1D7IA

Fkbp complexed with methyl methylsulfinylmethyl sulfide (dss)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of small ligand-FKBP complexes provide an estimate for hydrophobic interaction energies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
total genus 26
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1d7iA00
2F4EA 3IHZA 5GPGA 5HWCA 3UQBA 1NMVA 3IK8A 1EYMA 4JFKA 1Q6IA 3RFWA 1NSGA 3IKGA 4QIBA 2F2DA 1P5QA 2UZ5A 2D9FA 3KAHA 1W26A 4DRHA 1C9HA 1BKFA 3JYJA 3O5LA 1D7IA 2DG3A 4ODLA 4U84A 3UQIA 2F21A 1R9HA 3KAIA 4W9QA 2XP4A 3O5RA 4IQCA 2ZR6A 3I6CA 4DRPA 3UI6A 3NTPA 2PBCA 1YW5A 4U86A 4DZ3A 2XP6A 2PV3A 3B7XA 5B8IC 3TC5A 3MDYB 2MLYA 2ZR4A 4G2PA 5DIUA 3JYMA 3O5IA 4LAWA 2KGJA 5D75A 1FKTA 4IPXA 4DRKA 2XPBA 1HXVA 5J6EA 1ZCNA 2M1IA 2PV1A 2DG9A 2KR7A 2VN1A 2KO7A 2ZQTA 2ZQSA 1FKSA 3PRBA 2RUCA 1JNTA 3O5KA 3KAFA 1FKRA 1N1AA 1FKKA 2PPPA 2MPHA 1PINA 3O5DA 2ITKA 2ZQUA 4ITZA 1FKLA 4BF8A 5HWBA 1F40A 4O2TA 2RSEA 1Q6UA 4GGQA 3O5QA 4JFJA 2JZVA 2L2SA 3FAPA 1D7HA 1F8AB 2M08A 2RQSA 5HT1A 1J6YA 2XP3A 2XP9A 2ZQVA 3GPKA 2OFNA 1FKIA 4R0XA 4TYOA 5HW8A 2RURA 4FAPA 3PA7A 2KFWA 4TW8A 1EQ3A 4JFIA 4ODPA 4NNRA 1B6CA 4MGVA 3EY6A 4N19A 1JVWA 4QT3A 2XPAA 3IKDA 2MLZA 4ODMA 4DIPA 1J4IA 1T11A 3LUOA 3KCEA 4TW7A 3CGNA 1FKFA 2PPOA 4ODKA 5DITA 4JFLA 3UI5A 2XP8A 3O5MA 4ODQA 5HW6A 1L1PA 1FKHA 1ROTA 4DT4A 1FKJA 3UQAA 4ODOA 3JXVA 1J4RA 2PV2A 4TNSA 3O5JA 3VAWA 2M2AA 4DH0A 2MLXA 3OOBA 3UI4A 3KZ7A 4DRMA 2LKNA 2KI3A 5I98A 4FN2A 5HTGA 3H9RB 3RGCA 2AWGA 4DRJA 1U79A 3TDBA 4W9PA 4TW6A 4TX0A 4QT2A 3ODKA 4IQ2A 1FKDA 4LAYA 3KACA 5HUAA 1NMWA 2XP5A 4ODRA 4MSPA 3KADA 5HW7A 1QPLA 2KE0A 2RUDA 1FJDA 4DRNA 1J4HA 1FD9A 1D7JA 2K8IA 1Y0OA 2VCDA 4GIVA 4U85A 1Q1CA 5DIVA 4DRQA 2N87A 1JNSA 2LPVA 3CGMA 1M5YA 5HKGA 1BL4A 3O5FA 2ZR5A 2Y78A 4DZ2A 3PRDA 4ODNA 4C02B 1QPFA 2LJ4A 4DROA 4LAVA 1FKGA 1Q6HA 1TCOC 2PPNA 2Q5AA 4DRIA 3TCZA 5BXJA 1FKBA 2FKEA 1D6OA 4J4NA 2MNTA 4JYSA 1YATA 1ZK6A 1KT1A 3NI6A 1KT0A 3WH0A 3KAGA 4G50A 1PBKA 2LGOA 1ROUA 2FAPA 2MF9A 1FAPA 3KABA 3NRKA 3O5GA 4J4OA 2RUQA 4JFMA 1QZ2A 1A7XA 2XP7A 3O5OA 3O5PA 4W9OA 3O5EA 3UF8A 4LAXA 2IF4A 2DG4A
chains in the Genus database with same CATH superfamily
3IHZA 4Z2HA 5HWCA 2WK2A 1FKRA 1NSGA 4QIBA 2UZ5A 1E9LA 4DRHA 1BKFA 2DG3A 1JCHB 1WB0A 2XP4A 3O5RA 3RMEA 2ZR6A 1GRJA 3I6CA 3UI6A 4U86A 4DZ3A 2XP6A 2PV3A 3B7XA 3BXWA 4L3NA 4P8UA 3O5IA 3CHCA 4LAWA 4MAVA 4QT3A 2RUCA 1JNTA 3KAFA 1GOIA 2ITKA 2FDMA 2RSEA 1SYTA 1Q6UA 2YBUA 3O5QA 2RQSA 2WLZA 4NZCA 1J6YA 3GPKA 5GQBA 5HW8A 4ODPA 1ZBWA 1HKKA 1UR9A 4N19A 2A3AA 1JVWA 3CHDA 3PR9A 1OGBA 3CGNA 1EHNA 5DITA 3UI5A 1FKHA 1XHGA 4TNSA 3FY1A 4WKAA 4WKHA 4DH0A 4DRMA 2LKNA 4Z2LA 2AWGA 3QOKA 1NWSA 1HKIA 3CHEA 3ODKA 3BMBA 1E44A 1LJYA 3KADA 1KFWA 1FJDA 2QF8A 4DRNA 1J4HA 1FD9A 2PN0A 3WD1A 4Z2KA 5DIVA 1Y0OA 3AQUA 4GIVA 4U85A 3WQWA 1W9UA 4DWSA 4URIA 4P8WA 3O5FA 2Y78A 1EIBA 1IX5A 4WIWA 4ODNA 1QPFA 2LJ4A 4P8VA 1Q6HA 1K9TA 1FFQA 4DWSC 3TCZA 1LL6A 3WD2A 1D6OA 3AS2A 3ALGA 1UR8A 1YATA 1ZK6A 3NI6A 1KT0A 4Q7NA 1PBKA 1NWTA 2LGOA 1FAPA 4DWSB 4LAXA 2MPHA 2F4EA 3AS1A 1NMVA 3IK8A 2P4VA 1EYMA 3IKGA 1W26A 2ETNA 2YBTA 3WL0A 4R5EA 4ODLA 3CHFA 2A3BA 1NWUA 2DT2A 3MDYB 5DIUA 1W9PA 2IUZA 4IPXA 1W1TA 5J6EA 2M1IA 2DG9A 2KO7A 1N1AA 2ZQUA 1JNDA 4JFJA 3G6MA 3FAPA 2L2SA 3AS0A 1D7HA 1F8AB 2M08A 1TFVA 1FKIA 1W1PA 4FAPA 1EQ3A 4NNRA 3ARYA 2F23A 3EY6A 3RM9A 3W4RA 4HBEA 4DIPA 1J4IA 2ESCA 2PPOA 1FKJA 4ODOA 3JXVA 1J4RA 2PV2A 3O5JA 3ARXA 3VAWA 2B5UB 1ZU8A 2PI6A 1OWQA 1GUVA 3KZ7A 2KI3A 3WD4A 3RM4A 4DRJA 4HBOA 1U79A 3TDBA 4TX0A 4ZPWR 5HUAA 1E6NA 2XP5A 4ODRA 4MSPA 1QPLA 2RUDA 4DWSD 3GTYX 2G41A 1FFRA 4UDMA 4DRQA 3ARPA 1ZB5A 2N87A 4ZS6A 1LL7A 1HKJA 4ZPVR 4C02B 3CZ8A 4IT4A 3ARZA 2Q5AA 1HJWA 2WM0A 2FKEA 3GU0A 4JYSA 3WH0A 4Z2IA 2FAPA 1LG2A 1QZ2A 3O5PA 3O5OA 4W9OA 3RM8A 4DT4A 1KT1A 4WK9A 4JFKA 1Q6IA 3RFWA 1SR0A 2F2DA 1P5QA 3ARTA 2D9FA 3KAHA 4WJXA 1C9HA 3JYJA 2A3CA 3ARWA 4U84A 3UQIA 3G6LA 2DSVA 1R9HA 3AS3A 4W9QA 1CTNA 1LG1A 4MTVA 4MNMA 5B8IC 3TC5A 1H0GA 2MLYA 2ZR4A 4G2PA 1HKMA 2KGJA 3ARSA 1FKTA 5GPRA 1HXVA 1ZCNA 2PV1A 2VN1A 2ZQTA 3PRBA 2ZQSA 4PTMA 1PINA 4ITZA 4AY1A 3AROA 5HT1A 2XP3A 2XP9A 1L1PA 3ALFA 2RURA 2KFWA 4TW8A 2A3EA 4MGVA 3WD0A 2DT0A 1HJVA 1E6PA 3LUOA 3KCEA 1EDQA 4ML4A 1FKFA 1XRVA 4JFLA 1LQ0A 3O5MA 4ODQA 1W9VA 1NH6A 1ROTA 4NSBA 2DSZA 2DSWA 4HARA 2M2AA 2MLXA 3OOBA 3UI4A 5HTGA 3RGCA 2O92A 3B9AA 1ZBCA 4QT2A 1FKDA 1WAWA 2DT1A 5HW7A 4LGXA 1D2KA 4KR0B 1W1YA 3WL1A 4IT6A 3CGMA 1M5YA 1RD6A 2ZR5A 3ARUA 4DROA 4LAVA 1TCOC 4W5UA 2PPNA 2OLHA 5BXJA 4S3KA 5DEZA 2MNTA 1LL4A 3KAGA 1X6NA 2MF9A 3KABA 4TYOA 1E6RA 3NRKA 4TW6A 5HWBA 1F40A 2RUQA 3O5EA 5DF0A 2IF4A 2DG4A 1ROUA 5GPGA 3UQBA 1ZBVA 2EULA 4L72B 3PRAA 4ZPTR 3CH9A 3O5LA 1D7IA 4QZVB 4XAKA 2F21A 3KAIA 4IQCA 1JNEA 3B8SA 4DRPA 1ZL1A 3NTPA 2PBCA 1YW5A 3JYMA 5D75A 2DT3A 4DRKA 4MNKA 2XPBA 2KR7A 1FKSA 3O5KA 4Q22A 2PPPA 1FKKA 1WNOA 3O5DA 1W1VA 4BF8A 1FKLA 1VF8A 1X6LA 3WD3A 4O2TA 4GGQA 5HBFA 1HJXA 1ZBKA 2JZVA 2O9OA 2ZQVA 4R0XA 2OFNA 4MPKA 5DO2A 2DSUA 3PA7A 4JFIA 3WQVA 1B6CA 2XPAA 1NWRA 3IKDA 4KQZA 2MLZA 4MNLA 4ODMA 3WKZA 1H0IA 4TW7A 1T11A 4MNJA 2WLYA 4ODKA 2XP8A 3ARVA 1O6IA 5HW6A 5JH8A 2AOSA 3UQAA 3B9EA 3WIJA 1ITXA 3B9DA 4WKFA 5I98A 4FN2A 3H9RB 3OA5A 1E6ZA 3ARQA 2DPEA 2G8ZA 4W9PA 3ARRA 4IQ2A 4LAYA 3KACA 1NMWA 2KE0A 1E15A 1D7JA 2K8IA 2VCDA 1Q1CA 1JNSA 2LPVA 2B31A 5HKGA 4Z2JA 1BL4A 4DZ2A 3PRDA 1FKGA 4DRIA 1FKBA 1OGGA 1GPFA 4Z2GA 4J4NA 4S3JA 4P8XA 4G50A 3O5GA 3EIPA 4J4OA 4JFMA 2XP7A 1A7XA 3FXYA 3UF8A
chains in the Genus database with same CATH topology
3IHZA 4Z2HA 5HWCA 2WK2A 1FKRA 1NSGA 4QIBA 2UZ5A 1E9LA 4DRHA 1BKFA 2DG3A 1WB0A 2XP4A 3O5RA 3RMEA 2ZR6A 3I6CA 3UI6A 4U86A 4DZ3A 2XP6A 2PV3A 3B7XA 3BXWA 4L3NA 4P8UA 3O5IA 3CHCA 4LAWA 4MAVA 4QT3A 2RUCA 1JNTA 3KAFA 1GOIA 2ITKA 2FDMA 2RSEA 1SYTA 1Q6UA 2YBUA 3O5QA 2RQSA 2WLZA 4NZCA 1J6YA 3GPKA 5GQBA 5HW8A 4ODPA 1ZBWA 1HKKA 1UR9A 4N19A 2A3AA 1JVWA 3CHDA 3PR9A 1OGBA 3CGNA 1EHNA 5DITA 3UI5A 1FKHA 1XHGA 4TNSA 3FY1A 4WKAA 4WKHA 4DH0A 4DRMA 2LKNA 4Z2LA 2AWGA 3QOKA 1NWSA 1HKIA 3CHEA 3ODKA 1LJYA 3KADA 1KFWA 1FJDA 2QF8A 4DRNA 1J4HA 1FD9A 3WD1A 4Z2KA 5DIVA 1Y0OA 3AQUA 4GIVA 4U85A 3WQWA 1W9UA 4DWSA 4URIA 4P8WA 3O5FA 2Y78A 1EIBA 1IX5A 4WIWA 4ODNA 1QPFA 2LJ4A 4P8VA 1Q6HA 1K9TA 1FFQA 4DWSC 3TCZA 1LL6A 3WD2A 1D6OA 3AS2A 3ALGA 1UR8A 1YATA 1ZK6A 3NI6A 1KT0A 4Q7NA 1PBKA 1NWTA 2LGOA 1FAPA 4DWSB 4LAXA 2MPHA 2F4EA 3AS1A 1NMVA 3IK8A 1EYMA 3IKGA 1W26A 2YBTA 3WL0A 4R5EA 4ODLA 3CHFA 2A3BA 1NWUA 2DT2A 3MDYB 5DIUA 1W9PA 2IUZA 4IPXA 1W1TA 5J6EA 2M1IA 2DG9A 2KO7A 1N1AA 2ZQUA 1JNDA 4JFJA 3G6MA 3FAPA 2L2SA 3AS0A 1D7HA 1F8AB 2M08A 1TFVA 1FKIA 1W1PA 4FAPA 1EQ3A 4NNRA 3ARYA 3EY6A 3RM9A 3W4RA 4HBEA 4DIPA 1J4IA 2ESCA 2PPOA 1FKJA 4ODOA 3JXVA 1J4RA 2PV2A 3O5JA 3ARXA 3VAWA 1ZU8A 2PI6A 1OWQA 1GUVA 3KZ7A 2KI3A 3WD4A 3RM4A 4DRJA 4HBOA 1U79A 3TDBA 4TX0A 4ZPWR 5HUAA 1E6NA 2XP5A 4ODRA 4MSPA 1QPLA 2RUDA 4DWSD 2G41A 1FFRA 4DRQA 3ARPA 1ZB5A 2N87A 4ZS6A 1LL7A 1HKJA 4ZPVR 4C02B 3CZ8A 4IT4A 3ARZA 2Q5AA 1HJWA 2WM0A 2FKEA 4JYSA 3WH0A 4Z2IA 2FAPA 1LG2A 1QZ2A 3O5PA 3O5OA 4W9OA 3RM8A 4DT4A 1KT1A 4WK9A 4JFKA 1Q6IA 3RFWA 1SR0A 2F2DA 1P5QA 3ARTA 2D9FA 3KAHA 4WJXA 1C9HA 3JYJA 2A3CA 3ARWA 4U84A 3UQIA 3G6LA 2DSVA 1R9HA 3AS3A 4W9QA 1CTNA 1LG1A 4MTVA 4MNMA 5B8IC 3TC5A 1H0GA 2MLYA 2ZR4A 4G2PA 1HKMA 2KGJA 3ARSA 1FKTA 5GPRA 1HXVA 1ZCNA 2PV1A 2VN1A 2ZQTA 3PRBA 2ZQSA 4PTMA 1PINA 4ITZA 4AY1A 3AROA 5HT1A 2XP3A 2XP9A 1L1PA 3ALFA 2RURA 2KFWA 4TW8A 2A3EA 4MGVA 3WD0A 2DT0A 1HJVA 1E6PA 3LUOA 3KCEA 1EDQA 4ML4A 1FKFA 1XRVA 4JFLA 1LQ0A 3O5MA 4ODQA 1W9VA 1NH6A 1ROTA 4NSBA 2DSZA 2DSWA 4HARA 2M2AA 2MLXA 3OOBA 3UI4A 5HTGA 3RGCA 2O92A 3B9AA 1ZBCA 4QT2A 1FKDA 1WAWA 2DT1A 5HW7A 4LGXA 1D2KA 4KR0B 1W1YA 3WL1A 4IT6A 3CGMA 1M5YA 1RD6A 2ZR5A 3ARUA 4DROA 4LAVA 1TCOC 4W5UA 2PPNA 2OLHA 5BXJA 4S3KA 5DEZA 2MNTA 1LL4A 3KAGA 1X6NA 2MF9A 3KABA 4TYOA 1E6RA 3NRKA 4TW6A 5HWBA 1F40A 2RUQA 3O5EA 5DF0A 2IF4A 2DG4A 1ROUA 5GPGA 3UQBA 1ZBVA 4L72B 3PRAA 4ZPTR 3CH9A 3O5LA 1D7IA 4QZVB 4XAKA 2F21A 3KAIA 4IQCA 1JNEA 3B8SA 4DRPA 1ZL1A 3NTPA 2PBCA 1YW5A 3JYMA 5D75A 2DT3A 4DRKA 4MNKA 2XPBA 2KR7A 1FKSA 3O5KA 4Q22A 2PPPA 1FKKA 1WNOA 3O5DA 1W1VA 4BF8A 1FKLA 1VF8A 1X6LA 3WD3A 4O2TA 4GGQA 5HBFA 1HJXA 1ZBKA 2JZVA 2O9OA 2ZQVA 4R0XA 2OFNA 4MPKA 5DO2A 2DSUA 3PA7A 4JFIA 3WQVA 1B6CA 2XPAA 1NWRA 3IKDA 4KQZA 2MLZA 4MNLA 4ODMA 3WKZA 1H0IA 4TW7A 1T11A 4MNJA 2WLYA 4ODKA 2XP8A 3ARVA 1O6IA 5HW6A 5JH8A 2AOSA 3UQAA 3B9EA 3WIJA 1ITXA 3B9DA 4WKFA 5I98A 4FN2A 3H9RB 3OA5A 1E6ZA 3ARQA 2DPEA 2G8ZA 4W9PA 3ARRA 4IQ2A 4LAYA 3KACA 1NMWA 2KE0A 1E15A 1D7JA 2K8IA 2VCDA 1Q1CA 1JNSA 2LPVA 2B31A 5HKGA 4Z2JA 1BL4A 4DZ2A 3PRDA 1FKGA 4DRIA 1FKBA 1OGGA 1GPFA 4Z2GA 4J4NA 4S3JA 4P8XA 4G50A 3O5GA 4J4OA 4JFMA 2XP7A 1A7XA 3FXYA 3UF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4E A;  3IHZ A;  5GPG A;  5HWC A;  3UQB A;  1NMV A;  3IK8 A;  1EYM A;  4JFK A;  1Q6I A;  3RFW A;  1NSG A;  3IKG A;  4QIB A;  2F2D A;  1P5Q A;  2UZ5 A;  2D9F A;  3KAH A;  1W26 A;  4DRH A;  1C9H A;  1BKF A;  3JYJ A;  3O5L A;  1D7I A;  2DG3 A;  4ODL A;  4U84 A;  3UQI A;  2F21 A;  1R9H A;  3KAI A;  4W9Q A;  2XP4 A;  3O5R A;  4IQC A;  2ZR6 A;  3I6C A;  4DRP A;  3UI6 A;  3NTP A;  2PBC A;  1YW5 A;  4U86 A;  4DZ3 A;  2XP6 A;  2PV3 A;  3B7X A;  5B8I C;  3TC5 A;  3MDY B;  2MLY A;  2ZR4 A;  4G2P A;  5DIU A;  3JYM A;  3O5I A;  4LAW A;  2KGJ A;  5D75 A;  1FKT A;  4IPX A;  4DRK A;  2XPB A;  1HXV A;  5J6E A;  1ZCN A;  2M1I A;  2PV1 A;  2DG9 A;  2KR7 A;  2VN1 A;  2KO7 A;  2ZQT A;  2ZQS A;  1FKS A;  3PRB A;  2RUC A;  1JNT A;  3O5K A;  3KAF A;  1FKR A;  1N1A A;  1FKK A;  2PPP A;  2MPH A;  1PIN A;  3O5D A;  2ITK A;  2ZQU A;  4ITZ A;  1FKL A;  4BF8 A;  5HWB A;  1F40 A;  4O2T A;  2RSE A;  1Q6U A;  4GGQ A;  3O5Q A;  4JFJ A;  2JZV A;  2L2S A;  3FAP A;  1D7H A;  1F8A B;  2M08 A;  2RQS A;  5HT1 A;  1J6Y A;  2XP3 A;  2XP9 A;  2ZQV A;  3GPK A;  2OFN A;  1FKI A;  4R0X A;  4TYO A;  5HW8 A;  2RUR A;  4FAP A;  3PA7 A;  2KFW A;  4TW8 A;  1EQ3 A;  4JFI A;  4ODP A;  4NNR A;  1B6C A;  4MGV A;  3EY6 A;  4N19 A;  1JVW A;  4QT3 A;  2XPA A;  3IKD A;  2MLZ A;  4ODM A;  4DIP A;  1J4I A;  1T11 A;  3LUO A;  3KCE A;  4TW7 A;  3CGN A;  1FKF A;  2PPO A;  4ODK A;  5DIT A;  4JFL A;  3UI5 A;  2XP8 A;  3O5M A;  4ODQ A;  5HW6 A;  1L1P A;  1FKH A;  1ROT A;  4DT4 A;  1FKJ A;  3UQA A;  4ODO A;  3JXV A;  1J4R A;  2PV2 A;  4TNS A;  3O5J A;  3VAW A;  2M2A A;  4DH0 A;  2MLX A;  3OOB A;  3UI4 A;  3KZ7 A;  4DRM A;  2LKN A;  2KI3 A;  5I98 A;  4FN2 A;  5HTG A;  3H9R B;  3RGC A;  2AWG A;  4DRJ A;  1U79 A;  3TDB A;  4W9P A;  4TW6 A;  4TX0 A;  4QT2 A;  3ODK A;  4IQ2 A;  1FKD A;  4LAY A;  3KAC A;  5HUA A;  1NMW A;  2XP5 A;  4ODR A;  4MSP A;  3KAD A;  5HW7 A;  1QPL A;  2KE0 A;  2RUD A;  1FJD A;  4DRN A;  1J4H A;  1FD9 A;  1D7J A;  2K8I A;  1Y0O A;  2VCD A;  4GIV A;  4U85 A;  1Q1C A;  5DIV A;  4DRQ A;  2N87 A;  1JNS A;  2LPV A;  3CGM A;  1M5Y A;  5HKG A;  1BL4 A;  3O5F A;  2ZR5 A;  2Y78 A;  4DZ2 A;  3PRD A;  4ODN A;  4C02 B;  1QPF A;  2LJ4 A;  4DRO A;  4LAV A;  1FKG A;  1Q6H A;  1TCO C;  2PPN A;  2Q5A A;  4DRI A;  3TCZ A;  5BXJ A;  1FKB A;  2FKE A;  1D6O A;  4J4N A;  2MNT A;  4JYS A;  1YAT A;  1ZK6 A;  1KT1 A;  3NI6 A;  1KT0 A;  3WH0 A;  3KAG A;  4G50 A;  1PBK A;  2LGO A;  1ROU A;  2FAP A;  2MF9 A;  1FAP A;  3KAB A;  3NRK A;  3O5G A;  4J4O A;  2RUQ A;  4JFM A;  1QZ2 A;  1A7X A;  2XP7 A;  3O5O A;  3O5P A;  4W9O A;  3O5E A;  3UF8 A;  4LAX A;  2IF4 A;  2DG4 A; 
#chains in the Genus database with same CATH topology
 3IHZ A;  4Z2H A;  5HWC A;  2WK2 A;  1FKR A;  1NSG A;  4QIB A;  2UZ5 A;  1E9L A;  4DRH A;  1BKF A;  2DG3 A;  1JCH B;  1WB0 A;  2XP4 A;  3O5R A;  3RME A;  2ZR6 A;  1GRJ A;  3I6C A;  3UI6 A;  4U86 A;  4DZ3 A;  2XP6 A;  2PV3 A;  3B7X A;  3BXW A;  4L3N A;  4P8U A;  3O5I A;  3CHC A;  4LAW A;  4MAV A;  4QT3 A;  2RUC A;  1JNT A;  3KAF A;  1GOI A;  2ITK A;  2FDM A;  2RSE A;  1SYT A;  1Q6U A;  2YBU A;  3O5Q A;  2RQS A;  2WLZ A;  4NZC A;  1J6Y A;  3GPK A;  5GQB A;  5HW8 A;  4ODP A;  1ZBW A;  1HKK A;  1UR9 A;  4N19 A;  2A3A A;  1JVW A;  3CHD A;  3PR9 A;  1OGB A;  3CGN A;  1EHN A;  5DIT A;  3UI5 A;  1FKH A;  1XHG A;  4TNS A;  3FY1 A;  4WKA A;  4WKH A;  4DH0 A;  4DRM A;  2LKN A;  4Z2L A;  2AWG A;  3QOK A;  1NWS A;  1HKI A;  3CHE A;  3ODK A;  3BMB A;  1E44 A;  1LJY A;  3KAD A;  1KFW A;  1FJD A;  2QF8 A;  4DRN A;  1J4H A;  1FD9 A;  2PN0 A;  3WD1 A;  4Z2K A;  5DIV A;  1Y0O A;  3AQU A;  4GIV A;  4U85 A;  3WQW A;  1W9U A;  4DWS A;  4URI A;  4P8W A;  3O5F A;  2Y78 A;  1EIB A;  1IX5 A;  4WIW A;  4ODN A;  1QPF A;  2LJ4 A;  4P8V A;  1Q6H A;  1K9T A;  1FFQ A;  4DWS C;  3TCZ A;  1LL6 A;  3WD2 A;  1D6O A;  3AS2 A;  3ALG A;  1UR8 A;  1YAT A;  1ZK6 A;  3NI6 A;  1KT0 A;  4Q7N A;  1PBK A;  1NWT A;  2LGO A;  1FAP A;  4DWS B;  4LAX A;  2MPH A;  2F4E A;  3AS1 A;  1NMV A;  3IK8 A;  2P4V A;  1EYM A;  3IKG A;  1W26 A;  2ETN A;  2YBT A;  3WL0 A;  4R5E A;  4ODL A;  3CHF A;  2A3B A;  1NWU A;  2DT2 A;  3MDY B;  5DIU A;  1W9P A;  2IUZ A;  4IPX A;  1W1T A;  5J6E A;  2M1I A;  2DG9 A;  2KO7 A;  1N1A A;  2ZQU A;  1JND A;  4JFJ A;  3G6M A;  3FAP A;  2L2S A;  3AS0 A;  1D7H A;  1F8A B;  2M08 A;  1TFV A;  1FKI A;  1W1P A;  4FAP A;  1EQ3 A;  4NNR A;  3ARY A;  2F23 A;  3EY6 A;  3RM9 A;  3W4R A;  4HBE A;  4DIP A;  1J4I A;  2ESC A;  2PPO A;  1FKJ A;  4ODO A;  3JXV A;  1J4R A;  2PV2 A;  3O5J A;  3ARX A;  3VAW A;  2B5U B;  1ZU8 A;  2PI6 A;  1OWQ A;  1GUV A;  3KZ7 A;  2KI3 A;  3WD4 A;  3RM4 A;  4DRJ A;  4HBO A;  1U79 A;  3TDB A;  4TX0 A;  4ZPW R;  5HUA A;  1E6N A;  2XP5 A;  4ODR A;  4MSP A;  1QPL A;  2RUD A;  4DWS D;  3GTY X;  2G41 A;  1FFR A;  4UDM A;  4DRQ A;  3ARP A;  1ZB5 A;  2N87 A;  4ZS6 A;  1LL7 A;  1HKJ A;  4ZPV R;  4C02 B;  3CZ8 A;  4IT4 A;  3ARZ A;  2Q5A A;  1HJW A;  2WM0 A;  2FKE A;  3GU0 A;  4JYS A;  3WH0 A;  4Z2I A;  2FAP A;  1LG2 A;  1QZ2 A;  3O5P A;  3O5O A;  4W9O A;  3RM8 A;  4DT4 A;  1KT1 A;  4WK9 A;  4JFK A;  1Q6I A;  3RFW A;  1SR0 A;  2F2D A;  1P5Q A;  3ART A;  2D9F A;  3KAH A;  4WJX A;  1C9H A;  3JYJ A;  2A3C A;  3ARW A;  4U84 A;  3UQI A;  3G6L A;  2DSV A;  1R9H A;  3AS3 A;  4W9Q A;  1CTN A;  1LG1 A;  4MTV A;  4MNM A;  5B8I C;  3TC5 A;  1H0G A;  2MLY A;  2ZR4 A;  4G2P A;  1HKM A;  2KGJ A;  3ARS A;  1FKT A;  5GPR A;  1HXV A;  1ZCN A;  2PV1 A;  2VN1 A;  2ZQT A;  3PRB A;  2ZQS A;  4PTM A;  1PIN A;  4ITZ A;  4AY1 A;  3ARO A;  5HT1 A;  2XP3 A;  2XP9 A;  1L1P A;  3ALF A;  2RUR A;  2KFW A;  4TW8 A;  2A3E A;  4MGV A;  3WD0 A;  2DT0 A;  1HJV A;  1E6P A;  3LUO A;  3KCE A;  1EDQ A;  4ML4 A;  1FKF A;  1XRV A;  4JFL A;  1LQ0 A;  3O5M A;  4ODQ A;  1W9V A;  1NH6 A;  1ROT A;  4NSB A;  2DSZ A;  2DSW A;  4HAR A;  2M2A A;  2MLX A;  3OOB A;  3UI4 A;  5HTG A;  3RGC A;  2O92 A;  3B9A A;  1ZBC A;  4QT2 A;  1FKD A;  1WAW A;  2DT1 A;  5HW7 A;  4LGX A;  1D2K A;  4KR0 B;  1W1Y A;  3WL1 A;  4IT6 A;  3CGM A;  1M5Y A;  1RD6 A;  2ZR5 A;  3ARU A;  4DRO A;  4LAV A;  1TCO C;  4W5U A;  2PPN A;  2OLH A;  5BXJ A;  4S3K A;  5DEZ A;  2MNT A;  1LL4 A;  3KAG A;  1X6N A;  2MF9 A;  3KAB A;  4TYO A;  1E6R A;  3NRK A;  4TW6 A;  5HWB A;  1F40 A;  2RUQ A;  3O5E A;  5DF0 A;  2IF4 A;  2DG4 A;  1ROU A;  5GPG A;  3UQB A;  1ZBV A;  2EUL A;  4L72 B;  3PRA A;  4ZPT R;  3CH9 A;  3O5L A;  1D7I A;  4QZV B;  4XAK A;  2F21 A;  3KAI A;  4IQC A;  1JNE A;  3B8S A;  4DRP A;  1ZL1 A;  3NTP A;  2PBC A;  1YW5 A;  3JYM A;  5D75 A;  2DT3 A;  4DRK A;  4MNK A;  2XPB A;  2KR7 A;  1FKS A;  3O5K A;  4Q22 A;  2PPP A;  1FKK A;  1WNO A;  3O5D A;  1W1V A;  4BF8 A;  1FKL A;  1VF8 A;  1X6L A;  3WD3 A;  4O2T A;  4GGQ A;  5HBF A;  1HJX A;  1ZBK A;  2JZV A;  2O9O A;  2ZQV A;  4R0X A;  2OFN A;  4MPK A;  5DO2 A;  2DSU A;  3PA7 A;  4JFI A;  3WQV A;  1B6C A;  2XPA A;  1NWR A;  3IKD A;  4KQZ A;  2MLZ A;  4MNL A;  4ODM A;  3WKZ A;  1H0I A;  4TW7 A;  1T11 A;  4MNJ A;  2WLY A;  4ODK A;  2XP8 A;  3ARV A;  1O6I A;  5HW6 A;  5JH8 A;  2AOS A;  3UQA A;  3B9E A;  3WIJ A;  1ITX A;  3B9D A;  4WKF A;  5I98 A;  4FN2 A;  3H9R B;  3OA5 A;  1E6Z A;  3ARQ A;  2DPE A;  2G8Z A;  4W9P A;  3ARR A;  4IQ2 A;  4LAY A;  3KAC A;  1NMW A;  2KE0 A;  1E15 A;  1D7J A;  2K8I A;  2VCD A;  1Q1C A;  1JNS A;  2LPV A;  2B31 A;  5HKG A;  4Z2J A;  1BL4 A;  4DZ2 A;  3PRD A;  1FKG A;  4DRI A;  1FKB A;  1OGG A;  1GPF A;  4Z2G A;  4J4N A;  4S3J A;  4P8X A;  4G50 A;  3O5G A;  3EIP A;  4J4O A;  4JFM A;  2XP7 A;  1A7X A;  3FXY A;  3UF8 A; 
#chains in the Genus database with same CATH homology
 3IHZ A;  4Z2H A;  5HWC A;  2WK2 A;  1FKR A;  1NSG A;  4QIB A;  2UZ5 A;  1E9L A;  4DRH A;  1BKF A;  2DG3 A;  1WB0 A;  2XP4 A;  3O5R A;  3RME A;  2ZR6 A;  3I6C A;  3UI6 A;  4U86 A;  4DZ3 A;  2XP6 A;  2PV3 A;  3B7X A;  3BXW A;  4L3N A;  4P8U A;  3O5I A;  3CHC A;  4LAW A;  4MAV A;  4QT3 A;  2RUC A;  1JNT A;  3KAF A;  1GOI A;  2ITK A;  2FDM A;  2RSE A;  1SYT A;  1Q6U A;  2YBU A;  3O5Q A;  2RQS A;  2WLZ A;  4NZC A;  1J6Y A;  3GPK A;  5GQB A;  5HW8 A;  4ODP A;  1ZBW A;  1HKK A;  1UR9 A;  4N19 A;  2A3A A;  1JVW A;  3CHD A;  3PR9 A;  1OGB A;  3CGN A;  1EHN A;  5DIT A;  3UI5 A;  1FKH A;  1XHG A;  4TNS A;  3FY1 A;  4WKA A;  4WKH A;  4DH0 A;  4DRM A;  2LKN A;  4Z2L A;  2AWG A;  3QOK A;  1NWS A;  1HKI A;  3CHE A;  3ODK A;  1LJY A;  3KAD A;  1KFW A;  1FJD A;  2QF8 A;  4DRN A;  1J4H A;  1FD9 A;  3WD1 A;  4Z2K A;  5DIV A;  1Y0O A;  3AQU A;  4GIV A;  4U85 A;  3WQW A;  1W9U A;  4DWS A;  4URI A;  4P8W A;  3O5F A;  2Y78 A;  1EIB A;  1IX5 A;  4WIW A;  4ODN A;  1QPF A;  2LJ4 A;  4P8V A;  1Q6H A;  1K9T A;  1FFQ A;  4DWS C;  3TCZ A;  1LL6 A;  3WD2 A;  1D6O A;  3AS2 A;  3ALG A;  1UR8 A;  1YAT A;  1ZK6 A;  3NI6 A;  1KT0 A;  4Q7N A;  1PBK A;  1NWT A;  2LGO A;  1FAP A;  4DWS B;  4LAX A;  2MPH A;  2F4E A;  3AS1 A;  1NMV A;  3IK8 A;  1EYM A;  3IKG A;  1W26 A;  2YBT A;  3WL0 A;  4R5E A;  4ODL A;  3CHF A;  2A3B A;  1NWU A;  2DT2 A;  3MDY B;  5DIU A;  1W9P A;  2IUZ A;  4IPX A;  1W1T A;  5J6E A;  2M1I A;  2DG9 A;  2KO7 A;  1N1A A;  2ZQU A;  1JND A;  4JFJ A;  3G6M A;  3FAP A;  2L2S A;  3AS0 A;  1D7H A;  1F8A B;  2M08 A;  1TFV A;  1FKI A;  1W1P A;  4FAP A;  1EQ3 A;  4NNR A;  3ARY A;  3EY6 A;  3RM9 A;  3W4R A;  4HBE A;  4DIP A;  1J4I A;  2ESC A;  2PPO A;  1FKJ A;  4ODO A;  3JXV A;  1J4R A;  2PV2 A;  3O5J A;  3ARX A;  3VAW A;  1ZU8 A;  2PI6 A;  1OWQ A;  1GUV A;  3KZ7 A;  2KI3 A;  3WD4 A;  3RM4 A;  4DRJ A;  4HBO A;  1U79 A;  3TDB A;  4TX0 A;  4ZPW R;  5HUA A;  1E6N A;  2XP5 A;  4ODR A;  4MSP A;  1QPL A;  2RUD A;  4DWS D;  2G41 A;  1FFR A;  4DRQ A;  3ARP A;  1ZB5 A;  2N87 A;  4ZS6 A;  1LL7 A;  1HKJ A;  4ZPV R;  4C02 B;  3CZ8 A;  4IT4 A;  3ARZ A;  2Q5A A;  1HJW A;  2WM0 A;  2FKE A;  4JYS A;  3WH0 A;  4Z2I A;  2FAP A;  1LG2 A;  1QZ2 A;  3O5P A;  3O5O A;  4W9O A;  3RM8 A;  4DT4 A;  1KT1 A;  4WK9 A;  4JFK A;  1Q6I A;  3RFW A;  1SR0 A;  2F2D A;  1P5Q A;  3ART A;  2D9F A;  3KAH A;  4WJX A;  1C9H A;  3JYJ A;  2A3C A;  3ARW A;  4U84 A;  3UQI A;  3G6L A;  2DSV A;  1R9H A;  3AS3 A;  4W9Q A;  1CTN A;  1LG1 A;  4MTV A;  4MNM A;  5B8I C;  3TC5 A;  1H0G A;  2MLY A;  2ZR4 A;  4G2P A;  1HKM A;  2KGJ A;  3ARS A;  1FKT A;  5GPR A;  1HXV A;  1ZCN A;  2PV1 A;  2VN1 A;  2ZQT A;  3PRB A;  2ZQS A;  4PTM A;  1PIN A;  4ITZ A;  4AY1 A;  3ARO A;  5HT1 A;  2XP3 A;  2XP9 A;  1L1P A;  3ALF A;  2RUR A;  2KFW A;  4TW8 A;  2A3E A;  4MGV A;  3WD0 A;  2DT0 A;  1HJV A;  1E6P A;  3LUO A;  3KCE A;  1EDQ A;  4ML4 A;  1FKF A;  1XRV A;  4JFL A;  1LQ0 A;  3O5M A;  4ODQ A;  1W9V A;  1NH6 A;  1ROT A;  4NSB A;  2DSZ A;  2DSW A;  4HAR A;  2M2A A;  2MLX A;  3OOB A;  3UI4 A;  5HTG A;  3RGC A;  2O92 A;  3B9A A;  1ZBC A;  4QT2 A;  1FKD A;  1WAW A;  2DT1 A;  5HW7 A;  4LGX A;  1D2K A;  4KR0 B;  1W1Y A;  3WL1 A;  4IT6 A;  3CGM A;  1M5Y A;  1RD6 A;  2ZR5 A;  3ARU A;  4DRO A;  4LAV A;  1TCO C;  4W5U A;  2PPN A;  2OLH A;  5BXJ A;  4S3K A;  5DEZ A;  2MNT A;  1LL4 A;  3KAG A;  1X6N A;  2MF9 A;  3KAB A;  4TYO A;  1E6R A;  3NRK A;  4TW6 A;  5HWB A;  1F40 A;  2RUQ A;  3O5E A;  5DF0 A;  2IF4 A;  2DG4 A;  1ROU A;  5GPG A;  3UQB A;  1ZBV A;  4L72 B;  3PRA A;  4ZPT R;  3CH9 A;  3O5L A;  1D7I A;  4QZV B;  4XAK A;  2F21 A;  3KAI A;  4IQC A;  1JNE A;  3B8S A;  4DRP A;  1ZL1 A;  3NTP A;  2PBC A;  1YW5 A;  3JYM A;  5D75 A;  2DT3 A;  4DRK A;  4MNK A;  2XPB A;  2KR7 A;  1FKS A;  3O5K A;  4Q22 A;  2PPP A;  1FKK A;  1WNO A;  3O5D A;  1W1V A;  4BF8 A;  1FKL A;  1VF8 A;  1X6L A;  3WD3 A;  4O2T A;  4GGQ A;  5HBF A;  1HJX A;  1ZBK A;  2JZV A;  2O9O A;  2ZQV A;  4R0X A;  2OFN A;  4MPK A;  5DO2 A;  2DSU A;  3PA7 A;  4JFI A;  3WQV A;  1B6C A;  2XPA A;  1NWR A;  3IKD A;  4KQZ A;  2MLZ A;  4MNL A;  4ODM A;  3WKZ A;  1H0I A;  4TW7 A;  1T11 A;  4MNJ A;  2WLY A;  4ODK A;  2XP8 A;  3ARV A;  1O6I A;  5HW6 A;  5JH8 A;  2AOS A;  3UQA A;  3B9E A;  3WIJ A;  1ITX A;  3B9D A;  4WKF A;  5I98 A;  4FN2 A;  3H9R B;  3OA5 A;  1E6Z A;  3ARQ A;  2DPE A;  2G8Z A;  4W9P A;  3ARR A;  4IQ2 A;  4LAY A;  3KAC A;  1NMW A;  2KE0 A;  1E15 A;  1D7J A;  2K8I A;  2VCD A;  1Q1C A;  1JNS A;  2LPV A;  2B31 A;  5HKG A;  4Z2J A;  1BL4 A;  4DZ2 A;  3PRD A;  1FKG A;  4DRI A;  1FKB A;  1OGG A;  1GPF A;  4Z2G A;  4J4N A;  4S3J A;  4P8X A;  4G50 A;  3O5G A;  4J4O A;  4JFM A;  2XP7 A;  1A7X A;  3FXY A;  3UF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...