1D7IA

Fkbp complexed with methyl methylsulfinylmethyl sulfide (dss)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
publication title X-ray structures of small ligand-FKBP complexes provide an estimate for hydrophobic interaction energies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 26
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1d7iA00
4QIBA 1T11A 4ODRA 2UZ5A 1EQ3A 2PPNA 2RQSA 4J4NA 1FKBA 2KO7A 4ODQA 2Q5AA 2AWGA 2KR7A 3IKDA 1Q6HA 3UI6A 5DITA 3UQIA 3O5JA 4FN2A 1F40A 2KFWA 4TW8A 1Y0OA 4O2TA 2KE0A 1PINA 1BKFA 2XP5A 4U86A 1FKLA 2L2SA 4DRMA 2PPOA 4JFIA 1FKHA 2F21A 2ZQTA 3MDYB 2XPAA 1Q6UA 3TCZA 2LGOA 2MNTA 1FKSA 3IHZA 4G2PA 3O5DA 4C02B 1NSGA 3UI5A 3UI4A 1M5YA 2LJ4A 3O5MA 4LAYA 4BF8A 3O5RA 1FKTA 2MF9A 4DRHA 4W9PA 3O5FA 4DROA 3KAFA 4TYOA 1F8AB 3O5PA 3PA7A 5HKGA 4DRNA 5I98A 2K8IA 3O5LA 3RFWA 4DZ2A 2M1IA 4W9QA 3CGNA 2ITKA 2LPVA 2RSEA 2MPHA 2FKEA 1U79A 4JYSA 5DIVA 4J4OA 3KAHA 1J4IA 1FKFA 2M2AA 1QZ2A 2RURA 5D75A 3GPKA 4R0XA 3TDBA 3I6CA 3KCEA 4FAPA 1J4RA 1QPFA 2VCDA 4TW6A 1N1AA 3KZ7A 1P5QA 3O5GA 4W9OA 4DT4A 2KGJA 5HW8A 1C9HA 1B6CA 4ODMA 2RUDA 3UF8A 4U84A 5BXJA 1D7IA 3IK8A 1A7XA 4ODNA 1D6OA 4DRIA 3PRDA 4DRKA 1JVWA 2ZR6A 2MLZA 5DIUA 1FKIA 1NMVA 1FKGA 1EYMA 1ZK6A 4ODOA 5HWBA 3JYJA 1JNSA 4IPXA 2ZR4A 4LAWA 4MSPA 5HT1A 2PBCA 2MLYA 1JNTA 1PBKA 1QPLA 2DG3A 3IKGA 2IF4A 3JXVA 1L1PA 1TCOC 1YATA 4TX0A 1ZCNA 4DRPA 1Q6IA 2KI3A 5HW7A 2MLXA 5HTGA 5HUAA 4TW7A 2XP3A 1FAPA 2F2DA 3KADA 2XP6A 4LAXA 2XP8A 2PV2A 2JZVA 3KABA 1W26A 1YW5A 2XP4A 3PRBA 3VAWA 2Y78A 1ROTA 2FAPA 3JYMA 3NI6A 2LKNA 4QT3A 4DZ3A 1D7HA 4QT2A 1J6YA 2PV3A 2ZQVA 4DRJA 1ROUA 4LAVA 3KAGA 1FKKA 4JFMA 4NNRA 3UQBA 3OOBA 2XP7A 3O5EA 3O5KA 4IQCA 4ODPA 2D9FA 4JFLA 3O5OA 4G50A 2ZR5A 4JFKA 2M08A 4ODKA 5HWCA 1R9HA 2RUQA 4DIPA 2DG9A 5J6EA 1Q1CA 3FAPA 1D7JA 1NMWA 2N87A 4ITZA 3NRKA 2DG4A 4GGQA 4DH0A 3KACA 1KT1A 2ZQUA 3O5QA 3TC5A 3CGMA 3WH0A 5B8IC 3UQAA 1FKJA 3O5IA 3ODKA 2VN1A 3H9RB 2F4EA 2OFNA 4U85A 4TNSA 2PPPA 2PV1A 3KAIA 3LUOA 4IQ2A 4DRQA 1FJDA 1FKRA 5GPGA 4MGVA 1FD9A 1J4HA 2XPBA 4ODLA 2XP9A 4GIVA 3RGCA 4JFJA 4N19A 1HXVA 2ZQSA 3EY6A 3NTPA 1FKDA 1BL4A 1KT0A 2RUCA 5HW6A 3B7XA
chains in the Genus database with same CATH superfamily
1EQ3A 3WQWA 3RMEA 2PPNA 1FKBA 2Q5AA 1E6RA 3UQIA 1ZU8A 1F40A 3PRAA 4DWSC 3QOKA 1E44A 3MDYB 1Q6UA 4ZPVR 4S3KA 4QZVB 1X6NA 3O5DA 1M5YA 4LAYA 3O5MA 3O5RA 2MF9A 4DROA 4MAVA 1F8AB 2WLYA 3ARVA 5HKGA 4DRNA 3O5LA 1FFQA 4PTMA 4DZ2A 2RSEA 2FKEA 1NWUA 2M2AA 2RURA 3TDBA 1E15A 3KCEA 5DO2A 1J4RA 1GOIA 3O5GA 4DT4A 1GUVA 3UF8A 1D7IA 4KR0B 2ZR6A 5JH8A 1NMVA 1FKGA 4IPXA 4Q7NA 2AOSA 2WM0A 2WLZA 3GTYX 4ZPWR 2MLXA 2XP8A 2JZVA 3VAWA 2Y78A 3JYMA 4QT2A 1W9PA 2QF8A 1FKKA 4LAVA 5GQBA 3RM4A 3OOBA 2XP7A 5DF0A 3O5KA 4Z2LA 3O5OA 1EIBA 4JFKA 2M08A 4ODKA 4NZCA 4DIPA 1Q1CA 3WD1A 2DSZA 2N87A 4Z2IA 1OWQA 3CGMA 3AS0A 3UQAA 1RD6A 1FKJA 2G41A 1OGGA 2ESCA 4IQ2A 4DRQA 4P8UA 4MGVA 2XPBA 2XP9A 2ZQSA 2O92A 4P8VA 3B7XA 4QIBA 2IUZA 3ARSA 2A3BA 2KO7A 2AWGA 1LQ0A 2KR7A 1LL6A 5DITA 3O5JA 3CH9A 1ZL1A 2DT1A 2KE0A 3ALGA 2XP5A 4U86A 2DPEA 4DRMA 3TCZA 2LGOA 3G6MA 3ARXA 4G2PA 1HJWA 1FKTA 1WNOA 3KAFA 4TYOA 4MNMA 5I98A 2O9OA 3RFWA 3CHDA 1D2KA 4DWSA 4DWSB 1SYTA 4URIA 4L72B 1GRJA 4R0XA 1QPFA 4MTVA 2DSWA 1HJXA 1P5QA 1ZBKA 4IT4A 1W1TA 1C9HA 1B6CA 4ODMA 2RUDA 4U84A 3PRDA 5DIUA 4Z2KA 1FKIA 1EYMA 1E6ZA 3JYJA 4LAWA 5HT1A 2PBCA 4WKAA 3JXVA 1TCOC 1YATA 4TX0A 1ZCNA 1ZBCA 5HTGA 5HUAA 2F2DA 4Z2HA 1O6IA 1W26A 2XP4A 4Q22A 3NI6A 4LGXA 4QT3A 3CHCA 1W9VA 4JFMA 3BXWA 3AQUA 4ODPA 1IX5A 2YBTA 2ZR5A 4XAKA 1R9HA 3WD4A 2RUQA 3CHFA 2P4VA 5GPRA 1NMWA 4WKFA 4R5EA 2DG4A 4AY1A 3KACA 3O5QA 3TC5A 5B8IC 3O5IA 2F4EA 2PPPA 2PV1A 1X6LA 3LUOA 1FJDA 5GPGA 2PI6A 1NWSA 3B8SA 1J4HA 2DT2A 4N19A 1BL4A 2RUCA 1H0IA 4WJXA 2YBUA 2ETNA 1NWTA 1SR0A 1T11A 2UZ5A 4ODRA 4NSBA 1WB0A 4ODQA 4L3NA 3CHEA 1UR8A 3IKDA 1Q6HA 4MNLA 1JNDA 3CZ8A 4FN2A 2KFWA 4O2TA 1BKFA 1FKLA 2L2SA 2PPOA 1FKHA 3FXYA 3RM8A 1FKSA 1VF8A 3UI5A 4W9PA 3EIPA 4MNKA 3O5PA 1ZBVA 3AS2A 2M1IA 4W9QA 1K9TA 2ITKA 1ZBWA 2MPHA 3KAHA 3FY1A 4UDMA 1QZ2A 5D75A 3GPKA 4HBEA 4FAPA 4TW6A 3B9AA 1N1AA 1LL7A 4HARA 1XRVA 4W9OA 1WAWA 5BXJA 4ODNA 1D6OA 3WL1A 3WL0A 1JVWA 2DSUA 2OLHA 1ZK6A 4ODOA 5HWBA 1JNSA 4MSPA 1PBKA 1QPLA 2IF4A 4DRPA 1FFRA 2KI3A 3WD0A 4MNJA 2A3EA 4TW7A 1FAPA 4LAXA 2PV2A 3KABA 1ITXA 3ARTA 5HBFA 3AS3A 3PRBA 2FAPA 4MPKA 1TFVA 2EULA 2PV3A 2ZQVA 3WIJA 3ARUA 1HJVA 4IT6A 3WQVA 3RM9A 1UR9A 2D9FA 2DT3A 4JFLA 3OA5A 2A3CA 2B31A 5J6EA 2DG9A 3FAPA 1D7JA 4ML4A 3ARYA 4ITZA 3NRKA 4P8XA 3WD3A 4GGQA 4DH0A 1KT1A 4WKHA 2ZQUA 4HBOA 3BMBA 4WIWA 3H9RB 3KAIA 1GPFA 1EDQA 1FD9A 4GIVA 1H0GA 1KFWA 3EY6A 1FKDA 1LG1A 1KT0A 5HW6A 1E6NA 2RQSA 4J4NA 3B9EA 2F23A 3UI6A 5DEZA 4TW8A 2DSVA 1CTNA 1Y0OA 1PINA 1HKKA 4JFIA 3PR9A 2F21A 2ZQTA 1W1YA 1NH6A 2XPAA 2WK2A 2MNTA 3G6LA 3IHZA 4C02B 1NSGA 3UI4A 4BF8A 2LJ4A 4DRHA 3O5FA 1W1PA 3W4RA 3PA7A 3B9DA 2K8IA 3WD2A 3CGNA 1LG2A 3ARPA 2LPVA 4JYSA 1U79A 5DIVA 4J4OA 1J4IA 1FKFA 2FDMA 4WK9A 1HKIA 3I6CA 2G8ZA 1JNEA 2VCDA 3ARZA 3KZ7A 1W9UA 4P8WA 5HW8A 2KGJA 2B5UB 3IK8A 1A7XA 4DRIA 4DRKA 2MLZA 4Z2JA 2ZR4A 3ALFA 3AROA 2MLYA 1JNTA 1ZB5A 2DG3A 3IKGA 1L1PA 4W5UA 1Q6IA 5HW7A 2XP3A 3KADA 2XP6A 1E9LA 2PN0A 1YW5A 1ROTA 1XHGA 2LKNA 1J6YA 4DZ3A 1D7HA 4DRJA 1ROUA 1E6PA 4S3JA 3KAGA 1NWRA 2DT0A 1W1VA 4NNRA 3UQBA 3O5EA 4IQCA 1JCHB 4G50A 4KQZA 5HWCA 3ARWA 3ARRA 4Z2GA 1OGBA 4ZPTR 4DWSD 4ZS6A 1LL4A 3GU0A 3WH0A 3WKZA 3ODKA 2VN1A 2OFNA 4U85A 4TNSA 1FKRA 2A3AA 1LJYA 3ARQA 3AS1A 4ODLA 3RGCA 4JFJA 1HXVA 1HKJA 1HKMA 3NTPA 1EHNA
chains in the Genus database with same CATH topology
1EQ3A 3WQWA 3RMEA 2PPNA 1FKBA 2Q5AA 1E6RA 3UQIA 1ZU8A 1F40A 3PRAA 4DWSC 3QOKA 3MDYB 1Q6UA 4ZPVR 4S3KA 4QZVB 1X6NA 3O5DA 1M5YA 4LAYA 3O5MA 3O5RA 2MF9A 4DROA 4MAVA 1F8AB 2WLYA 3ARVA 5HKGA 4DRNA 3O5LA 1FFQA 4PTMA 4DZ2A 2RSEA 2FKEA 1NWUA 2M2AA 2RURA 3TDBA 1E15A 3KCEA 5DO2A 1J4RA 1GOIA 3O5GA 4DT4A 1GUVA 3UF8A 1D7IA 4KR0B 2ZR6A 5JH8A 1NMVA 1FKGA 4IPXA 4Q7NA 2AOSA 2WM0A 2WLZA 4ZPWR 2MLXA 2XP8A 2JZVA 3VAWA 2Y78A 3JYMA 4QT2A 1W9PA 2QF8A 1FKKA 4LAVA 5GQBA 3RM4A 3OOBA 2XP7A 5DF0A 3O5KA 4Z2LA 3O5OA 1EIBA 4JFKA 2M08A 4ODKA 4NZCA 4DIPA 1Q1CA 3WD1A 2DSZA 2N87A 4Z2IA 1OWQA 3CGMA 3AS0A 3UQAA 1RD6A 1FKJA 2G41A 1OGGA 2ESCA 4IQ2A 4DRQA 4P8UA 4MGVA 2XPBA 2XP9A 2ZQSA 2O92A 4P8VA 3B7XA 4QIBA 2IUZA 3ARSA 2A3BA 2KO7A 2AWGA 1LQ0A 2KR7A 1LL6A 5DITA 3O5JA 3CH9A 1ZL1A 2DT1A 2KE0A 3ALGA 2XP5A 4U86A 2DPEA 4DRMA 3TCZA 2LGOA 3G6MA 3ARXA 4G2PA 1HJWA 1FKTA 1WNOA 3KAFA 4TYOA 4MNMA 5I98A 2O9OA 3RFWA 3CHDA 1D2KA 4DWSA 4DWSB 1SYTA 4URIA 4L72B 4R0XA 1QPFA 4MTVA 2DSWA 1HJXA 1P5QA 1ZBKA 4IT4A 1W1TA 1C9HA 1B6CA 4ODMA 2RUDA 4U84A 3PRDA 5DIUA 4Z2KA 1FKIA 1EYMA 1E6ZA 3JYJA 4LAWA 5HT1A 2PBCA 4WKAA 3JXVA 1TCOC 1YATA 4TX0A 1ZCNA 1ZBCA 5HTGA 5HUAA 2F2DA 4Z2HA 1O6IA 1W26A 2XP4A 4Q22A 3NI6A 4LGXA 4QT3A 3CHCA 1W9VA 4JFMA 3BXWA 3AQUA 4ODPA 1IX5A 2YBTA 2ZR5A 4XAKA 1R9HA 3WD4A 2RUQA 3CHFA 5GPRA 1NMWA 4WKFA 4R5EA 2DG4A 4AY1A 3KACA 3O5QA 3TC5A 5B8IC 3O5IA 2F4EA 2PPPA 2PV1A 1X6LA 3LUOA 1FJDA 5GPGA 2PI6A 1NWSA 3B8SA 1J4HA 2DT2A 4N19A 1BL4A 2RUCA 1H0IA 4WJXA 2YBUA 1NWTA 1SR0A 1T11A 2UZ5A 4ODRA 4NSBA 1WB0A 4ODQA 4L3NA 3CHEA 1UR8A 3IKDA 1Q6HA 4MNLA 1JNDA 3CZ8A 4FN2A 2KFWA 4O2TA 1BKFA 1FKLA 2L2SA 2PPOA 1FKHA 3FXYA 3RM8A 1FKSA 1VF8A 3UI5A 4W9PA 4MNKA 3O5PA 1ZBVA 3AS2A 2M1IA 4W9QA 1K9TA 2ITKA 1ZBWA 2MPHA 3KAHA 3FY1A 1QZ2A 5D75A 3GPKA 4HBEA 4FAPA 4TW6A 3B9AA 1N1AA 1LL7A 4HARA 1XRVA 4W9OA 1WAWA 5BXJA 4ODNA 1D6OA 3WL1A 3WL0A 1JVWA 2DSUA 2OLHA 1ZK6A 4ODOA 5HWBA 1JNSA 4MSPA 1PBKA 1QPLA 2IF4A 4DRPA 1FFRA 2KI3A 3WD0A 4MNJA 2A3EA 4TW7A 1FAPA 4LAXA 2PV2A 3KABA 1ITXA 3ARTA 5HBFA 3AS3A 3PRBA 2FAPA 4MPKA 1TFVA 2PV3A 2ZQVA 3WIJA 3ARUA 1HJVA 4IT6A 3WQVA 3RM9A 1UR9A 2D9FA 2DT3A 4JFLA 3OA5A 2A3CA 2B31A 5J6EA 2DG9A 3FAPA 1D7JA 4ML4A 3ARYA 4ITZA 3NRKA 4P8XA 3WD3A 4GGQA 4DH0A 1KT1A 4WKHA 2ZQUA 4HBOA 4WIWA 3H9RB 3KAIA 1GPFA 1EDQA 1FD9A 4GIVA 1H0GA 1KFWA 3EY6A 1FKDA 1LG1A 1KT0A 5HW6A 1E6NA 2RQSA 4J4NA 3B9EA 3UI6A 5DEZA 4TW8A 2DSVA 1CTNA 1Y0OA 1PINA 1HKKA 4JFIA 3PR9A 2F21A 2ZQTA 1W1YA 1NH6A 2XPAA 2WK2A 2MNTA 3G6LA 3IHZA 4C02B 1NSGA 3UI4A 4BF8A 2LJ4A 4DRHA 3O5FA 1W1PA 3W4RA 3PA7A 3B9DA 2K8IA 3WD2A 3CGNA 1LG2A 3ARPA 2LPVA 4JYSA 1U79A 5DIVA 4J4OA 1J4IA 1FKFA 2FDMA 4WK9A 1HKIA 3I6CA 2G8ZA 1JNEA 2VCDA 3ARZA 3KZ7A 1W9UA 4P8WA 5HW8A 2KGJA 3IK8A 1A7XA 4DRIA 4DRKA 2MLZA 4Z2JA 2ZR4A 3ALFA 3AROA 2MLYA 1JNTA 1ZB5A 2DG3A 3IKGA 1L1PA 4W5UA 1Q6IA 5HW7A 2XP3A 3KADA 2XP6A 1E9LA 1YW5A 1ROTA 1XHGA 2LKNA 1J6YA 4DZ3A 1D7HA 4DRJA 1ROUA 1E6PA 4S3JA 3KAGA 1NWRA 2DT0A 1W1VA 4NNRA 3UQBA 3O5EA 4IQCA 4G50A 4KQZA 5HWCA 3ARWA 3ARRA 4Z2GA 1OGBA 4ZPTR 4DWSD 4ZS6A 1LL4A 3WH0A 3WKZA 3ODKA 2VN1A 2OFNA 4U85A 4TNSA 1FKRA 2A3AA 1LJYA 3ARQA 3AS1A 4ODLA 3RGCA 4JFJA 1HXVA 1HKJA 1HKMA 3NTPA 1EHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QIB A;  1T11 A;  4ODR A;  2UZ5 A;  1EQ3 A;  2PPN A;  2RQS A;  4J4N A;  1FKB A;  2KO7 A;  4ODQ A;  2Q5A A;  2AWG A;  2KR7 A;  3IKD A;  1Q6H A;  3UI6 A;  5DIT A;  3UQI A;  3O5J A;  4FN2 A;  1F40 A;  2KFW A;  4TW8 A;  1Y0O A;  4O2T A;  2KE0 A;  1PIN A;  1BKF A;  2XP5 A;  4U86 A;  1FKL A;  2L2S A;  4DRM A;  2PPO A;  4JFI A;  1FKH A;  2F21 A;  2ZQT A;  3MDY B;  2XPA A;  1Q6U A;  3TCZ A;  2LGO A;  2MNT A;  1FKS A;  3IHZ A;  4G2P A;  3O5D A;  4C02 B;  1NSG A;  3UI5 A;  3UI4 A;  1M5Y A;  2LJ4 A;  3O5M A;  4LAY A;  4BF8 A;  3O5R A;  1FKT A;  2MF9 A;  4DRH A;  4W9P A;  3O5F A;  4DRO A;  3KAF A;  4TYO A;  1F8A B;  3O5P A;  3PA7 A;  5HKG A;  4DRN A;  5I98 A;  2K8I A;  3O5L A;  3RFW A;  4DZ2 A;  2M1I A;  4W9Q A;  3CGN A;  2ITK A;  2LPV A;  2RSE A;  2MPH A;  2FKE A;  1U79 A;  4JYS A;  5DIV A;  4J4O A;  3KAH A;  1J4I A;  1FKF A;  2M2A A;  1QZ2 A;  2RUR A;  5D75 A;  3GPK A;  4R0X A;  3TDB A;  3I6C A;  3KCE A;  4FAP A;  1J4R A;  1QPF A;  2VCD A;  4TW6 A;  1N1A A;  3KZ7 A;  1P5Q A;  3O5G A;  4W9O A;  4DT4 A;  2KGJ A;  5HW8 A;  1C9H A;  1B6C A;  4ODM A;  2RUD A;  3UF8 A;  4U84 A;  5BXJ A;  1D7I A;  3IK8 A;  1A7X A;  4ODN A;  1D6O A;  4DRI A;  3PRD A;  4DRK A;  1JVW A;  2ZR6 A;  2MLZ A;  5DIU A;  1FKI A;  1NMV A;  1FKG A;  1EYM A;  1ZK6 A;  4ODO A;  5HWB A;  3JYJ A;  1JNS A;  4IPX A;  2ZR4 A;  4LAW A;  4MSP A;  5HT1 A;  2PBC A;  2MLY A;  1JNT A;  1PBK A;  1QPL A;  2DG3 A;  3IKG A;  2IF4 A;  3JXV A;  1L1P A;  1TCO C;  1YAT A;  4TX0 A;  1ZCN A;  4DRP A;  1Q6I A;  2KI3 A;  5HW7 A;  2MLX A;  5HTG A;  5HUA A;  4TW7 A;  2XP3 A;  1FAP A;  2F2D A;  3KAD A;  2XP6 A;  4LAX A;  2XP8 A;  2PV2 A;  2JZV A;  3KAB A;  1W26 A;  1YW5 A;  2XP4 A;  3PRB A;  3VAW A;  2Y78 A;  1ROT A;  2FAP A;  3JYM A;  3NI6 A;  2LKN A;  4QT3 A;  4DZ3 A;  1D7H A;  4QT2 A;  1J6Y A;  2PV3 A;  2ZQV A;  4DRJ A;  1ROU A;  4LAV A;  3KAG A;  1FKK A;  4JFM A;  4NNR A;  3UQB A;  3OOB A;  2XP7 A;  3O5E A;  3O5K A;  4IQC A;  4ODP A;  2D9F A;  4JFL A;  3O5O A;  4G50 A;  2ZR5 A;  4JFK A;  2M08 A;  4ODK A;  5HWC A;  1R9H A;  2RUQ A;  4DIP A;  2DG9 A;  5J6E A;  1Q1C A;  3FAP A;  1D7J A;  1NMW A;  2N87 A;  4ITZ A;  3NRK A;  2DG4 A;  4GGQ A;  4DH0 A;  3KAC A;  1KT1 A;  2ZQU A;  3O5Q A;  3TC5 A;  3CGM A;  3WH0 A;  5B8I C;  3UQA A;  1FKJ A;  3O5I A;  3ODK A;  2VN1 A;  3H9R B;  2F4E A;  2OFN A;  4U85 A;  4TNS A;  2PPP A;  2PV1 A;  3KAI A;  3LUO A;  4IQ2 A;  4DRQ A;  1FJD A;  1FKR A;  5GPG A;  4MGV A;  1FD9 A;  1J4H A;  2XPB A;  4ODL A;  2XP9 A;  4GIV A;  3RGC A;  4JFJ A;  4N19 A;  1HXV A;  2ZQS A;  3EY6 A;  3NTP A;  1FKD A;  1BL4 A;  1KT0 A;  2RUC A;  5HW6 A;  3B7X A; 
#chains in the Genus database with same CATH topology
 1EQ3 A;  3WQW A;  3RME A;  2PPN A;  1FKB A;  2Q5A A;  1E6R A;  3UQI A;  1ZU8 A;  1F40 A;  3PRA A;  4DWS C;  3QOK A;  1E44 A;  3MDY B;  1Q6U A;  4ZPV R;  4S3K A;  4QZV B;  1X6N A;  3O5D A;  1M5Y A;  4LAY A;  3O5M A;  3O5R A;  2MF9 A;  4DRO A;  4MAV A;  1F8A B;  2WLY A;  3ARV A;  5HKG A;  4DRN A;  3O5L A;  1FFQ A;  4PTM A;  4DZ2 A;  2RSE A;  2FKE A;  1NWU A;  2M2A A;  2RUR A;  3TDB A;  1E15 A;  3KCE A;  5DO2 A;  1J4R A;  1GOI A;  3O5G A;  4DT4 A;  1GUV A;  3UF8 A;  1D7I A;  4KR0 B;  2ZR6 A;  5JH8 A;  1NMV A;  1FKG A;  4IPX A;  4Q7N A;  2AOS A;  2WM0 A;  2WLZ A;  3GTY X;  4ZPW R;  2MLX A;  2XP8 A;  2JZV A;  3VAW A;  2Y78 A;  3JYM A;  4QT2 A;  1W9P A;  2QF8 A;  1FKK A;  4LAV A;  5GQB A;  3RM4 A;  3OOB A;  2XP7 A;  5DF0 A;  3O5K A;  4Z2L A;  3O5O A;  1EIB A;  4JFK A;  2M08 A;  4ODK A;  4NZC A;  4DIP A;  1Q1C A;  3WD1 A;  2DSZ A;  2N87 A;  4Z2I A;  1OWQ A;  3CGM A;  3AS0 A;  3UQA A;  1RD6 A;  1FKJ A;  2G41 A;  1OGG A;  2ESC A;  4IQ2 A;  4DRQ A;  4P8U A;  4MGV A;  2XPB A;  2XP9 A;  2ZQS A;  2O92 A;  4P8V A;  3B7X A;  4QIB A;  2IUZ A;  3ARS A;  2A3B A;  2KO7 A;  2AWG A;  1LQ0 A;  2KR7 A;  1LL6 A;  5DIT A;  3O5J A;  3CH9 A;  1ZL1 A;  2DT1 A;  2KE0 A;  3ALG A;  2XP5 A;  4U86 A;  2DPE A;  4DRM A;  3TCZ A;  2LGO A;  3G6M A;  3ARX A;  4G2P A;  1HJW A;  1FKT A;  1WNO A;  3KAF A;  4TYO A;  4MNM A;  5I98 A;  2O9O A;  3RFW A;  3CHD A;  1D2K A;  4DWS A;  4DWS B;  1SYT A;  4URI A;  4L72 B;  1GRJ A;  4R0X A;  1QPF A;  4MTV A;  2DSW A;  1HJX A;  1P5Q A;  1ZBK A;  4IT4 A;  1W1T A;  1C9H A;  1B6C A;  4ODM A;  2RUD A;  4U84 A;  3PRD A;  5DIU A;  4Z2K A;  1FKI A;  1EYM A;  1E6Z A;  3JYJ A;  4LAW A;  5HT1 A;  2PBC A;  4WKA A;  3JXV A;  1TCO C;  1YAT A;  4TX0 A;  1ZCN A;  1ZBC A;  5HTG A;  5HUA A;  2F2D A;  4Z2H A;  1O6I A;  1W26 A;  2XP4 A;  4Q22 A;  3NI6 A;  4LGX A;  4QT3 A;  3CHC A;  1W9V A;  4JFM A;  3BXW A;  3AQU A;  4ODP A;  1IX5 A;  2YBT A;  2ZR5 A;  4XAK A;  1R9H A;  3WD4 A;  2RUQ A;  3CHF A;  2P4V A;  5GPR A;  1NMW A;  4WKF A;  4R5E A;  2DG4 A;  4AY1 A;  3KAC A;  3O5Q A;  3TC5 A;  5B8I C;  3O5I A;  2F4E A;  2PPP A;  2PV1 A;  1X6L A;  3LUO A;  1FJD A;  5GPG A;  2PI6 A;  1NWS A;  3B8S A;  1J4H A;  2DT2 A;  4N19 A;  1BL4 A;  2RUC A;  1H0I A;  4WJX A;  2YBU A;  2ETN A;  1NWT A;  1SR0 A;  1T11 A;  2UZ5 A;  4ODR A;  4NSB A;  1WB0 A;  4ODQ A;  4L3N A;  3CHE A;  1UR8 A;  3IKD A;  1Q6H A;  4MNL A;  1JND A;  3CZ8 A;  4FN2 A;  2KFW A;  4O2T A;  1BKF A;  1FKL A;  2L2S A;  2PPO A;  1FKH A;  3FXY A;  3RM8 A;  1FKS A;  1VF8 A;  3UI5 A;  4W9P A;  3EIP A;  4MNK A;  3O5P A;  1ZBV A;  3AS2 A;  2M1I A;  4W9Q A;  1K9T A;  2ITK A;  1ZBW A;  2MPH A;  3KAH A;  3FY1 A;  4UDM A;  1QZ2 A;  5D75 A;  3GPK A;  4HBE A;  4FAP A;  4TW6 A;  3B9A A;  1N1A A;  1LL7 A;  4HAR A;  1XRV A;  4W9O A;  1WAW A;  5BXJ A;  4ODN A;  1D6O A;  3WL1 A;  3WL0 A;  1JVW A;  2DSU A;  2OLH A;  1ZK6 A;  4ODO A;  5HWB A;  1JNS A;  4MSP A;  1PBK A;  1QPL A;  2IF4 A;  4DRP A;  1FFR A;  2KI3 A;  3WD0 A;  4MNJ A;  2A3E A;  4TW7 A;  1FAP A;  4LAX A;  2PV2 A;  3KAB A;  1ITX A;  3ART A;  5HBF A;  3AS3 A;  3PRB A;  2FAP A;  4MPK A;  1TFV A;  2EUL A;  2PV3 A;  2ZQV A;  3WIJ A;  3ARU A;  1HJV A;  4IT6 A;  3WQV A;  3RM9 A;  1UR9 A;  2D9F A;  2DT3 A;  4JFL A;  3OA5 A;  2A3C A;  2B31 A;  5J6E A;  2DG9 A;  3FAP A;  1D7J A;  4ML4 A;  3ARY A;  4ITZ A;  3NRK A;  4P8X A;  3WD3 A;  4GGQ A;  4DH0 A;  1KT1 A;  4WKH A;  2ZQU A;  4HBO A;  3BMB A;  4WIW A;  3H9R B;  3KAI A;  1GPF A;  1EDQ A;  1FD9 A;  4GIV A;  1H0G A;  1KFW A;  3EY6 A;  1FKD A;  1LG1 A;  1KT0 A;  5HW6 A;  1E6N A;  2RQS A;  4J4N A;  3B9E A;  2F23 A;  3UI6 A;  5DEZ A;  4TW8 A;  2DSV A;  1CTN A;  1Y0O A;  1PIN A;  1HKK A;  4JFI A;  3PR9 A;  2F21 A;  2ZQT A;  1W1Y A;  1NH6 A;  2XPA A;  2WK2 A;  2MNT A;  3G6L A;  3IHZ A;  4C02 B;  1NSG A;  3UI4 A;  4BF8 A;  2LJ4 A;  4DRH A;  3O5F A;  1W1P A;  3W4R A;  3PA7 A;  3B9D A;  2K8I A;  3WD2 A;  3CGN A;  1LG2 A;  3ARP A;  2LPV A;  4JYS A;  1U79 A;  5DIV A;  4J4O A;  1J4I A;  1FKF A;  2FDM A;  4WK9 A;  1HKI A;  3I6C A;  2G8Z A;  1JNE A;  2VCD A;  3ARZ A;  3KZ7 A;  1W9U A;  4P8W A;  5HW8 A;  2KGJ A;  2B5U B;  3IK8 A;  1A7X A;  4DRI A;  4DRK A;  2MLZ A;  4Z2J A;  2ZR4 A;  3ALF A;  3ARO A;  2MLY A;  1JNT A;  1ZB5 A;  2DG3 A;  3IKG A;  1L1P A;  4W5U A;  1Q6I A;  5HW7 A;  2XP3 A;  3KAD A;  2XP6 A;  1E9L A;  2PN0 A;  1YW5 A;  1ROT A;  1XHG A;  2LKN A;  1J6Y A;  4DZ3 A;  1D7H A;  4DRJ A;  1ROU A;  1E6P A;  4S3J A;  3KAG A;  1NWR A;  2DT0 A;  1W1V A;  4NNR A;  3UQB A;  3O5E A;  4IQC A;  1JCH B;  4G50 A;  4KQZ A;  5HWC A;  3ARW A;  3ARR A;  4Z2G A;  1OGB A;  4ZPT R;  4DWS D;  4ZS6 A;  1LL4 A;  3GU0 A;  3WH0 A;  3WKZ A;  3ODK A;  2VN1 A;  2OFN A;  4U85 A;  4TNS A;  1FKR A;  2A3A A;  1LJY A;  3ARQ A;  3AS1 A;  4ODL A;  3RGC A;  4JFJ A;  1HXV A;  1HKJ A;  1HKM A;  3NTP A;  1EHN A; 
#chains in the Genus database with same CATH homology
 1EQ3 A;  3WQW A;  3RME A;  2PPN A;  1FKB A;  2Q5A A;  1E6R A;  3UQI A;  1ZU8 A;  1F40 A;  3PRA A;  4DWS C;  3QOK A;  3MDY B;  1Q6U A;  4ZPV R;  4S3K A;  4QZV B;  1X6N A;  3O5D A;  1M5Y A;  4LAY A;  3O5M A;  3O5R A;  2MF9 A;  4DRO A;  4MAV A;  1F8A B;  2WLY A;  3ARV A;  5HKG A;  4DRN A;  3O5L A;  1FFQ A;  4PTM A;  4DZ2 A;  2RSE A;  2FKE A;  1NWU A;  2M2A A;  2RUR A;  3TDB A;  1E15 A;  3KCE A;  5DO2 A;  1J4R A;  1GOI A;  3O5G A;  4DT4 A;  1GUV A;  3UF8 A;  1D7I A;  4KR0 B;  2ZR6 A;  5JH8 A;  1NMV A;  1FKG A;  4IPX A;  4Q7N A;  2AOS A;  2WM0 A;  2WLZ A;  4ZPW R;  2MLX A;  2XP8 A;  2JZV A;  3VAW A;  2Y78 A;  3JYM A;  4QT2 A;  1W9P A;  2QF8 A;  1FKK A;  4LAV A;  5GQB A;  3RM4 A;  3OOB A;  2XP7 A;  5DF0 A;  3O5K A;  4Z2L A;  3O5O A;  1EIB A;  4JFK A;  2M08 A;  4ODK A;  4NZC A;  4DIP A;  1Q1C A;  3WD1 A;  2DSZ A;  2N87 A;  4Z2I A;  1OWQ A;  3CGM A;  3AS0 A;  3UQA A;  1RD6 A;  1FKJ A;  2G41 A;  1OGG A;  2ESC A;  4IQ2 A;  4DRQ A;  4P8U A;  4MGV A;  2XPB A;  2XP9 A;  2ZQS A;  2O92 A;  4P8V A;  3B7X A;  4QIB A;  2IUZ A;  3ARS A;  2A3B A;  2KO7 A;  2AWG A;  1LQ0 A;  2KR7 A;  1LL6 A;  5DIT A;  3O5J A;  3CH9 A;  1ZL1 A;  2DT1 A;  2KE0 A;  3ALG A;  2XP5 A;  4U86 A;  2DPE A;  4DRM A;  3TCZ A;  2LGO A;  3G6M A;  3ARX A;  4G2P A;  1HJW A;  1FKT A;  1WNO A;  3KAF A;  4TYO A;  4MNM A;  5I98 A;  2O9O A;  3RFW A;  3CHD A;  1D2K A;  4DWS A;  4DWS B;  1SYT A;  4URI A;  4L72 B;  4R0X A;  1QPF A;  4MTV A;  2DSW A;  1HJX A;  1P5Q A;  1ZBK A;  4IT4 A;  1W1T A;  1C9H A;  1B6C A;  4ODM A;  2RUD A;  4U84 A;  3PRD A;  5DIU A;  4Z2K A;  1FKI A;  1EYM A;  1E6Z A;  3JYJ A;  4LAW A;  5HT1 A;  2PBC A;  4WKA A;  3JXV A;  1TCO C;  1YAT A;  4TX0 A;  1ZCN A;  1ZBC A;  5HTG A;  5HUA A;  2F2D A;  4Z2H A;  1O6I A;  1W26 A;  2XP4 A;  4Q22 A;  3NI6 A;  4LGX A;  4QT3 A;  3CHC A;  1W9V A;  4JFM A;  3BXW A;  3AQU A;  4ODP A;  1IX5 A;  2YBT A;  2ZR5 A;  4XAK A;  1R9H A;  3WD4 A;  2RUQ A;  3CHF A;  5GPR A;  1NMW A;  4WKF A;  4R5E A;  2DG4 A;  4AY1 A;  3KAC A;  3O5Q A;  3TC5 A;  5B8I C;  3O5I A;  2F4E A;  2PPP A;  2PV1 A;  1X6L A;  3LUO A;  1FJD A;  5GPG A;  2PI6 A;  1NWS A;  3B8S A;  1J4H A;  2DT2 A;  4N19 A;  1BL4 A;  2RUC A;  1H0I A;  4WJX A;  2YBU A;  1NWT A;  1SR0 A;  1T11 A;  2UZ5 A;  4ODR A;  4NSB A;  1WB0 A;  4ODQ A;  4L3N A;  3CHE A;  1UR8 A;  3IKD A;  1Q6H A;  4MNL A;  1JND A;  3CZ8 A;  4FN2 A;  2KFW A;  4O2T A;  1BKF A;  1FKL A;  2L2S A;  2PPO A;  1FKH A;  3FXY A;  3RM8 A;  1FKS A;  1VF8 A;  3UI5 A;  4W9P A;  4MNK A;  3O5P A;  1ZBV A;  3AS2 A;  2M1I A;  4W9Q A;  1K9T A;  2ITK A;  1ZBW A;  2MPH A;  3KAH A;  3FY1 A;  1QZ2 A;  5D75 A;  3GPK A;  4HBE A;  4FAP A;  4TW6 A;  3B9A A;  1N1A A;  1LL7 A;  4HAR A;  1XRV A;  4W9O A;  1WAW A;  5BXJ A;  4ODN A;  1D6O A;  3WL1 A;  3WL0 A;  1JVW A;  2DSU A;  2OLH A;  1ZK6 A;  4ODO A;  5HWB A;  1JNS A;  4MSP A;  1PBK A;  1QPL A;  2IF4 A;  4DRP A;  1FFR A;  2KI3 A;  3WD0 A;  4MNJ A;  2A3E A;  4TW7 A;  1FAP A;  4LAX A;  2PV2 A;  3KAB A;  1ITX A;  3ART A;  5HBF A;  3AS3 A;  3PRB A;  2FAP A;  4MPK A;  1TFV A;  2PV3 A;  2ZQV A;  3WIJ A;  3ARU A;  1HJV A;  4IT6 A;  3WQV A;  3RM9 A;  1UR9 A;  2D9F A;  2DT3 A;  4JFL A;  3OA5 A;  2A3C A;  2B31 A;  5J6E A;  2DG9 A;  3FAP A;  1D7J A;  4ML4 A;  3ARY A;  4ITZ A;  3NRK A;  4P8X A;  3WD3 A;  4GGQ A;  4DH0 A;  1KT1 A;  4WKH A;  2ZQU A;  4HBO A;  4WIW A;  3H9R B;  3KAI A;  1GPF A;  1EDQ A;  1FD9 A;  4GIV A;  1H0G A;  1KFW A;  3EY6 A;  1FKD A;  1LG1 A;  1KT0 A;  5HW6 A;  1E6N A;  2RQS A;  4J4N A;  3B9E A;  3UI6 A;  5DEZ A;  4TW8 A;  2DSV A;  1CTN A;  1Y0O A;  1PIN A;  1HKK A;  4JFI A;  3PR9 A;  2F21 A;  2ZQT A;  1W1Y A;  1NH6 A;  2XPA A;  2WK2 A;  2MNT A;  3G6L A;  3IHZ A;  4C02 B;  1NSG A;  3UI4 A;  4BF8 A;  2LJ4 A;  4DRH A;  3O5F A;  1W1P A;  3W4R A;  3PA7 A;  3B9D A;  2K8I A;  3WD2 A;  3CGN A;  1LG2 A;  3ARP A;  2LPV A;  4JYS A;  1U79 A;  5DIV A;  4J4O A;  1J4I A;  1FKF A;  2FDM A;  4WK9 A;  1HKI A;  3I6C A;  2G8Z A;  1JNE A;  2VCD A;  3ARZ A;  3KZ7 A;  1W9U A;  4P8W A;  5HW8 A;  2KGJ A;  3IK8 A;  1A7X A;  4DRI A;  4DRK A;  2MLZ A;  4Z2J A;  2ZR4 A;  3ALF A;  3ARO A;  2MLY A;  1JNT A;  1ZB5 A;  2DG3 A;  3IKG A;  1L1P A;  4W5U A;  1Q6I A;  5HW7 A;  2XP3 A;  3KAD A;  2XP6 A;  1E9L A;  1YW5 A;  1ROT A;  1XHG A;  2LKN A;  1J6Y A;  4DZ3 A;  1D7H A;  4DRJ A;  1ROU A;  1E6P A;  4S3J A;  3KAG A;  1NWR A;  2DT0 A;  1W1V A;  4NNR A;  3UQB A;  3O5E A;  4IQC A;  4G50 A;  4KQZ A;  5HWC A;  3ARW A;  3ARR A;  4Z2G A;  1OGB A;  4ZPT R;  4DWS D;  4ZS6 A;  1LL4 A;  3WH0 A;  3WKZ A;  3ODK A;  2VN1 A;  2OFN A;  4U85 A;  4TNS A;  1FKR A;  2A3A A;  1LJY A;  3ARQ A;  3AS1 A;  4ODL A;  3RGC A;  4JFJ A;  1HXV A;  1HKJ A;  1HKM A;  3NTP A;  1EHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...