2KE0A

Solution structure of peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
117
structure length
117
Chain Sequence
GPGSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a Burkholderia pseudomallei immunophilin-inhibitor complex reveals new approaches to antimicrobial development.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase
total genus 16
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ke0A00
1FKJA 1F8AB 3PRBA 2RUCA 4TW7A 4ODLA 1KT1A 3IHZA 3KAGA 4JFKA 1JNTA 1FKGA 5HW6A 1FKIA 2AWGA 1D6OA 4DZ2A 2M1IA 2MNTA 2RQSA 3IK8A 2LJ4A 3UQBA 1ROUA 2MPHA 1F40A 4GIVA 2JZVA 2VCDA 2XPBA 4DRJA 5GPGA 3O5JA 2RSEA 3O5QA 2KO7A 4BF8A 1D7HA 1FAPA 2IF4A 3UQAA 1D7IA 1A7XA 4ITZA 3RGCA 1PINA 1Y0OA 2ZQTA 5DIVA 2OFNA 5HTGA 1QZ2A 2N87A 1D7JA 3KAIA 2KE0A 3NI6A 2XP7A 5D75A 5DIUA 1Q6UA 1R9HA 2M08A 1QPLA 2L2SA 5HT1A 2RURA 3EY6A 3FAPA 1KT0A 2ZR5A 1NMVA 1FKLA 1BKFA 1FJDA 1FKRA 2VN1A 3IKGA 3ODKA 4QIBA 2ZR4A 1BL4A 1FKFA 4G2PA 3UI5A 4ODQA 2F4EA 1YATA 1J4HA 4MSPA 2ZQUA 4W9QA 4ODRA 4FN2A 2F21A 2ZQVA 3KAFA 3UF8A 4GGQA 3RFWA 5HWCA 2KI3A 4U85A 4JFJA 2Q5AA 1PBKA 5HKGA 2ZR6A 1U79A 3KAHA 2XP9A 4DRPA 2XP6A 3O5KA 4JFMA 1FKHA 1FKTA 3UQIA 2KGJA 3OOBA 4ODOA 1J6YA 1HXVA 4U86A 4JYSA 4W9OA 1C9HA 4TX0A 1FKDA 2PPNA 1EQ3A 2PPOA 1T11A 4TW8A 1L1PA 2LPVA 3PA7A 2D9FA 3KZ7A 3H9RB 3IKDA 2MF9A 3I6CA 2RUDA 3O5OA 4DRMA 3O5PA 4C02B 1QPFA 1Q6IA 4NNRA 4DRKA 1YW5A 4IQCA 2LGOA 4IQ2A 1W26A 4U84A 2F2DA 1FKBA 2DG3A 3O5MA 1NSGA 4IPXA 3WH0A 4J4OA 4DZ3A 1FKKA 4JFIA 1M5YA 2XP3A 5HWBA 1J4RA 1NMWA 1P5QA 4FAPA 4DRQA 1B6CA 1Q6HA 1EYMA 2MLZA 4DRHA 1TCOC 2MLYA 4J4NA 3GPKA 2KFWA 4QT2A 3B7XA 3TDBA 3JYMA 4DIPA 1FKSA 1ROTA 2FAPA 5HW7A 2PV3A 3PRDA 2K8IA 3O5FA 4ODMA 3JXVA 4ODNA 3UI4A 3UI6A 5B8IC 4DRIA 5HUAA 4O2TA 4MGVA 4TW6A 2UZ5A 2ZQSA 2PV2A 2RUQA 1ZK6A 1JVWA 2LKNA 3LUOA 3O5RA 3O5LA 4LAWA 4TYOA 2XP4A 5BXJA 4R0XA 3KADA 1JNSA 3NTPA 3TCZA 5DITA 4LAYA 2M2AA 4DROA 2XP5A 3O5IA 5I98A 4N19A 4LAVA 2KR7A 2XP8A 4ODPA 3JYJA 4TNSA 1J4IA 3KABA 3O5DA 4DRNA 2XPAA 1ZCNA 3O5EA 3CGNA 3NRKA 5J6EA 2ITKA 2DG9A 2MLXA 3KACA 4ODKA 2PPPA 3CGMA 1N1AA 4DH0A 3O5GA 3TC5A 1FD9A 2DG4A 3MDYB 1Q1CA 3KCEA 4QT3A 5HW8A 4JFLA 2Y78A 2PV1A 2PBCA 4LAXA 4DT4A 2FKEA 4G50A 4W9PA 3VAWA
chains in the Genus database with same CATH superfamily
3WQWA 1FKJA 1F8AB 4Z2KA 4ODLA 3ARXA 3KAGA 1JNTA 3ARRA 3B9EA 2PN0A 2AWGA 1D6OA 2MNTA 2RQSA 3IK8A 2LJ4A 1ROUA 4LGXA 1OGGA 1HJXA 1LL7A 2MPHA 4GIVA 3ALGA 3WD4A 5GPGA 1ZU8A 1E6RA 3O5QA 3G6LA 1D7IA 1X6LA 2ZQTA 4S3KA 5HTGA 1W1TA 2N87A 3RM4A 3KAIA 2XP7A 1KT0A 1FKRA 4WKAA 2VN1A 4QIBA 1FKFA 1NWUA 4Z2HA 1J4HA 4MSPA 2F21A 1FFQA 5HWCA 1PBKA 5HKGA 4Z2GA 2A3EA 2XP9A 4NZCA 1C9HA 1T11A 4TW8A 1UR8A 2G41A 5DEZA 3H9RB 3I6CA 1OWQA 1YW5A 2ESCA 2EULA 3RMEA 1W1PA 2DSVA 4ML4A 4U84A 1FKBA 1HJVA 3WIJA 4J4OA 1D2KA 2F23A 4Z2LA 1J4RA 4DRQA 1B6CA 4MNLA 3WL0A 1LL4A 1ROTA 5HW7A 3O5FA 4KR0B 4ODMA 3JXVA 3ARQA 2IUZA 4O2TA 4MGVA 4TW6A 2UZ5A 4KQZA 3FXYA 3O5RA 3PRAA 3EIPA 3TCZA 3CH9A 5DITA 2M2AA 3O5IA 2DT1A 5I98A 1ZBVA 4DWSA 1W9PA 1GPFA 4ODPA 5GQBA 3KABA 4DRNA 3NRKA 2ITKA 4PTMA 4MNMA 4ODKA 3CGMA 1N1AA 4HBOA 1ZBWA 3BXWA 1E6PA 2PV1A 2DPEA 4AY1A 1SYTA 1HKKA 3ARWA 1KT1A 4P8UA 4MAVA 4JFKA 1EHNA 1EDQA 1OGBA 4WJXA 4DRJA 2WLYA 2RSEA 3UQAA 1FAPA 3ARSA 1TFVA 3AS3A 1Y0OA 5GPRA 2KE0A 5DIUA 1W1YA 1Q6UA 1R9HA 2QF8A 5HT1A 2RURA 3EY6A 3FAPA 3FY1A 2DT3A 1NMVA 3AROA 4L72B 4R5EA 4W9QA 4ODRA 1ZL1A 2WLZA 2ZQVA 1HJWA 2Q5AA 2ZR6A 1GOIA 2XP6A 4JFMA 1FKTA 4ODOA 1J6YA 4U86A 1JNEA 2PPOA 1L1PA 1W9UA 3PA7A 1NWRA 2ETNA 1H0IA 2RUDA 1NWTA 4NNRA 4IQCA 4ZPVR 1NH6A 3WH0A 4P8XA 1M5YA 4NSBA 2XP3A 4FAPA 1ITXA 1TCOC 2MLYA 2YBUA 3B7XA 1FKSA 3PRDA 3CHDA 5B8IC 3AQUA 4IT4A 4TYOA 2XP4A 5BXJA 2OLHA 3KADA 2WK2A 4LAYA 1JCHB 3ARTA 4TNSA 4L3NA 3O5DA 2XPAA 3O5EA 4QZVB 4WKFA 1E44A 3O5GA 4WKHA 3G6MA 3KCEA 1LL6A 3OA5A 2Y78A 4DT4A 4LAXA 5HBFA 4W9PA 5DF0A 4TW7A 3PRBA 4Z2JA 3IHZA 1ZBCA 3UQBA 4WIWA 1RD6A 1F40A 2JZVA 2VCDA 2XPBA 4P8VA 2O9OA 1D7HA 3RGCA 1PINA 5DIVA 4XAKA 1D7JA 3NI6A 3WD1A 5D75A 1UR9A 2M08A 1QPLA 4Z2IA 1XHGA 2A3AA 3GTYX 4W5UA 5DO2A 1FJDA 3ODKA 3IKGA 1BL4A 1WB0A 4ODQA 1YATA 4Q7NA 4ZS6A 2ZQUA 3ARYA 3KAFA 3ARVA 3UF8A 1WNOA 2KI3A 2O92A 1U79A 4DRPA 4MTVA 4JYSA 1FKDA 1ZB5A 3GU0A 3ARPA 1LG2A 4URIA 2LPVA 2D9FA 3IKDA 3O5OA 1LQ0A 4DRMA 4C02B 1Q6IA 1SR0A 1ZBKA 4IQ2A 3RM9A 2F2DA 3O5MA 1NSGA 4IPXA 4DZ3A 1FKKA 4JFIA 3WD2A 1P5QA 4IT6A 1EYMA 4HARA 1E15A 3WD0A 4J4NA 2YBTA 1E6NA 4QT2A 2FDMA 4DIPA 2FAPA 2PV3A 2K8IA 4ODNA 3UI4A 3UI6A 4DRIA 1EIBA 3B9AA 4ZPTR 2DT2A 3O5LA 4LAWA 4Q22A 1JNSA 1O6IA 3CHEA 4N19A 4LAVA 2KR7A 3ARUA 2AOSA 1ZCNA 3WL1A 5J6EA 2MLXA 3WKZA 2WM0A 4ZPWR 2A3BA 1FD9A 3B8SA 1LJYA 4QT3A 1E9LA 4HBEA 4JFLA 3WQVA 1XRVA 1NWSA 4G50A 3BMBA 3VAWA 1HKIA 1KFWA 2P4VA 2RUCA 3ARZA 3W4RA 1FKGA 5HW6A 1FKIA 4DZ2A 2DSWA 2M1IA 1LG1A 1X6NA 4P8WA 3RM8A 3QOKA 3O5JA 2KO7A 1IX5A 4BF8A 2IF4A 1A7XA 4ITZA 1HKJA 2OFNA 1QZ2A 3WD3A 2G8ZA 2L2SA 1WAWA 1VF8A 2ZR5A 1FKLA 1BKFA 2ZR4A 1H0GA 4G2PA 3CHCA 3UI5A 2F4EA 4FN2A 2B5UB 4GGQA 3RFWA 4U85A 4JFJA 2DT0A 3KAHA 3CHFA 3O5KA 3UQIA 1FKHA 4UDMA 2KGJA 3OOBA 1HXVA 4W9OA 2DSZA 4TX0A 2PPNA 1EQ3A 1JNDA 3CZ8A 3KZ7A 2MF9A 3O5PA 1QPFA 4DRKA 2DSUA 2LGOA 2PI6A 1W26A 2DG3A 4S3JA 1CTNA 5HWBA 1NMWA 1Q6HA 2MLZA 4DRHA 3GPKA 2KFWA 4MNJA 3TDBA 4DWSC 3JYMA 5HUAA 1W1VA 1GRJA 2ZQSA 2PV2A 2RUQA 1ZK6A 1JVWA 2A3CA 2LKNA 3LUOA 4MPKA 5JH8A 4R0XA 3NTPA 4MNKA 4DROA 2XP5A 3ALFA 4DWSD 3PR9A 2XP8A 3JYJA 1J4IA 3CGNA 1FFRA 4DWSB 2DG9A 3KACA 2PPPA 1GUVA 1W9VA 4DH0A 1K9TA 3TC5A 2DG4A 3MDYB 4WK9A 1Q1CA 1HKMA 3AS1A 5HW8A 2PBCA 3AS0A 2FKEA 3AS2A 2B31A 3B9DA 1E6ZA
chains in the Genus database with same CATH topology
3WQWA 1FKJA 1F8AB 4Z2KA 4ODLA 3ARXA 3KAGA 1JNTA 3ARRA 3B9EA 2AWGA 1D6OA 2MNTA 2RQSA 3IK8A 2LJ4A 1ROUA 4LGXA 1OGGA 1HJXA 1LL7A 2MPHA 4GIVA 3ALGA 3WD4A 5GPGA 1ZU8A 1E6RA 3O5QA 3G6LA 1D7IA 1X6LA 2ZQTA 4S3KA 5HTGA 1W1TA 2N87A 3RM4A 3KAIA 2XP7A 1KT0A 1FKRA 4WKAA 2VN1A 4QIBA 1FKFA 1NWUA 4Z2HA 1J4HA 4MSPA 2F21A 1FFQA 5HWCA 1PBKA 5HKGA 4Z2GA 2A3EA 2XP9A 4NZCA 1C9HA 1T11A 4TW8A 1UR8A 2G41A 5DEZA 3H9RB 3I6CA 1OWQA 1YW5A 2ESCA 3RMEA 1W1PA 2DSVA 4ML4A 4U84A 1FKBA 1HJVA 3WIJA 4J4OA 1D2KA 4Z2LA 1J4RA 4DRQA 1B6CA 4MNLA 3WL0A 1LL4A 1ROTA 5HW7A 3O5FA 4KR0B 4ODMA 3JXVA 3ARQA 2IUZA 4O2TA 4MGVA 4TW6A 2UZ5A 4KQZA 3FXYA 3O5RA 3PRAA 3TCZA 3CH9A 5DITA 2M2AA 3O5IA 2DT1A 5I98A 1ZBVA 4DWSA 1W9PA 1GPFA 4ODPA 5GQBA 3KABA 4DRNA 3NRKA 2ITKA 4PTMA 4MNMA 4ODKA 3CGMA 1N1AA 4HBOA 1ZBWA 3BXWA 1E6PA 2PV1A 2DPEA 4AY1A 1SYTA 1HKKA 3ARWA 1KT1A 4P8UA 4MAVA 4JFKA 1EHNA 1EDQA 1OGBA 4WJXA 4DRJA 2WLYA 2RSEA 3UQAA 1FAPA 3ARSA 1TFVA 3AS3A 1Y0OA 5GPRA 2KE0A 5DIUA 1W1YA 1Q6UA 1R9HA 2QF8A 5HT1A 2RURA 3EY6A 3FAPA 3FY1A 2DT3A 1NMVA 3AROA 4L72B 4R5EA 4W9QA 4ODRA 1ZL1A 2WLZA 2ZQVA 1HJWA 2Q5AA 2ZR6A 1GOIA 2XP6A 4JFMA 1FKTA 4ODOA 1J6YA 4U86A 1JNEA 2PPOA 1L1PA 1W9UA 3PA7A 1NWRA 1H0IA 2RUDA 1NWTA 4NNRA 4IQCA 4ZPVR 1NH6A 3WH0A 4P8XA 1M5YA 4NSBA 2XP3A 4FAPA 1ITXA 1TCOC 2MLYA 2YBUA 3B7XA 1FKSA 3PRDA 3CHDA 5B8IC 3AQUA 4IT4A 4TYOA 2XP4A 5BXJA 2OLHA 3KADA 2WK2A 4LAYA 3ARTA 4TNSA 4L3NA 3O5DA 2XPAA 3O5EA 4QZVB 4WKFA 3O5GA 4WKHA 3G6MA 3KCEA 1LL6A 3OA5A 2Y78A 4DT4A 4LAXA 5HBFA 4W9PA 5DF0A 4TW7A 3PRBA 4Z2JA 3IHZA 1ZBCA 3UQBA 4WIWA 1RD6A 1F40A 2JZVA 2VCDA 2XPBA 4P8VA 2O9OA 1D7HA 3RGCA 1PINA 5DIVA 4XAKA 1D7JA 3NI6A 3WD1A 5D75A 1UR9A 2M08A 1QPLA 4Z2IA 1XHGA 2A3AA 4W5UA 5DO2A 1FJDA 3ODKA 3IKGA 1BL4A 1WB0A 4ODQA 1YATA 4Q7NA 4ZS6A 2ZQUA 3ARYA 3KAFA 3ARVA 3UF8A 1WNOA 2KI3A 2O92A 1U79A 4DRPA 4MTVA 4JYSA 1FKDA 1ZB5A 3ARPA 1LG2A 4URIA 2LPVA 2D9FA 3IKDA 1LQ0A 3O5OA 4DRMA 4C02B 1Q6IA 1SR0A 1ZBKA 4IQ2A 3RM9A 2F2DA 3O5MA 1NSGA 4IPXA 4DZ3A 1FKKA 4JFIA 3WD2A 1P5QA 4IT6A 1EYMA 4HARA 1E15A 3WD0A 4J4NA 2YBTA 1E6NA 4QT2A 2FDMA 4DIPA 2FAPA 2PV3A 2K8IA 4ODNA 3UI4A 3UI6A 4DRIA 1EIBA 3B9AA 4ZPTR 2DT2A 3O5LA 4LAWA 4Q22A 1JNSA 1O6IA 3CHEA 4N19A 4LAVA 2KR7A 3ARUA 2AOSA 1ZCNA 3WL1A 5J6EA 2MLXA 3WKZA 2WM0A 4ZPWR 2A3BA 1FD9A 3B8SA 1LJYA 4QT3A 1E9LA 4HBEA 4JFLA 3WQVA 1XRVA 1NWSA 4G50A 3VAWA 1HKIA 1KFWA 2RUCA 3ARZA 3W4RA 1FKGA 5HW6A 1FKIA 4DZ2A 2DSWA 2M1IA 1LG1A 1X6NA 4P8WA 3RM8A 3QOKA 3O5JA 2KO7A 1IX5A 4BF8A 2IF4A 1A7XA 4ITZA 1HKJA 2OFNA 1QZ2A 3WD3A 2G8ZA 2L2SA 1WAWA 1VF8A 2ZR5A 1FKLA 1BKFA 2ZR4A 1H0GA 4G2PA 3CHCA 3UI5A 2F4EA 4FN2A 4GGQA 3RFWA 4U85A 4JFJA 2DT0A 3KAHA 3CHFA 3O5KA 3UQIA 1FKHA 2KGJA 3OOBA 1HXVA 4W9OA 2DSZA 4TX0A 2PPNA 1EQ3A 1JNDA 3CZ8A 3KZ7A 2MF9A 3O5PA 1QPFA 4DRKA 2DSUA 2LGOA 2PI6A 1W26A 2DG3A 4S3JA 1CTNA 5HWBA 1NMWA 1Q6HA 2MLZA 4DRHA 3GPKA 2KFWA 4MNJA 3TDBA 4DWSC 3JYMA 5HUAA 1W1VA 2ZQSA 2PV2A 2RUQA 1ZK6A 1JVWA 2A3CA 2LKNA 3LUOA 4MPKA 5JH8A 4R0XA 3NTPA 4MNKA 4DROA 2XP5A 3ALFA 4DWSD 3PR9A 2XP8A 3JYJA 1J4IA 3CGNA 1FFRA 4DWSB 2DG9A 3KACA 2PPPA 1GUVA 1W9VA 4DH0A 1K9TA 3TC5A 2DG4A 3MDYB 4WK9A 1Q1CA 1HKMA 3AS1A 5HW8A 2PBCA 3AS0A 2FKEA 3AS2A 2B31A 3B9DA 1E6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKJ A;  1F8A B;  3PRB A;  2RUC A;  4TW7 A;  4ODL A;  1KT1 A;  3IHZ A;  3KAG A;  4JFK A;  1JNT A;  1FKG A;  5HW6 A;  1FKI A;  2AWG A;  1D6O A;  4DZ2 A;  2M1I A;  2MNT A;  2RQS A;  3IK8 A;  2LJ4 A;  3UQB A;  1ROU A;  2MPH A;  1F40 A;  4GIV A;  2JZV A;  2VCD A;  2XPB A;  4DRJ A;  5GPG A;  3O5J A;  2RSE A;  3O5Q A;  2KO7 A;  4BF8 A;  1D7H A;  1FAP A;  2IF4 A;  3UQA A;  1D7I A;  1A7X A;  4ITZ A;  3RGC A;  1PIN A;  1Y0O A;  2ZQT A;  5DIV A;  2OFN A;  5HTG A;  1QZ2 A;  2N87 A;  1D7J A;  3KAI A;  2KE0 A;  3NI6 A;  2XP7 A;  5D75 A;  5DIU A;  1Q6U A;  1R9H A;  2M08 A;  1QPL A;  2L2S A;  5HT1 A;  2RUR A;  3EY6 A;  3FAP A;  1KT0 A;  2ZR5 A;  1NMV A;  1FKL A;  1BKF A;  1FJD A;  1FKR A;  2VN1 A;  3IKG A;  3ODK A;  4QIB A;  2ZR4 A;  1BL4 A;  1FKF A;  4G2P A;  3UI5 A;  4ODQ A;  2F4E A;  1YAT A;  1J4H A;  4MSP A;  2ZQU A;  4W9Q A;  4ODR A;  4FN2 A;  2F21 A;  2ZQV A;  3KAF A;  3UF8 A;  4GGQ A;  3RFW A;  5HWC A;  2KI3 A;  4U85 A;  4JFJ A;  2Q5A A;  1PBK A;  5HKG A;  2ZR6 A;  1U79 A;  3KAH A;  2XP9 A;  4DRP A;  2XP6 A;  3O5K A;  4JFM A;  1FKH A;  1FKT A;  3UQI A;  2KGJ A;  3OOB A;  4ODO A;  1J6Y A;  1HXV A;  4U86 A;  4JYS A;  4W9O A;  1C9H A;  4TX0 A;  1FKD A;  2PPN A;  1EQ3 A;  2PPO A;  1T11 A;  4TW8 A;  1L1P A;  2LPV A;  3PA7 A;  2D9F A;  3KZ7 A;  3H9R B;  3IKD A;  2MF9 A;  3I6C A;  2RUD A;  3O5O A;  4DRM A;  3O5P A;  4C02 B;  1QPF A;  1Q6I A;  4NNR A;  4DRK A;  1YW5 A;  4IQC A;  2LGO A;  4IQ2 A;  1W26 A;  4U84 A;  2F2D A;  1FKB A;  2DG3 A;  3O5M A;  1NSG A;  4IPX A;  3WH0 A;  4J4O A;  4DZ3 A;  1FKK A;  4JFI A;  1M5Y A;  2XP3 A;  5HWB A;  1J4R A;  1NMW A;  1P5Q A;  4FAP A;  4DRQ A;  1B6C A;  1Q6H A;  1EYM A;  2MLZ A;  4DRH A;  1TCO C;  2MLY A;  4J4N A;  3GPK A;  2KFW A;  4QT2 A;  3B7X A;  3TDB A;  3JYM A;  4DIP A;  1FKS A;  1ROT A;  2FAP A;  5HW7 A;  2PV3 A;  3PRD A;  2K8I A;  3O5F A;  4ODM A;  3JXV A;  4ODN A;  3UI4 A;  3UI6 A;  5B8I C;  4DRI A;  5HUA A;  4O2T A;  4MGV A;  4TW6 A;  2UZ5 A;  2ZQS A;  2PV2 A;  2RUQ A;  1ZK6 A;  1JVW A;  2LKN A;  3LUO A;  3O5R A;  3O5L A;  4LAW A;  4TYO A;  2XP4 A;  5BXJ A;  4R0X A;  3KAD A;  1JNS A;  3NTP A;  3TCZ A;  5DIT A;  4LAY A;  2M2A A;  4DRO A;  2XP5 A;  3O5I A;  5I98 A;  4N19 A;  4LAV A;  2KR7 A;  2XP8 A;  4ODP A;  3JYJ A;  4TNS A;  1J4I A;  3KAB A;  3O5D A;  4DRN A;  2XPA A;  1ZCN A;  3O5E A;  3CGN A;  3NRK A;  5J6E A;  2ITK A;  2DG9 A;  2MLX A;  3KAC A;  4ODK A;  2PPP A;  3CGM A;  1N1A A;  4DH0 A;  3O5G A;  3TC5 A;  1FD9 A;  2DG4 A;  3MDY B;  1Q1C A;  3KCE A;  4QT3 A;  5HW8 A;  4JFL A;  2Y78 A;  2PV1 A;  2PBC A;  4LAX A;  4DT4 A;  2FKE A;  4G50 A;  4W9P A;  3VAW A; 
#chains in the Genus database with same CATH topology
 3WQW A;  1FKJ A;  1F8A B;  4Z2K A;  4ODL A;  3ARX A;  3KAG A;  1JNT A;  3ARR A;  3B9E A;  2PN0 A;  2AWG A;  1D6O A;  2MNT A;  2RQS A;  3IK8 A;  2LJ4 A;  1ROU A;  4LGX A;  1OGG A;  1HJX A;  1LL7 A;  2MPH A;  4GIV A;  3ALG A;  3WD4 A;  5GPG A;  1ZU8 A;  1E6R A;  3O5Q A;  3G6L A;  1D7I A;  1X6L A;  2ZQT A;  4S3K A;  5HTG A;  1W1T A;  2N87 A;  3RM4 A;  3KAI A;  2XP7 A;  1KT0 A;  1FKR A;  4WKA A;  2VN1 A;  4QIB A;  1FKF A;  1NWU A;  4Z2H A;  1J4H A;  4MSP A;  2F21 A;  1FFQ A;  5HWC A;  1PBK A;  5HKG A;  4Z2G A;  2A3E A;  2XP9 A;  4NZC A;  1C9H A;  1T11 A;  4TW8 A;  1UR8 A;  2G41 A;  5DEZ A;  3H9R B;  3I6C A;  1OWQ A;  1YW5 A;  2ESC A;  2EUL A;  3RME A;  1W1P A;  2DSV A;  4ML4 A;  4U84 A;  1FKB A;  1HJV A;  3WIJ A;  4J4O A;  1D2K A;  2F23 A;  4Z2L A;  1J4R A;  4DRQ A;  1B6C A;  4MNL A;  3WL0 A;  1LL4 A;  1ROT A;  5HW7 A;  3O5F A;  4KR0 B;  4ODM A;  3JXV A;  3ARQ A;  2IUZ A;  4O2T A;  4MGV A;  4TW6 A;  2UZ5 A;  4KQZ A;  3FXY A;  3O5R A;  3PRA A;  3EIP A;  3TCZ A;  3CH9 A;  5DIT A;  2M2A A;  3O5I A;  2DT1 A;  5I98 A;  1ZBV A;  4DWS A;  1W9P A;  1GPF A;  4ODP A;  5GQB A;  3KAB A;  4DRN A;  3NRK A;  2ITK A;  4PTM A;  4MNM A;  4ODK A;  3CGM A;  1N1A A;  4HBO A;  1ZBW A;  3BXW A;  1E6P A;  2PV1 A;  2DPE A;  4AY1 A;  1SYT A;  1HKK A;  3ARW A;  1KT1 A;  4P8U A;  4MAV A;  4JFK A;  1EHN A;  1EDQ A;  1OGB A;  4WJX A;  4DRJ A;  2WLY A;  2RSE A;  3UQA A;  1FAP A;  3ARS A;  1TFV A;  3AS3 A;  1Y0O A;  5GPR A;  2KE0 A;  5DIU A;  1W1Y A;  1Q6U A;  1R9H A;  2QF8 A;  5HT1 A;  2RUR A;  3EY6 A;  3FAP A;  3FY1 A;  2DT3 A;  1NMV A;  3ARO A;  4L72 B;  4R5E A;  4W9Q A;  4ODR A;  1ZL1 A;  2WLZ A;  2ZQV A;  1HJW A;  2Q5A A;  2ZR6 A;  1GOI A;  2XP6 A;  4JFM A;  1FKT A;  4ODO A;  1J6Y A;  4U86 A;  1JNE A;  2PPO A;  1L1P A;  1W9U A;  3PA7 A;  1NWR A;  2ETN A;  1H0I A;  2RUD A;  1NWT A;  4NNR A;  4IQC A;  4ZPV R;  1NH6 A;  3WH0 A;  4P8X A;  1M5Y A;  4NSB A;  2XP3 A;  4FAP A;  1ITX A;  1TCO C;  2MLY A;  2YBU A;  3B7X A;  1FKS A;  3PRD A;  3CHD A;  5B8I C;  3AQU A;  4IT4 A;  4TYO A;  2XP4 A;  5BXJ A;  2OLH A;  3KAD A;  2WK2 A;  4LAY A;  1JCH B;  3ART A;  4TNS A;  4L3N A;  3O5D A;  2XPA A;  3O5E A;  4QZV B;  4WKF A;  1E44 A;  3O5G A;  4WKH A;  3G6M A;  3KCE A;  1LL6 A;  3OA5 A;  2Y78 A;  4DT4 A;  4LAX A;  5HBF A;  4W9P A;  5DF0 A;  4TW7 A;  3PRB A;  4Z2J A;  3IHZ A;  1ZBC A;  3UQB A;  4WIW A;  1RD6 A;  1F40 A;  2JZV A;  2VCD A;  2XPB A;  4P8V A;  2O9O A;  1D7H A;  3RGC A;  1PIN A;  5DIV A;  4XAK A;  1D7J A;  3NI6 A;  3WD1 A;  5D75 A;  1UR9 A;  2M08 A;  1QPL A;  4Z2I A;  1XHG A;  2A3A A;  3GTY X;  4W5U A;  5DO2 A;  1FJD A;  3ODK A;  3IKG A;  1BL4 A;  1WB0 A;  4ODQ A;  1YAT A;  4Q7N A;  4ZS6 A;  2ZQU A;  3ARY A;  3KAF A;  3ARV A;  3UF8 A;  1WNO A;  2KI3 A;  2O92 A;  1U79 A;  4DRP A;  4MTV A;  4JYS A;  1FKD A;  1ZB5 A;  3GU0 A;  3ARP A;  1LG2 A;  4URI A;  2LPV A;  2D9F A;  3IKD A;  3O5O A;  1LQ0 A;  4DRM A;  4C02 B;  1Q6I A;  1SR0 A;  1ZBK A;  4IQ2 A;  3RM9 A;  2F2D A;  3O5M A;  1NSG A;  4IPX A;  4DZ3 A;  1FKK A;  4JFI A;  3WD2 A;  1P5Q A;  4IT6 A;  1EYM A;  4HAR A;  1E15 A;  3WD0 A;  4J4N A;  2YBT A;  1E6N A;  4QT2 A;  2FDM A;  4DIP A;  2FAP A;  2PV3 A;  2K8I A;  4ODN A;  3UI4 A;  3UI6 A;  4DRI A;  1EIB A;  3B9A A;  4ZPT R;  2DT2 A;  3O5L A;  4LAW A;  4Q22 A;  1JNS A;  1O6I A;  3CHE A;  4N19 A;  4LAV A;  2KR7 A;  3ARU A;  2AOS A;  1ZCN A;  3WL1 A;  5J6E A;  2MLX A;  3WKZ A;  2WM0 A;  4ZPW R;  2A3B A;  1FD9 A;  3B8S A;  1LJY A;  4QT3 A;  1E9L A;  4HBE A;  4JFL A;  3WQV A;  1XRV A;  1NWS A;  4G50 A;  3BMB A;  3VAW A;  1HKI A;  1KFW A;  2P4V A;  2RUC A;  3ARZ A;  3W4R A;  1FKG A;  5HW6 A;  1FKI A;  4DZ2 A;  2DSW A;  2M1I A;  1LG1 A;  1X6N A;  4P8W A;  3RM8 A;  3QOK A;  3O5J A;  2KO7 A;  1IX5 A;  4BF8 A;  2IF4 A;  1A7X A;  4ITZ A;  1HKJ A;  2OFN A;  1QZ2 A;  3WD3 A;  2G8Z A;  2L2S A;  1WAW A;  1VF8 A;  2ZR5 A;  1FKL A;  1BKF A;  2ZR4 A;  1H0G A;  4G2P A;  3CHC A;  3UI5 A;  2F4E A;  4FN2 A;  2B5U B;  4GGQ A;  3RFW A;  4U85 A;  4JFJ A;  2DT0 A;  3KAH A;  3CHF A;  3O5K A;  3UQI A;  1FKH A;  4UDM A;  2KGJ A;  3OOB A;  1HXV A;  4W9O A;  2DSZ A;  4TX0 A;  2PPN A;  1EQ3 A;  1JND A;  3CZ8 A;  3KZ7 A;  2MF9 A;  3O5P A;  1QPF A;  4DRK A;  2DSU A;  2LGO A;  2PI6 A;  1W26 A;  2DG3 A;  4S3J A;  1CTN A;  5HWB A;  1NMW A;  1Q6H A;  2MLZ A;  4DRH A;  3GPK A;  2KFW A;  4MNJ A;  3TDB A;  4DWS C;  3JYM A;  5HUA A;  1W1V A;  1GRJ A;  2ZQS A;  2PV2 A;  2RUQ A;  1ZK6 A;  1JVW A;  2A3C A;  2LKN A;  3LUO A;  4MPK A;  5JH8 A;  4R0X A;  3NTP A;  4MNK A;  4DRO A;  2XP5 A;  3ALF A;  4DWS D;  3PR9 A;  2XP8 A;  3JYJ A;  1J4I A;  3CGN A;  1FFR A;  4DWS B;  2DG9 A;  3KAC A;  2PPP A;  1GUV A;  1W9V A;  4DH0 A;  1K9T A;  3TC5 A;  2DG4 A;  3MDY B;  4WK9 A;  1Q1C A;  1HKM A;  3AS1 A;  5HW8 A;  2PBC A;  3AS0 A;  2FKE A;  3AS2 A;  2B31 A;  3B9D A;  1E6Z A; 
#chains in the Genus database with same CATH homology
 3WQW A;  1FKJ A;  1F8A B;  4Z2K A;  4ODL A;  3ARX A;  3KAG A;  1JNT A;  3ARR A;  3B9E A;  2AWG A;  1D6O A;  2MNT A;  2RQS A;  3IK8 A;  2LJ4 A;  1ROU A;  4LGX A;  1OGG A;  1HJX A;  1LL7 A;  2MPH A;  4GIV A;  3ALG A;  3WD4 A;  5GPG A;  1ZU8 A;  1E6R A;  3O5Q A;  3G6L A;  1D7I A;  1X6L A;  2ZQT A;  4S3K A;  5HTG A;  1W1T A;  2N87 A;  3RM4 A;  3KAI A;  2XP7 A;  1KT0 A;  1FKR A;  4WKA A;  2VN1 A;  4QIB A;  1FKF A;  1NWU A;  4Z2H A;  1J4H A;  4MSP A;  2F21 A;  1FFQ A;  5HWC A;  1PBK A;  5HKG A;  4Z2G A;  2A3E A;  2XP9 A;  4NZC A;  1C9H A;  1T11 A;  4TW8 A;  1UR8 A;  2G41 A;  5DEZ A;  3H9R B;  3I6C A;  1OWQ A;  1YW5 A;  2ESC A;  3RME A;  1W1P A;  2DSV A;  4ML4 A;  4U84 A;  1FKB A;  1HJV A;  3WIJ A;  4J4O A;  1D2K A;  4Z2L A;  1J4R A;  4DRQ A;  1B6C A;  4MNL A;  3WL0 A;  1LL4 A;  1ROT A;  5HW7 A;  3O5F A;  4KR0 B;  4ODM A;  3JXV A;  3ARQ A;  2IUZ A;  4O2T A;  4MGV A;  4TW6 A;  2UZ5 A;  4KQZ A;  3FXY A;  3O5R A;  3PRA A;  3TCZ A;  3CH9 A;  5DIT A;  2M2A A;  3O5I A;  2DT1 A;  5I98 A;  1ZBV A;  4DWS A;  1W9P A;  1GPF A;  4ODP A;  5GQB A;  3KAB A;  4DRN A;  3NRK A;  2ITK A;  4PTM A;  4MNM A;  4ODK A;  3CGM A;  1N1A A;  4HBO A;  1ZBW A;  3BXW A;  1E6P A;  2PV1 A;  2DPE A;  4AY1 A;  1SYT A;  1HKK A;  3ARW A;  1KT1 A;  4P8U A;  4MAV A;  4JFK A;  1EHN A;  1EDQ A;  1OGB A;  4WJX A;  4DRJ A;  2WLY A;  2RSE A;  3UQA A;  1FAP A;  3ARS A;  1TFV A;  3AS3 A;  1Y0O A;  5GPR A;  2KE0 A;  5DIU A;  1W1Y A;  1Q6U A;  1R9H A;  2QF8 A;  5HT1 A;  2RUR A;  3EY6 A;  3FAP A;  3FY1 A;  2DT3 A;  1NMV A;  3ARO A;  4L72 B;  4R5E A;  4W9Q A;  4ODR A;  1ZL1 A;  2WLZ A;  2ZQV A;  1HJW A;  2Q5A A;  2ZR6 A;  1GOI A;  2XP6 A;  4JFM A;  1FKT A;  4ODO A;  1J6Y A;  4U86 A;  1JNE A;  2PPO A;  1L1P A;  1W9U A;  3PA7 A;  1NWR A;  1H0I A;  2RUD A;  1NWT A;  4NNR A;  4IQC A;  4ZPV R;  1NH6 A;  3WH0 A;  4P8X A;  1M5Y A;  4NSB A;  2XP3 A;  4FAP A;  1ITX A;  1TCO C;  2MLY A;  2YBU A;  3B7X A;  1FKS A;  3PRD A;  3CHD A;  5B8I C;  3AQU A;  4IT4 A;  4TYO A;  2XP4 A;  5BXJ A;  2OLH A;  3KAD A;  2WK2 A;  4LAY A;  3ART A;  4TNS A;  4L3N A;  3O5D A;  2XPA A;  3O5E A;  4QZV B;  4WKF A;  3O5G A;  4WKH A;  3G6M A;  3KCE A;  1LL6 A;  3OA5 A;  2Y78 A;  4DT4 A;  4LAX A;  5HBF A;  4W9P A;  5DF0 A;  4TW7 A;  3PRB A;  4Z2J A;  3IHZ A;  1ZBC A;  3UQB A;  4WIW A;  1RD6 A;  1F40 A;  2JZV A;  2VCD A;  2XPB A;  4P8V A;  2O9O A;  1D7H A;  3RGC A;  1PIN A;  5DIV A;  4XAK A;  1D7J A;  3NI6 A;  3WD1 A;  5D75 A;  1UR9 A;  2M08 A;  1QPL A;  4Z2I A;  1XHG A;  2A3A A;  4W5U A;  5DO2 A;  1FJD A;  3ODK A;  3IKG A;  1BL4 A;  1WB0 A;  4ODQ A;  1YAT A;  4Q7N A;  4ZS6 A;  2ZQU A;  3ARY A;  3KAF A;  3ARV A;  3UF8 A;  1WNO A;  2KI3 A;  2O92 A;  1U79 A;  4DRP A;  4MTV A;  4JYS A;  1FKD A;  1ZB5 A;  3ARP A;  1LG2 A;  4URI A;  2LPV A;  2D9F A;  3IKD A;  1LQ0 A;  3O5O A;  4DRM A;  4C02 B;  1Q6I A;  1SR0 A;  1ZBK A;  4IQ2 A;  3RM9 A;  2F2D A;  3O5M A;  1NSG A;  4IPX A;  4DZ3 A;  1FKK A;  4JFI A;  3WD2 A;  1P5Q A;  4IT6 A;  1EYM A;  4HAR A;  1E15 A;  3WD0 A;  4J4N A;  2YBT A;  1E6N A;  4QT2 A;  2FDM A;  4DIP A;  2FAP A;  2PV3 A;  2K8I A;  4ODN A;  3UI4 A;  3UI6 A;  4DRI A;  1EIB A;  3B9A A;  4ZPT R;  2DT2 A;  3O5L A;  4LAW A;  4Q22 A;  1JNS A;  1O6I A;  3CHE A;  4N19 A;  4LAV A;  2KR7 A;  3ARU A;  2AOS A;  1ZCN A;  3WL1 A;  5J6E A;  2MLX A;  3WKZ A;  2WM0 A;  4ZPW R;  2A3B A;  1FD9 A;  3B8S A;  1LJY A;  4QT3 A;  1E9L A;  4HBE A;  4JFL A;  3WQV A;  1XRV A;  1NWS A;  4G50 A;  3VAW A;  1HKI A;  1KFW A;  2RUC A;  3ARZ A;  3W4R A;  1FKG A;  5HW6 A;  1FKI A;  4DZ2 A;  2DSW A;  2M1I A;  1LG1 A;  1X6N A;  4P8W A;  3RM8 A;  3QOK A;  3O5J A;  2KO7 A;  1IX5 A;  4BF8 A;  2IF4 A;  1A7X A;  4ITZ A;  1HKJ A;  2OFN A;  1QZ2 A;  3WD3 A;  2G8Z A;  2L2S A;  1WAW A;  1VF8 A;  2ZR5 A;  1FKL A;  1BKF A;  2ZR4 A;  1H0G A;  4G2P A;  3CHC A;  3UI5 A;  2F4E A;  4FN2 A;  4GGQ A;  3RFW A;  4U85 A;  4JFJ A;  2DT0 A;  3KAH A;  3CHF A;  3O5K A;  3UQI A;  1FKH A;  2KGJ A;  3OOB A;  1HXV A;  4W9O A;  2DSZ A;  4TX0 A;  2PPN A;  1EQ3 A;  1JND A;  3CZ8 A;  3KZ7 A;  2MF9 A;  3O5P A;  1QPF A;  4DRK A;  2DSU A;  2LGO A;  2PI6 A;  1W26 A;  2DG3 A;  4S3J A;  1CTN A;  5HWB A;  1NMW A;  1Q6H A;  2MLZ A;  4DRH A;  3GPK A;  2KFW A;  4MNJ A;  3TDB A;  4DWS C;  3JYM A;  5HUA A;  1W1V A;  2ZQS A;  2PV2 A;  2RUQ A;  1ZK6 A;  1JVW A;  2A3C A;  2LKN A;  3LUO A;  4MPK A;  5JH8 A;  4R0X A;  3NTP A;  4MNK A;  4DRO A;  2XP5 A;  3ALF A;  4DWS D;  3PR9 A;  2XP8 A;  3JYJ A;  1J4I A;  3CGN A;  1FFR A;  4DWS B;  2DG9 A;  3KAC A;  2PPP A;  1GUV A;  1W9V A;  4DH0 A;  1K9T A;  3TC5 A;  2DG4 A;  3MDY B;  4WK9 A;  1Q1C A;  1HKM A;  3AS1 A;  5HW8 A;  2PBC A;  3AS0 A;  2FKE A;  3AS2 A;  2B31 A;  3B9D A;  1E6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...