1D7IA

Fkbp complexed with methyl methylsulfinylmethyl sulfide (dss)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
publication title X-ray structures of small ligand-FKBP complexes provide an estimate for hydrophobic interaction energies.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1d7iA00
4LAXA 1KT1A 2L2SA 1EQ3A 3O5MA 3IKDA 3FAPA 3O5FA 5DITA 4DROA 5HW6A 2RURA 4QIBA 2MF9A 2XPBA 1FKBA 1J4RA 2LPVA 5HWCA 2LKNA 3CGMA 4BF8A 1T11A 3IK8A 4IQ2A 4DZ2A 2M08A 2DG4A 2RUDA 4LAYA 4DH0A 2PV1A 1NMWA 1F8AB 3O5QA 3O5KA 2PPPA 2ZQTA 2RQSA 1FAPA 2ZQSA 1EYMA 4ODQA 5J6EA 4DRHA 1Q1CA 1ZCNA 2XP3A 3JXVA 3O5IA 4JFLA 4ODLA 4DRMA 1BL4A 3UI4A 1FKGA 4JFIA 3IKGA 5DIUA 1FKDA 3O5GA 2XP7A 4IQCA 4U86A 1FD9A 4MSPA 2KR7A 3IHZA 4TW8A 1FKKA 3OOBA 2RUQA 3RGCA 1FKLA 2N87A 2ZQVA 4J4OA 3UQIA 4C02B 4DIPA 1D7IA 2MLZA 3KAIA 2PPOA 4TW6A 1KT0A 2ZR6A 2ZR4A 1PBKA 2F2DA 3TC5A 2KE0A 1NSGA 4JFMA 1FKHA 5HT1A 1YW5A 3CGNA 1FKTA 4JFJA 2DG9A 5HW8A 3UQBA 2K8IA 2KGJA 3H9RB 2VN1A 1JVWA 1ZK6A 3JYJA 4W9PA 5BXJA 5HTGA 2XP5A 3KACA 2LJ4A 2UZ5A 3O5JA 1R9HA 2MLYA 1P5QA 2MLXA 3ODKA 4ITZA 2RUCA 1PINA 1YATA 2XP4A 2XPAA 1QPLA 3EY6A 4QT2A 1BKFA 4DRIA 4ODMA 4JFKA 1FKSA 4TNSA 1N1AA 3NI6A 1FKRA 1Q6IA 3PRDA 2FAPA 5HW7A 2Y78A 3KABA 1W26A 2MNTA 1J4IA 3UI5A 4DRKA 5B8IC 2KO7A 5I98A 4G50A 3KAGA 3KZ7A 2XP9A 1FKJA 4G2PA 1Q6UA 2LGOA 4ODRA 4JYSA 5D75A 1ROTA 3UF8A 2M2AA 1D7JA 2PPNA 4NNRA 4DRQA 4DRJA 2F4EA 2XP6A 1F40A 1J4HA 2MPHA 4DT4A 1D6OA 3TCZA 3O5PA 4J4NA 3I6CA 4ODPA 3RFWA 1ROUA 2IF4A 2ITKA 4MGVA 4TYOA 3VAWA 1NMVA 1FKFA 1QPFA 2PBCA 2D9FA 2PV3A 2F21A 2VCDA 5DIVA 2Q5AA 3O5RA 4N19A 1D7HA 4TW7A 1J6YA 1FJDA 4TX0A 1M5YA 4DRNA 1HXVA 3NTPA 5HWBA 4GGQA 3UI6A 4LAVA 1QZ2A 4GIVA 2AWGA 3PRBA 4R0XA 3UQAA 3O5LA 3JYMA 4U84A 4ODOA 1JNTA 4ODNA 3O5DA 2DG3A 4U85A 2ZR5A 4DZ3A 3KCEA 1B6CA 4LAWA 2ZQUA 4FN2A 3NRKA 3KAHA 1JNSA 3TDBA 4O2TA 2OFNA 3B7XA 1U79A 2KI3A 2FKEA 3PA7A 1L1PA 2RSEA 1TCOC 5HUAA 1C9HA 3KAFA 4ODKA 4DRPA 3GPKA 1Q6HA 4W9OA 5GPGA 2PV2A 3MDYB 2XP8A 1FKIA 3O5EA 3WH0A 4QT3A 1Y0OA 2JZVA 5HKGA 2M1IA 4W9QA 4FAPA 3KADA 1A7XA 2KFWA 3O5OA 3LUOA 4IPXA
chains in the Genus database with same CATH superfamily
4LAXA 2L2SA 3FY1A 4DROA 4QIBA 4P8XA 2LKNA 3CGMA 4BF8A 4WKFA 1T11A 2DG4A 2RUDA 2PV1A 1IX5A 3O5KA 1FFQA 5J6EA 1W9VA 4JFIA 1D2KA 1FD9A 2KR7A 1LG1A 1FKKA 2IUZA 1W1YA 2RUQA 2N87A 4C02B 4DIPA 1KT0A 1PBKA 1HJXA 3TC5A 1YW5A 3ALFA 4JFJA 3WD2A 1W9PA 4QZVB 5HW8A 2K8IA 2VN1A 2DT2A 5BXJA 3KACA 2UZ5A 2O9OA 1P5QA 3WD4A 2MLXA 3ODKA 1WAWA 1HKIA 2XPAA 3W4RA 1BKFA 4JFKA 1FKSA 1N1AA 2B31A 1W26A 4DWSA 4S3KA 4G50A 1H0GA 1FKJA 3AROA 2LGOA 4WKAA 1H0IA 2F4EA 1F40A 1WNOA 3WD1A 4Z2IA 1LL7A 3TCZA 3I6CA 4ODPA 3RM8A 2IF4A 1QPFA 5GQBA 1HJWA 4ZPWR 2PV3A 2VCDA 3ARVA 3O5RA 4TW7A 1FJDA 2B5UB 2DSZA 3AS2A 1EDQA 1QZ2A 2DSUA 1O6IA 1XRVA 3UQAA 1JNTA 1OGGA 3G6LA 3KCEA 2ZQUA 3NRKA 3KAHA 2OFNA 1GPFA 3B7XA 1L1PA 3PA7A 5DEZA 1TCOC 4PTMA 3KAFA 3GPKA 3MDYB 1GOIA 1GUVA 2G41A 3CHCA 2DPEA 3ARUA 4W9QA 1A7XA 5DO2A 2A3BA 1KT1A 3O5MA 4MNJA 3O5FA 4MPKA 2XPBA 1J4RA 4NSBA 1EIBA 3OA5A 2M08A 4IT4A 1ZB5A 3ARXA 2ETNA 1FAPA 1EYMA 4P8UA 3AS3A 3JXVA 4JFLA 3ALGA 4DRMA 1ZU8A 3IKGA 1E9LA 1X6LA 4IQCA 1LL4A 3OOBA 1FKLA 2ZQVA 4J4OA 3UQIA 1ZL1A 3WD0A 3KAIA 2F2DA 3PRAA 5HT1A 4JFMA 2WLYA 3GTYX 2DT0A 2KGJA 1JVWA 3O5JA 5DF0A 3RM9A 4WK9A 2A3EA 4AY1A 2RUCA 4QT2A 1QPLA 1EHNA 1LQ0A 1Q6IA 1JNEA 2ESCA 4DRKA 1J4IA 3UI5A 5B8IC 2XP9A 1JCHB 3B8SA 2OLHA 4ODRA 3WL1A 1LL6A 3ARWA 1ROTA 3PR9A 2PPNA 2DSWA 4NNRA 3EIPA 4DRJA 2EULA 1HKKA 2A3AA 3CHFA 1D6OA 4DWSC 3ARSA 3O5PA 4J4NA 4MGVA 2PBCA 1FKFA 2D9FA 4HARA 1W1PA 2Q5AA 4Z2HA 4Z2KA 4W5UA 3B9AA 2AWGA 3CZ8A 4R0XA 3O5LA 4U84A 3CHEA 4ODNA 2DG3A 4LAWA 1B6CA 4FN2A 4URIA 2KI3A 1TFVA 4ODKA 4DRPA 5GPGA 2PV2A 2XP8A 1NWTA 4QT3A 3LUOA 4LGXA 3IKDA 1OGBA 3ARTA 5HWCA 4KQZA 4L3NA 4IQ2A 3WL0A 4DZ2A 4LAYA 1X6NA 3WD3A 3ARYA 4DWSD 1F8AB 3O5QA 2RQSA 4ODQA 3WQVA 2O92A 4DRHA 1Q1CA 1ZCNA 2XP3A 1JNDA 4NZCA 4HBEA 1FKGA 2DSVA 3O5GA 4U86A 4MSPA 3IHZA 1E44A 4S3JA 1E15A 3RGCA 1D7IA 4L72B 2MLZA 4TW6A 2ZR6A 2DT3A 2ZR4A 4WKHA 1NSGA 2WM0A 2DG9A 3UQBA 1HJVA 5HBFA 3JYJA 4W9PA 1NWUA 3ARRA 2LJ4A 1R9HA 2MLYA 2YBUA 4ITZA 3FXYA 1PINA 2XP4A 4ZPVR 3EY6A 4DRIA 1ZBKA 4ODMA 4TNSA 3NI6A 1FKRA 1UR9A 4IPXA 5HW7A 2Y78A 3KABA 2MNTA 1E6PA 2KO7A 1NWRA 5I98A 3ARPA 3KZ7A 2F23A 2DT1A 4JYSA 3RMEA 1FFRA 3UF8A 4DRQA 4XAKA 3RFWA 1ROUA 2ITKA 3VAWA 4IT6A 4ML4A 2F21A 1J6YA 1M5YA 1HXVA 3BMBA 4MNLA 4LAVA 3QOKA 4GIVA 3PRBA 4DWSB 3ARZA 1K9TA 1ZBWA 4ODOA 3WQWA 4U85A 3B9EA 1E6NA 4DZ3A 3CHDA 4WJXA 5JH8A 3CH9A 3TDBA 1JNSA 1U79A 2FKEA 1C9HA 1Q6HA 1FKIA 3O5EA 3RM4A 3WH0A 1Y0OA 5HKGA 4FAPA 2P4VA 3B9DA 3GU0A 2KFWA 3O5OA 4Q7NA 1EQ3A 3FAPA 5DITA 5HW6A 2RURA 2MF9A 1FKBA 2LPVA 3ARQA 1W1VA 4MAVA 3IK8A 2G8ZA 3AS0A 4DH0A 1NMWA 1SYTA 2PPPA 2ZQTA 2FDMA 2ZQSA 4WIWA 2PI6A 1CTNA 3O5IA 4ODLA 1BL4A 3UI4A 1VF8A 5DIUA 1FKDA 2XP7A 4P8VA 4TW8A 4R5EA 2AOSA 4Z2GA 2PPOA 3BXWA 2PN0A 2KE0A 1FKHA 1LG2A 3CGNA 1FKTA 3H9RB 1ZK6A 5HTGA 2XP5A 4P8WA 2WK2A 1YATA 1W9UA 4UDMA 1ITXA 1ZBVA 1ZBCA 3PRDA 2FAPA 1KFWA 1NH6A 4MNMA 3KAGA 4G2PA 1Q6UA 5D75A 4MTVA 2M2AA 1D7JA 1WB0A 2XP6A 1XHGA 1J4HA 2MPHA 1SR0A 4DT4A 1HKMA 4ZS6A 1RD6A 4Q22A 4TYOA 4MNKA 1NMVA 1OWQA 5DIVA 4N19A 1D7HA 5GPRA 4TX0A 4Z2LA 4DRNA 3NTPA 5HWBA 4GGQA 3UI6A 1E6RA 1W1TA 1LJYA 2QF8A 3G6MA 3JYMA 2YBTA 3O5DA 2ZR5A 1HKJA 3WIJA 4Z2JA 1UR8A 4O2TA 2RSEA 1GRJA 5HUAA 1NWSA 4ZPTR 4W9OA 4KR0B 2WLZA 2JZVA 3AQUA 2M1IA 2A3CA 1E6ZA 3KADA 3WKZA 3AS1A 4HBOA
chains in the Genus database with same CATH topology
4LAXA 2L2SA 3FY1A 4DROA 4QIBA 4P8XA 2LKNA 3CGMA 4BF8A 4WKFA 1T11A 2DG4A 2RUDA 2PV1A 1IX5A 3O5KA 1FFQA 5J6EA 1W9VA 4JFIA 1D2KA 1FD9A 2KR7A 1LG1A 1FKKA 2IUZA 1W1YA 2RUQA 2N87A 4C02B 4DIPA 1KT0A 1PBKA 1HJXA 3TC5A 1YW5A 3ALFA 4JFJA 3WD2A 1W9PA 4QZVB 5HW8A 2K8IA 2VN1A 2DT2A 5BXJA 3KACA 2UZ5A 2O9OA 1P5QA 3WD4A 2MLXA 3ODKA 1WAWA 1HKIA 2XPAA 3W4RA 1BKFA 4JFKA 1FKSA 1N1AA 2B31A 1W26A 4DWSA 4S3KA 4G50A 1H0GA 1FKJA 3AROA 2LGOA 4WKAA 1H0IA 2F4EA 1F40A 1WNOA 3WD1A 4Z2IA 1LL7A 3TCZA 3I6CA 4ODPA 3RM8A 2IF4A 1QPFA 5GQBA 1HJWA 4ZPWR 2PV3A 2VCDA 3ARVA 3O5RA 4TW7A 1FJDA 2DSZA 3AS2A 1EDQA 1QZ2A 2DSUA 1O6IA 1XRVA 3UQAA 1JNTA 1OGGA 3G6LA 3KCEA 2ZQUA 3NRKA 3KAHA 2OFNA 1GPFA 3B7XA 1L1PA 3PA7A 5DEZA 1TCOC 4PTMA 3KAFA 3GPKA 3MDYB 1GOIA 1GUVA 2G41A 3CHCA 2DPEA 3ARUA 4W9QA 1A7XA 5DO2A 2A3BA 1KT1A 3O5MA 4MNJA 3O5FA 4MPKA 2XPBA 1J4RA 4NSBA 1EIBA 3OA5A 2M08A 4IT4A 1ZB5A 3ARXA 1FAPA 1EYMA 4P8UA 3AS3A 3JXVA 4JFLA 3ALGA 4DRMA 1ZU8A 3IKGA 1E9LA 1X6LA 4IQCA 1LL4A 3OOBA 1FKLA 2ZQVA 4J4OA 3UQIA 1ZL1A 3WD0A 3KAIA 2F2DA 3PRAA 5HT1A 4JFMA 2WLYA 2DT0A 2KGJA 1JVWA 3O5JA 5DF0A 3RM9A 4WK9A 2A3EA 4AY1A 2RUCA 4QT2A 1QPLA 1EHNA 1LQ0A 1Q6IA 1JNEA 2ESCA 4DRKA 1J4IA 3UI5A 5B8IC 2XP9A 3B8SA 2OLHA 4ODRA 3WL1A 1LL6A 3ARWA 1ROTA 3PR9A 2PPNA 2DSWA 4NNRA 4DRJA 1HKKA 2A3AA 3CHFA 1D6OA 4DWSC 3ARSA 3O5PA 4J4NA 4MGVA 2PBCA 1FKFA 2D9FA 4HARA 1W1PA 2Q5AA 4Z2HA 4Z2KA 4W5UA 3B9AA 2AWGA 3CZ8A 4R0XA 3O5LA 4U84A 3CHEA 4ODNA 2DG3A 4LAWA 1B6CA 4FN2A 4URIA 2KI3A 1TFVA 4ODKA 4DRPA 5GPGA 2PV2A 2XP8A 1NWTA 4QT3A 3LUOA 4LGXA 3IKDA 1OGBA 3ARTA 5HWCA 4KQZA 4L3NA 4IQ2A 3WL0A 4DZ2A 4LAYA 1X6NA 3WD3A 3ARYA 4DWSD 1F8AB 3O5QA 2RQSA 4ODQA 3WQVA 2O92A 4DRHA 1Q1CA 1ZCNA 2XP3A 1JNDA 4NZCA 4HBEA 1FKGA 2DSVA 3O5GA 4U86A 4MSPA 3IHZA 4S3JA 1E15A 3RGCA 1D7IA 4L72B 2MLZA 4TW6A 2ZR6A 2DT3A 2ZR4A 4WKHA 1NSGA 2WM0A 2DG9A 3UQBA 1HJVA 5HBFA 3JYJA 4W9PA 1NWUA 3ARRA 2LJ4A 1R9HA 2MLYA 2YBUA 4ITZA 3FXYA 1PINA 2XP4A 4ZPVR 3EY6A 4DRIA 1ZBKA 4ODMA 4TNSA 3NI6A 1FKRA 1UR9A 4IPXA 5HW7A 2Y78A 3KABA 2MNTA 1E6PA 2KO7A 1NWRA 5I98A 3ARPA 3KZ7A 2DT1A 4JYSA 3RMEA 1FFRA 3UF8A 4DRQA 4XAKA 3RFWA 1ROUA 2ITKA 3VAWA 4IT6A 4ML4A 2F21A 1J6YA 1M5YA 1HXVA 4MNLA 4LAVA 3QOKA 4GIVA 3PRBA 4DWSB 3ARZA 1K9TA 1ZBWA 4ODOA 3WQWA 4U85A 3B9EA 1E6NA 4DZ3A 3CHDA 4WJXA 5JH8A 3CH9A 3TDBA 1JNSA 1U79A 2FKEA 1C9HA 1Q6HA 1FKIA 3O5EA 3RM4A 3WH0A 1Y0OA 5HKGA 4FAPA 3B9DA 2KFWA 3O5OA 4Q7NA 1EQ3A 3FAPA 5DITA 5HW6A 2RURA 2MF9A 1FKBA 2LPVA 3ARQA 1W1VA 4MAVA 3IK8A 2G8ZA 3AS0A 4DH0A 1NMWA 1SYTA 2PPPA 2ZQTA 2FDMA 2ZQSA 4WIWA 2PI6A 1CTNA 3O5IA 4ODLA 1BL4A 3UI4A 1VF8A 5DIUA 1FKDA 2XP7A 4P8VA 4TW8A 4R5EA 2AOSA 4Z2GA 2PPOA 3BXWA 2KE0A 1FKHA 1LG2A 3CGNA 1FKTA 3H9RB 1ZK6A 5HTGA 2XP5A 4P8WA 2WK2A 1YATA 1W9UA 1ITXA 1ZBVA 1ZBCA 3PRDA 2FAPA 1KFWA 1NH6A 4MNMA 3KAGA 4G2PA 1Q6UA 5D75A 4MTVA 2M2AA 1D7JA 1WB0A 2XP6A 1XHGA 1J4HA 2MPHA 1SR0A 4DT4A 1HKMA 4ZS6A 1RD6A 4Q22A 4TYOA 4MNKA 1NMVA 1OWQA 5DIVA 4N19A 1D7HA 5GPRA 4TX0A 4Z2LA 4DRNA 3NTPA 5HWBA 4GGQA 3UI6A 1E6RA 1W1TA 1LJYA 2QF8A 3G6MA 3JYMA 2YBTA 3O5DA 2ZR5A 1HKJA 3WIJA 4Z2JA 1UR8A 4O2TA 2RSEA 5HUAA 1NWSA 4ZPTR 4W9OA 4KR0B 2WLZA 2JZVA 3AQUA 2M1IA 2A3CA 1E6ZA 3KADA 3WKZA 3AS1A 4HBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAX A;  1KT1 A;  2L2S A;  1EQ3 A;  3O5M A;  3IKD A;  3FAP A;  3O5F A;  5DIT A;  4DRO A;  5HW6 A;  2RUR A;  4QIB A;  2MF9 A;  2XPB A;  1FKB A;  1J4R A;  2LPV A;  5HWC A;  2LKN A;  3CGM A;  4BF8 A;  1T11 A;  3IK8 A;  4IQ2 A;  4DZ2 A;  2M08 A;  2DG4 A;  2RUD A;  4LAY A;  4DH0 A;  2PV1 A;  1NMW A;  1F8A B;  3O5Q A;  3O5K A;  2PPP A;  2ZQT A;  2RQS A;  1FAP A;  2ZQS A;  1EYM A;  4ODQ A;  5J6E A;  4DRH A;  1Q1C A;  1ZCN A;  2XP3 A;  3JXV A;  3O5I A;  4JFL A;  4ODL A;  4DRM A;  1BL4 A;  3UI4 A;  1FKG A;  4JFI A;  3IKG A;  5DIU A;  1FKD A;  3O5G A;  2XP7 A;  4IQC A;  4U86 A;  1FD9 A;  4MSP A;  2KR7 A;  3IHZ A;  4TW8 A;  1FKK A;  3OOB A;  2RUQ A;  3RGC A;  1FKL A;  2N87 A;  2ZQV A;  4J4O A;  3UQI A;  4C02 B;  4DIP A;  1D7I A;  2MLZ A;  3KAI A;  2PPO A;  4TW6 A;  1KT0 A;  2ZR6 A;  2ZR4 A;  1PBK A;  2F2D A;  3TC5 A;  2KE0 A;  1NSG A;  4JFM A;  1FKH A;  5HT1 A;  1YW5 A;  3CGN A;  1FKT A;  4JFJ A;  2DG9 A;  5HW8 A;  3UQB A;  2K8I A;  2KGJ A;  3H9R B;  2VN1 A;  1JVW A;  1ZK6 A;  3JYJ A;  4W9P A;  5BXJ A;  5HTG A;  2XP5 A;  3KAC A;  2LJ4 A;  2UZ5 A;  3O5J A;  1R9H A;  2MLY A;  1P5Q A;  2MLX A;  3ODK A;  4ITZ A;  2RUC A;  1PIN A;  1YAT A;  2XP4 A;  2XPA A;  1QPL A;  3EY6 A;  4QT2 A;  1BKF A;  4DRI A;  4ODM A;  4JFK A;  1FKS A;  4TNS A;  1N1A A;  3NI6 A;  1FKR A;  1Q6I A;  3PRD A;  2FAP A;  5HW7 A;  2Y78 A;  3KAB A;  1W26 A;  2MNT A;  1J4I A;  3UI5 A;  4DRK A;  5B8I C;  2KO7 A;  5I98 A;  4G50 A;  3KAG A;  3KZ7 A;  2XP9 A;  1FKJ A;  4G2P A;  1Q6U A;  2LGO A;  4ODR A;  4JYS A;  5D75 A;  1ROT A;  3UF8 A;  2M2A A;  1D7J A;  2PPN A;  4NNR A;  4DRQ A;  4DRJ A;  2F4E A;  2XP6 A;  1F40 A;  1J4H A;  2MPH A;  4DT4 A;  1D6O A;  3TCZ A;  3O5P A;  4J4N A;  3I6C A;  4ODP A;  3RFW A;  1ROU A;  2IF4 A;  2ITK A;  4MGV A;  4TYO A;  3VAW A;  1NMV A;  1FKF A;  1QPF A;  2PBC A;  2D9F A;  2PV3 A;  2F21 A;  2VCD A;  5DIV A;  2Q5A A;  3O5R A;  4N19 A;  1D7H A;  4TW7 A;  1J6Y A;  1FJD A;  4TX0 A;  1M5Y A;  4DRN A;  1HXV A;  3NTP A;  5HWB A;  4GGQ A;  3UI6 A;  4LAV A;  1QZ2 A;  4GIV A;  2AWG A;  3PRB A;  4R0X A;  3UQA A;  3O5L A;  3JYM A;  4U84 A;  4ODO A;  1JNT A;  4ODN A;  3O5D A;  2DG3 A;  4U85 A;  2ZR5 A;  4DZ3 A;  3KCE A;  1B6C A;  4LAW A;  2ZQU A;  4FN2 A;  3NRK A;  3KAH A;  1JNS A;  3TDB A;  4O2T A;  2OFN A;  3B7X A;  1U79 A;  2KI3 A;  2FKE A;  3PA7 A;  1L1P A;  2RSE A;  1TCO C;  5HUA A;  1C9H A;  3KAF A;  4ODK A;  4DRP A;  3GPK A;  1Q6H A;  4W9O A;  5GPG A;  2PV2 A;  3MDY B;  2XP8 A;  1FKI A;  3O5E A;  3WH0 A;  4QT3 A;  1Y0O A;  2JZV A;  5HKG A;  2M1I A;  4W9Q A;  4FAP A;  3KAD A;  1A7X A;  2KFW A;  3O5O A;  3LUO A;  4IPX A; 
#chains in the Genus database with same CATH topology
 4LAX A;  2L2S A;  3FY1 A;  4DRO A;  4QIB A;  4P8X A;  2LKN A;  3CGM A;  4BF8 A;  4WKF A;  1T11 A;  2DG4 A;  2RUD A;  2PV1 A;  1IX5 A;  3O5K A;  1FFQ A;  5J6E A;  1W9V A;  4JFI A;  1D2K A;  1FD9 A;  2KR7 A;  1LG1 A;  1FKK A;  2IUZ A;  1W1Y A;  2RUQ A;  2N87 A;  4C02 B;  4DIP A;  1KT0 A;  1PBK A;  1HJX A;  3TC5 A;  1YW5 A;  3ALF A;  4JFJ A;  3WD2 A;  1W9P A;  4QZV B;  5HW8 A;  2K8I A;  2VN1 A;  2DT2 A;  5BXJ A;  3KAC A;  2UZ5 A;  2O9O A;  1P5Q A;  3WD4 A;  2MLX A;  3ODK A;  1WAW A;  1HKI A;  2XPA A;  3W4R A;  1BKF A;  4JFK A;  1FKS A;  1N1A A;  2B31 A;  1W26 A;  4DWS A;  4S3K A;  4G50 A;  1H0G A;  1FKJ A;  3ARO A;  2LGO A;  4WKA A;  1H0I A;  2F4E A;  1F40 A;  1WNO A;  3WD1 A;  4Z2I A;  1LL7 A;  3TCZ A;  3I6C A;  4ODP A;  3RM8 A;  2IF4 A;  1QPF A;  5GQB A;  1HJW A;  4ZPW R;  2PV3 A;  2VCD A;  3ARV A;  3O5R A;  4TW7 A;  1FJD A;  2B5U B;  2DSZ A;  3AS2 A;  1EDQ A;  1QZ2 A;  2DSU A;  1O6I A;  1XRV A;  3UQA A;  1JNT A;  1OGG A;  3G6L A;  3KCE A;  2ZQU A;  3NRK A;  3KAH A;  2OFN A;  1GPF A;  3B7X A;  1L1P A;  3PA7 A;  5DEZ A;  1TCO C;  4PTM A;  3KAF A;  3GPK A;  3MDY B;  1GOI A;  1GUV A;  2G41 A;  3CHC A;  2DPE A;  3ARU A;  4W9Q A;  1A7X A;  5DO2 A;  2A3B A;  1KT1 A;  3O5M A;  4MNJ A;  3O5F A;  4MPK A;  2XPB A;  1J4R A;  4NSB A;  1EIB A;  3OA5 A;  2M08 A;  4IT4 A;  1ZB5 A;  3ARX A;  2ETN A;  1FAP A;  1EYM A;  4P8U A;  3AS3 A;  3JXV A;  4JFL A;  3ALG A;  4DRM A;  1ZU8 A;  3IKG A;  1E9L A;  1X6L A;  4IQC A;  1LL4 A;  3OOB A;  1FKL A;  2ZQV A;  4J4O A;  3UQI A;  1ZL1 A;  3WD0 A;  3KAI A;  2F2D A;  3PRA A;  5HT1 A;  4JFM A;  2WLY A;  3GTY X;  2DT0 A;  2KGJ A;  1JVW A;  3O5J A;  5DF0 A;  3RM9 A;  4WK9 A;  2A3E A;  4AY1 A;  2RUC A;  4QT2 A;  1QPL A;  1EHN A;  1LQ0 A;  1Q6I A;  1JNE A;  2ESC A;  4DRK A;  1J4I A;  3UI5 A;  5B8I C;  2XP9 A;  1JCH B;  3B8S A;  2OLH A;  4ODR A;  3WL1 A;  1LL6 A;  3ARW A;  1ROT A;  3PR9 A;  2PPN A;  2DSW A;  4NNR A;  3EIP A;  4DRJ A;  2EUL A;  1HKK A;  2A3A A;  3CHF A;  1D6O A;  4DWS C;  3ARS A;  3O5P A;  4J4N A;  4MGV A;  2PBC A;  1FKF A;  2D9F A;  4HAR A;  1W1P A;  2Q5A A;  4Z2H A;  4Z2K A;  4W5U A;  3B9A A;  2AWG A;  3CZ8 A;  4R0X A;  3O5L A;  4U84 A;  3CHE A;  4ODN A;  2DG3 A;  4LAW A;  1B6C A;  4FN2 A;  4URI A;  2KI3 A;  1TFV A;  4ODK A;  4DRP A;  5GPG A;  2PV2 A;  2XP8 A;  1NWT A;  4QT3 A;  3LUO A;  4LGX A;  3IKD A;  1OGB A;  3ART A;  5HWC A;  4KQZ A;  4L3N A;  4IQ2 A;  3WL0 A;  4DZ2 A;  4LAY A;  1X6N A;  3WD3 A;  3ARY A;  4DWS D;  1F8A B;  3O5Q A;  2RQS A;  4ODQ A;  3WQV A;  2O92 A;  4DRH A;  1Q1C A;  1ZCN A;  2XP3 A;  1JND A;  4NZC A;  4HBE A;  1FKG A;  2DSV A;  3O5G A;  4U86 A;  4MSP A;  3IHZ A;  1E44 A;  4S3J A;  1E15 A;  3RGC A;  1D7I A;  4L72 B;  2MLZ A;  4TW6 A;  2ZR6 A;  2DT3 A;  2ZR4 A;  4WKH A;  1NSG A;  2WM0 A;  2DG9 A;  3UQB A;  1HJV A;  5HBF A;  3JYJ A;  4W9P A;  1NWU A;  3ARR A;  2LJ4 A;  1R9H A;  2MLY A;  2YBU A;  4ITZ A;  3FXY A;  1PIN A;  2XP4 A;  4ZPV R;  3EY6 A;  4DRI A;  1ZBK A;  4ODM A;  4TNS A;  3NI6 A;  1FKR A;  1UR9 A;  4IPX A;  5HW7 A;  2Y78 A;  3KAB A;  2MNT A;  1E6P A;  2KO7 A;  1NWR A;  5I98 A;  3ARP A;  3KZ7 A;  2F23 A;  2DT1 A;  4JYS A;  3RME A;  1FFR A;  3UF8 A;  4DRQ A;  4XAK A;  3RFW A;  1ROU A;  2ITK A;  3VAW A;  4IT6 A;  4ML4 A;  2F21 A;  1J6Y A;  1M5Y A;  1HXV A;  3BMB A;  4MNL A;  4LAV A;  3QOK A;  4GIV A;  3PRB A;  4DWS B;  3ARZ A;  1K9T A;  1ZBW A;  4ODO A;  3WQW A;  4U85 A;  3B9E A;  1E6N A;  4DZ3 A;  3CHD A;  4WJX A;  5JH8 A;  3CH9 A;  3TDB A;  1JNS A;  1U79 A;  2FKE A;  1C9H A;  1Q6H A;  1FKI A;  3O5E A;  3RM4 A;  3WH0 A;  1Y0O A;  5HKG A;  4FAP A;  2P4V A;  3B9D A;  3GU0 A;  2KFW A;  3O5O A;  4Q7N A;  1EQ3 A;  3FAP A;  5DIT A;  5HW6 A;  2RUR A;  2MF9 A;  1FKB A;  2LPV A;  3ARQ A;  1W1V A;  4MAV A;  3IK8 A;  2G8Z A;  3AS0 A;  4DH0 A;  1NMW A;  1SYT A;  2PPP A;  2ZQT A;  2FDM A;  2ZQS A;  4WIW A;  2PI6 A;  1CTN A;  3O5I A;  4ODL A;  1BL4 A;  3UI4 A;  1VF8 A;  5DIU A;  1FKD A;  2XP7 A;  4P8V A;  4TW8 A;  4R5E A;  2AOS A;  4Z2G A;  2PPO A;  3BXW A;  2PN0 A;  2KE0 A;  1FKH A;  1LG2 A;  3CGN A;  1FKT A;  3H9R B;  1ZK6 A;  5HTG A;  2XP5 A;  4P8W A;  2WK2 A;  1YAT A;  1W9U A;  4UDM A;  1ITX A;  1ZBV A;  1ZBC A;  3PRD A;  2FAP A;  1KFW A;  1NH6 A;  4MNM A;  3KAG A;  4G2P A;  1Q6U A;  5D75 A;  4MTV A;  2M2A A;  1D7J A;  1WB0 A;  2XP6 A;  1XHG A;  1J4H A;  2MPH A;  1SR0 A;  4DT4 A;  1HKM A;  4ZS6 A;  1RD6 A;  4Q22 A;  4TYO A;  4MNK A;  1NMV A;  1OWQ A;  5DIV A;  4N19 A;  1D7H A;  5GPR A;  4TX0 A;  4Z2L A;  4DRN A;  3NTP A;  5HWB A;  4GGQ A;  3UI6 A;  1E6R A;  1W1T A;  1LJY A;  2QF8 A;  3G6M A;  3JYM A;  2YBT A;  3O5D A;  2ZR5 A;  1HKJ A;  3WIJ A;  4Z2J A;  1UR8 A;  4O2T A;  2RSE A;  1GRJ A;  5HUA A;  1NWS A;  4ZPT R;  4W9O A;  4KR0 B;  2WLZ A;  2JZV A;  3AQU A;  2M1I A;  2A3C A;  1E6Z A;  3KAD A;  3WKZ A;  3AS1 A;  4HBO A; 
#chains in the Genus database with same CATH homology
 4LAX A;  2L2S A;  3FY1 A;  4DRO A;  4QIB A;  4P8X A;  2LKN A;  3CGM A;  4BF8 A;  4WKF A;  1T11 A;  2DG4 A;  2RUD A;  2PV1 A;  1IX5 A;  3O5K A;  1FFQ A;  5J6E A;  1W9V A;  4JFI A;  1D2K A;  1FD9 A;  2KR7 A;  1LG1 A;  1FKK A;  2IUZ A;  1W1Y A;  2RUQ A;  2N87 A;  4C02 B;  4DIP A;  1KT0 A;  1PBK A;  1HJX A;  3TC5 A;  1YW5 A;  3ALF A;  4JFJ A;  3WD2 A;  1W9P A;  4QZV B;  5HW8 A;  2K8I A;  2VN1 A;  2DT2 A;  5BXJ A;  3KAC A;  2UZ5 A;  2O9O A;  1P5Q A;  3WD4 A;  2MLX A;  3ODK A;  1WAW A;  1HKI A;  2XPA A;  3W4R A;  1BKF A;  4JFK A;  1FKS A;  1N1A A;  2B31 A;  1W26 A;  4DWS A;  4S3K A;  4G50 A;  1H0G A;  1FKJ A;  3ARO A;  2LGO A;  4WKA A;  1H0I A;  2F4E A;  1F40 A;  1WNO A;  3WD1 A;  4Z2I A;  1LL7 A;  3TCZ A;  3I6C A;  4ODP A;  3RM8 A;  2IF4 A;  1QPF A;  5GQB A;  1HJW A;  4ZPW R;  2PV3 A;  2VCD A;  3ARV A;  3O5R A;  4TW7 A;  1FJD A;  2DSZ A;  3AS2 A;  1EDQ A;  1QZ2 A;  2DSU A;  1O6I A;  1XRV A;  3UQA A;  1JNT A;  1OGG A;  3G6L A;  3KCE A;  2ZQU A;  3NRK A;  3KAH A;  2OFN A;  1GPF A;  3B7X A;  1L1P A;  3PA7 A;  5DEZ A;  1TCO C;  4PTM A;  3KAF A;  3GPK A;  3MDY B;  1GOI A;  1GUV A;  2G41 A;  3CHC A;  2DPE A;  3ARU A;  4W9Q A;  1A7X A;  5DO2 A;  2A3B A;  1KT1 A;  3O5M A;  4MNJ A;  3O5F A;  4MPK A;  2XPB A;  1J4R A;  4NSB A;  1EIB A;  3OA5 A;  2M08 A;  4IT4 A;  1ZB5 A;  3ARX A;  1FAP A;  1EYM A;  4P8U A;  3AS3 A;  3JXV A;  4JFL A;  3ALG A;  4DRM A;  1ZU8 A;  3IKG A;  1E9L A;  1X6L A;  4IQC A;  1LL4 A;  3OOB A;  1FKL A;  2ZQV A;  4J4O A;  3UQI A;  1ZL1 A;  3WD0 A;  3KAI A;  2F2D A;  3PRA A;  5HT1 A;  4JFM A;  2WLY A;  2DT0 A;  2KGJ A;  1JVW A;  3O5J A;  5DF0 A;  3RM9 A;  4WK9 A;  2A3E A;  4AY1 A;  2RUC A;  4QT2 A;  1QPL A;  1EHN A;  1LQ0 A;  1Q6I A;  1JNE A;  2ESC A;  4DRK A;  1J4I A;  3UI5 A;  5B8I C;  2XP9 A;  3B8S A;  2OLH A;  4ODR A;  3WL1 A;  1LL6 A;  3ARW A;  1ROT A;  3PR9 A;  2PPN A;  2DSW A;  4NNR A;  4DRJ A;  1HKK A;  2A3A A;  3CHF A;  1D6O A;  4DWS C;  3ARS A;  3O5P A;  4J4N A;  4MGV A;  2PBC A;  1FKF A;  2D9F A;  4HAR A;  1W1P A;  2Q5A A;  4Z2H A;  4Z2K A;  4W5U A;  3B9A A;  2AWG A;  3CZ8 A;  4R0X A;  3O5L A;  4U84 A;  3CHE A;  4ODN A;  2DG3 A;  4LAW A;  1B6C A;  4FN2 A;  4URI A;  2KI3 A;  1TFV A;  4ODK A;  4DRP A;  5GPG A;  2PV2 A;  2XP8 A;  1NWT A;  4QT3 A;  3LUO A;  4LGX A;  3IKD A;  1OGB A;  3ART A;  5HWC A;  4KQZ A;  4L3N A;  4IQ2 A;  3WL0 A;  4DZ2 A;  4LAY A;  1X6N A;  3WD3 A;  3ARY A;  4DWS D;  1F8A B;  3O5Q A;  2RQS A;  4ODQ A;  3WQV A;  2O92 A;  4DRH A;  1Q1C A;  1ZCN A;  2XP3 A;  1JND A;  4NZC A;  4HBE A;  1FKG A;  2DSV A;  3O5G A;  4U86 A;  4MSP A;  3IHZ A;  4S3J A;  1E15 A;  3RGC A;  1D7I A;  4L72 B;  2MLZ A;  4TW6 A;  2ZR6 A;  2DT3 A;  2ZR4 A;  4WKH A;  1NSG A;  2WM0 A;  2DG9 A;  3UQB A;  1HJV A;  5HBF A;  3JYJ A;  4W9P A;  1NWU A;  3ARR A;  2LJ4 A;  1R9H A;  2MLY A;  2YBU A;  4ITZ A;  3FXY A;  1PIN A;  2XP4 A;  4ZPV R;  3EY6 A;  4DRI A;  1ZBK A;  4ODM A;  4TNS A;  3NI6 A;  1FKR A;  1UR9 A;  4IPX A;  5HW7 A;  2Y78 A;  3KAB A;  2MNT A;  1E6P A;  2KO7 A;  1NWR A;  5I98 A;  3ARP A;  3KZ7 A;  2DT1 A;  4JYS A;  3RME A;  1FFR A;  3UF8 A;  4DRQ A;  4XAK A;  3RFW A;  1ROU A;  2ITK A;  3VAW A;  4IT6 A;  4ML4 A;  2F21 A;  1J6Y A;  1M5Y A;  1HXV A;  4MNL A;  4LAV A;  3QOK A;  4GIV A;  3PRB A;  4DWS B;  3ARZ A;  1K9T A;  1ZBW A;  4ODO A;  3WQW A;  4U85 A;  3B9E A;  1E6N A;  4DZ3 A;  3CHD A;  4WJX A;  5JH8 A;  3CH9 A;  3TDB A;  1JNS A;  1U79 A;  2FKE A;  1C9H A;  1Q6H A;  1FKI A;  3O5E A;  3RM4 A;  3WH0 A;  1Y0O A;  5HKG A;  4FAP A;  3B9D A;  2KFW A;  3O5O A;  4Q7N A;  1EQ3 A;  3FAP A;  5DIT A;  5HW6 A;  2RUR A;  2MF9 A;  1FKB A;  2LPV A;  3ARQ A;  1W1V A;  4MAV A;  3IK8 A;  2G8Z A;  3AS0 A;  4DH0 A;  1NMW A;  1SYT A;  2PPP A;  2ZQT A;  2FDM A;  2ZQS A;  4WIW A;  2PI6 A;  1CTN A;  3O5I A;  4ODL A;  1BL4 A;  3UI4 A;  1VF8 A;  5DIU A;  1FKD A;  2XP7 A;  4P8V A;  4TW8 A;  4R5E A;  2AOS A;  4Z2G A;  2PPO A;  3BXW A;  2KE0 A;  1FKH A;  1LG2 A;  3CGN A;  1FKT A;  3H9R B;  1ZK6 A;  5HTG A;  2XP5 A;  4P8W A;  2WK2 A;  1YAT A;  1W9U A;  1ITX A;  1ZBV A;  1ZBC A;  3PRD A;  2FAP A;  1KFW A;  1NH6 A;  4MNM A;  3KAG A;  4G2P A;  1Q6U A;  5D75 A;  4MTV A;  2M2A A;  1D7J A;  1WB0 A;  2XP6 A;  1XHG A;  1J4H A;  2MPH A;  1SR0 A;  4DT4 A;  1HKM A;  4ZS6 A;  1RD6 A;  4Q22 A;  4TYO A;  4MNK A;  1NMV A;  1OWQ A;  5DIV A;  4N19 A;  1D7H A;  5GPR A;  4TX0 A;  4Z2L A;  4DRN A;  3NTP A;  5HWB A;  4GGQ A;  3UI6 A;  1E6R A;  1W1T A;  1LJY A;  2QF8 A;  3G6M A;  3JYM A;  2YBT A;  3O5D A;  2ZR5 A;  1HKJ A;  3WIJ A;  4Z2J A;  1UR8 A;  4O2T A;  2RSE A;  5HUA A;  1NWS A;  4ZPT R;  4W9O A;  4KR0 B;  2WLZ A;  2JZV A;  3AQU A;  2M1I A;  2A3C A;  1E6Z A;  3KAD A;  3WKZ A;  3AS1 A;  4HBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...