1D7IA

Fkbp complexed with methyl methylsulfinylmethyl sulfide (dss)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of small ligand-FKBP complexes provide an estimate for hydrophobic interaction energies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
total genus 26
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1d7iA00
2DG4A 3WH0A 1BKFA 3KACA 4DRPA 1FKFA 1QPLA 1TCOC 4U86A 2ZQUA 4IQCA 3KADA 1L1PA 3TDBA 4DROA 4ITZA 4JFJA 1ZK6A 1KT0A 1M5YA 2XP8A 1A7XA 1Q6UA 2KFWA 4G50A 1J6YA 1FKIA 1F8AB 1PBKA 3MDYB 1ROTA 3O5DA 3O5MA 3O5RA 3O5IA 4ODLA 4DRKA 3I6CA 2LJ4A 2VN1A 3JYJA 4O2TA 5HW8A 4FN2A 2KO7A 3NTPA 3O5QA 4W9QA 3O5PA 1C9HA 2LGOA 4W9OA 1FJDA 5HW7A 2KI3A 1FKDA 4ODQA 2N87A 2RSEA 4ODNA 1Y0OA 2AWGA 3EY6A 2ZR4A 3KCEA 1P5QA 2ZR6A 3NRKA 3O5KA 4R0XA 4DRJA 4DRNA 2MNTA 2F4EA 3UI6A 4J4NA 4QIBA 5DITA 1FKGA 5J6EA 1FD9A 4JYSA 4C02B 3UI4A 5HUAA 4ODMA 4ODRA 2PPPA 1PINA 2KGJA 1KT1A 3UI5A 4LAWA 2PV1A 1FAPA 1NMVA 1Q6HA 2XPAA 4ODPA 2KR7A 4G2PA 2DG9A 4GGQA 4DRQA 1NMWA 3H9RB 4W9PA 2MLXA 1FKHA 4LAXA 1F40A 3O5GA 5DIVA 1U79A 1ROUA 2F21A 4TW8A 4MSPA 4DIPA 4N19A 4J4OA 2FAPA 1D7IA 4GIVA 4NNRA 5HWCA 5BXJA 3B7XA 3RGCA 4ODOA 2PPNA 1J4HA 2ITKA 4QT2A 4IQ2A 3NI6A 2Q5AA 5HT1A 3O5OA 4JFLA 1FKRA 2XP7A 2M2AA 5HWBA 3CGMA 1EQ3A 1JVWA 2ZR5A 2UZ5A 3RFWA 2XP9A 2PBCA 1JNSA 4DT4A 2RUDA 2ZQSA 1T11A 1JNTA 2MF9A 1BL4A 2OFNA 1EYMA 2RQSA 3KAHA 3KAGA 2DG3A 2K8IA 3JYMA 2XPBA 5DIUA 4DH0A 1Q1CA 2JZVA 1ZCNA 3KABA 2D9FA 3FAPA 3GPKA 2IF4A 5HW6A 3PRDA 3KZ7A 4DZ3A 3O5JA 3UF8A 3TCZA 2PV2A 1YATA 2MLYA 4DRHA 4JFMA 5HKGA 4IPXA 1NSGA 3O5EA 2M08A 1N1AA 1FKKA 2XP4A 3O5FA 1FKJA 2MLZA 1FKBA 3PRBA 4TW6A 2RUQA 5I98A 2LKNA 2LPVA 4JFIA 4TYOA 3PA7A 4DRIA 2L2SA 2RURA 3IKDA 3LUOA 3CGNA 4JFKA 4LAVA 4TNSA 4U84A 4U85A 2MPHA 4DZ2A 4FAPA 1YW5A 5B8IC 4DRMA 2RUCA 2F2DA 1QPFA 1J4IA 1Q6IA 2XP6A 1B6CA 2ZQTA 4LAYA 3UQAA 5D75A 3O5LA 2KE0A 1D6OA 4MGVA 2FKEA 1FKLA 3VAWA 4BF8A 2XP3A 1J4RA 4ODKA 4TX0A 3IHZA 2VCDA 3IK8A 1HXVA 3OOBA 3UQBA 3JXVA 2Y78A 1FKSA 2PV3A 3ODKA 3UQIA 5HTGA 4QT3A 1D7JA 5GPGA 3KAIA 2M1IA 3TC5A 1W26A 3IKGA 2ZQVA 1R9HA 1D7HA 1FKTA 2PPOA 2XP5A 1QZ2A 3KAFA 4TW7A
chains in the Genus database with same CATH superfamily
2A3AA 1QPLA 3BXWA 4ZPWR 1X6NA 5DF0A 1ZBVA 1M5YA 1HJVA 3ARPA 2AOSA 4IT6A 1J6YA 1O6IA 3CHFA 4P8WA 3MDYB 3O5RA 3O5IA 4ODLA 1E6RA 3I6CA 2VN1A 4O2TA 1E6PA 1E6NA 3FXYA 1HKMA 1ZL1A 1FJDA 4NZCA 2KI3A 1HJWA 2WLZA 2RSEA 3O5KA 2DSWA 1LQ0A 2MNTA 3UI6A 4MNLA 3ARTA 4Z2KA 1FD9A 4Z2LA 3WQVA 5HUAA 3AQUA 2PN0A 4ODRA 2KGJA 3UI5A 2PV1A 3B8SA 4ZS6A 4DIPA 4NNRA 4MNMA 1NH6A 1J4HA 4W5UA 3NI6A 3WD0A 4DWSA 4WJXA 4WK9A 3CGMA 1EQ3A 1JVWA 2UZ5A 3AS1A 1HKJA 2A3BA 4NSBA 2MF9A 4MNKA 4DH0A 2JZVA 3GTYX 3FAPA 5HW6A 3KZ7A 3O5JA 2MLYA 4DRHA 4JFMA 5HKGA 1NSGA 4WIWA 2M08A 4Z2GA 1FFRA 3AS0A 1FKJA 1ZBCA 2L2SA 4JFKA 4TNSA 4HBEA 4DZ2A 4FAPA 1LL4A 1LG2A 3UQAA 1LL7A 3O5LA 2FKEA 3VAWA 4TX0A 4MPKA 3IHZA 2VCDA 3OOBA 1XRVA 2QF8A 3UQIA 2EULA 5HTGA 1NWTA 1NWRA 3KAFA 1R9HA 4QZVB 2ZQTA 1JCHB 4MTVA 3WL1A 1FKFA 1TCOC 4IQCA 3KADA 4ZPTR 3TDBA 3GU0A 3WIJA 1ZK6A 3B9EA 1A7XA 4WKHA 1FKIA 1PBKA 3ARRA 2B31A 4KR0B 4FN2A 2PI6A 4AY1A 1C9HA 2DPEA 2LGOA 1UR8A 1WNOA 4ODQA 2DT0A 3CHDA 1Y0OA 2AWGA 3EY6A 2ZR4A 1P5QA 2ZR6A 4DRJA 2OLHA 3AS2A 5J6EA 3EIPA 1OWQA 4ODMA 1WAWA 1W1TA 1PINA 1KT1A 4WKAA 4ODPA 2XPAA 4KQZA 3G6MA 3H9RB 2O9OA 1CTNA 4W9PA 1WB0A 3O5GA 4TW8A 4DRPA 3ARWA 2FAPA 5BXJA 3B7XA 2PPNA 4XAKA 5DO2A 4L3NA 4IQ2A 3WD2A 2DSVA 4JFLA 2M2AA 3ARZA 1SYTA 2RUDA 1VF8A 2ZQSA 1JNTA 4DRMA 1EYMA 4P8VA 2B5UB 3JYMA 1E44A 2XPBA 5DIUA 1Q1CA 5HBFA 2D9FA 1FFQA 1E9LA 2IF4A 3PRDA 4DZ3A 4P8UA 2PV2A 3ARYA 4IPXA 2YBUA 4DWSB 3CZ8A 1W1PA 1ZBWA 2MLZA 1FKBA 2RUQA 4LAVA 3IKDA 4U84A 2ETNA 1YW5A 4MNJA 2F2DA 2XP6A 2KE0A 4HARA 1EHNA 1FKLA 4Z2IA 3UQBA 2Y78A 3ODKA 4WKFA 2P4VA 1W1YA 3WD3A 1D7JA 5GPGA 3TC5A 3B9DA 3RM4A 1GPFA 4U86A 4DROA 5DEZA 4JFJA 1KT0A 2XP8A 4G50A 2DSUA 3O5DA 3O5MA 1OGBA 4LGXA 3W4RA 4DRKA 2LJ4A 3AROA 1W9UA 2ESCA 3NTPA 4S3KA 3RM9A 1EIBA 3ARUA 1LL6A 3O5PA 4W9QA 2DT2A 3CHCA 5HW7A 1RD6A 1XHGA 1FKDA 1ZB5A 2N87A 4ODNA 1ZBKA 4R0XA 4QIBA 1K9TA 5DITA 3CHEA 1W1VA 3ALFA 3OA5A 4LAWA 4P8XA 3WQWA 1Q6HA 2DG9A 4DRQA 1W9VA 1NMWA 4LAXA 5DIVA 1HKKA 4ZPVR 3PR9A 2F21A 4MSPA 4N19A 5HWCA 3RGCA 4ODOA 4QT2A 3WKZA 2DT3A 2Q5AA 5HT1A 3O5OA 1GRJA 2XP7A 3WL0A 2ZR5A 3CH9A 2WLYA 3RFWA 1JNSA 4DT4A 3KAGA 3KAHA 2DG3A 2K8IA 3AS3A 3ARSA 1X6LA 1E15A 1LG1A 3RMEA 2A3EA 3UF8A 3TCZA 1YATA 2IUZA 2XP4A 3BMBA 3O5FA 1SR0A 4HBOA 3PRBA 4TW6A 1W9PA 2LKNA 2LPVA 4TYOA 4DRIA 2RURA 2A3CA 4U85A 1QPFA 1J4IA 3G6LA 1Q6IA 5D75A 3PRAA 4BF8A 4MGVA 1ITXA 2XP3A 1J4RA 4ODKA 1HXVA 1FKSA 4QT3A 3QOKA 3KAIA 2M1IA 1W26A 4TW7A 4UDMA 1FKTA 2DG4A 2G41A 1BKFA 1LJYA 2WK2A 3KACA 2ZQUA 1L1PA 1JNDA 4MAVA 4ITZA 1NWUA 3FY1A 4IT4A 1GOIA 1Q6UA 2KFWA 1F8AB 1ROTA 5GPRA 1E6ZA 2FDMA 3JYJA 5HW8A 1ZU8A 2KO7A 3O5QA 1UR9A 4URIA 4W9OA 3ARVA 4L72B 3RM8A 3KCEA 3NRKA 4Q7NA 4DRNA 3ALGA 1OGGA 1HJXA 3ARXA 2F4EA 4Z2JA 4J4NA 1FKGA 4JYSA 4C02B 1D2KA 3UI4A 2PPPA 1FAPA 1NMVA 1HKIA 2KR7A 4G2PA 4GGQA 2MLXA 1FKHA 1F40A 1U79A 1KFWA 1ROUA 4S3JA 4J4OA 1D7IA 4GIVA 1NWSA 1IX5A 1H0GA 2ITKA 3ARQA 1FKRA 5HWBA 4Z2HA 4DWSC 2XP9A 2PBCA 2O92A 1T11A 2YBTA 2OFNA 1BL4A 2RQSA 1TFVA 3KABA 1ZCNA 3GPKA 1H0IA 2DSZA 4PTMA 2F23A 3O5EA 1N1AA 1FKKA 5JH8A 5I98A 4JFIA 1JNEA 3PA7A 3B9AA 3WH0A 3LUOA 3CGNA 4ML4A 2MPHA 5B8IC 2WM0A 2RUCA 1GUVA 1B6CA 4LAYA 2DT1A 1D6OA 3WD1A 2G8ZA 3IK8A 4DWSD 4Q22A 1EDQA 3JXVA 2PV3A 4R5EA 3IKGA 2ZQVA 2XP5A 1D7HA 2PPOA 3WD4A 1QZ2A 5GQBA
chains in the Genus database with same CATH topology
2A3AA 1QPLA 3BXWA 4ZPWR 1X6NA 5DF0A 1ZBVA 1M5YA 4IT6A 1HJVA 2AOSA 3ARPA 1J6YA 1O6IA 3CHFA 4P8WA 3MDYB 3O5RA 3O5IA 4ODLA 1E6RA 3I6CA 2VN1A 4O2TA 1E6PA 1E6NA 3FXYA 1HKMA 1ZL1A 1FJDA 4NZCA 2KI3A 1HJWA 2WLZA 2RSEA 3O5KA 2DSWA 1LQ0A 2MNTA 3UI6A 4MNLA 3ARTA 4Z2KA 1FD9A 4Z2LA 3WQVA 5HUAA 3AQUA 4ODRA 2KGJA 3UI5A 2PV1A 3B8SA 4ZS6A 4DIPA 4NNRA 4MNMA 1NH6A 1J4HA 4W5UA 3NI6A 3WD0A 4DWSA 4WJXA 4WK9A 3CGMA 1EQ3A 1JVWA 2UZ5A 3AS1A 1HKJA 2A3BA 4NSBA 2MF9A 4MNKA 4DH0A 2JZVA 3FAPA 5HW6A 3KZ7A 3O5JA 2MLYA 4DRHA 4JFMA 5HKGA 1NSGA 4WIWA 2M08A 4Z2GA 1FFRA 3AS0A 1FKJA 1ZBCA 2L2SA 4JFKA 4TNSA 4HBEA 4DZ2A 4FAPA 1LL4A 1LG2A 3UQAA 1LL7A 3O5LA 2FKEA 3VAWA 4TX0A 4MPKA 3IHZA 2VCDA 3OOBA 1XRVA 2QF8A 3UQIA 5HTGA 1NWTA 1NWRA 3KAFA 1R9HA 4QZVB 2ZQTA 4MTVA 3WL1A 1FKFA 1TCOC 4IQCA 3KADA 4ZPTR 3TDBA 3WIJA 1ZK6A 3B9EA 1A7XA 4WKHA 1FKIA 1PBKA 3ARRA 2B31A 4KR0B 4FN2A 2PI6A 4AY1A 1C9HA 2DPEA 2LGOA 1UR8A 1WNOA 4ODQA 2DT0A 3CHDA 1Y0OA 2AWGA 3EY6A 2ZR4A 1P5QA 2ZR6A 4DRJA 2OLHA 3AS2A 5J6EA 1OWQA 4ODMA 1WAWA 1W1TA 1PINA 1KT1A 4WKAA 4ODPA 2XPAA 4KQZA 3G6MA 3H9RB 2O9OA 1CTNA 4W9PA 1WB0A 3O5GA 4TW8A 4DRPA 3ARWA 2FAPA 5BXJA 3B7XA 2PPNA 4XAKA 5DO2A 4L3NA 4IQ2A 3WD2A 2DSVA 4JFLA 2M2AA 3ARZA 1SYTA 2RUDA 1VF8A 2ZQSA 1JNTA 4DRMA 1EYMA 4P8VA 5DIUA 3JYMA 2XPBA 1Q1CA 5HBFA 2D9FA 1FFQA 1E9LA 2IF4A 3PRDA 4DZ3A 4P8UA 2PV2A 3ARYA 4IPXA 2YBUA 4DWSB 3CZ8A 1W1PA 1ZBWA 2MLZA 1FKBA 2RUQA 4LAVA 3IKDA 4U84A 1YW5A 4MNJA 2F2DA 2XP6A 2KE0A 4HARA 1EHNA 1FKLA 4Z2IA 3UQBA 2Y78A 3ODKA 4WKFA 1W1YA 3WD3A 1D7JA 5GPGA 3TC5A 3B9DA 3RM4A 1GPFA 4U86A 4DROA 5DEZA 4JFJA 1KT0A 2XP8A 4G50A 2DSUA 3O5DA 3O5MA 1OGBA 4LGXA 3W4RA 4DRKA 2LJ4A 3AROA 1W9UA 2ESCA 3NTPA 4S3KA 3RM9A 1EIBA 3ARUA 1LL6A 3O5PA 4W9QA 2DT2A 3CHCA 5HW7A 1RD6A 1XHGA 1FKDA 1ZB5A 2N87A 4ODNA 1ZBKA 4R0XA 4QIBA 1K9TA 5DITA 3CHEA 1W1VA 3ALFA 3OA5A 4LAWA 4P8XA 3WQWA 1Q6HA 2DG9A 4DRQA 1W9VA 1NMWA 4LAXA 5DIVA 1HKKA 4ZPVR 3PR9A 2F21A 4MSPA 4N19A 5HWCA 3RGCA 4ODOA 4QT2A 3WKZA 2DT3A 2Q5AA 5HT1A 3O5OA 2XP7A 3WL0A 2ZR5A 3CH9A 2WLYA 3RFWA 1JNSA 4DT4A 3KAGA 3KAHA 2DG3A 2K8IA 3AS3A 3ARSA 1X6LA 1E15A 1LG1A 3RMEA 2A3EA 3UF8A 3TCZA 1YATA 2IUZA 2XP4A 3O5FA 1SR0A 4HBOA 3PRBA 4TW6A 1W9PA 2LKNA 2LPVA 4TYOA 4DRIA 2RURA 2A3CA 4U85A 1QPFA 1J4IA 3G6LA 1Q6IA 5D75A 3PRAA 4BF8A 4MGVA 1ITXA 2XP3A 1J4RA 4ODKA 1HXVA 1FKSA 4QT3A 3QOKA 3KAIA 2M1IA 1W26A 4TW7A 1FKTA 2DG4A 2G41A 1BKFA 1LJYA 2WK2A 3KACA 2ZQUA 1L1PA 1JNDA 4MAVA 4ITZA 1NWUA 3FY1A 4IT4A 1GOIA 1Q6UA 2KFWA 1F8AB 1ROTA 5GPRA 1E6ZA 2FDMA 3JYJA 5HW8A 1ZU8A 2KO7A 3O5QA 1UR9A 4URIA 4W9OA 3ARVA 4L72B 3RM8A 3KCEA 3NRKA 4Q7NA 4DRNA 3ALGA 1OGGA 1HJXA 3ARXA 2F4EA 4Z2JA 4J4NA 1FKGA 4JYSA 4C02B 1D2KA 3UI4A 2PPPA 1FAPA 1NMVA 1HKIA 2KR7A 4G2PA 4GGQA 2MLXA 1FKHA 1F40A 1U79A 1KFWA 1ROUA 4S3JA 4J4OA 1D7IA 4GIVA 1NWSA 1IX5A 1H0GA 2ITKA 3ARQA 1FKRA 5HWBA 4Z2HA 4DWSC 2XP9A 2PBCA 2O92A 1T11A 2YBTA 2OFNA 1BL4A 2RQSA 1TFVA 3KABA 1ZCNA 3GPKA 1H0IA 2DSZA 4PTMA 3O5EA 1N1AA 1FKKA 5JH8A 5I98A 4JFIA 1JNEA 3PA7A 3B9AA 3WH0A 3LUOA 3CGNA 4ML4A 2MPHA 5B8IC 2WM0A 2RUCA 1GUVA 1B6CA 4LAYA 2DT1A 1D6OA 3WD1A 2G8ZA 3IK8A 4DWSD 4Q22A 1EDQA 3JXVA 2PV3A 4R5EA 3IKGA 2ZQVA 2XP5A 1D7HA 2PPOA 3WD4A 1QZ2A 5GQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DG4 A;  3WH0 A;  1BKF A;  3KAC A;  4DRP A;  1FKF A;  1QPL A;  1TCO C;  4U86 A;  2ZQU A;  4IQC A;  3KAD A;  1L1P A;  3TDB A;  4DRO A;  4ITZ A;  4JFJ A;  1ZK6 A;  1KT0 A;  1M5Y A;  2XP8 A;  1A7X A;  1Q6U A;  2KFW A;  4G50 A;  1J6Y A;  1FKI A;  1F8A B;  1PBK A;  3MDY B;  1ROT A;  3O5D A;  3O5M A;  3O5R A;  3O5I A;  4ODL A;  4DRK A;  3I6C A;  2LJ4 A;  2VN1 A;  3JYJ A;  4O2T A;  5HW8 A;  4FN2 A;  2KO7 A;  3NTP A;  3O5Q A;  4W9Q A;  3O5P A;  1C9H A;  2LGO A;  4W9O A;  1FJD A;  5HW7 A;  2KI3 A;  1FKD A;  4ODQ A;  2N87 A;  2RSE A;  4ODN A;  1Y0O A;  2AWG A;  3EY6 A;  2ZR4 A;  3KCE A;  1P5Q A;  2ZR6 A;  3NRK A;  3O5K A;  4R0X A;  4DRJ A;  4DRN A;  2MNT A;  2F4E A;  3UI6 A;  4J4N A;  4QIB A;  5DIT A;  1FKG A;  5J6E A;  1FD9 A;  4JYS A;  4C02 B;  3UI4 A;  5HUA A;  4ODM A;  4ODR A;  2PPP A;  1PIN A;  2KGJ A;  1KT1 A;  3UI5 A;  4LAW A;  2PV1 A;  1FAP A;  1NMV A;  1Q6H A;  2XPA A;  4ODP A;  2KR7 A;  4G2P A;  2DG9 A;  4GGQ A;  4DRQ A;  1NMW A;  3H9R B;  4W9P A;  2MLX A;  1FKH A;  4LAX A;  1F40 A;  3O5G A;  5DIV A;  1U79 A;  1ROU A;  2F21 A;  4TW8 A;  4MSP A;  4DIP A;  4N19 A;  4J4O A;  2FAP A;  1D7I A;  4GIV A;  4NNR A;  5HWC A;  5BXJ A;  3B7X A;  3RGC A;  4ODO A;  2PPN A;  1J4H A;  2ITK A;  4QT2 A;  4IQ2 A;  3NI6 A;  2Q5A A;  5HT1 A;  3O5O A;  4JFL A;  1FKR A;  2XP7 A;  2M2A A;  5HWB A;  3CGM A;  1EQ3 A;  1JVW A;  2ZR5 A;  2UZ5 A;  3RFW A;  2XP9 A;  2PBC A;  1JNS A;  4DT4 A;  2RUD A;  2ZQS A;  1T11 A;  1JNT A;  2MF9 A;  1BL4 A;  2OFN A;  1EYM A;  2RQS A;  3KAH A;  3KAG A;  2DG3 A;  2K8I A;  3JYM A;  2XPB A;  5DIU A;  4DH0 A;  1Q1C A;  2JZV A;  1ZCN A;  3KAB A;  2D9F A;  3FAP A;  3GPK A;  2IF4 A;  5HW6 A;  3PRD A;  3KZ7 A;  4DZ3 A;  3O5J A;  3UF8 A;  3TCZ A;  2PV2 A;  1YAT A;  2MLY A;  4DRH A;  4JFM A;  5HKG A;  4IPX A;  1NSG A;  3O5E A;  2M08 A;  1N1A A;  1FKK A;  2XP4 A;  3O5F A;  1FKJ A;  2MLZ A;  1FKB A;  3PRB A;  4TW6 A;  2RUQ A;  5I98 A;  2LKN A;  2LPV A;  4JFI A;  4TYO A;  3PA7 A;  4DRI A;  2L2S A;  2RUR A;  3IKD A;  3LUO A;  3CGN A;  4JFK A;  4LAV A;  4TNS A;  4U84 A;  4U85 A;  2MPH A;  4DZ2 A;  4FAP A;  1YW5 A;  5B8I C;  4DRM A;  2RUC A;  2F2D A;  1QPF A;  1J4I A;  1Q6I A;  2XP6 A;  1B6C A;  2ZQT A;  4LAY A;  3UQA A;  5D75 A;  3O5L A;  2KE0 A;  1D6O A;  4MGV A;  2FKE A;  1FKL A;  3VAW A;  4BF8 A;  2XP3 A;  1J4R A;  4ODK A;  4TX0 A;  3IHZ A;  2VCD A;  3IK8 A;  1HXV A;  3OOB A;  3UQB A;  3JXV A;  2Y78 A;  1FKS A;  2PV3 A;  3ODK A;  3UQI A;  5HTG A;  4QT3 A;  1D7J A;  5GPG A;  3KAI A;  2M1I A;  3TC5 A;  1W26 A;  3IKG A;  2ZQV A;  1R9H A;  1D7H A;  1FKT A;  2PPO A;  2XP5 A;  1QZ2 A;  3KAF A;  4TW7 A; 
#chains in the Genus database with same CATH topology
 2A3A A;  1QPL A;  3BXW A;  4ZPW R;  1X6N A;  5DF0 A;  1ZBV A;  1M5Y A;  1HJV A;  3ARP A;  2AOS A;  4IT6 A;  1J6Y A;  1O6I A;  3CHF A;  4P8W A;  3MDY B;  3O5R A;  3O5I A;  4ODL A;  1E6R A;  3I6C A;  2VN1 A;  4O2T A;  1E6P A;  1E6N A;  3FXY A;  1HKM A;  1ZL1 A;  1FJD A;  4NZC A;  2KI3 A;  1HJW A;  2WLZ A;  2RSE A;  3O5K A;  2DSW A;  1LQ0 A;  2MNT A;  3UI6 A;  4MNL A;  3ART A;  4Z2K A;  1FD9 A;  4Z2L A;  3WQV A;  5HUA A;  3AQU A;  2PN0 A;  4ODR A;  2KGJ A;  3UI5 A;  2PV1 A;  3B8S A;  4ZS6 A;  4DIP A;  4NNR A;  4MNM A;  1NH6 A;  1J4H A;  4W5U A;  3NI6 A;  3WD0 A;  4DWS A;  4WJX A;  4WK9 A;  3CGM A;  1EQ3 A;  1JVW A;  2UZ5 A;  3AS1 A;  1HKJ A;  2A3B A;  4NSB A;  2MF9 A;  4MNK A;  4DH0 A;  2JZV A;  3GTY X;  3FAP A;  5HW6 A;  3KZ7 A;  3O5J A;  2MLY A;  4DRH A;  4JFM A;  5HKG A;  1NSG A;  4WIW A;  2M08 A;  4Z2G A;  1FFR A;  3AS0 A;  1FKJ A;  1ZBC A;  2L2S A;  4JFK A;  4TNS A;  4HBE A;  4DZ2 A;  4FAP A;  1LL4 A;  1LG2 A;  3UQA A;  1LL7 A;  3O5L A;  2FKE A;  3VAW A;  4TX0 A;  4MPK A;  3IHZ A;  2VCD A;  3OOB A;  1XRV A;  2QF8 A;  3UQI A;  2EUL A;  5HTG A;  1NWT A;  1NWR A;  3KAF A;  1R9H A;  4QZV B;  2ZQT A;  1JCH B;  4MTV A;  3WL1 A;  1FKF A;  1TCO C;  4IQC A;  3KAD A;  4ZPT R;  3TDB A;  3GU0 A;  3WIJ A;  1ZK6 A;  3B9E A;  1A7X A;  4WKH A;  1FKI A;  1PBK A;  3ARR A;  2B31 A;  4KR0 B;  4FN2 A;  2PI6 A;  4AY1 A;  1C9H A;  2DPE A;  2LGO A;  1UR8 A;  1WNO A;  4ODQ A;  2DT0 A;  3CHD A;  1Y0O A;  2AWG A;  3EY6 A;  2ZR4 A;  1P5Q A;  2ZR6 A;  4DRJ A;  2OLH A;  3AS2 A;  5J6E A;  3EIP A;  1OWQ A;  4ODM A;  1WAW A;  1W1T A;  1PIN A;  1KT1 A;  4WKA A;  4ODP A;  2XPA A;  4KQZ A;  3G6M A;  3H9R B;  2O9O A;  1CTN A;  4W9P A;  1WB0 A;  3O5G A;  4TW8 A;  4DRP A;  3ARW A;  2FAP A;  5BXJ A;  3B7X A;  2PPN A;  4XAK A;  5DO2 A;  4L3N A;  4IQ2 A;  3WD2 A;  2DSV A;  4JFL A;  2M2A A;  3ARZ A;  1SYT A;  2RUD A;  1VF8 A;  2ZQS A;  1JNT A;  4DRM A;  1EYM A;  4P8V A;  2B5U B;  3JYM A;  1E44 A;  2XPB A;  5DIU A;  1Q1C A;  5HBF A;  2D9F A;  1FFQ A;  1E9L A;  2IF4 A;  3PRD A;  4DZ3 A;  4P8U A;  2PV2 A;  3ARY A;  4IPX A;  2YBU A;  4DWS B;  3CZ8 A;  1W1P A;  1ZBW A;  2MLZ A;  1FKB A;  2RUQ A;  4LAV A;  3IKD A;  4U84 A;  2ETN A;  1YW5 A;  4MNJ A;  2F2D A;  2XP6 A;  2KE0 A;  4HAR A;  1EHN A;  1FKL A;  4Z2I A;  3UQB A;  2Y78 A;  3ODK A;  4WKF A;  2P4V A;  1W1Y A;  3WD3 A;  1D7J A;  5GPG A;  3TC5 A;  3B9D A;  3RM4 A;  1GPF A;  4U86 A;  4DRO A;  5DEZ A;  4JFJ A;  1KT0 A;  2XP8 A;  4G50 A;  2DSU A;  3O5D A;  3O5M A;  1OGB A;  4LGX A;  3W4R A;  4DRK A;  2LJ4 A;  3ARO A;  1W9U A;  2ESC A;  3NTP A;  4S3K A;  3RM9 A;  1EIB A;  3ARU A;  1LL6 A;  3O5P A;  4W9Q A;  2DT2 A;  3CHC A;  5HW7 A;  1RD6 A;  1XHG A;  1FKD A;  1ZB5 A;  2N87 A;  4ODN A;  1ZBK A;  4R0X A;  4QIB A;  1K9T A;  5DIT A;  3CHE A;  1W1V A;  3ALF A;  3OA5 A;  4LAW A;  4P8X A;  3WQW A;  1Q6H A;  2DG9 A;  4DRQ A;  1W9V A;  1NMW A;  4LAX A;  5DIV A;  1HKK A;  4ZPV R;  3PR9 A;  2F21 A;  4MSP A;  4N19 A;  5HWC A;  3RGC A;  4ODO A;  4QT2 A;  3WKZ A;  2DT3 A;  2Q5A A;  5HT1 A;  3O5O A;  1GRJ A;  2XP7 A;  3WL0 A;  2ZR5 A;  3CH9 A;  2WLY A;  3RFW A;  1JNS A;  4DT4 A;  3KAG A;  3KAH A;  2DG3 A;  2K8I A;  3AS3 A;  3ARS A;  1X6L A;  1E15 A;  1LG1 A;  3RME A;  2A3E A;  3UF8 A;  3TCZ A;  1YAT A;  2IUZ A;  2XP4 A;  3BMB A;  3O5F A;  1SR0 A;  4HBO A;  3PRB A;  4TW6 A;  1W9P A;  2LKN A;  2LPV A;  4TYO A;  4DRI A;  2RUR A;  2A3C A;  4U85 A;  1QPF A;  1J4I A;  3G6L A;  1Q6I A;  5D75 A;  3PRA A;  4BF8 A;  4MGV A;  1ITX A;  2XP3 A;  1J4R A;  4ODK A;  1HXV A;  1FKS A;  4QT3 A;  3QOK A;  3KAI A;  2M1I A;  1W26 A;  4TW7 A;  4UDM A;  1FKT A;  2DG4 A;  2G41 A;  1BKF A;  1LJY A;  2WK2 A;  3KAC A;  2ZQU A;  1L1P A;  1JND A;  4MAV A;  4ITZ A;  1NWU A;  3FY1 A;  4IT4 A;  1GOI A;  1Q6U A;  2KFW A;  1F8A B;  1ROT A;  5GPR A;  1E6Z A;  2FDM A;  3JYJ A;  5HW8 A;  1ZU8 A;  2KO7 A;  3O5Q A;  1UR9 A;  4URI A;  4W9O A;  3ARV A;  4L72 B;  3RM8 A;  3KCE A;  3NRK A;  4Q7N A;  4DRN A;  3ALG A;  1OGG A;  1HJX A;  3ARX A;  2F4E A;  4Z2J A;  4J4N A;  1FKG A;  4JYS A;  4C02 B;  1D2K A;  3UI4 A;  2PPP A;  1FAP A;  1NMV A;  1HKI A;  2KR7 A;  4G2P A;  4GGQ A;  2MLX A;  1FKH A;  1F40 A;  1U79 A;  1KFW A;  1ROU A;  4S3J A;  4J4O A;  1D7I A;  4GIV A;  1NWS A;  1IX5 A;  1H0G A;  2ITK A;  3ARQ A;  1FKR A;  5HWB A;  4Z2H A;  4DWS C;  2XP9 A;  2PBC A;  2O92 A;  1T11 A;  2YBT A;  2OFN A;  1BL4 A;  2RQS A;  1TFV A;  3KAB A;  1ZCN A;  3GPK A;  1H0I A;  2DSZ A;  4PTM A;  2F23 A;  3O5E A;  1N1A A;  1FKK A;  5JH8 A;  5I98 A;  4JFI A;  1JNE A;  3PA7 A;  3B9A A;  3WH0 A;  3LUO A;  3CGN A;  4ML4 A;  2MPH A;  5B8I C;  2WM0 A;  2RUC A;  1GUV A;  1B6C A;  4LAY A;  2DT1 A;  1D6O A;  3WD1 A;  2G8Z A;  3IK8 A;  4DWS D;  4Q22 A;  1EDQ A;  3JXV A;  2PV3 A;  4R5E A;  3IKG A;  2ZQV A;  2XP5 A;  1D7H A;  2PPO A;  3WD4 A;  1QZ2 A;  5GQB A; 
#chains in the Genus database with same CATH homology
 2A3A A;  1QPL A;  3BXW A;  4ZPW R;  1X6N A;  5DF0 A;  1ZBV A;  1M5Y A;  4IT6 A;  1HJV A;  2AOS A;  3ARP A;  1J6Y A;  1O6I A;  3CHF A;  4P8W A;  3MDY B;  3O5R A;  3O5I A;  4ODL A;  1E6R A;  3I6C A;  2VN1 A;  4O2T A;  1E6P A;  1E6N A;  3FXY A;  1HKM A;  1ZL1 A;  1FJD A;  4NZC A;  2KI3 A;  1HJW A;  2WLZ A;  2RSE A;  3O5K A;  2DSW A;  1LQ0 A;  2MNT A;  3UI6 A;  4MNL A;  3ART A;  4Z2K A;  1FD9 A;  4Z2L A;  3WQV A;  5HUA A;  3AQU A;  4ODR A;  2KGJ A;  3UI5 A;  2PV1 A;  3B8S A;  4ZS6 A;  4DIP A;  4NNR A;  4MNM A;  1NH6 A;  1J4H A;  4W5U A;  3NI6 A;  3WD0 A;  4DWS A;  4WJX A;  4WK9 A;  3CGM A;  1EQ3 A;  1JVW A;  2UZ5 A;  3AS1 A;  1HKJ A;  2A3B A;  4NSB A;  2MF9 A;  4MNK A;  4DH0 A;  2JZV A;  3FAP A;  5HW6 A;  3KZ7 A;  3O5J A;  2MLY A;  4DRH A;  4JFM A;  5HKG A;  1NSG A;  4WIW A;  2M08 A;  4Z2G A;  1FFR A;  3AS0 A;  1FKJ A;  1ZBC A;  2L2S A;  4JFK A;  4TNS A;  4HBE A;  4DZ2 A;  4FAP A;  1LL4 A;  1LG2 A;  3UQA A;  1LL7 A;  3O5L A;  2FKE A;  3VAW A;  4TX0 A;  4MPK A;  3IHZ A;  2VCD A;  3OOB A;  1XRV A;  2QF8 A;  3UQI A;  5HTG A;  1NWT A;  1NWR A;  3KAF A;  1R9H A;  4QZV B;  2ZQT A;  4MTV A;  3WL1 A;  1FKF A;  1TCO C;  4IQC A;  3KAD A;  4ZPT R;  3TDB A;  3WIJ A;  1ZK6 A;  3B9E A;  1A7X A;  4WKH A;  1FKI A;  1PBK A;  3ARR A;  2B31 A;  4KR0 B;  4FN2 A;  2PI6 A;  4AY1 A;  1C9H A;  2DPE A;  2LGO A;  1UR8 A;  1WNO A;  4ODQ A;  2DT0 A;  3CHD A;  1Y0O A;  2AWG A;  3EY6 A;  2ZR4 A;  1P5Q A;  2ZR6 A;  4DRJ A;  2OLH A;  3AS2 A;  5J6E A;  1OWQ A;  4ODM A;  1WAW A;  1W1T A;  1PIN A;  1KT1 A;  4WKA A;  4ODP A;  2XPA A;  4KQZ A;  3G6M A;  3H9R B;  2O9O A;  1CTN A;  4W9P A;  1WB0 A;  3O5G A;  4TW8 A;  4DRP A;  3ARW A;  2FAP A;  5BXJ A;  3B7X A;  2PPN A;  4XAK A;  5DO2 A;  4L3N A;  4IQ2 A;  3WD2 A;  2DSV A;  4JFL A;  2M2A A;  3ARZ A;  1SYT A;  2RUD A;  1VF8 A;  2ZQS A;  1JNT A;  4DRM A;  1EYM A;  4P8V A;  5DIU A;  3JYM A;  2XPB A;  1Q1C A;  5HBF A;  2D9F A;  1FFQ A;  1E9L A;  2IF4 A;  3PRD A;  4DZ3 A;  4P8U A;  2PV2 A;  3ARY A;  4IPX A;  2YBU A;  4DWS B;  3CZ8 A;  1W1P A;  1ZBW A;  2MLZ A;  1FKB A;  2RUQ A;  4LAV A;  3IKD A;  4U84 A;  1YW5 A;  4MNJ A;  2F2D A;  2XP6 A;  2KE0 A;  4HAR A;  1EHN A;  1FKL A;  4Z2I A;  3UQB A;  2Y78 A;  3ODK A;  4WKF A;  1W1Y A;  3WD3 A;  1D7J A;  5GPG A;  3TC5 A;  3B9D A;  3RM4 A;  1GPF A;  4U86 A;  4DRO A;  5DEZ A;  4JFJ A;  1KT0 A;  2XP8 A;  4G50 A;  2DSU A;  3O5D A;  3O5M A;  1OGB A;  4LGX A;  3W4R A;  4DRK A;  2LJ4 A;  3ARO A;  1W9U A;  2ESC A;  3NTP A;  4S3K A;  3RM9 A;  1EIB A;  3ARU A;  1LL6 A;  3O5P A;  4W9Q A;  2DT2 A;  3CHC A;  5HW7 A;  1RD6 A;  1XHG A;  1FKD A;  1ZB5 A;  2N87 A;  4ODN A;  1ZBK A;  4R0X A;  4QIB A;  1K9T A;  5DIT A;  3CHE A;  1W1V A;  3ALF A;  3OA5 A;  4LAW A;  4P8X A;  3WQW A;  1Q6H A;  2DG9 A;  4DRQ A;  1W9V A;  1NMW A;  4LAX A;  5DIV A;  1HKK A;  4ZPV R;  3PR9 A;  2F21 A;  4MSP A;  4N19 A;  5HWC A;  3RGC A;  4ODO A;  4QT2 A;  3WKZ A;  2DT3 A;  2Q5A A;  5HT1 A;  3O5O A;  2XP7 A;  3WL0 A;  2ZR5 A;  3CH9 A;  2WLY A;  3RFW A;  1JNS A;  4DT4 A;  3KAG A;  3KAH A;  2DG3 A;  2K8I A;  3AS3 A;  3ARS A;  1X6L A;  1E15 A;  1LG1 A;  3RME A;  2A3E A;  3UF8 A;  3TCZ A;  1YAT A;  2IUZ A;  2XP4 A;  3O5F A;  1SR0 A;  4HBO A;  3PRB A;  4TW6 A;  1W9P A;  2LKN A;  2LPV A;  4TYO A;  4DRI A;  2RUR A;  2A3C A;  4U85 A;  1QPF A;  1J4I A;  3G6L A;  1Q6I A;  5D75 A;  3PRA A;  4BF8 A;  4MGV A;  1ITX A;  2XP3 A;  1J4R A;  4ODK A;  1HXV A;  1FKS A;  4QT3 A;  3QOK A;  3KAI A;  2M1I A;  1W26 A;  4TW7 A;  1FKT A;  2DG4 A;  2G41 A;  1BKF A;  1LJY A;  2WK2 A;  3KAC A;  2ZQU A;  1L1P A;  1JND A;  4MAV A;  4ITZ A;  1NWU A;  3FY1 A;  4IT4 A;  1GOI A;  1Q6U A;  2KFW A;  1F8A B;  1ROT A;  5GPR A;  1E6Z A;  2FDM A;  3JYJ A;  5HW8 A;  1ZU8 A;  2KO7 A;  3O5Q A;  1UR9 A;  4URI A;  4W9O A;  3ARV A;  4L72 B;  3RM8 A;  3KCE A;  3NRK A;  4Q7N A;  4DRN A;  3ALG A;  1OGG A;  1HJX A;  3ARX A;  2F4E A;  4Z2J A;  4J4N A;  1FKG A;  4JYS A;  4C02 B;  1D2K A;  3UI4 A;  2PPP A;  1FAP A;  1NMV A;  1HKI A;  2KR7 A;  4G2P A;  4GGQ A;  2MLX A;  1FKH A;  1F40 A;  1U79 A;  1KFW A;  1ROU A;  4S3J A;  4J4O A;  1D7I A;  4GIV A;  1NWS A;  1IX5 A;  1H0G A;  2ITK A;  3ARQ A;  1FKR A;  5HWB A;  4Z2H A;  4DWS C;  2XP9 A;  2PBC A;  2O92 A;  1T11 A;  2YBT A;  2OFN A;  1BL4 A;  2RQS A;  1TFV A;  3KAB A;  1ZCN A;  3GPK A;  1H0I A;  2DSZ A;  4PTM A;  3O5E A;  1N1A A;  1FKK A;  5JH8 A;  5I98 A;  4JFI A;  1JNE A;  3PA7 A;  3B9A A;  3WH0 A;  3LUO A;  3CGN A;  4ML4 A;  2MPH A;  5B8I C;  2WM0 A;  2RUC A;  1GUV A;  1B6C A;  4LAY A;  2DT1 A;  1D6O A;  3WD1 A;  2G8Z A;  3IK8 A;  4DWS D;  4Q22 A;  1EDQ A;  3JXV A;  2PV3 A;  4R5E A;  3IKG A;  2ZQV A;  2XP5 A;  1D7H A;  2PPO A;  3WD4 A;  1QZ2 A;  5GQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...