1D7IA

Fkbp complexed with methyl methylsulfinylmethyl sulfide (dss)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
publication title X-ray structures of small ligand-FKBP complexes provide an estimate for hydrophobic interaction energies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 26
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1d7iA00
1ZCNA 2DG4A 1R9HA 4G50A 3KAIA 1TCOC 3KCEA 2MLYA 4QT2A 4MSPA 1KT0A 2IF4A 1FKKA 3OOBA 4DRHA 1FKIA 1FD9A 2PPPA 4TYOA 3UI5A 4DRQA 2M08A 3O5DA 2VN1A 3H9RB 1NMVA 2PV2A 2M1IA 2Q5AA 3KACA 1FJDA 1L1PA 2LGOA 3NRKA 4LAWA 1FKTA 3LUOA 2KI3A 4JFMA 3RGCA 3VAWA 2LPVA 2PPNA 4JFIA 1W26A 3CGMA 4LAVA 3PRBA 1PINA 4GIVA 4FAPA 4DIPA 3TC5A 3O5LA 3JXVA 3O5IA 4ODKA 4R0XA 1D6OA 4ITZA 3UQIA 2PBCA 3O5MA 4W9QA 1QZ2A 2XP4A 4DROA 4IPXA 2MLZA 5DIUA 2OFNA 3RFWA 1JVWA 2FAPA 4JFJA 2MF9A 1D7IA 4DRMA 2ZQUA 5HUAA 4FN2A 2ZQSA 1PBKA 2XP6A 3KAGA 4ODMA 5HW6A 4JFLA 3UF8A 1ROTA 3UI6A 2ZQTA 1KT1A 1QPFA 3KAHA 5HW8A 5HKGA 2VCDA 2RURA 1Q1CA 1NSGA 1J4IA 1EQ3A 2ZR5A 1FKHA 1ROUA 2XP8A 2KE0A 4U86A 1FKFA 4DRJA 4J4NA 4LAXA 4ODRA 5I98A 2MPHA 3IHZA 2KR7A 4ODPA 3PA7A 1B6CA 2XP7A 3O5JA 3O5QA 4DRIA 2L2SA 3GPKA 3MDYB 4JYSA 1J4HA 3KADA 1BL4A 3KABA 3WH0A 4LAYA 2PPOA 4ODLA 4TW8A 5HT1A 3EY6A 3IK8A 3UQBA 2ZR6A 4J4OA 1BKFA 3TCZA 4DZ3A 1FKRA 1A7XA 1FAPA 1JNTA 1ZK6A 3ODKA 4GGQA 5D75A 2MLXA 2ZR4A 3KAFA 4ODNA 3O5GA 4TX0A 4U84A 3O5FA 1FKJA 3CGNA 5BXJA 2N87A 4ODOA 4DRPA 1FKDA 4NNRA 2XP9A 3JYJA 4G2PA 2KGJA 4C02B 2XP5A 3UI4A 1Y0OA 4MGVA 1HXVA 5DIVA 5DITA 5B8IC 1P5QA 2MNTA 3O5EA 4TW7A 4DT4A 4DRNA 2RUCA 1EYMA 4IQCA 4ODQA 2ZQVA 3UQAA 2F2DA 1Q6IA 2F4EA 1YATA 1T11A 2AWGA 3FAPA 4O2TA 4W9PA 2RUDA 3I6CA 2XP3A 4QIBA 5HWCA 4W9OA 5GPGA 1NMWA 4QT3A 3JYMA 2XPAA 4N19A 5HW7A 1FKSA 1N1AA 2K8IA 2RUQA 3KZ7A 1J6YA 2XPBA 3O5PA 1F40A 2RQSA 2D9FA 4DH0A 4DRKA 1FKBA 2F21A 2PV1A 1Q6UA 1U79A 4BF8A 2LJ4A 4U85A 3PRDA 2LKNA 1FKLA 1C9HA 4TNSA 4TW6A 3TDBA 2Y78A 1QPLA 3NI6A 2M2AA 2FKEA 1D7JA 4DZ2A 3O5RA 2DG9A 1YW5A 3NTPA 3O5KA 4IQ2A 1D7HA 1Q6HA 2ITKA 1J4RA 3B7XA 5J6EA 2RSEA 2DG3A 1F8AB 1FKGA 1JNSA 2KFWA 5HTGA 3IKDA 3IKGA 4JFKA 1M5YA 2PV3A 2UZ5A 2JZVA 3O5OA 2KO7A 5HWBA
chains in the Genus database with same CATH superfamily
3KAIA 3EIPA 2B5UB 4DRHA 2PPPA 4KQZA 3KACA 1L1PA 2DSZA 2LGOA 4LAWA 1HJVA 4JFMA 3VAWA 4LAVA 3PRBA 4FAPA 2DT0A 1GOIA 3AQUA 1D6OA 4ITZA 2XP4A 1JNEA 2FAPA 4JFJA 4DRMA 5HUAA 4FN2A 4MTVA 5HW6A 2PI6A 1ROTA 3UI6A 1KT1A 2VCDA 3WQVA 3ARTA 1ROUA 3B8SA 4Z2GA 2XP8A 1FKFA 3G6MA 3IHZA 4MNJA 4ODPA 1B6CA 3O5QA 1ZBCA 3KABA 3WH0A 4TW8A 3W4RA 4HBEA 1W1PA 1FKRA 4P8VA 4GGQA 2WK2A 2MLXA 2ZR4A 3KAFA 3PR9A 3O5FA 2N87A 4LGXA 4WJXA 2KGJA 4MGVA 1HXVA 5DIVA 4NSBA 4MNKA 2DSUA 4DRNA 1EIBA 1OGGA 1Q6IA 1YATA 2A3AA 1GRJA 2AWGA 2RUDA 3I6CA 4WIWA 5HWCA 4Q22A 4W9OA 5GPGA 3ARRA 2XPAA 5HW7A 1FKSA 2XPBA 3O5PA 4L72B 1F40A 3AS3A 2D9FA 2F21A 5DF0A 3FY1A 2DSWA 2Y78A 3NI6A 2M2AA 1D7JA 2WLZA 3O5RA 3NTPA 3O5KA 4IT4A 3ARXA 1F8AB 3IKGA 4R5EA 1YW5A 1R9HA 4Z2KA 3OOBA 1EHNA 1FKKA 1FKIA 1FD9A 5DO2A 2M08A 1NMVA 1W1VA 2PV2A 2Q5AA 1FJDA 3PRAA 3LUOA 2KI3A 4JFIA 1LL7A 1PINA 4GIVA 4ODKA 2PBCA 1E9LA 4IPXA 4DWSB 2MF9A 1E6NA 2ZQSA 3CHCA 3ARPA 4JFLA 1QPFA 3KAHA 4P8XA 5HKGA 2RURA 1NSGA 1J4IA 1LL4A 1EQ3A 3WD1A 3GTYX 1VF8A 4U86A 4LAXA 4ODRA 5I98A 2MPHA 1E6PA 3CHDA 2XP7A 3MDYB 3ARVA 1FFQA 3B9EA 4LAYA 2PPOA 4ODLA 5HT1A 3UQBA 4J4OA 3WIJA 2ESCA 1BKFA 3ARQA 4DZ3A 4P8UA 5D75A 4ODNA 4TX0A 1E44A 2XP9A 3JYJA 3AS1A 1W9UA 4G2PA 3RMEA 1Y0OA 3CHEA 1P5QA 3O5EA 4XAKA 4DT4A 1XHGA 2RUCA 1O6IA 4ODQA 3UQAA 2F2DA 2F4EA 1T11A 5JH8A 1SR0A 4MAVA 3FAPA 3RM4A 4W9PA 4QIBA 1XRVA 5DEZA 1NMWA 1ZBWA 2B31A 3JYMA 4N19A 1N1AA 2G41A 2QF8A 4BF8A 2LJ4A 4ZPVR 4U85A 4Z2LA 2LKNA 1C9HA 1W1YA 3TDBA 1QPLA 2FKEA 4Z2HA 3ARSA 3ARWA 1J4RA 3ALFA 4W5UA 5J6EA 2RSEA 1NH6A 1H0IA 2DG3A 3RM9A 1FKGA 4MPKA 1JNSA 4WKFA 3O5OA 2KO7A 5HWBA 1TCOC 3KCEA 4QT2A 3UI5A 1ZBVA 2ETNA 1UR9A 1NWUA 2M1IA 2PN0A 1X6LA 4HARA 3RM8A 3RGCA 2LPVA 2PPNA 2DSVA 3CGMA 5GPRA 3CZ8A 4DIPA 1W1TA 3TC5A 3O5LA 3O5IA 4R0XA 3WD3A 3ARUA 3UQIA 4DROA 5GQBA 3RFWA 1HJXA 1D7IA 4HBOA 3ALGA 1PBKA 2XP6A 4ODMA 3UF8A 5HW8A 1K9TA 3GU0A 1ZL1A 1ITXA 1FKHA 2FDMA 1HKJA 2KE0A 2OLHA 2AOSA 2DT2A 1WB0A 4DRJA 1GPFA 3AROA 4WKAA 1HJWA 1LQ0A 3PA7A 4DRIA 4JYSA 3KADA 1BL4A 1LG2A 1WNOA 4DWSD 3IK8A 4PTMA 1LJYA 2IUZA 3TCZA 5HBFA 3AS0A 1JNTA 4U84A 5BXJA 1FKJA 3CGNA 1ZBKA 4WKHA 4DRPA 1FKDA 3WD2A 4C02B 3UI4A 4ZS6A 5DITA 5B8IC 2DPEA 4TW7A 4IQCA 3WL1A 2A3EA 1E15A 1OGBA 1W9VA 1ZU8A 4QZVB 3OA5A 4QT3A 2K8IA 3KZ7A 2RUQA 1J6YA 4DH0A 4DRKA 1FKBA 1Q6UA 1U79A 2O92A 4TNSA 1NWTA 2P4VA 1CTNA 1JNDA 4DZ2A 1LL6A 3B7XA 3WQWA 3B9DA 3BMBA 5HTGA 2WM0A 4L3NA 3IKDA 1M5YA 2PV3A 2UZ5A 1ZCNA 2DG4A 4DWSC 4G50A 1SYTA 2MLYA 1JCHB 4MSPA 1KT0A 1HKKA 2IF4A 1EDQA 4ML4A 4DRQA 4IT6A 4TYOA 3O5DA 2VN1A 3H9RB 1HKIA 3NRKA 1FKTA 2DT3A 1W26A 3FXYA 4ZPWR 3WKZA 4P8WA 3JXVA 4WK9A 4Z2JA 3WD4A 1NWRA 3O5MA 4W9QA 1QZ2A 4Z2IA 2MLZA 5DIUA 2OFNA 2A3BA 1JVWA 2DT1A 3CH9A 2ZQUA 3KAGA 1E6ZA 3QOKA 2ZQTA 1H0GA 1WAWA 4S3KA 1Q1CA 1HKMA 2ZR5A 4J4NA 1OWQA 3G6LA 4AY1A 2KR7A 4Q7NA 2YBTA 3O5JA 2L2SA 3GPKA 1J4HA 4NZCA 3EY6A 4MNMA 4DWSA 2ZR6A 3ARYA 1A7XA 1FAPA 3ARZA 1ZK6A 3ODKA 1GUVA 3O5GA 4ODOA 1KFWA 4NNRA 2A3CA 1NWSA 4KR0B 1UR8A 1X6NA 2XP5A 1TFVA 1LG1A 3WD0A 2MNTA 3BXWA 1IX5A 1EYMA 3AS2A 2ZQVA 2YBUA 2WLYA 1E6RA 2EULA 1ZB5A 1RD6A 1D2KA 4O2TA 4UDMA 2XP3A 2F23A 3WL0A 2RQSA 3CHFA 4MNLA 2O9OA 2PV1A 4URIA 4ZPTR 3PRDA 1FKLA 4TW6A 4S3JA 1FFRA 3B9AA 2G8ZA 2DG9A 4IQ2A 1D7HA 1Q6HA 2ITKA 1W9PA 2KFWA 4JFKA 2JZVA
chains in the Genus database with same CATH topology
3KAIA 4DRHA 2PPPA 4KQZA 3KACA 1L1PA 2DSZA 2LGOA 4LAWA 1HJVA 4JFMA 3VAWA 4LAVA 3PRBA 4FAPA 2DT0A 1GOIA 3AQUA 1D6OA 4ITZA 2XP4A 1JNEA 2FAPA 4JFJA 4DRMA 5HUAA 4FN2A 4MTVA 5HW6A 2PI6A 1ROTA 3UI6A 1KT1A 2VCDA 3WQVA 3ARTA 1ROUA 3B8SA 4Z2GA 2XP8A 1FKFA 3G6MA 3IHZA 4MNJA 4ODPA 1B6CA 3O5QA 1ZBCA 3KABA 3WH0A 4TW8A 3W4RA 4HBEA 1W1PA 1FKRA 4P8VA 4GGQA 2WK2A 2MLXA 2ZR4A 3KAFA 3PR9A 3O5FA 2N87A 4LGXA 4WJXA 2KGJA 4MGVA 1HXVA 5DIVA 4NSBA 4MNKA 2DSUA 4DRNA 1EIBA 1OGGA 1Q6IA 1YATA 2A3AA 2AWGA 2RUDA 3I6CA 4WIWA 5HWCA 4Q22A 4W9OA 5GPGA 3ARRA 2XPAA 5HW7A 1FKSA 2XPBA 3O5PA 4L72B 1F40A 3AS3A 2D9FA 2F21A 5DF0A 3FY1A 2DSWA 2Y78A 3NI6A 2M2AA 1D7JA 2WLZA 3O5RA 3NTPA 3O5KA 4IT4A 3ARXA 1F8AB 3IKGA 4R5EA 1YW5A 1R9HA 4Z2KA 3OOBA 1EHNA 1FKKA 1FKIA 1FD9A 5DO2A 2M08A 1NMVA 1W1VA 2PV2A 2Q5AA 1FJDA 3PRAA 3LUOA 2KI3A 4JFIA 1LL7A 1PINA 4GIVA 4ODKA 2PBCA 1E9LA 4IPXA 4DWSB 2MF9A 1E6NA 2ZQSA 3CHCA 3ARPA 4JFLA 1QPFA 3KAHA 4P8XA 5HKGA 2RURA 1NSGA 1J4IA 1LL4A 1EQ3A 3WD1A 1VF8A 4U86A 4LAXA 4ODRA 5I98A 2MPHA 1E6PA 3CHDA 2XP7A 3MDYB 3ARVA 1FFQA 3B9EA 4LAYA 2PPOA 4ODLA 5HT1A 3UQBA 4J4OA 3WIJA 2ESCA 1BKFA 3ARQA 4DZ3A 4P8UA 5D75A 4ODNA 4TX0A 2XP9A 3JYJA 3AS1A 1W9UA 4G2PA 3RMEA 1Y0OA 3CHEA 1P5QA 3O5EA 4XAKA 4DT4A 1XHGA 2RUCA 1O6IA 4ODQA 3UQAA 2F2DA 2F4EA 1T11A 5JH8A 1SR0A 4MAVA 3FAPA 3RM4A 4W9PA 4QIBA 1XRVA 5DEZA 1NMWA 1ZBWA 2B31A 3JYMA 4N19A 1N1AA 2G41A 2QF8A 4BF8A 2LJ4A 4ZPVR 4U85A 4Z2LA 2LKNA 1C9HA 1W1YA 3TDBA 1QPLA 2FKEA 4Z2HA 3ARSA 3ARWA 1J4RA 3ALFA 4W5UA 5J6EA 2RSEA 1NH6A 1H0IA 2DG3A 3RM9A 1FKGA 4MPKA 1JNSA 4WKFA 3O5OA 2KO7A 5HWBA 1TCOC 3KCEA 4QT2A 3UI5A 1ZBVA 1UR9A 1NWUA 2M1IA 4HARA 1X6LA 3RM8A 3RGCA 2LPVA 2PPNA 2DSVA 3CGMA 5GPRA 3CZ8A 4DIPA 1W1TA 3TC5A 3O5LA 3O5IA 4R0XA 3WD3A 3ARUA 3UQIA 4DROA 5GQBA 3RFWA 1HJXA 1D7IA 4HBOA 3ALGA 1PBKA 2XP6A 4ODMA 3UF8A 5HW8A 1K9TA 1ZL1A 1ITXA 1FKHA 2FDMA 1HKJA 2KE0A 2OLHA 2AOSA 2DT2A 1WB0A 4DRJA 1GPFA 3AROA 4WKAA 1HJWA 1LQ0A 3PA7A 4DRIA 4JYSA 3KADA 1BL4A 1LG2A 1WNOA 4DWSD 3IK8A 4PTMA 1LJYA 2IUZA 3TCZA 5HBFA 3AS0A 1JNTA 4U84A 5BXJA 1FKJA 3CGNA 1ZBKA 4WKHA 4DRPA 1FKDA 3WD2A 4C02B 3UI4A 4ZS6A 5DITA 5B8IC 2DPEA 4TW7A 4IQCA 3WL1A 2A3EA 1E15A 1OGBA 1W9VA 1ZU8A 4QZVB 3OA5A 4QT3A 2K8IA 3KZ7A 2RUQA 1J6YA 4DH0A 4DRKA 1FKBA 1Q6UA 1U79A 2O92A 4TNSA 1NWTA 1CTNA 1JNDA 4DZ2A 1LL6A 3B7XA 3WQWA 3B9DA 5HTGA 2WM0A 4L3NA 3IKDA 1M5YA 2PV3A 2UZ5A 1ZCNA 2DG4A 4DWSC 4G50A 1SYTA 2MLYA 4MSPA 1KT0A 1HKKA 2IF4A 1EDQA 4ML4A 4DRQA 4IT6A 4TYOA 3O5DA 2VN1A 3H9RB 1HKIA 3NRKA 1FKTA 2DT3A 1W26A 3FXYA 4ZPWR 3WKZA 4P8WA 3JXVA 4WK9A 4Z2JA 3WD4A 1NWRA 3O5MA 4W9QA 1QZ2A 4Z2IA 2MLZA 5DIUA 2OFNA 2A3BA 1JVWA 2DT1A 3CH9A 2ZQUA 3KAGA 1E6ZA 3QOKA 2ZQTA 1H0GA 1WAWA 4S3KA 1Q1CA 1HKMA 2ZR5A 4J4NA 1OWQA 3G6LA 4AY1A 2KR7A 4Q7NA 2YBTA 3O5JA 2L2SA 3GPKA 1J4HA 4NZCA 3EY6A 4MNMA 4DWSA 2ZR6A 3ARYA 1A7XA 1FAPA 3ARZA 1ZK6A 3ODKA 1GUVA 3O5GA 4ODOA 1KFWA 4NNRA 2A3CA 1NWSA 4KR0B 1UR8A 1X6NA 2XP5A 1TFVA 1LG1A 3WD0A 2MNTA 3BXWA 1IX5A 1EYMA 3AS2A 2ZQVA 2YBUA 2WLYA 1E6RA 1ZB5A 1RD6A 1D2KA 4O2TA 2XP3A 3WL0A 2RQSA 3CHFA 4MNLA 2O9OA 2PV1A 4URIA 4ZPTR 3PRDA 1FKLA 4TW6A 4S3JA 1FFRA 3B9AA 2G8ZA 2DG9A 4IQ2A 1D7HA 1Q6HA 2ITKA 1W9PA 2KFWA 4JFKA 2JZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZCN A;  2DG4 A;  1R9H A;  4G50 A;  3KAI A;  1TCO C;  3KCE A;  2MLY A;  4QT2 A;  4MSP A;  1KT0 A;  2IF4 A;  1FKK A;  3OOB A;  4DRH A;  1FKI A;  1FD9 A;  2PPP A;  4TYO A;  3UI5 A;  4DRQ A;  2M08 A;  3O5D A;  2VN1 A;  3H9R B;  1NMV A;  2PV2 A;  2M1I A;  2Q5A A;  3KAC A;  1FJD A;  1L1P A;  2LGO A;  3NRK A;  4LAW A;  1FKT A;  3LUO A;  2KI3 A;  4JFM A;  3RGC A;  3VAW A;  2LPV A;  2PPN A;  4JFI A;  1W26 A;  3CGM A;  4LAV A;  3PRB A;  1PIN A;  4GIV A;  4FAP A;  4DIP A;  3TC5 A;  3O5L A;  3JXV A;  3O5I A;  4ODK A;  4R0X A;  1D6O A;  4ITZ A;  3UQI A;  2PBC A;  3O5M A;  4W9Q A;  1QZ2 A;  2XP4 A;  4DRO A;  4IPX A;  2MLZ A;  5DIU A;  2OFN A;  3RFW A;  1JVW A;  2FAP A;  4JFJ A;  2MF9 A;  1D7I A;  4DRM A;  2ZQU A;  5HUA A;  4FN2 A;  2ZQS A;  1PBK A;  2XP6 A;  3KAG A;  4ODM A;  5HW6 A;  4JFL A;  3UF8 A;  1ROT A;  3UI6 A;  2ZQT A;  1KT1 A;  1QPF A;  3KAH A;  5HW8 A;  5HKG A;  2VCD A;  2RUR A;  1Q1C A;  1NSG A;  1J4I A;  1EQ3 A;  2ZR5 A;  1FKH A;  1ROU A;  2XP8 A;  2KE0 A;  4U86 A;  1FKF A;  4DRJ A;  4J4N A;  4LAX A;  4ODR A;  5I98 A;  2MPH A;  3IHZ A;  2KR7 A;  4ODP A;  3PA7 A;  1B6C A;  2XP7 A;  3O5J A;  3O5Q A;  4DRI A;  2L2S A;  3GPK A;  3MDY B;  4JYS A;  1J4H A;  3KAD A;  1BL4 A;  3KAB A;  3WH0 A;  4LAY A;  2PPO A;  4ODL A;  4TW8 A;  5HT1 A;  3EY6 A;  3IK8 A;  3UQB A;  2ZR6 A;  4J4O A;  1BKF A;  3TCZ A;  4DZ3 A;  1FKR A;  1A7X A;  1FAP A;  1JNT A;  1ZK6 A;  3ODK A;  4GGQ A;  5D75 A;  2MLX A;  2ZR4 A;  3KAF A;  4ODN A;  3O5G A;  4TX0 A;  4U84 A;  3O5F A;  1FKJ A;  3CGN A;  5BXJ A;  2N87 A;  4ODO A;  4DRP A;  1FKD A;  4NNR A;  2XP9 A;  3JYJ A;  4G2P A;  2KGJ A;  4C02 B;  2XP5 A;  3UI4 A;  1Y0O A;  4MGV A;  1HXV A;  5DIV A;  5DIT A;  5B8I C;  1P5Q A;  2MNT A;  3O5E A;  4TW7 A;  4DT4 A;  4DRN A;  2RUC A;  1EYM A;  4IQC A;  4ODQ A;  2ZQV A;  3UQA A;  2F2D A;  1Q6I A;  2F4E A;  1YAT A;  1T11 A;  2AWG A;  3FAP A;  4O2T A;  4W9P A;  2RUD A;  3I6C A;  2XP3 A;  4QIB A;  5HWC A;  4W9O A;  5GPG A;  1NMW A;  4QT3 A;  3JYM A;  2XPA A;  4N19 A;  5HW7 A;  1FKS A;  1N1A A;  2K8I A;  2RUQ A;  3KZ7 A;  1J6Y A;  2XPB A;  3O5P A;  1F40 A;  2RQS A;  2D9F A;  4DH0 A;  4DRK A;  1FKB A;  2F21 A;  2PV1 A;  1Q6U A;  1U79 A;  4BF8 A;  2LJ4 A;  4U85 A;  3PRD A;  2LKN A;  1FKL A;  1C9H A;  4TNS A;  4TW6 A;  3TDB A;  2Y78 A;  1QPL A;  3NI6 A;  2M2A A;  2FKE A;  1D7J A;  4DZ2 A;  3O5R A;  2DG9 A;  1YW5 A;  3NTP A;  3O5K A;  4IQ2 A;  1D7H A;  1Q6H A;  2ITK A;  1J4R A;  3B7X A;  5J6E A;  2RSE A;  2DG3 A;  1F8A B;  1FKG A;  1JNS A;  2KFW A;  5HTG A;  3IKD A;  3IKG A;  4JFK A;  1M5Y A;  2PV3 A;  2UZ5 A;  2JZV A;  3O5O A;  2KO7 A;  5HWB A; 
#chains in the Genus database with same CATH topology
 3KAI A;  3EIP A;  2B5U B;  4DRH A;  2PPP A;  4KQZ A;  3KAC A;  1L1P A;  2DSZ A;  2LGO A;  4LAW A;  1HJV A;  4JFM A;  3VAW A;  4LAV A;  3PRB A;  4FAP A;  2DT0 A;  1GOI A;  3AQU A;  1D6O A;  4ITZ A;  2XP4 A;  1JNE A;  2FAP A;  4JFJ A;  4DRM A;  5HUA A;  4FN2 A;  4MTV A;  5HW6 A;  2PI6 A;  1ROT A;  3UI6 A;  1KT1 A;  2VCD A;  3WQV A;  3ART A;  1ROU A;  3B8S A;  4Z2G A;  2XP8 A;  1FKF A;  3G6M A;  3IHZ A;  4MNJ A;  4ODP A;  1B6C A;  3O5Q A;  1ZBC A;  3KAB A;  3WH0 A;  4TW8 A;  3W4R A;  4HBE A;  1W1P A;  1FKR A;  4P8V A;  4GGQ A;  2WK2 A;  2MLX A;  2ZR4 A;  3KAF A;  3PR9 A;  3O5F A;  2N87 A;  4LGX A;  4WJX A;  2KGJ A;  4MGV A;  1HXV A;  5DIV A;  4NSB A;  4MNK A;  2DSU A;  4DRN A;  1EIB A;  1OGG A;  1Q6I A;  1YAT A;  2A3A A;  1GRJ A;  2AWG A;  2RUD A;  3I6C A;  4WIW A;  5HWC A;  4Q22 A;  4W9O A;  5GPG A;  3ARR A;  2XPA A;  5HW7 A;  1FKS A;  2XPB A;  3O5P A;  4L72 B;  1F40 A;  3AS3 A;  2D9F A;  2F21 A;  5DF0 A;  3FY1 A;  2DSW A;  2Y78 A;  3NI6 A;  2M2A A;  1D7J A;  2WLZ A;  3O5R A;  3NTP A;  3O5K A;  4IT4 A;  3ARX A;  1F8A B;  3IKG A;  4R5E A;  1YW5 A;  1R9H A;  4Z2K A;  3OOB A;  1EHN A;  1FKK A;  1FKI A;  1FD9 A;  5DO2 A;  2M08 A;  1NMV A;  1W1V A;  2PV2 A;  2Q5A A;  1FJD A;  3PRA A;  3LUO A;  2KI3 A;  4JFI A;  1LL7 A;  1PIN A;  4GIV A;  4ODK A;  2PBC A;  1E9L A;  4IPX A;  4DWS B;  2MF9 A;  1E6N A;  2ZQS A;  3CHC A;  3ARP A;  4JFL A;  1QPF A;  3KAH A;  4P8X A;  5HKG A;  2RUR A;  1NSG A;  1J4I A;  1LL4 A;  1EQ3 A;  3WD1 A;  3GTY X;  1VF8 A;  4U86 A;  4LAX A;  4ODR A;  5I98 A;  2MPH A;  1E6P A;  3CHD A;  2XP7 A;  3MDY B;  3ARV A;  1FFQ A;  3B9E A;  4LAY A;  2PPO A;  4ODL A;  5HT1 A;  3UQB A;  4J4O A;  3WIJ A;  2ESC A;  1BKF A;  3ARQ A;  4DZ3 A;  4P8U A;  5D75 A;  4ODN A;  4TX0 A;  1E44 A;  2XP9 A;  3JYJ A;  3AS1 A;  1W9U A;  4G2P A;  3RME A;  1Y0O A;  3CHE A;  1P5Q A;  3O5E A;  4XAK A;  4DT4 A;  1XHG A;  2RUC A;  1O6I A;  4ODQ A;  3UQA A;  2F2D A;  2F4E A;  1T11 A;  5JH8 A;  1SR0 A;  4MAV A;  3FAP A;  3RM4 A;  4W9P A;  4QIB A;  1XRV A;  5DEZ A;  1NMW A;  1ZBW A;  2B31 A;  3JYM A;  4N19 A;  1N1A A;  2G41 A;  2QF8 A;  4BF8 A;  2LJ4 A;  4ZPV R;  4U85 A;  4Z2L A;  2LKN A;  1C9H A;  1W1Y A;  3TDB A;  1QPL A;  2FKE A;  4Z2H A;  3ARS A;  3ARW A;  1J4R A;  3ALF A;  4W5U A;  5J6E A;  2RSE A;  1NH6 A;  1H0I A;  2DG3 A;  3RM9 A;  1FKG A;  4MPK A;  1JNS A;  4WKF A;  3O5O A;  2KO7 A;  5HWB A;  1TCO C;  3KCE A;  4QT2 A;  3UI5 A;  1ZBV A;  2ETN A;  1UR9 A;  1NWU A;  2M1I A;  2PN0 A;  1X6L A;  4HAR A;  3RM8 A;  3RGC A;  2LPV A;  2PPN A;  2DSV A;  3CGM A;  5GPR A;  3CZ8 A;  4DIP A;  1W1T A;  3TC5 A;  3O5L A;  3O5I A;  4R0X A;  3WD3 A;  3ARU A;  3UQI A;  4DRO A;  5GQB A;  3RFW A;  1HJX A;  1D7I A;  4HBO A;  3ALG A;  1PBK A;  2XP6 A;  4ODM A;  3UF8 A;  5HW8 A;  1K9T A;  3GU0 A;  1ZL1 A;  1ITX A;  1FKH A;  2FDM A;  1HKJ A;  2KE0 A;  2OLH A;  2AOS A;  2DT2 A;  1WB0 A;  4DRJ A;  1GPF A;  3ARO A;  4WKA A;  1HJW A;  1LQ0 A;  3PA7 A;  4DRI A;  4JYS A;  3KAD A;  1BL4 A;  1LG2 A;  1WNO A;  4DWS D;  3IK8 A;  4PTM A;  1LJY A;  2IUZ A;  3TCZ A;  5HBF A;  3AS0 A;  1JNT A;  4U84 A;  5BXJ A;  1FKJ A;  3CGN A;  1ZBK A;  4WKH A;  4DRP A;  1FKD A;  3WD2 A;  4C02 B;  3UI4 A;  4ZS6 A;  5DIT A;  5B8I C;  2DPE A;  4TW7 A;  4IQC A;  3WL1 A;  2A3E A;  1E15 A;  1OGB A;  1W9V A;  1ZU8 A;  4QZV B;  3OA5 A;  4QT3 A;  2K8I A;  3KZ7 A;  2RUQ A;  1J6Y A;  4DH0 A;  4DRK A;  1FKB A;  1Q6U A;  1U79 A;  2O92 A;  4TNS A;  1NWT A;  2P4V A;  1CTN A;  1JND A;  4DZ2 A;  1LL6 A;  3B7X A;  3WQW A;  3B9D A;  3BMB A;  5HTG A;  2WM0 A;  4L3N A;  3IKD A;  1M5Y A;  2PV3 A;  2UZ5 A;  1ZCN A;  2DG4 A;  4DWS C;  4G50 A;  1SYT A;  2MLY A;  1JCH B;  4MSP A;  1KT0 A;  1HKK A;  2IF4 A;  1EDQ A;  4ML4 A;  4DRQ A;  4IT6 A;  4TYO A;  3O5D A;  2VN1 A;  3H9R B;  1HKI A;  3NRK A;  1FKT A;  2DT3 A;  1W26 A;  3FXY A;  4ZPW R;  3WKZ A;  4P8W A;  3JXV A;  4WK9 A;  4Z2J A;  3WD4 A;  1NWR A;  3O5M A;  4W9Q A;  1QZ2 A;  4Z2I A;  2MLZ A;  5DIU A;  2OFN A;  2A3B A;  1JVW A;  2DT1 A;  3CH9 A;  2ZQU A;  3KAG A;  1E6Z A;  3QOK A;  2ZQT A;  1H0G A;  1WAW A;  4S3K A;  1Q1C A;  1HKM A;  2ZR5 A;  4J4N A;  1OWQ A;  3G6L A;  4AY1 A;  2KR7 A;  4Q7N A;  2YBT A;  3O5J A;  2L2S A;  3GPK A;  1J4H A;  4NZC A;  3EY6 A;  4MNM A;  4DWS A;  2ZR6 A;  3ARY A;  1A7X A;  1FAP A;  3ARZ A;  1ZK6 A;  3ODK A;  1GUV A;  3O5G A;  4ODO A;  1KFW A;  4NNR A;  2A3C A;  1NWS A;  4KR0 B;  1UR8 A;  1X6N A;  2XP5 A;  1TFV A;  1LG1 A;  3WD0 A;  2MNT A;  3BXW A;  1IX5 A;  1EYM A;  3AS2 A;  2ZQV A;  2YBU A;  2WLY A;  1E6R A;  2EUL A;  1ZB5 A;  1RD6 A;  1D2K A;  4O2T A;  4UDM A;  2XP3 A;  2F23 A;  3WL0 A;  2RQS A;  3CHF A;  4MNL A;  2O9O A;  2PV1 A;  4URI A;  4ZPT R;  3PRD A;  1FKL A;  4TW6 A;  4S3J A;  1FFR A;  3B9A A;  2G8Z A;  2DG9 A;  4IQ2 A;  1D7H A;  1Q6H A;  2ITK A;  1W9P A;  2KFW A;  4JFK A;  2JZV A; 
#chains in the Genus database with same CATH homology
 3KAI A;  4DRH A;  2PPP A;  4KQZ A;  3KAC A;  1L1P A;  2DSZ A;  2LGO A;  4LAW A;  1HJV A;  4JFM A;  3VAW A;  4LAV A;  3PRB A;  4FAP A;  2DT0 A;  1GOI A;  3AQU A;  1D6O A;  4ITZ A;  2XP4 A;  1JNE A;  2FAP A;  4JFJ A;  4DRM A;  5HUA A;  4FN2 A;  4MTV A;  5HW6 A;  2PI6 A;  1ROT A;  3UI6 A;  1KT1 A;  2VCD A;  3WQV A;  3ART A;  1ROU A;  3B8S A;  4Z2G A;  2XP8 A;  1FKF A;  3G6M A;  3IHZ A;  4MNJ A;  4ODP A;  1B6C A;  3O5Q A;  1ZBC A;  3KAB A;  3WH0 A;  4TW8 A;  3W4R A;  4HBE A;  1W1P A;  1FKR A;  4P8V A;  4GGQ A;  2WK2 A;  2MLX A;  2ZR4 A;  3KAF A;  3PR9 A;  3O5F A;  2N87 A;  4LGX A;  4WJX A;  2KGJ A;  4MGV A;  1HXV A;  5DIV A;  4NSB A;  4MNK A;  2DSU A;  4DRN A;  1EIB A;  1OGG A;  1Q6I A;  1YAT A;  2A3A A;  2AWG A;  2RUD A;  3I6C A;  4WIW A;  5HWC A;  4Q22 A;  4W9O A;  5GPG A;  3ARR A;  2XPA A;  5HW7 A;  1FKS A;  2XPB A;  3O5P A;  4L72 B;  1F40 A;  3AS3 A;  2D9F A;  2F21 A;  5DF0 A;  3FY1 A;  2DSW A;  2Y78 A;  3NI6 A;  2M2A A;  1D7J A;  2WLZ A;  3O5R A;  3NTP A;  3O5K A;  4IT4 A;  3ARX A;  1F8A B;  3IKG A;  4R5E A;  1YW5 A;  1R9H A;  4Z2K A;  3OOB A;  1EHN A;  1FKK A;  1FKI A;  1FD9 A;  5DO2 A;  2M08 A;  1NMV A;  1W1V A;  2PV2 A;  2Q5A A;  1FJD A;  3PRA A;  3LUO A;  2KI3 A;  4JFI A;  1LL7 A;  1PIN A;  4GIV A;  4ODK A;  2PBC A;  1E9L A;  4IPX A;  4DWS B;  2MF9 A;  1E6N A;  2ZQS A;  3CHC A;  3ARP A;  4JFL A;  1QPF A;  3KAH A;  4P8X A;  5HKG A;  2RUR A;  1NSG A;  1J4I A;  1LL4 A;  1EQ3 A;  3WD1 A;  1VF8 A;  4U86 A;  4LAX A;  4ODR A;  5I98 A;  2MPH A;  1E6P A;  3CHD A;  2XP7 A;  3MDY B;  3ARV A;  1FFQ A;  3B9E A;  4LAY A;  2PPO A;  4ODL A;  5HT1 A;  3UQB A;  4J4O A;  3WIJ A;  2ESC A;  1BKF A;  3ARQ A;  4DZ3 A;  4P8U A;  5D75 A;  4ODN A;  4TX0 A;  2XP9 A;  3JYJ A;  3AS1 A;  1W9U A;  4G2P A;  3RME A;  1Y0O A;  3CHE A;  1P5Q A;  3O5E A;  4XAK A;  4DT4 A;  1XHG A;  2RUC A;  1O6I A;  4ODQ A;  3UQA A;  2F2D A;  2F4E A;  1T11 A;  5JH8 A;  1SR0 A;  4MAV A;  3FAP A;  3RM4 A;  4W9P A;  4QIB A;  1XRV A;  5DEZ A;  1NMW A;  1ZBW A;  2B31 A;  3JYM A;  4N19 A;  1N1A A;  2G41 A;  2QF8 A;  4BF8 A;  2LJ4 A;  4ZPV R;  4U85 A;  4Z2L A;  2LKN A;  1C9H A;  1W1Y A;  3TDB A;  1QPL A;  2FKE A;  4Z2H A;  3ARS A;  3ARW A;  1J4R A;  3ALF A;  4W5U A;  5J6E A;  2RSE A;  1NH6 A;  1H0I A;  2DG3 A;  3RM9 A;  1FKG A;  4MPK A;  1JNS A;  4WKF A;  3O5O A;  2KO7 A;  5HWB A;  1TCO C;  3KCE A;  4QT2 A;  3UI5 A;  1ZBV A;  1UR9 A;  1NWU A;  2M1I A;  4HAR A;  1X6L A;  3RM8 A;  3RGC A;  2LPV A;  2PPN A;  2DSV A;  3CGM A;  5GPR A;  3CZ8 A;  4DIP A;  1W1T A;  3TC5 A;  3O5L A;  3O5I A;  4R0X A;  3WD3 A;  3ARU A;  3UQI A;  4DRO A;  5GQB A;  3RFW A;  1HJX A;  1D7I A;  4HBO A;  3ALG A;  1PBK A;  2XP6 A;  4ODM A;  3UF8 A;  5HW8 A;  1K9T A;  1ZL1 A;  1ITX A;  1FKH A;  2FDM A;  1HKJ A;  2KE0 A;  2OLH A;  2AOS A;  2DT2 A;  1WB0 A;  4DRJ A;  1GPF A;  3ARO A;  4WKA A;  1HJW A;  1LQ0 A;  3PA7 A;  4DRI A;  4JYS A;  3KAD A;  1BL4 A;  1LG2 A;  1WNO A;  4DWS D;  3IK8 A;  4PTM A;  1LJY A;  2IUZ A;  3TCZ A;  5HBF A;  3AS0 A;  1JNT A;  4U84 A;  5BXJ A;  1FKJ A;  3CGN A;  1ZBK A;  4WKH A;  4DRP A;  1FKD A;  3WD2 A;  4C02 B;  3UI4 A;  4ZS6 A;  5DIT A;  5B8I C;  2DPE A;  4TW7 A;  4IQC A;  3WL1 A;  2A3E A;  1E15 A;  1OGB A;  1W9V A;  1ZU8 A;  4QZV B;  3OA5 A;  4QT3 A;  2K8I A;  3KZ7 A;  2RUQ A;  1J6Y A;  4DH0 A;  4DRK A;  1FKB A;  1Q6U A;  1U79 A;  2O92 A;  4TNS A;  1NWT A;  1CTN A;  1JND A;  4DZ2 A;  1LL6 A;  3B7X A;  3WQW A;  3B9D A;  5HTG A;  2WM0 A;  4L3N A;  3IKD A;  1M5Y A;  2PV3 A;  2UZ5 A;  1ZCN A;  2DG4 A;  4DWS C;  4G50 A;  1SYT A;  2MLY A;  4MSP A;  1KT0 A;  1HKK A;  2IF4 A;  1EDQ A;  4ML4 A;  4DRQ A;  4IT6 A;  4TYO A;  3O5D A;  2VN1 A;  3H9R B;  1HKI A;  3NRK A;  1FKT A;  2DT3 A;  1W26 A;  3FXY A;  4ZPW R;  3WKZ A;  4P8W A;  3JXV A;  4WK9 A;  4Z2J A;  3WD4 A;  1NWR A;  3O5M A;  4W9Q A;  1QZ2 A;  4Z2I A;  2MLZ A;  5DIU A;  2OFN A;  2A3B A;  1JVW A;  2DT1 A;  3CH9 A;  2ZQU A;  3KAG A;  1E6Z A;  3QOK A;  2ZQT A;  1H0G A;  1WAW A;  4S3K A;  1Q1C A;  1HKM A;  2ZR5 A;  4J4N A;  1OWQ A;  3G6L A;  4AY1 A;  2KR7 A;  4Q7N A;  2YBT A;  3O5J A;  2L2S A;  3GPK A;  1J4H A;  4NZC A;  3EY6 A;  4MNM A;  4DWS A;  2ZR6 A;  3ARY A;  1A7X A;  1FAP A;  3ARZ A;  1ZK6 A;  3ODK A;  1GUV A;  3O5G A;  4ODO A;  1KFW A;  4NNR A;  2A3C A;  1NWS A;  4KR0 B;  1UR8 A;  1X6N A;  2XP5 A;  1TFV A;  1LG1 A;  3WD0 A;  2MNT A;  3BXW A;  1IX5 A;  1EYM A;  3AS2 A;  2ZQV A;  2YBU A;  2WLY A;  1E6R A;  1ZB5 A;  1RD6 A;  1D2K A;  4O2T A;  2XP3 A;  3WL0 A;  2RQS A;  3CHF A;  4MNL A;  2O9O A;  2PV1 A;  4URI A;  4ZPT R;  3PRD A;  1FKL A;  4TW6 A;  4S3J A;  1FFR A;  3B9A A;  2G8Z A;  2DG9 A;  4IQ2 A;  1D7H A;  1Q6H A;  2ITK A;  1W9P A;  2KFW A;  4JFK A;  2JZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...