9CB 3J7YU 3M6VA 2G0CA 5EDWA 4BWMA 5D4PA 4JOUA 1NK7A 3IWNC 2WSFC 5L9NA 2OSRA 3CJKA 3MECB 3DLBA 3PR9A 2KB2A 4X4TA 2GMLA 1YJ9S 2E1RA 3I0SA 1TKZB 3C6TB 3PEHA 3DLLQ 2MKSA 4Y2IA 1V6HA 4FBUA 2B56A 5GPRA 1CEZA 3ICLA 4E8UA 1HARA 4IG0B 1QAJA 1UMJA 3C66A 2DT3A 4ZP9A 2BOPA 4IUFA 1RQ0A 1TL4A 3TANA 1DARA 1URNA 2DITA 2NS1B 1RTIB 2WW8A 2GJ2A 3Q23A 5CXTA 3DYAB 5D4OA 3IHZA 4OI0A 5F8IA 1J2VA 3BR8A 5J2PB 2R2SA 1D1UA 2FLPA 4TLRA 2YNIA 3OTOF 1JLGA 5KFRA 4NYOA 3V4IB 4DN9A 4HT5A 5EWEA 5I3UA 3ARXA 3SCJE 1EP4B 2AF6A 2DNOA 2GHPA 4RW6A 5T7LB 4FF1A 1BL4A 4BF8A 2RIJA 4R8UA 2EPIA 2XP8A 1X4AA 4K5SA 1FJEB 2YQ3A 1MNEA 3CDBA 1SQEA 3IS9A 2UU9F 4P8XA 3K5PA 4A47A 2ADBA 2L9NA 2VPWB 3Q2SC 1HWIA 3FSIA 4C8KA 4NCBA 4X66F 1BD6A 3B9DA 4IR9A 2KT5A 4DOZA 3C46A 4TQRA 1WF1A 1AFJA 3ARPA 3TYTA 3HHDA 5C24A 3U7JA 1K9TA 1VGYA 4DWSC 3RU0A 3BSAA 1H0IA 3EZUA 1Q82T 4KRWA 2D9OA 4QIVA 3H40A 3PX4A 4Q0BA 3CSKA 4DR3F 3PV8A 2KZZA 1FKAF 2ZOGA 4WXOA 5AJ3F 1O51A 4MK9A 2I5JB 2BM0A 1OSDA 4DHVA 4W9OA 4JFIA 3I4HX 4I69A 4KR0B 1QLNA 1DURA 4DROA 1OQ3A 2WLYA 3BREA 3DI6B 1TFVA 3KAGA 3ZZRA 5A8KA 2CPZA 1HYSB 4LF9F 1ZM9A 3J7Z5 3QGHA 4AYBD 4FVMA 3KLIA 3NI6A 4Y00A 4CH1A 1JLBA 3ARQA 4NLDA 3UCZP 4DFKA 2LMIA 1JIHA 1JNEA 1TFWA 2M1IA 2ZH3A 1M5KC 2JOQA 3SV4A 2K3KA 4HDHA 3O5JA 2DR5A 2DPJA 4I1TA 3H5YA 2M8HA 2AGOA 2ZQTA 2B6AA 3PM9A 1D7HA 4A8SA 2XP5A 4NYZA 3IWLA 2DNHA 3B9AA 4P8UA 2KT2A 3JYTB 2E7XA 2YKMB 3M8PB 1WHVA 4CT8A 2QO3A 2K7KA 3HP6A 2RILA 1IX5A 2DSZA 3SCIE 2XLJA 2RNEA 1S1TB 2DGSA 4R5PA 2VL1A 3HDSA 2ZBIA 1S97A 1MW7A 2J9DA 1FXRA 2YWGA 2WK4A 3E01B 5G0RA 1YW5A 3MF5A 4W92B 2ZJRQ 4DL0C 2IJFA 3IA0A 2MQOA 1JXEA 4P7TA 1U1OA 1UA0A 1TL1B 2ZD1A 1XR5A 1Y00A 3WD0A 1EETB 3VF0B 2MKKA 3TC5A 3UF8A 2PA3A 2XULA 2UZAA 3SMZA 3SQGB 4LF7F 4N8OA 4UQTA 4X4NA 4B3RF 1S1XA 2D1CA 4X4PA 3GIJA 2L9DA 2ZR5A 3D28A 5HBMA 4C11A 2VH7A 4WU2A 1RTJB 3JSMB 3ZZPA 1RTDA 2EFGA 4YQWA 2MKJA 4K4VA 3K59A 1R43A 3B7XA 4K5RA 1KTQA 2R8HA 2DHSA 2C2RA 1Y3JA 4N77A 5KG5A 4TXSA 3I87A 2WONB 3FAPA 3MEKA 3MEEA