2RUQA

Solution structure of human pin1 ppiase mutant c113a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
GSHMEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDASSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Allosteric Breakage of the Hydrogen Bond within the Dual-Histidine Motif in the Active Site of Human Pin1 PPIase
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ruqA00
4LAVA 2IF4A 4DIPA 3IKDA 3O5LA 3IKGA 2PBCA 2Y78A 2ZQSA 1ROUA 3IHZA 4NNRA 4TW8A 5GPGA 2ZR4A 3CGMA 4TYOA 5DITA 4DZ3A 5HUAA 1J4RA 1J4IA 1FKIA 4ODRA 4G2PA 4IQCA 2FAPA 2M1IA 2RQSA 3O5RA 2XP8A 2FKEA 3O5JA 4G50A 2RUDA 4JYSA 4U85A 1BKFA 4C02B 4FAPA 3PA7A 2D9FA 1PINA 1YW5A 3O5IA 2KR7A 1A7XA 1FKBA 2XP6A 2RSEA 3O5MA 2LKNA 3KAHA 3O5GA 4IPXA 1D7JA 1D7IA 2K8IA 2KE0A 2RURA 4JFLA 4QT2A 5DIUA 1W26A 2DG3A 2MNTA 3O5DA 2VN1A 1J6YA 1FKLA 1KT0A 3B7XA 3O5EA 4DRPA 5HTGA 4DROA 3LUOA 3FAPA 1FKRA 2LJ4A 3KAGA 4TW7A 3TCZA 1EQ3A 1FKTA 3O5PA 1YATA 3KAFA 2L2SA 5I98A 3UQBA 5HKGA 2PPPA 1FKHA 1QPFA 2XPBA 2VCDA 3NTPA 3UI5A 3KAIA 1FKJA 4DRKA 1FAPA 3EY6A 3O5FA 4U86A 2PPOA 2ITKA 4DZ2A 1NSGA 1M5YA 2ZR6A 2ZR5A 2KO7A 2MLZA 2KGJA 3MDYB 2KFWA 4JFKA 4U84A 5DIVA 4DRHA 2AWGA 3UI4A 4J4NA 4ODPA 1QZ2A 4QT3A 4W9QA 2F21A 2XP3A 1F40A 4ODOA 3KABA 4MGVA 1KT1A 5HW7A 4QIBA 3PRBA 4N19A 2F2DA 3CGNA 5J6EA 1N1AA 3JXVA 3JYJA 4ITZA 4ODNA 4ODKA 3UI6A 1Q6IA 2M2AA 3KADA 1R9HA 2XPAA 4LAYA 2UZ5A 4W9PA 4FN2A 3TC5A 1PBKA 1J4HA 1ZK6A 2PPNA 2ZQTA 2DG4A 3GPKA 3RFWA 1FKSA 3NI6A 2M08A 3UQIA 1EYMA 1L1PA 1FKFA 4DRNA 2N87A 2PV1A 2XP5A 2ZQVA 2LGOA 4TX0A 3KACA 2ZQUA 1TCOC 4DRIA 5D75A 1ZCNA 1FJDA 1B6CA 1D7HA 2KI3A 3UF8A 4BF8A 1FKKA 4DRQA 4MSPA 2OFNA 4DT4A 3TDBA 1D6OA 3KZ7A 4ODLA 5HW8A 3UQAA 1JNSA 2MPHA 2XP9A 1FD9A 3KCEA 4JFMA 1HXVA 4DRJA 4DH0A 4DRMA 4TNSA 3JYMA 1FKGA 2JZVA 3NRKA 2RUQA 4LAXA 2PV3A 4ODMA 3VAWA 4O2TA 1Q1CA 1BL4A 2XP7A 4GIVA 1T11A 4LAWA 1F8AB 4GGQA 3OOBA 2MLXA 1JNTA 2RUCA 2PV2A 5HW6A 1JVWA 3ODKA 4J4OA 3RGCA 1ROTA 5HT1A 3H9RB 2Q5AA 1NMWA 1Q6UA 5BXJA 5B8IC 1U79A 5HWCA 4JFIA 1C9HA 4JFJA 2MLYA 2MF9A 1FKDA 1QPLA 2XP4A 3IK8A 3I6CA 3O5QA 3PRDA 1P5QA 4TW6A 4R0XA 1NMVA 4IQ2A 1Y0OA 4ODQA 2DG9A 4W9OA 5HWBA 3O5OA 2LPVA 2F4EA 3O5KA 1Q6HA 3WH0A
chains in the Genus database with same CATH superfamily
3RM4A 2IF4A 4L3NA 4S3KA 4P8WA 2PBCA 5GPGA 5DITA 3CGMA 5GPRA 2P4VA 4G2PA 1W1YA 3TC5A 4G50A 3WD4A 1BKFA 4C02B 1YW5A 4MAVA 4DWSB 3CHDA 2LKNA 1D7JA 5HBFA 2K8IA 1NWSA 2YBTA 4LGXA 1E9LA 1KT0A 3B7XA 3LUOA 3AS0A 3KAGA 1NH6A 1GRJA 3UQBA 3CH9A 1QPFA 3NTPA 4DRKA 1FAPA 4DWSA 1UR8A 4WJXA 3MDYB 5DIVA 3BXWA 2KFWA 2WLYA 3WD3A 3UI4A 1KFWA 1WAWA 4WIWA 1LL4A 3CHCA 4QIBA 3PRBA 2F2DA 3JXVA 3JYJA 1HJWA 1O6IA 3KADA 4W9PA 4FN2A 1W1PA 1NWTA 4ZS6A 1ZK6A 4Z2HA 2DG4A 3RFWA 3CHEA 1EYMA 3G6MA 1GPFA 1HJXA 2F23A 1ZCNA 1FJDA 1B6CA 4HBEA 4WKAA 3UF8A 4MSPA 2OFNA 3TDBA 1K9TA 2O92A 1HKMA 4ZPTR 4DRMA 3JYMA 1FKGA 2JZVA 2RUQA 1TFVA 1Q1CA 1BL4A 4GGQA 1W9PA 5HW6A 1ZL1A 1SYTA 1SR0A 1GOIA 1ROTA 4P8XA 1NMWA 5BXJA 2QF8A 4JFJA 2MLYA 2MF9A 4MNKA 3O5QA 4TW6A 4R0XA 1W9VA 4W9OA 3O5OA 2F4EA 5HT1A 4ZPWR 4Z2KA 5DO2A 3IHZA 4TW8A 3CZ8A 1OWQA 3ARWA 3WIJA 2ZR4A 5HUAA 4Z2JA 1J4RA 4IQCA 2RQSA 2M1IA 3O5RA 3O5JA 4U85A 3PA7A 4MTVA 4UDMA 3O5IA 2G41A 1A7XA 2KR7A 2XP6A 2RSEA 3ARSA 2O9OA 1D7IA 4Q7NA 4JFLA 3ARYA 4QT2A 4AY1A 4DWSD 3O5DA 5HTGA 4DROA 1FKRA 3G6LA 2PI6A 1ZBVA 1YATA 1EDQA 2XPBA 3B9DA 2DT2A 1FKJA 3OA5A 2ITKA 3B9EA 1M5YA 2ZR6A 4MNJA 2AWGA 3PR9A 1NWUA 1D2KA 3AS2A 5HW7A 4NSBA 1RD6A 3CGNA 4ITZA 4ODKA 3ALGA 2IUZA 2M2AA 1R9HA 2DSVA 4PTMA 1FFQA 3GPKA 1FKSA 1L1PA 1FKFA 3GU0A 2N87A 4S3JA 2XP5A 4DRNA 2LGOA 3KACA 4DRIA 1D7HA 4KR0B 4WK9A 4WKHA 4ZPVR 2DSWA 3B9AA 4TNSA 3PRAA 1GUVA 3NRKA 4ODMA 3VAWA 1X6LA 4GIVA 4LAWA 3ALFA 3OOBA 2ESCA 2RUCA 2PV2A 3RGCA 4IT6A 1VF8A 1QPLA 2B31A 3IK8A 3PRDA 3QOKA 3ARPA 1NMVA 4IQ2A 3WQWA 1Y0OA 4ODQA 5HWBA 4HBOA 2LPVA 4DRPA 1Q6HA 4IPXA 4LAVA 3WL1A 1H0IA 3IKDA 3IKGA 2Y78A 4NNRA 1IX5A 4DZ3A 4L72B 1HKIA 2B5UB 1J4IA 1HKJA 2FAPA 4URIA 2DT3A 5DEZA 1W9UA 1PINA 1OGGA 1JNEA 3O5MA 3O5GA 4Z2GA 1HKKA 2WM0A 1W26A 2DG3A 2MNTA 2VN1A 3O5EA 2LJ4A 3WD2A 4TW7A 3TCZA 3O5PA 5I98A 5HKGA 2PPPA 1FKHA 4MNLA 3UI5A 3KAIA 3EY6A 3O5FA 4U86A 2PPOA 3EIPA 1NSGA 2DPEA 1E6PA 2DSZA 2KGJA 2KO7A 2MLZA 4JFKA 4U84A 4J4NA 3BMBA 1QZ2A 4QT3A 4W9QA 2F21A 2XP3A 1F40A 4ODOA 3KABA 1KT1A 3ARZA 4N19A 4P8UA 1N1AA 1UR9A 2A3CA 3ARTA 4ODNA 1Q6IA 2UZ5A 1ZBWA 3NI6A 1WNOA 2OLHA 3ARQA 2PV1A 2ZQVA 4TX0A 4Z2LA 1E6ZA 2KI3A 5JH8A 4BF8A 1FKKA 4DRQA 3CHFA 1D6OA 3KZ7A 5HW8A 3UQAA 4JFMA 4DH0A 3ARRA 3AQUA 1ZBCA 5DF0A 4LAXA 2PV3A 2WK2A 2XP7A 1F8AB 3WD0A 4MPKA 2MLXA 2A3EA 1JNTA 1E44A 3B8SA 2Q5AA 4Q22A 4Z2IA 5HWCA 1LL6A 1FKDA 3I6CA 2G8ZA 3WD1A 3ARUA 3ARXA 2EULA 5GQBA 4XAKA 3WH0A 4DIPA 3O5LA 1JCHB 1WB0A 1XRVA 1ROUA 2ZQSA 4TYOA 3RM9A 1EIBA 1FKIA 4ODRA 4JYSA 2XP8A 2FKEA 4FAPA 2RUDA 1FFRA 2D9FA 3W4RA 3WQVA 4DWSC 1FKBA 1HJVA 1ITXA 1LQ0A 3KAHA 1LG1A 2KE0A 2RURA 5DIUA 1J6YA 1FKLA 4HARA 3FAPA 1JNDA 2DT0A 1EQ3A 3AS1A 1FKTA 1ZB5A 3KAFA 2L2SA 1E15A 2VCDA 3WL0A 1LJYA 2PN0A 4DZ2A 2ZR5A 4ML4A 4DRHA 4ODPA 1X6NA 4MGVA 3AROA 2YBUA 1E6NA 5J6EA 3UI6A 2DSUA 2XPAA 4LAYA 1PBKA 4WKFA 1J4HA 2PPNA 2ZQTA 3GTYX 2M08A 3FY1A 2WLZA 3UQIA 2AOSA 1CTNA 4W5UA 4QZVB 2ZQUA 1TCOC 5D75A 1ZU8A 4NZCA 4DT4A 4ODLA 1JNSA 3RM8A 2ETNA 4MNMA 2MPHA 1LG2A 2FDMA 4R5EA 2XP9A 1FD9A 3KCEA 1NWRA 1HXVA 4DRJA 1ZBKA 3FXYA 1E6RA 1LL7A 4O2TA 1T11A 1W1TA 4P8VA 1JVWA 1H0GA 3ODKA 4J4OA 2A3BA 1XHGA 3H9RB 3WKZA 1Q6UA 1W1VA 4IT4A 3RMEA 5B8IC 1U79A 4JFIA 1C9HA 1OGBA 2A3AA 2XP4A 3ARVA 1P5QA 1EHNA 3AS3A 2DG9A 4KQZA 3O5KA 2DT1A
chains in the Genus database with same CATH topology
3RM4A 2IF4A 4L3NA 4S3KA 4P8WA 2PBCA 5GPGA 5DITA 3CGMA 5GPRA 4G2PA 1W1YA 3TC5A 4G50A 3WD4A 1BKFA 4C02B 1YW5A 4MAVA 4DWSB 3CHDA 2LKNA 1D7JA 5HBFA 2K8IA 1NWSA 2YBTA 4LGXA 1E9LA 1KT0A 3B7XA 3LUOA 3AS0A 3KAGA 1NH6A 3UQBA 3CH9A 1QPFA 3NTPA 4DRKA 1FAPA 4DWSA 1UR8A 4WJXA 3MDYB 5DIVA 3BXWA 2KFWA 2WLYA 3WD3A 3UI4A 1KFWA 1WAWA 4WIWA 1LL4A 3CHCA 4QIBA 3PRBA 2F2DA 3JXVA 3JYJA 1HJWA 1O6IA 3KADA 4W9PA 4FN2A 1W1PA 1NWTA 4ZS6A 1ZK6A 4Z2HA 2DG4A 3RFWA 3CHEA 1EYMA 3G6MA 1GPFA 1HJXA 1ZCNA 1FJDA 1B6CA 4HBEA 4WKAA 3UF8A 4MSPA 2OFNA 3TDBA 1K9TA 2O92A 1HKMA 4ZPTR 4DRMA 3JYMA 1FKGA 2JZVA 2RUQA 1TFVA 1Q1CA 1BL4A 4GGQA 1W9PA 5HW6A 1ZL1A 1SYTA 1SR0A 1GOIA 1ROTA 4P8XA 1NMWA 5BXJA 2QF8A 4JFJA 2MLYA 2MF9A 4MNKA 3O5QA 4TW6A 4R0XA 1W9VA 4W9OA 3O5OA 2F4EA 5HT1A 4ZPWR 4Z2KA 5DO2A 3IHZA 4TW8A 3CZ8A 1OWQA 3ARWA 3WIJA 2ZR4A 5HUAA 4Z2JA 1J4RA 4IQCA 2RQSA 2M1IA 3O5RA 3O5JA 4U85A 3PA7A 4MTVA 3O5IA 2G41A 1A7XA 2KR7A 2XP6A 2RSEA 3ARSA 2O9OA 1D7IA 4Q7NA 4JFLA 3ARYA 4QT2A 4AY1A 4DWSD 3O5DA 5HTGA 4DROA 1FKRA 3G6LA 2PI6A 1ZBVA 1YATA 1EDQA 2XPBA 3B9DA 2DT2A 1FKJA 3OA5A 2ITKA 3B9EA 1M5YA 2ZR6A 4MNJA 2AWGA 3PR9A 1NWUA 1D2KA 3AS2A 5HW7A 4NSBA 1RD6A 3CGNA 4ITZA 4ODKA 3ALGA 2IUZA 2M2AA 1R9HA 2DSVA 4PTMA 1FFQA 3GPKA 1FKSA 1L1PA 1FKFA 4DRNA 2N87A 4S3JA 2XP5A 2LGOA 3KACA 4DRIA 1D7HA 4KR0B 4WK9A 4WKHA 4ZPVR 2DSWA 3B9AA 4TNSA 3PRAA 1GUVA 3NRKA 4ODMA 3VAWA 1X6LA 4GIVA 4LAWA 3ALFA 3OOBA 2ESCA 2RUCA 2PV2A 3RGCA 4IT6A 1VF8A 1QPLA 2B31A 3IK8A 3PRDA 3QOKA 3ARPA 1NMVA 4IQ2A 3WQWA 1Y0OA 4ODQA 5HWBA 4HBOA 2LPVA 4DRPA 1Q6HA 4IPXA 4LAVA 3WL1A 1H0IA 3IKDA 3IKGA 2Y78A 4NNRA 1IX5A 4DZ3A 4L72B 1HKIA 1J4IA 1HKJA 2FAPA 4URIA 2DT3A 5DEZA 1W9UA 1PINA 1OGGA 1JNEA 3O5MA 3O5GA 4Z2GA 1HKKA 2WM0A 1W26A 2DG3A 2MNTA 2VN1A 3O5EA 2LJ4A 3WD2A 4TW7A 3TCZA 3O5PA 5I98A 5HKGA 2PPPA 1FKHA 4MNLA 3UI5A 3KAIA 3EY6A 3O5FA 4U86A 2PPOA 1NSGA 2DPEA 1E6PA 2DSZA 2KGJA 2KO7A 2MLZA 4JFKA 4U84A 4J4NA 1QZ2A 4QT3A 4W9QA 2F21A 2XP3A 1F40A 4ODOA 3KABA 1KT1A 3ARZA 4N19A 4P8UA 1N1AA 1UR9A 2A3CA 3ARTA 4ODNA 1Q6IA 2UZ5A 1ZBWA 3NI6A 1WNOA 2OLHA 3ARQA 2PV1A 2ZQVA 4TX0A 4Z2LA 1E6ZA 2KI3A 5JH8A 4BF8A 1FKKA 4DRQA 3CHFA 1D6OA 3KZ7A 5HW8A 3UQAA 4JFMA 4DH0A 3ARRA 3AQUA 1ZBCA 5DF0A 4LAXA 2PV3A 2WK2A 2XP7A 1F8AB 3WD0A 4MPKA 2MLXA 2A3EA 1JNTA 3B8SA 2Q5AA 4Q22A 4Z2IA 5HWCA 1LL6A 1FKDA 3I6CA 2G8ZA 3WD1A 3ARUA 3ARXA 5GQBA 4XAKA 3WH0A 4DIPA 3O5LA 1WB0A 1XRVA 1ROUA 2ZQSA 4TYOA 3RM9A 1EIBA 1FKIA 4ODRA 4JYSA 2XP8A 2FKEA 4FAPA 2RUDA 1FFRA 2D9FA 3W4RA 3WQVA 4DWSC 1FKBA 1HJVA 1ITXA 1LQ0A 3KAHA 1LG1A 2KE0A 2RURA 5DIUA 1J6YA 1FKLA 4HARA 3FAPA 1JNDA 2DT0A 1EQ3A 3AS1A 1FKTA 1ZB5A 3KAFA 2L2SA 1E15A 2VCDA 3WL0A 1LJYA 4DZ2A 2ZR5A 4ML4A 4DRHA 4ODPA 1X6NA 4MGVA 3AROA 2YBUA 1E6NA 5J6EA 3UI6A 2DSUA 2XPAA 4LAYA 1PBKA 4WKFA 1J4HA 2PPNA 2ZQTA 2M08A 3FY1A 2WLZA 3UQIA 2AOSA 1CTNA 4W5UA 4QZVB 2ZQUA 1TCOC 5D75A 1ZU8A 4NZCA 4DT4A 4ODLA 1JNSA 3RM8A 4MNMA 2MPHA 1LG2A 2FDMA 4R5EA 2XP9A 1FD9A 3KCEA 1NWRA 1HXVA 4DRJA 1ZBKA 3FXYA 1E6RA 1LL7A 4O2TA 1T11A 1W1TA 4P8VA 1JVWA 1H0GA 3ODKA 4J4OA 2A3BA 1XHGA 3H9RB 3WKZA 1Q6UA 1W1VA 4IT4A 3RMEA 5B8IC 1U79A 4JFIA 1C9HA 1OGBA 2A3AA 2XP4A 3ARVA 1P5QA 1EHNA 3AS3A 2DG9A 4KQZA 3O5KA 2DT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAV A;  2IF4 A;  4DIP A;  3IKD A;  3O5L A;  3IKG A;  2PBC A;  2Y78 A;  2ZQS A;  1ROU A;  3IHZ A;  4NNR A;  4TW8 A;  5GPG A;  2ZR4 A;  3CGM A;  4TYO A;  5DIT A;  4DZ3 A;  5HUA A;  1J4R A;  1J4I A;  1FKI A;  4ODR A;  4G2P A;  4IQC A;  2FAP A;  2M1I A;  2RQS A;  3O5R A;  2XP8 A;  2FKE A;  3O5J A;  4G50 A;  2RUD A;  4JYS A;  4U85 A;  1BKF A;  4C02 B;  4FAP A;  3PA7 A;  2D9F A;  1PIN A;  1YW5 A;  3O5I A;  2KR7 A;  1A7X A;  1FKB A;  2XP6 A;  2RSE A;  3O5M A;  2LKN A;  3KAH A;  3O5G A;  4IPX A;  1D7J A;  1D7I A;  2K8I A;  2KE0 A;  2RUR A;  4JFL A;  4QT2 A;  5DIU A;  1W26 A;  2DG3 A;  2MNT A;  3O5D A;  2VN1 A;  1J6Y A;  1FKL A;  1KT0 A;  3B7X A;  3O5E A;  4DRP A;  5HTG A;  4DRO A;  3LUO A;  3FAP A;  1FKR A;  2LJ4 A;  3KAG A;  4TW7 A;  3TCZ A;  1EQ3 A;  1FKT A;  3O5P A;  1YAT A;  3KAF A;  2L2S A;  5I98 A;  3UQB A;  5HKG A;  2PPP A;  1FKH A;  1QPF A;  2XPB A;  2VCD A;  3NTP A;  3UI5 A;  3KAI A;  1FKJ A;  4DRK A;  1FAP A;  3EY6 A;  3O5F A;  4U86 A;  2PPO A;  2ITK A;  4DZ2 A;  1NSG A;  1M5Y A;  2ZR6 A;  2ZR5 A;  2KO7 A;  2MLZ A;  2KGJ A;  3MDY B;  2KFW A;  4JFK A;  4U84 A;  5DIV A;  4DRH A;  2AWG A;  3UI4 A;  4J4N A;  4ODP A;  1QZ2 A;  4QT3 A;  4W9Q A;  2F21 A;  2XP3 A;  1F40 A;  4ODO A;  3KAB A;  4MGV A;  1KT1 A;  5HW7 A;  4QIB A;  3PRB A;  4N19 A;  2F2D A;  3CGN A;  5J6E A;  1N1A A;  3JXV A;  3JYJ A;  4ITZ A;  4ODN A;  4ODK A;  3UI6 A;  1Q6I A;  2M2A A;  3KAD A;  1R9H A;  2XPA A;  4LAY A;  2UZ5 A;  4W9P A;  4FN2 A;  3TC5 A;  1PBK A;  1J4H A;  1ZK6 A;  2PPN A;  2ZQT A;  2DG4 A;  3GPK A;  3RFW A;  1FKS A;  3NI6 A;  2M08 A;  3UQI A;  1EYM A;  1L1P A;  1FKF A;  4DRN A;  2N87 A;  2PV1 A;  2XP5 A;  2ZQV A;  2LGO A;  4TX0 A;  3KAC A;  2ZQU A;  1TCO C;  4DRI A;  5D75 A;  1ZCN A;  1FJD A;  1B6C A;  1D7H A;  2KI3 A;  3UF8 A;  4BF8 A;  1FKK A;  4DRQ A;  4MSP A;  2OFN A;  4DT4 A;  3TDB A;  1D6O A;  3KZ7 A;  4ODL A;  5HW8 A;  3UQA A;  1JNS A;  2MPH A;  2XP9 A;  1FD9 A;  3KCE A;  4JFM A;  1HXV A;  4DRJ A;  4DH0 A;  4DRM A;  4TNS A;  3JYM A;  1FKG A;  2JZV A;  3NRK A;  2RUQ A;  4LAX A;  2PV3 A;  4ODM A;  3VAW A;  4O2T A;  1Q1C A;  1BL4 A;  2XP7 A;  4GIV A;  1T11 A;  4LAW A;  1F8A B;  4GGQ A;  3OOB A;  2MLX A;  1JNT A;  2RUC A;  2PV2 A;  5HW6 A;  1JVW A;  3ODK A;  4J4O A;  3RGC A;  1ROT A;  5HT1 A;  3H9R B;  2Q5A A;  1NMW A;  1Q6U A;  5BXJ A;  5B8I C;  1U79 A;  5HWC A;  4JFI A;  1C9H A;  4JFJ A;  2MLY A;  2MF9 A;  1FKD A;  1QPL A;  2XP4 A;  3IK8 A;  3I6C A;  3O5Q A;  3PRD A;  1P5Q A;  4TW6 A;  4R0X A;  1NMV A;  4IQ2 A;  1Y0O A;  4ODQ A;  2DG9 A;  4W9O A;  5HWB A;  3O5O A;  2LPV A;  2F4E A;  3O5K A;  1Q6H A;  3WH0 A; 
#chains in the Genus database with same CATH topology
 3RM4 A;  2IF4 A;  4L3N A;  4S3K A;  4P8W A;  2PBC A;  5GPG A;  5DIT A;  3CGM A;  5GPR A;  2P4V A;  4G2P A;  1W1Y A;  3TC5 A;  4G50 A;  3WD4 A;  1BKF A;  4C02 B;  1YW5 A;  4MAV A;  4DWS B;  3CHD A;  2LKN A;  1D7J A;  5HBF A;  2K8I A;  1NWS A;  2YBT A;  4LGX A;  1E9L A;  1KT0 A;  3B7X A;  3LUO A;  3AS0 A;  3KAG A;  1NH6 A;  1GRJ A;  3UQB A;  3CH9 A;  1QPF A;  3NTP A;  4DRK A;  1FAP A;  4DWS A;  1UR8 A;  4WJX A;  3MDY B;  5DIV A;  3BXW A;  2KFW A;  2WLY A;  3WD3 A;  3UI4 A;  1KFW A;  1WAW A;  4WIW A;  1LL4 A;  3CHC A;  4QIB A;  3PRB A;  2F2D A;  3JXV A;  3JYJ A;  1HJW A;  1O6I A;  3KAD A;  4W9P A;  4FN2 A;  1W1P A;  1NWT A;  4ZS6 A;  1ZK6 A;  4Z2H A;  2DG4 A;  3RFW A;  3CHE A;  1EYM A;  3G6M A;  1GPF A;  1HJX A;  2F23 A;  1ZCN A;  1FJD A;  1B6C A;  4HBE A;  4WKA A;  3UF8 A;  4MSP A;  2OFN A;  3TDB A;  1K9T A;  2O92 A;  1HKM A;  4ZPT R;  4DRM A;  3JYM A;  1FKG A;  2JZV A;  2RUQ A;  1TFV A;  1Q1C A;  1BL4 A;  4GGQ A;  1W9P A;  5HW6 A;  1ZL1 A;  1SYT A;  1SR0 A;  1GOI A;  1ROT A;  4P8X A;  1NMW A;  5BXJ A;  2QF8 A;  4JFJ A;  2MLY A;  2MF9 A;  4MNK A;  3O5Q A;  4TW6 A;  4R0X A;  1W9V A;  4W9O A;  3O5O A;  2F4E A;  5HT1 A;  4ZPW R;  4Z2K A;  5DO2 A;  3IHZ A;  4TW8 A;  3CZ8 A;  1OWQ A;  3ARW A;  3WIJ A;  2ZR4 A;  5HUA A;  4Z2J A;  1J4R A;  4IQC A;  2RQS A;  2M1I A;  3O5R A;  3O5J A;  4U85 A;  3PA7 A;  4MTV A;  4UDM A;  3O5I A;  2G41 A;  1A7X A;  2KR7 A;  2XP6 A;  2RSE A;  3ARS A;  2O9O A;  1D7I A;  4Q7N A;  4JFL A;  3ARY A;  4QT2 A;  4AY1 A;  4DWS D;  3O5D A;  5HTG A;  4DRO A;  1FKR A;  3G6L A;  2PI6 A;  1ZBV A;  1YAT A;  1EDQ A;  2XPB A;  3B9D A;  2DT2 A;  1FKJ A;  3OA5 A;  2ITK A;  3B9E A;  1M5Y A;  2ZR6 A;  4MNJ A;  2AWG A;  3PR9 A;  1NWU A;  1D2K A;  3AS2 A;  5HW7 A;  4NSB A;  1RD6 A;  3CGN A;  4ITZ A;  4ODK A;  3ALG A;  2IUZ A;  2M2A A;  1R9H A;  2DSV A;  4PTM A;  1FFQ A;  3GPK A;  1FKS A;  1L1P A;  1FKF A;  3GU0 A;  2N87 A;  4S3J A;  2XP5 A;  4DRN A;  2LGO A;  3KAC A;  4DRI A;  1D7H A;  4KR0 B;  4WK9 A;  4WKH A;  4ZPV R;  2DSW A;  3B9A A;  4TNS A;  3PRA A;  1GUV A;  3NRK A;  4ODM A;  3VAW A;  1X6L A;  4GIV A;  4LAW A;  3ALF A;  3OOB A;  2ESC A;  2RUC A;  2PV2 A;  3RGC A;  4IT6 A;  1VF8 A;  1QPL A;  2B31 A;  3IK8 A;  3PRD A;  3QOK A;  3ARP A;  1NMV A;  4IQ2 A;  3WQW A;  1Y0O A;  4ODQ A;  5HWB A;  4HBO A;  2LPV A;  4DRP A;  1Q6H A;  4IPX A;  4LAV A;  3WL1 A;  1H0I A;  3IKD A;  3IKG A;  2Y78 A;  4NNR A;  1IX5 A;  4DZ3 A;  4L72 B;  1HKI A;  2B5U B;  1J4I A;  1HKJ A;  2FAP A;  4URI A;  2DT3 A;  5DEZ A;  1W9U A;  1PIN A;  1OGG A;  1JNE A;  3O5M A;  3O5G A;  4Z2G A;  1HKK A;  2WM0 A;  1W26 A;  2DG3 A;  2MNT A;  2VN1 A;  3O5E A;  2LJ4 A;  3WD2 A;  4TW7 A;  3TCZ A;  3O5P A;  5I98 A;  5HKG A;  2PPP A;  1FKH A;  4MNL A;  3UI5 A;  3KAI A;  3EY6 A;  3O5F A;  4U86 A;  2PPO A;  3EIP A;  1NSG A;  2DPE A;  1E6P A;  2DSZ A;  2KGJ A;  2KO7 A;  2MLZ A;  4JFK A;  4U84 A;  4J4N A;  3BMB A;  1QZ2 A;  4QT3 A;  4W9Q A;  2F21 A;  2XP3 A;  1F40 A;  4ODO A;  3KAB A;  1KT1 A;  3ARZ A;  4N19 A;  4P8U A;  1N1A A;  1UR9 A;  2A3C A;  3ART A;  4ODN A;  1Q6I A;  2UZ5 A;  1ZBW A;  3NI6 A;  1WNO A;  2OLH A;  3ARQ A;  2PV1 A;  2ZQV A;  4TX0 A;  4Z2L A;  1E6Z A;  2KI3 A;  5JH8 A;  4BF8 A;  1FKK A;  4DRQ A;  3CHF A;  1D6O A;  3KZ7 A;  5HW8 A;  3UQA A;  4JFM A;  4DH0 A;  3ARR A;  3AQU A;  1ZBC A;  5DF0 A;  4LAX A;  2PV3 A;  2WK2 A;  2XP7 A;  1F8A B;  3WD0 A;  4MPK A;  2MLX A;  2A3E A;  1JNT A;  1E44 A;  3B8S A;  2Q5A A;  4Q22 A;  4Z2I A;  5HWC A;  1LL6 A;  1FKD A;  3I6C A;  2G8Z A;  3WD1 A;  3ARU A;  3ARX A;  2EUL A;  5GQB A;  4XAK A;  3WH0 A;  4DIP A;  3O5L A;  1JCH B;  1WB0 A;  1XRV A;  1ROU A;  2ZQS A;  4TYO A;  3RM9 A;  1EIB A;  1FKI A;  4ODR A;  4JYS A;  2XP8 A;  2FKE A;  4FAP A;  2RUD A;  1FFR A;  2D9F A;  3W4R A;  3WQV A;  4DWS C;  1FKB A;  1HJV A;  1ITX A;  1LQ0 A;  3KAH A;  1LG1 A;  2KE0 A;  2RUR A;  5DIU A;  1J6Y A;  1FKL A;  4HAR A;  3FAP A;  1JND A;  2DT0 A;  1EQ3 A;  3AS1 A;  1FKT A;  1ZB5 A;  3KAF A;  2L2S A;  1E15 A;  2VCD A;  3WL0 A;  1LJY A;  2PN0 A;  4DZ2 A;  2ZR5 A;  4ML4 A;  4DRH A;  4ODP A;  1X6N A;  4MGV A;  3ARO A;  2YBU A;  1E6N A;  5J6E A;  3UI6 A;  2DSU A;  2XPA A;  4LAY A;  1PBK A;  4WKF A;  1J4H A;  2PPN A;  2ZQT A;  3GTY X;  2M08 A;  3FY1 A;  2WLZ A;  3UQI A;  2AOS A;  1CTN A;  4W5U A;  4QZV B;  2ZQU A;  1TCO C;  5D75 A;  1ZU8 A;  4NZC A;  4DT4 A;  4ODL A;  1JNS A;  3RM8 A;  2ETN A;  4MNM A;  2MPH A;  1LG2 A;  2FDM A;  4R5E A;  2XP9 A;  1FD9 A;  3KCE A;  1NWR A;  1HXV A;  4DRJ A;  1ZBK A;  3FXY A;  1E6R A;  1LL7 A;  4O2T A;  1T11 A;  1W1T A;  4P8V A;  1JVW A;  1H0G A;  3ODK A;  4J4O A;  2A3B A;  1XHG A;  3H9R B;  3WKZ A;  1Q6U A;  1W1V A;  4IT4 A;  3RME A;  5B8I C;  1U79 A;  4JFI A;  1C9H A;  1OGB A;  2A3A A;  2XP4 A;  3ARV A;  1P5Q A;  1EHN A;  3AS3 A;  2DG9 A;  4KQZ A;  3O5K A;  2DT1 A; 
#chains in the Genus database with same CATH homology
 3RM4 A;  2IF4 A;  4L3N A;  4S3K A;  4P8W A;  2PBC A;  5GPG A;  5DIT A;  3CGM A;  5GPR A;  4G2P A;  1W1Y A;  3TC5 A;  4G50 A;  3WD4 A;  1BKF A;  4C02 B;  1YW5 A;  4MAV A;  4DWS B;  3CHD A;  2LKN A;  1D7J A;  5HBF A;  2K8I A;  1NWS A;  2YBT A;  4LGX A;  1E9L A;  1KT0 A;  3B7X A;  3LUO A;  3AS0 A;  3KAG A;  1NH6 A;  3UQB A;  3CH9 A;  1QPF A;  3NTP A;  4DRK A;  1FAP A;  4DWS A;  1UR8 A;  4WJX A;  3MDY B;  5DIV A;  3BXW A;  2KFW A;  2WLY A;  3WD3 A;  3UI4 A;  1KFW A;  1WAW A;  4WIW A;  1LL4 A;  3CHC A;  4QIB A;  3PRB A;  2F2D A;  3JXV A;  3JYJ A;  1HJW A;  1O6I A;  3KAD A;  4W9P A;  4FN2 A;  1W1P A;  1NWT A;  4ZS6 A;  1ZK6 A;  4Z2H A;  2DG4 A;  3RFW A;  3CHE A;  1EYM A;  3G6M A;  1GPF A;  1HJX A;  1ZCN A;  1FJD A;  1B6C A;  4HBE A;  4WKA A;  3UF8 A;  4MSP A;  2OFN A;  3TDB A;  1K9T A;  2O92 A;  1HKM A;  4ZPT R;  4DRM A;  3JYM A;  1FKG A;  2JZV A;  2RUQ A;  1TFV A;  1Q1C A;  1BL4 A;  4GGQ A;  1W9P A;  5HW6 A;  1ZL1 A;  1SYT A;  1SR0 A;  1GOI A;  1ROT A;  4P8X A;  1NMW A;  5BXJ A;  2QF8 A;  4JFJ A;  2MLY A;  2MF9 A;  4MNK A;  3O5Q A;  4TW6 A;  4R0X A;  1W9V A;  4W9O A;  3O5O A;  2F4E A;  5HT1 A;  4ZPW R;  4Z2K A;  5DO2 A;  3IHZ A;  4TW8 A;  3CZ8 A;  1OWQ A;  3ARW A;  3WIJ A;  2ZR4 A;  5HUA A;  4Z2J A;  1J4R A;  4IQC A;  2RQS A;  2M1I A;  3O5R A;  3O5J A;  4U85 A;  3PA7 A;  4MTV A;  3O5I A;  2G41 A;  1A7X A;  2KR7 A;  2XP6 A;  2RSE A;  3ARS A;  2O9O A;  1D7I A;  4Q7N A;  4JFL A;  3ARY A;  4QT2 A;  4AY1 A;  4DWS D;  3O5D A;  5HTG A;  4DRO A;  1FKR A;  3G6L A;  2PI6 A;  1ZBV A;  1YAT A;  1EDQ A;  2XPB A;  3B9D A;  2DT2 A;  1FKJ A;  3OA5 A;  2ITK A;  3B9E A;  1M5Y A;  2ZR6 A;  4MNJ A;  2AWG A;  3PR9 A;  1NWU A;  1D2K A;  3AS2 A;  5HW7 A;  4NSB A;  1RD6 A;  3CGN A;  4ITZ A;  4ODK A;  3ALG A;  2IUZ A;  2M2A A;  1R9H A;  2DSV A;  4PTM A;  1FFQ A;  3GPK A;  1FKS A;  1L1P A;  1FKF A;  4DRN A;  2N87 A;  4S3J A;  2XP5 A;  2LGO A;  3KAC A;  4DRI A;  1D7H A;  4KR0 B;  4WK9 A;  4WKH A;  4ZPV R;  2DSW A;  3B9A A;  4TNS A;  3PRA A;  1GUV A;  3NRK A;  4ODM A;  3VAW A;  1X6L A;  4GIV A;  4LAW A;  3ALF A;  3OOB A;  2ESC A;  2RUC A;  2PV2 A;  3RGC A;  4IT6 A;  1VF8 A;  1QPL A;  2B31 A;  3IK8 A;  3PRD A;  3QOK A;  3ARP A;  1NMV A;  4IQ2 A;  3WQW A;  1Y0O A;  4ODQ A;  5HWB A;  4HBO A;  2LPV A;  4DRP A;  1Q6H A;  4IPX A;  4LAV A;  3WL1 A;  1H0I A;  3IKD A;  3IKG A;  2Y78 A;  4NNR A;  1IX5 A;  4DZ3 A;  4L72 B;  1HKI A;  1J4I A;  1HKJ A;  2FAP A;  4URI A;  2DT3 A;  5DEZ A;  1W9U A;  1PIN A;  1OGG A;  1JNE A;  3O5M A;  3O5G A;  4Z2G A;  1HKK A;  2WM0 A;  1W26 A;  2DG3 A;  2MNT A;  2VN1 A;  3O5E A;  2LJ4 A;  3WD2 A;  4TW7 A;  3TCZ A;  3O5P A;  5I98 A;  5HKG A;  2PPP A;  1FKH A;  4MNL A;  3UI5 A;  3KAI A;  3EY6 A;  3O5F A;  4U86 A;  2PPO A;  1NSG A;  2DPE A;  1E6P A;  2DSZ A;  2KGJ A;  2KO7 A;  2MLZ A;  4JFK A;  4U84 A;  4J4N A;  1QZ2 A;  4QT3 A;  4W9Q A;  2F21 A;  2XP3 A;  1F40 A;  4ODO A;  3KAB A;  1KT1 A;  3ARZ A;  4N19 A;  4P8U A;  1N1A A;  1UR9 A;  2A3C A;  3ART A;  4ODN A;  1Q6I A;  2UZ5 A;  1ZBW A;  3NI6 A;  1WNO A;  2OLH A;  3ARQ A;  2PV1 A;  2ZQV A;  4TX0 A;  4Z2L A;  1E6Z A;  2KI3 A;  5JH8 A;  4BF8 A;  1FKK A;  4DRQ A;  3CHF A;  1D6O A;  3KZ7 A;  5HW8 A;  3UQA A;  4JFM A;  4DH0 A;  3ARR A;  3AQU A;  1ZBC A;  5DF0 A;  4LAX A;  2PV3 A;  2WK2 A;  2XP7 A;  1F8A B;  3WD0 A;  4MPK A;  2MLX A;  2A3E A;  1JNT A;  3B8S A;  2Q5A A;  4Q22 A;  4Z2I A;  5HWC A;  1LL6 A;  1FKD A;  3I6C A;  2G8Z A;  3WD1 A;  3ARU A;  3ARX A;  5GQB A;  4XAK A;  3WH0 A;  4DIP A;  3O5L A;  1WB0 A;  1XRV A;  1ROU A;  2ZQS A;  4TYO A;  3RM9 A;  1EIB A;  1FKI A;  4ODR A;  4JYS A;  2XP8 A;  2FKE A;  4FAP A;  2RUD A;  1FFR A;  2D9F A;  3W4R A;  3WQV A;  4DWS C;  1FKB A;  1HJV A;  1ITX A;  1LQ0 A;  3KAH A;  1LG1 A;  2KE0 A;  2RUR A;  5DIU A;  1J6Y A;  1FKL A;  4HAR A;  3FAP A;  1JND A;  2DT0 A;  1EQ3 A;  3AS1 A;  1FKT A;  1ZB5 A;  3KAF A;  2L2S A;  1E15 A;  2VCD A;  3WL0 A;  1LJY A;  4DZ2 A;  2ZR5 A;  4ML4 A;  4DRH A;  4ODP A;  1X6N A;  4MGV A;  3ARO A;  2YBU A;  1E6N A;  5J6E A;  3UI6 A;  2DSU A;  2XPA A;  4LAY A;  1PBK A;  4WKF A;  1J4H A;  2PPN A;  2ZQT A;  2M08 A;  3FY1 A;  2WLZ A;  3UQI A;  2AOS A;  1CTN A;  4W5U A;  4QZV B;  2ZQU A;  1TCO C;  5D75 A;  1ZU8 A;  4NZC A;  4DT4 A;  4ODL A;  1JNS A;  3RM8 A;  4MNM A;  2MPH A;  1LG2 A;  2FDM A;  4R5E A;  2XP9 A;  1FD9 A;  3KCE A;  1NWR A;  1HXV A;  4DRJ A;  1ZBK A;  3FXY A;  1E6R A;  1LL7 A;  4O2T A;  1T11 A;  1W1T A;  4P8V A;  1JVW A;  1H0G A;  3ODK A;  4J4O A;  2A3B A;  1XHG A;  3H9R B;  3WKZ A;  1Q6U A;  1W1V A;  4IT4 A;  3RME A;  5B8I C;  1U79 A;  4JFI A;  1C9H A;  1OGB A;  2A3A A;  2XP4 A;  3ARV A;  1P5Q A;  1EHN A;  3AS3 A;  2DG9 A;  4KQZ A;  3O5K A;  2DT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...