2RUQA

Solution structure of human pin1 ppiase mutant c113a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
GSHMEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDASSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Allosteric Breakage of the Hydrogen Bond within the Dual-Histidine Motif in the Active Site of Human Pin1 PPIase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 31
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ruqA00
3KACA 3EY6A 1P5QA 2MLZA 3LUOA 3O5KA 3RGCA 3WH0A 2RUCA 3O5FA 4FN2A 5I98A 4TW6A 1FKTA 1FJDA 2PV1A 3NI6A 4TX0A 5HUAA 3O5DA 3O5MA 4JFMA 2MLYA 1QPFA 2PPNA 4JFJA 2M1IA 4IQCA 1FAPA 4LAXA 4QIBA 2VN1A 5DIUA 5B8IC 2KI3A 1B6CA 2F2DA 1FKHA 1D7JA 2PBCA 3KAFA 4R0XA 1EQ3A 1Q6HA 3CGMA 1NSGA 3JXVA 3O5PA 3O5RA 2MNTA 4GGQA 1FKKA 4QT3A 3PRBA 3TDBA 1A7XA 4U84A 1QPLA 3O5QA 3IHZA 4IPXA 5J6EA 1Q6IA 4DH0A 1L1PA 1W26A 1F8AB 1PBKA 3FAPA 3O5IA 3KADA 4JYSA 3CGNA 1M5YA 4MSPA 2RUQA 1F40A 1C9HA 4DT4A 3MDYB 4W9QA 4DRNA 1FKLA 3PRDA 4G2PA 2UZ5A 1N1AA 1R9HA 2PV3A 3UF8A 1FKDA 1JNTA 1KT1A 2RUDA 2XP4A 3NRKA 1YATA 5HW8A 4ODLA 3TCZA 4DZ2A 1Y0OA 1YW5A 2KE0A 4ITZA 4JFKA 1ZCNA 4DIPA 2KR7A 3H9RB 4TW7A 4DRQA 3UQIA 4IQ2A 1ROTA 4DRIA 1U79A 4ODPA 4DRJA 2PPPA 4O2TA 3I6CA 4DRMA 1FD9A 2LGOA 2XP7A 2PV2A 5BXJA 2FKEA 3O5JA 2XP8A 2XP9A 1FKGA 3KAHA 3GPKA 5HW6A 3UI6A 3RFWA 5HT1A 3UI4A 4G50A 1D7IA 1FKIA 1ZK6A 2Y78A 4JFLA 1FKRA 1FKSA 2FAPA 1J4IA 4N19A 2ZR4A 3O5GA 4LAYA 4TYOA 4DZ3A 4GIVA 1J4RA 4W9OA 3UQBA 2LKNA 2MLXA 5DIVA 4DRKA 3JYJA 2RSEA 1HXVA 4ODKA 5HW7A 4TNSA 5HWCA 2M08A 2L2SA 4W9PA 2KGJA 2DG3A 4U86A 2M2AA 2KO7A 2N87A 2RQSA 4LAWA 4TW8A 2LJ4A 4MGVA 2ZR5A 2AWGA 1FKFA 2DG4A 2ITKA 2ZQSA 3KCEA 3O5LA 2XP5A 2XPAA 1KT0A 1T11A 3KABA 2ZR6A 2D9FA 4BF8A 1JNSA 1BL4A 4C02B 2RURA 5HTGA 1Q6UA 1J4HA 5D75A 3TC5A 4J4OA 4FAPA 1EYMA 2LPVA 3VAWA 1FKJA 4ODNA 3ODKA 2MPHA 2ZQUA 1NMWA 1Q1CA 2DG9A 2F21A 2XP6A 2KFWA 2XP3A 3JYMA 3IK8A 2K8IA 2XPBA 5HKGA 2MF9A 2VCDA 2Q5AA 3KZ7A 4DRHA 3KAGA 1TCOC 4ODQA 1NMVA 3PA7A 3IKGA 4JFIA 3UQAA 2PPOA 3IKDA 1QZ2A 5GPGA 5HWBA 4NNRA 1ROUA 4ODMA 1J6YA 2JZVA 3OOBA 1D6OA 5DITA 4U85A 3NTPA 4ODRA 4DROA 1D7HA 3UI5A 1JVWA 3O5OA 3KAIA 1FKBA 3O5EA 3B7XA 1PINA 2F4EA 2OFNA 4DRPA 4QT2A 1BKFA 2IF4A 2ZQVA 4J4NA 4LAVA 2ZQTA 4ODOA
chains in the Genus database with same CATH superfamily
3RGCA 3O5FA 4TW6A 3BMBA 1OGBA 2MLYA 2M1IA 1FAPA 2KI3A 5GPRA 2F2DA 4R0XA 1D7JA 1Q6HA 2P4VA 4ML4A 1FFQA 3AS2A 1FKKA 1OGGA 3PRBA 1HJVA 3O5QA 1LL4A 5HBFA 4Z2IA 3CHEA 3CGNA 3ARRA 3QOKA 1GPFA 1C9HA 4Z2JA 3CH9A 4W9QA 4DRNA 4Z2GA 1JCHB 1KFWA 2A3EA 5HW8A 3WD4A 1TFVA 1YW5A 1ZCNA 4XAKA 5DEZA 3ARUA 1W9UA 3UQIA 1ZBWA 3FY1A 4ODPA 2XP7A 2PV2A 2FKEA 3O5JA 2XP9A 3GPKA 3RFWA 1NH6A 3UI4A 2DSZA 4W9OA 1O6IA 4P8VA 4DRKA 4ODKA 1ITXA 1E6RA 3G6MA 1LG2A 1EHNA 2RQSA 2LJ4A 1NWRA 4LGXA 2ZR5A 2DG4A 1WNOA 4HBOA 2QF8A 5GQBA 1KT0A 1Q6UA 5D75A 3ARQA 3WQWA 4ODNA 4U85A 4KR0B 2WLYA 2Q5AA 1E6ZA 4ODQA 4JFIA 3UQAA 2PPOA 2DPEA 5GPGA 3RM8A 2JZVA 2OLHA 2ESCA 1W9PA 1JVWA 3O5OA 2ZQVA 1E6NA 3BXWA 4S3JA 1ZBVA 2ZQTA 1ZB5A 4J4OA 4ODOA 1OWQA 4Z2LA 3KACA 3EY6A 3WH0A 4FN2A 3CHFA 2PV1A 3NI6A 5HUAA 1QPFA 2DT3A 4ZPVR 3GU0A 4ZPTR 1EQ3A 2PBCA 4R5EA 2MNTA 4UDMA 1XRVA 4QT3A 3TDBA 1W1YA 4MNKA 4U84A 1WAWA 4MNJA 4QZVB 4S3KA 2A3BA 4IPXA 1L1PA 3FAPA 1M5YA 2RUQA 4MAVA 4L3NA 1RD6A 2G41A 3PRDA 4G2PA 2PI6A 3AS1A 2PV3A 1JNTA 2RUDA 2XP4A 4AY1A 1HKJA 1YATA 4ODLA 1Y0OA 4JFKA 2KE0A 2WM0A 2KR7A 4TW7A 1ROTA 1WB0A 4DRIA 3ALFA 3WL0A 4DRJA 3GTYX 3I6CA 1HKKA 2O92A 3WKZA 3ARPA 4NSBA 4NZCA 1ZK6A 1ZL1A 1LJYA 4HBEA 4TYOA 4GIVA 1J4RA 4IT6A 2RSEA 5HW7A 5HWCA 2M2AA 4DWSC 2N87A 1LL7A 4Q7NA 2ZQSA 3KCEA 2XPAA 3KABA 1T11A 1GUVA 1GRJA 1JNSA 4C02B 4Q22A 3WL1A 3B9EA 1LL6A 3AS0A 1XHGA 1JNEA 1Q1CA 2DG9A 2F21A 2K8IA 3OA5A 3ARVA 2FDMA 3ARZA 2MF9A 3KZ7A 3KAGA 1NMVA 3ALGA 1LQ0A 1QZ2A 5HWBA 1D6OA 5DITA 4ODRA 2YBUA 3KAIA 1FKBA 4QT2A 4Z2HA 2B5UB 4J4NA 4TW8A 2MLZA 3O5KA 1D2KA 3ARXA 5I98A 1FJDA 4TX0A 3O5DA 1VF8A 3ARYA 3CZ8A 4LAXA 4QIBA 3ARSA 5DIUA 4MNLA 5B8IC 1B6CA 3O5PA 2G8ZA 3RM9A 1A7XA 1UR8A 1NWUA 2AOSA 2O9OA 1SR0A 1ZBCA 5J6EA 1Q6IA 4DH0A 2DT1A 1F8AB 3O5IA 4MSPA 1F40A 4DWSB 5JH8A 1N1AA 1R9HA 3UF8A 3NRKA 1KT1A 2B31A 4DZ2A 3H9RB 4L72B 5DF0A 3FXYA 2DT0A 4DRMA 4ZS6A 2XP8A 1FKGA 2A3AA 5HW6A 3PRAA 1K9TA 3WD0A 4G50A 1D7IA 2FAPA 1JNDA 1J4IA 4N19A 3O5GA 4WIWA 1LG1A 2LKNA 2MLXA 5DIVA 3WQVA 4TNSA 3PR9A 2M08A 4W9PA 2DG3A 2KO7A 4PTMA 3AQUA 1HKMA 3RM4A 3RMEA 2AWGA 1HJWA 2DSVA 3W4RA 1FKFA 3O5LA 4Z2KA 4BF8A 1BL4A 1H0GA 2RURA 1UR9A 5HTGA 1ZBKA 1J4HA 3TC5A 2WK2A 1EYMA 2ETNA 3VAWA 1FKJA 4DRHA 2MPHA 3JYMA 3IK8A 4MPKA 2VCDA 3EIPA 3PA7A 4WK9A 1ROUA 3OOBA 2IUZA 4DROA 2DSWA 4WKAA 3UI5A 4DRPA 3O5EA 3WD1A 1PINA 1P5QA 3LUOA 4DWSD 2RUCA 1HKIA 4WJXA 1W1TA 1FKTA 1CTNA 3O5MA 4JFMA 2PPNA 4JFJA 4IQCA 2VN1A 3KAFA 1FKHA 3CGMA 1NSGA 3JXVA 3O5RA 4GGQA 5DO2A 1QPLA 1SYTA 3B9AA 4WKHA 2A3CA 4W5UA 2EULA 3IHZA 1W1VA 1W26A 1PBKA 4JYSA 3KADA 1W9VA 4DT4A 3MDYB 3B8SA 1FKLA 2UZ5A 3G6LA 3ARTA 1FKDA 3TCZA 3WIJA 4ITZA 1W1PA 4P8WA 1X6LA 4DIPA 1HJXA 4DRQA 1EIBA 4IQ2A 1U79A 1E44A 2PPPA 4O2TA 1FD9A 2LGOA 2PN0A 5BXJA 3KAHA 1E15A 3UI6A 5HT1A 4ZPWR 2Y78A 1FKIA 1X6NA 4MNMA 2DSUA 4JFLA 1FKRA 1FKSA 1NWSA 2ZR4A 4DZ3A 4LAYA 3CHDA 3UQBA 3CHCA 3JYJA 1HXVA 1GOIA 2YBTA 1EDQA 1H0IA 2L2SA 4HARA 2KGJA 4U86A 3WD2A 4LAWA 3B9DA 4MGVA 4IT4A 1E9LA 3WD3A 2F23A 2ITKA 1FFRA 2XP5A 2ZR6A 2D9FA 3AROA 4P8UA 4FAPA 2LPVA 4DWSA 3AS3A 1IX5A 2DT2A 3ODKA 2ZQUA 1NMWA 2XP6A 2KFWA 2XP3A 4P8XA 4MTVA 1E6PA 2XPBA 4URIA 5HKGA 1TCOC 3IKGA 3ARWA 4KQZA 3IKDA 4NNRA 4ODMA 1J6YA 4WKFA 1ZU8A 3NTPA 1D7HA 2WLZA 3B7XA 2OFNA 2F4EA 1BKFA 2IF4A 4LAVA 1NWTA
chains in the Genus database with same CATH topology
3RGCA 3O5FA 4TW6A 1OGBA 2MLYA 2M1IA 1FAPA 2KI3A 5GPRA 2F2DA 4R0XA 1D7JA 1Q6HA 4ML4A 1FFQA 3AS2A 1FKKA 1OGGA 3PRBA 1HJVA 3O5QA 1LL4A 5HBFA 4Z2IA 3CHEA 3CGNA 3ARRA 3QOKA 1GPFA 1C9HA 4Z2JA 3CH9A 4W9QA 4DRNA 4Z2GA 1KFWA 2A3EA 5HW8A 3WD4A 1TFVA 1YW5A 1ZCNA 4XAKA 5DEZA 3ARUA 1W9UA 3UQIA 1ZBWA 3FY1A 4ODPA 2XP7A 2PV2A 2FKEA 3O5JA 2XP9A 3GPKA 3RFWA 1NH6A 3UI4A 2DSZA 4W9OA 1O6IA 4P8VA 4DRKA 4ODKA 1ITXA 1E6RA 3G6MA 1LG2A 1EHNA 2RQSA 2LJ4A 1NWRA 4LGXA 2ZR5A 2DG4A 1WNOA 4HBOA 2QF8A 5GQBA 1KT0A 1Q6UA 5D75A 3ARQA 3WQWA 4ODNA 4U85A 4KR0B 2WLYA 2Q5AA 1E6ZA 4ODQA 4JFIA 3UQAA 2PPOA 2DPEA 5GPGA 3RM8A 2JZVA 2OLHA 2ESCA 1W9PA 1JVWA 3O5OA 2ZQVA 1E6NA 3BXWA 4S3JA 1ZBVA 2ZQTA 1ZB5A 4J4OA 4ODOA 1OWQA 4Z2LA 3KACA 3EY6A 3WH0A 4FN2A 3CHFA 2PV1A 3NI6A 5HUAA 1QPFA 2DT3A 4ZPVR 4ZPTR 1EQ3A 2PBCA 4R5EA 2MNTA 1XRVA 4QT3A 3TDBA 1W1YA 4MNKA 4U84A 1WAWA 4MNJA 4QZVB 4S3KA 2A3BA 4IPXA 1L1PA 3FAPA 1M5YA 2RUQA 4MAVA 4L3NA 1RD6A 2G41A 3PRDA 4G2PA 2PI6A 3AS1A 2PV3A 1JNTA 2RUDA 2XP4A 4AY1A 1HKJA 1YATA 4ODLA 1Y0OA 4JFKA 2KE0A 2WM0A 2KR7A 4TW7A 1ROTA 1WB0A 4DRIA 3ALFA 3WL0A 4DRJA 3I6CA 1HKKA 2O92A 3WKZA 3ARPA 4NSBA 4NZCA 1ZK6A 1ZL1A 1LJYA 4HBEA 4TYOA 4GIVA 1J4RA 4IT6A 2RSEA 5HW7A 5HWCA 2M2AA 4DWSC 2N87A 1LL7A 4Q7NA 2ZQSA 3KCEA 2XPAA 3KABA 1T11A 1GUVA 1JNSA 4C02B 4Q22A 3WL1A 3B9EA 1LL6A 3AS0A 1XHGA 1JNEA 1Q1CA 2DG9A 2F21A 2K8IA 3OA5A 3ARVA 2FDMA 3ARZA 2MF9A 3KZ7A 3KAGA 1NMVA 3ALGA 1LQ0A 1QZ2A 5HWBA 1D6OA 5DITA 4ODRA 2YBUA 3KAIA 1FKBA 4QT2A 4Z2HA 4J4NA 4TW8A 2MLZA 3O5KA 1D2KA 3ARXA 5I98A 1FJDA 4TX0A 3O5DA 1VF8A 3ARYA 3CZ8A 4LAXA 4QIBA 3ARSA 5DIUA 4MNLA 5B8IC 1B6CA 3O5PA 2G8ZA 3RM9A 1A7XA 1UR8A 1NWUA 2AOSA 2O9OA 1SR0A 1ZBCA 5J6EA 1Q6IA 4DH0A 2DT1A 1F8AB 3O5IA 4MSPA 1F40A 4DWSB 5JH8A 1N1AA 1R9HA 3UF8A 3NRKA 1KT1A 2B31A 4DZ2A 3H9RB 4L72B 5DF0A 3FXYA 2DT0A 4DRMA 4ZS6A 2XP8A 1FKGA 2A3AA 5HW6A 3PRAA 1K9TA 3WD0A 4G50A 1D7IA 2FAPA 1JNDA 1J4IA 4N19A 3O5GA 4WIWA 1LG1A 2LKNA 2MLXA 5DIVA 3WQVA 4TNSA 3PR9A 2M08A 4W9PA 2DG3A 2KO7A 4PTMA 3AQUA 1HKMA 3RM4A 3RMEA 2AWGA 1HJWA 2DSVA 3W4RA 1FKFA 3O5LA 4Z2KA 4BF8A 1BL4A 1H0GA 2RURA 1UR9A 5HTGA 1ZBKA 1J4HA 3TC5A 2WK2A 1EYMA 3VAWA 1FKJA 4DRHA 2MPHA 3JYMA 3IK8A 4MPKA 2VCDA 3PA7A 4WK9A 1ROUA 3OOBA 2IUZA 4DROA 2DSWA 4WKAA 3UI5A 4DRPA 3O5EA 3WD1A 1PINA 1P5QA 3LUOA 4DWSD 2RUCA 1HKIA 4WJXA 1W1TA 1FKTA 1CTNA 3O5MA 4JFMA 2PPNA 4JFJA 4IQCA 2VN1A 3KAFA 1FKHA 3CGMA 1NSGA 3JXVA 3O5RA 4GGQA 5DO2A 1QPLA 1SYTA 3B9AA 4WKHA 2A3CA 4W5UA 3IHZA 1W1VA 1W26A 1PBKA 4JYSA 3KADA 1W9VA 4DT4A 3MDYB 3B8SA 1FKLA 2UZ5A 3G6LA 3ARTA 1FKDA 3TCZA 3WIJA 4ITZA 1W1PA 4P8WA 1X6LA 4DIPA 1HJXA 4DRQA 1EIBA 4IQ2A 1U79A 2PPPA 4O2TA 1FD9A 2LGOA 5BXJA 3KAHA 1E15A 3UI6A 5HT1A 4ZPWR 2Y78A 1FKIA 1X6NA 4MNMA 2DSUA 4JFLA 1FKRA 1FKSA 1NWSA 2ZR4A 4DZ3A 4LAYA 3CHDA 3UQBA 3CHCA 3JYJA 1HXVA 1GOIA 2YBTA 1EDQA 1H0IA 2L2SA 4HARA 2KGJA 4U86A 3WD2A 4LAWA 3B9DA 4MGVA 4IT4A 1E9LA 3WD3A 2ITKA 1FFRA 2XP5A 2ZR6A 2D9FA 3AROA 4P8UA 4FAPA 2LPVA 4DWSA 3AS3A 1IX5A 2DT2A 3ODKA 2ZQUA 1NMWA 2XP6A 2KFWA 2XP3A 4P8XA 4MTVA 1E6PA 2XPBA 4URIA 5HKGA 1TCOC 3IKGA 3ARWA 4KQZA 3IKDA 4NNRA 4ODMA 1J6YA 4WKFA 1ZU8A 3NTPA 1D7HA 2WLZA 3B7XA 2OFNA 2F4EA 1BKFA 2IF4A 4LAVA 1NWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAC A;  3EY6 A;  1P5Q A;  2MLZ A;  3LUO A;  3O5K A;  3RGC A;  3WH0 A;  2RUC A;  3O5F A;  4FN2 A;  5I98 A;  4TW6 A;  1FKT A;  1FJD A;  2PV1 A;  3NI6 A;  4TX0 A;  5HUA A;  3O5D A;  3O5M A;  4JFM A;  2MLY A;  1QPF A;  2PPN A;  4JFJ A;  2M1I A;  4IQC A;  1FAP A;  4LAX A;  4QIB A;  2VN1 A;  5DIU A;  5B8I C;  2KI3 A;  1B6C A;  2F2D A;  1FKH A;  1D7J A;  2PBC A;  3KAF A;  4R0X A;  1EQ3 A;  1Q6H A;  3CGM A;  1NSG A;  3JXV A;  3O5P A;  3O5R A;  2MNT A;  4GGQ A;  1FKK A;  4QT3 A;  3PRB A;  3TDB A;  1A7X A;  4U84 A;  1QPL A;  3O5Q A;  3IHZ A;  4IPX A;  5J6E A;  1Q6I A;  4DH0 A;  1L1P A;  1W26 A;  1F8A B;  1PBK A;  3FAP A;  3O5I A;  3KAD A;  4JYS A;  3CGN A;  1M5Y A;  4MSP A;  2RUQ A;  1F40 A;  1C9H A;  4DT4 A;  3MDY B;  4W9Q A;  4DRN A;  1FKL A;  3PRD A;  4G2P A;  2UZ5 A;  1N1A A;  1R9H A;  2PV3 A;  3UF8 A;  1FKD A;  1JNT A;  1KT1 A;  2RUD A;  2XP4 A;  3NRK A;  1YAT A;  5HW8 A;  4ODL A;  3TCZ A;  4DZ2 A;  1Y0O A;  1YW5 A;  2KE0 A;  4ITZ A;  4JFK A;  1ZCN A;  4DIP A;  2KR7 A;  3H9R B;  4TW7 A;  4DRQ A;  3UQI A;  4IQ2 A;  1ROT A;  4DRI A;  1U79 A;  4ODP A;  4DRJ A;  2PPP A;  4O2T A;  3I6C A;  4DRM A;  1FD9 A;  2LGO A;  2XP7 A;  2PV2 A;  5BXJ A;  2FKE A;  3O5J A;  2XP8 A;  2XP9 A;  1FKG A;  3KAH A;  3GPK A;  5HW6 A;  3UI6 A;  3RFW A;  5HT1 A;  3UI4 A;  4G50 A;  1D7I A;  1FKI A;  1ZK6 A;  2Y78 A;  4JFL A;  1FKR A;  1FKS A;  2FAP A;  1J4I A;  4N19 A;  2ZR4 A;  3O5G A;  4LAY A;  4TYO A;  4DZ3 A;  4GIV A;  1J4R A;  4W9O A;  3UQB A;  2LKN A;  2MLX A;  5DIV A;  4DRK A;  3JYJ A;  2RSE A;  1HXV A;  4ODK A;  5HW7 A;  4TNS A;  5HWC A;  2M08 A;  2L2S A;  4W9P A;  2KGJ A;  2DG3 A;  4U86 A;  2M2A A;  2KO7 A;  2N87 A;  2RQS A;  4LAW A;  4TW8 A;  2LJ4 A;  4MGV A;  2ZR5 A;  2AWG A;  1FKF A;  2DG4 A;  2ITK A;  2ZQS A;  3KCE A;  3O5L A;  2XP5 A;  2XPA A;  1KT0 A;  1T11 A;  3KAB A;  2ZR6 A;  2D9F A;  4BF8 A;  1JNS A;  1BL4 A;  4C02 B;  2RUR A;  5HTG A;  1Q6U A;  1J4H A;  5D75 A;  3TC5 A;  4J4O A;  4FAP A;  1EYM A;  2LPV A;  3VAW A;  1FKJ A;  4ODN A;  3ODK A;  2MPH A;  2ZQU A;  1NMW A;  1Q1C A;  2DG9 A;  2F21 A;  2XP6 A;  2KFW A;  2XP3 A;  3JYM A;  3IK8 A;  2K8I A;  2XPB A;  5HKG A;  2MF9 A;  2VCD A;  2Q5A A;  3KZ7 A;  4DRH A;  3KAG A;  1TCO C;  4ODQ A;  1NMV A;  3PA7 A;  3IKG A;  4JFI A;  3UQA A;  2PPO A;  3IKD A;  1QZ2 A;  5GPG A;  5HWB A;  4NNR A;  1ROU A;  4ODM A;  1J6Y A;  2JZV A;  3OOB A;  1D6O A;  5DIT A;  4U85 A;  3NTP A;  4ODR A;  4DRO A;  1D7H A;  3UI5 A;  1JVW A;  3O5O A;  3KAI A;  1FKB A;  3O5E A;  3B7X A;  1PIN A;  2F4E A;  2OFN A;  4DRP A;  4QT2 A;  1BKF A;  2IF4 A;  2ZQV A;  4J4N A;  4LAV A;  2ZQT A;  4ODO A; 
#chains in the Genus database with same CATH topology
 3RGC A;  3O5F A;  4TW6 A;  3BMB A;  1OGB A;  2MLY A;  2M1I A;  1FAP A;  2KI3 A;  5GPR A;  2F2D A;  4R0X A;  1D7J A;  1Q6H A;  2P4V A;  4ML4 A;  1FFQ A;  3AS2 A;  1FKK A;  1OGG A;  3PRB A;  1HJV A;  3O5Q A;  1LL4 A;  5HBF A;  4Z2I A;  3CHE A;  3CGN A;  3ARR A;  3QOK A;  1GPF A;  1C9H A;  4Z2J A;  3CH9 A;  4W9Q A;  4DRN A;  4Z2G A;  1JCH B;  1KFW A;  2A3E A;  5HW8 A;  3WD4 A;  1TFV A;  1YW5 A;  1ZCN A;  4XAK A;  5DEZ A;  3ARU A;  1W9U A;  3UQI A;  1ZBW A;  3FY1 A;  4ODP A;  2XP7 A;  2PV2 A;  2FKE A;  3O5J A;  2XP9 A;  3GPK A;  3RFW A;  1NH6 A;  3UI4 A;  2DSZ A;  4W9O A;  1O6I A;  4P8V A;  4DRK A;  4ODK A;  1ITX A;  1E6R A;  3G6M A;  1LG2 A;  1EHN A;  2RQS A;  2LJ4 A;  1NWR A;  4LGX A;  2ZR5 A;  2DG4 A;  1WNO A;  4HBO A;  2QF8 A;  5GQB A;  1KT0 A;  1Q6U A;  5D75 A;  3ARQ A;  3WQW A;  4ODN A;  4U85 A;  4KR0 B;  2WLY A;  2Q5A A;  1E6Z A;  4ODQ A;  4JFI A;  3UQA A;  2PPO A;  2DPE A;  5GPG A;  3RM8 A;  2JZV A;  2OLH A;  2ESC A;  1W9P A;  1JVW A;  3O5O A;  2ZQV A;  1E6N A;  3BXW A;  4S3J A;  1ZBV A;  2ZQT A;  1ZB5 A;  4J4O A;  4ODO A;  1OWQ A;  4Z2L A;  3KAC A;  3EY6 A;  3WH0 A;  4FN2 A;  3CHF A;  2PV1 A;  3NI6 A;  5HUA A;  1QPF A;  2DT3 A;  4ZPV R;  3GU0 A;  4ZPT R;  1EQ3 A;  2PBC A;  4R5E A;  2MNT A;  4UDM A;  1XRV A;  4QT3 A;  3TDB A;  1W1Y A;  4MNK A;  4U84 A;  1WAW A;  4MNJ A;  4QZV B;  4S3K A;  2A3B A;  4IPX A;  1L1P A;  3FAP A;  1M5Y A;  2RUQ A;  4MAV A;  4L3N A;  1RD6 A;  2G41 A;  3PRD A;  4G2P A;  2PI6 A;  3AS1 A;  2PV3 A;  1JNT A;  2RUD A;  2XP4 A;  4AY1 A;  1HKJ A;  1YAT A;  4ODL A;  1Y0O A;  4JFK A;  2KE0 A;  2WM0 A;  2KR7 A;  4TW7 A;  1ROT A;  1WB0 A;  4DRI A;  3ALF A;  3WL0 A;  4DRJ A;  3GTY X;  3I6C A;  1HKK A;  2O92 A;  3WKZ A;  3ARP A;  4NSB A;  4NZC A;  1ZK6 A;  1ZL1 A;  1LJY A;  4HBE A;  4TYO A;  4GIV A;  1J4R A;  4IT6 A;  2RSE A;  5HW7 A;  5HWC A;  2M2A A;  4DWS C;  2N87 A;  1LL7 A;  4Q7N A;  2ZQS A;  3KCE A;  2XPA A;  3KAB A;  1T11 A;  1GUV A;  1GRJ A;  1JNS A;  4C02 B;  4Q22 A;  3WL1 A;  3B9E A;  1LL6 A;  3AS0 A;  1XHG A;  1JNE A;  1Q1C A;  2DG9 A;  2F21 A;  2K8I A;  3OA5 A;  3ARV A;  2FDM A;  3ARZ A;  2MF9 A;  3KZ7 A;  3KAG A;  1NMV A;  3ALG A;  1LQ0 A;  1QZ2 A;  5HWB A;  1D6O A;  5DIT A;  4ODR A;  2YBU A;  3KAI A;  1FKB A;  4QT2 A;  4Z2H A;  2B5U B;  4J4N A;  4TW8 A;  2MLZ A;  3O5K A;  1D2K A;  3ARX A;  5I98 A;  1FJD A;  4TX0 A;  3O5D A;  1VF8 A;  3ARY A;  3CZ8 A;  4LAX A;  4QIB A;  3ARS A;  5DIU A;  4MNL A;  5B8I C;  1B6C A;  3O5P A;  2G8Z A;  3RM9 A;  1A7X A;  1UR8 A;  1NWU A;  2AOS A;  2O9O A;  1SR0 A;  1ZBC A;  5J6E A;  1Q6I A;  4DH0 A;  2DT1 A;  1F8A B;  3O5I A;  4MSP A;  1F40 A;  4DWS B;  5JH8 A;  1N1A A;  1R9H A;  3UF8 A;  3NRK A;  1KT1 A;  2B31 A;  4DZ2 A;  3H9R B;  4L72 B;  5DF0 A;  3FXY A;  2DT0 A;  4DRM A;  4ZS6 A;  2XP8 A;  1FKG A;  2A3A A;  5HW6 A;  3PRA A;  1K9T A;  3WD0 A;  4G50 A;  1D7I A;  2FAP A;  1JND A;  1J4I A;  4N19 A;  3O5G A;  4WIW A;  1LG1 A;  2LKN A;  2MLX A;  5DIV A;  3WQV A;  4TNS A;  3PR9 A;  2M08 A;  4W9P A;  2DG3 A;  2KO7 A;  4PTM A;  3AQU A;  1HKM A;  3RM4 A;  3RME A;  2AWG A;  1HJW A;  2DSV A;  3W4R A;  1FKF A;  3O5L A;  4Z2K A;  4BF8 A;  1BL4 A;  1H0G A;  2RUR A;  1UR9 A;  5HTG A;  1ZBK A;  1J4H A;  3TC5 A;  2WK2 A;  1EYM A;  2ETN A;  3VAW A;  1FKJ A;  4DRH A;  2MPH A;  3JYM A;  3IK8 A;  4MPK A;  2VCD A;  3EIP A;  3PA7 A;  4WK9 A;  1ROU A;  3OOB A;  2IUZ A;  4DRO A;  2DSW A;  4WKA A;  3UI5 A;  4DRP A;  3O5E A;  3WD1 A;  1PIN A;  1P5Q A;  3LUO A;  4DWS D;  2RUC A;  1HKI A;  4WJX A;  1W1T A;  1FKT A;  1CTN A;  3O5M A;  4JFM A;  2PPN A;  4JFJ A;  4IQC A;  2VN1 A;  3KAF A;  1FKH A;  3CGM A;  1NSG A;  3JXV A;  3O5R A;  4GGQ A;  5DO2 A;  1QPL A;  1SYT A;  3B9A A;  4WKH A;  2A3C A;  4W5U A;  2EUL A;  3IHZ A;  1W1V A;  1W26 A;  1PBK A;  4JYS A;  3KAD A;  1W9V A;  4DT4 A;  3MDY B;  3B8S A;  1FKL A;  2UZ5 A;  3G6L A;  3ART A;  1FKD A;  3TCZ A;  3WIJ A;  4ITZ A;  1W1P A;  4P8W A;  1X6L A;  4DIP A;  1HJX A;  4DRQ A;  1EIB A;  4IQ2 A;  1U79 A;  1E44 A;  2PPP A;  4O2T A;  1FD9 A;  2LGO A;  2PN0 A;  5BXJ A;  3KAH A;  1E15 A;  3UI6 A;  5HT1 A;  4ZPW R;  2Y78 A;  1FKI A;  1X6N A;  4MNM A;  2DSU A;  4JFL A;  1FKR A;  1FKS A;  1NWS A;  2ZR4 A;  4DZ3 A;  4LAY A;  3CHD A;  3UQB A;  3CHC A;  3JYJ A;  1HXV A;  1GOI A;  2YBT A;  1EDQ A;  1H0I A;  2L2S A;  4HAR A;  2KGJ A;  4U86 A;  3WD2 A;  4LAW A;  3B9D A;  4MGV A;  4IT4 A;  1E9L A;  3WD3 A;  2F23 A;  2ITK A;  1FFR A;  2XP5 A;  2ZR6 A;  2D9F A;  3ARO A;  4P8U A;  4FAP A;  2LPV A;  4DWS A;  3AS3 A;  1IX5 A;  2DT2 A;  3ODK A;  2ZQU A;  1NMW A;  2XP6 A;  2KFW A;  2XP3 A;  4P8X A;  4MTV A;  1E6P A;  2XPB A;  4URI A;  5HKG A;  1TCO C;  3IKG A;  3ARW A;  4KQZ A;  3IKD A;  4NNR A;  4ODM A;  1J6Y A;  4WKF A;  1ZU8 A;  3NTP A;  1D7H A;  2WLZ A;  3B7X A;  2OFN A;  2F4E A;  1BKF A;  2IF4 A;  4LAV A;  1NWT A; 
#chains in the Genus database with same CATH homology
 3RGC A;  3O5F A;  4TW6 A;  1OGB A;  2MLY A;  2M1I A;  1FAP A;  2KI3 A;  5GPR A;  2F2D A;  4R0X A;  1D7J A;  1Q6H A;  4ML4 A;  1FFQ A;  3AS2 A;  1FKK A;  1OGG A;  3PRB A;  1HJV A;  3O5Q A;  1LL4 A;  5HBF A;  4Z2I A;  3CHE A;  3CGN A;  3ARR A;  3QOK A;  1GPF A;  1C9H A;  4Z2J A;  3CH9 A;  4W9Q A;  4DRN A;  4Z2G A;  1KFW A;  2A3E A;  5HW8 A;  3WD4 A;  1TFV A;  1YW5 A;  1ZCN A;  4XAK A;  5DEZ A;  3ARU A;  1W9U A;  3UQI A;  1ZBW A;  3FY1 A;  4ODP A;  2XP7 A;  2PV2 A;  2FKE A;  3O5J A;  2XP9 A;  3GPK A;  3RFW A;  1NH6 A;  3UI4 A;  2DSZ A;  4W9O A;  1O6I A;  4P8V A;  4DRK A;  4ODK A;  1ITX A;  1E6R A;  3G6M A;  1LG2 A;  1EHN A;  2RQS A;  2LJ4 A;  1NWR A;  4LGX A;  2ZR5 A;  2DG4 A;  1WNO A;  4HBO A;  2QF8 A;  5GQB A;  1KT0 A;  1Q6U A;  5D75 A;  3ARQ A;  3WQW A;  4ODN A;  4U85 A;  4KR0 B;  2WLY A;  2Q5A A;  1E6Z A;  4ODQ A;  4JFI A;  3UQA A;  2PPO A;  2DPE A;  5GPG A;  3RM8 A;  2JZV A;  2OLH A;  2ESC A;  1W9P A;  1JVW A;  3O5O A;  2ZQV A;  1E6N A;  3BXW A;  4S3J A;  1ZBV A;  2ZQT A;  1ZB5 A;  4J4O A;  4ODO A;  1OWQ A;  4Z2L A;  3KAC A;  3EY6 A;  3WH0 A;  4FN2 A;  3CHF A;  2PV1 A;  3NI6 A;  5HUA A;  1QPF A;  2DT3 A;  4ZPV R;  4ZPT R;  1EQ3 A;  2PBC A;  4R5E A;  2MNT A;  1XRV A;  4QT3 A;  3TDB A;  1W1Y A;  4MNK A;  4U84 A;  1WAW A;  4MNJ A;  4QZV B;  4S3K A;  2A3B A;  4IPX A;  1L1P A;  3FAP A;  1M5Y A;  2RUQ A;  4MAV A;  4L3N A;  1RD6 A;  2G41 A;  3PRD A;  4G2P A;  2PI6 A;  3AS1 A;  2PV3 A;  1JNT A;  2RUD A;  2XP4 A;  4AY1 A;  1HKJ A;  1YAT A;  4ODL A;  1Y0O A;  4JFK A;  2KE0 A;  2WM0 A;  2KR7 A;  4TW7 A;  1ROT A;  1WB0 A;  4DRI A;  3ALF A;  3WL0 A;  4DRJ A;  3I6C A;  1HKK A;  2O92 A;  3WKZ A;  3ARP A;  4NSB A;  4NZC A;  1ZK6 A;  1ZL1 A;  1LJY A;  4HBE A;  4TYO A;  4GIV A;  1J4R A;  4IT6 A;  2RSE A;  5HW7 A;  5HWC A;  2M2A A;  4DWS C;  2N87 A;  1LL7 A;  4Q7N A;  2ZQS A;  3KCE A;  2XPA A;  3KAB A;  1T11 A;  1GUV A;  1JNS A;  4C02 B;  4Q22 A;  3WL1 A;  3B9E A;  1LL6 A;  3AS0 A;  1XHG A;  1JNE A;  1Q1C A;  2DG9 A;  2F21 A;  2K8I A;  3OA5 A;  3ARV A;  2FDM A;  3ARZ A;  2MF9 A;  3KZ7 A;  3KAG A;  1NMV A;  3ALG A;  1LQ0 A;  1QZ2 A;  5HWB A;  1D6O A;  5DIT A;  4ODR A;  2YBU A;  3KAI A;  1FKB A;  4QT2 A;  4Z2H A;  4J4N A;  4TW8 A;  2MLZ A;  3O5K A;  1D2K A;  3ARX A;  5I98 A;  1FJD A;  4TX0 A;  3O5D A;  1VF8 A;  3ARY A;  3CZ8 A;  4LAX A;  4QIB A;  3ARS A;  5DIU A;  4MNL A;  5B8I C;  1B6C A;  3O5P A;  2G8Z A;  3RM9 A;  1A7X A;  1UR8 A;  1NWU A;  2AOS A;  2O9O A;  1SR0 A;  1ZBC A;  5J6E A;  1Q6I A;  4DH0 A;  2DT1 A;  1F8A B;  3O5I A;  4MSP A;  1F40 A;  4DWS B;  5JH8 A;  1N1A A;  1R9H A;  3UF8 A;  3NRK A;  1KT1 A;  2B31 A;  4DZ2 A;  3H9R B;  4L72 B;  5DF0 A;  3FXY A;  2DT0 A;  4DRM A;  4ZS6 A;  2XP8 A;  1FKG A;  2A3A A;  5HW6 A;  3PRA A;  1K9T A;  3WD0 A;  4G50 A;  1D7I A;  2FAP A;  1JND A;  1J4I A;  4N19 A;  3O5G A;  4WIW A;  1LG1 A;  2LKN A;  2MLX A;  5DIV A;  3WQV A;  4TNS A;  3PR9 A;  2M08 A;  4W9P A;  2DG3 A;  2KO7 A;  4PTM A;  3AQU A;  1HKM A;  3RM4 A;  3RME A;  2AWG A;  1HJW A;  2DSV A;  3W4R A;  1FKF A;  3O5L A;  4Z2K A;  4BF8 A;  1BL4 A;  1H0G A;  2RUR A;  1UR9 A;  5HTG A;  1ZBK A;  1J4H A;  3TC5 A;  2WK2 A;  1EYM A;  3VAW A;  1FKJ A;  4DRH A;  2MPH A;  3JYM A;  3IK8 A;  4MPK A;  2VCD A;  3PA7 A;  4WK9 A;  1ROU A;  3OOB A;  2IUZ A;  4DRO A;  2DSW A;  4WKA A;  3UI5 A;  4DRP A;  3O5E A;  3WD1 A;  1PIN A;  1P5Q A;  3LUO A;  4DWS D;  2RUC A;  1HKI A;  4WJX A;  1W1T A;  1FKT A;  1CTN A;  3O5M A;  4JFM A;  2PPN A;  4JFJ A;  4IQC A;  2VN1 A;  3KAF A;  1FKH A;  3CGM A;  1NSG A;  3JXV A;  3O5R A;  4GGQ A;  5DO2 A;  1QPL A;  1SYT A;  3B9A A;  4WKH A;  2A3C A;  4W5U A;  3IHZ A;  1W1V A;  1W26 A;  1PBK A;  4JYS A;  3KAD A;  1W9V A;  4DT4 A;  3MDY B;  3B8S A;  1FKL A;  2UZ5 A;  3G6L A;  3ART A;  1FKD A;  3TCZ A;  3WIJ A;  4ITZ A;  1W1P A;  4P8W A;  1X6L A;  4DIP A;  1HJX A;  4DRQ A;  1EIB A;  4IQ2 A;  1U79 A;  2PPP A;  4O2T A;  1FD9 A;  2LGO A;  5BXJ A;  3KAH A;  1E15 A;  3UI6 A;  5HT1 A;  4ZPW R;  2Y78 A;  1FKI A;  1X6N A;  4MNM A;  2DSU A;  4JFL A;  1FKR A;  1FKS A;  1NWS A;  2ZR4 A;  4DZ3 A;  4LAY A;  3CHD A;  3UQB A;  3CHC A;  3JYJ A;  1HXV A;  1GOI A;  2YBT A;  1EDQ A;  1H0I A;  2L2S A;  4HAR A;  2KGJ A;  4U86 A;  3WD2 A;  4LAW A;  3B9D A;  4MGV A;  4IT4 A;  1E9L A;  3WD3 A;  2ITK A;  1FFR A;  2XP5 A;  2ZR6 A;  2D9F A;  3ARO A;  4P8U A;  4FAP A;  2LPV A;  4DWS A;  3AS3 A;  1IX5 A;  2DT2 A;  3ODK A;  2ZQU A;  1NMW A;  2XP6 A;  2KFW A;  2XP3 A;  4P8X A;  4MTV A;  1E6P A;  2XPB A;  4URI A;  5HKG A;  1TCO C;  3IKG A;  3ARW A;  4KQZ A;  3IKD A;  4NNR A;  4ODM A;  1J6Y A;  4WKF A;  1ZU8 A;  3NTP A;  1D7H A;  2WLZ A;  3B7X A;  2OFN A;  2F4E A;  1BKF A;  2IF4 A;  4LAV A;  1NWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...