1D7IA

Fkbp complexed with methyl methylsulfinylmethyl sulfide (dss)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
publication title X-ray structures of small ligand-FKBP complexes provide an estimate for hydrophobic interaction energies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 26
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1d7iA00
2KFWA 1T11A 1J4RA 1Y0OA 1FKRA 2L2SA 2PBCA 4ODOA 4TNSA 4NNRA 3UQAA 1FKLA 5GPGA 2MF9A 1W26A 3KAHA 4LAVA 5DITA 2ZR6A 3JYMA 3KZ7A 3MDYB 3NRKA 2KI3A 1FKGA 3O5LA 3UQBA 3RFWA 1FKHA 1PINA 5HT1A 3NTPA 4JFIA 1J6YA 4TX0A 2FAPA 4MSPA 3B7XA 3O5IA 4MGVA 4W9PA 2RSEA 4DIPA 5HWBA 5J6EA 1EYMA 3UF8A 1F8AB 4JFKA 3PA7A 5HUAA 4O2TA 2F2DA 3IHZA 4FAPA 1M5YA 3UI6A 2M1IA 3KABA 1B6CA 2MLYA 3IKDA 3TDBA 2VCDA 4LAXA 2MLZA 4DRHA 2MLXA 3VAWA 1F40A 5HWCA 3UI4A 1KT0A 3KAGA 4DRPA 3EY6A 1FKKA 1TCOC 5HKGA 2F4EA 5HW6A 4BF8A 4TW8A 4DZ3A 2PV1A 2VN1A 1D7HA 1Q1CA 3O5JA 3O5OA 4U84A 4W9QA 3O5EA 1D6OA 4LAYA 4DRJA 4N19A 2ITKA 2DG9A 2XPAA 3PRDA 4FN2A 2Q5AA 1JNTA 2AWGA 5BXJA 3WH0A 1FKJA 3O5QA 2RQSA 1YATA 3KADA 4ODMA 4JYSA 1L1PA 1C9HA 1N1AA 4DRMA 4ODLA 4JFLA 2RUQA 4IQCA 1QPLA 3IKGA 4ODPA 2ZQVA 1J4IA 4IPXA 2LGOA 4U85A 3I6CA 4J4NA 4ODQA 1FAPA 2N87A 3GPKA 3KACA 2F21A 3O5PA 1D7JA 1A7XA 2RUCA 1Q6HA 4QT3A 4TYOA 2XP3A 3JYJA 1EQ3A 2PPNA 1NMWA 4DH0A 2ZR4A 2PPPA 2XP4A 5HW7A 3H9RB 4TW6A 2DG3A 3PRBA 1U79A 3O5RA 2XP5A 1BKFA 2M2AA 1J4HA 1QPFA 2RURA 3UQIA 3LUOA 3ODKA 4JFJA 2FKEA 5DIVA 5HW8A 4DT4A 3O5DA 1FJDA 2XP8A 3NI6A 1JVWA 1D7IA 5I98A 4IQ2A 2XP7A 3KAFA 4DRNA 3TC5A 4G50A 1NMVA 3CGNA 1KT1A 2DG4A 1Q6IA 4R0XA 2MPHA 3OOBA 4U86A 2UZ5A 5B8IC 5HTGA 1FKBA 4QIBA 2KGJA 4DRKA 1FKFA 3CGMA 5D75A 2JZVA 3KCEA 3TCZA 1ROTA 2ZQSA 3O5GA 1NSGA 2LKNA 4DZ2A 2PV2A 4DRQA 4C02B 2LJ4A 1FKIA 3O5MA 2OFNA 4LAWA 4DRIA 3UI5A 4ITZA 2KE0A 4DROA 1JNSA 2K8IA 1P5QA 1FD9A 1BL4A 2D9FA 2IF4A 2PV3A 2Y78A 2ZQUA 3O5FA 4W9OA 1HXVA 4ODRA 4ODNA 4ODKA 3IK8A 2MNTA 5DIUA 2XPBA 2ZQTA 1Q6UA 4GGQA 4J4OA 2M08A 4GIVA 1ZK6A 2KR7A 1FKTA 2LPVA 2KO7A 1QZ2A 4QT2A 2XP6A 3JXVA 1FKDA 3FAPA 1ROUA 1YW5A 1ZCNA 2RUDA 2XP9A 2ZR5A 1PBKA 4G2PA 4JFMA 1R9HA 2PPOA 3O5KA 4TW7A 3KAIA 1FKSA 3RGCA
chains in the Genus database with same CATH superfamily
2KFWA 1T11A 1X6NA 1FKRA 4NNRA 3KZ7A 3ARRA 2WLZA 4WK9A 3RM8A 1HJWA 4IT4A 1J6YA 4JFIA 1W1YA 2FAPA 3ARXA 3B7XA 3UF8A 4JFKA 3ARZA 3ALGA 3UI6A 3KABA 3IKDA 4LAXA 3UI4A 3EY6A 1TCOC 2PV1A 1ZL1A 4U84A 3O5EA 3AS3A 4DRJA 2ITKA 2XPAA 4FN2A 2Q5AA 3WH0A 1FKJA 3KADA 3AS2A 4JFLA 2DSZA 3B8SA 2LGOA 1EIBA 1FFRA 3GPKA 3KACA 2F21A 3PR9A 2PI6A 3O5PA 4Q22A 3CH9A 5JH8A 2PN0A 3H9RB 4TW6A 3ARPA 3PRBA 3ARSA 3O5RA 2XP5A 3WKZA 1QPFA 2DT3A 1WNOA 4DWSC 3ODKA 4JFJA 2FKEA 5DIVA 1FJDA 1RD6A 4Z2IA 1KT1A 3G6LA 1ZBVA 4U86A 1IX5A 4L3NA 4IT6A 4QIBA 4DRKA 2JZVA 3KCEA 1HJXA 1LJYA 3TCZA 3PRAA 1FKIA 3O5MA 1LQ0A 4DROA 3BMBA 1P5QA 2IF4A 3O5FA 2WM0A 1JCHB 4ODKA 2FDMA 1HKIA 2F23A 4ZPWR 2ZQTA 1HKJA 2LPVA 1QZ2A 4QT2A 1W9PA 1ZBCA 1FKDA 3GU0A 2ZR5A 2RUDA 3FY1A 2DT1A 3RMEA 1PBKA 4MAVA 1R9HA 3O5KA 4MPKA 4NSBA 1FKSA 2A3AA 1SYTA 2L2SA 3GTYX 4TNSA 1FKLA 2MF9A 4DWSD 3CHFA 2ZR6A 3MDYB 2KI3A 1FKGA 3O5LA 2DPEA 4DWSA 4MGVA 5J6EA 1EYMA 3PA7A 5HUAA 2F2DA 3IHZA 4FAPA 1M5YA 4ZS6A 3TDBA 4UDMA 2VCDA 2MLZA 2ESCA 3VAWA 1F40A 1ITXA 3ARUA 1JNEA 1FKKA 5HKGA 4P8XA 2VN1A 4LAYA 3WD0A 1LL7A 3B9EA 5BXJA 2AWGA 1XRVA 1LG2A 3O5QA 2RQSA 4JYSA 3B9DA 4ODLA 2RUQA 3IKGA 3WQWA 3I6CA 4J4NA 2N87A 2EULA 1E6ZA 1A7XA 4S3JA 1Q6HA 1EQ3A 1NMWA 5DO2A 2ZR4A 2PPPA 4W5UA 2DG3A 4HBOA 1LL4A 3UQIA 2M2AA 1J4HA 2RURA 3LUOA 3AROA 3WL0A 3W4RA 3ARVA 4NZCA 3NI6A 2XP7A 3KAFA 4WKFA 3TC5A 1NMVA 1O6IA 2DG4A 4WKAA 2UZ5A 2WK2A 5B8IC 5HTGA 1GUVA 5D75A 1ROTA 3ARYA 2A3BA 4DZ2A 2OFNA 3ARTA 4LAWA 4DRIA 3ALFA 1JNSA 1FD9A 2D9FA 2ZQUA 4KR0B 3BXWA 4ML4A 4Z2GA 2MNTA 2B5UB 3AQUA 3RM9A 4G2PA 1SR0A 4JFMA 1GOIA 5DEZA 1J4RA 1E44A 1EDQA 4LGXA 1JNDA 5GPGA 4LAVA 5DITA 3JYMA 2YBUA 4AY1A 3UQBA 4Z2LA 1H0GA 5HT1A 3NTPA 4DWSB 1ZBKA 1WB0A 4TX0A 4MSPA 3O5IA 4W9PA 2RSEA 4DIPA 5HWBA 1F8AB 2IUZA 2DT0A 3QOKA 2M1IA 1B6CA 2MLYA 5DF0A 5HWCA 1KT0A 4HBEA 1X6LA 4WIWA 2F4EA 4BF8A 1Q1CA 3O5OA 4W9QA 1W1PA 3CHDA 2ETNA 1OGGA 4N19A 2DG9A 1W1VA 1JNTA 4R5EA 1CTNA 4WJXA 4ZPTR 1C9HA 1N1AA 3FXYA 4DRMA 1QPLA 4ODPA 3CHCA 4MNMA 1FFQA 1D7JA 2RUCA 3EIPA 4QT3A 2XP3A 3JYJA 4TYOA 1E6NA 2PPNA 4DH0A 2XP4A 4ZPVR 4MNJA 4DT4A 2XP8A 4KQZA 1JVWA 5I98A 4IQ2A 4DRNA 1VF8A 4R0XA 3G6MA 2MPHA 3OOBA 3WD1A 3CGMA 2ZQSA 3CZ8A 3O5GA 2LKNA 1H0IA 4DRQA 2LJ4A 1HJVA 4Q7NA 1LG1A 4P8UA 4ITZA 2KE0A 1KFWA 2AOSA 2K8IA 1K9TA 2Y78A 1BL4A 4W9OA 1HXVA 4WKHA 2DSUA 4ODRA 3IK8A 1ZBWA 5DIUA 2XPBA 1TFVA 1Q6UA 4GGQA 4J4OA 4GIVA 1ZK6A 2A3CA 1FKTA 2KO7A 4XAKA 3JXVA 1E6RA 2O92A 1W1TA 2PPOA 3KAIA 3RGCA 1LL6A 1UR8A 2DSVA 1Y0OA 2PBCA 4ODOA 2WLYA 1WAWA 3UQAA 1D2KA 2DSWA 1W26A 3KAHA 3OA5A 4S3KA 3NRKA 3B9AA 3RFWA 2B31A 1FKHA 1PINA 1E6PA 3WL1A 1EHNA 4O2TA 3WD4A 1OWQA 2DT2A 4DRHA 3WQVA 2MLXA 1NH6A 1OGBA 4MNLA 1ZB5A 3KAGA 4DRPA 2OLHA 5HW6A 5HBFA 4TW8A 4DZ3A 1D7HA 3O5JA 1HKMA 2QF8A 1D6OA 3PRDA 4P8VA 1YATA 1NWRA 4ODMA 1L1PA 5GQBA 4IQCA 4MNKA 3AS1A 2ZQVA 1J4IA 3ARWA 4IPXA 4MTVA 4U85A 1GRJA 4ODQA 1FAPA 1NWTA 4URIA 1HKKA 1W9UA 2O9OA 4HARA 5HW7A 3WIJA 1GPFA 1U79A 1BKFA 4L72B 4P8WA 1E9LA 5HW8A 2A3EA 3CHEA 3O5DA 1D7IA 1W9VA 2YBTA 4G50A 3CGNA 1Q6IA 3ARQA 3WD3A 1FKBA 2KGJA 1FKFA 2G41A 1E15A 2P4VA 1ZU8A 1UR9A 1NSGA 2PV2A 4C02B 4QZVB 3UI5A 4Z2HA 2PV3A 4Z2KA 1NWUA 4ODNA 2G8ZA 1NWSA 1XHGA 5GPRA 4PTMA 3AS0A 3RM4A 2M08A 2KR7A 2XP6A 3FAPA 2XP9A 1ROUA 1YW5A 1ZCNA 3WD2A 4TW7A 4Z2JA
chains in the Genus database with same CATH topology
2KFWA 1T11A 1X6NA 1FKRA 4NNRA 3KZ7A 3ARRA 2WLZA 4WK9A 3RM8A 1HJWA 4IT4A 1J6YA 4JFIA 1W1YA 2FAPA 3ARXA 3B7XA 3UF8A 4JFKA 3ARZA 3ALGA 3UI6A 3KABA 3IKDA 4LAXA 3UI4A 3EY6A 1TCOC 2PV1A 1ZL1A 4U84A 3O5EA 3AS3A 4DRJA 2ITKA 2XPAA 4FN2A 2Q5AA 3WH0A 1FKJA 3KADA 3AS2A 4JFLA 2DSZA 3B8SA 2LGOA 1EIBA 1FFRA 3GPKA 3KACA 2F21A 3PR9A 2PI6A 3O5PA 4Q22A 3CH9A 5JH8A 3H9RB 4TW6A 3ARPA 3PRBA 3ARSA 3O5RA 2XP5A 3WKZA 1QPFA 2DT3A 1WNOA 4DWSC 3ODKA 4JFJA 2FKEA 5DIVA 1FJDA 1RD6A 4Z2IA 1KT1A 3G6LA 1ZBVA 4U86A 1IX5A 4L3NA 4IT6A 4QIBA 4DRKA 2JZVA 1HJXA 3KCEA 1LJYA 3TCZA 3PRAA 1FKIA 3O5MA 1LQ0A 4DROA 1P5QA 2IF4A 3O5FA 2WM0A 4ODKA 2FDMA 1HKIA 4ZPWR 2ZQTA 1HKJA 2LPVA 1QZ2A 4QT2A 1W9PA 1ZBCA 1FKDA 3RMEA 2ZR5A 2RUDA 3FY1A 2DT1A 1PBKA 4MAVA 1R9HA 3O5KA 4MPKA 4NSBA 1FKSA 2A3AA 1SYTA 2L2SA 4TNSA 1FKLA 2MF9A 4DWSD 3CHFA 2ZR6A 3MDYB 2KI3A 1FKGA 3O5LA 2DPEA 4DWSA 4MGVA 5J6EA 1EYMA 3PA7A 5HUAA 2F2DA 3IHZA 4FAPA 1M5YA 4ZS6A 3TDBA 2VCDA 2MLZA 2ESCA 3VAWA 1F40A 1ITXA 3ARUA 1JNEA 1FKKA 5HKGA 4P8XA 2VN1A 4LAYA 3WD0A 1LL7A 3B9EA 5BXJA 2AWGA 1XRVA 1LG2A 3O5QA 2RQSA 4JYSA 3B9DA 4ODLA 2RUQA 3IKGA 3WQWA 3I6CA 4J4NA 2N87A 1E6ZA 1A7XA 4S3JA 1Q6HA 1EQ3A 1NMWA 5DO2A 2ZR4A 2PPPA 4W5UA 2DG3A 4HBOA 1LL4A 3UQIA 2M2AA 1J4HA 2RURA 3LUOA 3AROA 3WL0A 3W4RA 3ARVA 4NZCA 3NI6A 2XP7A 3KAFA 4WKFA 3TC5A 1NMVA 1O6IA 2DG4A 4WKAA 2UZ5A 2WK2A 5B8IC 5HTGA 1GUVA 5D75A 1ROTA 3ARYA 2A3BA 4DZ2A 2OFNA 3ARTA 4LAWA 4DRIA 3ALFA 1JNSA 1FD9A 2D9FA 2ZQUA 4KR0B 3BXWA 4ML4A 4Z2GA 2MNTA 3AQUA 3RM9A 4G2PA 1SR0A 4JFMA 1GOIA 5DEZA 1J4RA 1EDQA 4LGXA 1JNDA 5GPGA 4LAVA 5DITA 3JYMA 2YBUA 4AY1A 3UQBA 4Z2LA 1H0GA 5HT1A 3NTPA 4DWSB 1ZBKA 1WB0A 4TX0A 4MSPA 3O5IA 4W9PA 2RSEA 4DIPA 5HWBA 1F8AB 2IUZA 2DT0A 3QOKA 2M1IA 1B6CA 2MLYA 5DF0A 5HWCA 1KT0A 4HBEA 1X6LA 4WIWA 2F4EA 4BF8A 1Q1CA 3O5OA 4W9QA 1W1PA 3CHDA 1OGGA 4N19A 2DG9A 1W1VA 1JNTA 4R5EA 1CTNA 4WJXA 4ZPTR 1C9HA 1N1AA 3FXYA 4DRMA 1QPLA 4ODPA 3CHCA 4MNMA 1FFQA 1D7JA 2RUCA 4QT3A 4TYOA 2XP3A 3JYJA 1E6NA 2PPNA 4DH0A 2XP4A 4ZPVR 4MNJA 4DT4A 2XP8A 4KQZA 1JVWA 5I98A 4IQ2A 4DRNA 1VF8A 4R0XA 3G6MA 2MPHA 3OOBA 3WD1A 3CGMA 2ZQSA 3CZ8A 3O5GA 2LKNA 1H0IA 4DRQA 2LJ4A 1HJVA 4Q7NA 1LG1A 4P8UA 4ITZA 2KE0A 1KFWA 2AOSA 2K8IA 1K9TA 2Y78A 1BL4A 4W9OA 1HXVA 4WKHA 2DSUA 4ODRA 3IK8A 1ZBWA 5DIUA 2XPBA 1TFVA 1Q6UA 4GGQA 4J4OA 4GIVA 1ZK6A 2A3CA 1FKTA 2KO7A 4XAKA 3JXVA 1E6RA 2O92A 1W1TA 2PPOA 3KAIA 3RGCA 1LL6A 1UR8A 2DSVA 1Y0OA 2PBCA 4ODOA 2WLYA 1WAWA 3UQAA 1D2KA 2DSWA 1W26A 3KAHA 3OA5A 4S3KA 3NRKA 3B9AA 3RFWA 2B31A 1FKHA 1PINA 1E6PA 3WL1A 1EHNA 4O2TA 3WD4A 1OWQA 2DT2A 4DRHA 3WQVA 2MLXA 1NH6A 1OGBA 4MNLA 1ZB5A 3KAGA 4DRPA 2OLHA 5HW6A 5HBFA 4TW8A 4DZ3A 1D7HA 3O5JA 1HKMA 2QF8A 1D6OA 3PRDA 4P8VA 1YATA 1NWRA 4ODMA 1L1PA 5GQBA 4IQCA 4MNKA 3AS1A 2ZQVA 1J4IA 3ARWA 4IPXA 4MTVA 4U85A 4ODQA 1FAPA 1NWTA 4URIA 1HKKA 1W9UA 2O9OA 4HARA 5HW7A 3WIJA 1GPFA 1U79A 1BKFA 4L72B 4P8WA 1E9LA 5HW8A 2A3EA 3CHEA 3O5DA 1D7IA 1W9VA 2YBTA 4G50A 3CGNA 1Q6IA 3ARQA 3WD3A 1FKBA 2KGJA 1FKFA 2G41A 1E15A 1ZU8A 1UR9A 1NSGA 2PV2A 4C02B 4QZVB 3UI5A 4Z2HA 2PV3A 4Z2KA 1NWUA 4ODNA 2G8ZA 1NWSA 1XHGA 5GPRA 4PTMA 3AS0A 3RM4A 2M08A 2KR7A 2XP6A 3FAPA 2XP9A 1ROUA 1YW5A 1ZCNA 3WD2A 4TW7A 4Z2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KFW A;  1T11 A;  1J4R A;  1Y0O A;  1FKR A;  2L2S A;  2PBC A;  4ODO A;  4TNS A;  4NNR A;  3UQA A;  1FKL A;  5GPG A;  2MF9 A;  1W26 A;  3KAH A;  4LAV A;  5DIT A;  2ZR6 A;  3JYM A;  3KZ7 A;  3MDY B;  3NRK A;  2KI3 A;  1FKG A;  3O5L A;  3UQB A;  3RFW A;  1FKH A;  1PIN A;  5HT1 A;  3NTP A;  4JFI A;  1J6Y A;  4TX0 A;  2FAP A;  4MSP A;  3B7X A;  3O5I A;  4MGV A;  4W9P A;  2RSE A;  4DIP A;  5HWB A;  5J6E A;  1EYM A;  3UF8 A;  1F8A B;  4JFK A;  3PA7 A;  5HUA A;  4O2T A;  2F2D A;  3IHZ A;  4FAP A;  1M5Y A;  3UI6 A;  2M1I A;  3KAB A;  1B6C A;  2MLY A;  3IKD A;  3TDB A;  2VCD A;  4LAX A;  2MLZ A;  4DRH A;  2MLX A;  3VAW A;  1F40 A;  5HWC A;  3UI4 A;  1KT0 A;  3KAG A;  4DRP A;  3EY6 A;  1FKK A;  1TCO C;  5HKG A;  2F4E A;  5HW6 A;  4BF8 A;  4TW8 A;  4DZ3 A;  2PV1 A;  2VN1 A;  1D7H A;  1Q1C A;  3O5J A;  3O5O A;  4U84 A;  4W9Q A;  3O5E A;  1D6O A;  4LAY A;  4DRJ A;  4N19 A;  2ITK A;  2DG9 A;  2XPA A;  3PRD A;  4FN2 A;  2Q5A A;  1JNT A;  2AWG A;  5BXJ A;  3WH0 A;  1FKJ A;  3O5Q A;  2RQS A;  1YAT A;  3KAD A;  4ODM A;  4JYS A;  1L1P A;  1C9H A;  1N1A A;  4DRM A;  4ODL A;  4JFL A;  2RUQ A;  4IQC A;  1QPL A;  3IKG A;  4ODP A;  2ZQV A;  1J4I A;  4IPX A;  2LGO A;  4U85 A;  3I6C A;  4J4N A;  4ODQ A;  1FAP A;  2N87 A;  3GPK A;  3KAC A;  2F21 A;  3O5P A;  1D7J A;  1A7X A;  2RUC A;  1Q6H A;  4QT3 A;  4TYO A;  2XP3 A;  3JYJ A;  1EQ3 A;  2PPN A;  1NMW A;  4DH0 A;  2ZR4 A;  2PPP A;  2XP4 A;  5HW7 A;  3H9R B;  4TW6 A;  2DG3 A;  3PRB A;  1U79 A;  3O5R A;  2XP5 A;  1BKF A;  2M2A A;  1J4H A;  1QPF A;  2RUR A;  3UQI A;  3LUO A;  3ODK A;  4JFJ A;  2FKE A;  5DIV A;  5HW8 A;  4DT4 A;  3O5D A;  1FJD A;  2XP8 A;  3NI6 A;  1JVW A;  1D7I A;  5I98 A;  4IQ2 A;  2XP7 A;  3KAF A;  4DRN A;  3TC5 A;  4G50 A;  1NMV A;  3CGN A;  1KT1 A;  2DG4 A;  1Q6I A;  4R0X A;  2MPH A;  3OOB A;  4U86 A;  2UZ5 A;  5B8I C;  5HTG A;  1FKB A;  4QIB A;  2KGJ A;  4DRK A;  1FKF A;  3CGM A;  5D75 A;  2JZV A;  3KCE A;  3TCZ A;  1ROT A;  2ZQS A;  3O5G A;  1NSG A;  2LKN A;  4DZ2 A;  2PV2 A;  4DRQ A;  4C02 B;  2LJ4 A;  1FKI A;  3O5M A;  2OFN A;  4LAW A;  4DRI A;  3UI5 A;  4ITZ A;  2KE0 A;  4DRO A;  1JNS A;  2K8I A;  1P5Q A;  1FD9 A;  1BL4 A;  2D9F A;  2IF4 A;  2PV3 A;  2Y78 A;  2ZQU A;  3O5F A;  4W9O A;  1HXV A;  4ODR A;  4ODN A;  4ODK A;  3IK8 A;  2MNT A;  5DIU A;  2XPB A;  2ZQT A;  1Q6U A;  4GGQ A;  4J4O A;  2M08 A;  4GIV A;  1ZK6 A;  2KR7 A;  1FKT A;  2LPV A;  2KO7 A;  1QZ2 A;  4QT2 A;  2XP6 A;  3JXV A;  1FKD A;  3FAP A;  1ROU A;  1YW5 A;  1ZCN A;  2RUD A;  2XP9 A;  2ZR5 A;  1PBK A;  4G2P A;  4JFM A;  1R9H A;  2PPO A;  3O5K A;  4TW7 A;  3KAI A;  1FKS A;  3RGC A; 
#chains in the Genus database with same CATH topology
 2KFW A;  1T11 A;  1X6N A;  1FKR A;  4NNR A;  3KZ7 A;  3ARR A;  2WLZ A;  4WK9 A;  3RM8 A;  1HJW A;  4IT4 A;  1J6Y A;  4JFI A;  1W1Y A;  2FAP A;  3ARX A;  3B7X A;  3UF8 A;  4JFK A;  3ARZ A;  3ALG A;  3UI6 A;  3KAB A;  3IKD A;  4LAX A;  3UI4 A;  3EY6 A;  1TCO C;  2PV1 A;  1ZL1 A;  4U84 A;  3O5E A;  3AS3 A;  4DRJ A;  2ITK A;  2XPA A;  4FN2 A;  2Q5A A;  3WH0 A;  1FKJ A;  3KAD A;  3AS2 A;  4JFL A;  2DSZ A;  3B8S A;  2LGO A;  1EIB A;  1FFR A;  3GPK A;  3KAC A;  2F21 A;  3PR9 A;  2PI6 A;  3O5P A;  4Q22 A;  3CH9 A;  5JH8 A;  2PN0 A;  3H9R B;  4TW6 A;  3ARP A;  3PRB A;  3ARS A;  3O5R A;  2XP5 A;  3WKZ A;  1QPF A;  2DT3 A;  1WNO A;  4DWS C;  3ODK A;  4JFJ A;  2FKE A;  5DIV A;  1FJD A;  1RD6 A;  4Z2I A;  1KT1 A;  3G6L A;  1ZBV A;  4U86 A;  1IX5 A;  4L3N A;  4IT6 A;  4QIB A;  4DRK A;  2JZV A;  3KCE A;  1HJX A;  1LJY A;  3TCZ A;  3PRA A;  1FKI A;  3O5M A;  1LQ0 A;  4DRO A;  3BMB A;  1P5Q A;  2IF4 A;  3O5F A;  2WM0 A;  1JCH B;  4ODK A;  2FDM A;  1HKI A;  2F23 A;  4ZPW R;  2ZQT A;  1HKJ A;  2LPV A;  1QZ2 A;  4QT2 A;  1W9P A;  1ZBC A;  1FKD A;  3GU0 A;  2ZR5 A;  2RUD A;  3FY1 A;  2DT1 A;  3RME A;  1PBK A;  4MAV A;  1R9H A;  3O5K A;  4MPK A;  4NSB A;  1FKS A;  2A3A A;  1SYT A;  2L2S A;  3GTY X;  4TNS A;  1FKL A;  2MF9 A;  4DWS D;  3CHF A;  2ZR6 A;  3MDY B;  2KI3 A;  1FKG A;  3O5L A;  2DPE A;  4DWS A;  4MGV A;  5J6E A;  1EYM A;  3PA7 A;  5HUA A;  2F2D A;  3IHZ A;  4FAP A;  1M5Y A;  4ZS6 A;  3TDB A;  4UDM A;  2VCD A;  2MLZ A;  2ESC A;  3VAW A;  1F40 A;  1ITX A;  3ARU A;  1JNE A;  1FKK A;  5HKG A;  4P8X A;  2VN1 A;  4LAY A;  3WD0 A;  1LL7 A;  3B9E A;  5BXJ A;  2AWG A;  1XRV A;  1LG2 A;  3O5Q A;  2RQS A;  4JYS A;  3B9D A;  4ODL A;  2RUQ A;  3IKG A;  3WQW A;  3I6C A;  4J4N A;  2N87 A;  2EUL A;  1E6Z A;  1A7X A;  4S3J A;  1Q6H A;  1EQ3 A;  1NMW A;  5DO2 A;  2ZR4 A;  2PPP A;  4W5U A;  2DG3 A;  4HBO A;  1LL4 A;  3UQI A;  2M2A A;  1J4H A;  2RUR A;  3LUO A;  3ARO A;  3WL0 A;  3W4R A;  3ARV A;  4NZC A;  3NI6 A;  2XP7 A;  3KAF A;  4WKF A;  3TC5 A;  1NMV A;  1O6I A;  2DG4 A;  4WKA A;  2UZ5 A;  2WK2 A;  5B8I C;  5HTG A;  1GUV A;  5D75 A;  1ROT A;  3ARY A;  2A3B A;  4DZ2 A;  2OFN A;  3ART A;  4LAW A;  4DRI A;  3ALF A;  1JNS A;  1FD9 A;  2D9F A;  2ZQU A;  4KR0 B;  3BXW A;  4ML4 A;  4Z2G A;  2MNT A;  2B5U B;  3AQU A;  3RM9 A;  4G2P A;  1SR0 A;  4JFM A;  1GOI A;  5DEZ A;  1J4R A;  1E44 A;  1EDQ A;  4LGX A;  1JND A;  5GPG A;  4LAV A;  5DIT A;  3JYM A;  2YBU A;  4AY1 A;  3UQB A;  4Z2L A;  1H0G A;  5HT1 A;  3NTP A;  4DWS B;  1ZBK A;  1WB0 A;  4TX0 A;  4MSP A;  3O5I A;  4W9P A;  2RSE A;  4DIP A;  5HWB A;  1F8A B;  2IUZ A;  2DT0 A;  3QOK A;  2M1I A;  1B6C A;  2MLY A;  5DF0 A;  5HWC A;  1KT0 A;  4HBE A;  1X6L A;  4WIW A;  2F4E A;  4BF8 A;  1Q1C A;  3O5O A;  4W9Q A;  1W1P A;  3CHD A;  2ETN A;  1OGG A;  4N19 A;  2DG9 A;  1W1V A;  1JNT A;  4R5E A;  1CTN A;  4WJX A;  4ZPT R;  1C9H A;  1N1A A;  3FXY A;  4DRM A;  1QPL A;  4ODP A;  3CHC A;  4MNM A;  1FFQ A;  1D7J A;  2RUC A;  3EIP A;  4QT3 A;  2XP3 A;  3JYJ A;  4TYO A;  1E6N A;  2PPN A;  4DH0 A;  2XP4 A;  4ZPV R;  4MNJ A;  4DT4 A;  2XP8 A;  4KQZ A;  1JVW A;  5I98 A;  4IQ2 A;  4DRN A;  1VF8 A;  4R0X A;  3G6M A;  2MPH A;  3OOB A;  3WD1 A;  3CGM A;  2ZQS A;  3CZ8 A;  3O5G A;  2LKN A;  1H0I A;  4DRQ A;  2LJ4 A;  1HJV A;  4Q7N A;  1LG1 A;  4P8U A;  4ITZ A;  2KE0 A;  1KFW A;  2AOS A;  2K8I A;  1K9T A;  2Y78 A;  1BL4 A;  4W9O A;  1HXV A;  4WKH A;  2DSU A;  4ODR A;  3IK8 A;  1ZBW A;  5DIU A;  2XPB A;  1TFV A;  1Q6U A;  4GGQ A;  4J4O A;  4GIV A;  1ZK6 A;  2A3C A;  1FKT A;  2KO7 A;  4XAK A;  3JXV A;  1E6R A;  2O92 A;  1W1T A;  2PPO A;  3KAI A;  3RGC A;  1LL6 A;  1UR8 A;  2DSV A;  1Y0O A;  2PBC A;  4ODO A;  2WLY A;  1WAW A;  3UQA A;  1D2K A;  2DSW A;  1W26 A;  3KAH A;  3OA5 A;  4S3K A;  3NRK A;  3B9A A;  3RFW A;  2B31 A;  1FKH A;  1PIN A;  1E6P A;  3WL1 A;  1EHN A;  4O2T A;  3WD4 A;  1OWQ A;  2DT2 A;  4DRH A;  3WQV A;  2MLX A;  1NH6 A;  1OGB A;  4MNL A;  1ZB5 A;  3KAG A;  4DRP A;  2OLH A;  5HW6 A;  5HBF A;  4TW8 A;  4DZ3 A;  1D7H A;  3O5J A;  1HKM A;  2QF8 A;  1D6O A;  3PRD A;  4P8V A;  1YAT A;  1NWR A;  4ODM A;  1L1P A;  5GQB A;  4IQC A;  4MNK A;  3AS1 A;  2ZQV A;  1J4I A;  3ARW A;  4IPX A;  4MTV A;  4U85 A;  1GRJ A;  4ODQ A;  1FAP A;  1NWT A;  4URI A;  1HKK A;  1W9U A;  2O9O A;  4HAR A;  5HW7 A;  3WIJ A;  1GPF A;  1U79 A;  1BKF A;  4L72 B;  4P8W A;  1E9L A;  5HW8 A;  2A3E A;  3CHE A;  3O5D A;  1D7I A;  1W9V A;  2YBT A;  4G50 A;  3CGN A;  1Q6I A;  3ARQ A;  3WD3 A;  1FKB A;  2KGJ A;  1FKF A;  2G41 A;  1E15 A;  2P4V A;  1ZU8 A;  1UR9 A;  1NSG A;  2PV2 A;  4C02 B;  4QZV B;  3UI5 A;  4Z2H A;  2PV3 A;  4Z2K A;  1NWU A;  4ODN A;  2G8Z A;  1NWS A;  1XHG A;  5GPR A;  4PTM A;  3AS0 A;  3RM4 A;  2M08 A;  2KR7 A;  2XP6 A;  3FAP A;  2XP9 A;  1ROU A;  1YW5 A;  1ZCN A;  3WD2 A;  4TW7 A;  4Z2J A; 
#chains in the Genus database with same CATH homology
 2KFW A;  1T11 A;  1X6N A;  1FKR A;  4NNR A;  3KZ7 A;  3ARR A;  2WLZ A;  4WK9 A;  3RM8 A;  1HJW A;  4IT4 A;  1J6Y A;  4JFI A;  1W1Y A;  2FAP A;  3ARX A;  3B7X A;  3UF8 A;  4JFK A;  3ARZ A;  3ALG A;  3UI6 A;  3KAB A;  3IKD A;  4LAX A;  3UI4 A;  3EY6 A;  1TCO C;  2PV1 A;  1ZL1 A;  4U84 A;  3O5E A;  3AS3 A;  4DRJ A;  2ITK A;  2XPA A;  4FN2 A;  2Q5A A;  3WH0 A;  1FKJ A;  3KAD A;  3AS2 A;  4JFL A;  2DSZ A;  3B8S A;  2LGO A;  1EIB A;  1FFR A;  3GPK A;  3KAC A;  2F21 A;  3PR9 A;  2PI6 A;  3O5P A;  4Q22 A;  3CH9 A;  5JH8 A;  3H9R B;  4TW6 A;  3ARP A;  3PRB A;  3ARS A;  3O5R A;  2XP5 A;  3WKZ A;  1QPF A;  2DT3 A;  1WNO A;  4DWS C;  3ODK A;  4JFJ A;  2FKE A;  5DIV A;  1FJD A;  1RD6 A;  4Z2I A;  1KT1 A;  3G6L A;  1ZBV A;  4U86 A;  1IX5 A;  4L3N A;  4IT6 A;  4QIB A;  4DRK A;  2JZV A;  1HJX A;  3KCE A;  1LJY A;  3TCZ A;  3PRA A;  1FKI A;  3O5M A;  1LQ0 A;  4DRO A;  1P5Q A;  2IF4 A;  3O5F A;  2WM0 A;  4ODK A;  2FDM A;  1HKI A;  4ZPW R;  2ZQT A;  1HKJ A;  2LPV A;  1QZ2 A;  4QT2 A;  1W9P A;  1ZBC A;  1FKD A;  3RME A;  2ZR5 A;  2RUD A;  3FY1 A;  2DT1 A;  1PBK A;  4MAV A;  1R9H A;  3O5K A;  4MPK A;  4NSB A;  1FKS A;  2A3A A;  1SYT A;  2L2S A;  4TNS A;  1FKL A;  2MF9 A;  4DWS D;  3CHF A;  2ZR6 A;  3MDY B;  2KI3 A;  1FKG A;  3O5L A;  2DPE A;  4DWS A;  4MGV A;  5J6E A;  1EYM A;  3PA7 A;  5HUA A;  2F2D A;  3IHZ A;  4FAP A;  1M5Y A;  4ZS6 A;  3TDB A;  2VCD A;  2MLZ A;  2ESC A;  3VAW A;  1F40 A;  1ITX A;  3ARU A;  1JNE A;  1FKK A;  5HKG A;  4P8X A;  2VN1 A;  4LAY A;  3WD0 A;  1LL7 A;  3B9E A;  5BXJ A;  2AWG A;  1XRV A;  1LG2 A;  3O5Q A;  2RQS A;  4JYS A;  3B9D A;  4ODL A;  2RUQ A;  3IKG A;  3WQW A;  3I6C A;  4J4N A;  2N87 A;  1E6Z A;  1A7X A;  4S3J A;  1Q6H A;  1EQ3 A;  1NMW A;  5DO2 A;  2ZR4 A;  2PPP A;  4W5U A;  2DG3 A;  4HBO A;  1LL4 A;  3UQI A;  2M2A A;  1J4H A;  2RUR A;  3LUO A;  3ARO A;  3WL0 A;  3W4R A;  3ARV A;  4NZC A;  3NI6 A;  2XP7 A;  3KAF A;  4WKF A;  3TC5 A;  1NMV A;  1O6I A;  2DG4 A;  4WKA A;  2UZ5 A;  2WK2 A;  5B8I C;  5HTG A;  1GUV A;  5D75 A;  1ROT A;  3ARY A;  2A3B A;  4DZ2 A;  2OFN A;  3ART A;  4LAW A;  4DRI A;  3ALF A;  1JNS A;  1FD9 A;  2D9F A;  2ZQU A;  4KR0 B;  3BXW A;  4ML4 A;  4Z2G A;  2MNT A;  3AQU A;  3RM9 A;  4G2P A;  1SR0 A;  4JFM A;  1GOI A;  5DEZ A;  1J4R A;  1EDQ A;  4LGX A;  1JND A;  5GPG A;  4LAV A;  5DIT A;  3JYM A;  2YBU A;  4AY1 A;  3UQB A;  4Z2L A;  1H0G A;  5HT1 A;  3NTP A;  4DWS B;  1ZBK A;  1WB0 A;  4TX0 A;  4MSP A;  3O5I A;  4W9P A;  2RSE A;  4DIP A;  5HWB A;  1F8A B;  2IUZ A;  2DT0 A;  3QOK A;  2M1I A;  1B6C A;  2MLY A;  5DF0 A;  5HWC A;  1KT0 A;  4HBE A;  1X6L A;  4WIW A;  2F4E A;  4BF8 A;  1Q1C A;  3O5O A;  4W9Q A;  1W1P A;  3CHD A;  1OGG A;  4N19 A;  2DG9 A;  1W1V A;  1JNT A;  4R5E A;  1CTN A;  4WJX A;  4ZPT R;  1C9H A;  1N1A A;  3FXY A;  4DRM A;  1QPL A;  4ODP A;  3CHC A;  4MNM A;  1FFQ A;  1D7J A;  2RUC A;  4QT3 A;  4TYO A;  2XP3 A;  3JYJ A;  1E6N A;  2PPN A;  4DH0 A;  2XP4 A;  4ZPV R;  4MNJ A;  4DT4 A;  2XP8 A;  4KQZ A;  1JVW A;  5I98 A;  4IQ2 A;  4DRN A;  1VF8 A;  4R0X A;  3G6M A;  2MPH A;  3OOB A;  3WD1 A;  3CGM A;  2ZQS A;  3CZ8 A;  3O5G A;  2LKN A;  1H0I A;  4DRQ A;  2LJ4 A;  1HJV A;  4Q7N A;  1LG1 A;  4P8U A;  4ITZ A;  2KE0 A;  1KFW A;  2AOS A;  2K8I A;  1K9T A;  2Y78 A;  1BL4 A;  4W9O A;  1HXV A;  4WKH A;  2DSU A;  4ODR A;  3IK8 A;  1ZBW A;  5DIU A;  2XPB A;  1TFV A;  1Q6U A;  4GGQ A;  4J4O A;  4GIV A;  1ZK6 A;  2A3C A;  1FKT A;  2KO7 A;  4XAK A;  3JXV A;  1E6R A;  2O92 A;  1W1T A;  2PPO A;  3KAI A;  3RGC A;  1LL6 A;  1UR8 A;  2DSV A;  1Y0O A;  2PBC A;  4ODO A;  2WLY A;  1WAW A;  3UQA A;  1D2K A;  2DSW A;  1W26 A;  3KAH A;  3OA5 A;  4S3K A;  3NRK A;  3B9A A;  3RFW A;  2B31 A;  1FKH A;  1PIN A;  1E6P A;  3WL1 A;  1EHN A;  4O2T A;  3WD4 A;  1OWQ A;  2DT2 A;  4DRH A;  3WQV A;  2MLX A;  1NH6 A;  1OGB A;  4MNL A;  1ZB5 A;  3KAG A;  4DRP A;  2OLH A;  5HW6 A;  5HBF A;  4TW8 A;  4DZ3 A;  1D7H A;  3O5J A;  1HKM A;  2QF8 A;  1D6O A;  3PRD A;  4P8V A;  1YAT A;  1NWR A;  4ODM A;  1L1P A;  5GQB A;  4IQC A;  4MNK A;  3AS1 A;  2ZQV A;  1J4I A;  3ARW A;  4IPX A;  4MTV A;  4U85 A;  4ODQ A;  1FAP A;  1NWT A;  4URI A;  1HKK A;  1W9U A;  2O9O A;  4HAR A;  5HW7 A;  3WIJ A;  1GPF A;  1U79 A;  1BKF A;  4L72 B;  4P8W A;  1E9L A;  5HW8 A;  2A3E A;  3CHE A;  3O5D A;  1D7I A;  1W9V A;  2YBT A;  4G50 A;  3CGN A;  1Q6I A;  3ARQ A;  3WD3 A;  1FKB A;  2KGJ A;  1FKF A;  2G41 A;  1E15 A;  1ZU8 A;  1UR9 A;  1NSG A;  2PV2 A;  4C02 B;  4QZV B;  3UI5 A;  4Z2H A;  2PV3 A;  4Z2K A;  1NWU A;  4ODN A;  2G8Z A;  1NWS A;  1XHG A;  5GPR A;  4PTM A;  3AS0 A;  3RM4 A;  2M08 A;  2KR7 A;  2XP6 A;  3FAP A;  2XP9 A;  1ROU A;  1YW5 A;  1ZCN A;  3WD2 A;  4TW7 A;  4Z2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...