2RUQA

Solution structure of human pin1 ppiase mutant c113a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
GSHMEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDASSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Breakage of the Hydrogen Bond within the Dual-Histidine Motif in the Active Site of Human Pin1 PPIase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 31
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ruqA00
4QT2A 3O5GA 1T11A 1NMVA 1TCOC 4ODNA 3VAWA 1NSGA 4IQ2A 3O5RA 1EQ3A 3UF8A 4DZ2A 1YATA 2MNTA 4IPXA 1W26A 4DIPA 3KADA 2DG3A 4J4OA 2ZQUA 1Y0OA 2XPAA 4GGQA 4DRJA 2LKNA 4DROA 1FKGA 2RQSA 4G50A 4W9QA 1FKHA 2M08A 2ZQTA 1FKSA 2PPPA 1D7JA 4ODRA 1NMWA 5GPGA 4BF8A 3I6CA 4IQCA 2PV3A 1Q6IA 1FKDA 4QIBA 2VN1A 4W9OA 5DIVA 1FKBA 3TCZA 5J6EA 2ZQVA 3PRDA 4DZ3A 4TYOA 1EYMA 1D7IA 1FKJA 3O5OA 3O5MA 2XP8A 2AWGA 3KZ7A 1F40A 1M5YA 2VCDA 1D6OA 3PA7A 1KT1A 1FKLA 1ZK6A 4DRNA 5I98A 3O5PA 1PBKA 3UQBA 3JYJA 5HWBA 4R0XA 3CGNA 3O5DA 4J4NA 1J6YA 2XP3A 3O5LA 1ROUA 1J4RA 2XP7A 2M1IA 1FKFA 2RUCA 1F8AB 4TX0A 4ODMA 4JFLA 1U79A 2RSEA 2XP4A 4JYSA 4DH0A 3JXVA 1QPLA 2PPOA 3KCEA 3O5QA 3UI4A 1FJDA 3H9RB 2RURA 4ODQA 3RGCA 4C02B 2KO7A 3NRKA 5DITA 1C9HA 2Y78A 1BKFA 1Q6UA 3ODKA 4TW6A 4U86A 3IKDA 2KE0A 4ODKA 4FAPA 2D9FA 3OOBA 3EY6A 2FKEA 3KABA 3WH0A 3NTPA 1B6CA 1J4HA 3O5EA 1QZ2A 2MF9A 3KACA 3O5IA 4LAXA 3TC5A 5HKGA 1JNTA 2F2DA 3NI6A 1D7HA 4QT3A 3O5KA 3KAFA 2ZR5A 1FKIA 2KFWA 4TW7A 3UQAA 1PINA 1Q1CA 2MLZA 4N19A 1BL4A 4ODOA 4U85A 1A7XA 2DG9A 2PPNA 1ZCNA 2XP9A 5HT1A 1N1AA 2MLXA 5D75A 5DIUA 1FKTA 4JFKA 2LPVA 4DRHA 2KI3A 3UQIA 2L2SA 3PRBA 3KAGA 2Q5AA 2FAPA 2MPHA 3MDYB 4JFJA 5HTGA 4DRQA 5HUAA 1KT0A 2JZVA 3TDBA 1FD9A 4DRMA 4DT4A 1HXVA 2LJ4A 1Q6HA 3KAIA 2KGJA 2XP5A 3IKGA 4ITZA 2UZ5A 2XP6A 3KAHA 3RFWA 1P5QA 3GPKA 3IHZA 1J4IA 2KR7A 3FAPA 2OFNA 5HW8A 4NNRA 1FKRA 2DG4A 1JVWA 2XPBA 4JFIA 4MSPA 5BXJA 1ROTA 5HW6A 2N87A 3JYMA 4DRPA 3UI5A 4G2PA 4LAYA 2K8IA 2ZR4A 2IF4A 4LAVA 1L1PA 4O2TA 2F21A 2F4EA 2ZQSA 1YW5A 3O5JA 2LGOA 3O5FA 4LAWA 4U84A 1QPFA 2PV1A 1JNSA 1R9HA 2MLYA 4DRIA 4DRKA 4JFMA 4W9PA 2RUQA 4MGVA 3B7XA 3CGMA 1FAPA 2M2AA 2ZR6A 4GIVA 4ODLA 2PBCA 4TNSA 3IK8A 4TW8A 3UI6A 4FN2A 1FKKA 4ODPA 5B8IC 2PV2A 5HW7A 2RUDA 3LUOA 2ITKA 5HWCA
chains in the Genus database with same CATH superfamily
1E6PA 1NMVA 4MPKA 3VAWA 1WNOA 1LL7A 1W26A 4DIPA 2DG3A 3WD0A 1Y0OA 2XPAA 1GUVA 4GGQA 4DRJA 2LKNA 2RQSA 3W4RA 2EULA 4G50A 3FY1A 1E6RA 1OGGA 3I6CA 2PV3A 1WAWA 4DWSC 1FKDA 4QIBA 1JNDA 1SYTA 5DIVA 1HJXA 2ZQVA 1EYMA 1FKJA 3WKZA 2AWGA 3KZ7A 3QOKA 3G6LA 3PA7A 1D6OA 3ARUA 4L72B 3RM8A 3WD2A 1ROUA 1ZBKA 4JFLA 1HKMA 1U79A 4JYSA 1QPLA 3UI4A 2A3BA 3NRKA 1BKFA 5DEZA 3ODKA 4TW6A 3IKDA 4FAPA 3B9DA 3NTPA 3O5EA 1QZ2A 2MF9A 3BXWA 2DSWA 4LAXA 2F2DA 1D7HA 1FKIA 1D2KA 2MLZA 4U85A 1CTNA 1GOIA 1N1AA 2LPVA 2L2SA 2MPHA 5HTGA 1IX5A 4DRMA 1W1YA 1HXVA 1Q6HA 3KAIA 2KGJA 3B8SA 4ITZA 1H0GA 3RFWA 5HBFA 2DSZA 1HJWA 3WQVA 2DG4A 3B9AA 4MNLA 1WB0A 1XHGA 1W1VA 5HW6A 4URIA 4WKAA 4LAYA 1L1PA 4LGXA 1YW5A 2DSVA 2LGOA 2DT3A 3OA5A 1ZL1A 3UQIA 4W5UA 2M2AA 3AS2A 3ARQA 2PV2A 5HW7A 2RUDA 2ITKA 5HWCA 1ZBCA 3O5GA 1E6NA 4ODNA 3O5RA 2OLHA 3UF8A 4DZ2A 5JH8A 1YATA 2MNTA 3ALFA 1KFWA 4DROA 4W9QA 1EIBA 2M08A 1XRVA 1D7JA 1NWUA 3CHFA 5GPGA 3ARWA 4IQCA 1Q6IA 3WD3A 4KQZA 3TCZA 1FFQA 4DZ3A 1W9PA 1ZBVA 3O5MA 1FKLA 3RM4A 4DRNA 2DT2A 4ZPTR 3O5DA 1J6YA 3GU0A 3AQUA 3ARTA 1J4RA 3ARZA 2PI6A 4MNJA 2DT1A 2XP4A 3JXVA 4ZPVR 4Z2HA 1C9HA 2Y78A 3GTYX 2DT0A 1Q6UA 2YBTA 1X6NA 2B5UB 2FDMA 2D9FA 3ARSA 2FKEA 3WH0A 2WLYA 1W1PA 4P8UA 5HKGA 4WJXA 2ZR5A 1SR0A 2KFWA 4L3NA 4WK9A 2PPNA 2XP9A 5HT1A 5DIUA 3PRBA 3KAGA 2Q5AA 2FAPA 2G8ZA 3ARXA 1RD6A 3PR9A 3WL1A 2ETNA 1LG2A 1J4IA 2KR7A 3FAPA 1HKIA 3WL0A 3B9EA 1FKRA 1JVWA 4JFIA 5GQBA 3RM9A 4MSPA 5BXJA 4Q7NA 1ITXA 4ML4A 2WM0A 2ZR4A 3ARVA 4Z2JA 1JNSA 3ALGA 4W9PA 2RUQA 3B7XA 4TNSA 4ODLA 3TC5A 3WQWA 1FKKA 1W9VA 4QT2A 1GPFA 1H0IA 1UR8A 4IQ2A 4WKFA 4IPXA 2ZQUA 2DPEA 3CH9A 4UDMA 1NH6A 2YBUA 2ZQTA 1FKSA 1NMWA 4BF8A 1VF8A 3CHEA 1ZBWA 3PRDA 4TYOA 1D7IA 4DWSD 2XP8A 1M5YA 2VCDA 4KR0B 1ZK6A 1PBKA 3UQBA 1K9TA 4R0XA 3CGNA 2IUZA 2XP3A 3O5LA 4ZPWR 3AS3A 2XP7A 1F8AB 4ODMA 1JNEA 5DF0A 4WKHA 4DH0A 3O5QA 2PPOA 3RGCA 2RURA 5DO2A 4C02B 5DITA 4XAKA 3WD1A 2A3AA 2QF8A 4U86A 1OWQA 2KE0A 3OOBA 1FFRA 3ARYA 3KACA 4Z2IA 3O5KA 3KAFA 3UQAA 1Q1CA 4N19A 3CHCA 4S3KA 1ZCNA 2MLXA 5D75A 1OGBA 1FKTA 4DRHA 2KI3A 4DWSB 3EIPA 4MNKA 4JFJA 4DRQA 1KT0A 2JZVA 3TDBA 1FD9A 4DT4A 2LJ4A 3IKGA 1ZB5A 3CHDA 2UZ5A 2XP6A 3KAHA 1LL4A 4IT4A 5HW8A 1HKJA 4NNRA 2XPBA 2ESCA 1ROTA 2N87A 2P4VA 3JYMA 4DRPA 1LG1A 4QZVB 4O2TA 2F4EA 1EDQA 4U84A 4LAWA 2PV1A 3ARPA 2MLYA 2G41A 4DRIA 4DRKA 4Z2LA 1ZU8A 3CGMA 5J6EA 2ZR6A 4TW8A 2PBCA 1HKKA 2DSUA 4FN2A 1F40A 1EHNA 1E15A 1T11A 1TCOC 3AS0A 1NSGA 4HARA 1EQ3A 1LL6A 1LQ0A 4R5EA 1NWTA 3KADA 4J4OA 4Q22A 5GPRA 3FXYA 1FKGA 1FKHA 4HBEA 2PPPA 4S3JA 4ODRA 1W9UA 1NWRA 2O9OA 2VN1A 4W9OA 1FKBA 2A3CA 2AOSA 3O5OA 5I98A 1KT1A 3O5PA 1JCHB 3JYJA 4AY1A 2WK2A 5HWBA 4J4NA 3WIJA 2M1IA 1FKFA 2RUCA 4TX0A 3ARRA 4WIWA 1E44A 2RSEA 3CZ8A 3KCEA 2A3EA 1FJDA 3H9RB 4ODQA 2KO7A 2O92A 2F23A 4PTMA 3RMEA 1W1TA 4ODKA 4HBOA 3EY6A 1E9LA 3BMBA 3KABA 1B6CA 4MTVA 1J4HA 3O5IA 1JNTA 3NI6A 4P8VA 4QT3A 4IT6A 4NZCA 4Z2KA 4TW7A 1PINA 4ODOA 1BL4A 4NSBA 1A7XA 2DG9A 4JFKA 4P8WA 1O6IA 1HJVA 3MDYB 5HUAA 2XP5A 3AS1A 1UR9A 1P5QA 3GPKA 3IHZA 4MAVA 1NWSA 2B31A 4Z2GA 2OFNA 4DWSA 3WD4A 1LJYA 3UI5A 4G2PA 1X6LA 2K8IA 1TFVA 2IF4A 4LAVA 4MNMA 2F21A 3O5FA 2PN0A 2ZQSA 3AROA 3O5JA 1E6ZA 1QPFA 1R9HA 1GRJA 4JFMA 3G6MA 4MGVA 4P8XA 4ZS6A 1FAPA 4GIVA 3IK8A 5B8IC 3UI6A 4ODPA 3PRAA 3LUOA 2WLZA
chains in the Genus database with same CATH topology
1E6PA 1NMVA 4MPKA 3VAWA 1WNOA 1LL7A 1W26A 4DIPA 2DG3A 3WD0A 1Y0OA 2XPAA 1GUVA 4GGQA 4DRJA 2LKNA 2RQSA 3W4RA 4G50A 3FY1A 1E6RA 1OGGA 3I6CA 2PV3A 1WAWA 4DWSC 1FKDA 4QIBA 1JNDA 1SYTA 5DIVA 1HJXA 2ZQVA 1EYMA 1FKJA 3WKZA 2AWGA 3KZ7A 3QOKA 3G6LA 3PA7A 1D6OA 3ARUA 4L72B 3RM8A 3WD2A 1ROUA 1ZBKA 4JFLA 1HKMA 1U79A 4JYSA 1QPLA 3UI4A 2A3BA 3NRKA 1BKFA 5DEZA 3ODKA 4TW6A 3IKDA 4FAPA 3B9DA 3NTPA 3O5EA 1QZ2A 2MF9A 3BXWA 2DSWA 4LAXA 2F2DA 1D7HA 1FKIA 1D2KA 2MLZA 4U85A 1CTNA 1GOIA 1N1AA 2LPVA 2L2SA 2MPHA 5HTGA 1IX5A 4DRMA 1W1YA 1HXVA 1Q6HA 3KAIA 2KGJA 3B8SA 4ITZA 1H0GA 3RFWA 5HBFA 2DSZA 1HJWA 3WQVA 2DG4A 3B9AA 4MNLA 1WB0A 1XHGA 1W1VA 5HW6A 4URIA 4WKAA 4LAYA 1L1PA 4LGXA 1YW5A 2DSVA 2LGOA 2DT3A 3OA5A 1ZL1A 3UQIA 4W5UA 2M2AA 3AS2A 3ARQA 2PV2A 5HW7A 2RUDA 2ITKA 5HWCA 1ZBCA 3O5GA 1E6NA 4ODNA 3O5RA 2OLHA 3UF8A 4DZ2A 5JH8A 1YATA 2MNTA 3ALFA 1KFWA 4DROA 4W9QA 1EIBA 2M08A 1XRVA 1D7JA 1NWUA 3CHFA 5GPGA 3ARWA 4IQCA 1Q6IA 3WD3A 4KQZA 3TCZA 1FFQA 4DZ3A 1W9PA 1ZBVA 3O5MA 1FKLA 3RM4A 4DRNA 2DT2A 4ZPTR 3O5DA 1J6YA 3AQUA 3ARTA 1J4RA 3ARZA 2PI6A 4MNJA 2DT1A 2XP4A 3JXVA 4ZPVR 4Z2HA 1C9HA 2Y78A 2DT0A 1Q6UA 2YBTA 1X6NA 2FDMA 2D9FA 3ARSA 2FKEA 3WH0A 2WLYA 1W1PA 4P8UA 5HKGA 4WJXA 2ZR5A 1SR0A 2KFWA 4L3NA 4WK9A 2PPNA 2XP9A 5HT1A 5DIUA 3PRBA 3KAGA 2Q5AA 2FAPA 2G8ZA 3ARXA 1RD6A 3PR9A 3WL1A 1LG2A 1J4IA 2KR7A 3FAPA 1HKIA 3WL0A 3B9EA 1FKRA 1JVWA 4JFIA 5GQBA 3RM9A 4MSPA 5BXJA 4Q7NA 1ITXA 4ML4A 2WM0A 2ZR4A 3ARVA 4Z2JA 1JNSA 3ALGA 4W9PA 2RUQA 3B7XA 4TNSA 4ODLA 3TC5A 3WQWA 1FKKA 1W9VA 4QT2A 1GPFA 1H0IA 1UR8A 4IQ2A 4WKFA 4IPXA 2ZQUA 2DPEA 3CH9A 1NH6A 2YBUA 2ZQTA 1FKSA 1NMWA 4BF8A 1VF8A 3CHEA 1ZBWA 3PRDA 4TYOA 1D7IA 4DWSD 2XP8A 1M5YA 2VCDA 4KR0B 1ZK6A 1PBKA 3UQBA 1K9TA 4R0XA 3CGNA 2IUZA 2XP3A 3O5LA 4ZPWR 3AS3A 2XP7A 1F8AB 4ODMA 1JNEA 5DF0A 4WKHA 4DH0A 3O5QA 2PPOA 3RGCA 2RURA 5DO2A 4C02B 5DITA 4XAKA 3WD1A 2A3AA 2QF8A 4U86A 1OWQA 2KE0A 3OOBA 1FFRA 3ARYA 3KACA 4Z2IA 3O5KA 3KAFA 3UQAA 1Q1CA 4N19A 3CHCA 4S3KA 1ZCNA 2MLXA 5D75A 1OGBA 1FKTA 4DRHA 2KI3A 4DWSB 4MNKA 4JFJA 4DRQA 1KT0A 2JZVA 3TDBA 1FD9A 4DT4A 2LJ4A 3IKGA 1ZB5A 3CHDA 2UZ5A 2XP6A 3KAHA 1LL4A 4IT4A 5HW8A 1HKJA 4NNRA 2XPBA 2ESCA 1ROTA 2N87A 3JYMA 4DRPA 1LG1A 4QZVB 4O2TA 2F4EA 1EDQA 4U84A 4LAWA 2PV1A 3ARPA 2MLYA 2G41A 4DRIA 4DRKA 4Z2LA 1ZU8A 3CGMA 5J6EA 2ZR6A 4TW8A 2PBCA 1HKKA 2DSUA 4FN2A 1F40A 1EHNA 1E15A 1T11A 1TCOC 3AS0A 1NSGA 4HARA 1EQ3A 1LL6A 1LQ0A 4R5EA 1NWTA 3KADA 4J4OA 4Q22A 5GPRA 3FXYA 1FKGA 1FKHA 4HBEA 2PPPA 4S3JA 4ODRA 1W9UA 1NWRA 2O9OA 2VN1A 4W9OA 1FKBA 2A3CA 2AOSA 3O5OA 5I98A 1KT1A 3O5PA 3JYJA 4AY1A 2WK2A 5HWBA 4J4NA 3WIJA 2M1IA 1FKFA 2RUCA 4TX0A 3ARRA 4WIWA 2RSEA 3CZ8A 3KCEA 2A3EA 1FJDA 3H9RB 4ODQA 2KO7A 2O92A 4PTMA 3RMEA 1W1TA 4ODKA 4HBOA 3EY6A 1E9LA 3KABA 1B6CA 4MTVA 1J4HA 3O5IA 1JNTA 3NI6A 4P8VA 4QT3A 4IT6A 4NZCA 4Z2KA 4TW7A 1PINA 4ODOA 1BL4A 4NSBA 1A7XA 2DG9A 4JFKA 4P8WA 1O6IA 1HJVA 3MDYB 5HUAA 2XP5A 3AS1A 1UR9A 1P5QA 3GPKA 3IHZA 4MAVA 1NWSA 2B31A 4Z2GA 2OFNA 4DWSA 3WD4A 1LJYA 3UI5A 4G2PA 1X6LA 2K8IA 1TFVA 2IF4A 4LAVA 4MNMA 2F21A 3O5FA 2ZQSA 3O5JA 3AROA 1E6ZA 1QPFA 1R9HA 4JFMA 3G6MA 4MGVA 4P8XA 4ZS6A 1FAPA 4GIVA 3IK8A 5B8IC 3UI6A 4ODPA 3PRAA 3LUOA 2WLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QT2 A;  3O5G A;  1T11 A;  1NMV A;  1TCO C;  4ODN A;  3VAW A;  1NSG A;  4IQ2 A;  3O5R A;  1EQ3 A;  3UF8 A;  4DZ2 A;  1YAT A;  2MNT A;  4IPX A;  1W26 A;  4DIP A;  3KAD A;  2DG3 A;  4J4O A;  2ZQU A;  1Y0O A;  2XPA A;  4GGQ A;  4DRJ A;  2LKN A;  4DRO A;  1FKG A;  2RQS A;  4G50 A;  4W9Q A;  1FKH A;  2M08 A;  2ZQT A;  1FKS A;  2PPP A;  1D7J A;  4ODR A;  1NMW A;  5GPG A;  4BF8 A;  3I6C A;  4IQC A;  2PV3 A;  1Q6I A;  1FKD A;  4QIB A;  2VN1 A;  4W9O A;  5DIV A;  1FKB A;  3TCZ A;  5J6E A;  2ZQV A;  3PRD A;  4DZ3 A;  4TYO A;  1EYM A;  1D7I A;  1FKJ A;  3O5O A;  3O5M A;  2XP8 A;  2AWG A;  3KZ7 A;  1F40 A;  1M5Y A;  2VCD A;  1D6O A;  3PA7 A;  1KT1 A;  1FKL A;  1ZK6 A;  4DRN A;  5I98 A;  3O5P A;  1PBK A;  3UQB A;  3JYJ A;  5HWB A;  4R0X A;  3CGN A;  3O5D A;  4J4N A;  1J6Y A;  2XP3 A;  3O5L A;  1ROU A;  1J4R A;  2XP7 A;  2M1I A;  1FKF A;  2RUC A;  1F8A B;  4TX0 A;  4ODM A;  4JFL A;  1U79 A;  2RSE A;  2XP4 A;  4JYS A;  4DH0 A;  3JXV A;  1QPL A;  2PPO A;  3KCE A;  3O5Q A;  3UI4 A;  1FJD A;  3H9R B;  2RUR A;  4ODQ A;  3RGC A;  4C02 B;  2KO7 A;  3NRK A;  5DIT A;  1C9H A;  2Y78 A;  1BKF A;  1Q6U A;  3ODK A;  4TW6 A;  4U86 A;  3IKD A;  2KE0 A;  4ODK A;  4FAP A;  2D9F A;  3OOB A;  3EY6 A;  2FKE A;  3KAB A;  3WH0 A;  3NTP A;  1B6C A;  1J4H A;  3O5E A;  1QZ2 A;  2MF9 A;  3KAC A;  3O5I A;  4LAX A;  3TC5 A;  5HKG A;  1JNT A;  2F2D A;  3NI6 A;  1D7H A;  4QT3 A;  3O5K A;  3KAF A;  2ZR5 A;  1FKI A;  2KFW A;  4TW7 A;  3UQA A;  1PIN A;  1Q1C A;  2MLZ A;  4N19 A;  1BL4 A;  4ODO A;  4U85 A;  1A7X A;  2DG9 A;  2PPN A;  1ZCN A;  2XP9 A;  5HT1 A;  1N1A A;  2MLX A;  5D75 A;  5DIU A;  1FKT A;  4JFK A;  2LPV A;  4DRH A;  2KI3 A;  3UQI A;  2L2S A;  3PRB A;  3KAG A;  2Q5A A;  2FAP A;  2MPH A;  3MDY B;  4JFJ A;  5HTG A;  4DRQ A;  5HUA A;  1KT0 A;  2JZV A;  3TDB A;  1FD9 A;  4DRM A;  4DT4 A;  1HXV A;  2LJ4 A;  1Q6H A;  3KAI A;  2KGJ A;  2XP5 A;  3IKG A;  4ITZ A;  2UZ5 A;  2XP6 A;  3KAH A;  3RFW A;  1P5Q A;  3GPK A;  3IHZ A;  1J4I A;  2KR7 A;  3FAP A;  2OFN A;  5HW8 A;  4NNR A;  1FKR A;  2DG4 A;  1JVW A;  2XPB A;  4JFI A;  4MSP A;  5BXJ A;  1ROT A;  5HW6 A;  2N87 A;  3JYM A;  4DRP A;  3UI5 A;  4G2P A;  4LAY A;  2K8I A;  2ZR4 A;  2IF4 A;  4LAV A;  1L1P A;  4O2T A;  2F21 A;  2F4E A;  2ZQS A;  1YW5 A;  3O5J A;  2LGO A;  3O5F A;  4LAW A;  4U84 A;  1QPF A;  2PV1 A;  1JNS A;  1R9H A;  2MLY A;  4DRI A;  4DRK A;  4JFM A;  4W9P A;  2RUQ A;  4MGV A;  3B7X A;  3CGM A;  1FAP A;  2M2A A;  2ZR6 A;  4GIV A;  4ODL A;  2PBC A;  4TNS A;  3IK8 A;  4TW8 A;  3UI6 A;  4FN2 A;  1FKK A;  4ODP A;  5B8I C;  2PV2 A;  5HW7 A;  2RUD A;  3LUO A;  2ITK A;  5HWC A; 
#chains in the Genus database with same CATH topology
 1E6P A;  1NMV A;  4MPK A;  3VAW A;  1WNO A;  1LL7 A;  1W26 A;  4DIP A;  2DG3 A;  3WD0 A;  1Y0O A;  2XPA A;  1GUV A;  4GGQ A;  4DRJ A;  2LKN A;  2RQS A;  3W4R A;  2EUL A;  4G50 A;  3FY1 A;  1E6R A;  1OGG A;  3I6C A;  2PV3 A;  1WAW A;  4DWS C;  1FKD A;  4QIB A;  1JND A;  1SYT A;  5DIV A;  1HJX A;  2ZQV A;  1EYM A;  1FKJ A;  3WKZ A;  2AWG A;  3KZ7 A;  3QOK A;  3G6L A;  3PA7 A;  1D6O A;  3ARU A;  4L72 B;  3RM8 A;  3WD2 A;  1ROU A;  1ZBK A;  4JFL A;  1HKM A;  1U79 A;  4JYS A;  1QPL A;  3UI4 A;  2A3B A;  3NRK A;  1BKF A;  5DEZ A;  3ODK A;  4TW6 A;  3IKD A;  4FAP A;  3B9D A;  3NTP A;  3O5E A;  1QZ2 A;  2MF9 A;  3BXW A;  2DSW A;  4LAX A;  2F2D A;  1D7H A;  1FKI A;  1D2K A;  2MLZ A;  4U85 A;  1CTN A;  1GOI A;  1N1A A;  2LPV A;  2L2S A;  2MPH A;  5HTG A;  1IX5 A;  4DRM A;  1W1Y A;  1HXV A;  1Q6H A;  3KAI A;  2KGJ A;  3B8S A;  4ITZ A;  1H0G A;  3RFW A;  5HBF A;  2DSZ A;  1HJW A;  3WQV A;  2DG4 A;  3B9A A;  4MNL A;  1WB0 A;  1XHG A;  1W1V A;  5HW6 A;  4URI A;  4WKA A;  4LAY A;  1L1P A;  4LGX A;  1YW5 A;  2DSV A;  2LGO A;  2DT3 A;  3OA5 A;  1ZL1 A;  3UQI A;  4W5U A;  2M2A A;  3AS2 A;  3ARQ A;  2PV2 A;  5HW7 A;  2RUD A;  2ITK A;  5HWC A;  1ZBC A;  3O5G A;  1E6N A;  4ODN A;  3O5R A;  2OLH A;  3UF8 A;  4DZ2 A;  5JH8 A;  1YAT A;  2MNT A;  3ALF A;  1KFW A;  4DRO A;  4W9Q A;  1EIB A;  2M08 A;  1XRV A;  1D7J A;  1NWU A;  3CHF A;  5GPG A;  3ARW A;  4IQC A;  1Q6I A;  3WD3 A;  4KQZ A;  3TCZ A;  1FFQ A;  4DZ3 A;  1W9P A;  1ZBV A;  3O5M A;  1FKL A;  3RM4 A;  4DRN A;  2DT2 A;  4ZPT R;  3O5D A;  1J6Y A;  3GU0 A;  3AQU A;  3ART A;  1J4R A;  3ARZ A;  2PI6 A;  4MNJ A;  2DT1 A;  2XP4 A;  3JXV A;  4ZPV R;  4Z2H A;  1C9H A;  2Y78 A;  3GTY X;  2DT0 A;  1Q6U A;  2YBT A;  1X6N A;  2B5U B;  2FDM A;  2D9F A;  3ARS A;  2FKE A;  3WH0 A;  2WLY A;  1W1P A;  4P8U A;  5HKG A;  4WJX A;  2ZR5 A;  1SR0 A;  2KFW A;  4L3N A;  4WK9 A;  2PPN A;  2XP9 A;  5HT1 A;  5DIU A;  3PRB A;  3KAG A;  2Q5A A;  2FAP A;  2G8Z A;  3ARX A;  1RD6 A;  3PR9 A;  3WL1 A;  2ETN A;  1LG2 A;  1J4I A;  2KR7 A;  3FAP A;  1HKI A;  3WL0 A;  3B9E A;  1FKR A;  1JVW A;  4JFI A;  5GQB A;  3RM9 A;  4MSP A;  5BXJ A;  4Q7N A;  1ITX A;  4ML4 A;  2WM0 A;  2ZR4 A;  3ARV A;  4Z2J A;  1JNS A;  3ALG A;  4W9P A;  2RUQ A;  3B7X A;  4TNS A;  4ODL A;  3TC5 A;  3WQW A;  1FKK A;  1W9V A;  4QT2 A;  1GPF A;  1H0I A;  1UR8 A;  4IQ2 A;  4WKF A;  4IPX A;  2ZQU A;  2DPE A;  3CH9 A;  4UDM A;  1NH6 A;  2YBU A;  2ZQT A;  1FKS A;  1NMW A;  4BF8 A;  1VF8 A;  3CHE A;  1ZBW A;  3PRD A;  4TYO A;  1D7I A;  4DWS D;  2XP8 A;  1M5Y A;  2VCD A;  4KR0 B;  1ZK6 A;  1PBK A;  3UQB A;  1K9T A;  4R0X A;  3CGN A;  2IUZ A;  2XP3 A;  3O5L A;  4ZPW R;  3AS3 A;  2XP7 A;  1F8A B;  4ODM A;  1JNE A;  5DF0 A;  4WKH A;  4DH0 A;  3O5Q A;  2PPO A;  3RGC A;  2RUR A;  5DO2 A;  4C02 B;  5DIT A;  4XAK A;  3WD1 A;  2A3A A;  2QF8 A;  4U86 A;  1OWQ A;  2KE0 A;  3OOB A;  1FFR A;  3ARY A;  3KAC A;  4Z2I A;  3O5K A;  3KAF A;  3UQA A;  1Q1C A;  4N19 A;  3CHC A;  4S3K A;  1ZCN A;  2MLX A;  5D75 A;  1OGB A;  1FKT A;  4DRH A;  2KI3 A;  4DWS B;  3EIP A;  4MNK A;  4JFJ A;  4DRQ A;  1KT0 A;  2JZV A;  3TDB A;  1FD9 A;  4DT4 A;  2LJ4 A;  3IKG A;  1ZB5 A;  3CHD A;  2UZ5 A;  2XP6 A;  3KAH A;  1LL4 A;  4IT4 A;  5HW8 A;  1HKJ A;  4NNR A;  2XPB A;  2ESC A;  1ROT A;  2N87 A;  2P4V A;  3JYM A;  4DRP A;  1LG1 A;  4QZV B;  4O2T A;  2F4E A;  1EDQ A;  4U84 A;  4LAW A;  2PV1 A;  3ARP A;  2MLY A;  2G41 A;  4DRI A;  4DRK A;  4Z2L A;  1ZU8 A;  3CGM A;  5J6E A;  2ZR6 A;  4TW8 A;  2PBC A;  1HKK A;  2DSU A;  4FN2 A;  1F40 A;  1EHN A;  1E15 A;  1T11 A;  1TCO C;  3AS0 A;  1NSG A;  4HAR A;  1EQ3 A;  1LL6 A;  1LQ0 A;  4R5E A;  1NWT A;  3KAD A;  4J4O A;  4Q22 A;  5GPR A;  3FXY A;  1FKG A;  1FKH A;  4HBE A;  2PPP A;  4S3J A;  4ODR A;  1W9U A;  1NWR A;  2O9O A;  2VN1 A;  4W9O A;  1FKB A;  2A3C A;  2AOS A;  3O5O A;  5I98 A;  1KT1 A;  3O5P A;  1JCH B;  3JYJ A;  4AY1 A;  2WK2 A;  5HWB A;  4J4N A;  3WIJ A;  2M1I A;  1FKF A;  2RUC A;  4TX0 A;  3ARR A;  4WIW A;  1E44 A;  2RSE A;  3CZ8 A;  3KCE A;  2A3E A;  1FJD A;  3H9R B;  4ODQ A;  2KO7 A;  2O92 A;  2F23 A;  4PTM A;  3RME A;  1W1T A;  4ODK A;  4HBO A;  3EY6 A;  1E9L A;  3BMB A;  3KAB A;  1B6C A;  4MTV A;  1J4H A;  3O5I A;  1JNT A;  3NI6 A;  4P8V A;  4QT3 A;  4IT6 A;  4NZC A;  4Z2K A;  4TW7 A;  1PIN A;  4ODO A;  1BL4 A;  4NSB A;  1A7X A;  2DG9 A;  4JFK A;  4P8W A;  1O6I A;  1HJV A;  3MDY B;  5HUA A;  2XP5 A;  3AS1 A;  1UR9 A;  1P5Q A;  3GPK A;  3IHZ A;  4MAV A;  1NWS A;  2B31 A;  4Z2G A;  2OFN A;  4DWS A;  3WD4 A;  1LJY A;  3UI5 A;  4G2P A;  1X6L A;  2K8I A;  1TFV A;  2IF4 A;  4LAV A;  4MNM A;  2F21 A;  3O5F A;  2PN0 A;  2ZQS A;  3ARO A;  3O5J A;  1E6Z A;  1QPF A;  1R9H A;  1GRJ A;  4JFM A;  3G6M A;  4MGV A;  4P8X A;  4ZS6 A;  1FAP A;  4GIV A;  3IK8 A;  5B8I C;  3UI6 A;  4ODP A;  3PRA A;  3LUO A;  2WLZ A; 
#chains in the Genus database with same CATH homology
 1E6P A;  1NMV A;  4MPK A;  3VAW A;  1WNO A;  1LL7 A;  1W26 A;  4DIP A;  2DG3 A;  3WD0 A;  1Y0O A;  2XPA A;  1GUV A;  4GGQ A;  4DRJ A;  2LKN A;  2RQS A;  3W4R A;  4G50 A;  3FY1 A;  1E6R A;  1OGG A;  3I6C A;  2PV3 A;  1WAW A;  4DWS C;  1FKD A;  4QIB A;  1JND A;  1SYT A;  5DIV A;  1HJX A;  2ZQV A;  1EYM A;  1FKJ A;  3WKZ A;  2AWG A;  3KZ7 A;  3QOK A;  3G6L A;  3PA7 A;  1D6O A;  3ARU A;  4L72 B;  3RM8 A;  3WD2 A;  1ROU A;  1ZBK A;  4JFL A;  1HKM A;  1U79 A;  4JYS A;  1QPL A;  3UI4 A;  2A3B A;  3NRK A;  1BKF A;  5DEZ A;  3ODK A;  4TW6 A;  3IKD A;  4FAP A;  3B9D A;  3NTP A;  3O5E A;  1QZ2 A;  2MF9 A;  3BXW A;  2DSW A;  4LAX A;  2F2D A;  1D7H A;  1FKI A;  1D2K A;  2MLZ A;  4U85 A;  1CTN A;  1GOI A;  1N1A A;  2LPV A;  2L2S A;  2MPH A;  5HTG A;  1IX5 A;  4DRM A;  1W1Y A;  1HXV A;  1Q6H A;  3KAI A;  2KGJ A;  3B8S A;  4ITZ A;  1H0G A;  3RFW A;  5HBF A;  2DSZ A;  1HJW A;  3WQV A;  2DG4 A;  3B9A A;  4MNL A;  1WB0 A;  1XHG A;  1W1V A;  5HW6 A;  4URI A;  4WKA A;  4LAY A;  1L1P A;  4LGX A;  1YW5 A;  2DSV A;  2LGO A;  2DT3 A;  3OA5 A;  1ZL1 A;  3UQI A;  4W5U A;  2M2A A;  3AS2 A;  3ARQ A;  2PV2 A;  5HW7 A;  2RUD A;  2ITK A;  5HWC A;  1ZBC A;  3O5G A;  1E6N A;  4ODN A;  3O5R A;  2OLH A;  3UF8 A;  4DZ2 A;  5JH8 A;  1YAT A;  2MNT A;  3ALF A;  1KFW A;  4DRO A;  4W9Q A;  1EIB A;  2M08 A;  1XRV A;  1D7J A;  1NWU A;  3CHF A;  5GPG A;  3ARW A;  4IQC A;  1Q6I A;  3WD3 A;  4KQZ A;  3TCZ A;  1FFQ A;  4DZ3 A;  1W9P A;  1ZBV A;  3O5M A;  1FKL A;  3RM4 A;  4DRN A;  2DT2 A;  4ZPT R;  3O5D A;  1J6Y A;  3AQU A;  3ART A;  1J4R A;  3ARZ A;  2PI6 A;  4MNJ A;  2DT1 A;  2XP4 A;  3JXV A;  4ZPV R;  4Z2H A;  1C9H A;  2Y78 A;  2DT0 A;  1Q6U A;  2YBT A;  1X6N A;  2FDM A;  2D9F A;  3ARS A;  2FKE A;  3WH0 A;  2WLY A;  1W1P A;  4P8U A;  5HKG A;  4WJX A;  2ZR5 A;  1SR0 A;  2KFW A;  4L3N A;  4WK9 A;  2PPN A;  2XP9 A;  5HT1 A;  5DIU A;  3PRB A;  3KAG A;  2Q5A A;  2FAP A;  2G8Z A;  3ARX A;  1RD6 A;  3PR9 A;  3WL1 A;  1LG2 A;  1J4I A;  2KR7 A;  3FAP A;  1HKI A;  3WL0 A;  3B9E A;  1FKR A;  1JVW A;  4JFI A;  5GQB A;  3RM9 A;  4MSP A;  5BXJ A;  4Q7N A;  1ITX A;  4ML4 A;  2WM0 A;  2ZR4 A;  3ARV A;  4Z2J A;  1JNS A;  3ALG A;  4W9P A;  2RUQ A;  3B7X A;  4TNS A;  4ODL A;  3TC5 A;  3WQW A;  1FKK A;  1W9V A;  4QT2 A;  1GPF A;  1H0I A;  1UR8 A;  4IQ2 A;  4WKF A;  4IPX A;  2ZQU A;  2DPE A;  3CH9 A;  1NH6 A;  2YBU A;  2ZQT A;  1FKS A;  1NMW A;  4BF8 A;  1VF8 A;  3CHE A;  1ZBW A;  3PRD A;  4TYO A;  1D7I A;  4DWS D;  2XP8 A;  1M5Y A;  2VCD A;  4KR0 B;  1ZK6 A;  1PBK A;  3UQB A;  1K9T A;  4R0X A;  3CGN A;  2IUZ A;  2XP3 A;  3O5L A;  4ZPW R;  3AS3 A;  2XP7 A;  1F8A B;  4ODM A;  1JNE A;  5DF0 A;  4WKH A;  4DH0 A;  3O5Q A;  2PPO A;  3RGC A;  2RUR A;  5DO2 A;  4C02 B;  5DIT A;  4XAK A;  3WD1 A;  2A3A A;  2QF8 A;  4U86 A;  1OWQ A;  2KE0 A;  3OOB A;  1FFR A;  3ARY A;  3KAC A;  4Z2I A;  3O5K A;  3KAF A;  3UQA A;  1Q1C A;  4N19 A;  3CHC A;  4S3K A;  1ZCN A;  2MLX A;  5D75 A;  1OGB A;  1FKT A;  4DRH A;  2KI3 A;  4DWS B;  4MNK A;  4JFJ A;  4DRQ A;  1KT0 A;  2JZV A;  3TDB A;  1FD9 A;  4DT4 A;  2LJ4 A;  3IKG A;  1ZB5 A;  3CHD A;  2UZ5 A;  2XP6 A;  3KAH A;  1LL4 A;  4IT4 A;  5HW8 A;  1HKJ A;  4NNR A;  2XPB A;  2ESC A;  1ROT A;  2N87 A;  3JYM A;  4DRP A;  1LG1 A;  4QZV B;  4O2T A;  2F4E A;  1EDQ A;  4U84 A;  4LAW A;  2PV1 A;  3ARP A;  2MLY A;  2G41 A;  4DRI A;  4DRK A;  4Z2L A;  1ZU8 A;  3CGM A;  5J6E A;  2ZR6 A;  4TW8 A;  2PBC A;  1HKK A;  2DSU A;  4FN2 A;  1F40 A;  1EHN A;  1E15 A;  1T11 A;  1TCO C;  3AS0 A;  1NSG A;  4HAR A;  1EQ3 A;  1LL6 A;  1LQ0 A;  4R5E A;  1NWT A;  3KAD A;  4J4O A;  4Q22 A;  5GPR A;  3FXY A;  1FKG A;  1FKH A;  4HBE A;  2PPP A;  4S3J A;  4ODR A;  1W9U A;  1NWR A;  2O9O A;  2VN1 A;  4W9O A;  1FKB A;  2A3C A;  2AOS A;  3O5O A;  5I98 A;  1KT1 A;  3O5P A;  3JYJ A;  4AY1 A;  2WK2 A;  5HWB A;  4J4N A;  3WIJ A;  2M1I A;  1FKF A;  2RUC A;  4TX0 A;  3ARR A;  4WIW A;  2RSE A;  3CZ8 A;  3KCE A;  2A3E A;  1FJD A;  3H9R B;  4ODQ A;  2KO7 A;  2O92 A;  4PTM A;  3RME A;  1W1T A;  4ODK A;  4HBO A;  3EY6 A;  1E9L A;  3KAB A;  1B6C A;  4MTV A;  1J4H A;  3O5I A;  1JNT A;  3NI6 A;  4P8V A;  4QT3 A;  4IT6 A;  4NZC A;  4Z2K A;  4TW7 A;  1PIN A;  4ODO A;  1BL4 A;  4NSB A;  1A7X A;  2DG9 A;  4JFK A;  4P8W A;  1O6I A;  1HJV A;  3MDY B;  5HUA A;  2XP5 A;  3AS1 A;  1UR9 A;  1P5Q A;  3GPK A;  3IHZ A;  4MAV A;  1NWS A;  2B31 A;  4Z2G A;  2OFN A;  4DWS A;  3WD4 A;  1LJY A;  3UI5 A;  4G2P A;  1X6L A;  2K8I A;  1TFV A;  2IF4 A;  4LAV A;  4MNM A;  2F21 A;  3O5F A;  2ZQS A;  3O5J A;  3ARO A;  1E6Z A;  1QPF A;  1R9H A;  4JFM A;  3G6M A;  4MGV A;  4P8X A;  4ZS6 A;  1FAP A;  4GIV A;  3IK8 A;  5B8I C;  3UI6 A;  4ODP A;  3PRA A;  3LUO A;  2WLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...