2RUQA

Solution structure of human pin1 ppiase mutant c113a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
b'GSHMEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDASSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Allosteric Breakage of the Hydrogen Bond within the Dual-Histidine Motif in the Active Site of Human Pin1 PPIase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 31
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ruqA00
3UI6A 4ODNA 1PBKA 5BXJA 1D7JA 2D9FA 1JNSA 2ITKA 3KZ7A 4ODOA 4ODPA 2KO7A 5D75A 1ROTA 2M08A 4QIBA 5I98A 1QPLA 3O5GA 3UQIA 4G50A 1P5QA 2LPVA 1FKLA 2XP4A 3KACA 2PPNA 2RUQA 4DH0A 2M2AA 3CGNA 4TW7A 4DRPA 2VCDA 3O5FA 3IKGA 2XP5A 1YW5A 4IQCA 3UI5A 2RUCA 4DZ3A 1FKBA 1FKDA 4FN2A 4DRNA 5HKGA 2KR7A 3IK8A 3TCZA 3TDBA 2XPBA 1Q6UA 2IF4A 4IPXA 2FKEA 4TNSA 2MPHA 1BKFA 3NTPA 4TW6A 4ODLA 4FAPA 4J4OA 1ZCNA 1FAPA 3VAWA 1FKTA 3O5EA 3KADA 4ITZA 4DRQA 1J4RA 2ZR4A 2L2SA 1R9HA 1J6YA 5B8IC 1FKHA 2OFNA 3O5IA 4MSPA 1B6CA 2ZQVA 3PA7A 2FAPA 4DROA 2F21A 4DRIA 4R0XA 4ODKA 1PINA 1JNTA 5DIVA 1Q1CA 4TX0A 2MLXA 2KI3A 2ZQUA 3O5QA 4TW8A 3UI4A 4QT3A 4W9QA 4W9PA 3UF8A 4JFJA 1KT1A 2PBCA 3GPKA 4DRJA 1FD9A 3KCEA 3O5KA 3JYMA 2RURA 1FKGA 3I6CA 3O5MA 2K8IA 2DG4A 4DRHA 3O5RA 2PPPA 1C9HA 4DIPA 3ODKA 2DG9A 2LGOA 1BL4A 2PV3A 4MGVA 4U84A 3O5DA 2MF9A 1Q6HA 4ODRA 2RUDA 2M1IA 3LUOA 1A7XA 4LAVA 2F2DA 5HWCA 1KT0A 2XP8A 3EY6A 3O5PA 5HUAA 5HW6A 4DT4A 5DIUA 3TC5A 1EYMA 2MLZA 2N87A 4JFKA 3NRKA 4LAYA 2RQSA 1T11A 2XP6A 3O5JA 4U86A 4QT2A 2PV2A 1N1AA 5HTGA 2UZ5A 3CGMA 4JYSA 3KAGA 3RFWA 1QPFA 4J4NA 3IHZA 1L1PA 1FKJA 2F4EA 1NMVA 2LKNA 3H9RB 4O2TA 3FAPA 1F40A 4NNRA 4W9OA 4ODQA 1FJDA 5J6EA 4IQ2A 1W26A 1D7IA 1J4HA 1FKKA 3NI6A 5HT1A 2XPAA 1ROUA 2JZVA 2KFWA 3KAIA 3O5OA 3WH0A 2PPOA 4TYOA 4JFLA 2ZQSA 2ZR5A 2DG3A 1JVWA 1FKSA 3B7XA 2ZR6A 4ODMA 1FKRA 3IKDA 2Q5AA 3KAHA 2KE0A 4GGQA 5DITA 5GPGA 2XP7A 1FKFA 3KABA 5HW8A 4JFMA 4LAXA 2PV1A 4BF8A 3JXVA 1FKIA 3PRDA 5HW7A 1F8AB 2AWGA 3OOBA 4U85A 5HWBA 2Y78A 4G2PA 3RGCA 3PRBA 1QZ2A 1J4IA 3O5LA 1YATA 1ZK6A 2LJ4A 3JYJA 2VN1A 4LAWA 2ZQTA 2MNTA 3MDYB 2KGJA 1D6OA 1HXVA 1M5YA 4DRKA 3UQBA 3UQAA 2XP9A 4C02B 2RSEA 4N19A 1Q6IA 2XP3A 4DZ2A 4GIVA 4DRMA 1EQ3A 1U79A 1Y0OA 1D7HA 1NMWA 1NSGA 1TCOC 4JFIA 2MLYA 3KAFA
chains in the Genus database with same CATH superfamily
1PBKA 5DEZA 5BXJA 2D9FA 3CHEA 1JNSA 2O92A 4ODPA 3W4RA 1IX5A 1ROTA 1QPLA 3UQIA 2WK2A 1FKLA 3KACA 2RUQA 4AY1A 3CGNA 4TW7A 2VCDA 3O5FA 3IKGA 4W5UA 1HJXA 1ZB5A 4IQCA 2RUCA 1FKBA 1HJVA 4Z2GA 1SR0A 4DRNA 3AROA 3FXYA 2KR7A 3TCZA 2XPBA 4IPXA 1BKFA 3ALGA 1ZCNA 4ZPVR 3VAWA 2WM0A 3ARQA 1OGGA 2OFNA 4MSPA 2FAPA 1UR8A 1JNTA 1Q1CA 2DPEA 1KT1A 4Z2HA 1FD9A 3KCEA 3I6CA 3O5RA 2PPPA 2YBUA 3WD4A 2AOSA 2LGOA 4MGVA 2G8ZA 1LG2A 2DSZA 5DF0A 1X6LA 4Q7NA 3GU0A 4ZPTR 3EY6A 5HUAA 5DIUA 2A3EA 1NWTA 1EYMA 3NRKA 4L72B 4U86A 1LG1A 1E9LA 4QT2A 2UZ5A 3CGMA 4DWSC 4IT6A 4J4NA 4S3KA 2F4EA 2LKNA 1VF8A 4W9OA 4ODQA 5J6EA 4IT4A 1J4HA 1LJYA 3WQWA 1FKKA 2DT1A 1ROUA 4JFLA 1JVWA 1FKSA 2ZR6A 1FKRA 2Q5AA 5HW8A 4NZCA 1JNEA 3QOKA 3OA5A 3PRBA 1QZ2A 3WD1A 1J4IA 1YATA 4LAWA 4Z2JA 3MDYB 3RM9A 1D6OA 1OGBA 3UQAA 2RSEA 3AS1A 4GIVA 1EQ3A 1EIBA 1U79A 1D7HA 1Y0OA 1WAWA 2MLYA 3KAFA 4Z2LA 1E44A 4MAVA 2EULA 2M08A 2B31A 3O5GA 2G41A 2XP4A 3ARPA 3WIJA 1D2KA 1FKDA 1JNDA 1H0IA 1E15A 2IF4A 1X6NA 4TNSA 3NTPA 4HBOA 4TW6A 4ZS6A 4XAKA 3KADA 3ARRA 4ITZA 4DRQA 2L2SA 1J6YA 5B8IC 1FKHA 3O5IA 1B6CA 2DSUA 3CHDA 4WJXA 2F21A 3ARSA 2PN0A 4ODKA 1PINA 4TX0A 3PR9A 3O5QA 4MNJA 4W9PA 1E6ZA 3ARWA 1KFWA 3JYMA 4DRHA 1C9HA 1W9UA 2DG9A 1BL4A 2PV3A 4U84A 3WQVA 2WLZA 2YBTA 1NH6A 1HKMA 2MF9A 4ODRA 2RUDA 3RM8A 2F2DA 4Q22A 5HWCA 2XP8A 1ZU8A 4L3NA 3ALFA 1E6NA 2MLZA 4JFKA 2RQSA 3O5JA 1N1AA 2B5UB 2A3AA 4NSBA 3IHZA 3AS0A 1F40A 4ZPWR 1E6RA 4IQ2A 2IUZA 3NI6A 1FFRA 1LL6A 2JZVA 1RD6A 2KFWA 2XPAA 3O5OA 3WH0A 2PPOA 3EIPA 4TYOA 1LQ0A 2DG3A 4GGQA 5DITA 3AS2A 4LGXA 5GPRA 3KABA 1ZBVA 5HW7A 2AWGA 4U85A 1JCHB 3WL1A 3JYJA 2VN1A 1ZBCA 1HKIA 4WIWA 5HBFA 4P8VA 1NSGA 3RFWA 4JFIA 4ML4A 3PA7A 1D7JA 1LL4A 2ITKA 1K9TA 2KO7A 3WKZA 5D75A 4QIBA 4G50A 1XHGA 4P8WA 1P5QA 3WL0A 4DH0A 4MNKA 2M2AA 3WD2A 3B9AA 1YW5A 2P4VA 4DZ3A 4KR0B 3BMBA 4QZVB 4WKHA 3RMEA 2MPHA 4UDMA 1TFVA 3B8SA 2QF8A 4MNMA 2ZR4A 1HKJA 4Z2KA 4MNLA 3B9DA 4DWSA 2DT0A 4DROA 1W1PA 4S3JA 4DRIA 4R0XA 5DIVA 1ZBKA 3WD3A 2MLXA 2KI3A 2ZQUA 3ARYA 4QT3A 4W9QA 1H0GA 1NWRA 4JFJA 3UF8A 5GQBA 3GPKA 3O5KA 2RURA 1FKGA 4HBEA 2DG4A 2F23A 3ARZA 3ODKA 3G6MA 4KQZA 2M1IA 3AS3A 1KT0A 3O5PA 5HW6A 4DT4A 4P8XA 3TC5A 2N87A 1W9PA 1T11A 2XP6A 3GTYX 1ZL1A 2PV2A 3WD0A 3AQUA 3CZ8A 3ARTA 2OLHA 1L1PA 1NMVA 2A3BA 4PTMA 5HT1A 2PI6A 2ZQSA 2ZR5A 3IKDA 2O9OA 1O6IA 2KE0A 3CH9A 2FDMA 4LAXA 4BF8A 2PV1A 3JXVA 1F8AB 3OOBA 1WNOA 5HWBA 2Y78A 3O5LA 4URIA 1ZK6A 4P8UA 2ZQTA 2MNTA 2KGJA 4DRKA 2XP9A 2DSVA 1Q6IA 2XP3A 4N19A 4DZ2A 1TCOC 2WLYA 1ITXA 3UI6A 4ODNA 4WK9A 2DT3A 3KZ7A 4ODOA 1HJWA 5I98A 1SYTA 4MTVA 1HKKA 4R5EA 1ZBWA 3BXWA 3ARUA 2LPVA 2PPNA 1GRJA 3RM4A 4DRPA 5JH8A 2XP5A 3UI5A 1W1VA 4DWSB 1W9VA 4FN2A 5HKGA 3IK8A 4DWSD 3TDBA 4WKAA 1Q6UA 4Z2IA 2FKEA 4ODLA 4FAPA 1FFQA 4J4OA 1FAPA 1FKTA 1GPFA 1E6PA 3O5EA 1CTNA 1J4RA 1R9HA 2ESCA 2ZQVA 1UR9A 2DT2A 3FY1A 3ARVA 1EDQA 4TW8A 3UI4A 3ARXA 2PBCA 4DRJA 4HARA 1NWUA 1GOIA 3O5MA 2K8IA 3B9EA 4DIPA 3O5DA 1Q6HA 1LL7A 3LUOA 1A7XA 1W1TA 4LAVA 1WB0A 1NWSA 1W1YA 4LAYA 5HTGA 4JYSA 3KAGA 1QPFA 3CHFA 1FKJA 3H9RB 3PRAA 4O2TA 3FAPA 1FJDA 1OWQA 4NNRA 1W26A 1D7IA 3KAIA 1EHNA 3B7XA 4ODMA 5GPGA 3KAHA 2XP7A 1FKFA 1XRVA 4JFMA 3PRDA 1FKIA 2DSWA 4G2PA 3RGCA 3G6LA 4WKFA 2ETNA 2LJ4A 1GUVA 5DO2A 2A3CA 1HXVA 1M5YA 3UQBA 4MPKA 4C02B 4DRMA 1NMWA 3CHCA
chains in the Genus database with same CATH topology
1PBKA 5DEZA 5BXJA 2D9FA 3CHEA 1JNSA 2O92A 4ODPA 3W4RA 1IX5A 1ROTA 1QPLA 3UQIA 2WK2A 1FKLA 3KACA 2RUQA 4AY1A 3CGNA 4TW7A 2VCDA 3O5FA 3IKGA 4W5UA 1HJXA 1ZB5A 4IQCA 2RUCA 1FKBA 1HJVA 4Z2GA 1SR0A 4DRNA 3AROA 3FXYA 2KR7A 3TCZA 2XPBA 4IPXA 1BKFA 3ALGA 1ZCNA 4ZPVR 3VAWA 2WM0A 3ARQA 1OGGA 2OFNA 4MSPA 2FAPA 1UR8A 1JNTA 1Q1CA 2DPEA 1KT1A 4Z2HA 1FD9A 3KCEA 3I6CA 3O5RA 2PPPA 2YBUA 3WD4A 2AOSA 2LGOA 4MGVA 2G8ZA 1LG2A 2DSZA 5DF0A 1X6LA 4Q7NA 4ZPTR 3EY6A 5HUAA 5DIUA 2A3EA 1NWTA 1EYMA 3NRKA 4L72B 4U86A 1LG1A 1E9LA 4QT2A 2UZ5A 3CGMA 4DWSC 4IT6A 4J4NA 4S3KA 2F4EA 2LKNA 1VF8A 4W9OA 4ODQA 5J6EA 4IT4A 1J4HA 1LJYA 3WQWA 1FKKA 2DT1A 1ROUA 4JFLA 1JVWA 1FKSA 2ZR6A 1FKRA 2Q5AA 5HW8A 4NZCA 1JNEA 3QOKA 3OA5A 3PRBA 1QZ2A 3WD1A 1J4IA 1YATA 4LAWA 4Z2JA 3MDYB 3RM9A 1D6OA 1OGBA 3UQAA 2RSEA 3AS1A 4GIVA 1EQ3A 1EIBA 1U79A 1D7HA 1Y0OA 1WAWA 2MLYA 3KAFA 4Z2LA 4MAVA 2M08A 2B31A 3O5GA 2G41A 2XP4A 3ARPA 3WIJA 1D2KA 1FKDA 1JNDA 1H0IA 1E15A 2IF4A 1X6NA 4TNSA 3NTPA 4HBOA 4TW6A 4ZS6A 4XAKA 3KADA 3ARRA 4ITZA 4DRQA 2L2SA 1J6YA 5B8IC 1FKHA 3O5IA 1B6CA 2DSUA 3CHDA 4WJXA 2F21A 3ARSA 4ODKA 1PINA 4TX0A 3PR9A 3O5QA 4MNJA 4W9PA 1E6ZA 3ARWA 1KFWA 3JYMA 4DRHA 1C9HA 1W9UA 2DG9A 1BL4A 2PV3A 4U84A 3WQVA 2WLZA 2YBTA 1NH6A 1HKMA 2MF9A 4ODRA 2RUDA 3RM8A 2F2DA 4Q22A 5HWCA 2XP8A 1ZU8A 4L3NA 3ALFA 1E6NA 2MLZA 4JFKA 2RQSA 3O5JA 1N1AA 2A3AA 4NSBA 3IHZA 3AS0A 1F40A 4ZPWR 1E6RA 4IQ2A 2IUZA 3NI6A 1FFRA 1LL6A 2JZVA 1RD6A 2KFWA 2XPAA 3O5OA 3WH0A 2PPOA 4TYOA 1LQ0A 2DG3A 4GGQA 5DITA 3AS2A 4LGXA 5GPRA 3KABA 1ZBVA 5HW7A 2AWGA 4U85A 3WL1A 3JYJA 2VN1A 1ZBCA 1HKIA 4WIWA 5HBFA 4P8VA 1NSGA 3RFWA 4JFIA 4ML4A 3PA7A 1D7JA 1LL4A 2ITKA 1K9TA 2KO7A 3WKZA 5D75A 4QIBA 4G50A 1XHGA 4P8WA 1P5QA 3WL0A 4DH0A 4MNKA 2M2AA 3WD2A 3B9AA 1YW5A 4DZ3A 4KR0B 4QZVB 4WKHA 3RMEA 2MPHA 1TFVA 3B8SA 2QF8A 4MNMA 2ZR4A 1HKJA 4Z2KA 4MNLA 3B9DA 4DWSA 2DT0A 4DROA 1W1PA 4S3JA 4DRIA 4R0XA 5DIVA 1ZBKA 3WD3A 2MLXA 2KI3A 2ZQUA 3ARYA 4QT3A 4W9QA 1H0GA 1NWRA 4JFJA 3UF8A 5GQBA 3GPKA 3O5KA 2RURA 1FKGA 4HBEA 2DG4A 3ARZA 3ODKA 3G6MA 4KQZA 2M1IA 3AS3A 1KT0A 3O5PA 5HW6A 4DT4A 4P8XA 3TC5A 2N87A 1W9PA 1T11A 2XP6A 1ZL1A 2PV2A 3WD0A 3AQUA 3CZ8A 3ARTA 2OLHA 1L1PA 1NMVA 2A3BA 4PTMA 5HT1A 2PI6A 2ZQSA 2ZR5A 3IKDA 2O9OA 1O6IA 2KE0A 3CH9A 2FDMA 4LAXA 4BF8A 2PV1A 3JXVA 1F8AB 3OOBA 1WNOA 5HWBA 2Y78A 3O5LA 4URIA 1ZK6A 4P8UA 2ZQTA 2MNTA 2KGJA 4DRKA 2XP9A 2DSVA 1Q6IA 2XP3A 4N19A 4DZ2A 1TCOC 2WLYA 1ITXA 3UI6A 4ODNA 4WK9A 2DT3A 3KZ7A 4ODOA 1HJWA 5I98A 1SYTA 4MTVA 1HKKA 4R5EA 1ZBWA 3BXWA 3ARUA 2LPVA 2PPNA 3RM4A 4DRPA 5JH8A 2XP5A 3UI5A 1W1VA 4DWSB 1W9VA 4FN2A 5HKGA 3IK8A 4DWSD 3TDBA 4WKAA 1Q6UA 4Z2IA 2FKEA 4ODLA 4FAPA 1FFQA 4J4OA 1FAPA 1FKTA 1GPFA 1E6PA 3O5EA 1CTNA 1J4RA 1R9HA 2ESCA 2ZQVA 1UR9A 2DT2A 3FY1A 3ARVA 1EDQA 4TW8A 3UI4A 3ARXA 2PBCA 4DRJA 4HARA 1NWUA 1GOIA 3O5MA 2K8IA 3B9EA 4DIPA 3O5DA 1Q6HA 1LL7A 3LUOA 1A7XA 1W1TA 4LAVA 1WB0A 1NWSA 1W1YA 4LAYA 5HTGA 4JYSA 3KAGA 1QPFA 3CHFA 1FKJA 3H9RB 3PRAA 4O2TA 3FAPA 1FJDA 1OWQA 4NNRA 1W26A 1D7IA 3KAIA 1EHNA 3B7XA 4ODMA 5GPGA 3KAHA 2XP7A 1FKFA 1XRVA 4JFMA 3PRDA 1FKIA 2DSWA 4G2PA 3RGCA 3G6LA 4WKFA 2LJ4A 1GUVA 5DO2A 2A3CA 1HXVA 1M5YA 3UQBA 4MPKA 4C02B 4DRMA 1NMWA 3CHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UI6 A;  4ODN A;  1PBK A;  5BXJ A;  1D7J A;  2D9F A;  1JNS A;  2ITK A;  3KZ7 A;  4ODO A;  4ODP A;  2KO7 A;  5D75 A;  1ROT A;  2M08 A;  4QIB A;  5I98 A;  1QPL A;  3O5G A;  3UQI A;  4G50 A;  1P5Q A;  2LPV A;  1FKL A;  2XP4 A;  3KAC A;  2PPN A;  2RUQ A;  4DH0 A;  2M2A A;  3CGN A;  4TW7 A;  4DRP A;  2VCD A;  3O5F A;  3IKG A;  2XP5 A;  1YW5 A;  4IQC A;  3UI5 A;  2RUC A;  4DZ3 A;  1FKB A;  1FKD A;  4FN2 A;  4DRN A;  5HKG A;  2KR7 A;  3IK8 A;  3TCZ A;  3TDB A;  2XPB A;  1Q6U A;  2IF4 A;  4IPX A;  2FKE A;  4TNS A;  2MPH A;  1BKF A;  3NTP A;  4TW6 A;  4ODL A;  4FAP A;  4J4O A;  1ZCN A;  1FAP A;  3VAW A;  1FKT A;  3O5E A;  3KAD A;  4ITZ A;  4DRQ A;  1J4R A;  2ZR4 A;  2L2S A;  1R9H A;  1J6Y A;  5B8I C;  1FKH A;  2OFN A;  3O5I A;  4MSP A;  1B6C A;  2ZQV A;  3PA7 A;  2FAP A;  4DRO A;  2F21 A;  4DRI A;  4R0X A;  4ODK A;  1PIN A;  1JNT A;  5DIV A;  1Q1C A;  4TX0 A;  2MLX A;  2KI3 A;  2ZQU A;  3O5Q A;  4TW8 A;  3UI4 A;  4QT3 A;  4W9Q A;  4W9P A;  3UF8 A;  4JFJ A;  1KT1 A;  2PBC A;  3GPK A;  4DRJ A;  1FD9 A;  3KCE A;  3O5K A;  3JYM A;  2RUR A;  1FKG A;  3I6C A;  3O5M A;  2K8I A;  2DG4 A;  4DRH A;  3O5R A;  2PPP A;  1C9H A;  4DIP A;  3ODK A;  2DG9 A;  2LGO A;  1BL4 A;  2PV3 A;  4MGV A;  4U84 A;  3O5D A;  2MF9 A;  1Q6H A;  4ODR A;  2RUD A;  2M1I A;  3LUO A;  1A7X A;  4LAV A;  2F2D A;  5HWC A;  1KT0 A;  2XP8 A;  3EY6 A;  3O5P A;  5HUA A;  5HW6 A;  4DT4 A;  5DIU A;  3TC5 A;  1EYM A;  2MLZ A;  2N87 A;  4JFK A;  3NRK A;  4LAY A;  2RQS A;  1T11 A;  2XP6 A;  3O5J A;  4U86 A;  4QT2 A;  2PV2 A;  1N1A A;  5HTG A;  2UZ5 A;  3CGM A;  4JYS A;  3KAG A;  3RFW A;  1QPF A;  4J4N A;  3IHZ A;  1L1P A;  1FKJ A;  2F4E A;  1NMV A;  2LKN A;  3H9R B;  4O2T A;  3FAP A;  1F40 A;  4NNR A;  4W9O A;  4ODQ A;  1FJD A;  5J6E A;  4IQ2 A;  1W26 A;  1D7I A;  1J4H A;  1FKK A;  3NI6 A;  5HT1 A;  2XPA A;  1ROU A;  2JZV A;  2KFW A;  3KAI A;  3O5O A;  3WH0 A;  2PPO A;  4TYO A;  4JFL A;  2ZQS A;  2ZR5 A;  2DG3 A;  1JVW A;  1FKS A;  3B7X A;  2ZR6 A;  4ODM A;  1FKR A;  3IKD A;  2Q5A A;  3KAH A;  2KE0 A;  4GGQ A;  5DIT A;  5GPG A;  2XP7 A;  1FKF A;  3KAB A;  5HW8 A;  4JFM A;  4LAX A;  2PV1 A;  4BF8 A;  3JXV A;  1FKI A;  3PRD A;  5HW7 A;  1F8A B;  2AWG A;  3OOB A;  4U85 A;  5HWB A;  2Y78 A;  4G2P A;  3RGC A;  3PRB A;  1QZ2 A;  1J4I A;  3O5L A;  1YAT A;  1ZK6 A;  2LJ4 A;  3JYJ A;  2VN1 A;  4LAW A;  2ZQT A;  2MNT A;  3MDY B;  2KGJ A;  1D6O A;  1HXV A;  1M5Y A;  4DRK A;  3UQB A;  3UQA A;  2XP9 A;  4C02 B;  2RSE A;  4N19 A;  1Q6I A;  2XP3 A;  4DZ2 A;  4GIV A;  4DRM A;  1EQ3 A;  1U79 A;  1Y0O A;  1D7H A;  1NMW A;  1NSG A;  1TCO C;  4JFI A;  2MLY A;  3KAF A; 
#chains in the Genus database with same CATH topology
 1PBK A;  5DEZ A;  5BXJ A;  2D9F A;  3CHE A;  1JNS A;  2O92 A;  4ODP A;  3W4R A;  1IX5 A;  1ROT A;  1QPL A;  3UQI A;  2WK2 A;  1FKL A;  3KAC A;  2RUQ A;  4AY1 A;  3CGN A;  4TW7 A;  2VCD A;  3O5F A;  3IKG A;  4W5U A;  1HJX A;  1ZB5 A;  4IQC A;  2RUC A;  1FKB A;  1HJV A;  4Z2G A;  1SR0 A;  4DRN A;  3ARO A;  3FXY A;  2KR7 A;  3TCZ A;  2XPB A;  4IPX A;  1BKF A;  3ALG A;  1ZCN A;  4ZPV R;  3VAW A;  2WM0 A;  3ARQ A;  1OGG A;  2OFN A;  4MSP A;  2FAP A;  1UR8 A;  1JNT A;  1Q1C A;  2DPE A;  1KT1 A;  4Z2H A;  1FD9 A;  3KCE A;  3I6C A;  3O5R A;  2PPP A;  2YBU A;  3WD4 A;  2AOS A;  2LGO A;  4MGV A;  2G8Z A;  1LG2 A;  2DSZ A;  5DF0 A;  1X6L A;  4Q7N A;  3GU0 A;  4ZPT R;  3EY6 A;  5HUA A;  5DIU A;  2A3E A;  1NWT A;  1EYM A;  3NRK A;  4L72 B;  4U86 A;  1LG1 A;  1E9L A;  4QT2 A;  2UZ5 A;  3CGM A;  4DWS C;  4IT6 A;  4J4N A;  4S3K A;  2F4E A;  2LKN A;  1VF8 A;  4W9O A;  4ODQ A;  5J6E A;  4IT4 A;  1J4H A;  1LJY A;  3WQW A;  1FKK A;  2DT1 A;  1ROU A;  4JFL A;  1JVW A;  1FKS A;  2ZR6 A;  1FKR A;  2Q5A A;  5HW8 A;  4NZC A;  1JNE A;  3QOK A;  3OA5 A;  3PRB A;  1QZ2 A;  3WD1 A;  1J4I A;  1YAT A;  4LAW A;  4Z2J A;  3MDY B;  3RM9 A;  1D6O A;  1OGB A;  3UQA A;  2RSE A;  3AS1 A;  4GIV A;  1EQ3 A;  1EIB A;  1U79 A;  1D7H A;  1Y0O A;  1WAW A;  2MLY A;  3KAF A;  4Z2L A;  1E44 A;  4MAV A;  2EUL A;  2M08 A;  2B31 A;  3O5G A;  2G41 A;  2XP4 A;  3ARP A;  3WIJ A;  1D2K A;  1FKD A;  1JND A;  1H0I A;  1E15 A;  2IF4 A;  1X6N A;  4TNS A;  3NTP A;  4HBO A;  4TW6 A;  4ZS6 A;  4XAK A;  3KAD A;  3ARR A;  4ITZ A;  4DRQ A;  2L2S A;  1J6Y A;  5B8I C;  1FKH A;  3O5I A;  1B6C A;  2DSU A;  3CHD A;  4WJX A;  2F21 A;  3ARS A;  2PN0 A;  4ODK A;  1PIN A;  4TX0 A;  3PR9 A;  3O5Q A;  4MNJ A;  4W9P A;  1E6Z A;  3ARW A;  1KFW A;  3JYM A;  4DRH A;  1C9H A;  1W9U A;  2DG9 A;  1BL4 A;  2PV3 A;  4U84 A;  3WQV A;  2WLZ A;  2YBT A;  1NH6 A;  1HKM A;  2MF9 A;  4ODR A;  2RUD A;  3RM8 A;  2F2D A;  4Q22 A;  5HWC A;  2XP8 A;  1ZU8 A;  4L3N A;  3ALF A;  1E6N A;  2MLZ A;  4JFK A;  2RQS A;  3O5J A;  1N1A A;  2B5U B;  2A3A A;  4NSB A;  3IHZ A;  3AS0 A;  1F40 A;  4ZPW R;  1E6R A;  4IQ2 A;  2IUZ A;  3NI6 A;  1FFR A;  1LL6 A;  2JZV A;  1RD6 A;  2KFW A;  2XPA A;  3O5O A;  3WH0 A;  2PPO A;  3EIP A;  4TYO A;  1LQ0 A;  2DG3 A;  4GGQ A;  5DIT A;  3AS2 A;  4LGX A;  5GPR A;  3KAB A;  1ZBV A;  5HW7 A;  2AWG A;  4U85 A;  1JCH B;  3WL1 A;  3JYJ A;  2VN1 A;  1ZBC A;  1HKI A;  4WIW A;  5HBF A;  4P8V A;  1NSG A;  3RFW A;  4JFI A;  4ML4 A;  3PA7 A;  1D7J A;  1LL4 A;  2ITK A;  1K9T A;  2KO7 A;  3WKZ A;  5D75 A;  4QIB A;  4G50 A;  1XHG A;  4P8W A;  1P5Q A;  3WL0 A;  4DH0 A;  4MNK A;  2M2A A;  3WD2 A;  3B9A A;  1YW5 A;  2P4V A;  4DZ3 A;  4KR0 B;  3BMB A;  4QZV B;  4WKH A;  3RME A;  2MPH A;  4UDM A;  1TFV A;  3B8S A;  2QF8 A;  4MNM A;  2ZR4 A;  1HKJ A;  4Z2K A;  4MNL A;  3B9D A;  4DWS A;  2DT0 A;  4DRO A;  1W1P A;  4S3J A;  4DRI A;  4R0X A;  5DIV A;  1ZBK A;  3WD3 A;  2MLX A;  2KI3 A;  2ZQU A;  3ARY A;  4QT3 A;  4W9Q A;  1H0G A;  1NWR A;  4JFJ A;  3UF8 A;  5GQB A;  3GPK A;  3O5K A;  2RUR A;  1FKG A;  4HBE A;  2DG4 A;  2F23 A;  3ARZ A;  3ODK A;  3G6M A;  4KQZ A;  2M1I A;  3AS3 A;  1KT0 A;  3O5P A;  5HW6 A;  4DT4 A;  4P8X A;  3TC5 A;  2N87 A;  1W9P A;  1T11 A;  2XP6 A;  3GTY X;  1ZL1 A;  2PV2 A;  3WD0 A;  3AQU A;  3CZ8 A;  3ART A;  2OLH A;  1L1P A;  1NMV A;  2A3B A;  4PTM A;  5HT1 A;  2PI6 A;  2ZQS A;  2ZR5 A;  3IKD A;  2O9O A;  1O6I A;  2KE0 A;  3CH9 A;  2FDM A;  4LAX A;  4BF8 A;  2PV1 A;  3JXV A;  1F8A B;  3OOB A;  1WNO A;  5HWB A;  2Y78 A;  3O5L A;  4URI A;  1ZK6 A;  4P8U A;  2ZQT A;  2MNT A;  2KGJ A;  4DRK A;  2XP9 A;  2DSV A;  1Q6I A;  2XP3 A;  4N19 A;  4DZ2 A;  1TCO C;  2WLY A;  1ITX A;  3UI6 A;  4ODN A;  4WK9 A;  2DT3 A;  3KZ7 A;  4ODO A;  1HJW A;  5I98 A;  1SYT A;  4MTV A;  1HKK A;  4R5E A;  1ZBW A;  3BXW A;  3ARU A;  2LPV A;  2PPN A;  1GRJ A;  3RM4 A;  4DRP A;  5JH8 A;  2XP5 A;  3UI5 A;  1W1V A;  4DWS B;  1W9V A;  4FN2 A;  5HKG A;  3IK8 A;  4DWS D;  3TDB A;  4WKA A;  1Q6U A;  4Z2I A;  2FKE A;  4ODL A;  4FAP A;  1FFQ A;  4J4O A;  1FAP A;  1FKT A;  1GPF A;  1E6P A;  3O5E A;  1CTN A;  1J4R A;  1R9H A;  2ESC A;  2ZQV A;  1UR9 A;  2DT2 A;  3FY1 A;  3ARV A;  1EDQ A;  4TW8 A;  3UI4 A;  3ARX A;  2PBC A;  4DRJ A;  4HAR A;  1NWU A;  1GOI A;  3O5M A;  2K8I A;  3B9E A;  4DIP A;  3O5D A;  1Q6H A;  1LL7 A;  3LUO A;  1A7X A;  1W1T A;  4LAV A;  1WB0 A;  1NWS A;  1W1Y A;  4LAY A;  5HTG A;  4JYS A;  3KAG A;  1QPF A;  3CHF A;  1FKJ A;  3H9R B;  3PRA A;  4O2T A;  3FAP A;  1FJD A;  1OWQ A;  4NNR A;  1W26 A;  1D7I A;  3KAI A;  1EHN A;  3B7X A;  4ODM A;  5GPG A;  3KAH A;  2XP7 A;  1FKF A;  1XRV A;  4JFM A;  3PRD A;  1FKI A;  2DSW A;  4G2P A;  3RGC A;  3G6L A;  4WKF A;  2ETN A;  2LJ4 A;  1GUV A;  5DO2 A;  2A3C A;  1HXV A;  1M5Y A;  3UQB A;  4MPK A;  4C02 B;  4DRM A;  1NMW A;  3CHC A; 
#chains in the Genus database with same CATH homology
 1PBK A;  5DEZ A;  5BXJ A;  2D9F A;  3CHE A;  1JNS A;  2O92 A;  4ODP A;  3W4R A;  1IX5 A;  1ROT A;  1QPL A;  3UQI A;  2WK2 A;  1FKL A;  3KAC A;  2RUQ A;  4AY1 A;  3CGN A;  4TW7 A;  2VCD A;  3O5F A;  3IKG A;  4W5U A;  1HJX A;  1ZB5 A;  4IQC A;  2RUC A;  1FKB A;  1HJV A;  4Z2G A;  1SR0 A;  4DRN A;  3ARO A;  3FXY A;  2KR7 A;  3TCZ A;  2XPB A;  4IPX A;  1BKF A;  3ALG A;  1ZCN A;  4ZPV R;  3VAW A;  2WM0 A;  3ARQ A;  1OGG A;  2OFN A;  4MSP A;  2FAP A;  1UR8 A;  1JNT A;  1Q1C A;  2DPE A;  1KT1 A;  4Z2H A;  1FD9 A;  3KCE A;  3I6C A;  3O5R A;  2PPP A;  2YBU A;  3WD4 A;  2AOS A;  2LGO A;  4MGV A;  2G8Z A;  1LG2 A;  2DSZ A;  5DF0 A;  1X6L A;  4Q7N A;  4ZPT R;  3EY6 A;  5HUA A;  5DIU A;  2A3E A;  1NWT A;  1EYM A;  3NRK A;  4L72 B;  4U86 A;  1LG1 A;  1E9L A;  4QT2 A;  2UZ5 A;  3CGM A;  4DWS C;  4IT6 A;  4J4N A;  4S3K A;  2F4E A;  2LKN A;  1VF8 A;  4W9O A;  4ODQ A;  5J6E A;  4IT4 A;  1J4H A;  1LJY A;  3WQW A;  1FKK A;  2DT1 A;  1ROU A;  4JFL A;  1JVW A;  1FKS A;  2ZR6 A;  1FKR A;  2Q5A A;  5HW8 A;  4NZC A;  1JNE A;  3QOK A;  3OA5 A;  3PRB A;  1QZ2 A;  3WD1 A;  1J4I A;  1YAT A;  4LAW A;  4Z2J A;  3MDY B;  3RM9 A;  1D6O A;  1OGB A;  3UQA A;  2RSE A;  3AS1 A;  4GIV A;  1EQ3 A;  1EIB A;  1U79 A;  1D7H A;  1Y0O A;  1WAW A;  2MLY A;  3KAF A;  4Z2L A;  4MAV A;  2M08 A;  2B31 A;  3O5G A;  2G41 A;  2XP4 A;  3ARP A;  3WIJ A;  1D2K A;  1FKD A;  1JND A;  1H0I A;  1E15 A;  2IF4 A;  1X6N A;  4TNS A;  3NTP A;  4HBO A;  4TW6 A;  4ZS6 A;  4XAK A;  3KAD A;  3ARR A;  4ITZ A;  4DRQ A;  2L2S A;  1J6Y A;  5B8I C;  1FKH A;  3O5I A;  1B6C A;  2DSU A;  3CHD A;  4WJX A;  2F21 A;  3ARS A;  4ODK A;  1PIN A;  4TX0 A;  3PR9 A;  3O5Q A;  4MNJ A;  4W9P A;  1E6Z A;  3ARW A;  1KFW A;  3JYM A;  4DRH A;  1C9H A;  1W9U A;  2DG9 A;  1BL4 A;  2PV3 A;  4U84 A;  3WQV A;  2WLZ A;  2YBT A;  1NH6 A;  1HKM A;  2MF9 A;  4ODR A;  2RUD A;  3RM8 A;  2F2D A;  4Q22 A;  5HWC A;  2XP8 A;  1ZU8 A;  4L3N A;  3ALF A;  1E6N A;  2MLZ A;  4JFK A;  2RQS A;  3O5J A;  1N1A A;  2A3A A;  4NSB A;  3IHZ A;  3AS0 A;  1F40 A;  4ZPW R;  1E6R A;  4IQ2 A;  2IUZ A;  3NI6 A;  1FFR A;  1LL6 A;  2JZV A;  1RD6 A;  2KFW A;  2XPA A;  3O5O A;  3WH0 A;  2PPO A;  4TYO A;  1LQ0 A;  2DG3 A;  4GGQ A;  5DIT A;  3AS2 A;  4LGX A;  5GPR A;  3KAB A;  1ZBV A;  5HW7 A;  2AWG A;  4U85 A;  3WL1 A;  3JYJ A;  2VN1 A;  1ZBC A;  1HKI A;  4WIW A;  5HBF A;  4P8V A;  1NSG A;  3RFW A;  4JFI A;  4ML4 A;  3PA7 A;  1D7J A;  1LL4 A;  2ITK A;  1K9T A;  2KO7 A;  3WKZ A;  5D75 A;  4QIB A;  4G50 A;  1XHG A;  4P8W A;  1P5Q A;  3WL0 A;  4DH0 A;  4MNK A;  2M2A A;  3WD2 A;  3B9A A;  1YW5 A;  4DZ3 A;  4KR0 B;  4QZV B;  4WKH A;  3RME A;  2MPH A;  1TFV A;  3B8S A;  2QF8 A;  4MNM A;  2ZR4 A;  1HKJ A;  4Z2K A;  4MNL A;  3B9D A;  4DWS A;  2DT0 A;  4DRO A;  1W1P A;  4S3J A;  4DRI A;  4R0X A;  5DIV A;  1ZBK A;  3WD3 A;  2MLX A;  2KI3 A;  2ZQU A;  3ARY A;  4QT3 A;  4W9Q A;  1H0G A;  1NWR A;  4JFJ A;  3UF8 A;  5GQB A;  3GPK A;  3O5K A;  2RUR A;  1FKG A;  4HBE A;  2DG4 A;  3ARZ A;  3ODK A;  3G6M A;  4KQZ A;  2M1I A;  3AS3 A;  1KT0 A;  3O5P A;  5HW6 A;  4DT4 A;  4P8X A;  3TC5 A;  2N87 A;  1W9P A;  1T11 A;  2XP6 A;  1ZL1 A;  2PV2 A;  3WD0 A;  3AQU A;  3CZ8 A;  3ART A;  2OLH A;  1L1P A;  1NMV A;  2A3B A;  4PTM A;  5HT1 A;  2PI6 A;  2ZQS A;  2ZR5 A;  3IKD A;  2O9O A;  1O6I A;  2KE0 A;  3CH9 A;  2FDM A;  4LAX A;  4BF8 A;  2PV1 A;  3JXV A;  1F8A B;  3OOB A;  1WNO A;  5HWB A;  2Y78 A;  3O5L A;  4URI A;  1ZK6 A;  4P8U A;  2ZQT A;  2MNT A;  2KGJ A;  4DRK A;  2XP9 A;  2DSV A;  1Q6I A;  2XP3 A;  4N19 A;  4DZ2 A;  1TCO C;  2WLY A;  1ITX A;  3UI6 A;  4ODN A;  4WK9 A;  2DT3 A;  3KZ7 A;  4ODO A;  1HJW A;  5I98 A;  1SYT A;  4MTV A;  1HKK A;  4R5E A;  1ZBW A;  3BXW A;  3ARU A;  2LPV A;  2PPN A;  3RM4 A;  4DRP A;  5JH8 A;  2XP5 A;  3UI5 A;  1W1V A;  4DWS B;  1W9V A;  4FN2 A;  5HKG A;  3IK8 A;  4DWS D;  3TDB A;  4WKA A;  1Q6U A;  4Z2I A;  2FKE A;  4ODL A;  4FAP A;  1FFQ A;  4J4O A;  1FAP A;  1FKT A;  1GPF A;  1E6P A;  3O5E A;  1CTN A;  1J4R A;  1R9H A;  2ESC A;  2ZQV A;  1UR9 A;  2DT2 A;  3FY1 A;  3ARV A;  1EDQ A;  4TW8 A;  3UI4 A;  3ARX A;  2PBC A;  4DRJ A;  4HAR A;  1NWU A;  1GOI A;  3O5M A;  2K8I A;  3B9E A;  4DIP A;  3O5D A;  1Q6H A;  1LL7 A;  3LUO A;  1A7X A;  1W1T A;  4LAV A;  1WB0 A;  1NWS A;  1W1Y A;  4LAY A;  5HTG A;  4JYS A;  3KAG A;  1QPF A;  3CHF A;  1FKJ A;  3H9R B;  3PRA A;  4O2T A;  3FAP A;  1FJD A;  1OWQ A;  4NNR A;  1W26 A;  1D7I A;  3KAI A;  1EHN A;  3B7X A;  4ODM A;  5GPG A;  3KAH A;  2XP7 A;  1FKF A;  1XRV A;  4JFM A;  3PRD A;  1FKI A;  2DSW A;  4G2P A;  3RGC A;  3G6L A;  4WKF A;  2LJ4 A;  1GUV A;  5DO2 A;  2A3C A;  1HXV A;  1M5Y A;  3UQB A;  4MPK A;  4C02 B;  4DRM A;  1NMW A;  3CHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...