4DH0A

X-ray crystal structure of 28-o-methylrapamycin complexed with fkbp12: is the cyclohexyl moiety part of the effector domain of rapamycin?
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/immunosuppressant
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
publication title X-ray Crystal Structure of 28-O-Methylrapamycin complexed with FKBP12: Is the Cyclohexyl Moiety Part of the Effector Domain of Rapamycin?
doi rcsb
source organism Homo sapiens
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dh0A00
2D9FA 3O5KA 1BL4A 3JYJA 4DROA 2MLXA 1FKBA 2XP8A 1YATA 4O2TA 4TNSA 2MPHA 1ZK6A 2N87A 3PA7A 4TW8A 3WH0A 1L1PA 1FKJA 1PBKA 2PPOA 2RUDA 2Y78A 3GPKA 4LAYA 5HUAA 3B7XA 1NSGA 3O5JA 4ODPA 4FN2A 2FAPA 4DRJA 4ODLA 2RURA 4JFKA 3UI5A 1M5YA 5HT1A 4U84A 1FJDA 3UI6A 2LPVA 4TX0A 1NMWA 1P5QA 1QPFA 2LJ4A 4ITZA 3RGCA 5BXJA 2PV2A 2XP5A 3KAFA 3MDYB 4TYOA 3O5EA 1F40A 3JXVA 1Q6IA 2DG3A 1FD9A 2M1IA 1FKGA 3H9RB 2XP3A 1J4HA 3O5FA 4DRQA 3JYMA 3NI6A 1FKFA 2M08A 1FKHA 4DRNA 3CGMA 2MLYA 4JYSA 1FKKA 3IKGA 3IKDA 4IQ2A 3UQBA 3KACA 3O5LA 5B8IC 1FKLA 3UQAA 3ODKA 2XP6A 5GPGA 2PV1A 4MGVA 2ZR5A 3KCEA 1FKDA 1W26A 3EY6A 2KI3A 4DZ3A 2PPNA 3TC5A 1HXVA 1D7IA 2KO7A 4W9QA 3TCZA 4GIVA 4LAVA 3FAPA 4LAXA 1J4IA 5J6EA 3KABA 1J6YA 1N1AA 2ITKA 3OOBA 4DRHA 2ZQUA 2RUCA 1ZCNA 3KAIA 2MF9A 3O5IA 4ODNA 4C02B 2L2SA 5D75A 5HWCA 1FKSA 2M2AA 2VCDA 1R9HA 1EQ3A 1JVWA 3LUOA 2LKNA 4ODMA 4ODQA 3KADA 1NMVA 4U85A 5DIVA 4FAPA 2XPBA 4G2PA 2UZ5A 1QZ2A 2RQSA 4ODKA 3TDBA 1ROTA 2ZR4A 1D7HA 1BKFA 2PV3A 5I98A 2PBCA 4DT4A 2Q5AA 2XP7A 3O5RA 3O5DA 4U86A 2JZVA 1FKIA 3O5PA 3UI4A 3O5OA 2PPPA 2XP9A 3KZ7A 3O5GA 4QIBA 2FKEA 4ODRA 3VAWA 1FAPA 2ZQTA 4JFJA 4TW6A 1A7XA 2F4EA 3O5QA 1J4RA 1FKTA 4DH0A 4JFMA 3PRBA 4R0XA 4BF8A 4DRKA 2RSEA 2LGOA 1TCOC 1Q1CA 4DRPA 1Q6UA 2XPAA 1C9HA 4LAWA 3KAHA 1KT0A 4DRIA 3UF8A 2OFNA 5HW6A 5HTGA 2MLZA 4IPXA 2XP4A 5HKGA 3IHZA 1Y0OA 4IQCA 3NTPA 4MSPA 3IK8A 2RUQA 4QT2A 2AWGA 2F2DA 5DITA 1B6CA 4GGQA 4JFLA 4QT3A 2ZR6A 2KE0A 4JFIA 2IF4A 1F8AB 1D6OA 2DG4A 2F21A 3CGNA 2KGJA 5DIUA 1FKRA 5HWBA 1D7JA 1EYMA 2MNTA 1Q6HA 3NRKA 4TW7A 4W9PA 4DIPA 1T11A 4ODOA 3I6CA 2VN1A 1JNTA 1KT1A 2KFWA 3RFWA 3UQIA 1ROUA 4J4OA 4DZ2A 1QPLA 5HW8A 1YW5A 2DG9A 2K8IA 2KR7A 2ZQSA 4W9OA 4G50A 1JNSA 1U79A 5HW7A 4N19A 4NNRA 1PINA 4DRMA 3KAGA 3PRDA 4J4NA 2ZQVA 3O5MA
chains in the Genus database with same CATH superfamily
5DO2A 1E15A 3AS2A 1E6ZA 1O6IA 1FKJA 4LAYA 3OA5A 3O5JA 1EHNA 4FN2A 4ZS6A 4ODLA 1WNOA 1FJDA 2A3BA 4HBEA 3WD3A 1QPFA 1F40A 3RGCA 3CHDA 1Q6IA 1FKGA 1J4HA 3WQWA 5JH8A 1GPFA 1FKFA 1FKHA 3CGMA 5HBFA 2DT2A 3IKGA 1LQ0A 3BXWA 3KACA 5GPGA 3QOKA 2YBUA 4NSBA 1HKJA 3EY6A 2KI3A 4DZ3A 3TC5A 4P8VA 1UR9A 4GIVA 4LAVA 1E6PA 2O9OA 2ZQUA 1LG1A 4KR0B 4ODNA 1W9UA 1FKSA 1LG2A 3AQUA 2M2AA 2P4VA 1EQ3A 4ODQA 1FFQA 4IT4A 1NMVA 3G6MA 4U85A 2XPBA 2UZ5A 4HBOA 1QZ2A 1HKIA 1D7HA 1BKFA 5I98A 2B5UB 2JZVA 3O5GA 2XP9A 4IT6A 1W9PA 2QF8A 4DH0A 1GRJA 3PRBA 3RMEA 2O92A 2LGOA 4DRPA 1Q1CA 4LAWA 1NH6A 1KT0A 5HKGA 2XP4A 3IHZA 3PRAA 1ZB5A 1JNEA 1SR0A 3ARUA 4QT3A 4JFIA 3ARZA 3CHCA 3RM4A 4MTVA 1Q6HA 4TW7A 1T11A 1FFRA 3I6CA 1KT1A 4MNJA 5HW8A 1X6LA 3FXYA 2DG9A 2K8IA 2DT0A 4N19A 2YBTA 2ETNA 3JYJA 4DROA 1FKBA 2XP8A 1YATA 5DF0A 3PA7A 1NWUA 4TW8A 3GPKA 2PPOA 2G41A 1NSGA 1JNDA 1HKMA 1ZBVA 4JFKA 3UI5A 1M5YA 1ZBCA 4MAVA 3UI6A 2LPVA 1NMWA 1P5QA 1W1TA 2LJ4A 4ITZA 5BXJA 2PV2A 4TYOA 1TFVA 3GU0A 3JXVA 4DWSD 3O5FA 3WL0A 3ARPA 4DRNA 4UDMA 3O5LA 3ODKA 5GPRA 2PN0A 2DT1A 4ZPWR 4Q7NA 2ZR5A 1LL4A 4W9QA 1J6YA 4LAXA 4URIA 3KABA 1N1AA 2ITKA 3ARVA 3GTYX 3O5IA 4C02B 2B31A 4ZPTR 3RM9A 2DT3A 1R9HA 1JVWA 3LUOA 2LKNA 3WD4A 2OLHA 1EDQA 2EULA 2ZR4A 4Q22A 4DT4A 3O5PA 2PPPA 3KZ7A 4Z2GA 3ALFA 2FKEA 3ARXA 1LJYA 2F4EA 3O5QA 1J4RA 4WKAA 1FKTA 3B9EA 1WB0A 2RSEA 2XPAA 4DRIA 1C9HA 5HTGA 3KAHA 3B8SA 3WIJA 1H0IA 2G8ZA 4Z2JA 4PTMA 4IQCA 3IK8A 4QT2A 2AWGA 2ZR6A 2IF4A 3WQVA 3WD0A 2DG4A 4WK9A 4L72B 2KGJA 1D7JA 1NWSA 1E44A 2AOSA 1ZU8A 2KFWA 3RFWA 1ROUA 4XAKA 2DSZA 2KR7A 3RM8A 4DWSC 1JNSA 3AS3A 1U79A 4DRMA 3FY1A 3O5MA 3AS0A 2D9FA 3O5KA 1BL4A 4TNSA 4O2TA 3WKZA 1W1PA 3B9DA 5DEZA 4DWSB 3ARRA 3WD1A 2A3CA 4U84A 4ZPVR 1GUVA 1CTNA 3WD2A 2XP5A 3KAFA 3CHEA 3O5EA 4DRQA 1OGBA 2M08A 3CH9A 1FKKA 1X6NA 3UQBA 4L3NA 5B8IC 5GQBA 3UQAA 2XP6A 2PV1A 1EIBA 3KCEA 1FKDA 3B9AA 1W26A 1HXVA 1HJXA 2KO7A 1ITXA 3TCZA 3W4RA 3ARTA 3OOBA 4DRHA 2RUCA 1ZCNA 1WAWA 2FDMA 2MF9A 1XHGA 2A3EA 4WKHA 5D75A 5HWCA 4MNKA 4P8XA 2DSUA 5DIVA 2RQSA 1ROTA 2PV3A 2PBCA 2Q5AA 2XP7A 3O5RA 3O5DA 3AROA 4U86A 1ZBKA 4QIBA 1E6NA 3VAWA 1FAPA 2ZQTA 4TW6A 2A3AA 4JFMA 4R0XA 2DSVA 1ZL1A 1TCOC 1Q6UA 3UF8A 4Z2KA 4MPKA 1Y0OA 1HJWA 4MSPA 2RUQA 3ARWA 2DPEA 1ZBWA 1RD6A 5DITA 4JFLA 1JCHB 1D6OA 1NWRA 3CGNA 1FKRA 3NRKA 4R5EA 4W9PA 4ODOA 3PR9A 4DZ2A 1W9VA 4WKFA 4J4OA 1QPLA 2ZQSA 4W9OA 1LL7A 5HW7A 3KAGA 3PRDA 3AS1A 4ML4A 4Z2HA 1D2KA 2MLXA 2MPHA 1ZK6A 2N87A 3WH0A 1L1PA 1PBKA 2RUDA 2Y78A 5HUAA 3B7XA 4KQZA 1E9LA 4MNMA 4ODPA 1GOIA 1HKKA 2FAPA 4DRJA 2RURA 2DSWA 5HT1A 3CHFA 4TX0A 3MDYB 2ESCA 4DWSA 2DG3A 1FD9A 1K9TA 1KFWA 2M1IA 3H9RB 2XP3A 3JYMA 3NI6A 3ALGA 2MLYA 2IUZA 4JYSA 3IKDA 4IQ2A 1FKLA 2WLZA 4MGVA 4Z2LA 3ARYA 2PI6A 2PPNA 1VF8A 1D7IA 3FAPA 1J4IA 1SYTA 5J6EA 4P8UA 1NWTA 3KAIA 2L2SA 1OWQA 1W1VA 1W1YA 4LGXA 2VCDA 4ODMA 4S3JA 3KADA 3EIPA 4FAPA 4G2PA 2WLYA 3TDBA 4ODKA 4QZVB 1XRVA 3UI4A 1FKIA 3O5OA 4ODRA 4S3KA 3BMBA 4JFJA 1A7XA 4AY1A 3G6LA 4MNLA 4BF8A 4DRKA 2WK2A 1IX5A 2OFNA 3WL1A 5HW6A 2MLZA 4IPXA 4W5UA 3NTPA 1LL6A 4P8WA 1HJVA 2WM0A 4HARA 2F2DA 1B6CA 4GGQA 2F23A 1OGGA 2KE0A 1F8AB 4WIWA 1E6RA 2F21A 5DIUA 4WJXA 5HWBA 4Z2IA 1EYMA 2MNTA 4DIPA 3UQIA 2VN1A 1JNTA 3CZ8A 1YW5A 4NZCA 4G50A 1H0GA 3ARSA 4NNRA 1PINA 3ARQA 4J4NA 2ZQVA 1UR8A
chains in the Genus database with same CATH topology
5DO2A 1E15A 3AS2A 1E6ZA 1O6IA 1FKJA 4LAYA 3OA5A 3O5JA 1EHNA 4FN2A 4ZS6A 4ODLA 1WNOA 1FJDA 2A3BA 4HBEA 3WD3A 1QPFA 1F40A 3RGCA 3CHDA 1Q6IA 1FKGA 1J4HA 3WQWA 5JH8A 1GPFA 1FKFA 1FKHA 3CGMA 5HBFA 2DT2A 3IKGA 1LQ0A 3BXWA 3KACA 5GPGA 3QOKA 2YBUA 4NSBA 1HKJA 3EY6A 2KI3A 4DZ3A 3TC5A 4P8VA 1UR9A 4GIVA 4LAVA 1E6PA 2O9OA 2ZQUA 1LG1A 4KR0B 4ODNA 1W9UA 1FKSA 1LG2A 3AQUA 2M2AA 1EQ3A 4ODQA 1FFQA 4IT4A 1NMVA 3G6MA 4U85A 2XPBA 2UZ5A 4HBOA 1QZ2A 1HKIA 1D7HA 1BKFA 5I98A 2JZVA 3O5GA 2XP9A 4IT6A 1W9PA 2QF8A 4DH0A 3PRBA 3RMEA 2O92A 2LGOA 4DRPA 1Q1CA 4LAWA 1NH6A 1KT0A 5HKGA 2XP4A 3IHZA 3PRAA 1ZB5A 1JNEA 1SR0A 3ARUA 4QT3A 4JFIA 3ARZA 3CHCA 3RM4A 4MTVA 1Q6HA 4TW7A 1T11A 1FFRA 3I6CA 1KT1A 4MNJA 5HW8A 1X6LA 3FXYA 2DG9A 2K8IA 2DT0A 4N19A 2YBTA 3JYJA 4DROA 1FKBA 2XP8A 1YATA 5DF0A 3PA7A 1NWUA 4TW8A 3GPKA 2PPOA 2G41A 1NSGA 1JNDA 1HKMA 1ZBVA 4JFKA 3UI5A 1M5YA 1ZBCA 4MAVA 3UI6A 2LPVA 1NMWA 1P5QA 1W1TA 2LJ4A 4ITZA 5BXJA 2PV2A 4TYOA 1TFVA 3JXVA 4DWSD 3O5FA 3WL0A 3ARPA 4DRNA 3O5LA 3ODKA 5GPRA 2DT1A 4ZPWR 4Q7NA 2ZR5A 1LL4A 4W9QA 1J6YA 4LAXA 4URIA 3KABA 1N1AA 2ITKA 3ARVA 3O5IA 4C02B 2B31A 4ZPTR 3RM9A 2DT3A 1R9HA 1JVWA 3LUOA 2LKNA 3WD4A 2OLHA 1EDQA 2ZR4A 4Q22A 4DT4A 3O5PA 2PPPA 3KZ7A 4Z2GA 3ALFA 2FKEA 3ARXA 1LJYA 2F4EA 3O5QA 1J4RA 4WKAA 1FKTA 3B9EA 1WB0A 2RSEA 2XPAA 4DRIA 1C9HA 5HTGA 3KAHA 3B8SA 3WIJA 1H0IA 2G8ZA 4Z2JA 4PTMA 4IQCA 3IK8A 4QT2A 2AWGA 2ZR6A 2IF4A 3WQVA 3WD0A 2DG4A 4WK9A 4L72B 2KGJA 1D7JA 1NWSA 2AOSA 1ZU8A 2KFWA 3RFWA 1ROUA 4XAKA 2DSZA 2KR7A 3RM8A 4DWSC 1JNSA 3AS3A 1U79A 4DRMA 3FY1A 3O5MA 3AS0A 2D9FA 3O5KA 1BL4A 4TNSA 4O2TA 3WKZA 1W1PA 3B9DA 5DEZA 4DWSB 3ARRA 3WD1A 2A3CA 4U84A 4ZPVR 1GUVA 1CTNA 3WD2A 2XP5A 3KAFA 3CHEA 3O5EA 4DRQA 1OGBA 2M08A 3CH9A 1FKKA 1X6NA 3UQBA 4L3NA 5B8IC 5GQBA 3UQAA 2XP6A 2PV1A 1EIBA 3KCEA 1FKDA 3B9AA 1W26A 1HXVA 1HJXA 2KO7A 1ITXA 3TCZA 3W4RA 3ARTA 3OOBA 4DRHA 2RUCA 1ZCNA 1WAWA 2FDMA 2MF9A 1XHGA 2A3EA 4WKHA 5D75A 5HWCA 4MNKA 4P8XA 2DSUA 5DIVA 2RQSA 1ROTA 2PV3A 2PBCA 2Q5AA 2XP7A 3O5RA 3O5DA 3AROA 4U86A 1ZBKA 4QIBA 1E6NA 3VAWA 1FAPA 2ZQTA 4TW6A 2A3AA 4JFMA 4R0XA 2DSVA 1ZL1A 1TCOC 1Q6UA 3UF8A 4Z2KA 4MPKA 1Y0OA 1HJWA 4MSPA 2RUQA 3ARWA 2DPEA 1ZBWA 1RD6A 5DITA 4JFLA 1D6OA 1NWRA 3CGNA 1FKRA 3NRKA 4R5EA 4W9PA 4ODOA 3PR9A 4DZ2A 1W9VA 4WKFA 4J4OA 1QPLA 2ZQSA 4W9OA 1LL7A 5HW7A 3KAGA 3PRDA 3AS1A 4ML4A 4Z2HA 1D2KA 2MLXA 2MPHA 1ZK6A 2N87A 3WH0A 1L1PA 1PBKA 2RUDA 2Y78A 5HUAA 3B7XA 4KQZA 1E9LA 4MNMA 4ODPA 1GOIA 1HKKA 2FAPA 4DRJA 2RURA 2DSWA 5HT1A 3CHFA 4TX0A 3MDYB 2ESCA 4DWSA 2DG3A 1FD9A 1K9TA 1KFWA 2M1IA 3H9RB 2XP3A 3JYMA 3NI6A 3ALGA 2MLYA 2IUZA 4JYSA 3IKDA 4IQ2A 1FKLA 2WLZA 4MGVA 4Z2LA 3ARYA 2PI6A 2PPNA 1VF8A 1D7IA 3FAPA 1J4IA 1SYTA 5J6EA 4P8UA 1NWTA 3KAIA 2L2SA 1OWQA 1W1VA 1W1YA 4LGXA 2VCDA 4ODMA 4S3JA 3KADA 4FAPA 4G2PA 2WLYA 3TDBA 4ODKA 4QZVB 1XRVA 3UI4A 1FKIA 3O5OA 4ODRA 4S3KA 4JFJA 1A7XA 4AY1A 3G6LA 4MNLA 4BF8A 4DRKA 2WK2A 1IX5A 2OFNA 3WL1A 5HW6A 2MLZA 4IPXA 4W5UA 3NTPA 1LL6A 4P8WA 1HJVA 2WM0A 4HARA 2F2DA 1B6CA 4GGQA 1OGGA 2KE0A 1F8AB 4WIWA 1E6RA 2F21A 5DIUA 4WJXA 5HWBA 4Z2IA 1EYMA 2MNTA 4DIPA 3UQIA 2VN1A 1JNTA 3CZ8A 1YW5A 4NZCA 4G50A 1H0GA 3ARSA 4NNRA 1PINA 3ARQA 4J4NA 2ZQVA 1UR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9F A;  3O5K A;  1BL4 A;  3JYJ A;  4DRO A;  2MLX A;  1FKB A;  2XP8 A;  1YAT A;  4O2T A;  4TNS A;  2MPH A;  1ZK6 A;  2N87 A;  3PA7 A;  4TW8 A;  3WH0 A;  1L1P A;  1FKJ A;  1PBK A;  2PPO A;  2RUD A;  2Y78 A;  3GPK A;  4LAY A;  5HUA A;  3B7X A;  1NSG A;  3O5J A;  4ODP A;  4FN2 A;  2FAP A;  4DRJ A;  4ODL A;  2RUR A;  4JFK A;  3UI5 A;  1M5Y A;  5HT1 A;  4U84 A;  1FJD A;  3UI6 A;  2LPV A;  4TX0 A;  1NMW A;  1P5Q A;  1QPF A;  2LJ4 A;  4ITZ A;  3RGC A;  5BXJ A;  2PV2 A;  2XP5 A;  3KAF A;  3MDY B;  4TYO A;  3O5E A;  1F40 A;  3JXV A;  1Q6I A;  2DG3 A;  1FD9 A;  2M1I A;  1FKG A;  3H9R B;  2XP3 A;  1J4H A;  3O5F A;  4DRQ A;  3JYM A;  3NI6 A;  1FKF A;  2M08 A;  1FKH A;  4DRN A;  3CGM A;  2MLY A;  4JYS A;  1FKK A;  3IKG A;  3IKD A;  4IQ2 A;  3UQB A;  3KAC A;  3O5L A;  5B8I C;  1FKL A;  3UQA A;  3ODK A;  2XP6 A;  5GPG A;  2PV1 A;  4MGV A;  2ZR5 A;  3KCE A;  1FKD A;  1W26 A;  3EY6 A;  2KI3 A;  4DZ3 A;  2PPN A;  3TC5 A;  1HXV A;  1D7I A;  2KO7 A;  4W9Q A;  3TCZ A;  4GIV A;  4LAV A;  3FAP A;  4LAX A;  1J4I A;  5J6E A;  3KAB A;  1J6Y A;  1N1A A;  2ITK A;  3OOB A;  4DRH A;  2ZQU A;  2RUC A;  1ZCN A;  3KAI A;  2MF9 A;  3O5I A;  4ODN A;  4C02 B;  2L2S A;  5D75 A;  5HWC A;  1FKS A;  2M2A A;  2VCD A;  1R9H A;  1EQ3 A;  1JVW A;  3LUO A;  2LKN A;  4ODM A;  4ODQ A;  3KAD A;  1NMV A;  4U85 A;  5DIV A;  4FAP A;  2XPB A;  4G2P A;  2UZ5 A;  1QZ2 A;  2RQS A;  4ODK A;  3TDB A;  1ROT A;  2ZR4 A;  1D7H A;  1BKF A;  2PV3 A;  5I98 A;  2PBC A;  4DT4 A;  2Q5A A;  2XP7 A;  3O5R A;  3O5D A;  4U86 A;  2JZV A;  1FKI A;  3O5P A;  3UI4 A;  3O5O A;  2PPP A;  2XP9 A;  3KZ7 A;  3O5G A;  4QIB A;  2FKE A;  4ODR A;  3VAW A;  1FAP A;  2ZQT A;  4JFJ A;  4TW6 A;  1A7X A;  2F4E A;  3O5Q A;  1J4R A;  1FKT A;  4DH0 A;  4JFM A;  3PRB A;  4R0X A;  4BF8 A;  4DRK A;  2RSE A;  2LGO A;  1TCO C;  1Q1C A;  4DRP A;  1Q6U A;  2XPA A;  1C9H A;  4LAW A;  3KAH A;  1KT0 A;  4DRI A;  3UF8 A;  2OFN A;  5HW6 A;  5HTG A;  2MLZ A;  4IPX A;  2XP4 A;  5HKG A;  3IHZ A;  1Y0O A;  4IQC A;  3NTP A;  4MSP A;  3IK8 A;  2RUQ A;  4QT2 A;  2AWG A;  2F2D A;  5DIT A;  1B6C A;  4GGQ A;  4JFL A;  4QT3 A;  2ZR6 A;  2KE0 A;  4JFI A;  2IF4 A;  1F8A B;  1D6O A;  2DG4 A;  2F21 A;  3CGN A;  2KGJ A;  5DIU A;  1FKR A;  5HWB A;  1D7J A;  1EYM A;  2MNT A;  1Q6H A;  3NRK A;  4TW7 A;  4W9P A;  4DIP A;  1T11 A;  4ODO A;  3I6C A;  2VN1 A;  1JNT A;  1KT1 A;  2KFW A;  3RFW A;  3UQI A;  1ROU A;  4J4O A;  4DZ2 A;  1QPL A;  5HW8 A;  1YW5 A;  2DG9 A;  2K8I A;  2KR7 A;  2ZQS A;  4W9O A;  4G50 A;  1JNS A;  1U79 A;  5HW7 A;  4N19 A;  4NNR A;  1PIN A;  4DRM A;  3KAG A;  3PRD A;  4J4N A;  2ZQV A;  3O5M A; 
#chains in the Genus database with same CATH topology
 5DO2 A;  1E15 A;  3AS2 A;  1E6Z A;  1O6I A;  1FKJ A;  4LAY A;  3OA5 A;  3O5J A;  1EHN A;  4FN2 A;  4ZS6 A;  4ODL A;  1WNO A;  1FJD A;  2A3B A;  4HBE A;  3WD3 A;  1QPF A;  1F40 A;  3RGC A;  3CHD A;  1Q6I A;  1FKG A;  1J4H A;  3WQW A;  5JH8 A;  1GPF A;  1FKF A;  1FKH A;  3CGM A;  5HBF A;  2DT2 A;  3IKG A;  1LQ0 A;  3BXW A;  3KAC A;  5GPG A;  3QOK A;  2YBU A;  4NSB A;  1HKJ A;  3EY6 A;  2KI3 A;  4DZ3 A;  3TC5 A;  4P8V A;  1UR9 A;  4GIV A;  4LAV A;  1E6P A;  2O9O A;  2ZQU A;  1LG1 A;  4KR0 B;  4ODN A;  1W9U A;  1FKS A;  1LG2 A;  3AQU A;  2M2A A;  2P4V A;  1EQ3 A;  4ODQ A;  1FFQ A;  4IT4 A;  1NMV A;  3G6M A;  4U85 A;  2XPB A;  2UZ5 A;  4HBO A;  1QZ2 A;  1HKI A;  1D7H A;  1BKF A;  5I98 A;  2B5U B;  2JZV A;  3O5G A;  2XP9 A;  4IT6 A;  1W9P A;  2QF8 A;  4DH0 A;  1GRJ A;  3PRB A;  3RME A;  2O92 A;  2LGO A;  4DRP A;  1Q1C A;  4LAW A;  1NH6 A;  1KT0 A;  5HKG A;  2XP4 A;  3IHZ A;  3PRA A;  1ZB5 A;  1JNE A;  1SR0 A;  3ARU A;  4QT3 A;  4JFI A;  3ARZ A;  3CHC A;  3RM4 A;  4MTV A;  1Q6H A;  4TW7 A;  1T11 A;  1FFR A;  3I6C A;  1KT1 A;  4MNJ A;  5HW8 A;  1X6L A;  3FXY A;  2DG9 A;  2K8I A;  2DT0 A;  4N19 A;  2YBT A;  2ETN A;  3JYJ A;  4DRO A;  1FKB A;  2XP8 A;  1YAT A;  5DF0 A;  3PA7 A;  1NWU A;  4TW8 A;  3GPK A;  2PPO A;  2G41 A;  1NSG A;  1JND A;  1HKM A;  1ZBV A;  4JFK A;  3UI5 A;  1M5Y A;  1ZBC A;  4MAV A;  3UI6 A;  2LPV A;  1NMW A;  1P5Q A;  1W1T A;  2LJ4 A;  4ITZ A;  5BXJ A;  2PV2 A;  4TYO A;  1TFV A;  3GU0 A;  3JXV A;  4DWS D;  3O5F A;  3WL0 A;  3ARP A;  4DRN A;  4UDM A;  3O5L A;  3ODK A;  5GPR A;  2PN0 A;  2DT1 A;  4ZPW R;  4Q7N A;  2ZR5 A;  1LL4 A;  4W9Q A;  1J6Y A;  4LAX A;  4URI A;  3KAB A;  1N1A A;  2ITK A;  3ARV A;  3GTY X;  3O5I A;  4C02 B;  2B31 A;  4ZPT R;  3RM9 A;  2DT3 A;  1R9H A;  1JVW A;  3LUO A;  2LKN A;  3WD4 A;  2OLH A;  1EDQ A;  2EUL A;  2ZR4 A;  4Q22 A;  4DT4 A;  3O5P A;  2PPP A;  3KZ7 A;  4Z2G A;  3ALF A;  2FKE A;  3ARX A;  1LJY A;  2F4E A;  3O5Q A;  1J4R A;  4WKA A;  1FKT A;  3B9E A;  1WB0 A;  2RSE A;  2XPA A;  4DRI A;  1C9H A;  5HTG A;  3KAH A;  3B8S A;  3WIJ A;  1H0I A;  2G8Z A;  4Z2J A;  4PTM A;  4IQC A;  3IK8 A;  4QT2 A;  2AWG A;  2ZR6 A;  2IF4 A;  3WQV A;  3WD0 A;  2DG4 A;  4WK9 A;  4L72 B;  2KGJ A;  1D7J A;  1NWS A;  1E44 A;  2AOS A;  1ZU8 A;  2KFW A;  3RFW A;  1ROU A;  4XAK A;  2DSZ A;  2KR7 A;  3RM8 A;  4DWS C;  1JNS A;  3AS3 A;  1U79 A;  4DRM A;  3FY1 A;  3O5M A;  3AS0 A;  2D9F A;  3O5K A;  1BL4 A;  4TNS A;  4O2T A;  3WKZ A;  1W1P A;  3B9D A;  5DEZ A;  4DWS B;  3ARR A;  3WD1 A;  2A3C A;  4U84 A;  4ZPV R;  1GUV A;  1CTN A;  3WD2 A;  2XP5 A;  3KAF A;  3CHE A;  3O5E A;  4DRQ A;  1OGB A;  2M08 A;  3CH9 A;  1FKK A;  1X6N A;  3UQB A;  4L3N A;  5B8I C;  5GQB A;  3UQA A;  2XP6 A;  2PV1 A;  1EIB A;  3KCE A;  1FKD A;  3B9A A;  1W26 A;  1HXV A;  1HJX A;  2KO7 A;  1ITX A;  3TCZ A;  3W4R A;  3ART A;  3OOB A;  4DRH A;  2RUC A;  1ZCN A;  1WAW A;  2FDM A;  2MF9 A;  1XHG A;  2A3E A;  4WKH A;  5D75 A;  5HWC A;  4MNK A;  4P8X A;  2DSU A;  5DIV A;  2RQS A;  1ROT A;  2PV3 A;  2PBC A;  2Q5A A;  2XP7 A;  3O5R A;  3O5D A;  3ARO A;  4U86 A;  1ZBK A;  4QIB A;  1E6N A;  3VAW A;  1FAP A;  2ZQT A;  4TW6 A;  2A3A A;  4JFM A;  4R0X A;  2DSV A;  1ZL1 A;  1TCO C;  1Q6U A;  3UF8 A;  4Z2K A;  4MPK A;  1Y0O A;  1HJW A;  4MSP A;  2RUQ A;  3ARW A;  2DPE A;  1ZBW A;  1RD6 A;  5DIT A;  4JFL A;  1JCH B;  1D6O A;  1NWR A;  3CGN A;  1FKR A;  3NRK A;  4R5E A;  4W9P A;  4ODO A;  3PR9 A;  4DZ2 A;  1W9V A;  4WKF A;  4J4O A;  1QPL A;  2ZQS A;  4W9O A;  1LL7 A;  5HW7 A;  3KAG A;  3PRD A;  3AS1 A;  4ML4 A;  4Z2H A;  1D2K A;  2MLX A;  2MPH A;  1ZK6 A;  2N87 A;  3WH0 A;  1L1P A;  1PBK A;  2RUD A;  2Y78 A;  5HUA A;  3B7X A;  4KQZ A;  1E9L A;  4MNM A;  4ODP A;  1GOI A;  1HKK A;  2FAP A;  4DRJ A;  2RUR A;  2DSW A;  5HT1 A;  3CHF A;  4TX0 A;  3MDY B;  2ESC A;  4DWS A;  2DG3 A;  1FD9 A;  1K9T A;  1KFW A;  2M1I A;  3H9R B;  2XP3 A;  3JYM A;  3NI6 A;  3ALG A;  2MLY A;  2IUZ A;  4JYS A;  3IKD A;  4IQ2 A;  1FKL A;  2WLZ A;  4MGV A;  4Z2L A;  3ARY A;  2PI6 A;  2PPN A;  1VF8 A;  1D7I A;  3FAP A;  1J4I A;  1SYT A;  5J6E A;  4P8U A;  1NWT A;  3KAI A;  2L2S A;  1OWQ A;  1W1V A;  1W1Y A;  4LGX A;  2VCD A;  4ODM A;  4S3J A;  3KAD A;  3EIP A;  4FAP A;  4G2P A;  2WLY A;  3TDB A;  4ODK A;  4QZV B;  1XRV A;  3UI4 A;  1FKI A;  3O5O A;  4ODR A;  4S3K A;  3BMB A;  4JFJ A;  1A7X A;  4AY1 A;  3G6L A;  4MNL A;  4BF8 A;  4DRK A;  2WK2 A;  1IX5 A;  2OFN A;  3WL1 A;  5HW6 A;  2MLZ A;  4IPX A;  4W5U A;  3NTP A;  1LL6 A;  4P8W A;  1HJV A;  2WM0 A;  4HAR A;  2F2D A;  1B6C A;  4GGQ A;  2F23 A;  1OGG A;  2KE0 A;  1F8A B;  4WIW A;  1E6R A;  2F21 A;  5DIU A;  4WJX A;  5HWB A;  4Z2I A;  1EYM A;  2MNT A;  4DIP A;  3UQI A;  2VN1 A;  1JNT A;  3CZ8 A;  1YW5 A;  4NZC A;  4G50 A;  1H0G A;  3ARS A;  4NNR A;  1PIN A;  3ARQ A;  4J4N A;  2ZQV A;  1UR8 A; 
#chains in the Genus database with same CATH homology
 5DO2 A;  1E15 A;  3AS2 A;  1E6Z A;  1O6I A;  1FKJ A;  4LAY A;  3OA5 A;  3O5J A;  1EHN A;  4FN2 A;  4ZS6 A;  4ODL A;  1WNO A;  1FJD A;  2A3B A;  4HBE A;  3WD3 A;  1QPF A;  1F40 A;  3RGC A;  3CHD A;  1Q6I A;  1FKG A;  1J4H A;  3WQW A;  5JH8 A;  1GPF A;  1FKF A;  1FKH A;  3CGM A;  5HBF A;  2DT2 A;  3IKG A;  1LQ0 A;  3BXW A;  3KAC A;  5GPG A;  3QOK A;  2YBU A;  4NSB A;  1HKJ A;  3EY6 A;  2KI3 A;  4DZ3 A;  3TC5 A;  4P8V A;  1UR9 A;  4GIV A;  4LAV A;  1E6P A;  2O9O A;  2ZQU A;  1LG1 A;  4KR0 B;  4ODN A;  1W9U A;  1FKS A;  1LG2 A;  3AQU A;  2M2A A;  1EQ3 A;  4ODQ A;  1FFQ A;  4IT4 A;  1NMV A;  3G6M A;  4U85 A;  2XPB A;  2UZ5 A;  4HBO A;  1QZ2 A;  1HKI A;  1D7H A;  1BKF A;  5I98 A;  2JZV A;  3O5G A;  2XP9 A;  4IT6 A;  1W9P A;  2QF8 A;  4DH0 A;  3PRB A;  3RME A;  2O92 A;  2LGO A;  4DRP A;  1Q1C A;  4LAW A;  1NH6 A;  1KT0 A;  5HKG A;  2XP4 A;  3IHZ A;  3PRA A;  1ZB5 A;  1JNE A;  1SR0 A;  3ARU A;  4QT3 A;  4JFI A;  3ARZ A;  3CHC A;  3RM4 A;  4MTV A;  1Q6H A;  4TW7 A;  1T11 A;  1FFR A;  3I6C A;  1KT1 A;  4MNJ A;  5HW8 A;  1X6L A;  3FXY A;  2DG9 A;  2K8I A;  2DT0 A;  4N19 A;  2YBT A;  3JYJ A;  4DRO A;  1FKB A;  2XP8 A;  1YAT A;  5DF0 A;  3PA7 A;  1NWU A;  4TW8 A;  3GPK A;  2PPO A;  2G41 A;  1NSG A;  1JND A;  1HKM A;  1ZBV A;  4JFK A;  3UI5 A;  1M5Y A;  1ZBC A;  4MAV A;  3UI6 A;  2LPV A;  1NMW A;  1P5Q A;  1W1T A;  2LJ4 A;  4ITZ A;  5BXJ A;  2PV2 A;  4TYO A;  1TFV A;  3JXV A;  4DWS D;  3O5F A;  3WL0 A;  3ARP A;  4DRN A;  3O5L A;  3ODK A;  5GPR A;  2DT1 A;  4ZPW R;  4Q7N A;  2ZR5 A;  1LL4 A;  4W9Q A;  1J6Y A;  4LAX A;  4URI A;  3KAB A;  1N1A A;  2ITK A;  3ARV A;  3O5I A;  4C02 B;  2B31 A;  4ZPT R;  3RM9 A;  2DT3 A;  1R9H A;  1JVW A;  3LUO A;  2LKN A;  3WD4 A;  2OLH A;  1EDQ A;  2ZR4 A;  4Q22 A;  4DT4 A;  3O5P A;  2PPP A;  3KZ7 A;  4Z2G A;  3ALF A;  2FKE A;  3ARX A;  1LJY A;  2F4E A;  3O5Q A;  1J4R A;  4WKA A;  1FKT A;  3B9E A;  1WB0 A;  2RSE A;  2XPA A;  4DRI A;  1C9H A;  5HTG A;  3KAH A;  3B8S A;  3WIJ A;  1H0I A;  2G8Z A;  4Z2J A;  4PTM A;  4IQC A;  3IK8 A;  4QT2 A;  2AWG A;  2ZR6 A;  2IF4 A;  3WQV A;  3WD0 A;  2DG4 A;  4WK9 A;  4L72 B;  2KGJ A;  1D7J A;  1NWS A;  2AOS A;  1ZU8 A;  2KFW A;  3RFW A;  1ROU A;  4XAK A;  2DSZ A;  2KR7 A;  3RM8 A;  4DWS C;  1JNS A;  3AS3 A;  1U79 A;  4DRM A;  3FY1 A;  3O5M A;  3AS0 A;  2D9F A;  3O5K A;  1BL4 A;  4TNS A;  4O2T A;  3WKZ A;  1W1P A;  3B9D A;  5DEZ A;  4DWS B;  3ARR A;  3WD1 A;  2A3C A;  4U84 A;  4ZPV R;  1GUV A;  1CTN A;  3WD2 A;  2XP5 A;  3KAF A;  3CHE A;  3O5E A;  4DRQ A;  1OGB A;  2M08 A;  3CH9 A;  1FKK A;  1X6N A;  3UQB A;  4L3N A;  5B8I C;  5GQB A;  3UQA A;  2XP6 A;  2PV1 A;  1EIB A;  3KCE A;  1FKD A;  3B9A A;  1W26 A;  1HXV A;  1HJX A;  2KO7 A;  1ITX A;  3TCZ A;  3W4R A;  3ART A;  3OOB A;  4DRH A;  2RUC A;  1ZCN A;  1WAW A;  2FDM A;  2MF9 A;  1XHG A;  2A3E A;  4WKH A;  5D75 A;  5HWC A;  4MNK A;  4P8X A;  2DSU A;  5DIV A;  2RQS A;  1ROT A;  2PV3 A;  2PBC A;  2Q5A A;  2XP7 A;  3O5R A;  3O5D A;  3ARO A;  4U86 A;  1ZBK A;  4QIB A;  1E6N A;  3VAW A;  1FAP A;  2ZQT A;  4TW6 A;  2A3A A;  4JFM A;  4R0X A;  2DSV A;  1ZL1 A;  1TCO C;  1Q6U A;  3UF8 A;  4Z2K A;  4MPK A;  1Y0O A;  1HJW A;  4MSP A;  2RUQ A;  3ARW A;  2DPE A;  1ZBW A;  1RD6 A;  5DIT A;  4JFL A;  1D6O A;  1NWR A;  3CGN A;  1FKR A;  3NRK A;  4R5E A;  4W9P A;  4ODO A;  3PR9 A;  4DZ2 A;  1W9V A;  4WKF A;  4J4O A;  1QPL A;  2ZQS A;  4W9O A;  1LL7 A;  5HW7 A;  3KAG A;  3PRD A;  3AS1 A;  4ML4 A;  4Z2H A;  1D2K A;  2MLX A;  2MPH A;  1ZK6 A;  2N87 A;  3WH0 A;  1L1P A;  1PBK A;  2RUD A;  2Y78 A;  5HUA A;  3B7X A;  4KQZ A;  1E9L A;  4MNM A;  4ODP A;  1GOI A;  1HKK A;  2FAP A;  4DRJ A;  2RUR A;  2DSW A;  5HT1 A;  3CHF A;  4TX0 A;  3MDY B;  2ESC A;  4DWS A;  2DG3 A;  1FD9 A;  1K9T A;  1KFW A;  2M1I A;  3H9R B;  2XP3 A;  3JYM A;  3NI6 A;  3ALG A;  2MLY A;  2IUZ A;  4JYS A;  3IKD A;  4IQ2 A;  1FKL A;  2WLZ A;  4MGV A;  4Z2L A;  3ARY A;  2PI6 A;  2PPN A;  1VF8 A;  1D7I A;  3FAP A;  1J4I A;  1SYT A;  5J6E A;  4P8U A;  1NWT A;  3KAI A;  2L2S A;  1OWQ A;  1W1V A;  1W1Y A;  4LGX A;  2VCD A;  4ODM A;  4S3J A;  3KAD A;  4FAP A;  4G2P A;  2WLY A;  3TDB A;  4ODK A;  4QZV B;  1XRV A;  3UI4 A;  1FKI A;  3O5O A;  4ODR A;  4S3K A;  4JFJ A;  1A7X A;  4AY1 A;  3G6L A;  4MNL A;  4BF8 A;  4DRK A;  2WK2 A;  1IX5 A;  2OFN A;  3WL1 A;  5HW6 A;  2MLZ A;  4IPX A;  4W5U A;  3NTP A;  1LL6 A;  4P8W A;  1HJV A;  2WM0 A;  4HAR A;  2F2D A;  1B6C A;  4GGQ A;  1OGG A;  2KE0 A;  1F8A B;  4WIW A;  1E6R A;  2F21 A;  5DIU A;  4WJX A;  5HWB A;  4Z2I A;  1EYM A;  2MNT A;  4DIP A;  3UQI A;  2VN1 A;  1JNT A;  3CZ8 A;  1YW5 A;  4NZC A;  4G50 A;  1H0G A;  3ARS A;  4NNR A;  1PIN A;  3ARQ A;  4J4N A;  2ZQV A;  1UR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...