2RUQA

Solution structure of human pin1 ppiase mutant c113a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
GSHMEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDASSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Allosteric Breakage of the Hydrogen Bond within the Dual-Histidine Motif in the Active Site of Human Pin1 PPIase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 31
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ruqA00
4ODKA 2PV2A 2LGOA 2ZQVA 5DIVA 2DG3A 4O2TA 1M5YA 5HKGA 4G50A 1W26A 4DROA 1FKHA 4TX0A 2RUCA 1ZCNA 2ZQUA 3JYMA 2KO7A 1J4HA 1FAPA 3PRDA 5D75A 1EYMA 4DH0A 1FKIA 4JFKA 1J4IA 5GPGA 2XPAA 1FKSA 2JZVA 5DIUA 1L1PA 3PRBA 5HW7A 4W9OA 4DRPA 2FAPA 2PBCA 4DT4A 1NSGA 3O5PA 3UI6A 4ODLA 1U79A 4C02B 2MPHA 4FAPA 1YATA 4NNRA 4DRMA 4ODRA 1Y0OA 3UI5A 1KT1A 1D7IA 3CGMA 4W9QA 3EY6A 4DRQA 2MF9A 4N19A 4TW7A 3NI6A 2ZR6A 3OOBA 1JNSA 1Q6UA 1JNTA 2RUQA 4LAWA 4TW6A 5HT1A 3UI4A 4DRIA 3O5EA 3B7XA 1QZ2A 4JFIA 4JYSA 3O5KA 4QT2A 1NMVA 2LPVA 4FN2A 2XP9A 2KE0A 3IKGA 2Q5AA 3KACA 2ZR5A 2KGJA 3O5DA 2IF4A 1FKKA 2XP6A 3VAWA 4QIBA 1BL4A 1D6OA 2RUDA 2Y78A 4TW8A 3NTPA 1Q1CA 1FKLA 5J6EA 2ITKA 2F4EA 2MLYA 4IQ2A 4MSPA 1FKTA 1FKGA 4IQCA 4J4OA 3UQBA 3ODKA 2XP8A 4ODMA 2RQSA 3KAGA 3UQIA 5DITA 1B6CA 4GIVA 2AWGA 2KFWA 1N1AA 2XP4A 4MGVA 4U84A 2K8IA 4R0XA 3TCZA 1T11A 3H9RB 3IKDA 4GGQA 4LAVA 2MNTA 2RURA 1FD9A 1HXVA 2VN1A 4J4NA 1NMWA 3TDBA 5HWBA 4ODNA 3O5MA 2PPOA 4JFJA 3UF8A 1BKFA 3JXVA 1YW5A 4DZ2A 2UZ5A 3IK8A 4W9PA 1JVWA 3MDYB 2M1IA 4TYOA 1Q6HA 1EQ3A 4ODQA 5HWCA 2PV1A 4JFMA 4U86A 1QPFA 3LUOA 2F21A 2KI3A 4BF8A 3UQAA 2M2AA 3KAIA 3O5LA 2MLXA 2KR7A 1PINA 1J4RA 3KAHA 3TC5A 4DIPA 5HW8A 1KT0A 3KCEA 2XP5A 3KAFA 2M08A 2RSEA 1F8AB 1Q6IA 4G2PA 1ZK6A 2FKEA 3O5GA 3O5QA 5HTGA 1FKRA 2XP3A 3KZ7A 5HW6A 3WH0A 1FKJA 2OFNA 4QT3A 4DZ3A 2PPPA 3O5OA 5HUAA 3GPKA 4DRNA 1P5QA 1F40A 2PV3A 3FAPA 3NRKA 4LAXA 4DRKA 2N87A 2ZR4A 3I6CA 2D9FA 4IPXA 2LKNA 3KABA 2DG4A 2ZQSA 2MLZA 3PA7A 2PPNA 1FKBA 1ROTA 2XPBA 5B8IC 2VCDA 1D7JA 3JYJA 4U85A 1ROUA 1A7XA 1D7HA 3O5RA 4LAYA 2XP7A 3O5FA 3CGNA 3O5IA 1TCOC 4ODOA 4DRHA 2L2SA 4TNSA 3O5JA 1J6YA 1FJDA 1R9HA 2F2DA 3KADA 1C9HA 1FKDA 3RGCA 4ITZA 5BXJA 5I98A 1PBKA 2LJ4A 4ODPA 3IHZA 1FKFA 4DRJA 1QPLA 4JFLA 3RFWA 2ZQTA 2DG9A
chains in the Genus database with same CATH superfamily
1XRVA 3WQWA 4O2TA 1M5YA 3WL1A 4G50A 5HKGA 2A3EA 1FFQA 2DT3A 1FAPA 1LQ0A 1ZBVA 2DSZA 5D75A 1EYMA 4WIWA 1FKIA 1ZBWA 1JNDA 5DEZA 1FKSA 1HJVA 3PRBA 1EHNA 4W9OA 4DRPA 2PBCA 1OWQA 4ODLA 4C02B 1Y0OA 1VF8A 4MNKA 4Q22A 1D7IA 3EY6A 3WD2A 4N19A 3WD0A 4TW7A 1JNSA 1Q6UA 4DRIA 4WKFA 1LG2A 3O5EA 2A3CA 3B7XA 4JYSA 4QT2A 1NMVA 4LGXA 3B9AA 3KACA 2IF4A 3VAWA 1W1YA 2Y78A 3NTPA 1Q1CA 2F4EA 4MSPA 1HJXA 4PTMA 3UQIA 5DITA 4GIVA 2AWGA 3H9RB 1NH6A 2VN1A 4J4NA 1NMWA 3WD4A 5HWBA 4ODNA 2O9OA 4DZ2A 2UZ5A 1CTNA 4DWSA 1Q6HA 4ODQA 5HWCA 4NSBA 4NZCA 2F21A 2KI3A 3B9DA 2G41A 2M2AA 3RM4A 1F8AB 1ZK6A 2FKEA 1FKRA 3RM8A 3CHFA 3GTYX 1FKJA 5HUAA 4DRNA 2N87A 2LKNA 1D7JA 1ROUA 4LAYA 1UR8A 4ODOA 1GRJA 2L2SA 3O5JA 5BXJA 3ARZA 1PBKA 3WD1A 1HJWA 3AQUA 1E9LA 4Z2IA 4MPKA 3CHEA 5DIVA 1WNOA 2EULA 1X6LA 1W1VA 2ZQUA 4MNJA 4MAVA 4JFKA 2XPAA 2JZVA 4KQZA 5HW7A 4MNLA 3ARSA 1NSGA 3O5PA 3UI6A 1YATA 4NNRA 4ODRA 3ARPA 1OGGA 5DO2A 3RM9A 1K9TA 4DWSD 3UI4A 5HT1A 1ZBCA 2DT2A 2DSVA 1QZ2A 4JFIA 1GPFA 4HBOA 4Z2HA 1FKGA 1GUVA 1H0GA 3ARUA 2KFWA 1E6ZA 1N1AA 2XP4A 4R0XA 3IKDA 4GGQA 1NWUA 3TDBA 3AROA 2PPOA 4JFJA 3UF8A 1BKFA 4Z2JA 1YW5A 3IK8A 3WKZA 3MDYB 1EQ3A 3AS0A 1HKJA 2PV1A 4JFMA 2YBUA 4P8WA 1PINA 1KT0A 4XAKA 4ZS6A 2XP5A 4G2PA 4KR0B 3CZ8A 4ZPTR 2DT1A 3EIPA 3OA5A 3CHCA 1H0IA 2PPPA 4QT3A 3GPKA 2PV3A 4LAXA 4IPXA 2OLHA 4TNSA 2A3BA 2ZQSA 3PR9A 3PA7A 1FKBA 1ROTA 2XPBA 3GU0A 5B8IC 3JYJA 4DWSC 1D7HA 1W1TA 3AS1A 4DRHA 1TCOC 1FJDA 2DSWA 2F2DA 1C9HA 4UDMA 3RGCA 5I98A 2O92A 5HBFA 4ODPA 1EDQA 3IHZA 1ZB5A 2P4VA 4DRJA 3ARQA 4JFLA 1EIBA 3RFWA 3PRAA 2DG9A 4ODKA 2PV2A 2LGOA 2ZQVA 2DG3A 4ZPWR 3W4RA 1KFWA 4DROA 1W26A 1FKHA 4TX0A 3WQVA 1ZCNA 2KO7A 3WIJA 1WAWA 3ARTA 1ZBKA 4AY1A 3FY1A 3ARWA 4S3KA 1E44A 2WLZA 5GPGA 5JH8A 1L1PA 1W9UA 1RD6A 4DT4A 3WD3A 4Q7NA 2MPHA 2B31A 4URIA 3UI5A 3CH9A 1KT1A 3RMEA 3CGMA 4W9QA 1LJYA 3NI6A 3OOBA 4MNMA 2RUQA 4LAWA 1ITXA 5GQBA 3O5KA 4FN2A 2XP9A 4P8VA 4QZVB 2KGJA 2PN0A 2QF8A 1BL4A 1FKLA 2MLYA 1FKTA 1LL6A 1GOIA 2XP8A 3ODKA 2RQSA 1HKIA 1T11A 4LAVA 1JNEA 1FD9A 1HXVA 1NWRA 3ALFA 3O5MA 1LL4A 3JXVA 1JVWA 4R5EA 2DPEA 1O6IA 3ARRA 4Z2KA 2PI6A 3AS2A 1UR9A 2YBTA 3BMBA 3LUOA 1XHGA 2AOSA 4BF8A 1E6PA 3KAIA 3O5LA 2MLXA 1J4RA 3KAHA 1HKKA 2F23A 4Z2LA 3KCEA 2WK2A 3KAFA 2G8ZA 1E15A 2M08A 1SYTA 2RSEA 4WKAA 4WKHA 2ESCA 5HTGA 2XP3A 1NWSA 5HW6A 1NWTA 2OFNA 4DZ3A 3O5OA 3BXWA 1P5QA 1F40A 3NRKA 4DRKA 4DH0A 4DRQA 3I6CA 2D9FA 3KABA 2A3AA 2DSUA 2PPNA 2VCDA 3O5RA 1A7XA 1TFVA 3CGNA 4MTVA 5DF0A 1J6YA 1LL7A 3KADA 4ITZA 4ML4A 3B9EA 2LJ4A 4L72B 2WLYA 1E6RA 2RUCA 3JYMA 4S3JA 1J4HA 3G6LA 2IUZA 3PRDA 1D2KA 4P8UA 4WJXA 1J4IA 5DIUA 2FAPA 4L3NA 1U79A 4FAPA 4DRMA 3B8SA 3ARYA 4IT6A 1LG1A 2MF9A 2DT0A 2ZR6A 4TW6A 1JNTA 1FFRA 3QOKA 1OGBA 2LPVA 2KE0A 3IKGA 1SR0A 2Q5AA 3FXYA 2ZR5A 3O5DA 4HBEA 1FKKA 2XP6A 4QIBA 1D6OA 2RUDA 4TW8A 5J6EA 2ITKA 3ARXA 3UQBA 4IQ2A 4IQCA 4J4OA 4ODMA 3KAGA 1B6CA 4MGVA 4U84A 5GPRA 2K8IA 3TCZA 3ALGA 2MNTA 2RURA 1W1PA 4W9PA 4Z2GA 4P8XA 1W9VA 2M1IA 4TYOA 1E6NA 4U86A 1QPFA 4W5UA 3UQAA 2KR7A 3TC5A 4DIPA 5HW8A 2WM0A 4WK9A 4ZPVR 1Q6IA 1W9PA 3O5GA 3O5QA 2B5UB 3KZ7A 3WH0A 1HKMA 3G6MA 4HARA 2ETNA 2FDMA 3FAPA 1X6NA 1JCHB 2ZR4A 4IT4A 2DG4A 2MLZA 4DWSB 3WL0A 4U85A 2XP7A 3O5FA 3O5IA 1R9HA 1FKDA 1WB0A 3AS3A 3ARVA 1IX5A 1FKFA 1QPLA 1ZU8A 3CHDA 2ZQTA 1ZL1A
chains in the Genus database with same CATH topology
1XRVA 3WQWA 4O2TA 1M5YA 3WL1A 4G50A 5HKGA 2A3EA 1FFQA 2DT3A 1FAPA 1LQ0A 1ZBVA 2DSZA 5D75A 1EYMA 4WIWA 1FKIA 1ZBWA 1JNDA 5DEZA 1FKSA 1HJVA 3PRBA 1EHNA 4W9OA 4DRPA 2PBCA 1OWQA 4ODLA 4C02B 1Y0OA 1VF8A 4MNKA 4Q22A 1D7IA 3EY6A 3WD2A 4N19A 3WD0A 4TW7A 1JNSA 1Q6UA 4DRIA 4WKFA 1LG2A 3O5EA 2A3CA 3B7XA 4JYSA 4QT2A 1NMVA 4LGXA 3B9AA 3KACA 2IF4A 3VAWA 1W1YA 2Y78A 3NTPA 1Q1CA 2F4EA 4MSPA 1HJXA 4PTMA 3UQIA 5DITA 4GIVA 2AWGA 3H9RB 1NH6A 2VN1A 4J4NA 1NMWA 3WD4A 5HWBA 4ODNA 2O9OA 4DZ2A 2UZ5A 1CTNA 4DWSA 1Q6HA 4ODQA 5HWCA 4NSBA 4NZCA 2F21A 2KI3A 3B9DA 2G41A 2M2AA 3RM4A 1F8AB 1ZK6A 2FKEA 1FKRA 3RM8A 3CHFA 1FKJA 5HUAA 4DRNA 2N87A 2LKNA 1D7JA 1ROUA 4LAYA 1UR8A 4ODOA 2L2SA 3O5JA 5BXJA 3ARZA 1PBKA 3WD1A 1HJWA 3AQUA 1E9LA 4Z2IA 4MPKA 3CHEA 5DIVA 1WNOA 1X6LA 1W1VA 2ZQUA 4MNJA 4MAVA 4JFKA 2XPAA 2JZVA 4KQZA 5HW7A 4MNLA 3ARSA 1NSGA 3O5PA 3UI6A 1YATA 4NNRA 4ODRA 3ARPA 1OGGA 5DO2A 3RM9A 1K9TA 4DWSD 3UI4A 5HT1A 1ZBCA 2DT2A 2DSVA 1QZ2A 4JFIA 1GPFA 4HBOA 4Z2HA 1FKGA 1GUVA 1H0GA 3ARUA 2KFWA 1E6ZA 1N1AA 2XP4A 4R0XA 3IKDA 4GGQA 1NWUA 3TDBA 3AROA 2PPOA 4JFJA 3UF8A 1BKFA 4Z2JA 1YW5A 3IK8A 3WKZA 3MDYB 1EQ3A 3AS0A 1HKJA 2PV1A 4JFMA 2YBUA 4P8WA 1PINA 1KT0A 4XAKA 4ZS6A 2XP5A 4G2PA 4KR0B 3CZ8A 4ZPTR 2DT1A 3OA5A 3CHCA 1H0IA 2PPPA 4QT3A 3GPKA 2PV3A 4LAXA 4IPXA 2OLHA 4TNSA 2A3BA 2ZQSA 3PR9A 3PA7A 1FKBA 1ROTA 2XPBA 5B8IC 3JYJA 4DWSC 1D7HA 1W1TA 3AS1A 4DRHA 1TCOC 1FJDA 2DSWA 2F2DA 1C9HA 3RGCA 5I98A 2O92A 5HBFA 4ODPA 1EDQA 3IHZA 1ZB5A 4DRJA 3ARQA 4JFLA 1EIBA 3RFWA 3PRAA 2DG9A 4ODKA 2PV2A 2LGOA 2ZQVA 2DG3A 4ZPWR 3W4RA 1KFWA 4DROA 1W26A 1FKHA 4TX0A 3WQVA 1ZCNA 2KO7A 3WIJA 1WAWA 3ARTA 1ZBKA 4AY1A 3FY1A 3ARWA 4S3KA 2WLZA 5GPGA 5JH8A 1L1PA 1W9UA 1RD6A 4DT4A 3WD3A 4Q7NA 2MPHA 2B31A 4URIA 3UI5A 3CH9A 1KT1A 3RMEA 3CGMA 4W9QA 1LJYA 3NI6A 3OOBA 4MNMA 2RUQA 4LAWA 1ITXA 5GQBA 3O5KA 4FN2A 2XP9A 4P8VA 4QZVB 2KGJA 2QF8A 1BL4A 1FKLA 2MLYA 1FKTA 1LL6A 1GOIA 2XP8A 3ODKA 2RQSA 1HKIA 1T11A 4LAVA 1JNEA 1FD9A 1HXVA 1NWRA 3ALFA 3O5MA 1LL4A 3JXVA 1JVWA 4R5EA 2DPEA 1O6IA 3ARRA 4Z2KA 2PI6A 3AS2A 1UR9A 2YBTA 3LUOA 1XHGA 2AOSA 4BF8A 1E6PA 3KAIA 3O5LA 2MLXA 1J4RA 3KAHA 1HKKA 4Z2LA 3KCEA 2WK2A 3KAFA 2G8ZA 1E15A 2M08A 1SYTA 2RSEA 4WKAA 4WKHA 2ESCA 5HTGA 2XP3A 1NWSA 5HW6A 1NWTA 2OFNA 4DZ3A 3O5OA 3BXWA 1P5QA 1F40A 3NRKA 4DRKA 4DH0A 4DRQA 3I6CA 2D9FA 3KABA 2A3AA 2DSUA 2PPNA 2VCDA 3O5RA 1A7XA 1TFVA 3CGNA 4MTVA 5DF0A 1J6YA 1LL7A 3KADA 4ITZA 4ML4A 3B9EA 2LJ4A 4L72B 2WLYA 1E6RA 2RUCA 3JYMA 4S3JA 1J4HA 3G6LA 2IUZA 3PRDA 1D2KA 4P8UA 4WJXA 1J4IA 5DIUA 2FAPA 4L3NA 1U79A 4FAPA 4DRMA 3B8SA 3ARYA 4IT6A 1LG1A 2MF9A 2DT0A 2ZR6A 4TW6A 1JNTA 1FFRA 3QOKA 1OGBA 2LPVA 2KE0A 3IKGA 1SR0A 2Q5AA 3FXYA 2ZR5A 3O5DA 4HBEA 1FKKA 2XP6A 4QIBA 1D6OA 2RUDA 4TW8A 5J6EA 2ITKA 3ARXA 3UQBA 4IQ2A 4IQCA 4J4OA 4ODMA 3KAGA 1B6CA 4MGVA 4U84A 5GPRA 2K8IA 3TCZA 3ALGA 2MNTA 2RURA 1W1PA 4W9PA 4Z2GA 4P8XA 1W9VA 2M1IA 4TYOA 1E6NA 4U86A 1QPFA 4W5UA 3UQAA 2KR7A 3TC5A 4DIPA 5HW8A 2WM0A 4WK9A 4ZPVR 1Q6IA 1W9PA 3O5GA 3O5QA 3KZ7A 3WH0A 1HKMA 3G6MA 4HARA 2FDMA 3FAPA 1X6NA 2ZR4A 4IT4A 2DG4A 2MLZA 4DWSB 3WL0A 4U85A 2XP7A 3O5FA 3O5IA 1R9HA 1FKDA 1WB0A 3AS3A 3ARVA 1IX5A 1FKFA 1QPLA 1ZU8A 3CHDA 2ZQTA 1ZL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODK A;  2PV2 A;  2LGO A;  2ZQV A;  5DIV A;  2DG3 A;  4O2T A;  1M5Y A;  5HKG A;  4G50 A;  1W26 A;  4DRO A;  1FKH A;  4TX0 A;  2RUC A;  1ZCN A;  2ZQU A;  3JYM A;  2KO7 A;  1J4H A;  1FAP A;  3PRD A;  5D75 A;  1EYM A;  4DH0 A;  1FKI A;  4JFK A;  1J4I A;  5GPG A;  2XPA A;  1FKS A;  2JZV A;  5DIU A;  1L1P A;  3PRB A;  5HW7 A;  4W9O A;  4DRP A;  2FAP A;  2PBC A;  4DT4 A;  1NSG A;  3O5P A;  3UI6 A;  4ODL A;  1U79 A;  4C02 B;  2MPH A;  4FAP A;  1YAT A;  4NNR A;  4DRM A;  4ODR A;  1Y0O A;  3UI5 A;  1KT1 A;  1D7I A;  3CGM A;  4W9Q A;  3EY6 A;  4DRQ A;  2MF9 A;  4N19 A;  4TW7 A;  3NI6 A;  2ZR6 A;  3OOB A;  1JNS A;  1Q6U A;  1JNT A;  2RUQ A;  4LAW A;  4TW6 A;  5HT1 A;  3UI4 A;  4DRI A;  3O5E A;  3B7X A;  1QZ2 A;  4JFI A;  4JYS A;  3O5K A;  4QT2 A;  1NMV A;  2LPV A;  4FN2 A;  2XP9 A;  2KE0 A;  3IKG A;  2Q5A A;  3KAC A;  2ZR5 A;  2KGJ A;  3O5D A;  2IF4 A;  1FKK A;  2XP6 A;  3VAW A;  4QIB A;  1BL4 A;  1D6O A;  2RUD A;  2Y78 A;  4TW8 A;  3NTP A;  1Q1C A;  1FKL A;  5J6E A;  2ITK A;  2F4E A;  2MLY A;  4IQ2 A;  4MSP A;  1FKT A;  1FKG A;  4IQC A;  4J4O A;  3UQB A;  3ODK A;  2XP8 A;  4ODM A;  2RQS A;  3KAG A;  3UQI A;  5DIT A;  1B6C A;  4GIV A;  2AWG A;  2KFW A;  1N1A A;  2XP4 A;  4MGV A;  4U84 A;  2K8I A;  4R0X A;  3TCZ A;  1T11 A;  3H9R B;  3IKD A;  4GGQ A;  4LAV A;  2MNT A;  2RUR A;  1FD9 A;  1HXV A;  2VN1 A;  4J4N A;  1NMW A;  3TDB A;  5HWB A;  4ODN A;  3O5M A;  2PPO A;  4JFJ A;  3UF8 A;  1BKF A;  3JXV A;  1YW5 A;  4DZ2 A;  2UZ5 A;  3IK8 A;  4W9P A;  1JVW A;  3MDY B;  2M1I A;  4TYO A;  1Q6H A;  1EQ3 A;  4ODQ A;  5HWC A;  2PV1 A;  4JFM A;  4U86 A;  1QPF A;  3LUO A;  2F21 A;  2KI3 A;  4BF8 A;  3UQA A;  2M2A A;  3KAI A;  3O5L A;  2MLX A;  2KR7 A;  1PIN A;  1J4R A;  3KAH A;  3TC5 A;  4DIP A;  5HW8 A;  1KT0 A;  3KCE A;  2XP5 A;  3KAF A;  2M08 A;  2RSE A;  1F8A B;  1Q6I A;  4G2P A;  1ZK6 A;  2FKE A;  3O5G A;  3O5Q A;  5HTG A;  1FKR A;  2XP3 A;  3KZ7 A;  5HW6 A;  3WH0 A;  1FKJ A;  2OFN A;  4QT3 A;  4DZ3 A;  2PPP A;  3O5O A;  5HUA A;  3GPK A;  4DRN A;  1P5Q A;  1F40 A;  2PV3 A;  3FAP A;  3NRK A;  4LAX A;  4DRK A;  2N87 A;  2ZR4 A;  3I6C A;  2D9F A;  4IPX A;  2LKN A;  3KAB A;  2DG4 A;  2ZQS A;  2MLZ A;  3PA7 A;  2PPN A;  1FKB A;  1ROT A;  2XPB A;  5B8I C;  2VCD A;  1D7J A;  3JYJ A;  4U85 A;  1ROU A;  1A7X A;  1D7H A;  3O5R A;  4LAY A;  2XP7 A;  3O5F A;  3CGN A;  3O5I A;  1TCO C;  4ODO A;  4DRH A;  2L2S A;  4TNS A;  3O5J A;  1J6Y A;  1FJD A;  1R9H A;  2F2D A;  3KAD A;  1C9H A;  1FKD A;  3RGC A;  4ITZ A;  5BXJ A;  5I98 A;  1PBK A;  2LJ4 A;  4ODP A;  3IHZ A;  1FKF A;  4DRJ A;  1QPL A;  4JFL A;  3RFW A;  2ZQT A;  2DG9 A; 
#chains in the Genus database with same CATH topology
 1XRV A;  3WQW A;  4O2T A;  1M5Y A;  3WL1 A;  4G50 A;  5HKG A;  2A3E A;  1FFQ A;  2DT3 A;  1FAP A;  1LQ0 A;  1ZBV A;  2DSZ A;  5D75 A;  1EYM A;  4WIW A;  1FKI A;  1ZBW A;  1JND A;  5DEZ A;  1FKS A;  1HJV A;  3PRB A;  1EHN A;  4W9O A;  4DRP A;  2PBC A;  1OWQ A;  4ODL A;  4C02 B;  1Y0O A;  1VF8 A;  4MNK A;  4Q22 A;  1D7I A;  3EY6 A;  3WD2 A;  4N19 A;  3WD0 A;  4TW7 A;  1JNS A;  1Q6U A;  4DRI A;  4WKF A;  1LG2 A;  3O5E A;  2A3C A;  3B7X A;  4JYS A;  4QT2 A;  1NMV A;  4LGX A;  3B9A A;  3KAC A;  2IF4 A;  3VAW A;  1W1Y A;  2Y78 A;  3NTP A;  1Q1C A;  2F4E A;  4MSP A;  1HJX A;  4PTM A;  3UQI A;  5DIT A;  4GIV A;  2AWG A;  3H9R B;  1NH6 A;  2VN1 A;  4J4N A;  1NMW A;  3WD4 A;  5HWB A;  4ODN A;  2O9O A;  4DZ2 A;  2UZ5 A;  1CTN A;  4DWS A;  1Q6H A;  4ODQ A;  5HWC A;  4NSB A;  4NZC A;  2F21 A;  2KI3 A;  3B9D A;  2G41 A;  2M2A A;  3RM4 A;  1F8A B;  1ZK6 A;  2FKE A;  1FKR A;  3RM8 A;  3CHF A;  3GTY X;  1FKJ A;  5HUA A;  4DRN A;  2N87 A;  2LKN A;  1D7J A;  1ROU A;  4LAY A;  1UR8 A;  4ODO A;  1GRJ A;  2L2S A;  3O5J A;  5BXJ A;  3ARZ A;  1PBK A;  3WD1 A;  1HJW A;  3AQU A;  1E9L A;  4Z2I A;  4MPK A;  3CHE A;  5DIV A;  1WNO A;  2EUL A;  1X6L A;  1W1V A;  2ZQU A;  4MNJ A;  4MAV A;  4JFK A;  2XPA A;  2JZV A;  4KQZ A;  5HW7 A;  4MNL A;  3ARS A;  1NSG A;  3O5P A;  3UI6 A;  1YAT A;  4NNR A;  4ODR A;  3ARP A;  1OGG A;  5DO2 A;  3RM9 A;  1K9T A;  4DWS D;  3UI4 A;  5HT1 A;  1ZBC A;  2DT2 A;  2DSV A;  1QZ2 A;  4JFI A;  1GPF A;  4HBO A;  4Z2H A;  1FKG A;  1GUV A;  1H0G A;  3ARU A;  2KFW A;  1E6Z A;  1N1A A;  2XP4 A;  4R0X A;  3IKD A;  4GGQ A;  1NWU A;  3TDB A;  3ARO A;  2PPO A;  4JFJ A;  3UF8 A;  1BKF A;  4Z2J A;  1YW5 A;  3IK8 A;  3WKZ A;  3MDY B;  1EQ3 A;  3AS0 A;  1HKJ A;  2PV1 A;  4JFM A;  2YBU A;  4P8W A;  1PIN A;  1KT0 A;  4XAK A;  4ZS6 A;  2XP5 A;  4G2P A;  4KR0 B;  3CZ8 A;  4ZPT R;  2DT1 A;  3EIP A;  3OA5 A;  3CHC A;  1H0I A;  2PPP A;  4QT3 A;  3GPK A;  2PV3 A;  4LAX A;  4IPX A;  2OLH A;  4TNS A;  2A3B A;  2ZQS A;  3PR9 A;  3PA7 A;  1FKB A;  1ROT A;  2XPB A;  3GU0 A;  5B8I C;  3JYJ A;  4DWS C;  1D7H A;  1W1T A;  3AS1 A;  4DRH A;  1TCO C;  1FJD A;  2DSW A;  2F2D A;  1C9H A;  4UDM A;  3RGC A;  5I98 A;  2O92 A;  5HBF A;  4ODP A;  1EDQ A;  3IHZ A;  1ZB5 A;  2P4V A;  4DRJ A;  3ARQ A;  4JFL A;  1EIB A;  3RFW A;  3PRA A;  2DG9 A;  4ODK A;  2PV2 A;  2LGO A;  2ZQV A;  2DG3 A;  4ZPW R;  3W4R A;  1KFW A;  4DRO A;  1W26 A;  1FKH A;  4TX0 A;  3WQV A;  1ZCN A;  2KO7 A;  3WIJ A;  1WAW A;  3ART A;  1ZBK A;  4AY1 A;  3FY1 A;  3ARW A;  4S3K A;  1E44 A;  2WLZ A;  5GPG A;  5JH8 A;  1L1P A;  1W9U A;  1RD6 A;  4DT4 A;  3WD3 A;  4Q7N A;  2MPH A;  2B31 A;  4URI A;  3UI5 A;  3CH9 A;  1KT1 A;  3RME A;  3CGM A;  4W9Q A;  1LJY A;  3NI6 A;  3OOB A;  4MNM A;  2RUQ A;  4LAW A;  1ITX A;  5GQB A;  3O5K A;  4FN2 A;  2XP9 A;  4P8V A;  4QZV B;  2KGJ A;  2PN0 A;  2QF8 A;  1BL4 A;  1FKL A;  2MLY A;  1FKT A;  1LL6 A;  1GOI A;  2XP8 A;  3ODK A;  2RQS A;  1HKI A;  1T11 A;  4LAV A;  1JNE A;  1FD9 A;  1HXV A;  1NWR A;  3ALF A;  3O5M A;  1LL4 A;  3JXV A;  1JVW A;  4R5E A;  2DPE A;  1O6I A;  3ARR A;  4Z2K A;  2PI6 A;  3AS2 A;  1UR9 A;  2YBT A;  3BMB A;  3LUO A;  1XHG A;  2AOS A;  4BF8 A;  1E6P A;  3KAI A;  3O5L A;  2MLX A;  1J4R A;  3KAH A;  1HKK A;  2F23 A;  4Z2L A;  3KCE A;  2WK2 A;  3KAF A;  2G8Z A;  1E15 A;  2M08 A;  1SYT A;  2RSE A;  4WKA A;  4WKH A;  2ESC A;  5HTG A;  2XP3 A;  1NWS A;  5HW6 A;  1NWT A;  2OFN A;  4DZ3 A;  3O5O A;  3BXW A;  1P5Q A;  1F40 A;  3NRK A;  4DRK A;  4DH0 A;  4DRQ A;  3I6C A;  2D9F A;  3KAB A;  2A3A A;  2DSU A;  2PPN A;  2VCD A;  3O5R A;  1A7X A;  1TFV A;  3CGN A;  4MTV A;  5DF0 A;  1J6Y A;  1LL7 A;  3KAD A;  4ITZ A;  4ML4 A;  3B9E A;  2LJ4 A;  4L72 B;  2WLY A;  1E6R A;  2RUC A;  3JYM A;  4S3J A;  1J4H A;  3G6L A;  2IUZ A;  3PRD A;  1D2K A;  4P8U A;  4WJX A;  1J4I A;  5DIU A;  2FAP A;  4L3N A;  1U79 A;  4FAP A;  4DRM A;  3B8S A;  3ARY A;  4IT6 A;  1LG1 A;  2MF9 A;  2DT0 A;  2ZR6 A;  4TW6 A;  1JNT A;  1FFR A;  3QOK A;  1OGB A;  2LPV A;  2KE0 A;  3IKG A;  1SR0 A;  2Q5A A;  3FXY A;  2ZR5 A;  3O5D A;  4HBE A;  1FKK A;  2XP6 A;  4QIB A;  1D6O A;  2RUD A;  4TW8 A;  5J6E A;  2ITK A;  3ARX A;  3UQB A;  4IQ2 A;  4IQC A;  4J4O A;  4ODM A;  3KAG A;  1B6C A;  4MGV A;  4U84 A;  5GPR A;  2K8I A;  3TCZ A;  3ALG A;  2MNT A;  2RUR A;  1W1P A;  4W9P A;  4Z2G A;  4P8X A;  1W9V A;  2M1I A;  4TYO A;  1E6N A;  4U86 A;  1QPF A;  4W5U A;  3UQA A;  2KR7 A;  3TC5 A;  4DIP A;  5HW8 A;  2WM0 A;  4WK9 A;  4ZPV R;  1Q6I A;  1W9P A;  3O5G A;  3O5Q A;  2B5U B;  3KZ7 A;  3WH0 A;  1HKM A;  3G6M A;  4HAR A;  2ETN A;  2FDM A;  3FAP A;  1X6N A;  1JCH B;  2ZR4 A;  4IT4 A;  2DG4 A;  2MLZ A;  4DWS B;  3WL0 A;  4U85 A;  2XP7 A;  3O5F A;  3O5I A;  1R9H A;  1FKD A;  1WB0 A;  3AS3 A;  3ARV A;  1IX5 A;  1FKF A;  1QPL A;  1ZU8 A;  3CHD A;  2ZQT A;  1ZL1 A; 
#chains in the Genus database with same CATH homology
 1XRV A;  3WQW A;  4O2T A;  1M5Y A;  3WL1 A;  4G50 A;  5HKG A;  2A3E A;  1FFQ A;  2DT3 A;  1FAP A;  1LQ0 A;  1ZBV A;  2DSZ A;  5D75 A;  1EYM A;  4WIW A;  1FKI A;  1ZBW A;  1JND A;  5DEZ A;  1FKS A;  1HJV A;  3PRB A;  1EHN A;  4W9O A;  4DRP A;  2PBC A;  1OWQ A;  4ODL A;  4C02 B;  1Y0O A;  1VF8 A;  4MNK A;  4Q22 A;  1D7I A;  3EY6 A;  3WD2 A;  4N19 A;  3WD0 A;  4TW7 A;  1JNS A;  1Q6U A;  4DRI A;  4WKF A;  1LG2 A;  3O5E A;  2A3C A;  3B7X A;  4JYS A;  4QT2 A;  1NMV A;  4LGX A;  3B9A A;  3KAC A;  2IF4 A;  3VAW A;  1W1Y A;  2Y78 A;  3NTP A;  1Q1C A;  2F4E A;  4MSP A;  1HJX A;  4PTM A;  3UQI A;  5DIT A;  4GIV A;  2AWG A;  3H9R B;  1NH6 A;  2VN1 A;  4J4N A;  1NMW A;  3WD4 A;  5HWB A;  4ODN A;  2O9O A;  4DZ2 A;  2UZ5 A;  1CTN A;  4DWS A;  1Q6H A;  4ODQ A;  5HWC A;  4NSB A;  4NZC A;  2F21 A;  2KI3 A;  3B9D A;  2G41 A;  2M2A A;  3RM4 A;  1F8A B;  1ZK6 A;  2FKE A;  1FKR A;  3RM8 A;  3CHF A;  1FKJ A;  5HUA A;  4DRN A;  2N87 A;  2LKN A;  1D7J A;  1ROU A;  4LAY A;  1UR8 A;  4ODO A;  2L2S A;  3O5J A;  5BXJ A;  3ARZ A;  1PBK A;  3WD1 A;  1HJW A;  3AQU A;  1E9L A;  4Z2I A;  4MPK A;  3CHE A;  5DIV A;  1WNO A;  1X6L A;  1W1V A;  2ZQU A;  4MNJ A;  4MAV A;  4JFK A;  2XPA A;  2JZV A;  4KQZ A;  5HW7 A;  4MNL A;  3ARS A;  1NSG A;  3O5P A;  3UI6 A;  1YAT A;  4NNR A;  4ODR A;  3ARP A;  1OGG A;  5DO2 A;  3RM9 A;  1K9T A;  4DWS D;  3UI4 A;  5HT1 A;  1ZBC A;  2DT2 A;  2DSV A;  1QZ2 A;  4JFI A;  1GPF A;  4HBO A;  4Z2H A;  1FKG A;  1GUV A;  1H0G A;  3ARU A;  2KFW A;  1E6Z A;  1N1A A;  2XP4 A;  4R0X A;  3IKD A;  4GGQ A;  1NWU A;  3TDB A;  3ARO A;  2PPO A;  4JFJ A;  3UF8 A;  1BKF A;  4Z2J A;  1YW5 A;  3IK8 A;  3WKZ A;  3MDY B;  1EQ3 A;  3AS0 A;  1HKJ A;  2PV1 A;  4JFM A;  2YBU A;  4P8W A;  1PIN A;  1KT0 A;  4XAK A;  4ZS6 A;  2XP5 A;  4G2P A;  4KR0 B;  3CZ8 A;  4ZPT R;  2DT1 A;  3OA5 A;  3CHC A;  1H0I A;  2PPP A;  4QT3 A;  3GPK A;  2PV3 A;  4LAX A;  4IPX A;  2OLH A;  4TNS A;  2A3B A;  2ZQS A;  3PR9 A;  3PA7 A;  1FKB A;  1ROT A;  2XPB A;  5B8I C;  3JYJ A;  4DWS C;  1D7H A;  1W1T A;  3AS1 A;  4DRH A;  1TCO C;  1FJD A;  2DSW A;  2F2D A;  1C9H A;  3RGC A;  5I98 A;  2O92 A;  5HBF A;  4ODP A;  1EDQ A;  3IHZ A;  1ZB5 A;  4DRJ A;  3ARQ A;  4JFL A;  1EIB A;  3RFW A;  3PRA A;  2DG9 A;  4ODK A;  2PV2 A;  2LGO A;  2ZQV A;  2DG3 A;  4ZPW R;  3W4R A;  1KFW A;  4DRO A;  1W26 A;  1FKH A;  4TX0 A;  3WQV A;  1ZCN A;  2KO7 A;  3WIJ A;  1WAW A;  3ART A;  1ZBK A;  4AY1 A;  3FY1 A;  3ARW A;  4S3K A;  2WLZ A;  5GPG A;  5JH8 A;  1L1P A;  1W9U A;  1RD6 A;  4DT4 A;  3WD3 A;  4Q7N A;  2MPH A;  2B31 A;  4URI A;  3UI5 A;  3CH9 A;  1KT1 A;  3RME A;  3CGM A;  4W9Q A;  1LJY A;  3NI6 A;  3OOB A;  4MNM A;  2RUQ A;  4LAW A;  1ITX A;  5GQB A;  3O5K A;  4FN2 A;  2XP9 A;  4P8V A;  4QZV B;  2KGJ A;  2QF8 A;  1BL4 A;  1FKL A;  2MLY A;  1FKT A;  1LL6 A;  1GOI A;  2XP8 A;  3ODK A;  2RQS A;  1HKI A;  1T11 A;  4LAV A;  1JNE A;  1FD9 A;  1HXV A;  1NWR A;  3ALF A;  3O5M A;  1LL4 A;  3JXV A;  1JVW A;  4R5E A;  2DPE A;  1O6I A;  3ARR A;  4Z2K A;  2PI6 A;  3AS2 A;  1UR9 A;  2YBT A;  3LUO A;  1XHG A;  2AOS A;  4BF8 A;  1E6P A;  3KAI A;  3O5L A;  2MLX A;  1J4R A;  3KAH A;  1HKK A;  4Z2L A;  3KCE A;  2WK2 A;  3KAF A;  2G8Z A;  1E15 A;  2M08 A;  1SYT A;  2RSE A;  4WKA A;  4WKH A;  2ESC A;  5HTG A;  2XP3 A;  1NWS A;  5HW6 A;  1NWT A;  2OFN A;  4DZ3 A;  3O5O A;  3BXW A;  1P5Q A;  1F40 A;  3NRK A;  4DRK A;  4DH0 A;  4DRQ A;  3I6C A;  2D9F A;  3KAB A;  2A3A A;  2DSU A;  2PPN A;  2VCD A;  3O5R A;  1A7X A;  1TFV A;  3CGN A;  4MTV A;  5DF0 A;  1J6Y A;  1LL7 A;  3KAD A;  4ITZ A;  4ML4 A;  3B9E A;  2LJ4 A;  4L72 B;  2WLY A;  1E6R A;  2RUC A;  3JYM A;  4S3J A;  1J4H A;  3G6L A;  2IUZ A;  3PRD A;  1D2K A;  4P8U A;  4WJX A;  1J4I A;  5DIU A;  2FAP A;  4L3N A;  1U79 A;  4FAP A;  4DRM A;  3B8S A;  3ARY A;  4IT6 A;  1LG1 A;  2MF9 A;  2DT0 A;  2ZR6 A;  4TW6 A;  1JNT A;  1FFR A;  3QOK A;  1OGB A;  2LPV A;  2KE0 A;  3IKG A;  1SR0 A;  2Q5A A;  3FXY A;  2ZR5 A;  3O5D A;  4HBE A;  1FKK A;  2XP6 A;  4QIB A;  1D6O A;  2RUD A;  4TW8 A;  5J6E A;  2ITK A;  3ARX A;  3UQB A;  4IQ2 A;  4IQC A;  4J4O A;  4ODM A;  3KAG A;  1B6C A;  4MGV A;  4U84 A;  5GPR A;  2K8I A;  3TCZ A;  3ALG A;  2MNT A;  2RUR A;  1W1P A;  4W9P A;  4Z2G A;  4P8X A;  1W9V A;  2M1I A;  4TYO A;  1E6N A;  4U86 A;  1QPF A;  4W5U A;  3UQA A;  2KR7 A;  3TC5 A;  4DIP A;  5HW8 A;  2WM0 A;  4WK9 A;  4ZPV R;  1Q6I A;  1W9P A;  3O5G A;  3O5Q A;  3KZ7 A;  3WH0 A;  1HKM A;  3G6M A;  4HAR A;  2FDM A;  3FAP A;  1X6N A;  2ZR4 A;  4IT4 A;  2DG4 A;  2MLZ A;  4DWS B;  3WL0 A;  4U85 A;  2XP7 A;  3O5F A;  3O5I A;  1R9H A;  1FKD A;  1WB0 A;  3AS3 A;  3ARV A;  1IX5 A;  1FKF A;  1QPL A;  1ZU8 A;  3CHD A;  2ZQT A;  1ZL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...