4DH0A

X-ray crystal structure of 28-o-methylrapamycin complexed with fkbp12: is the cyclohexyl moiety part of the effector domain of rapamycin?
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
publication title X-ray Crystal Structure of 28-O-Methylrapamycin complexed with FKBP12: Is the Cyclohexyl Moiety Part of the Effector Domain of Rapamycin?
doi rcsb
source organism Homo sapiens
molecule tags Isomerase/immunosuppressant
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dh0A00
3KZ7A 1M5YA 1ZK6A 2XP5A 5HW8A 4GGQA 2UZ5A 3CGMA 3I6CA 5DIVA 2VCDA 3O5QA 4U85A 2F4EA 4MSPA 3TC5A 1Y0OA 4FN2A 4LAWA 3UI4A 4DRKA 4TW6A 5DIUA 4DIPA 4QIBA 4G2PA 3UI5A 3KAHA 4JFKA 2XP3A 1FKFA 1QPFA 1FKTA 4JYSA 1FKDA 2ZQSA 4W9OA 2RUQA 3H9RB 3KACA 2K8IA 1W26A 2M1IA 4ODNA 5DITA 5J6EA 2DG3A 1J6YA 1F40A 3KCEA 1FKKA 4JFIA 1FKHA 5HWCA 3KABA 3UQIA 5HT1A 2ZQVA 3IK8A 4W9QA 1BKFA 3TCZA 1FAPA 3TDBA 1P5QA 4ODOA 3LUOA 2KR7A 3NTPA 4DZ2A 3CGNA 3O5GA 5D75A 2FAPA 4JFMA 2LGOA 1Q6HA 2ZR4A 2PV3A 1F8AB 2DG4A 3O5IA 1FKBA 4ODMA 4DRIA 2RQSA 3PRDA 1L1PA 4ODRA 3O5PA 1J4RA 2Q5AA 1HXVA 3KAIA 2LJ4A 3O5JA 2DG9A 3PA7A 2ZQTA 1QZ2A 4R0XA 2PV1A 3GPKA 4TW8A 4DRMA 2MLZA 4TX0A 4IQCA 5B8IC 3UQAA 1JNTA 3IHZA 3MDYB 2M2AA 4N19A 5BXJA 2JZVA 3B7XA 4ITZA 1YATA 2XP7A 2XP6A 1ZCNA 4ODLA 2IF4A 3KAFA 4TW7A 4DRJA 2LKNA 3UQBA 1D6OA 1J4HA 1FKLA 1PBKA 4NNRA 2ITKA 3EY6A 3KAGA 1J4IA 4C02B 3PRBA 4IQ2A 1EQ3A 2ZR6A 4W9PA 5HW7A 3FAPA 1D7IA 4BF8A 1D7JA 2VN1A 1YW5A 1TCOC 1KT0A 4JFJA 3IKDA 2XP4A 3JYMA 2PPOA 2KFWA 3WH0A 3RGCA 2RURA 1ROTA 4ODQA 3O5RA 4DROA 3OOBA 1FKRA 1KT1A 4LAYA 2XPBA 2MLYA 4TYOA 4IPXA 3IKGA 4DRPA 1T11A 2F21A 2N87A 2RUCA 3VAWA 3ODKA 1FKGA 1QPLA 3O5FA 2FKEA 2M08A 1R9HA 4LAXA 1A7XA 1FD9A 2XP8A 1JNSA 1PINA 2ZR5A 5GPGA 2MF9A 1NSGA 2KE0A 1FKJA 1FKSA 1NMWA 2KGJA 2OFNA 4MGVA 3NRKA 4DRHA 5HUAA 5I98A 2MLXA 4J4OA 4JFLA 3O5EA 4ODPA 1EYMA 4QT3A 4DT4A 2LPVA 2PPNA 5HWBA 2XPAA 1Q1CA 2MNTA 2PBCA 2L2SA 3UI6A 4QT2A 1BL4A 1NMVA 4U86A 3NI6A 2PPPA 2RUDA 4ODKA 3O5DA 2D9FA 1FKIA 2KI3A 2Y78A 4U84A 3UF8A 4J4NA 4TNSA 4DH0A 1ROUA 4DRNA 4DZ3A 2AWGA 5HKGA 1Q6UA 3JXVA 2XP9A 4GIVA 1B6CA 1Q6IA 3O5MA 3O5LA 2ZQUA 3KADA 4LAVA 3RFWA 4G50A 2KO7A 1FJDA 2F2DA 2MPHA 4FAPA 1N1AA 3JYJA 5HTGA 3O5OA 1C9HA 1JVWA 4DRQA 2PV2A 3O5KA 4O2TA 1U79A 5HW6A 1D7HA 2RSEA
chains in the Genus database with same CATH superfamily
3KZ7A 4P8UA 3VAWA 4U85A 3TC5A 1Y0OA 3B9EA 4DRKA 5DIUA 1JNDA 1FKFA 1QPFA 4URIA 2RUQA 4Z2KA 1W26A 2DT2A 4JFIA 1EHNA 1ZBCA 1SYTA 3CGNA 3CHDA 3GTYX 2LGOA 3PR9A 1XRVA 2ZR4A 1F8AB 1E6NA 2FDMA 1HKKA 2LJ4A 2A3BA 3O5JA 3AROA 4R0XA 3EIPA 1JNTA 3MDYB 1FFQA 2JZVA 2XP6A 4KR0B 1NWUA 2IF4A 4DRJA 1J4HA 1PBKA 2DT1A 3WD3A 2B5UB 4C02B 3WD1A 1OWQA 2B31A 5HW7A 1D7IA 4BF8A 3RMEA 1ZU8A 1JCHB 2XP4A 2KFWA 1WB0A 3OOBA 3OA5A 4IPXA 3AQUA 4DRPA 1T11A 2RUCA 3ODKA 1FKGA 1LL4A 4W5UA 2M08A 1JNSA 1PINA 1GUVA 3AS2A 5GPGA 5DO2A 3NRKA 2PN0A 1HKMA 3O5EA 1W1TA 2MNTA 5GPRA 2WLYA 4Z2HA 1NMVA 2RUDA 2D9FA 3ARQA 2KI3A 1HJXA 5GQBA 4U84A 1GRJA 5HWCA 2XP9A 3O5LA 3RM4A 1FJDA 2O9OA 3WD2A 4FAPA 2A3CA 1C9HA 4DRQA 2PV2A 1D7HA 2ETNA 1M5YA 1ZK6A 1ZBVA 4MNJA 5HW8A 5DIVA 3CHFA 4MSPA 4FN2A 3ARVA 4LAWA 3UI4A 4G2PA 4W9OA 3H9RB 1J6YA 3KACA 2K8IA 4ODNA 1W9UA 3BXWA 2DG3A 1LQ0A 1FKKA 1FKHA 2OLHA 3IK8A 4W9QA 1BKFA 1NWTA 3ARUA 1FAPA 3TDBA 4ODOA 4JFMA 4Z2IA 1Q6HA 2PV3A 2DG4A 3ARWA 1FKBA 4ODMA 1E15A 1WAWA 2Q5AA 3ARZA 3WL1A 1TFVA 1KFWA 2G41A 2DG9A 2ZQTA 2PV1A 1W1YA 4DRMA 4Q7NA 4IQCA 3IHZA 1NWSA 4N19A 2XP7A 1ZCNA 1ZBWA 1JNEA 3AS1A 3KAFA 2ITKA 3KAGA 1J4IA 1H0GA 2WM0A 1NH6A 4IQ2A 4HBOA 3RM9A 3FAPA 4MPKA 1LG1A 1YW5A 1TCOC 1H0IA 4JFJA 4ZPTR 2DSVA 4DROA 3IKGA 4IT6A 2N87A 4ZS6A 1K9TA 2DSUA 2FKEA 1A7XA 2IUZA 1UR8A 5HBFA 3CHCA 4MNMA 1NSGA 2KGJA 1NMWA 1FKSA 4DRHA 4MGVA 5HUAA 4MAVA 4ZPVR 2MLXA 3PRAA 1EYMA 5HWBA 3B8SA 2L2SA 3UI6A 4R5EA 4U86A 2DT3A 3O5DA 4AY1A 4P8XA 4NSBA 4DZ3A 4ZPWR 4P8WA 2DPEA 3ARRA 4GIVA 3O5MA 2ZQUA 3KADA 4MNLA 1CTNA 2A3AA 1E6PA 1N1AA 3G6MA 3O5OA 4HARA 1RD6A 1X6LA 1EIBA 1GOIA 2PI6A 3CGMA 3I6CA 4XAKA 2QF8A 4TW6A 4QIBA 3KAHA 2XP3A 5DF0A 1FKDA 1ZBKA 5DITA 3KCEA 3W4RA 5HT1A 2ZQVA 3TCZA 3WQVA 3LUOA 2KR7A 3NTPA 4DZ2A 3O5GA 1X6NA 3BMBA 1W1VA 3O5IA 2RQSA 4QZVB 1L1PA 4ODRA 3O5PA 1J4RA 4WKHA 3ARXA 2DSWA 4DWSD 3PA7A 2ESCA 3GPKA 4TW8A 2MLZA 3CZ8A 3UQAA 3B7XA 1XHGA 1LJYA 2LKNA 1D2KA 1FKLA 4NNRA 4NZCA 3EY6A 3G6LA 3PRBA 3WQWA 2WK2A 2VN1A 3RM8A 1E44A 1VF8A 4P8VA 1LL7A 3JYMA 3WKZA 4WKFA 5HW6A 2RURA 4ODQA 3ARYA 1FKRA 1KT1A 4TYOA 2F21A 2WLZA 1QPLA 3O5FA 1E9LA 3ARPA 1OGGA 3B9DA 3WD0A 3AS3A 2F23A 1FKJA 2KE0A 5J6EA 5I98A 4J4OA 5HTGA 4JFLA 1W9PA 1HJWA 4ODPA 2LPVA 2PPNA 4WK9A 4L72B 1GPFA 4QT2A 1BL4A 2P4VA 3NI6A 4ODKA 4HBEA 1FKIA 4Q22A 1ITXA 5HKGA 4TNSA 4DH0A 4DRNA 2AWGA 1SR0A 1B6CA 3CHEA 1E6ZA 2KO7A 2F2DA 2MPHA 4KQZA 3FXYA 1LL6A 2G8ZA 2XP5A 1UR9A 4GGQA 2UZ5A 3UF8A 2VCDA 3O5QA 2F4EA 4DWSB 4DWSA 1IX5A 4DIPA 3UI5A 4JFKA 2O92A 1FKTA 4JYSA 2ZQSA 1F40A 2M1IA 3WIJA 1W9VA 3ALGA 3KABA 3QOKA 3UQIA 4PTMA 1P5QA 1HKJA 5D75A 2FAPA 4DRIA 3PRDA 1HXVA 3KAIA 1QZ2A 1E6RA 5DEZA 4TX0A 5B8IC 2M2AA 5BXJA 4ITZA 4S3KA 1YATA 3ARSA 2YBTA 3ALFA 4ODLA 4S3JA 4TW7A 3UQBA 1D6OA 2EULA 1ZB5A 1WNOA 4MNKA 4WJXA 4DWSC 3WL0A 2DT0A 2ZR6A 1EQ3A 4W9PA 1D7JA 1KT0A 3B9AA 3IKDA 4UDMA 2PPOA 3WH0A 3RGCA 4L3NA 1ROTA 3O5RA 4WKAA 4LAYA 2XPBA 2MLYA 3WD4A 1O6IA 4Z2JA 5JH8A 1R9HA 4LAXA 1ZL1A 1FD9A 1W1PA 2XP8A 2ZR5A 2MF9A 4WIWA 2OFNA 3CH9A 4LGXA 4QT3A 4DT4A 2XPAA 1Q1CA 1HKIA 2PBCA 4IT4A 2PPPA 2Y78A 4J4NA 1FFRA 4MTVA 1OGBA 1ROUA 1HJVA 1NWRA 1Q6UA 3JXVA 4ML4A 1Q6IA 4LAVA 4Z2LA 3RFWA 4G50A 3AS0A 2A3EA 2YBUA 3ARTA 2AOSA 3FY1A 1EDQA 3JYJA 1JVWA 1LG2A 2DSZA 3O5KA 4O2TA 1U79A 4Z2GA 3GU0A 2RSEA
chains in the Genus database with same CATH topology
3KZ7A 4P8UA 3VAWA 4U85A 3TC5A 1Y0OA 3B9EA 4DRKA 5DIUA 1JNDA 1FKFA 1QPFA 4URIA 2RUQA 4Z2KA 1W26A 2DT2A 4JFIA 1EHNA 1ZBCA 1SYTA 3CGNA 3CHDA 2LGOA 3PR9A 1XRVA 2ZR4A 1F8AB 1E6NA 2FDMA 1HKKA 2LJ4A 2A3BA 3O5JA 3AROA 4R0XA 1JNTA 3MDYB 1FFQA 2JZVA 2XP6A 4KR0B 1NWUA 2IF4A 4DRJA 1J4HA 1PBKA 2DT1A 3WD3A 4C02B 3WD1A 1OWQA 2B31A 5HW7A 1D7IA 4BF8A 3RMEA 1ZU8A 2XP4A 2KFWA 1WB0A 3OOBA 3OA5A 4IPXA 3AQUA 4DRPA 1T11A 2RUCA 3ODKA 1FKGA 1LL4A 4W5UA 2M08A 1JNSA 1PINA 1GUVA 3AS2A 5GPGA 5DO2A 3NRKA 1HKMA 3O5EA 1W1TA 2MNTA 5GPRA 2WLYA 4Z2HA 1NMVA 2RUDA 2D9FA 3ARQA 2KI3A 1HJXA 5GQBA 4U84A 5HWCA 2XP9A 3O5LA 3RM4A 1FJDA 2O9OA 3WD2A 4FAPA 2A3CA 1C9HA 4DRQA 2PV2A 1D7HA 1M5YA 1ZK6A 1ZBVA 4MNJA 5HW8A 5DIVA 3CHFA 4MSPA 4FN2A 3ARVA 4LAWA 3UI4A 4G2PA 4W9OA 3H9RB 1J6YA 3KACA 2K8IA 4ODNA 1W9UA 3BXWA 2DG3A 1LQ0A 1FKKA 1FKHA 2OLHA 3IK8A 4W9QA 1BKFA 1NWTA 3ARUA 1FAPA 3TDBA 4ODOA 4JFMA 4Z2IA 1Q6HA 2PV3A 2DG4A 3ARWA 1FKBA 4ODMA 1E15A 1WAWA 2Q5AA 3ARZA 3WL1A 1TFVA 1KFWA 2G41A 2DG9A 2ZQTA 2PV1A 1W1YA 4DRMA 4Q7NA 4IQCA 3IHZA 1NWSA 4N19A 2XP7A 1ZCNA 1ZBWA 1JNEA 3AS1A 3KAFA 2ITKA 3KAGA 1J4IA 1H0GA 2WM0A 1NH6A 4IQ2A 4HBOA 3RM9A 3FAPA 4MPKA 1LG1A 1YW5A 1TCOC 1H0IA 4JFJA 4ZPTR 2DSVA 4DROA 3IKGA 4IT6A 2N87A 4ZS6A 1K9TA 2DSUA 2FKEA 1A7XA 2IUZA 1UR8A 5HBFA 3CHCA 4MNMA 1NSGA 2KGJA 1NMWA 1FKSA 4DRHA 4MGVA 5HUAA 4MAVA 4ZPVR 2MLXA 3PRAA 1EYMA 5HWBA 3B8SA 2L2SA 3UI6A 4R5EA 4U86A 2DT3A 3O5DA 4AY1A 4P8XA 4NSBA 4DZ3A 4ZPWR 4P8WA 2DPEA 3ARRA 4GIVA 3O5MA 2ZQUA 3KADA 4MNLA 1CTNA 2A3AA 1E6PA 1N1AA 3G6MA 3O5OA 4HARA 1RD6A 1X6LA 1EIBA 1GOIA 2PI6A 3CGMA 3I6CA 4XAKA 2QF8A 4TW6A 4QIBA 3KAHA 2XP3A 5DF0A 1FKDA 1ZBKA 5DITA 3KCEA 3W4RA 5HT1A 2ZQVA 3TCZA 3WQVA 3LUOA 2KR7A 3NTPA 4DZ2A 3O5GA 1X6NA 1W1VA 3O5IA 2RQSA 4QZVB 1L1PA 4ODRA 3O5PA 1J4RA 4WKHA 3ARXA 2DSWA 4DWSD 3PA7A 2ESCA 3GPKA 4TW8A 2MLZA 3CZ8A 3UQAA 3B7XA 1XHGA 1LJYA 2LKNA 1D2KA 1FKLA 4NNRA 4NZCA 3EY6A 3G6LA 3PRBA 3WQWA 2WK2A 2VN1A 3RM8A 1VF8A 4P8VA 1LL7A 3JYMA 3WKZA 4WKFA 2RURA 4ODQA 3ARYA 1FKRA 1KT1A 4TYOA 2F21A 2WLZA 1QPLA 3O5FA 1E9LA 3ARPA 1OGGA 3B9DA 3WD0A 3AS3A 2KE0A 1FKJA 5J6EA 5I98A 4J4OA 5HTGA 4JFLA 1W9PA 1HJWA 4ODPA 2LPVA 2PPNA 4WK9A 4L72B 1GPFA 4QT2A 1BL4A 3NI6A 4ODKA 4HBEA 1FKIA 4Q22A 1ITXA 5HKGA 4TNSA 4DH0A 4DRNA 2AWGA 1SR0A 1B6CA 3CHEA 1E6ZA 2KO7A 2F2DA 2MPHA 4KQZA 3FXYA 1LL6A 2G8ZA 2XP5A 1UR9A 4GGQA 2UZ5A 3UF8A 2VCDA 3O5QA 2F4EA 4DWSB 4DWSA 1IX5A 4DIPA 3UI5A 4JFKA 2O92A 1FKTA 4JYSA 2ZQSA 1F40A 2M1IA 3WIJA 1W9VA 3ALGA 3KABA 3QOKA 3UQIA 4PTMA 1P5QA 1HKJA 5D75A 2FAPA 4DRIA 3PRDA 1HXVA 3KAIA 1QZ2A 1E6RA 5DEZA 4TX0A 5B8IC 2M2AA 5BXJA 4ITZA 4S3KA 1YATA 3ARSA 2YBTA 3ALFA 4ODLA 4S3JA 4TW7A 3UQBA 1D6OA 1ZB5A 1WNOA 4MNKA 4WJXA 4DWSC 3WL0A 2DT0A 2ZR6A 1EQ3A 4W9PA 1D7JA 1KT0A 3B9AA 3IKDA 2PPOA 3WH0A 3RGCA 4L3NA 1ROTA 3O5RA 4WKAA 4LAYA 2XPBA 2MLYA 3WD4A 1O6IA 4Z2JA 5JH8A 1R9HA 4LAXA 1ZL1A 1FD9A 1W1PA 2XP8A 2ZR5A 2MF9A 4WIWA 2OFNA 3CH9A 4LGXA 4QT3A 4DT4A 2XPAA 1Q1CA 1HKIA 2PBCA 4IT4A 2PPPA 2Y78A 4J4NA 1FFRA 4MTVA 1OGBA 1ROUA 1HJVA 1NWRA 1Q6UA 3JXVA 4ML4A 1Q6IA 4LAVA 4Z2LA 3RFWA 4G50A 3AS0A 2A3EA 2YBUA 3ARTA 2AOSA 3FY1A 1EDQA 3JYJA 1JVWA 1LG2A 2DSZA 3O5KA 4O2TA 1U79A 4Z2GA 5HW6A 2RSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZ7 A;  1M5Y A;  1ZK6 A;  2XP5 A;  5HW8 A;  4GGQ A;  2UZ5 A;  3CGM A;  3I6C A;  5DIV A;  2VCD A;  3O5Q A;  4U85 A;  2F4E A;  4MSP A;  3TC5 A;  1Y0O A;  4FN2 A;  4LAW A;  3UI4 A;  4DRK A;  4TW6 A;  5DIU A;  4DIP A;  4QIB A;  4G2P A;  3UI5 A;  3KAH A;  4JFK A;  2XP3 A;  1FKF A;  1QPF A;  1FKT A;  4JYS A;  1FKD A;  2ZQS A;  4W9O A;  2RUQ A;  3H9R B;  3KAC A;  2K8I A;  1W26 A;  2M1I A;  4ODN A;  5DIT A;  5J6E A;  2DG3 A;  1J6Y A;  1F40 A;  3KCE A;  1FKK A;  4JFI A;  1FKH A;  5HWC A;  3KAB A;  3UQI A;  5HT1 A;  2ZQV A;  3IK8 A;  4W9Q A;  1BKF A;  3TCZ A;  1FAP A;  3TDB A;  1P5Q A;  4ODO A;  3LUO A;  2KR7 A;  3NTP A;  4DZ2 A;  3CGN A;  3O5G A;  5D75 A;  2FAP A;  4JFM A;  2LGO A;  1Q6H A;  2ZR4 A;  2PV3 A;  1F8A B;  2DG4 A;  3O5I A;  1FKB A;  4ODM A;  4DRI A;  2RQS A;  3PRD A;  1L1P A;  4ODR A;  3O5P A;  1J4R A;  2Q5A A;  1HXV A;  3KAI A;  2LJ4 A;  3O5J A;  2DG9 A;  3PA7 A;  2ZQT A;  1QZ2 A;  4R0X A;  2PV1 A;  3GPK A;  4TW8 A;  4DRM A;  2MLZ A;  4TX0 A;  4IQC A;  5B8I C;  3UQA A;  1JNT A;  3IHZ A;  3MDY B;  2M2A A;  4N19 A;  5BXJ A;  2JZV A;  3B7X A;  4ITZ A;  1YAT A;  2XP7 A;  2XP6 A;  1ZCN A;  4ODL A;  2IF4 A;  3KAF A;  4TW7 A;  4DRJ A;  2LKN A;  3UQB A;  1D6O A;  1J4H A;  1FKL A;  1PBK A;  4NNR A;  2ITK A;  3EY6 A;  3KAG A;  1J4I A;  4C02 B;  3PRB A;  4IQ2 A;  1EQ3 A;  2ZR6 A;  4W9P A;  5HW7 A;  3FAP A;  1D7I A;  4BF8 A;  1D7J A;  2VN1 A;  1YW5 A;  1TCO C;  1KT0 A;  4JFJ A;  3IKD A;  2XP4 A;  3JYM A;  2PPO A;  2KFW A;  3WH0 A;  3RGC A;  2RUR A;  1ROT A;  4ODQ A;  3O5R A;  4DRO A;  3OOB A;  1FKR A;  1KT1 A;  4LAY A;  2XPB A;  2MLY A;  4TYO A;  4IPX A;  3IKG A;  4DRP A;  1T11 A;  2F21 A;  2N87 A;  2RUC A;  3VAW A;  3ODK A;  1FKG A;  1QPL A;  3O5F A;  2FKE A;  2M08 A;  1R9H A;  4LAX A;  1A7X A;  1FD9 A;  2XP8 A;  1JNS A;  1PIN A;  2ZR5 A;  5GPG A;  2MF9 A;  1NSG A;  2KE0 A;  1FKJ A;  1FKS A;  1NMW A;  2KGJ A;  2OFN A;  4MGV A;  3NRK A;  4DRH A;  5HUA A;  5I98 A;  2MLX A;  4J4O A;  4JFL A;  3O5E A;  4ODP A;  1EYM A;  4QT3 A;  4DT4 A;  2LPV A;  2PPN A;  5HWB A;  2XPA A;  1Q1C A;  2MNT A;  2PBC A;  2L2S A;  3UI6 A;  4QT2 A;  1BL4 A;  1NMV A;  4U86 A;  3NI6 A;  2PPP A;  2RUD A;  4ODK A;  3O5D A;  2D9F A;  1FKI A;  2KI3 A;  2Y78 A;  4U84 A;  3UF8 A;  4J4N A;  4TNS A;  4DH0 A;  1ROU A;  4DRN A;  4DZ3 A;  2AWG A;  5HKG A;  1Q6U A;  3JXV A;  2XP9 A;  4GIV A;  1B6C A;  1Q6I A;  3O5M A;  3O5L A;  2ZQU A;  3KAD A;  4LAV A;  3RFW A;  4G50 A;  2KO7 A;  1FJD A;  2F2D A;  2MPH A;  4FAP A;  1N1A A;  3JYJ A;  5HTG A;  3O5O A;  1C9H A;  1JVW A;  4DRQ A;  2PV2 A;  3O5K A;  4O2T A;  1U79 A;  5HW6 A;  1D7H A;  2RSE A; 
#chains in the Genus database with same CATH topology
 3KZ7 A;  4P8U A;  3VAW A;  4U85 A;  3TC5 A;  1Y0O A;  3B9E A;  4DRK A;  5DIU A;  1JND A;  1FKF A;  1QPF A;  4URI A;  2RUQ A;  4Z2K A;  1W26 A;  2DT2 A;  4JFI A;  1EHN A;  1ZBC A;  1SYT A;  3CGN A;  3CHD A;  3GTY X;  2LGO A;  3PR9 A;  1XRV A;  2ZR4 A;  1F8A B;  1E6N A;  2FDM A;  1HKK A;  2LJ4 A;  2A3B A;  3O5J A;  3ARO A;  4R0X A;  3EIP A;  1JNT A;  3MDY B;  1FFQ A;  2JZV A;  2XP6 A;  4KR0 B;  1NWU A;  2IF4 A;  4DRJ A;  1J4H A;  1PBK A;  2DT1 A;  3WD3 A;  2B5U B;  4C02 B;  3WD1 A;  1OWQ A;  2B31 A;  5HW7 A;  1D7I A;  4BF8 A;  3RME A;  1ZU8 A;  1JCH B;  2XP4 A;  2KFW A;  1WB0 A;  3OOB A;  3OA5 A;  4IPX A;  3AQU A;  4DRP A;  1T11 A;  2RUC A;  3ODK A;  1FKG A;  1LL4 A;  4W5U A;  2M08 A;  1JNS A;  1PIN A;  1GUV A;  3AS2 A;  5GPG A;  5DO2 A;  3NRK A;  2PN0 A;  1HKM A;  3O5E A;  1W1T A;  2MNT A;  5GPR A;  2WLY A;  4Z2H A;  1NMV A;  2RUD A;  2D9F A;  3ARQ A;  2KI3 A;  1HJX A;  5GQB A;  4U84 A;  1GRJ A;  5HWC A;  2XP9 A;  3O5L A;  3RM4 A;  1FJD A;  2O9O A;  3WD2 A;  4FAP A;  2A3C A;  1C9H A;  4DRQ A;  2PV2 A;  1D7H A;  2ETN A;  1M5Y A;  1ZK6 A;  1ZBV A;  4MNJ A;  5HW8 A;  5DIV A;  3CHF A;  4MSP A;  4FN2 A;  3ARV A;  4LAW A;  3UI4 A;  4G2P A;  4W9O A;  3H9R B;  1J6Y A;  3KAC A;  2K8I A;  4ODN A;  1W9U A;  3BXW A;  2DG3 A;  1LQ0 A;  1FKK A;  1FKH A;  2OLH A;  3IK8 A;  4W9Q A;  1BKF A;  1NWT A;  3ARU A;  1FAP A;  3TDB A;  4ODO A;  4JFM A;  4Z2I A;  1Q6H A;  2PV3 A;  2DG4 A;  3ARW A;  1FKB A;  4ODM A;  1E15 A;  1WAW A;  2Q5A A;  3ARZ A;  3WL1 A;  1TFV A;  1KFW A;  2G41 A;  2DG9 A;  2ZQT A;  2PV1 A;  1W1Y A;  4DRM A;  4Q7N A;  4IQC A;  3IHZ A;  1NWS A;  4N19 A;  2XP7 A;  1ZCN A;  1ZBW A;  1JNE A;  3AS1 A;  3KAF A;  2ITK A;  3KAG A;  1J4I A;  1H0G A;  2WM0 A;  1NH6 A;  4IQ2 A;  4HBO A;  3RM9 A;  3FAP A;  4MPK A;  1LG1 A;  1YW5 A;  1TCO C;  1H0I A;  4JFJ A;  4ZPT R;  2DSV A;  4DRO A;  3IKG A;  4IT6 A;  2N87 A;  4ZS6 A;  1K9T A;  2DSU A;  2FKE A;  1A7X A;  2IUZ A;  1UR8 A;  5HBF A;  3CHC A;  4MNM A;  1NSG A;  2KGJ A;  1NMW A;  1FKS A;  4DRH A;  4MGV A;  5HUA A;  4MAV A;  4ZPV R;  2MLX A;  3PRA A;  1EYM A;  5HWB A;  3B8S A;  2L2S A;  3UI6 A;  4R5E A;  4U86 A;  2DT3 A;  3O5D A;  4AY1 A;  4P8X A;  4NSB A;  4DZ3 A;  4ZPW R;  4P8W A;  2DPE A;  3ARR A;  4GIV A;  3O5M A;  2ZQU A;  3KAD A;  4MNL A;  1CTN A;  2A3A A;  1E6P A;  1N1A A;  3G6M A;  3O5O A;  4HAR A;  1RD6 A;  1X6L A;  1EIB A;  1GOI A;  2PI6 A;  3CGM A;  3I6C A;  4XAK A;  2QF8 A;  4TW6 A;  4QIB A;  3KAH A;  2XP3 A;  5DF0 A;  1FKD A;  1ZBK A;  5DIT A;  3KCE A;  3W4R A;  5HT1 A;  2ZQV A;  3TCZ A;  3WQV A;  3LUO A;  2KR7 A;  3NTP A;  4DZ2 A;  3O5G A;  1X6N A;  3BMB A;  1W1V A;  3O5I A;  2RQS A;  4QZV B;  1L1P A;  4ODR A;  3O5P A;  1J4R A;  4WKH A;  3ARX A;  2DSW A;  4DWS D;  3PA7 A;  2ESC A;  3GPK A;  4TW8 A;  2MLZ A;  3CZ8 A;  3UQA A;  3B7X A;  1XHG A;  1LJY A;  2LKN A;  1D2K A;  1FKL A;  4NNR A;  4NZC A;  3EY6 A;  3G6L A;  3PRB A;  3WQW A;  2WK2 A;  2VN1 A;  3RM8 A;  1E44 A;  1VF8 A;  4P8V A;  1LL7 A;  3JYM A;  3WKZ A;  4WKF A;  5HW6 A;  2RUR A;  4ODQ A;  3ARY A;  1FKR A;  1KT1 A;  4TYO A;  2F21 A;  2WLZ A;  1QPL A;  3O5F A;  1E9L A;  3ARP A;  1OGG A;  3B9D A;  3WD0 A;  3AS3 A;  2F23 A;  1FKJ A;  2KE0 A;  5J6E A;  5I98 A;  4J4O A;  5HTG A;  4JFL A;  1W9P A;  1HJW A;  4ODP A;  2LPV A;  2PPN A;  4WK9 A;  4L72 B;  1GPF A;  4QT2 A;  1BL4 A;  2P4V A;  3NI6 A;  4ODK A;  4HBE A;  1FKI A;  4Q22 A;  1ITX A;  5HKG A;  4TNS A;  4DH0 A;  4DRN A;  2AWG A;  1SR0 A;  1B6C A;  3CHE A;  1E6Z A;  2KO7 A;  2F2D A;  2MPH A;  4KQZ A;  3FXY A;  1LL6 A;  2G8Z A;  2XP5 A;  1UR9 A;  4GGQ A;  2UZ5 A;  3UF8 A;  2VCD A;  3O5Q A;  2F4E A;  4DWS B;  4DWS A;  1IX5 A;  4DIP A;  3UI5 A;  4JFK A;  2O92 A;  1FKT A;  4JYS A;  2ZQS A;  1F40 A;  2M1I A;  3WIJ A;  1W9V A;  3ALG A;  3KAB A;  3QOK A;  3UQI A;  4PTM A;  1P5Q A;  1HKJ A;  5D75 A;  2FAP A;  4DRI A;  3PRD A;  1HXV A;  3KAI A;  1QZ2 A;  1E6R A;  5DEZ A;  4TX0 A;  5B8I C;  2M2A A;  5BXJ A;  4ITZ A;  4S3K A;  1YAT A;  3ARS A;  2YBT A;  3ALF A;  4ODL A;  4S3J A;  4TW7 A;  3UQB A;  1D6O A;  2EUL A;  1ZB5 A;  1WNO A;  4MNK A;  4WJX A;  4DWS C;  3WL0 A;  2DT0 A;  2ZR6 A;  1EQ3 A;  4W9P A;  1D7J A;  1KT0 A;  3B9A A;  3IKD A;  4UDM A;  2PPO A;  3WH0 A;  3RGC A;  4L3N A;  1ROT A;  3O5R A;  4WKA A;  4LAY A;  2XPB A;  2MLY A;  3WD4 A;  1O6I A;  4Z2J A;  5JH8 A;  1R9H A;  4LAX A;  1ZL1 A;  1FD9 A;  1W1P A;  2XP8 A;  2ZR5 A;  2MF9 A;  4WIW A;  2OFN A;  3CH9 A;  4LGX A;  4QT3 A;  4DT4 A;  2XPA A;  1Q1C A;  1HKI A;  2PBC A;  4IT4 A;  2PPP A;  2Y78 A;  4J4N A;  1FFR A;  4MTV A;  1OGB A;  1ROU A;  1HJV A;  1NWR A;  1Q6U A;  3JXV A;  4ML4 A;  1Q6I A;  4LAV A;  4Z2L A;  3RFW A;  4G50 A;  3AS0 A;  2A3E A;  2YBU A;  3ART A;  2AOS A;  3FY1 A;  1EDQ A;  3JYJ A;  1JVW A;  1LG2 A;  2DSZ A;  3O5K A;  4O2T A;  1U79 A;  4Z2G A;  3GU0 A;  2RSE A; 
#chains in the Genus database with same CATH homology
 3KZ7 A;  4P8U A;  3VAW A;  4U85 A;  3TC5 A;  1Y0O A;  3B9E A;  4DRK A;  5DIU A;  1JND A;  1FKF A;  1QPF A;  4URI A;  2RUQ A;  4Z2K A;  1W26 A;  2DT2 A;  4JFI A;  1EHN A;  1ZBC A;  1SYT A;  3CGN A;  3CHD A;  2LGO A;  3PR9 A;  1XRV A;  2ZR4 A;  1F8A B;  1E6N A;  2FDM A;  1HKK A;  2LJ4 A;  2A3B A;  3O5J A;  3ARO A;  4R0X A;  1JNT A;  3MDY B;  1FFQ A;  2JZV A;  2XP6 A;  4KR0 B;  1NWU A;  2IF4 A;  4DRJ A;  1J4H A;  1PBK A;  2DT1 A;  3WD3 A;  4C02 B;  3WD1 A;  1OWQ A;  2B31 A;  5HW7 A;  1D7I A;  4BF8 A;  3RME A;  1ZU8 A;  2XP4 A;  2KFW A;  1WB0 A;  3OOB A;  3OA5 A;  4IPX A;  3AQU A;  4DRP A;  1T11 A;  2RUC A;  3ODK A;  1FKG A;  1LL4 A;  4W5U A;  2M08 A;  1JNS A;  1PIN A;  1GUV A;  3AS2 A;  5GPG A;  5DO2 A;  3NRK A;  1HKM A;  3O5E A;  1W1T A;  2MNT A;  5GPR A;  2WLY A;  4Z2H A;  1NMV A;  2RUD A;  2D9F A;  3ARQ A;  2KI3 A;  1HJX A;  5GQB A;  4U84 A;  5HWC A;  2XP9 A;  3O5L A;  3RM4 A;  1FJD A;  2O9O A;  3WD2 A;  4FAP A;  2A3C A;  1C9H A;  4DRQ A;  2PV2 A;  1D7H A;  1M5Y A;  1ZK6 A;  1ZBV A;  4MNJ A;  5HW8 A;  5DIV A;  3CHF A;  4MSP A;  4FN2 A;  3ARV A;  4LAW A;  3UI4 A;  4G2P A;  4W9O A;  3H9R B;  1J6Y A;  3KAC A;  2K8I A;  4ODN A;  1W9U A;  3BXW A;  2DG3 A;  1LQ0 A;  1FKK A;  1FKH A;  2OLH A;  3IK8 A;  4W9Q A;  1BKF A;  1NWT A;  3ARU A;  1FAP A;  3TDB A;  4ODO A;  4JFM A;  4Z2I A;  1Q6H A;  2PV3 A;  2DG4 A;  3ARW A;  1FKB A;  4ODM A;  1E15 A;  1WAW A;  2Q5A A;  3ARZ A;  3WL1 A;  1TFV A;  1KFW A;  2G41 A;  2DG9 A;  2ZQT A;  2PV1 A;  1W1Y A;  4DRM A;  4Q7N A;  4IQC A;  3IHZ A;  1NWS A;  4N19 A;  2XP7 A;  1ZCN A;  1ZBW A;  1JNE A;  3AS1 A;  3KAF A;  2ITK A;  3KAG A;  1J4I A;  1H0G A;  2WM0 A;  1NH6 A;  4IQ2 A;  4HBO A;  3RM9 A;  3FAP A;  4MPK A;  1LG1 A;  1YW5 A;  1TCO C;  1H0I A;  4JFJ A;  4ZPT R;  2DSV A;  4DRO A;  3IKG A;  4IT6 A;  2N87 A;  4ZS6 A;  1K9T A;  2DSU A;  2FKE A;  1A7X A;  2IUZ A;  1UR8 A;  5HBF A;  3CHC A;  4MNM A;  1NSG A;  2KGJ A;  1NMW A;  1FKS A;  4DRH A;  4MGV A;  5HUA A;  4MAV A;  4ZPV R;  2MLX A;  3PRA A;  1EYM A;  5HWB A;  3B8S A;  2L2S A;  3UI6 A;  4R5E A;  4U86 A;  2DT3 A;  3O5D A;  4AY1 A;  4P8X A;  4NSB A;  4DZ3 A;  4ZPW R;  4P8W A;  2DPE A;  3ARR A;  4GIV A;  3O5M A;  2ZQU A;  3KAD A;  4MNL A;  1CTN A;  2A3A A;  1E6P A;  1N1A A;  3G6M A;  3O5O A;  4HAR A;  1RD6 A;  1X6L A;  1EIB A;  1GOI A;  2PI6 A;  3CGM A;  3I6C A;  4XAK A;  2QF8 A;  4TW6 A;  4QIB A;  3KAH A;  2XP3 A;  5DF0 A;  1FKD A;  1ZBK A;  5DIT A;  3KCE A;  3W4R A;  5HT1 A;  2ZQV A;  3TCZ A;  3WQV A;  3LUO A;  2KR7 A;  3NTP A;  4DZ2 A;  3O5G A;  1X6N A;  1W1V A;  3O5I A;  2RQS A;  4QZV B;  1L1P A;  4ODR A;  3O5P A;  1J4R A;  4WKH A;  3ARX A;  2DSW A;  4DWS D;  3PA7 A;  2ESC A;  3GPK A;  4TW8 A;  2MLZ A;  3CZ8 A;  3UQA A;  3B7X A;  1XHG A;  1LJY A;  2LKN A;  1D2K A;  1FKL A;  4NNR A;  4NZC A;  3EY6 A;  3G6L A;  3PRB A;  3WQW A;  2WK2 A;  2VN1 A;  3RM8 A;  1VF8 A;  4P8V A;  1LL7 A;  3JYM A;  3WKZ A;  4WKF A;  2RUR A;  4ODQ A;  3ARY A;  1FKR A;  1KT1 A;  4TYO A;  2F21 A;  2WLZ A;  1QPL A;  3O5F A;  1E9L A;  3ARP A;  1OGG A;  3B9D A;  3WD0 A;  3AS3 A;  2KE0 A;  1FKJ A;  5J6E A;  5I98 A;  4J4O A;  5HTG A;  4JFL A;  1W9P A;  1HJW A;  4ODP A;  2LPV A;  2PPN A;  4WK9 A;  4L72 B;  1GPF A;  4QT2 A;  1BL4 A;  3NI6 A;  4ODK A;  4HBE A;  1FKI A;  4Q22 A;  1ITX A;  5HKG A;  4TNS A;  4DH0 A;  4DRN A;  2AWG A;  1SR0 A;  1B6C A;  3CHE A;  1E6Z A;  2KO7 A;  2F2D A;  2MPH A;  4KQZ A;  3FXY A;  1LL6 A;  2G8Z A;  2XP5 A;  1UR9 A;  4GGQ A;  2UZ5 A;  3UF8 A;  2VCD A;  3O5Q A;  2F4E A;  4DWS B;  4DWS A;  1IX5 A;  4DIP A;  3UI5 A;  4JFK A;  2O92 A;  1FKT A;  4JYS A;  2ZQS A;  1F40 A;  2M1I A;  3WIJ A;  1W9V A;  3ALG A;  3KAB A;  3QOK A;  3UQI A;  4PTM A;  1P5Q A;  1HKJ A;  5D75 A;  2FAP A;  4DRI A;  3PRD A;  1HXV A;  3KAI A;  1QZ2 A;  1E6R A;  5DEZ A;  4TX0 A;  5B8I C;  2M2A A;  5BXJ A;  4ITZ A;  4S3K A;  1YAT A;  3ARS A;  2YBT A;  3ALF A;  4ODL A;  4S3J A;  4TW7 A;  3UQB A;  1D6O A;  1ZB5 A;  1WNO A;  4MNK A;  4WJX A;  4DWS C;  3WL0 A;  2DT0 A;  2ZR6 A;  1EQ3 A;  4W9P A;  1D7J A;  1KT0 A;  3B9A A;  3IKD A;  2PPO A;  3WH0 A;  3RGC A;  4L3N A;  1ROT A;  3O5R A;  4WKA A;  4LAY A;  2XPB A;  2MLY A;  3WD4 A;  1O6I A;  4Z2J A;  5JH8 A;  1R9H A;  4LAX A;  1ZL1 A;  1FD9 A;  1W1P A;  2XP8 A;  2ZR5 A;  2MF9 A;  4WIW A;  2OFN A;  3CH9 A;  4LGX A;  4QT3 A;  4DT4 A;  2XPA A;  1Q1C A;  1HKI A;  2PBC A;  4IT4 A;  2PPP A;  2Y78 A;  4J4N A;  1FFR A;  4MTV A;  1OGB A;  1ROU A;  1HJV A;  1NWR A;  1Q6U A;  3JXV A;  4ML4 A;  1Q6I A;  4LAV A;  4Z2L A;  3RFW A;  4G50 A;  3AS0 A;  2A3E A;  2YBU A;  3ART A;  2AOS A;  3FY1 A;  1EDQ A;  3JYJ A;  1JVW A;  1LG2 A;  2DSZ A;  3O5K A;  4O2T A;  1U79 A;  4Z2G A;  5HW6 A;  2RSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...