2RUQA

Solution structure of human pin1 ppiase mutant c113a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
GSHMEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDASSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Breakage of the Hydrogen Bond within the Dual-Histidine Motif in the Active Site of Human Pin1 PPIase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 31
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ruqA00
4FAPA 1QZ2A 4U86A 4LAWA 4TYOA 1FKRA 1B6CA 1D7HA 2ZR5A 2MPHA 4DIPA 1ZK6A 3UQIA 4DRIA 1QPFA 4G50A 1FAPA 1Y0OA 3VAWA 5D75A 4J4OA 1KT1A 4FN2A 3RFWA 1A7XA 3JYMA 4JFKA 4J4NA 2ITKA 3O5OA 2LPVA 2XP7A 4LAYA 5HUAA 1FKIA 3UI5A 2Q5AA 2XPBA 5I98A 1W26A 1FKKA 2DG4A 3O5EA 4JFIA 2JZVA 1HXVA 2XP4A 3TDBA 4GGQA 2MF9A 2D9FA 1PINA 5HT1A 3KAIA 1J4IA 4O2TA 3UI6A 5DIVA 4DH0A 1J4HA 4DT4A 4DRPA 2VN1A 1Q6UA 2KI3A 5HWCA 2FAPA 4ODRA 2RUDA 1ROTA 1JNTA 5HTGA 1FKFA 2PPNA 4U85A 1FJDA 3O5FA 1Q6HA 1F40A 1D6OA 1FKGA 4W9OA 3UF8A 5J6EA 2PV3A 4QT2A 1N1AA 2DG9A 3UI4A 1FD9A 2KFWA 2XP8A 1FKBA 2XP9A 4IQCA 2LKNA 5GPGA 1J4RA 1C9HA 1D7JA 4NNRA 3KABA 4TW7A 2N87A 2IF4A 3WH0A 1YATA 3GPKA 4U84A 1Q1CA 3KAGA 4QT3A 4DROA 1L1PA 2MLXA 2RURA 2K8IA 3O5QA 2PBCA 2VCDA 2ZQVA 1BKFA 4R0XA 4TNSA 1ROUA 2MLYA 2ZR6A 1FKDA 4DZ2A 5B8IC 2ZQUA 3TC5A 2AWGA 2ZQTA 1J6YA 3OOBA 2M2AA 4W9PA 4TX0A 5DIUA 1JNSA 1F8AB 1T11A 1D7IA 2F21A 2MNTA 3H9RB 4JFJA 5DITA 2M1IA 2F4EA 2RQSA 3KAHA 4ODPA 2MLZA 1M5YA 4ODQA 2KO7A 4DRKA 1P5QA 4N19A 1YW5A 3IHZA 3NTPA 1TCOC 3MDYB 1PBKA 3O5RA 3O5MA 4LAVA 1FKHA 2M08A 3IKDA 2RUQA 2PPOA 3KCEA 3PRBA 4C02B 2RUCA 2OFNA 2DG3A 1Q6IA 3JXVA 4IQ2A 4JFLA 3O5DA 4ODMA 3RGCA 3UQAA 1EQ3A 2ZQSA 3O5GA 3CGNA 3O5JA 3KACA 4BF8A 1U79A 2UZ5A 2KR7A 2LJ4A 2XPAA 1QPLA 4MSPA 4DRNA 1NMVA 3FAPA 2KE0A 2XP3A 2ZR4A 4IPXA 3KZ7A 2FKEA 2PV1A 4JFMA 1EYMA 1FKLA 3PA7A 3ODKA 1FKSA 1JVWA 3IKGA 3O5PA 5HKGA 5HW7A 3UQBA 4ODLA 2PPPA 3JYJA 4DRJA 4TW8A 3EY6A 3KAFA 3IK8A 3I6CA 5HWBA 1NMWA 3B7XA 1R9HA 3CGMA 3PRDA 1BL4A 4ODKA 4W9QA 3TCZA 2LGOA 2RSEA 4QIBA 2KGJA 1ZCNA 2PV2A 2Y78A 4GIVA 4DRHA 4ODNA 5BXJA 5HW6A 2XP5A 5HW8A 1FKTA 3O5IA 1KT0A 2L2SA 4ODOA 2XP6A 3LUOA 4G2PA 1NSGA 4JYSA 4DZ3A 4DRMA 3KADA 3O5LA 3NI6A 4ITZA 4DRQA 3O5KA 4LAXA 4MGVA 4TW6A 1FKJA 3NRKA 2F2DA
chains in the Genus database with same CATH superfamily
1QZ2A 4LAWA 1SYTA 1ZK6A 4ML4A 3QOKA 3RMEA 4DRIA 1QPFA 4ZPVR 3VAWA 3CHDA 3JYMA 4JFKA 4MAVA 2XP7A 4MNJA 5I98A 1ZBKA 2DG4A 2G41A 1HXVA 2XP4A 3FY1A 3TDBA 4MNMA 1LL6A 1PINA 3B9EA 3CHEA 5DIVA 2B31A 5JH8A 4ODRA 2RUDA 1ROTA 1JNTA 5HTGA 2PPNA 3ARXA 4R5EA 3WD2A 1FJDA 3WL0A 1WAWA 2PV3A 2A3BA 1FD9A 2XP8A 2DT1A 5GPGA 1J4RA 4NNRA 4TW7A 1CTNA 2IF4A 1Q1CA 4QT3A 1L1PA 2K8IA 4R0XA 1BKFA 1HKJA 5B8IC 1ITXA 3WQVA 3OA5A 4WJXA 1F8AB 1D7IA 4ZPTR 2RQSA 1OWQA 4ODQA 3O5RA 3O5MA 2IUZA 1FKHA 2RUQA 2PPOA 3KCEA 4ZS6A 2OFNA 1IX5A 3ARSA 3EIPA 3UQAA 3BMBA 3CGNA 4BF8A 1RD6A 1GUVA 2ZR4A 4S3JA 2YBUA 3PA7A 1FKLA 3UQBA 1JVWA 3G6MA 4P8WA 4ODLA 3JYJA 4DRJA 1X6LA 1R9HA 3CGMA 3CHFA 2KGJA 4KQZA 2WLZA 3RM4A 4GIVA 3CH9A 4DRHA 4Z2GA 5HW8A 4G2PA 2FDMA 3O5LA 3NI6A 4ITZA 4Q22A 4Z2IA 3O5KA 4TW6A 2WM0A 1HJVA 3NRKA 3ARWA 3GTYX 1H0IA 3AS0A 4FAPA 1W9PA 1B6CA 2ZR5A 3WL1A 3UQIA 1E6RA 4MPKA 2PI6A 1Y0OA 4P8UA 1E6NA 2B5UB 1KT1A 1O6IA 1A7XA 4LAYA 4J4NA 2LPVA 2P4VA 3O5EA 3AS2A 1TFVA 2JZVA 3B9AA 3ARYA 3PRAA 4HARA 4O2TA 4URIA 4DH0A 1VF8A 4PTMA 4DRPA 2VN1A 1UR9A 1OGBA 1D2KA 1FKFA 3FXYA 3O5FA 4W9OA 5J6EA 1W1PA 4QT2A 2DG9A 3WD3A 5DO2A 1E44A 1C9HA 2N87A 1HKIA 3WH0A 1LQ0A 4DROA 4TNSA 2MLYA 4P8XA 1J6YA 2M2AA 3ARPA 1JNSA 1ZBWA 1H0GA 4JFJA 1E6PA 2M1IA 2F4EA 3KAHA 3CHCA 1P5QA 1YW5A 4LAVA 3WQWA 1PBKA 4MNKA 2PN0A 4DWSA 4XAKA 1ZB5A 2DG3A 3O5DA 2O92A 2ZQSA 3O5GA 4MTVA 3AROA 1NMVA 4Z2JA 1NWRA 4JFMA 2FKEA 1LJYA 5HKGA 1FKSA 2PPPA 1HKKA 3KAFA 1LG2A 5HWBA 4ODKA 3B8SA 1XHGA 2LGOA 2A3CA 2Y78A 4NSBA 3WD4A 5BXJA 4ODOA 2XP6A 3ALGA 3AS1A 4JYSA 1ZU8A 3KADA 4DRQA 1FFQA 1FKJA 5HWCA 2F2DA 1EQ3A 4TYOA 4DWSD 1NWTA 1LL4A 2DT0A 3GU0A 4WIWA 4HBOA 4DWSC 1NH6A 3PR9A 4FN2A 3RFWA 1JNEA 5HUAA 4P8VA 3UI5A 1W26A 1FKKA 1XRVA 2MF9A 2G8ZA 1J4IA 4HBEA 1WB0A 5DF0A 1NWUA 4DT4A 1Q6UA 3B9DA 2FAPA 5HBFA 1X6NA 1ZBVA 2QF8A 1Q6HA 1D6OA 3UF8A 1N1AA 3UI4A 2KFWA 2XP9A 3WKZA 4IQCA 2ESCA 2LKNA 4Z2HA 1D7JA 1GRJA 3GPKA 4U84A 3KAGA 1FFRA 1W1TA 2MLXA 2RURA 3O5QA 2PBCA 2VCDA 2ZR6A 1FKDA 3BXWA 3TC5A 1JCHB 2F23A 4W9PA 1T11A 2MNTA 3H9RB 5DITA 4W5UA 2DSUA 2MLZA 1ZL1A 3IHZA 3MDYB 3WIJA 3IKDA 3PRBA 1ZBCA 4C02B 2RUCA 1Q6IA 4JFLA 4ODMA 1HJWA 3O5JA 2KR7A 2XPAA 3FAPA 3ARQA 2DSWA 2PV1A 1KFWA 3ODKA 3O5PA 1EDQA 4TW8A 3IK8A 3I6CA 1NMWA 2WK2A 3B7XA 3PRDA 4W9QA 3TCZA 1BL4A 4Z2KA 2PV2A 1OGGA 2AOSA 1E15A 3ALFA 3AS3A 1E6ZA 1E9LA 1FKTA 4QZVB 1W1VA 5DEZA 2YBTA 3LUOA 1NSGA 4DZ3A 5GPRA 1LG1A 3WD0A 2DSZA 4MGVA 4LGXA 4DZ2A 4U86A 4IT6A 4WKAA 1D7HA 2WLYA 2MPHA 4DIPA 3G6LA 2A3AA 4G50A 4UDMA 1FAPA 5D75A 4J4OA 4MNLA 3W4RA 2ITKA 3O5OA 1FKIA 2Q5AA 2XPBA 3CZ8A 4JFIA 4GGQA 2D9FA 2OLHA 5HT1A 1HKMA 3KAIA 3UI6A 1EHNA 1J4HA 2KI3A 5GQBA 2EULA 4U85A 2A3EA 1F40A 2DT2A 1FKGA 1WNOA 3ARUA 1FKBA 1W9UA 4WK9A 2ETNA 3KABA 1YATA 4NZCA 4AY1A 1FKRA 2ZQVA 1NWSA 2DPEA 1LL7A 1ROUA 1SR0A 2DSVA 2ZQUA 1JNDA 2AWGA 2ZQTA 3OOBA 3ARVA 4TX0A 5DIUA 4Z2LA 2F21A 1GOIA 4ODPA 4DWSB 3ARTA 2O9OA 3ARZA 1M5YA 4DRKA 2KO7A 4N19A 3NTPA 1TCOC 2M08A 1W1YA 4Q7NA 3JXVA 4IQ2A 1GPFA 4S3KA 4WKFA 3RGCA 3RM8A 3KACA 1U79A 2UZ5A 2LJ4A 4MSPA 1QPLA 4DRNA 4WKHA 4L3NA 2KE0A 2XP3A 4IPXA 3AQUA 3KZ7A 1EYMA 3IKGA 5HW7A 1W9VA 3RM9A 4KR0B 3EY6A 3WD1A 4L72B 1UR8A 2RSEA 1HJXA 2DT3A 4QIBA 1ZCNA 4IT4A 3ARRA 4ODNA 4ZPWR 5HW6A 2XP5A 3O5IA 1KT0A 2L2SA 4DRMA 4LAXA 1K9TA 1EIBA
chains in the Genus database with same CATH topology
1QZ2A 4LAWA 1SYTA 1ZK6A 4ML4A 3QOKA 3RMEA 4DRIA 1QPFA 4ZPVR 3VAWA 3CHDA 3JYMA 4JFKA 4MAVA 2XP7A 4MNJA 5I98A 1ZBKA 2DG4A 2G41A 1HXVA 2XP4A 3FY1A 3TDBA 4MNMA 1LL6A 1PINA 3B9EA 3CHEA 5DIVA 2B31A 5JH8A 4ODRA 2RUDA 1ROTA 1JNTA 5HTGA 2PPNA 3ARXA 4R5EA 3WD2A 1FJDA 3WL0A 1WAWA 2PV3A 2A3BA 1FD9A 2XP8A 2DT1A 5GPGA 1J4RA 4NNRA 4TW7A 1CTNA 2IF4A 1Q1CA 4QT3A 1L1PA 2K8IA 4R0XA 1BKFA 1HKJA 5B8IC 1ITXA 3WQVA 3OA5A 4WJXA 1F8AB 1D7IA 4ZPTR 2RQSA 1OWQA 4ODQA 3O5RA 3O5MA 2IUZA 1FKHA 2RUQA 2PPOA 3KCEA 4ZS6A 2OFNA 1IX5A 3ARSA 3UQAA 3CGNA 4BF8A 1RD6A 1GUVA 2ZR4A 4S3JA 2YBUA 3PA7A 1FKLA 3UQBA 1JVWA 3G6MA 4P8WA 4ODLA 3JYJA 4DRJA 1X6LA 1R9HA 3CGMA 3CHFA 2KGJA 4KQZA 2WLZA 3RM4A 4GIVA 3CH9A 4DRHA 4Z2GA 5HW8A 4G2PA 2FDMA 3O5LA 3NI6A 4ITZA 4Q22A 4Z2IA 3O5KA 4TW6A 2WM0A 1HJVA 3NRKA 3ARWA 1H0IA 3AS0A 4FAPA 1W9PA 1B6CA 2ZR5A 3WL1A 3UQIA 1E6RA 4MPKA 2PI6A 1Y0OA 4P8UA 1E6NA 1KT1A 1O6IA 1A7XA 4LAYA 4J4NA 2LPVA 3O5EA 3AS2A 1TFVA 2JZVA 3B9AA 3ARYA 3PRAA 4HARA 4O2TA 4URIA 4DH0A 1VF8A 4PTMA 4DRPA 2VN1A 1UR9A 1OGBA 1D2KA 1FKFA 3FXYA 3O5FA 4W9OA 5J6EA 1W1PA 4QT2A 2DG9A 3WD3A 5DO2A 1C9HA 2N87A 1HKIA 3WH0A 1LQ0A 4DROA 4TNSA 2MLYA 4P8XA 1J6YA 2M2AA 3ARPA 1JNSA 1ZBWA 1H0GA 4JFJA 1E6PA 2M1IA 2F4EA 3KAHA 3CHCA 1P5QA 1YW5A 4LAVA 3WQWA 1PBKA 4MNKA 4DWSA 4XAKA 1ZB5A 2DG3A 3O5DA 2O92A 2ZQSA 3O5GA 4MTVA 3AROA 1NMVA 4Z2JA 1NWRA 4JFMA 2FKEA 1LJYA 5HKGA 1FKSA 2PPPA 1HKKA 3KAFA 1LG2A 5HWBA 4ODKA 3B8SA 1XHGA 2LGOA 2A3CA 2Y78A 4NSBA 3WD4A 5BXJA 4ODOA 2XP6A 3ALGA 3AS1A 4JYSA 1ZU8A 3KADA 4DRQA 1FFQA 1FKJA 5HWCA 2F2DA 1EQ3A 4TYOA 4DWSD 1NWTA 1LL4A 2DT0A 4WIWA 4HBOA 4DWSC 1NH6A 3PR9A 4FN2A 3RFWA 1JNEA 5HUAA 4P8VA 3UI5A 1W26A 1FKKA 1XRVA 2MF9A 2G8ZA 1J4IA 4HBEA 1WB0A 5DF0A 1NWUA 4DT4A 1Q6UA 3B9DA 2FAPA 5HBFA 1X6NA 1ZBVA 2QF8A 1Q6HA 1D6OA 3UF8A 1N1AA 3UI4A 2KFWA 2XP9A 3WKZA 4IQCA 2ESCA 2LKNA 4Z2HA 1D7JA 3GPKA 4U84A 3KAGA 1FFRA 1W1TA 2MLXA 2RURA 3O5QA 2PBCA 2VCDA 2ZR6A 1FKDA 3BXWA 3TC5A 4W9PA 1T11A 2MNTA 3H9RB 5DITA 4W5UA 2DSUA 2MLZA 1ZL1A 3IHZA 3MDYB 3WIJA 3IKDA 3PRBA 1ZBCA 4C02B 2RUCA 1Q6IA 4JFLA 4ODMA 1HJWA 3O5JA 2KR7A 2XPAA 3FAPA 3ARQA 2DSWA 2PV1A 1KFWA 3ODKA 3O5PA 1EDQA 4TW8A 3IK8A 3I6CA 1NMWA 2WK2A 3B7XA 3PRDA 4W9QA 3TCZA 1BL4A 4Z2KA 2PV2A 1OGGA 2AOSA 1E15A 3ALFA 3AS3A 1E6ZA 1E9LA 1FKTA 4QZVB 1W1VA 5DEZA 2YBTA 3LUOA 1NSGA 4DZ3A 5GPRA 1LG1A 3WD0A 2DSZA 4MGVA 4LGXA 4DZ2A 4U86A 4IT6A 4WKAA 1D7HA 2WLYA 2MPHA 4DIPA 3G6LA 2A3AA 4G50A 1FAPA 5D75A 4J4OA 4MNLA 3W4RA 2ITKA 3O5OA 1FKIA 2Q5AA 2XPBA 3CZ8A 4JFIA 4GGQA 2D9FA 2OLHA 5HT1A 1HKMA 3KAIA 3UI6A 1EHNA 1J4HA 2KI3A 5GQBA 4U85A 2A3EA 1F40A 2DT2A 1FKGA 1WNOA 3ARUA 1FKBA 1W9UA 4WK9A 3KABA 1YATA 4NZCA 4AY1A 1FKRA 2ZQVA 1NWSA 2DPEA 1LL7A 1ROUA 1SR0A 2DSVA 2ZQUA 1JNDA 2AWGA 2ZQTA 3OOBA 3ARVA 4TX0A 5DIUA 4Z2LA 2F21A 1GOIA 4ODPA 4DWSB 3ARTA 2O9OA 3ARZA 1M5YA 4DRKA 2KO7A 4N19A 3NTPA 1TCOC 2M08A 1W1YA 4Q7NA 3JXVA 4IQ2A 1GPFA 4S3KA 4WKFA 3RGCA 3RM8A 3KACA 1U79A 2UZ5A 2LJ4A 4MSPA 1QPLA 4DRNA 4WKHA 4L3NA 2KE0A 2XP3A 4IPXA 3AQUA 3KZ7A 1EYMA 3IKGA 5HW7A 1W9VA 3RM9A 4KR0B 3EY6A 3WD1A 4L72B 1UR8A 2RSEA 1HJXA 2DT3A 4QIBA 1ZCNA 4IT4A 3ARRA 4ODNA 4ZPWR 5HW6A 2XP5A 3O5IA 1KT0A 2L2SA 4DRMA 4LAXA 1K9TA 1EIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAP A;  1QZ2 A;  4U86 A;  4LAW A;  4TYO A;  1FKR A;  1B6C A;  1D7H A;  2ZR5 A;  2MPH A;  4DIP A;  1ZK6 A;  3UQI A;  4DRI A;  1QPF A;  4G50 A;  1FAP A;  1Y0O A;  3VAW A;  5D75 A;  4J4O A;  1KT1 A;  4FN2 A;  3RFW A;  1A7X A;  3JYM A;  4JFK A;  4J4N A;  2ITK A;  3O5O A;  2LPV A;  2XP7 A;  4LAY A;  5HUA A;  1FKI A;  3UI5 A;  2Q5A A;  2XPB A;  5I98 A;  1W26 A;  1FKK A;  2DG4 A;  3O5E A;  4JFI A;  2JZV A;  1HXV A;  2XP4 A;  3TDB A;  4GGQ A;  2MF9 A;  2D9F A;  1PIN A;  5HT1 A;  3KAI A;  1J4I A;  4O2T A;  3UI6 A;  5DIV A;  4DH0 A;  1J4H A;  4DT4 A;  4DRP A;  2VN1 A;  1Q6U A;  2KI3 A;  5HWC A;  2FAP A;  4ODR A;  2RUD A;  1ROT A;  1JNT A;  5HTG A;  1FKF A;  2PPN A;  4U85 A;  1FJD A;  3O5F A;  1Q6H A;  1F40 A;  1D6O A;  1FKG A;  4W9O A;  3UF8 A;  5J6E A;  2PV3 A;  4QT2 A;  1N1A A;  2DG9 A;  3UI4 A;  1FD9 A;  2KFW A;  2XP8 A;  1FKB A;  2XP9 A;  4IQC A;  2LKN A;  5GPG A;  1J4R A;  1C9H A;  1D7J A;  4NNR A;  3KAB A;  4TW7 A;  2N87 A;  2IF4 A;  3WH0 A;  1YAT A;  3GPK A;  4U84 A;  1Q1C A;  3KAG A;  4QT3 A;  4DRO A;  1L1P A;  2MLX A;  2RUR A;  2K8I A;  3O5Q A;  2PBC A;  2VCD A;  2ZQV A;  1BKF A;  4R0X A;  4TNS A;  1ROU A;  2MLY A;  2ZR6 A;  1FKD A;  4DZ2 A;  5B8I C;  2ZQU A;  3TC5 A;  2AWG A;  2ZQT A;  1J6Y A;  3OOB A;  2M2A A;  4W9P A;  4TX0 A;  5DIU A;  1JNS A;  1F8A B;  1T11 A;  1D7I A;  2F21 A;  2MNT A;  3H9R B;  4JFJ A;  5DIT A;  2M1I A;  2F4E A;  2RQS A;  3KAH A;  4ODP A;  2MLZ A;  1M5Y A;  4ODQ A;  2KO7 A;  4DRK A;  1P5Q A;  4N19 A;  1YW5 A;  3IHZ A;  3NTP A;  1TCO C;  3MDY B;  1PBK A;  3O5R A;  3O5M A;  4LAV A;  1FKH A;  2M08 A;  3IKD A;  2RUQ A;  2PPO A;  3KCE A;  3PRB A;  4C02 B;  2RUC A;  2OFN A;  2DG3 A;  1Q6I A;  3JXV A;  4IQ2 A;  4JFL A;  3O5D A;  4ODM A;  3RGC A;  3UQA A;  1EQ3 A;  2ZQS A;  3O5G A;  3CGN A;  3O5J A;  3KAC A;  4BF8 A;  1U79 A;  2UZ5 A;  2KR7 A;  2LJ4 A;  2XPA A;  1QPL A;  4MSP A;  4DRN A;  1NMV A;  3FAP A;  2KE0 A;  2XP3 A;  2ZR4 A;  4IPX A;  3KZ7 A;  2FKE A;  2PV1 A;  4JFM A;  1EYM A;  1FKL A;  3PA7 A;  3ODK A;  1FKS A;  1JVW A;  3IKG A;  3O5P A;  5HKG A;  5HW7 A;  3UQB A;  4ODL A;  2PPP A;  3JYJ A;  4DRJ A;  4TW8 A;  3EY6 A;  3KAF A;  3IK8 A;  3I6C A;  5HWB A;  1NMW A;  3B7X A;  1R9H A;  3CGM A;  3PRD A;  1BL4 A;  4ODK A;  4W9Q A;  3TCZ A;  2LGO A;  2RSE A;  4QIB A;  2KGJ A;  1ZCN A;  2PV2 A;  2Y78 A;  4GIV A;  4DRH A;  4ODN A;  5BXJ A;  5HW6 A;  2XP5 A;  5HW8 A;  1FKT A;  3O5I A;  1KT0 A;  2L2S A;  4ODO A;  2XP6 A;  3LUO A;  4G2P A;  1NSG A;  4JYS A;  4DZ3 A;  4DRM A;  3KAD A;  3O5L A;  3NI6 A;  4ITZ A;  4DRQ A;  3O5K A;  4LAX A;  4MGV A;  4TW6 A;  1FKJ A;  3NRK A;  2F2D A; 
#chains in the Genus database with same CATH topology
 1QZ2 A;  4LAW A;  1SYT A;  1ZK6 A;  4ML4 A;  3QOK A;  3RME A;  4DRI A;  1QPF A;  4ZPV R;  3VAW A;  3CHD A;  3JYM A;  4JFK A;  4MAV A;  2XP7 A;  4MNJ A;  5I98 A;  1ZBK A;  2DG4 A;  2G41 A;  1HXV A;  2XP4 A;  3FY1 A;  3TDB A;  4MNM A;  1LL6 A;  1PIN A;  3B9E A;  3CHE A;  5DIV A;  2B31 A;  5JH8 A;  4ODR A;  2RUD A;  1ROT A;  1JNT A;  5HTG A;  2PPN A;  3ARX A;  4R5E A;  3WD2 A;  1FJD A;  3WL0 A;  1WAW A;  2PV3 A;  2A3B A;  1FD9 A;  2XP8 A;  2DT1 A;  5GPG A;  1J4R A;  4NNR A;  4TW7 A;  1CTN A;  2IF4 A;  1Q1C A;  4QT3 A;  1L1P A;  2K8I A;  4R0X A;  1BKF A;  1HKJ A;  5B8I C;  1ITX A;  3WQV A;  3OA5 A;  4WJX A;  1F8A B;  1D7I A;  4ZPT R;  2RQS A;  1OWQ A;  4ODQ A;  3O5R A;  3O5M A;  2IUZ A;  1FKH A;  2RUQ A;  2PPO A;  3KCE A;  4ZS6 A;  2OFN A;  1IX5 A;  3ARS A;  3EIP A;  3UQA A;  3BMB A;  3CGN A;  4BF8 A;  1RD6 A;  1GUV A;  2ZR4 A;  4S3J A;  2YBU A;  3PA7 A;  1FKL A;  3UQB A;  1JVW A;  3G6M A;  4P8W A;  4ODL A;  3JYJ A;  4DRJ A;  1X6L A;  1R9H A;  3CGM A;  3CHF A;  2KGJ A;  4KQZ A;  2WLZ A;  3RM4 A;  4GIV A;  3CH9 A;  4DRH A;  4Z2G A;  5HW8 A;  4G2P A;  2FDM A;  3O5L A;  3NI6 A;  4ITZ A;  4Q22 A;  4Z2I A;  3O5K A;  4TW6 A;  2WM0 A;  1HJV A;  3NRK A;  3ARW A;  3GTY X;  1H0I A;  3AS0 A;  4FAP A;  1W9P A;  1B6C A;  2ZR5 A;  3WL1 A;  3UQI A;  1E6R A;  4MPK A;  2PI6 A;  1Y0O A;  4P8U A;  1E6N A;  2B5U B;  1KT1 A;  1O6I A;  1A7X A;  4LAY A;  4J4N A;  2LPV A;  2P4V A;  3O5E A;  3AS2 A;  1TFV A;  2JZV A;  3B9A A;  3ARY A;  3PRA A;  4HAR A;  4O2T A;  4URI A;  4DH0 A;  1VF8 A;  4PTM A;  4DRP A;  2VN1 A;  1UR9 A;  1OGB A;  1D2K A;  1FKF A;  3FXY A;  3O5F A;  4W9O A;  5J6E A;  1W1P A;  4QT2 A;  2DG9 A;  3WD3 A;  5DO2 A;  1E44 A;  1C9H A;  2N87 A;  1HKI A;  3WH0 A;  1LQ0 A;  4DRO A;  4TNS A;  2MLY A;  4P8X A;  1J6Y A;  2M2A A;  3ARP A;  1JNS A;  1ZBW A;  1H0G A;  4JFJ A;  1E6P A;  2M1I A;  2F4E A;  3KAH A;  3CHC A;  1P5Q A;  1YW5 A;  4LAV A;  3WQW A;  1PBK A;  4MNK A;  2PN0 A;  4DWS A;  4XAK A;  1ZB5 A;  2DG3 A;  3O5D A;  2O92 A;  2ZQS A;  3O5G A;  4MTV A;  3ARO A;  1NMV A;  4Z2J A;  1NWR A;  4JFM A;  2FKE A;  1LJY A;  5HKG A;  1FKS A;  2PPP A;  1HKK A;  3KAF A;  1LG2 A;  5HWB A;  4ODK A;  3B8S A;  1XHG A;  2LGO A;  2A3C A;  2Y78 A;  4NSB A;  3WD4 A;  5BXJ A;  4ODO A;  2XP6 A;  3ALG A;  3AS1 A;  4JYS A;  1ZU8 A;  3KAD A;  4DRQ A;  1FFQ A;  1FKJ A;  5HWC A;  2F2D A;  1EQ3 A;  4TYO A;  4DWS D;  1NWT A;  1LL4 A;  2DT0 A;  3GU0 A;  4WIW A;  4HBO A;  4DWS C;  1NH6 A;  3PR9 A;  4FN2 A;  3RFW A;  1JNE A;  5HUA A;  4P8V A;  3UI5 A;  1W26 A;  1FKK A;  1XRV A;  2MF9 A;  2G8Z A;  1J4I A;  4HBE A;  1WB0 A;  5DF0 A;  1NWU A;  4DT4 A;  1Q6U A;  3B9D A;  2FAP A;  5HBF A;  1X6N A;  1ZBV A;  2QF8 A;  1Q6H A;  1D6O A;  3UF8 A;  1N1A A;  3UI4 A;  2KFW A;  2XP9 A;  3WKZ A;  4IQC A;  2ESC A;  2LKN A;  4Z2H A;  1D7J A;  1GRJ A;  3GPK A;  4U84 A;  3KAG A;  1FFR A;  1W1T A;  2MLX A;  2RUR A;  3O5Q A;  2PBC A;  2VCD A;  2ZR6 A;  1FKD A;  3BXW A;  3TC5 A;  1JCH B;  2F23 A;  4W9P A;  1T11 A;  2MNT A;  3H9R B;  5DIT A;  4W5U A;  2DSU A;  2MLZ A;  1ZL1 A;  3IHZ A;  3MDY B;  3WIJ A;  3IKD A;  3PRB A;  1ZBC A;  4C02 B;  2RUC A;  1Q6I A;  4JFL A;  4ODM A;  1HJW A;  3O5J A;  2KR7 A;  2XPA A;  3FAP A;  3ARQ A;  2DSW A;  2PV1 A;  1KFW A;  3ODK A;  3O5P A;  1EDQ A;  4TW8 A;  3IK8 A;  3I6C A;  1NMW A;  2WK2 A;  3B7X A;  3PRD A;  4W9Q A;  3TCZ A;  1BL4 A;  4Z2K A;  2PV2 A;  1OGG A;  2AOS A;  1E15 A;  3ALF A;  3AS3 A;  1E6Z A;  1E9L A;  1FKT A;  4QZV B;  1W1V A;  5DEZ A;  2YBT A;  3LUO A;  1NSG A;  4DZ3 A;  5GPR A;  1LG1 A;  3WD0 A;  2DSZ A;  4MGV A;  4LGX A;  4DZ2 A;  4U86 A;  4IT6 A;  4WKA A;  1D7H A;  2WLY A;  2MPH A;  4DIP A;  3G6L A;  2A3A A;  4G50 A;  4UDM A;  1FAP A;  5D75 A;  4J4O A;  4MNL A;  3W4R A;  2ITK A;  3O5O A;  1FKI A;  2Q5A A;  2XPB A;  3CZ8 A;  4JFI A;  4GGQ A;  2D9F A;  2OLH A;  5HT1 A;  1HKM A;  3KAI A;  3UI6 A;  1EHN A;  1J4H A;  2KI3 A;  5GQB A;  2EUL A;  4U85 A;  2A3E A;  1F40 A;  2DT2 A;  1FKG A;  1WNO A;  3ARU A;  1FKB A;  1W9U A;  4WK9 A;  2ETN A;  3KAB A;  1YAT A;  4NZC A;  4AY1 A;  1FKR A;  2ZQV A;  1NWS A;  2DPE A;  1LL7 A;  1ROU A;  1SR0 A;  2DSV A;  2ZQU A;  1JND A;  2AWG A;  2ZQT A;  3OOB A;  3ARV A;  4TX0 A;  5DIU A;  4Z2L A;  2F21 A;  1GOI A;  4ODP A;  4DWS B;  3ART A;  2O9O A;  3ARZ A;  1M5Y A;  4DRK A;  2KO7 A;  4N19 A;  3NTP A;  1TCO C;  2M08 A;  1W1Y A;  4Q7N A;  3JXV A;  4IQ2 A;  1GPF A;  4S3K A;  4WKF A;  3RGC A;  3RM8 A;  3KAC A;  1U79 A;  2UZ5 A;  2LJ4 A;  4MSP A;  1QPL A;  4DRN A;  4WKH A;  4L3N A;  2KE0 A;  2XP3 A;  4IPX A;  3AQU A;  3KZ7 A;  1EYM A;  3IKG A;  5HW7 A;  1W9V A;  3RM9 A;  4KR0 B;  3EY6 A;  3WD1 A;  4L72 B;  1UR8 A;  2RSE A;  1HJX A;  2DT3 A;  4QIB A;  1ZCN A;  4IT4 A;  3ARR A;  4ODN A;  4ZPW R;  5HW6 A;  2XP5 A;  3O5I A;  1KT0 A;  2L2S A;  4DRM A;  4LAX A;  1K9T A;  1EIB A; 
#chains in the Genus database with same CATH homology
 1QZ2 A;  4LAW A;  1SYT A;  1ZK6 A;  4ML4 A;  3QOK A;  3RME A;  4DRI A;  1QPF A;  4ZPV R;  3VAW A;  3CHD A;  3JYM A;  4JFK A;  4MAV A;  2XP7 A;  4MNJ A;  5I98 A;  1ZBK A;  2DG4 A;  2G41 A;  1HXV A;  2XP4 A;  3FY1 A;  3TDB A;  4MNM A;  1LL6 A;  1PIN A;  3B9E A;  3CHE A;  5DIV A;  2B31 A;  5JH8 A;  4ODR A;  2RUD A;  1ROT A;  1JNT A;  5HTG A;  2PPN A;  3ARX A;  4R5E A;  3WD2 A;  1FJD A;  3WL0 A;  1WAW A;  2PV3 A;  2A3B A;  1FD9 A;  2XP8 A;  2DT1 A;  5GPG A;  1J4R A;  4NNR A;  4TW7 A;  1CTN A;  2IF4 A;  1Q1C A;  4QT3 A;  1L1P A;  2K8I A;  4R0X A;  1BKF A;  1HKJ A;  5B8I C;  1ITX A;  3WQV A;  3OA5 A;  4WJX A;  1F8A B;  1D7I A;  4ZPT R;  2RQS A;  1OWQ A;  4ODQ A;  3O5R A;  3O5M A;  2IUZ A;  1FKH A;  2RUQ A;  2PPO A;  3KCE A;  4ZS6 A;  2OFN A;  1IX5 A;  3ARS A;  3UQA A;  3CGN A;  4BF8 A;  1RD6 A;  1GUV A;  2ZR4 A;  4S3J A;  2YBU A;  3PA7 A;  1FKL A;  3UQB A;  1JVW A;  3G6M A;  4P8W A;  4ODL A;  3JYJ A;  4DRJ A;  1X6L A;  1R9H A;  3CGM A;  3CHF A;  2KGJ A;  4KQZ A;  2WLZ A;  3RM4 A;  4GIV A;  3CH9 A;  4DRH A;  4Z2G A;  5HW8 A;  4G2P A;  2FDM A;  3O5L A;  3NI6 A;  4ITZ A;  4Q22 A;  4Z2I A;  3O5K A;  4TW6 A;  2WM0 A;  1HJV A;  3NRK A;  3ARW A;  1H0I A;  3AS0 A;  4FAP A;  1W9P A;  1B6C A;  2ZR5 A;  3WL1 A;  3UQI A;  1E6R A;  4MPK A;  2PI6 A;  1Y0O A;  4P8U A;  1E6N A;  1KT1 A;  1O6I A;  1A7X A;  4LAY A;  4J4N A;  2LPV A;  3O5E A;  3AS2 A;  1TFV A;  2JZV A;  3B9A A;  3ARY A;  3PRA A;  4HAR A;  4O2T A;  4URI A;  4DH0 A;  1VF8 A;  4PTM A;  4DRP A;  2VN1 A;  1UR9 A;  1OGB A;  1D2K A;  1FKF A;  3FXY A;  3O5F A;  4W9O A;  5J6E A;  1W1P A;  4QT2 A;  2DG9 A;  3WD3 A;  5DO2 A;  1C9H A;  2N87 A;  1HKI A;  3WH0 A;  1LQ0 A;  4DRO A;  4TNS A;  2MLY A;  4P8X A;  1J6Y A;  2M2A A;  3ARP A;  1JNS A;  1ZBW A;  1H0G A;  4JFJ A;  1E6P A;  2M1I A;  2F4E A;  3KAH A;  3CHC A;  1P5Q A;  1YW5 A;  4LAV A;  3WQW A;  1PBK A;  4MNK A;  4DWS A;  4XAK A;  1ZB5 A;  2DG3 A;  3O5D A;  2O92 A;  2ZQS A;  3O5G A;  4MTV A;  3ARO A;  1NMV A;  4Z2J A;  1NWR A;  4JFM A;  2FKE A;  1LJY A;  5HKG A;  1FKS A;  2PPP A;  1HKK A;  3KAF A;  1LG2 A;  5HWB A;  4ODK A;  3B8S A;  1XHG A;  2LGO A;  2A3C A;  2Y78 A;  4NSB A;  3WD4 A;  5BXJ A;  4ODO A;  2XP6 A;  3ALG A;  3AS1 A;  4JYS A;  1ZU8 A;  3KAD A;  4DRQ A;  1FFQ A;  1FKJ A;  5HWC A;  2F2D A;  1EQ3 A;  4TYO A;  4DWS D;  1NWT A;  1LL4 A;  2DT0 A;  4WIW A;  4HBO A;  4DWS C;  1NH6 A;  3PR9 A;  4FN2 A;  3RFW A;  1JNE A;  5HUA A;  4P8V A;  3UI5 A;  1W26 A;  1FKK A;  1XRV A;  2MF9 A;  2G8Z A;  1J4I A;  4HBE A;  1WB0 A;  5DF0 A;  1NWU A;  4DT4 A;  1Q6U A;  3B9D A;  2FAP A;  5HBF A;  1X6N A;  1ZBV A;  2QF8 A;  1Q6H A;  1D6O A;  3UF8 A;  1N1A A;  3UI4 A;  2KFW A;  2XP9 A;  3WKZ A;  4IQC A;  2ESC A;  2LKN A;  4Z2H A;  1D7J A;  3GPK A;  4U84 A;  3KAG A;  1FFR A;  1W1T A;  2MLX A;  2RUR A;  3O5Q A;  2PBC A;  2VCD A;  2ZR6 A;  1FKD A;  3BXW A;  3TC5 A;  4W9P A;  1T11 A;  2MNT A;  3H9R B;  5DIT A;  4W5U A;  2DSU A;  2MLZ A;  1ZL1 A;  3IHZ A;  3MDY B;  3WIJ A;  3IKD A;  3PRB A;  1ZBC A;  4C02 B;  2RUC A;  1Q6I A;  4JFL A;  4ODM A;  1HJW A;  3O5J A;  2KR7 A;  2XPA A;  3FAP A;  3ARQ A;  2DSW A;  2PV1 A;  1KFW A;  3ODK A;  3O5P A;  1EDQ A;  4TW8 A;  3IK8 A;  3I6C A;  1NMW A;  2WK2 A;  3B7X A;  3PRD A;  4W9Q A;  3TCZ A;  1BL4 A;  4Z2K A;  2PV2 A;  1OGG A;  2AOS A;  1E15 A;  3ALF A;  3AS3 A;  1E6Z A;  1E9L A;  1FKT A;  4QZV B;  1W1V A;  5DEZ A;  2YBT A;  3LUO A;  1NSG A;  4DZ3 A;  5GPR A;  1LG1 A;  3WD0 A;  2DSZ A;  4MGV A;  4LGX A;  4DZ2 A;  4U86 A;  4IT6 A;  4WKA A;  1D7H A;  2WLY A;  2MPH A;  4DIP A;  3G6L A;  2A3A A;  4G50 A;  1FAP A;  5D75 A;  4J4O A;  4MNL A;  3W4R A;  2ITK A;  3O5O A;  1FKI A;  2Q5A A;  2XPB A;  3CZ8 A;  4JFI A;  4GGQ A;  2D9F A;  2OLH A;  5HT1 A;  1HKM A;  3KAI A;  3UI6 A;  1EHN A;  1J4H A;  2KI3 A;  5GQB A;  4U85 A;  2A3E A;  1F40 A;  2DT2 A;  1FKG A;  1WNO A;  3ARU A;  1FKB A;  1W9U A;  4WK9 A;  3KAB A;  1YAT A;  4NZC A;  4AY1 A;  1FKR A;  2ZQV A;  1NWS A;  2DPE A;  1LL7 A;  1ROU A;  1SR0 A;  2DSV A;  2ZQU A;  1JND A;  2AWG A;  2ZQT A;  3OOB A;  3ARV A;  4TX0 A;  5DIU A;  4Z2L A;  2F21 A;  1GOI A;  4ODP A;  4DWS B;  3ART A;  2O9O A;  3ARZ A;  1M5Y A;  4DRK A;  2KO7 A;  4N19 A;  3NTP A;  1TCO C;  2M08 A;  1W1Y A;  4Q7N A;  3JXV A;  4IQ2 A;  1GPF A;  4S3K A;  4WKF A;  3RGC A;  3RM8 A;  3KAC A;  1U79 A;  2UZ5 A;  2LJ4 A;  4MSP A;  1QPL A;  4DRN A;  4WKH A;  4L3N A;  2KE0 A;  2XP3 A;  4IPX A;  3AQU A;  3KZ7 A;  1EYM A;  3IKG A;  5HW7 A;  1W9V A;  3RM9 A;  4KR0 B;  3EY6 A;  3WD1 A;  4L72 B;  1UR8 A;  2RSE A;  1HJX A;  2DT3 A;  4QIB A;  1ZCN A;  4IT4 A;  3ARR A;  4ODN A;  4ZPW R;  5HW6 A;  2XP5 A;  3O5I A;  1KT0 A;  2L2S A;  4DRM A;  4LAX A;  1K9T A;  1EIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...