2KE0A

Solution structure of peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
117
structure length
117
Chain Sequence
GPGSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a Burkholderia pseudomallei immunophilin-inhibitor complex reveals new approaches to antimicrobial development.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase
total genus 16
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ke0A00
3GPKA 2M2AA 4LAXA 2VCDA 2IF4A 1NMVA 4DROA 2ZR4A 1FKDA 2DG4A 5HTGA 5HW7A 2PV2A 2F21A 3KAFA 1ROUA 1JVWA 3MDYB 4JFLA 3O5LA 1D7JA 1BKFA 2ZQSA 2ZR5A 4ODPA 4W9OA 2PPPA 2RUCA 1FKKA 3B7XA 2MLYA 4MGVA 4ODKA 2LJ4A 1U79A 3NRKA 4U84A 4QT2A 1Y0OA 3WH0A 4MSPA 2JZVA 1J6YA 1FKFA 1ZCNA 2FAPA 4DZ3A 2XPBA 1J4HA 1EYMA 3O5DA 4TW8A 3O5GA 3O5MA 3O5QA 1YW5A 1BL4A 4DZ2A 3JYMA 4DRHA 3KAHA 2ZR6A 3H9RB 3O5FA 3RGCA 2PPNA 3CGNA 2KO7A 3EY6A 4LAYA 4DRKA 1EQ3A 1FKBA 1W26A 3UQIA 1D7IA 2ZQVA 3LUOA 3OOBA 4ODRA 4ODOA 2LKNA 1TCOC 4JFMA 1L1PA 1ROTA 4IPXA 2K8IA 1FD9A 4TW7A 1YATA 2XP5A 3TCZA 4ODQA 2L2SA 2KFWA 3O5PA 1FKSA 1KT1A 1FKHA 2F4EA 2M1IA 5HT1A 1NMWA 2LGOA 4J4NA 4DRNA 1QZ2A 2AWGA 5DIVA 1C9HA 2XP8A 4NNRA 2F2DA 2MLZA 3KAIA 1FKRA 4G2PA 4LAVA 2XP9A 5HKGA 1FKGA 1FKTA 2FKEA 2UZ5A 1ZK6A 3NTPA 4BF8A 1QPLA 1F40A 2ITKA 4IQCA 2KE0A 2DG9A 4U85A 2KR7A 4DH0A 3IKDA 3TC5A 5B8IC 1D6OA 1A7XA 4QT3A 4FAPA 3O5KA 4DRIA 2N87A 1B6CA 1Q1CA 1FJDA 3KZ7A 1M5YA 3IHZA 4DRPA 1J4IA 4W9PA 4N19A 1FKLA 1FKJA 2Q5AA 2XP3A 3O5RA 5HW6A 2XP7A 1FAPA 1P5QA 2DG3A 1NSGA 2KGJA 5I98A 3KABA 3ODKA 3IKGA 2RURA 4QIBA 1HXVA 4DIPA 4C02B 3UI5A 4ODLA 1FKIA 1KT0A 3CGMA 1F8AB 4IQ2A 3VAWA 5HUAA 3IK8A 3O5JA 1J4RA 1Q6IA 4G50A 5HW8A 3UI4A 2RQSA 2KI3A 2XP4A 4TW6A 4DRQA 2RUDA 4W9QA 4DRMA 1PBKA 4ODMA 3KACA 1N1AA 2VN1A 2MPHA 3JXVA 3KAGA 2D9FA 2LPVA 3O5OA 1D7HA 1QPFA 5BXJA 5HWBA 2MNTA 1PINA 4LAWA 1JNTA 3O5EA 4GGQA 5GPGA 4DRJA 2XP6A 2RUQA 5HWCA 3UQBA 3JYJA 4ODNA 3PRBA 4JFIA 4JFKA 2OFNA 3NI6A 3UQAA 3UI6A 3RFWA 4J4OA 5D75A 3UF8A 1JNSA 4GIVA 2XPAA 4ITZA 4U86A 3PRDA 1T11A 2RSEA 4O2TA 5DIUA 2ZQTA 4TNSA 2M08A 3FAPA 2Y78A 2PBCA 1Q6HA 2PV3A 3PA7A 4JFJA 3TDBA 1Q6UA 3KCEA 4R0XA 1R9HA 4DT4A 3KADA 3I6CA 4TX0A 5DITA 5J6EA 3O5IA 4JYSA 4TYOA 2MLXA 4FN2A 2ZQUA 2MF9A 2PPOA 2PV1A
chains in the Genus database with same CATH superfamily
3GPKA 2DSVA 4LAXA 2DPEA 1FKDA 2PV2A 4MAVA 1JVWA 2QF8A 3MDYB 2ZR5A 2ZQSA 2DSZA 2RUCA 3B7XA 3NRKA 1GRJA 1Y0OA 4MSPA 2JZVA 1FKFA 3RM8A 4DZ3A 2XPBA 1EYMA 2DT1A 3B9DA 3O5GA 5HBFA 3O5MA 1BL4A 3RM9A 2G8ZA 3KAHA 3H9RB 3O5FA 3UQIA 4ODRA 1L1PA 1ROTA 4IPXA 1FD9A 1YATA 4QZVB 3TCZA 4ODQA 2KFWA 5GQBA 1FKHA 2M1IA 4DRNA 3CHDA 3ARRA 3WD4A 1C9HA 4P8UA 4NNRA 3KAIA 2MLZA 1WNOA 2FKEA 1QPLA 1HJVA 3ARVA 1E6PA 1ZBKA 4U85A 2G41A 3TC5A 1A7XA 4DRIA 1B6CA 1M5YA 1ZBVA 4DRPA 2PI6A 4W9PA 2XP3A 3O5RA 1FAPA 2WLZA 2KGJA 3KABA 2ESCA 1HXVA 4WKAA 4C02B 5JH8A 1FKIA 3CGMA 4IQ2A 1LQ0A 4NZCA 4WK9A 1ZB5A 3WL1A 4G50A 4Q7NA 2KI3A 5DO2A 1CTNA 4Z2JA 3KAGA 2MPHA 2D9FA 2LPVA 1D7HA 4MNKA 1PINA 3O5EA 5GPGA 3WQVA 5GPRA 4ODNA 3ALFA 4JFIA 3B8SA 4MNMA 4J4OA 4KR0B 4LGXA 4Z2LA 2ZQTA 2Y78A 4JFJA 4P8WA 1R9HA 1XHGA 2A3CA 3KADA 5DEZA 4TYOA 2ZQUA 2DG4A 5HW7A 3ARSA 4HARA 1H0IA 1LL4A 1FKKA 4MGVA 3AS2A 1W1PA 3WH0A 2LJ4A 5BXJA 3ARTA 3PR9A 4TW8A 3O5QA 1YW5A 2YBTA 3JYMA 4AY1A 3CGNA 2OLHA 3EY6A 1FKBA 3ARUA 3OOBA 4ODOA 3WD1A 2K8IA 1X6LA 2AOSA 1KT1A 1OGBA 1NMWA 2LGOA 2F2DA 4G2PA 4P8XA 1FKGA 1LG2A 2UZ5A 1F40A 2ITKA 2KE0A 2B31A 2KR7A 4DH0A 3GU0A 4IT4A 1FJDA 3IHZA 4DWSC 4Z2HA 4L3NA 2Q5AA 2XP7A 1W9UA 1P5QA 4S3JA 4XAKA 3IKGA 3BMBA 2RURA 4DIPA 4ODLA 2DT0A 3VAWA 1F8AB 4WKFA 3UI4A 2RQSA 4PTMA 4TW6A 1KFWA 2RUDA 3CHCA 1PBKA 1E6ZA 3O5OA 1N1AA 2VN1A 4Z2GA 4LAWA 3PRAA 1HKIA 1NWRA 1LL7A 2OFNA 3UI6A 1NWUA 2WLYA 4URIA 3RFWA 3ARWA 3UF8A 2RSEA 4DWSD 1JNEA 1GOIA 2A3BA 3ARXA 3WL0A 2PV3A 4R0XA 5J6EA 3O5IA 1W1VA 2MLXA 4WIWA 3AS3A 2PPOA 1LJYA 3UQBA 1VF8A 1H0GA 2M2AA 3OA5A 3WQWA 4W5UA 3ARPA 4ZPWR 2F21A 3AROA 3O5LA 1D7JA 1BKFA 1FFRA 2PPPA 1WAWA 2MLYA 4ODKA 4U84A 1OWQA 1SYTA 1IX5A 1ZCNA 2FAPA 3O5DA 2FDMA 3EIPA 4DRHA 2ZR6A 3CHEA 2KO7A 1E44A 4LAYA 2DSWA 2ZQVA 3CHFA 3LUOA 1WB0A 1ZBCA 2LKNA 4JFMA 4MNLA 4TW7A 3O5PA 1FKSA 2F4EA 4ML4A 3AS0A 1QZ2A 5DIVA 2XP8A 3BXWA 1FKRA 1O6IA 2PN0A 2XP9A 5HKGA 3B9AA 3NTPA 4IQCA 4DWSB 2B5UB 5B8IC 1ZL1A 1D6OA 1W9VA 4FAPA 1E15A 3G6LA 2N87A 4ZPTR 2WK2A 3KZ7A 4IT6A 1E9LA 1FKJA 1FFQA 1GUVA 4P8VA 2A3EA 1NH6A 2ETNA 4HBEA 1TFVA 5I98A 3ODKA 3ALGA 3UI5A 5HUAA 3IK8A 4DWSA 1J4RA 5HW8A 2XP4A 3RM4A 4W9QA 4DRMA 4ODMA 3KACA 2O9OA 5DF0A 5HWBA 4Z2IA 4DRJA 1JNTA 2F23A 2RUQA 3CH9A 3JYJA 1SR0A 3PRBA 4JFKA 4R5EA 3B9EA 3NI6A 1K9TA 1LG1A 1ITXA 1JNSA 4GIVA 2XPAA 4ITZA 4U86A 3PRDA 1HJWA 4O2TA 2DSUA 2M08A 5HTGA 1Q6HA 3TDBA 3KCEA 4DT4A 3I6CA 2DT2A 4JYSA 3WD3A 4FN2A 3AQUA 2A3AA 4Z2KA 2VCDA 2IF4A 1NMVA 4DROA 2ZR4A 3GTYX 3KAFA 1ROUA 4JFLA 4NSBA 1GPFA 4ODPA 1OGGA 4W9OA 1U79A 4ZS6A 4QT2A 1J6YA 4KQZA 1UR8A 1J4HA 1W9PA 1LL6A 1EDQA 4DZ2A 3RGCA 2PPNA 3WIJA 4DRKA 4WKHA 1EQ3A 1W26A 2WM0A 1D7IA 1E6NA 1EIBA 4UDMA 1TCOC 1X6NA 2XP5A 2L2SA 5HT1A 3FXYA 4Q22A 4J4NA 1HKKA 2AWGA 4HBOA 3ARYA 1RD6A 4LAVA 1FKTA 4BF8A 2EULA 3QOKA 1ZK6A 3AS1A 1JNDA 3G6MA 2DG9A 3IKDA 4QT3A 3O5KA 1D2KA 1Q1CA 1W1TA 1J4IA 2IUZA 1HKJA 1ZBWA 4MTVA 3FY1A 1FKLA 4N19A 5HW6A 1UR9A 3WD2A 2DG3A 1NSGA 3WD0A 1NWSA 4QIBA 4WJXA 1KT0A 3O5JA 1E6RA 3CZ8A 4L72B 1Q6IA 3ARQA 1XRVA 4DRQA 3RMEA 4S3KA 1W1YA 2PV1A 3JXVA 2YBUA 2DT3A 1QPFA 1EHNA 2MNTA 4GGQA 5HWCA 2XP6A 2O92A 3ARZA 1ZU8A 1JCHB 3UQAA 1NWTA 5D75A 4MNJA 1T11A 5DIUA 4TNSA 2PBCA 3PA7A 4ZPVR 1Q6UA 4TX0A 5DITA 4MPKA 3W4RA 1HKMA 3WKZA 2P4VA 3FAPA 2MF9A 1HJXA
chains in the Genus database with same CATH topology
3GPKA 2DSVA 4LAXA 2DPEA 1FKDA 2PV2A 4MAVA 1JVWA 2QF8A 3MDYB 2ZR5A 2ZQSA 2DSZA 2RUCA 3B7XA 3NRKA 1Y0OA 4MSPA 2JZVA 1FKFA 3RM8A 4DZ3A 2XPBA 1EYMA 2DT1A 3B9DA 3O5GA 5HBFA 3O5MA 1BL4A 3RM9A 2G8ZA 3KAHA 3H9RB 3O5FA 3UQIA 4ODRA 1L1PA 1ROTA 4IPXA 1FD9A 1YATA 4QZVB 3TCZA 4ODQA 2KFWA 5GQBA 1FKHA 2M1IA 4DRNA 3CHDA 3ARRA 3WD4A 1C9HA 4P8UA 4NNRA 3KAIA 2MLZA 1WNOA 2FKEA 1QPLA 1HJVA 3ARVA 1E6PA 1ZBKA 4U85A 2G41A 3TC5A 1A7XA 4DRIA 1B6CA 1M5YA 1ZBVA 4DRPA 2PI6A 4W9PA 2XP3A 3O5RA 1FAPA 2WLZA 2KGJA 3KABA 2ESCA 1HXVA 4WKAA 4C02B 5JH8A 1FKIA 3CGMA 4IQ2A 1LQ0A 4NZCA 4WK9A 1ZB5A 3WL1A 4G50A 4Q7NA 2KI3A 5DO2A 1CTNA 4Z2JA 3KAGA 2MPHA 2D9FA 2LPVA 1D7HA 4MNKA 1PINA 3O5EA 5GPGA 3WQVA 5GPRA 4ODNA 3ALFA 4JFIA 3B8SA 4MNMA 4J4OA 4KR0B 4LGXA 4Z2LA 2ZQTA 2Y78A 4JFJA 4P8WA 1R9HA 1XHGA 2A3CA 3KADA 5DEZA 4TYOA 2ZQUA 2DG4A 5HW7A 3ARSA 4HARA 1H0IA 1LL4A 1FKKA 4MGVA 3AS2A 1W1PA 3WH0A 2LJ4A 5BXJA 3ARTA 3PR9A 4TW8A 3O5QA 1YW5A 2YBTA 3JYMA 4AY1A 3CGNA 2OLHA 3EY6A 1FKBA 3ARUA 3OOBA 4ODOA 3WD1A 2K8IA 1X6LA 2AOSA 1KT1A 1OGBA 1NMWA 2LGOA 2F2DA 4G2PA 4P8XA 1FKGA 1LG2A 2UZ5A 1F40A 2ITKA 2KE0A 2B31A 2KR7A 4DH0A 4IT4A 1FJDA 3IHZA 4DWSC 4Z2HA 4L3NA 2Q5AA 2XP7A 1W9UA 1P5QA 4S3JA 4XAKA 3IKGA 2RURA 4DIPA 4ODLA 2DT0A 3VAWA 1F8AB 4WKFA 3UI4A 2RQSA 4PTMA 4TW6A 1KFWA 2RUDA 3CHCA 1PBKA 1E6ZA 3O5OA 1N1AA 2VN1A 4Z2GA 4LAWA 3PRAA 1HKIA 1NWRA 1LL7A 2OFNA 3UI6A 1NWUA 2WLYA 4URIA 3RFWA 3ARWA 3UF8A 2RSEA 4DWSD 1JNEA 1GOIA 2A3BA 3ARXA 3WL0A 2PV3A 4R0XA 5J6EA 3O5IA 1W1VA 2MLXA 4WIWA 3AS3A 2PPOA 1LJYA 3UQBA 1VF8A 1H0GA 2M2AA 3OA5A 3WQWA 4W5UA 3ARPA 4ZPWR 2F21A 3AROA 3O5LA 1D7JA 1BKFA 1FFRA 2PPPA 1WAWA 2MLYA 4ODKA 4U84A 1OWQA 1SYTA 1IX5A 1ZCNA 2FAPA 3O5DA 2FDMA 4DRHA 2ZR6A 3CHEA 2KO7A 4LAYA 2DSWA 2ZQVA 3CHFA 3LUOA 1WB0A 1ZBCA 2LKNA 4JFMA 4MNLA 4TW7A 3O5PA 1FKSA 2F4EA 4ML4A 3AS0A 1QZ2A 5DIVA 2XP8A 3BXWA 1FKRA 1O6IA 2XP9A 5HKGA 3B9AA 3NTPA 4IQCA 4DWSB 5B8IC 1ZL1A 1D6OA 1W9VA 4FAPA 1E15A 3G6LA 2N87A 4ZPTR 2WK2A 3KZ7A 4IT6A 1E9LA 1FKJA 1FFQA 1GUVA 4P8VA 2A3EA 1NH6A 4HBEA 1TFVA 5I98A 3ODKA 3ALGA 3UI5A 5HUAA 3IK8A 4DWSA 1J4RA 5HW8A 2XP4A 3RM4A 4W9QA 4DRMA 4ODMA 3KACA 2O9OA 5DF0A 5HWBA 4Z2IA 4DRJA 1JNTA 2RUQA 3CH9A 3JYJA 1SR0A 3PRBA 4JFKA 4R5EA 3B9EA 3NI6A 1K9TA 1LG1A 1ITXA 1JNSA 4GIVA 2XPAA 4ITZA 4U86A 3PRDA 1HJWA 4O2TA 2DSUA 2M08A 5HTGA 1Q6HA 3TDBA 3KCEA 4DT4A 3I6CA 2DT2A 4JYSA 3WD3A 4FN2A 3AQUA 2A3AA 4Z2KA 2VCDA 2IF4A 1NMVA 4DROA 2ZR4A 3KAFA 1ROUA 4JFLA 4NSBA 1GPFA 4ODPA 1OGGA 4W9OA 1U79A 4ZS6A 4QT2A 1J6YA 4KQZA 1UR8A 1J4HA 1W9PA 1LL6A 1EDQA 4DZ2A 3RGCA 2PPNA 3WIJA 4DRKA 4WKHA 1EQ3A 1W26A 2WM0A 1D7IA 1E6NA 1EIBA 1TCOC 1X6NA 2XP5A 2L2SA 5HT1A 3FXYA 4Q22A 4J4NA 1HKKA 2AWGA 4HBOA 3ARYA 1RD6A 4LAVA 1FKTA 4BF8A 3QOKA 1ZK6A 3AS1A 1JNDA 3G6MA 2DG9A 3IKDA 4QT3A 3O5KA 1D2KA 1Q1CA 1W1TA 1J4IA 2IUZA 1HKJA 1ZBWA 4MTVA 3FY1A 1FKLA 4N19A 5HW6A 1UR9A 3WD2A 2DG3A 1NSGA 3WD0A 1NWSA 4QIBA 4WJXA 1KT0A 3O5JA 1E6RA 3CZ8A 4L72B 1Q6IA 3ARQA 1XRVA 4DRQA 3RMEA 4S3KA 1W1YA 2PV1A 3JXVA 2YBUA 2DT3A 1QPFA 1EHNA 2MNTA 4GGQA 5HWCA 2XP6A 2O92A 3ARZA 1ZU8A 3UQAA 1NWTA 5D75A 4MNJA 1T11A 5DIUA 4TNSA 2PBCA 3PA7A 4ZPVR 1Q6UA 4TX0A 5DITA 4MPKA 3W4RA 1HKMA 3WKZA 3FAPA 2MF9A 1HJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPK A;  2M2A A;  4LAX A;  2VCD A;  2IF4 A;  1NMV A;  4DRO A;  2ZR4 A;  1FKD A;  2DG4 A;  5HTG A;  5HW7 A;  2PV2 A;  2F21 A;  3KAF A;  1ROU A;  1JVW A;  3MDY B;  4JFL A;  3O5L A;  1D7J A;  1BKF A;  2ZQS A;  2ZR5 A;  4ODP A;  4W9O A;  2PPP A;  2RUC A;  1FKK A;  3B7X A;  2MLY A;  4MGV A;  4ODK A;  2LJ4 A;  1U79 A;  3NRK A;  4U84 A;  4QT2 A;  1Y0O A;  3WH0 A;  4MSP A;  2JZV A;  1J6Y A;  1FKF A;  1ZCN A;  2FAP A;  4DZ3 A;  2XPB A;  1J4H A;  1EYM A;  3O5D A;  4TW8 A;  3O5G A;  3O5M A;  3O5Q A;  1YW5 A;  1BL4 A;  4DZ2 A;  3JYM A;  4DRH A;  3KAH A;  2ZR6 A;  3H9R B;  3O5F A;  3RGC A;  2PPN A;  3CGN A;  2KO7 A;  3EY6 A;  4LAY A;  4DRK A;  1EQ3 A;  1FKB A;  1W26 A;  3UQI A;  1D7I A;  2ZQV A;  3LUO A;  3OOB A;  4ODR A;  4ODO A;  2LKN A;  1TCO C;  4JFM A;  1L1P A;  1ROT A;  4IPX A;  2K8I A;  1FD9 A;  4TW7 A;  1YAT A;  2XP5 A;  3TCZ A;  4ODQ A;  2L2S A;  2KFW A;  3O5P A;  1FKS A;  1KT1 A;  1FKH A;  2F4E A;  2M1I A;  5HT1 A;  1NMW A;  2LGO A;  4J4N A;  4DRN A;  1QZ2 A;  2AWG A;  5DIV A;  1C9H A;  2XP8 A;  4NNR A;  2F2D A;  2MLZ A;  3KAI A;  1FKR A;  4G2P A;  4LAV A;  2XP9 A;  5HKG A;  1FKG A;  1FKT A;  2FKE A;  2UZ5 A;  1ZK6 A;  3NTP A;  4BF8 A;  1QPL A;  1F40 A;  2ITK A;  4IQC A;  2KE0 A;  2DG9 A;  4U85 A;  2KR7 A;  4DH0 A;  3IKD A;  3TC5 A;  5B8I C;  1D6O A;  1A7X A;  4QT3 A;  4FAP A;  3O5K A;  4DRI A;  2N87 A;  1B6C A;  1Q1C A;  1FJD A;  3KZ7 A;  1M5Y A;  3IHZ A;  4DRP A;  1J4I A;  4W9P A;  4N19 A;  1FKL A;  1FKJ A;  2Q5A A;  2XP3 A;  3O5R A;  5HW6 A;  2XP7 A;  1FAP A;  1P5Q A;  2DG3 A;  1NSG A;  2KGJ A;  5I98 A;  3KAB A;  3ODK A;  3IKG A;  2RUR A;  4QIB A;  1HXV A;  4DIP A;  4C02 B;  3UI5 A;  4ODL A;  1FKI A;  1KT0 A;  3CGM A;  1F8A B;  4IQ2 A;  3VAW A;  5HUA A;  3IK8 A;  3O5J A;  1J4R A;  1Q6I A;  4G50 A;  5HW8 A;  3UI4 A;  2RQS A;  2KI3 A;  2XP4 A;  4TW6 A;  4DRQ A;  2RUD A;  4W9Q A;  4DRM A;  1PBK A;  4ODM A;  3KAC A;  1N1A A;  2VN1 A;  2MPH A;  3JXV A;  3KAG A;  2D9F A;  2LPV A;  3O5O A;  1D7H A;  1QPF A;  5BXJ A;  5HWB A;  2MNT A;  1PIN A;  4LAW A;  1JNT A;  3O5E A;  4GGQ A;  5GPG A;  4DRJ A;  2XP6 A;  2RUQ A;  5HWC A;  3UQB A;  3JYJ A;  4ODN A;  3PRB A;  4JFI A;  4JFK A;  2OFN A;  3NI6 A;  3UQA A;  3UI6 A;  3RFW A;  4J4O A;  5D75 A;  3UF8 A;  1JNS A;  4GIV A;  2XPA A;  4ITZ A;  4U86 A;  3PRD A;  1T11 A;  2RSE A;  4O2T A;  5DIU A;  2ZQT A;  4TNS A;  2M08 A;  3FAP A;  2Y78 A;  2PBC A;  1Q6H A;  2PV3 A;  3PA7 A;  4JFJ A;  3TDB A;  1Q6U A;  3KCE A;  4R0X A;  1R9H A;  4DT4 A;  3KAD A;  3I6C A;  4TX0 A;  5DIT A;  5J6E A;  3O5I A;  4JYS A;  4TYO A;  2MLX A;  4FN2 A;  2ZQU A;  2MF9 A;  2PPO A;  2PV1 A; 
#chains in the Genus database with same CATH topology
 3GPK A;  2DSV A;  4LAX A;  2DPE A;  1FKD A;  2PV2 A;  4MAV A;  1JVW A;  2QF8 A;  3MDY B;  2ZR5 A;  2ZQS A;  2DSZ A;  2RUC A;  3B7X A;  3NRK A;  1GRJ A;  1Y0O A;  4MSP A;  2JZV A;  1FKF A;  3RM8 A;  4DZ3 A;  2XPB A;  1EYM A;  2DT1 A;  3B9D A;  3O5G A;  5HBF A;  3O5M A;  1BL4 A;  3RM9 A;  2G8Z A;  3KAH A;  3H9R B;  3O5F A;  3UQI A;  4ODR A;  1L1P A;  1ROT A;  4IPX A;  1FD9 A;  1YAT A;  4QZV B;  3TCZ A;  4ODQ A;  2KFW A;  5GQB A;  1FKH A;  2M1I A;  4DRN A;  3CHD A;  3ARR A;  3WD4 A;  1C9H A;  4P8U A;  4NNR A;  3KAI A;  2MLZ A;  1WNO A;  2FKE A;  1QPL A;  1HJV A;  3ARV A;  1E6P A;  1ZBK A;  4U85 A;  2G41 A;  3TC5 A;  1A7X A;  4DRI A;  1B6C A;  1M5Y A;  1ZBV A;  4DRP A;  2PI6 A;  4W9P A;  2XP3 A;  3O5R A;  1FAP A;  2WLZ A;  2KGJ A;  3KAB A;  2ESC A;  1HXV A;  4WKA A;  4C02 B;  5JH8 A;  1FKI A;  3CGM A;  4IQ2 A;  1LQ0 A;  4NZC A;  4WK9 A;  1ZB5 A;  3WL1 A;  4G50 A;  4Q7N A;  2KI3 A;  5DO2 A;  1CTN A;  4Z2J A;  3KAG A;  2MPH A;  2D9F A;  2LPV A;  1D7H A;  4MNK A;  1PIN A;  3O5E A;  5GPG A;  3WQV A;  5GPR A;  4ODN A;  3ALF A;  4JFI A;  3B8S A;  4MNM A;  4J4O A;  4KR0 B;  4LGX A;  4Z2L A;  2ZQT A;  2Y78 A;  4JFJ A;  4P8W A;  1R9H A;  1XHG A;  2A3C A;  3KAD A;  5DEZ A;  4TYO A;  2ZQU A;  2DG4 A;  5HW7 A;  3ARS A;  4HAR A;  1H0I A;  1LL4 A;  1FKK A;  4MGV A;  3AS2 A;  1W1P A;  3WH0 A;  2LJ4 A;  5BXJ A;  3ART A;  3PR9 A;  4TW8 A;  3O5Q A;  1YW5 A;  2YBT A;  3JYM A;  4AY1 A;  3CGN A;  2OLH A;  3EY6 A;  1FKB A;  3ARU A;  3OOB A;  4ODO A;  3WD1 A;  2K8I A;  1X6L A;  2AOS A;  1KT1 A;  1OGB A;  1NMW A;  2LGO A;  2F2D A;  4G2P A;  4P8X A;  1FKG A;  1LG2 A;  2UZ5 A;  1F40 A;  2ITK A;  2KE0 A;  2B31 A;  2KR7 A;  4DH0 A;  3GU0 A;  4IT4 A;  1FJD A;  3IHZ A;  4DWS C;  4Z2H A;  4L3N A;  2Q5A A;  2XP7 A;  1W9U A;  1P5Q A;  4S3J A;  4XAK A;  3IKG A;  3BMB A;  2RUR A;  4DIP A;  4ODL A;  2DT0 A;  3VAW A;  1F8A B;  4WKF A;  3UI4 A;  2RQS A;  4PTM A;  4TW6 A;  1KFW A;  2RUD A;  3CHC A;  1PBK A;  1E6Z A;  3O5O A;  1N1A A;  2VN1 A;  4Z2G A;  4LAW A;  3PRA A;  1HKI A;  1NWR A;  1LL7 A;  2OFN A;  3UI6 A;  1NWU A;  2WLY A;  4URI A;  3RFW A;  3ARW A;  3UF8 A;  2RSE A;  4DWS D;  1JNE A;  1GOI A;  2A3B A;  3ARX A;  3WL0 A;  2PV3 A;  4R0X A;  5J6E A;  3O5I A;  1W1V A;  2MLX A;  4WIW A;  3AS3 A;  2PPO A;  1LJY A;  3UQB A;  1VF8 A;  1H0G A;  2M2A A;  3OA5 A;  3WQW A;  4W5U A;  3ARP A;  4ZPW R;  2F21 A;  3ARO A;  3O5L A;  1D7J A;  1BKF A;  1FFR A;  2PPP A;  1WAW A;  2MLY A;  4ODK A;  4U84 A;  1OWQ A;  1SYT A;  1IX5 A;  1ZCN A;  2FAP A;  3O5D A;  2FDM A;  3EIP A;  4DRH A;  2ZR6 A;  3CHE A;  2KO7 A;  1E44 A;  4LAY A;  2DSW A;  2ZQV A;  3CHF A;  3LUO A;  1WB0 A;  1ZBC A;  2LKN A;  4JFM A;  4MNL A;  4TW7 A;  3O5P A;  1FKS A;  2F4E A;  4ML4 A;  3AS0 A;  1QZ2 A;  5DIV A;  2XP8 A;  3BXW A;  1FKR A;  1O6I A;  2PN0 A;  2XP9 A;  5HKG A;  3B9A A;  3NTP A;  4IQC A;  4DWS B;  2B5U B;  5B8I C;  1ZL1 A;  1D6O A;  1W9V A;  4FAP A;  1E15 A;  3G6L A;  2N87 A;  4ZPT R;  2WK2 A;  3KZ7 A;  4IT6 A;  1E9L A;  1FKJ A;  1FFQ A;  1GUV A;  4P8V A;  2A3E A;  1NH6 A;  2ETN A;  4HBE A;  1TFV A;  5I98 A;  3ODK A;  3ALG A;  3UI5 A;  5HUA A;  3IK8 A;  4DWS A;  1J4R A;  5HW8 A;  2XP4 A;  3RM4 A;  4W9Q A;  4DRM A;  4ODM A;  3KAC A;  2O9O A;  5DF0 A;  5HWB A;  4Z2I A;  4DRJ A;  1JNT A;  2F23 A;  2RUQ A;  3CH9 A;  3JYJ A;  1SR0 A;  3PRB A;  4JFK A;  4R5E A;  3B9E A;  3NI6 A;  1K9T A;  1LG1 A;  1ITX A;  1JNS A;  4GIV A;  2XPA A;  4ITZ A;  4U86 A;  3PRD A;  1HJW A;  4O2T A;  2DSU A;  2M08 A;  5HTG A;  1Q6H A;  3TDB A;  3KCE A;  4DT4 A;  3I6C A;  2DT2 A;  4JYS A;  3WD3 A;  4FN2 A;  3AQU A;  2A3A A;  4Z2K A;  2VCD A;  2IF4 A;  1NMV A;  4DRO A;  2ZR4 A;  3GTY X;  3KAF A;  1ROU A;  4JFL A;  4NSB A;  1GPF A;  4ODP A;  1OGG A;  4W9O A;  1U79 A;  4ZS6 A;  4QT2 A;  1J6Y A;  4KQZ A;  1UR8 A;  1J4H A;  1W9P A;  1LL6 A;  1EDQ A;  4DZ2 A;  3RGC A;  2PPN A;  3WIJ A;  4DRK A;  4WKH A;  1EQ3 A;  1W26 A;  2WM0 A;  1D7I A;  1E6N A;  1EIB A;  4UDM A;  1TCO C;  1X6N A;  2XP5 A;  2L2S A;  5HT1 A;  3FXY A;  4Q22 A;  4J4N A;  1HKK A;  2AWG A;  4HBO A;  3ARY A;  1RD6 A;  4LAV A;  1FKT A;  4BF8 A;  2EUL A;  3QOK A;  1ZK6 A;  3AS1 A;  1JND A;  3G6M A;  2DG9 A;  3IKD A;  4QT3 A;  3O5K A;  1D2K A;  1Q1C A;  1W1T A;  1J4I A;  2IUZ A;  1HKJ A;  1ZBW A;  4MTV A;  3FY1 A;  1FKL A;  4N19 A;  5HW6 A;  1UR9 A;  3WD2 A;  2DG3 A;  1NSG A;  3WD0 A;  1NWS A;  4QIB A;  4WJX A;  1KT0 A;  3O5J A;  1E6R A;  3CZ8 A;  4L72 B;  1Q6I A;  3ARQ A;  1XRV A;  4DRQ A;  3RME A;  4S3K A;  1W1Y A;  2PV1 A;  3JXV A;  2YBU A;  2DT3 A;  1QPF A;  1EHN A;  2MNT A;  4GGQ A;  5HWC A;  2XP6 A;  2O92 A;  3ARZ A;  1ZU8 A;  1JCH B;  3UQA A;  1NWT A;  5D75 A;  4MNJ A;  1T11 A;  5DIU A;  4TNS A;  2PBC A;  3PA7 A;  4ZPV R;  1Q6U A;  4TX0 A;  5DIT A;  4MPK A;  3W4R A;  1HKM A;  3WKZ A;  2P4V A;  3FAP A;  2MF9 A;  1HJX A; 
#chains in the Genus database with same CATH homology
 3GPK A;  2DSV A;  4LAX A;  2DPE A;  1FKD A;  2PV2 A;  4MAV A;  1JVW A;  2QF8 A;  3MDY B;  2ZR5 A;  2ZQS A;  2DSZ A;  2RUC A;  3B7X A;  3NRK A;  1Y0O A;  4MSP A;  2JZV A;  1FKF A;  3RM8 A;  4DZ3 A;  2XPB A;  1EYM A;  2DT1 A;  3B9D A;  3O5G A;  5HBF A;  3O5M A;  1BL4 A;  3RM9 A;  2G8Z A;  3KAH A;  3H9R B;  3O5F A;  3UQI A;  4ODR A;  1L1P A;  1ROT A;  4IPX A;  1FD9 A;  1YAT A;  4QZV B;  3TCZ A;  4ODQ A;  2KFW A;  5GQB A;  1FKH A;  2M1I A;  4DRN A;  3CHD A;  3ARR A;  3WD4 A;  1C9H A;  4P8U A;  4NNR A;  3KAI A;  2MLZ A;  1WNO A;  2FKE A;  1QPL A;  1HJV A;  3ARV A;  1E6P A;  1ZBK A;  4U85 A;  2G41 A;  3TC5 A;  1A7X A;  4DRI A;  1B6C A;  1M5Y A;  1ZBV A;  4DRP A;  2PI6 A;  4W9P A;  2XP3 A;  3O5R A;  1FAP A;  2WLZ A;  2KGJ A;  3KAB A;  2ESC A;  1HXV A;  4WKA A;  4C02 B;  5JH8 A;  1FKI A;  3CGM A;  4IQ2 A;  1LQ0 A;  4NZC A;  4WK9 A;  1ZB5 A;  3WL1 A;  4G50 A;  4Q7N A;  2KI3 A;  5DO2 A;  1CTN A;  4Z2J A;  3KAG A;  2MPH A;  2D9F A;  2LPV A;  1D7H A;  4MNK A;  1PIN A;  3O5E A;  5GPG A;  3WQV A;  5GPR A;  4ODN A;  3ALF A;  4JFI A;  3B8S A;  4MNM A;  4J4O A;  4KR0 B;  4LGX A;  4Z2L A;  2ZQT A;  2Y78 A;  4JFJ A;  4P8W A;  1R9H A;  1XHG A;  2A3C A;  3KAD A;  5DEZ A;  4TYO A;  2ZQU A;  2DG4 A;  5HW7 A;  3ARS A;  4HAR A;  1H0I A;  1LL4 A;  1FKK A;  4MGV A;  3AS2 A;  1W1P A;  3WH0 A;  2LJ4 A;  5BXJ A;  3ART A;  3PR9 A;  4TW8 A;  3O5Q A;  1YW5 A;  2YBT A;  3JYM A;  4AY1 A;  3CGN A;  2OLH A;  3EY6 A;  1FKB A;  3ARU A;  3OOB A;  4ODO A;  3WD1 A;  2K8I A;  1X6L A;  2AOS A;  1KT1 A;  1OGB A;  1NMW A;  2LGO A;  2F2D A;  4G2P A;  4P8X A;  1FKG A;  1LG2 A;  2UZ5 A;  1F40 A;  2ITK A;  2KE0 A;  2B31 A;  2KR7 A;  4DH0 A;  4IT4 A;  1FJD A;  3IHZ A;  4DWS C;  4Z2H A;  4L3N A;  2Q5A A;  2XP7 A;  1W9U A;  1P5Q A;  4S3J A;  4XAK A;  3IKG A;  2RUR A;  4DIP A;  4ODL A;  2DT0 A;  3VAW A;  1F8A B;  4WKF A;  3UI4 A;  2RQS A;  4PTM A;  4TW6 A;  1KFW A;  2RUD A;  3CHC A;  1PBK A;  1E6Z A;  3O5O A;  1N1A A;  2VN1 A;  4Z2G A;  4LAW A;  3PRA A;  1HKI A;  1NWR A;  1LL7 A;  2OFN A;  3UI6 A;  1NWU A;  2WLY A;  4URI A;  3RFW A;  3ARW A;  3UF8 A;  2RSE A;  4DWS D;  1JNE A;  1GOI A;  2A3B A;  3ARX A;  3WL0 A;  2PV3 A;  4R0X A;  5J6E A;  3O5I A;  1W1V A;  2MLX A;  4WIW A;  3AS3 A;  2PPO A;  1LJY A;  3UQB A;  1VF8 A;  1H0G A;  2M2A A;  3OA5 A;  3WQW A;  4W5U A;  3ARP A;  4ZPW R;  2F21 A;  3ARO A;  3O5L A;  1D7J A;  1BKF A;  1FFR A;  2PPP A;  1WAW A;  2MLY A;  4ODK A;  4U84 A;  1OWQ A;  1SYT A;  1IX5 A;  1ZCN A;  2FAP A;  3O5D A;  2FDM A;  4DRH A;  2ZR6 A;  3CHE A;  2KO7 A;  4LAY A;  2DSW A;  2ZQV A;  3CHF A;  3LUO A;  1WB0 A;  1ZBC A;  2LKN A;  4JFM A;  4MNL A;  4TW7 A;  3O5P A;  1FKS A;  2F4E A;  4ML4 A;  3AS0 A;  1QZ2 A;  5DIV A;  2XP8 A;  3BXW A;  1FKR A;  1O6I A;  2XP9 A;  5HKG A;  3B9A A;  3NTP A;  4IQC A;  4DWS B;  5B8I C;  1ZL1 A;  1D6O A;  1W9V A;  4FAP A;  1E15 A;  3G6L A;  2N87 A;  4ZPT R;  2WK2 A;  3KZ7 A;  4IT6 A;  1E9L A;  1FKJ A;  1FFQ A;  1GUV A;  4P8V A;  2A3E A;  1NH6 A;  4HBE A;  1TFV A;  5I98 A;  3ODK A;  3ALG A;  3UI5 A;  5HUA A;  3IK8 A;  4DWS A;  1J4R A;  5HW8 A;  2XP4 A;  3RM4 A;  4W9Q A;  4DRM A;  4ODM A;  3KAC A;  2O9O A;  5DF0 A;  5HWB A;  4Z2I A;  4DRJ A;  1JNT A;  2RUQ A;  3CH9 A;  3JYJ A;  1SR0 A;  3PRB A;  4JFK A;  4R5E A;  3B9E A;  3NI6 A;  1K9T A;  1LG1 A;  1ITX A;  1JNS A;  4GIV A;  2XPA A;  4ITZ A;  4U86 A;  3PRD A;  1HJW A;  4O2T A;  2DSU A;  2M08 A;  5HTG A;  1Q6H A;  3TDB A;  3KCE A;  4DT4 A;  3I6C A;  2DT2 A;  4JYS A;  3WD3 A;  4FN2 A;  3AQU A;  2A3A A;  4Z2K A;  2VCD A;  2IF4 A;  1NMV A;  4DRO A;  2ZR4 A;  3KAF A;  1ROU A;  4JFL A;  4NSB A;  1GPF A;  4ODP A;  1OGG A;  4W9O A;  1U79 A;  4ZS6 A;  4QT2 A;  1J6Y A;  4KQZ A;  1UR8 A;  1J4H A;  1W9P A;  1LL6 A;  1EDQ A;  4DZ2 A;  3RGC A;  2PPN A;  3WIJ A;  4DRK A;  4WKH A;  1EQ3 A;  1W26 A;  2WM0 A;  1D7I A;  1E6N A;  1EIB A;  1TCO C;  1X6N A;  2XP5 A;  2L2S A;  5HT1 A;  3FXY A;  4Q22 A;  4J4N A;  1HKK A;  2AWG A;  4HBO A;  3ARY A;  1RD6 A;  4LAV A;  1FKT A;  4BF8 A;  3QOK A;  1ZK6 A;  3AS1 A;  1JND A;  3G6M A;  2DG9 A;  3IKD A;  4QT3 A;  3O5K A;  1D2K A;  1Q1C A;  1W1T A;  1J4I A;  2IUZ A;  1HKJ A;  1ZBW A;  4MTV A;  3FY1 A;  1FKL A;  4N19 A;  5HW6 A;  1UR9 A;  3WD2 A;  2DG3 A;  1NSG A;  3WD0 A;  1NWS A;  4QIB A;  4WJX A;  1KT0 A;  3O5J A;  1E6R A;  3CZ8 A;  4L72 B;  1Q6I A;  3ARQ A;  1XRV A;  4DRQ A;  3RME A;  4S3K A;  1W1Y A;  2PV1 A;  3JXV A;  2YBU A;  2DT3 A;  1QPF A;  1EHN A;  2MNT A;  4GGQ A;  5HWC A;  2XP6 A;  2O92 A;  3ARZ A;  1ZU8 A;  3UQA A;  1NWT A;  5D75 A;  4MNJ A;  1T11 A;  5DIU A;  4TNS A;  2PBC A;  3PA7 A;  4ZPV R;  1Q6U A;  4TX0 A;  5DIT A;  4MPK A;  3W4R A;  1HKM A;  3WKZ A;  3FAP A;  2MF9 A;  1HJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...