2KE0A

Solution structure of peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
117
structure length
117
Chain Sequence
GPGSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title The structure of a Burkholderia pseudomallei immunophilin-inhibitor complex reveals new approaches to antimicrobial development.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 16
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ke0A00
1NSGA 1YATA 1PBKA 3O5OA 1Q1CA 2KO7A 2MLZA 5HWBA 1J6YA 1A7XA 3ODKA 3O5QA 1Y0OA 2RQSA 4JFMA 2LPVA 4DRPA 3O5MA 1J4IA 3JYMA 2ZQSA 2AWGA 1FKFA 2ZQUA 4NNRA 4ODQA 1BKFA 1C9HA 4ODMA 4IQ2A 2F2DA 3LUOA 4DRJA 1YW5A 5J6EA 1BL4A 2XP3A 3NRKA 4G50A 4J4OA 1NMVA 2XP4A 2Q5AA 4N19A 4QT3A 4LAXA 4U84A 4BF8A 1J4HA 4QT2A 2MLYA 1R9HA 4ODLA 1Q6UA 2PPPA 2DG4A 2FAPA 3UF8A 3UQAA 4DRMA 4G2PA 5GPGA 3TC5A 1Q6IA 3UI4A 1FKKA 3TCZA 2XP6A 4U85A 4DH0A 1FKIA 1ROUA 2RUCA 2KFWA 3KAIA 4DRKA 2OFNA 4MSPA 3CGNA 3FAPA 5I98A 2MLXA 2VCDA 1Q6HA 2JZVA 4JFJA 2XP9A 1P5QA 1KT0A 3IKGA 2DG9A 3JYJA 1D7JA 1FKHA 4W9OA 2XPBA 1F8AB 4JYSA 4R0XA 4ITZA 2L2SA 2LJ4A 2PV2A 4FAPA 1QPLA 3PRDA 3KAGA 1QZ2A 2D9FA 3B7XA 2ZR6A 3OOBA 4GIVA 5DIUA 1D6OA 3O5LA 4JFKA 1FKDA 5DIVA 2MF9A 2Y78A 3O5FA 4C02B 3O5IA 4ODOA 4ODPA 4J4NA 3O5PA 2PBCA 3NTPA 3PRBA 4LAWA 2KGJA 4MGVA 4O2TA 2ZR5A 3I6CA 4ODNA 3UI5A 3CGMA 3O5GA 4DRHA 1FKLA 3MDYB 4DRNA 2F21A 3KZ7A 1M5YA 2LGOA 3KACA 2XP7A 4DIPA 1D7IA 3IK8A 2M2AA 2DG3A 3O5JA 4TW8A 3UI6A 3O5RA 2PPNA 4TW7A 4W9QA 4DRIA 4U86A 4ODKA 5HWCA 1EQ3A 5B8IC 2VN1A 3IHZA 3VAWA 3RGCA 2KI3A 4DT4A 3O5EA 2MPHA 4JFLA 2KE0A 1TCOC 2ZQVA 1FKJA 1ZK6A 2MNTA 5D75A 4QIBA 2K8IA 1QPFA 3KABA 3TDBA 3UQBA 1FKSA 4W9PA 2PPOA 1FKGA 2RUDA 4GGQA 3UQIA 2RURA 1FKTA 3RFWA 3KAHA 3NI6A 1U79A 3EY6A 4JFIA 5HKGA 3WH0A 1D7HA 1JVWA 5HUAA 2PV3A 1NMWA 5DITA 2RSEA 1J4RA 4TW6A 4TX0A 1FJDA 2ITKA 4DROA 1N1AA 4DRQA 1FD9A 3IKDA 2IF4A 3O5DA 1HXVA 1FKBA 2RUQA 2N87A 1F40A 1ZCNA 1W26A 2M08A 4TNSA 2XPAA 1T11A 1JNTA 4DZ2A 4TYOA 1ROTA 2PV1A 2XP5A 4ODRA 2F4EA 2LKNA 4IQCA 2ZQTA 3KCEA 4LAVA 2XP8A 1L1PA 2UZ5A 4DZ3A 1EYMA 1PINA 4LAYA 5HT1A 5HTGA 5HW8A 1B6CA 3GPKA 3KAFA 1FKRA 2FKEA 3JXVA 1FAPA 2ZR4A 1KT1A 5BXJA 3KADA 3PA7A 1JNSA 3O5KA 4IPXA 3H9RB 2M1IA 4FN2A 5HW6A 2KR7A 5HW7A
chains in the Genus database with same CATH superfamily
4Z2GA 4MTVA 2LPVA 3B9DA 1FKFA 2ZQUA 4NNRA 1C9HA 4IQ2A 4L3NA 4G50A 3NRKA 1NMVA 4QT3A 4LAXA 4NZCA 4BF8A 2O9OA 4XAKA 3RM8A 3ARWA 3UF8A 3AROA 4WJXA 3TCZA 1K9TA 4NSBA 4U85A 4MPKA 2RUCA 4R5EA 2OFNA 4HARA 4WKAA 3FAPA 2A3CA 1Q6HA 2JZVA 4JFJA 2XP9A 3JYJA 4Z2KA 1D7JA 3WD3A 3ARSA 3CZ8A 2LJ4A 4FAPA 1QPLA 4DWSA 1ITXA 1FKDA 2YBTA 5DIVA 2Y78A 4ODOA 1LL6A 2PBCA 3NTPA 3PRBA 1LJYA 3I6CA 1KFWA 1ZB5A 4Z2IA 2XP7A 1D7IA 1JNDA 4TW8A 3UI6A 1LQ0A 3O5RA 4TW7A 1EQ3A 1GRJA 1W1VA 2FDMA 3FY1A 1TCOC 2ZQVA 2MNTA 2DSVA 2K8IA 3KABA 4W9PA 4GGQA 1VF8A 2RURA 3RFWA 3KAHA 4MNMA 5HKGA 1OWQA 5DITA 1FJDA 2B31A 4TX0A 4DROA 3CHFA 1FD9A 3IKDA 1TFVA 3O5DA 3OA5A 2RUQA 2N87A 1NH6A 2A3BA 5HBFA 1UR9A 1WB0A 4DZ2A 1H0GA 4ODRA 4LAVA 4DZ3A 1EYMA 1EDQA 1PINA 1WNOA 3G6MA 4LAYA 4WKHA 3GPKA 4P8UA 1FAPA 2AOSA 5JH8A 2G41A 3RM4A 1RD6A 2KR7A 5HW7A 3PR9A 1YATA 3O5OA 1J6YA 1Q1CA 2KO7A 2MLZA 1A7XA 4DWSC 1HKMA 1Y0OA 2A3EA 3JYMA 2AWGA 4MNKA 4ODMA 3ARZA 2F2DA 4ZS6A 4DRJA 1BL4A 2XP4A 2Q5AA 4U84A 4DWSD 1W9PA 1OGGA 5DEZA 1Q6UA 3ARPA 2PPPA 2FAPA 3ARVA 3B9AA 4S3KA 1Q6IA 1FKIA 1ROUA 2KFWA 2QF8A 3CGNA 2MLXA 2VCDA 3IKGA 2F23A 2DT2A 1FKHA 1LL4A 1F8AB 2L2SA 1ZBVA 1QZ2A 1HJVA 2MF9A 2DT3A 1E15A 3AS3A 1HXVA 2KGJA 1LL7A 4IT4A 3MDYB 2F21A 3BXWA 2M2AA 4ZPTR 2PPNA 4DRIA 4ODKA 3ARQA 1W1TA 2ESCA 1JNEA 3RGCA 2KI3A 4P8VA 4DT4A 3GU0A 3WKZA 3O5EA 3TDBA 4QIBA 1H0IA 1NWSA 1FKTA 2YBUA 1E6RA 4TW6A 3AS0A 1LG2A 4WIWA 4DRQA 3CHDA 1FFRA 1W26A 1T11A 3ARXA 4KR0B 2LKNA 5HTGA 5HW8A 1B6CA 1WAWA 3KADA 4Z2HA 3O5KA 5GQBA 2M1IA 5HW6A 3WL0A 4UDMA 1CTNA 3WD2A 5HWBA 3AS2A 1E44A 2RQSA 3O5QA 3O5MA 3ARUA 4MNLA 2WLZA 3ARRA 4LGXA 4Z2JA 5J6EA 4J4OA 4N19A 1E9LA 4DWSB 1J4HA 4QT2A 1R9HA 2DG4A 4DRMA 4G2PA 2WLYA 1FKKA 1EHNA 4DH0A 1HKIA 4DRKA 2A3AA 3RMEA 2DSZA 4Z2LA 3WL1A 1W9UA 4W5UA 1HJWA 2XPBA 4JYSA 4R0XA 3KAGA 3FXYA 5GPRA 2ZR6A 4GIVA 1D6OA 3O5LA 4JFKA 3O5FA 4C02B 3O5IA 2EULA 4J4NA 3O5PA 4LAWA 4ODNA 3PRAA 4DRNA 4DRHA 4AY1A 3CGMA 1GOIA 3O5GA 3B9EA 1W1PA 3KZ7A 3KACA 4URIA 4DIPA 3IK8A 4L72B 2DG3A 2DSWA 4W9QA 4U86A 4WK9A 5B8IC 3IHZA 4MAVA 4ZPVR 3RM9A 3B8SA 1W1YA 4JFLA 3WIJA 1FKJA 1ZK6A 5D75A 1QPFA 3UQBA 4QZVB 3ARTA 2RUDA 1FKGA 1U79A 5DF0A 3EY6A 3WH0A 3G6LA 2PV3A 1F40A 1ZCNA 2B5UB 4TNSA 1HKJA 4TYOA 2XP5A 4IQCA 1NWTA 1O6IA 1L1PA 3WD4A 2ZR4A 3EIPA 1KT1A 1E6NA 4ZPWR 1JNSA 1ZBCA 1JCHB 3CHCA 1HJXA 1X6NA 1NSGA 1LG1A 1PBKA 2DT1A 2G8ZA 1NWUA 3ODKA 2WM0A 4JFMA 4DRPA 1J4IA 1X6LA 2ZQSA 4ODQA 1BKFA 2P4VA 3LUOA 1YW5A 2XP3A 1IX5A 5DO2A 4MNJA 2IUZA 2PN0A 2MLYA 3GTYX 4ODLA 3UQAA 4PTMA 4HBEA 5GPGA 1SYTA 3TC5A 3UI4A 1E6ZA 2XP6A 3KAIA 4MSPA 3AS1A 5I98A 1P5QA 1KT0A 1XHGA 2DG9A 4W9OA 4HBOA 4KQZA 2O92A 4ML4A 2PI6A 3ALFA 4ITZA 1UR8A 2PV2A 3PRDA 2D9FA 3B7XA 3OOBA 4P8WA 5DIUA 3WD0A 3WQVA 2ETNA 3QOKA 3CH9A 4ODPA 4O2TA 4MGVA 2ZR5A 3UI5A 1XRVA 3ARYA 1FKLA 1ZBKA 1M5YA 2LGOA 1OGBA 3O5JA 5HWCA 4IT6A 2VN1A 3VAWA 2DSUA 2MPHA 1EIBA 2KE0A 4P8XA 1HKKA 1GUVA 1GPFA 1FKSA 2PPOA 3CHEA 3UQIA 4Q22A 3NI6A 4JFIA 1ZBWA 1D7HA 1JVWA 3BMBA 5HUAA 1NMWA 1NWRA 2RSEA 1J4RA 1SR0A 2ITKA 1ZU8A 3W4RA 1N1AA 1ZL1A 4Q7NA 2DT0A 2IF4A 3ALGA 4S3JA 1FKBA 2M08A 2XPAA 1JNTA 3AQUA 1ROTA 2PV1A 2DPEA 2F4EA 2WK2A 2ZQTA 3KCEA 2XP8A 2UZ5A 1E6PA 1FFQA 5HT1A 3WD1A 2OLHA 1FKRA 3KAFA 2FKEA 1D2KA 3JXVA 1W9VA 3WQWA 5BXJA 3PA7A 4IPXA 3H9RB 4FN2A 4WKFA
chains in the Genus database with same CATH topology
4Z2GA 4MTVA 2LPVA 3B9DA 1FKFA 2ZQUA 4NNRA 1C9HA 4IQ2A 4L3NA 4G50A 3NRKA 1NMVA 4QT3A 4LAXA 4NZCA 4BF8A 2O9OA 4XAKA 3RM8A 3ARWA 3UF8A 3AROA 4WJXA 3TCZA 1K9TA 4NSBA 4U85A 4MPKA 2RUCA 4R5EA 2OFNA 4HARA 4WKAA 3FAPA 2A3CA 1Q6HA 2JZVA 4JFJA 2XP9A 3JYJA 4Z2KA 1D7JA 3WD3A 3ARSA 3CZ8A 2LJ4A 4FAPA 1QPLA 4DWSA 1ITXA 1FKDA 2YBTA 5DIVA 2Y78A 4ODOA 1LL6A 2PBCA 3NTPA 3PRBA 1LJYA 3I6CA 1KFWA 1ZB5A 4Z2IA 2XP7A 1D7IA 1JNDA 4TW8A 3UI6A 1LQ0A 3O5RA 4TW7A 1EQ3A 1W1VA 2FDMA 3FY1A 1TCOC 2ZQVA 2MNTA 2DSVA 2K8IA 3KABA 4W9PA 4GGQA 1VF8A 2RURA 3RFWA 3KAHA 4MNMA 5HKGA 1OWQA 5DITA 1FJDA 2B31A 4TX0A 4DROA 3CHFA 3O5DA 1FD9A 1TFVA 3IKDA 3OA5A 2RUQA 2N87A 1NH6A 2A3BA 5HBFA 1UR9A 1WB0A 4DZ2A 1H0GA 4ODRA 4LAVA 4DZ3A 1EYMA 1EDQA 1PINA 1WNOA 3G6MA 4LAYA 4WKHA 3GPKA 4P8UA 1FAPA 2AOSA 5JH8A 2G41A 3RM4A 1RD6A 2KR7A 5HW7A 3PR9A 1YATA 3O5OA 1J6YA 1Q1CA 2KO7A 2MLZA 1A7XA 4DWSC 1HKMA 1Y0OA 2A3EA 3JYMA 2AWGA 4MNKA 4ODMA 3ARZA 2F2DA 4ZS6A 4DRJA 1BL4A 2XP4A 2Q5AA 4U84A 4DWSD 1W9PA 1OGGA 5DEZA 1Q6UA 3ARPA 2PPPA 2FAPA 3ARVA 3B9AA 4S3KA 1Q6IA 1FKIA 1ROUA 2KFWA 2QF8A 3CGNA 2MLXA 2VCDA 3IKGA 2DT2A 1FKHA 1LL4A 1F8AB 2L2SA 1ZBVA 1QZ2A 1HJVA 2MF9A 2DT3A 1E15A 3AS3A 1HXVA 2KGJA 1LL7A 4IT4A 3MDYB 2F21A 3BXWA 2M2AA 4ZPTR 2PPNA 4DRIA 4ODKA 3ARQA 1W1TA 2ESCA 1JNEA 3RGCA 2KI3A 4P8VA 4DT4A 3WKZA 3O5EA 3TDBA 4QIBA 1H0IA 1NWSA 1FKTA 2YBUA 1E6RA 4TW6A 3AS0A 1LG2A 4WIWA 4DRQA 3CHDA 1FFRA 1W26A 1T11A 3ARXA 4KR0B 2LKNA 5HTGA 5HW8A 1B6CA 1WAWA 3KADA 4Z2HA 3O5KA 5GQBA 2M1IA 5HW6A 3WL0A 1CTNA 3WD2A 5HWBA 3AS2A 3O5QA 2RQSA 3O5MA 3ARUA 4MNLA 2WLZA 3ARRA 4LGXA 4Z2JA 5J6EA 4J4OA 4N19A 1E9LA 4DWSB 1J4HA 4QT2A 1R9HA 2DG4A 4DRMA 4G2PA 2WLYA 1FKKA 1EHNA 4DH0A 1HKIA 4DRKA 2A3AA 3RMEA 2DSZA 4Z2LA 3WL1A 1W9UA 4W5UA 1HJWA 2XPBA 4JYSA 4R0XA 3KAGA 3FXYA 5GPRA 2ZR6A 4GIVA 1D6OA 3O5LA 4JFKA 3O5FA 4C02B 3O5IA 4J4NA 3O5PA 4LAWA 4ODNA 3PRAA 4DRNA 4DRHA 4AY1A 3CGMA 3O5GA 1GOIA 3B9EA 1W1PA 3KZ7A 3KACA 4URIA 4DIPA 3IK8A 4L72B 2DG3A 2DSWA 4W9QA 4U86A 4WK9A 5B8IC 3IHZA 4MAVA 4ZPVR 3RM9A 3B8SA 1W1YA 4JFLA 3WIJA 1FKJA 1ZK6A 5D75A 1QPFA 3UQBA 4QZVB 3ARTA 2RUDA 1FKGA 1U79A 5DF0A 3EY6A 3WH0A 3G6LA 2PV3A 1F40A 1ZCNA 4TNSA 1HKJA 4TYOA 2XP5A 4IQCA 1NWTA 1O6IA 1L1PA 3WD4A 2ZR4A 1KT1A 1E6NA 4ZPWR 1JNSA 1ZBCA 3CHCA 1HJXA 1X6NA 1NSGA 1LG1A 1PBKA 2DT1A 2G8ZA 1NWUA 3ODKA 2WM0A 4JFMA 4DRPA 1J4IA 1X6LA 2ZQSA 4ODQA 1BKFA 3LUOA 1YW5A 2XP3A 1IX5A 5DO2A 4MNJA 2IUZA 2MLYA 4ODLA 3UQAA 4PTMA 4HBEA 5GPGA 1SYTA 3TC5A 3UI4A 1E6ZA 2XP6A 3KAIA 4MSPA 3AS1A 5I98A 1P5QA 1KT0A 1XHGA 2DG9A 4W9OA 4HBOA 4KQZA 2O92A 4ML4A 2PI6A 3ALFA 4ITZA 1UR8A 2PV2A 3PRDA 2D9FA 3B7XA 3OOBA 4P8WA 5DIUA 3WD0A 3WQVA 3QOKA 3CH9A 4ODPA 4O2TA 4MGVA 2ZR5A 3UI5A 1XRVA 3ARYA 1FKLA 1ZBKA 1M5YA 2LGOA 1OGBA 3O5JA 5HWCA 4IT6A 2VN1A 3VAWA 2DSUA 2MPHA 1EIBA 2KE0A 4P8XA 1HKKA 1GUVA 1GPFA 1FKSA 2PPOA 3CHEA 3UQIA 4Q22A 3NI6A 4JFIA 1ZBWA 1D7HA 1JVWA 5HUAA 1NMWA 1NWRA 2RSEA 1J4RA 1SR0A 2ITKA 1ZU8A 3W4RA 1N1AA 1ZL1A 4Q7NA 2DT0A 2IF4A 3ALGA 4S3JA 1FKBA 2M08A 2XPAA 1JNTA 3AQUA 1ROTA 2PV1A 2DPEA 2F4EA 2WK2A 2ZQTA 3KCEA 2XP8A 2UZ5A 1E6PA 1FFQA 5HT1A 3WD1A 2OLHA 1FKRA 3KAFA 2FKEA 1D2KA 3JXVA 1W9VA 3WQWA 5BXJA 3PA7A 4IPXA 3H9RB 4FN2A 4WKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NSG A;  1YAT A;  1PBK A;  3O5O A;  1Q1C A;  2KO7 A;  2MLZ A;  5HWB A;  1J6Y A;  1A7X A;  3ODK A;  3O5Q A;  1Y0O A;  2RQS A;  4JFM A;  2LPV A;  4DRP A;  3O5M A;  1J4I A;  3JYM A;  2ZQS A;  2AWG A;  1FKF A;  2ZQU A;  4NNR A;  4ODQ A;  1BKF A;  1C9H A;  4ODM A;  4IQ2 A;  2F2D A;  3LUO A;  4DRJ A;  1YW5 A;  5J6E A;  1BL4 A;  2XP3 A;  3NRK A;  4G50 A;  4J4O A;  1NMV A;  2XP4 A;  2Q5A A;  4N19 A;  4QT3 A;  4LAX A;  4U84 A;  4BF8 A;  1J4H A;  4QT2 A;  2MLY A;  1R9H A;  4ODL A;  1Q6U A;  2PPP A;  2DG4 A;  2FAP A;  3UF8 A;  3UQA A;  4DRM A;  4G2P A;  5GPG A;  3TC5 A;  1Q6I A;  3UI4 A;  1FKK A;  3TCZ A;  2XP6 A;  4U85 A;  4DH0 A;  1FKI A;  1ROU A;  2RUC A;  2KFW A;  3KAI A;  4DRK A;  2OFN A;  4MSP A;  3CGN A;  3FAP A;  5I98 A;  2MLX A;  2VCD A;  1Q6H A;  2JZV A;  4JFJ A;  2XP9 A;  1P5Q A;  1KT0 A;  3IKG A;  2DG9 A;  3JYJ A;  1D7J A;  1FKH A;  4W9O A;  2XPB A;  1F8A B;  4JYS A;  4R0X A;  4ITZ A;  2L2S A;  2LJ4 A;  2PV2 A;  4FAP A;  1QPL A;  3PRD A;  3KAG A;  1QZ2 A;  2D9F A;  3B7X A;  2ZR6 A;  3OOB A;  4GIV A;  5DIU A;  1D6O A;  3O5L A;  4JFK A;  1FKD A;  5DIV A;  2MF9 A;  2Y78 A;  3O5F A;  4C02 B;  3O5I A;  4ODO A;  4ODP A;  4J4N A;  3O5P A;  2PBC A;  3NTP A;  3PRB A;  4LAW A;  2KGJ A;  4MGV A;  4O2T A;  2ZR5 A;  3I6C A;  4ODN A;  3UI5 A;  3CGM A;  3O5G A;  4DRH A;  1FKL A;  3MDY B;  4DRN A;  2F21 A;  3KZ7 A;  1M5Y A;  2LGO A;  3KAC A;  2XP7 A;  4DIP A;  1D7I A;  3IK8 A;  2M2A A;  2DG3 A;  3O5J A;  4TW8 A;  3UI6 A;  3O5R A;  2PPN A;  4TW7 A;  4W9Q A;  4DRI A;  4U86 A;  4ODK A;  5HWC A;  1EQ3 A;  5B8I C;  2VN1 A;  3IHZ A;  3VAW A;  3RGC A;  2KI3 A;  4DT4 A;  3O5E A;  2MPH A;  4JFL A;  2KE0 A;  1TCO C;  2ZQV A;  1FKJ A;  1ZK6 A;  2MNT A;  5D75 A;  4QIB A;  2K8I A;  1QPF A;  3KAB A;  3TDB A;  3UQB A;  1FKS A;  4W9P A;  2PPO A;  1FKG A;  2RUD A;  4GGQ A;  3UQI A;  2RUR A;  1FKT A;  3RFW A;  3KAH A;  3NI6 A;  1U79 A;  3EY6 A;  4JFI A;  5HKG A;  3WH0 A;  1D7H A;  1JVW A;  5HUA A;  2PV3 A;  1NMW A;  5DIT A;  2RSE A;  1J4R A;  4TW6 A;  4TX0 A;  1FJD A;  2ITK A;  4DRO A;  1N1A A;  4DRQ A;  1FD9 A;  3IKD A;  2IF4 A;  3O5D A;  1HXV A;  1FKB A;  2RUQ A;  2N87 A;  1F40 A;  1ZCN A;  1W26 A;  2M08 A;  4TNS A;  2XPA A;  1T11 A;  1JNT A;  4DZ2 A;  4TYO A;  1ROT A;  2PV1 A;  2XP5 A;  4ODR A;  2F4E A;  2LKN A;  4IQC A;  2ZQT A;  3KCE A;  4LAV A;  2XP8 A;  1L1P A;  2UZ5 A;  4DZ3 A;  1EYM A;  1PIN A;  4LAY A;  5HT1 A;  5HTG A;  5HW8 A;  1B6C A;  3GPK A;  3KAF A;  1FKR A;  2FKE A;  3JXV A;  1FAP A;  2ZR4 A;  1KT1 A;  5BXJ A;  3KAD A;  3PA7 A;  1JNS A;  3O5K A;  4IPX A;  3H9R B;  2M1I A;  4FN2 A;  5HW6 A;  2KR7 A;  5HW7 A; 
#chains in the Genus database with same CATH topology
 4Z2G A;  4MTV A;  2LPV A;  3B9D A;  1FKF A;  2ZQU A;  4NNR A;  1C9H A;  4IQ2 A;  4L3N A;  4G50 A;  3NRK A;  1NMV A;  4QT3 A;  4LAX A;  4NZC A;  4BF8 A;  2O9O A;  4XAK A;  3RM8 A;  3ARW A;  3UF8 A;  3ARO A;  4WJX A;  3TCZ A;  1K9T A;  4NSB A;  4U85 A;  4MPK A;  2RUC A;  4R5E A;  2OFN A;  4HAR A;  4WKA A;  3FAP A;  2A3C A;  1Q6H A;  2JZV A;  4JFJ A;  2XP9 A;  3JYJ A;  4Z2K A;  1D7J A;  3WD3 A;  3ARS A;  3CZ8 A;  2LJ4 A;  4FAP A;  1QPL A;  4DWS A;  1ITX A;  1FKD A;  2YBT A;  5DIV A;  2Y78 A;  4ODO A;  1LL6 A;  2PBC A;  3NTP A;  3PRB A;  1LJY A;  3I6C A;  1KFW A;  1ZB5 A;  4Z2I A;  2XP7 A;  1D7I A;  1JND A;  4TW8 A;  3UI6 A;  1LQ0 A;  3O5R A;  4TW7 A;  1EQ3 A;  1GRJ A;  1W1V A;  2FDM A;  3FY1 A;  1TCO C;  2ZQV A;  2MNT A;  2DSV A;  2K8I A;  3KAB A;  4W9P A;  4GGQ A;  1VF8 A;  2RUR A;  3RFW A;  3KAH A;  4MNM A;  5HKG A;  1OWQ A;  5DIT A;  1FJD A;  2B31 A;  4TX0 A;  4DRO A;  3CHF A;  1FD9 A;  3IKD A;  1TFV A;  3O5D A;  3OA5 A;  2RUQ A;  2N87 A;  1NH6 A;  2A3B A;  5HBF A;  1UR9 A;  1WB0 A;  4DZ2 A;  1H0G A;  4ODR A;  4LAV A;  4DZ3 A;  1EYM A;  1EDQ A;  1PIN A;  1WNO A;  3G6M A;  4LAY A;  4WKH A;  3GPK A;  4P8U A;  1FAP A;  2AOS A;  5JH8 A;  2G41 A;  3RM4 A;  1RD6 A;  2KR7 A;  5HW7 A;  3PR9 A;  1YAT A;  3O5O A;  1J6Y A;  1Q1C A;  2KO7 A;  2MLZ A;  1A7X A;  4DWS C;  1HKM A;  1Y0O A;  2A3E A;  3JYM A;  2AWG A;  4MNK A;  4ODM A;  3ARZ A;  2F2D A;  4ZS6 A;  4DRJ A;  1BL4 A;  2XP4 A;  2Q5A A;  4U84 A;  4DWS D;  1W9P A;  1OGG A;  5DEZ A;  1Q6U A;  3ARP A;  2PPP A;  2FAP A;  3ARV A;  3B9A A;  4S3K A;  1Q6I A;  1FKI A;  1ROU A;  2KFW A;  2QF8 A;  3CGN A;  2MLX A;  2VCD A;  3IKG A;  2F23 A;  2DT2 A;  1FKH A;  1LL4 A;  1F8A B;  2L2S A;  1ZBV A;  1QZ2 A;  1HJV A;  2MF9 A;  2DT3 A;  1E15 A;  3AS3 A;  1HXV A;  2KGJ A;  1LL7 A;  4IT4 A;  3MDY B;  2F21 A;  3BXW A;  2M2A A;  4ZPT R;  2PPN A;  4DRI A;  4ODK A;  3ARQ A;  1W1T A;  2ESC A;  1JNE A;  3RGC A;  2KI3 A;  4P8V A;  4DT4 A;  3GU0 A;  3WKZ A;  3O5E A;  3TDB A;  4QIB A;  1H0I A;  1NWS A;  1FKT A;  2YBU A;  1E6R A;  4TW6 A;  3AS0 A;  1LG2 A;  4WIW A;  4DRQ A;  3CHD A;  1FFR A;  1W26 A;  1T11 A;  3ARX A;  4KR0 B;  2LKN A;  5HTG A;  5HW8 A;  1B6C A;  1WAW A;  3KAD A;  4Z2H A;  3O5K A;  5GQB A;  2M1I A;  5HW6 A;  3WL0 A;  4UDM A;  1CTN A;  3WD2 A;  5HWB A;  3AS2 A;  1E44 A;  2RQS A;  3O5Q A;  3O5M A;  3ARU A;  4MNL A;  2WLZ A;  3ARR A;  4LGX A;  4Z2J A;  5J6E A;  4J4O A;  4N19 A;  1E9L A;  4DWS B;  1J4H A;  4QT2 A;  1R9H A;  2DG4 A;  4DRM A;  4G2P A;  2WLY A;  1FKK A;  1EHN A;  4DH0 A;  1HKI A;  4DRK A;  2A3A A;  3RME A;  2DSZ A;  4Z2L A;  3WL1 A;  1W9U A;  4W5U A;  1HJW A;  2XPB A;  4JYS A;  4R0X A;  3KAG A;  3FXY A;  5GPR A;  2ZR6 A;  4GIV A;  1D6O A;  3O5L A;  4JFK A;  3O5F A;  4C02 B;  3O5I A;  2EUL A;  4J4N A;  3O5P A;  4LAW A;  4ODN A;  3PRA A;  4DRN A;  4DRH A;  4AY1 A;  3CGM A;  1GOI A;  3O5G A;  3B9E A;  1W1P A;  3KZ7 A;  3KAC A;  4URI A;  4DIP A;  3IK8 A;  4L72 B;  2DG3 A;  2DSW A;  4W9Q A;  4U86 A;  4WK9 A;  5B8I C;  3IHZ A;  4MAV A;  4ZPV R;  3RM9 A;  3B8S A;  1W1Y A;  4JFL A;  3WIJ A;  1FKJ A;  1ZK6 A;  5D75 A;  1QPF A;  3UQB A;  4QZV B;  3ART A;  2RUD A;  1FKG A;  1U79 A;  5DF0 A;  3EY6 A;  3WH0 A;  3G6L A;  2PV3 A;  1F40 A;  1ZCN A;  2B5U B;  4TNS A;  1HKJ A;  4TYO A;  2XP5 A;  4IQC A;  1NWT A;  1O6I A;  1L1P A;  3WD4 A;  2ZR4 A;  3EIP A;  1KT1 A;  1E6N A;  4ZPW R;  1JNS A;  1ZBC A;  1JCH B;  3CHC A;  1HJX A;  1X6N A;  1NSG A;  1LG1 A;  1PBK A;  2DT1 A;  2G8Z A;  1NWU A;  3ODK A;  2WM0 A;  4JFM A;  4DRP A;  1J4I A;  1X6L A;  2ZQS A;  4ODQ A;  1BKF A;  2P4V A;  3LUO A;  1YW5 A;  2XP3 A;  1IX5 A;  5DO2 A;  4MNJ A;  2IUZ A;  2PN0 A;  2MLY A;  3GTY X;  4ODL A;  3UQA A;  4PTM A;  4HBE A;  5GPG A;  1SYT A;  3TC5 A;  3UI4 A;  1E6Z A;  2XP6 A;  3KAI A;  4MSP A;  3AS1 A;  5I98 A;  1P5Q A;  1KT0 A;  1XHG A;  2DG9 A;  4W9O A;  4HBO A;  4KQZ A;  2O92 A;  4ML4 A;  2PI6 A;  3ALF A;  4ITZ A;  1UR8 A;  2PV2 A;  3PRD A;  2D9F A;  3B7X A;  3OOB A;  4P8W A;  5DIU A;  3WD0 A;  3WQV A;  2ETN A;  3QOK A;  3CH9 A;  4ODP A;  4O2T A;  4MGV A;  2ZR5 A;  3UI5 A;  1XRV A;  3ARY A;  1FKL A;  1ZBK A;  1M5Y A;  2LGO A;  1OGB A;  3O5J A;  5HWC A;  4IT6 A;  2VN1 A;  3VAW A;  2DSU A;  2MPH A;  1EIB A;  2KE0 A;  4P8X A;  1HKK A;  1GUV A;  1GPF A;  1FKS A;  2PPO A;  3CHE A;  3UQI A;  4Q22 A;  3NI6 A;  4JFI A;  1ZBW A;  1D7H A;  1JVW A;  3BMB A;  5HUA A;  1NMW A;  1NWR A;  2RSE A;  1J4R A;  1SR0 A;  2ITK A;  1ZU8 A;  3W4R A;  1N1A A;  1ZL1 A;  4Q7N A;  2DT0 A;  2IF4 A;  3ALG A;  4S3J A;  1FKB A;  2M08 A;  2XPA A;  1JNT A;  3AQU A;  1ROT A;  2PV1 A;  2DPE A;  2F4E A;  2WK2 A;  2ZQT A;  3KCE A;  2XP8 A;  2UZ5 A;  1E6P A;  1FFQ A;  5HT1 A;  3WD1 A;  2OLH A;  1FKR A;  3KAF A;  2FKE A;  1D2K A;  3JXV A;  1W9V A;  3WQW A;  5BXJ A;  3PA7 A;  4IPX A;  3H9R B;  4FN2 A;  4WKF A; 
#chains in the Genus database with same CATH homology
 4Z2G A;  4MTV A;  2LPV A;  3B9D A;  1FKF A;  2ZQU A;  4NNR A;  1C9H A;  4IQ2 A;  4L3N A;  4G50 A;  3NRK A;  1NMV A;  4QT3 A;  4LAX A;  4NZC A;  4BF8 A;  2O9O A;  4XAK A;  3RM8 A;  3ARW A;  3UF8 A;  3ARO A;  4WJX A;  3TCZ A;  1K9T A;  4NSB A;  4U85 A;  4MPK A;  2RUC A;  4R5E A;  2OFN A;  4HAR A;  4WKA A;  3FAP A;  2A3C A;  1Q6H A;  2JZV A;  4JFJ A;  2XP9 A;  3JYJ A;  4Z2K A;  1D7J A;  3WD3 A;  3ARS A;  3CZ8 A;  2LJ4 A;  4FAP A;  1QPL A;  4DWS A;  1ITX A;  1FKD A;  2YBT A;  5DIV A;  2Y78 A;  4ODO A;  1LL6 A;  2PBC A;  3NTP A;  3PRB A;  1LJY A;  3I6C A;  1KFW A;  1ZB5 A;  4Z2I A;  2XP7 A;  1D7I A;  1JND A;  4TW8 A;  3UI6 A;  1LQ0 A;  3O5R A;  4TW7 A;  1EQ3 A;  1W1V A;  2FDM A;  3FY1 A;  1TCO C;  2ZQV A;  2MNT A;  2DSV A;  2K8I A;  3KAB A;  4W9P A;  4GGQ A;  1VF8 A;  2RUR A;  3RFW A;  3KAH A;  4MNM A;  5HKG A;  1OWQ A;  5DIT A;  1FJD A;  2B31 A;  4TX0 A;  4DRO A;  3CHF A;  3O5D A;  1FD9 A;  1TFV A;  3IKD A;  3OA5 A;  2RUQ A;  2N87 A;  1NH6 A;  2A3B A;  5HBF A;  1UR9 A;  1WB0 A;  4DZ2 A;  1H0G A;  4ODR A;  4LAV A;  4DZ3 A;  1EYM A;  1EDQ A;  1PIN A;  1WNO A;  3G6M A;  4LAY A;  4WKH A;  3GPK A;  4P8U A;  1FAP A;  2AOS A;  5JH8 A;  2G41 A;  3RM4 A;  1RD6 A;  2KR7 A;  5HW7 A;  3PR9 A;  1YAT A;  3O5O A;  1J6Y A;  1Q1C A;  2KO7 A;  2MLZ A;  1A7X A;  4DWS C;  1HKM A;  1Y0O A;  2A3E A;  3JYM A;  2AWG A;  4MNK A;  4ODM A;  3ARZ A;  2F2D A;  4ZS6 A;  4DRJ A;  1BL4 A;  2XP4 A;  2Q5A A;  4U84 A;  4DWS D;  1W9P A;  1OGG A;  5DEZ A;  1Q6U A;  3ARP A;  2PPP A;  2FAP A;  3ARV A;  3B9A A;  4S3K A;  1Q6I A;  1FKI A;  1ROU A;  2KFW A;  2QF8 A;  3CGN A;  2MLX A;  2VCD A;  3IKG A;  2DT2 A;  1FKH A;  1LL4 A;  1F8A B;  2L2S A;  1ZBV A;  1QZ2 A;  1HJV A;  2MF9 A;  2DT3 A;  1E15 A;  3AS3 A;  1HXV A;  2KGJ A;  1LL7 A;  4IT4 A;  3MDY B;  2F21 A;  3BXW A;  2M2A A;  4ZPT R;  2PPN A;  4DRI A;  4ODK A;  3ARQ A;  1W1T A;  2ESC A;  1JNE A;  3RGC A;  2KI3 A;  4P8V A;  4DT4 A;  3WKZ A;  3O5E A;  3TDB A;  4QIB A;  1H0I A;  1NWS A;  1FKT A;  2YBU A;  1E6R A;  4TW6 A;  3AS0 A;  1LG2 A;  4WIW A;  4DRQ A;  3CHD A;  1FFR A;  1W26 A;  1T11 A;  3ARX A;  4KR0 B;  2LKN A;  5HTG A;  5HW8 A;  1B6C A;  1WAW A;  3KAD A;  4Z2H A;  3O5K A;  5GQB A;  2M1I A;  5HW6 A;  3WL0 A;  1CTN A;  3WD2 A;  5HWB A;  3AS2 A;  3O5Q A;  2RQS A;  3O5M A;  3ARU A;  4MNL A;  2WLZ A;  3ARR A;  4LGX A;  4Z2J A;  5J6E A;  4J4O A;  4N19 A;  1E9L A;  4DWS B;  1J4H A;  4QT2 A;  1R9H A;  2DG4 A;  4DRM A;  4G2P A;  2WLY A;  1FKK A;  1EHN A;  4DH0 A;  1HKI A;  4DRK A;  2A3A A;  3RME A;  2DSZ A;  4Z2L A;  3WL1 A;  1W9U A;  4W5U A;  1HJW A;  2XPB A;  4JYS A;  4R0X A;  3KAG A;  3FXY A;  5GPR A;  2ZR6 A;  4GIV A;  1D6O A;  3O5L A;  4JFK A;  3O5F A;  4C02 B;  3O5I A;  4J4N A;  3O5P A;  4LAW A;  4ODN A;  3PRA A;  4DRN A;  4DRH A;  4AY1 A;  3CGM A;  3O5G A;  1GOI A;  3B9E A;  1W1P A;  3KZ7 A;  3KAC A;  4URI A;  4DIP A;  3IK8 A;  4L72 B;  2DG3 A;  2DSW A;  4W9Q A;  4U86 A;  4WK9 A;  5B8I C;  3IHZ A;  4MAV A;  4ZPV R;  3RM9 A;  3B8S A;  1W1Y A;  4JFL A;  3WIJ A;  1FKJ A;  1ZK6 A;  5D75 A;  1QPF A;  3UQB A;  4QZV B;  3ART A;  2RUD A;  1FKG A;  1U79 A;  5DF0 A;  3EY6 A;  3WH0 A;  3G6L A;  2PV3 A;  1F40 A;  1ZCN A;  4TNS A;  1HKJ A;  4TYO A;  2XP5 A;  4IQC A;  1NWT A;  1O6I A;  1L1P A;  3WD4 A;  2ZR4 A;  1KT1 A;  1E6N A;  4ZPW R;  1JNS A;  1ZBC A;  3CHC A;  1HJX A;  1X6N A;  1NSG A;  1LG1 A;  1PBK A;  2DT1 A;  2G8Z A;  1NWU A;  3ODK A;  2WM0 A;  4JFM A;  4DRP A;  1J4I A;  1X6L A;  2ZQS A;  4ODQ A;  1BKF A;  3LUO A;  1YW5 A;  2XP3 A;  1IX5 A;  5DO2 A;  4MNJ A;  2IUZ A;  2MLY A;  4ODL A;  3UQA A;  4PTM A;  4HBE A;  5GPG A;  1SYT A;  3TC5 A;  3UI4 A;  1E6Z A;  2XP6 A;  3KAI A;  4MSP A;  3AS1 A;  5I98 A;  1P5Q A;  1KT0 A;  1XHG A;  2DG9 A;  4W9O A;  4HBO A;  4KQZ A;  2O92 A;  4ML4 A;  2PI6 A;  3ALF A;  4ITZ A;  1UR8 A;  2PV2 A;  3PRD A;  2D9F A;  3B7X A;  3OOB A;  4P8W A;  5DIU A;  3WD0 A;  3WQV A;  3QOK A;  3CH9 A;  4ODP A;  4O2T A;  4MGV A;  2ZR5 A;  3UI5 A;  1XRV A;  3ARY A;  1FKL A;  1ZBK A;  1M5Y A;  2LGO A;  1OGB A;  3O5J A;  5HWC A;  4IT6 A;  2VN1 A;  3VAW A;  2DSU A;  2MPH A;  1EIB A;  2KE0 A;  4P8X A;  1HKK A;  1GUV A;  1GPF A;  1FKS A;  2PPO A;  3CHE A;  3UQI A;  4Q22 A;  3NI6 A;  4JFI A;  1ZBW A;  1D7H A;  1JVW A;  5HUA A;  1NMW A;  1NWR A;  2RSE A;  1J4R A;  1SR0 A;  2ITK A;  1ZU8 A;  3W4R A;  1N1A A;  1ZL1 A;  4Q7N A;  2DT0 A;  2IF4 A;  3ALG A;  4S3J A;  1FKB A;  2M08 A;  2XPA A;  1JNT A;  3AQU A;  1ROT A;  2PV1 A;  2DPE A;  2F4E A;  2WK2 A;  2ZQT A;  3KCE A;  2XP8 A;  2UZ5 A;  1E6P A;  1FFQ A;  5HT1 A;  3WD1 A;  2OLH A;  1FKR A;  3KAF A;  2FKE A;  1D2K A;  3JXV A;  1W9V A;  3WQW A;  5BXJ A;  3PA7 A;  4IPX A;  3H9R B;  4FN2 A;  4WKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...