4DH0A

X-ray crystal structure of 28-o-methylrapamycin complexed with fkbp12: is the cyclohexyl moiety part of the effector domain of rapamycin?
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
publication title X-ray Crystal Structure of 28-O-Methylrapamycin complexed with FKBP12: Is the Cyclohexyl Moiety Part of the Effector Domain of Rapamycin?
doi rcsb
source organism Homo sapiens
molecule tags Isomerase/immunosuppressant
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dh0A00
3O5GA 4JFKA 4BF8A 5GPGA 3EY6A 3KACA 4U85A 4IQCA 1P5QA 1JVWA 3IK8A 3PRDA 4ODNA 4JFJA 2KR7A 2ZQVA 1ROUA 3CGMA 3IKDA 4MGVA 2F21A 4QT3A 2ZQSA 1KT0A 3O5JA 4DRIA 2XP4A 1R9HA 1ZCNA 3JYMA 2M1IA 2MPHA 2M2AA 4ODRA 3TDBA 3UF8A 4NNRA 3KAIA 5HW8A 1QPFA 4IQ2A 1J4HA 1F40A 2Q5AA 1B6CA 1FKKA 1BKFA 4QIBA 1J4IA 1A7XA 3OOBA 1ROTA 3O5DA 2JZVA 1FKJA 4TW8A 2PV1A 2RUQA 3B7XA 4TX0A 4DRKA 2KFWA 3JYJA 3PA7A 1C9HA 1TCOC 1FKDA 3KAHA 4U86A 3FAPA 5J6EA 2DG4A 1D7HA 4DROA 2XPBA 3KAFA 3RFWA 2PBCA 1N1AA 2RURA 2XP6A 1HXVA 1PBKA 1Q6HA 3KABA 4O2TA 2PV3A 2ZR5A 1D6OA 4J4OA 2N87A 2MLZA 4ODQA 4TW7A 5DITA 3NRKA 1EQ3A 3IKGA 2LJ4A 4J4NA 2AWGA 2DG3A 5HKGA 4DZ3A 1PINA 4C02B 1FD9A 5HWCA 4DRMA 5D75A 3UI4A 2VCDA 4LAVA 3O5MA 4TNSA 3NTPA 3I6CA 4U84A 1FKLA 3VAWA 2D9FA 5HW7A 1Q6IA 1KT1A 1EYMA 3PRBA 2KGJA 4LAXA 2ZQUA 4TW6A 5HW6A 3UQAA 4DRNA 5I98A 3CGNA 4DZ2A 5HTGA 4G50A 3LUOA 1FKSA 1Y0OA 2OFNA 4LAWA 4QT2A 3WH0A 1JNSA 1NMWA 1JNTA 4JYSA 3O5QA 4DRHA 1YW5A 1F8AB 1FKFA 1FKGA 2IF4A 3O5RA 3O5KA 2ZQTA 1FKBA 2XP3A 3ODKA 4W9QA 4G2PA 2K8IA 2LKNA 3O5PA 4W9PA 2XPAA 3RGCA 1NMVA 2RSEA 4JFIA 2PV2A 2ITKA 1QZ2A 5DIVA 2FKEA 1FJDA 5HT1A 1FAPA 2PPOA 3O5FA 2KI3A 2MF9A 2XP9A 1D7JA 2FAPA 2L2SA 2XP7A 4R0XA 5HWBA 2VN1A 1QPLA 3O5OA 4MSPA 4N19A 4ODPA 2MLXA 4ODOA 2XP5A 1FKRA 1YATA 5HUAA 3MDYB 3IHZA 1T11A 3UI6A 3JXVA 5B8IC 2F4EA 2PPPA 2LGOA 2MLYA 2ZR6A 3KAGA 3O5EA 4ITZA 5BXJA 4ODLA 2LPVA 3KZ7A 4GIVA 5DIUA 2RQSA 2XP8A 4FN2A 4LAYA 2UZ5A 4JFLA 1J4RA 1D7IA 1J6YA 3UI5A 4W9OA 4GGQA 4DRJA 1NSGA 1ZK6A 2ZR4A 2F2DA 1FKIA 2KE0A 4DRPA 1W26A 2MNTA 3TC5A 3UQBA 1M5YA 2DG9A 2RUDA 3H9RB 3O5LA 3GPKA 1FKTA 4DT4A 4IPXA 1FKHA 2RUCA 3NI6A 3TCZA 3O5IA 4DIPA 2PPNA 1Q1CA 1Q6UA 3UQIA 4FAPA 4ODKA 1U79A 2M08A 3KADA 1BL4A 4DH0A 4JFMA 2KO7A 2Y78A 4TYOA 1L1PA 3KCEA 4ODMA 4DRQA
chains in the Genus database with same CATH superfamily
3O5GA 3WQVA 1P5QA 4ODNA 4AY1A 4JFJA 1ROUA 4MGVA 2ZQSA 1KT0A 2WLYA 1E6NA 1ZCNA 3CZ8A 2YBTA 2M1IA 2A3AA 5HW8A 4LGXA 1B6CA 2DSUA 3B7XA 1C9HA 3B9EA 3ARRA 1TCOC 3WD0A 5J6EA 3RFWA 1EDQA 2PBCA 1E6ZA 2RURA 2XP6A 3ALGA 1GUVA 4WK9A 2PV3A 4Z2LA 3NRKA 1ZU8A 1EQ3A 3IKGA 4MNJA 4Z2HA 1ZBCA 1KFWA 5HWCA 3AROA 4DRMA 3UI4A 3CH9A 4TNSA 4LAXA 5HW6A 3PRBA 3WQWA 3ARZA 3UQAA 4DRNA 4S3JA 1UR9A 3RM4A 5HTGA 1X6LA 3RM8A 4Z2JA 1FKFA 4U84A 3WD4A 1FFRA 1FKBA 1HJWA 2FDMA 1W9PA 3AS1A 2PV2A 3OA5A 1QZ2A 5DIVA 2FKEA 2G8ZA 3ALFA 1E6PA 2XP9A 1IX5A 4L72B 4ODOA 2MLXA 1YATA 3ARXA 2F4EA 4URIA 5GQBA 4GIVA 2RQSA 1H0GA 1D2KA 1SR0A 2A3CA 2ZR4A 1W26A 1E6RA 3TC5A 4WKFA 1LL4A 1GOIA 1M5YA 2DSWA 1LL6A 4Q22A 1FKTA 1FKHA 1LG1A 3TCZA 1LQ0A 1Q6UA 4R5EA 4ODKA 4WKAA 1BL4A 4JFMA 4TYOA 1L1PA 4P8UA 3AQUA 4ODMA 3G6LA 1E44A 4W5UA 3ARWA 5HBFA 4P8WA 4IQCA 3AS0A 3IK8A 2DT3A 1ZL1A 1UR8A 2KR7A 4WIWA 4DWSC 2F21A 4QT3A 4L3NA 1E9LA 5JH8A 3FXYA 4ODRA 4NNRA 4XAKA 1NWUA 1O6IA 1HJVA 1JNEA 2B31A 3B9AA 1FKKA 1BKFA 3OOBA 5DITA 1ROTA 4TX0A 2DT0A 2PV1A 4S3KA 4HBOA 4U86A 3QOKA 1HKMA 3WL1A 3KABA 4IT6A 1D6OA 4HARA 1ZB5A 3PRAA 4DWSB 4ZS6A 1W1TA 2LJ4A 1HKKA 4MNKA 1PINA 4C02B 3PR9A 5D75A 3NTPA 3VAWA 4TW6A 1KT1A 4MNMA 4WKHA 2ESCA 1FKSA 4LAWA 4Z2GA 1JNSA 1JNTA 4JYSA 4MAVA 3ODKA 4ZPVR 5DO2A 3FY1A 1H0IA 1GPFA 4JFIA 2ITKA 1XRVA 2A3EA 2OLHA 5HT1A 2ETNA 3BMBA 3RM9A 2PPOA 3O5FA 2XP7A 3WD2A 1QPLA 3O5OA 4MSPA 2DT2A 3IHZA 3CHCA 5DF0A 5B8IC 1GRJA 3WD3A 1ZBWA 4LAYA 4DWSD 1D7IA 3UI5A 4W9OA 1NWTA 2F2DA 4DRPA 4NSBA 3EIPA 3H9RB 3O5LA 3GPKA 4MTVA 2RUCA 3O5IA 3ARUA 2PPNA 3UQIA 3KADA 4DH0A 3WIJA 2KO7A 1ITXA 1TFVA 4JFKA 4BF8A 4P8VA 5GPGA 3EY6A 1W9VA 3PRDA 2B5UB 1HKIA 3O5JA 4DWSA 1W1YA 2MPHA 3UF8A 1JNDA 1NWSA 1QPFA 4IQ2A 3WKZA 3ARSA 1F40A 4QIBA 1A7XA 2F23A 2QF8A 4ML4A 2JZVA 1FKJA 4TW8A 4DRKA 2WK2A 1OWQA 3FAPA 1ZBKA 2XPBA 3KAFA 4DROA 1HXVA 1PBKA 4O2TA 5GPRA 4J4OA 2N87A 2MLZA 4TW7A 2YBUA 2DG3A 4DZ3A 1LJYA 2G41A 4LAVA 5HW7A 1FKLA 1XHGA 2D9FA 1Q6IA 3B9DA 4G50A 3LUOA 3W4RA 4MPKA 1W9UA 3O5QA 4DRHA 2IF4A 3O5RA 1FKGA 3O5KA 2ZQTA 2XP3A 4W9QA 5DEZA 4G2PA 3ARQA 3O5PA 4W9PA 1EHNA 2XPAA 3RGCA 2RSEA 3WD1A 1OGBA 3AS2A 3BXWA 1FJDA 2AOSA 4IT4A 2MF9A 2L2SA 5HWBA 2DSVA 2VN1A 2P4VA 1FKRA 2DSZA 2EULA 3MDYB 3UI6A 4NZCA 2PI6A 2PPPA 1FFQA 2LGOA 2MLYA 3G6MA 4ITZA 1WB0A 3O5EA 4ODLA 3KZ7A 2XP8A 4FN2A 1J6YA 1LG2A 4GGQA 4KQZA 2KE0A 2RUDA 4DT4A 4IPXA 1W1VA 4UDMA 1SYTA 1CTNA 1Q1CA 1E15A 1HKJA 4MNLA 2M08A 1RD6A 2Y78A 3KCEA 4ZPWR 1HJXA 2WM0A 1WNOA 4DRQA 3KACA 4U85A 2O92A 2IUZA 1JVWA 1EIBA 2ZQVA 3CGMA 3IKDA 4DRIA 1NWRA 1R9HA 2XP4A 1K9TA 3JYMA 2M2AA 3TDBA 4HBEA 3KAIA 4Q7NA 1J4HA 2O9OA 3ARVA 2Q5AA 4ZPTR 1OGGA 2PN0A 1J4IA 3ARPA 3O5DA 2RUQA 2KFWA 3JYJA 1JCHB 3PA7A 1FKDA 3KAHA 2DG4A 1D7HA 3AS3A 1N1AA 3CHDA 1Q6HA 2ZR5A 4ODQA 4J4NA 2AWGA 5HKGA 1FD9A 3B8SA 2VCDA 3O5MA 3I6CA 1ZBVA 1EYMA 2KGJA 2ZQUA 5I98A 2WLZA 3CGNA 4Z2KA 4DZ2A 1Y0OA 2OFNA 4QT2A 3WH0A 1NMWA 1YW5A 1NH6A 1F8AB 4QZVB 2K8IA 2LKNA 1NMVA 4P8XA 1X6NA 1FAPA 2KI3A 4R0XA 3GU0A 1D7JA 2FAPA 1WAWA 4ODPA 4N19A 2XP5A 5HUAA 1T11A 3ARTA 3JXVA 2A3BA 3WL0A 4WJXA 4KR0B 1LL7A 3KAGA 2ZR6A 5BXJA 2LPVA 5DIUA 2UZ5A 3GTYX 4JFLA 1J4RA 2DPEA 4DRJA 1NSGA 1ZK6A 3ARYA 1FKIA 2MNTA 3UQBA 1W1PA 2DG9A 3RMEA 3NI6A 4DIPA 2DT1A 3CHFA 4Z2IA 4FAPA 4PTMA 3CHEA 1U79A 1VF8A
chains in the Genus database with same CATH topology
3O5GA 3WQVA 1P5QA 4ODNA 4AY1A 4JFJA 1ROUA 4MGVA 2ZQSA 1KT0A 2WLYA 1E6NA 1ZCNA 3CZ8A 2YBTA 2M1IA 2A3AA 5HW8A 4LGXA 1B6CA 2DSUA 3B7XA 1C9HA 3B9EA 3ARRA 1TCOC 3WD0A 5J6EA 3RFWA 1EDQA 2PBCA 1E6ZA 2RURA 2XP6A 3ALGA 1GUVA 4WK9A 2PV3A 4Z2LA 3NRKA 1ZU8A 1EQ3A 3IKGA 4MNJA 4Z2HA 1ZBCA 1KFWA 5HWCA 3AROA 4DRMA 3UI4A 3CH9A 4TNSA 4LAXA 5HW6A 3PRBA 3WQWA 3ARZA 3UQAA 4DRNA 4S3JA 1UR9A 3RM4A 5HTGA 1X6LA 3RM8A 4Z2JA 1FKFA 4U84A 3WD4A 1FFRA 1FKBA 1HJWA 2FDMA 1W9PA 3AS1A 2PV2A 3OA5A 1QZ2A 5DIVA 2FKEA 2G8ZA 3ALFA 1E6PA 2XP9A 1IX5A 4L72B 4ODOA 2MLXA 1YATA 3ARXA 2F4EA 4URIA 5GQBA 4GIVA 2RQSA 1H0GA 1D2KA 1SR0A 2A3CA 2ZR4A 1W26A 1E6RA 3TC5A 4WKFA 1LL4A 1GOIA 1M5YA 2DSWA 1LL6A 4Q22A 1FKTA 1FKHA 1LG1A 3TCZA 1LQ0A 1Q6UA 4R5EA 4ODKA 4WKAA 1BL4A 4JFMA 4TYOA 1L1PA 4P8UA 3AQUA 4ODMA 3G6LA 4W5UA 3ARWA 5HBFA 4P8WA 4IQCA 3AS0A 3IK8A 2DT3A 1ZL1A 1UR8A 2KR7A 4WIWA 4DWSC 2F21A 4QT3A 4L3NA 1E9LA 5JH8A 3FXYA 4ODRA 4NNRA 4XAKA 1NWUA 1O6IA 1HJVA 1JNEA 2B31A 3B9AA 1FKKA 1BKFA 3OOBA 5DITA 1ROTA 4TX0A 2DT0A 2PV1A 4S3KA 4HBOA 4U86A 3QOKA 1HKMA 3WL1A 3KABA 4IT6A 1D6OA 4HARA 1ZB5A 3PRAA 4DWSB 4ZS6A 1W1TA 2LJ4A 1HKKA 4MNKA 1PINA 4C02B 3PR9A 5D75A 3NTPA 3VAWA 4TW6A 1KT1A 4MNMA 4WKHA 2ESCA 1FKSA 4LAWA 4Z2GA 1JNSA 1JNTA 4JYSA 4MAVA 3ODKA 4ZPVR 5DO2A 3FY1A 1H0IA 1GPFA 4JFIA 2ITKA 1XRVA 2A3EA 2OLHA 5HT1A 3RM9A 2PPOA 3O5FA 2XP7A 3WD2A 1QPLA 3O5OA 4MSPA 2DT2A 3IHZA 3CHCA 5DF0A 5B8IC 3WD3A 1ZBWA 4LAYA 4DWSD 1D7IA 3UI5A 4W9OA 1NWTA 2F2DA 4DRPA 4NSBA 3H9RB 3O5LA 3GPKA 4MTVA 2RUCA 3O5IA 3ARUA 2PPNA 3UQIA 3KADA 4DH0A 3WIJA 2KO7A 1ITXA 1TFVA 4JFKA 4BF8A 4P8VA 5GPGA 3EY6A 1W9VA 3PRDA 1HKIA 3O5JA 4DWSA 1W1YA 2MPHA 3UF8A 1JNDA 1NWSA 1QPFA 4IQ2A 3WKZA 3ARSA 1F40A 4QIBA 1A7XA 4ML4A 2QF8A 4TW8A 2JZVA 1FKJA 4DRKA 2WK2A 1OWQA 3FAPA 1ZBKA 2XPBA 3KAFA 4DROA 1HXVA 1PBKA 4O2TA 5GPRA 4J4OA 2N87A 2MLZA 4TW7A 2YBUA 2DG3A 4DZ3A 1LJYA 2G41A 4LAVA 5HW7A 1FKLA 1XHGA 2D9FA 1Q6IA 3B9DA 4G50A 3LUOA 3W4RA 4MPKA 1W9UA 3O5QA 4DRHA 2IF4A 3O5RA 1FKGA 3O5KA 2ZQTA 2XP3A 4W9QA 5DEZA 4G2PA 3ARQA 3O5PA 4W9PA 1EHNA 2XPAA 3RGCA 2RSEA 3WD1A 1OGBA 3AS2A 3BXWA 1FJDA 2AOSA 4IT4A 2MF9A 2L2SA 5HWBA 2DSVA 2VN1A 1FKRA 2DSZA 3MDYB 3UI6A 4NZCA 2PI6A 2PPPA 1FFQA 2LGOA 2MLYA 3G6MA 4ITZA 1WB0A 3O5EA 4ODLA 3KZ7A 2XP8A 4FN2A 1J6YA 1LG2A 4GGQA 4KQZA 2KE0A 2RUDA 4DT4A 4IPXA 1W1VA 1SYTA 1CTNA 1Q1CA 1E15A 1HKJA 4MNLA 2M08A 1RD6A 2Y78A 3KCEA 4ZPWR 1HJXA 2WM0A 1WNOA 4DRQA 3KACA 4U85A 2O92A 2IUZA 1JVWA 1EIBA 2ZQVA 3CGMA 3IKDA 4DRIA 1NWRA 1R9HA 2XP4A 1K9TA 3JYMA 2M2AA 3TDBA 4HBEA 3KAIA 4Q7NA 1J4HA 2O9OA 3ARVA 2Q5AA 4ZPTR 1OGGA 1J4IA 3ARPA 3O5DA 2RUQA 2KFWA 3JYJA 3PA7A 1FKDA 3KAHA 2DG4A 1D7HA 3AS3A 1N1AA 3CHDA 1Q6HA 2ZR5A 4ODQA 4J4NA 2AWGA 5HKGA 1FD9A 3B8SA 2VCDA 3O5MA 3I6CA 1ZBVA 1EYMA 2KGJA 2ZQUA 5I98A 2WLZA 3CGNA 4Z2KA 4DZ2A 1Y0OA 2OFNA 4QT2A 3WH0A 1NMWA 1YW5A 1NH6A 1F8AB 4QZVB 2K8IA 2LKNA 1NMVA 4P8XA 1X6NA 1FAPA 2KI3A 4R0XA 1D7JA 2FAPA 1WAWA 4ODPA 4N19A 2XP5A 5HUAA 1T11A 3ARTA 3JXVA 2A3BA 3WL0A 4WJXA 4KR0B 1LL7A 3KAGA 2ZR6A 5BXJA 2LPVA 5DIUA 2UZ5A 4JFLA 1J4RA 2DPEA 4DRJA 1NSGA 1ZK6A 3ARYA 1FKIA 2MNTA 3UQBA 1W1PA 2DG9A 3RMEA 3NI6A 4DIPA 2DT1A 3CHFA 4Z2IA 4FAPA 4PTMA 3CHEA 1U79A 1VF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5G A;  4JFK A;  4BF8 A;  5GPG A;  3EY6 A;  3KAC A;  4U85 A;  4IQC A;  1P5Q A;  1JVW A;  3IK8 A;  3PRD A;  4ODN A;  4JFJ A;  2KR7 A;  2ZQV A;  1ROU A;  3CGM A;  3IKD A;  4MGV A;  2F21 A;  4QT3 A;  2ZQS A;  1KT0 A;  3O5J A;  4DRI A;  2XP4 A;  1R9H A;  1ZCN A;  3JYM A;  2M1I A;  2MPH A;  2M2A A;  4ODR A;  3TDB A;  3UF8 A;  4NNR A;  3KAI A;  5HW8 A;  1QPF A;  4IQ2 A;  1J4H A;  1F40 A;  2Q5A A;  1B6C A;  1FKK A;  1BKF A;  4QIB A;  1J4I A;  1A7X A;  3OOB A;  1ROT A;  3O5D A;  2JZV A;  1FKJ A;  4TW8 A;  2PV1 A;  2RUQ A;  3B7X A;  4TX0 A;  4DRK A;  2KFW A;  3JYJ A;  3PA7 A;  1C9H A;  1TCO C;  1FKD A;  3KAH A;  4U86 A;  3FAP A;  5J6E A;  2DG4 A;  1D7H A;  4DRO A;  2XPB A;  3KAF A;  3RFW A;  2PBC A;  1N1A A;  2RUR A;  2XP6 A;  1HXV A;  1PBK A;  1Q6H A;  3KAB A;  4O2T A;  2PV3 A;  2ZR5 A;  1D6O A;  4J4O A;  2N87 A;  2MLZ A;  4ODQ A;  4TW7 A;  5DIT A;  3NRK A;  1EQ3 A;  3IKG A;  2LJ4 A;  4J4N A;  2AWG A;  2DG3 A;  5HKG A;  4DZ3 A;  1PIN A;  4C02 B;  1FD9 A;  5HWC A;  4DRM A;  5D75 A;  3UI4 A;  2VCD A;  4LAV A;  3O5M A;  4TNS A;  3NTP A;  3I6C A;  4U84 A;  1FKL A;  3VAW A;  2D9F A;  5HW7 A;  1Q6I A;  1KT1 A;  1EYM A;  3PRB A;  2KGJ A;  4LAX A;  2ZQU A;  4TW6 A;  5HW6 A;  3UQA A;  4DRN A;  5I98 A;  3CGN A;  4DZ2 A;  5HTG A;  4G50 A;  3LUO A;  1FKS A;  1Y0O A;  2OFN A;  4LAW A;  4QT2 A;  3WH0 A;  1JNS A;  1NMW A;  1JNT A;  4JYS A;  3O5Q A;  4DRH A;  1YW5 A;  1F8A B;  1FKF A;  1FKG A;  2IF4 A;  3O5R A;  3O5K A;  2ZQT A;  1FKB A;  2XP3 A;  3ODK A;  4W9Q A;  4G2P A;  2K8I A;  2LKN A;  3O5P A;  4W9P A;  2XPA A;  3RGC A;  1NMV A;  2RSE A;  4JFI A;  2PV2 A;  2ITK A;  1QZ2 A;  5DIV A;  2FKE A;  1FJD A;  5HT1 A;  1FAP A;  2PPO A;  3O5F A;  2KI3 A;  2MF9 A;  2XP9 A;  1D7J A;  2FAP A;  2L2S A;  2XP7 A;  4R0X A;  5HWB A;  2VN1 A;  1QPL A;  3O5O A;  4MSP A;  4N19 A;  4ODP A;  2MLX A;  4ODO A;  2XP5 A;  1FKR A;  1YAT A;  5HUA A;  3MDY B;  3IHZ A;  1T11 A;  3UI6 A;  3JXV A;  5B8I C;  2F4E A;  2PPP A;  2LGO A;  2MLY A;  2ZR6 A;  3KAG A;  3O5E A;  4ITZ A;  5BXJ A;  4ODL A;  2LPV A;  3KZ7 A;  4GIV A;  5DIU A;  2RQS A;  2XP8 A;  4FN2 A;  4LAY A;  2UZ5 A;  4JFL A;  1J4R A;  1D7I A;  1J6Y A;  3UI5 A;  4W9O A;  4GGQ A;  4DRJ A;  1NSG A;  1ZK6 A;  2ZR4 A;  2F2D A;  1FKI A;  2KE0 A;  4DRP A;  1W26 A;  2MNT A;  3TC5 A;  3UQB A;  1M5Y A;  2DG9 A;  2RUD A;  3H9R B;  3O5L A;  3GPK A;  1FKT A;  4DT4 A;  4IPX A;  1FKH A;  2RUC A;  3NI6 A;  3TCZ A;  3O5I A;  4DIP A;  2PPN A;  1Q1C A;  1Q6U A;  3UQI A;  4FAP A;  4ODK A;  1U79 A;  2M08 A;  3KAD A;  1BL4 A;  4DH0 A;  4JFM A;  2KO7 A;  2Y78 A;  4TYO A;  1L1P A;  3KCE A;  4ODM A;  4DRQ A; 
#chains in the Genus database with same CATH topology
 3O5G A;  3WQV A;  1P5Q A;  4ODN A;  4AY1 A;  4JFJ A;  1ROU A;  4MGV A;  2ZQS A;  1KT0 A;  2WLY A;  1E6N A;  1ZCN A;  3CZ8 A;  2YBT A;  2M1I A;  2A3A A;  5HW8 A;  4LGX A;  1B6C A;  2DSU A;  3B7X A;  1C9H A;  3B9E A;  3ARR A;  1TCO C;  3WD0 A;  5J6E A;  3RFW A;  1EDQ A;  2PBC A;  1E6Z A;  2RUR A;  2XP6 A;  3ALG A;  1GUV A;  4WK9 A;  2PV3 A;  4Z2L A;  3NRK A;  1ZU8 A;  1EQ3 A;  3IKG A;  4MNJ A;  4Z2H A;  1ZBC A;  1KFW A;  5HWC A;  3ARO A;  4DRM A;  3UI4 A;  3CH9 A;  4TNS A;  4LAX A;  5HW6 A;  3PRB A;  3WQW A;  3ARZ A;  3UQA A;  4DRN A;  4S3J A;  1UR9 A;  3RM4 A;  5HTG A;  1X6L A;  3RM8 A;  4Z2J A;  1FKF A;  4U84 A;  3WD4 A;  1FFR A;  1FKB A;  1HJW A;  2FDM A;  1W9P A;  3AS1 A;  2PV2 A;  3OA5 A;  1QZ2 A;  5DIV A;  2FKE A;  2G8Z A;  3ALF A;  1E6P A;  2XP9 A;  1IX5 A;  4L72 B;  4ODO A;  2MLX A;  1YAT A;  3ARX A;  2F4E A;  4URI A;  5GQB A;  4GIV A;  2RQS A;  1H0G A;  1D2K A;  1SR0 A;  2A3C A;  2ZR4 A;  1W26 A;  1E6R A;  3TC5 A;  4WKF A;  1LL4 A;  1GOI A;  1M5Y A;  2DSW A;  1LL6 A;  4Q22 A;  1FKT A;  1FKH A;  1LG1 A;  3TCZ A;  1LQ0 A;  1Q6U A;  4R5E A;  4ODK A;  4WKA A;  1BL4 A;  4JFM A;  4TYO A;  1L1P A;  4P8U A;  3AQU A;  4ODM A;  3G6L A;  1E44 A;  4W5U A;  3ARW A;  5HBF A;  4P8W A;  4IQC A;  3AS0 A;  3IK8 A;  2DT3 A;  1ZL1 A;  1UR8 A;  2KR7 A;  4WIW A;  4DWS C;  2F21 A;  4QT3 A;  4L3N A;  1E9L A;  5JH8 A;  3FXY A;  4ODR A;  4NNR A;  4XAK A;  1NWU A;  1O6I A;  1HJV A;  1JNE A;  2B31 A;  3B9A A;  1FKK A;  1BKF A;  3OOB A;  5DIT A;  1ROT A;  4TX0 A;  2DT0 A;  2PV1 A;  4S3K A;  4HBO A;  4U86 A;  3QOK A;  1HKM A;  3WL1 A;  3KAB A;  4IT6 A;  1D6O A;  4HAR A;  1ZB5 A;  3PRA A;  4DWS B;  4ZS6 A;  1W1T A;  2LJ4 A;  1HKK A;  4MNK A;  1PIN A;  4C02 B;  3PR9 A;  5D75 A;  3NTP A;  3VAW A;  4TW6 A;  1KT1 A;  4MNM A;  4WKH A;  2ESC A;  1FKS A;  4LAW A;  4Z2G A;  1JNS A;  1JNT A;  4JYS A;  4MAV A;  3ODK A;  4ZPV R;  5DO2 A;  3FY1 A;  1H0I A;  1GPF A;  4JFI A;  2ITK A;  1XRV A;  2A3E A;  2OLH A;  5HT1 A;  2ETN A;  3BMB A;  3RM9 A;  2PPO A;  3O5F A;  2XP7 A;  3WD2 A;  1QPL A;  3O5O A;  4MSP A;  2DT2 A;  3IHZ A;  3CHC A;  5DF0 A;  5B8I C;  1GRJ A;  3WD3 A;  1ZBW A;  4LAY A;  4DWS D;  1D7I A;  3UI5 A;  4W9O A;  1NWT A;  2F2D A;  4DRP A;  4NSB A;  3EIP A;  3H9R B;  3O5L A;  3GPK A;  4MTV A;  2RUC A;  3O5I A;  3ARU A;  2PPN A;  3UQI A;  3KAD A;  4DH0 A;  3WIJ A;  2KO7 A;  1ITX A;  1TFV A;  4JFK A;  4BF8 A;  4P8V A;  5GPG A;  3EY6 A;  1W9V A;  3PRD A;  2B5U B;  1HKI A;  3O5J A;  4DWS A;  1W1Y A;  2MPH A;  3UF8 A;  1JND A;  1NWS A;  1QPF A;  4IQ2 A;  3WKZ A;  3ARS A;  1F40 A;  4QIB A;  1A7X A;  2F23 A;  2QF8 A;  4ML4 A;  2JZV A;  1FKJ A;  4TW8 A;  4DRK A;  2WK2 A;  1OWQ A;  3FAP A;  1ZBK A;  2XPB A;  3KAF A;  4DRO A;  1HXV A;  1PBK A;  4O2T A;  5GPR A;  4J4O A;  2N87 A;  2MLZ A;  4TW7 A;  2YBU A;  2DG3 A;  4DZ3 A;  1LJY A;  2G41 A;  4LAV A;  5HW7 A;  1FKL A;  1XHG A;  2D9F A;  1Q6I A;  3B9D A;  4G50 A;  3LUO A;  3W4R A;  4MPK A;  1W9U A;  3O5Q A;  4DRH A;  2IF4 A;  3O5R A;  1FKG A;  3O5K A;  2ZQT A;  2XP3 A;  4W9Q A;  5DEZ A;  4G2P A;  3ARQ A;  3O5P A;  4W9P A;  1EHN A;  2XPA A;  3RGC A;  2RSE A;  3WD1 A;  1OGB A;  3AS2 A;  3BXW A;  1FJD A;  2AOS A;  4IT4 A;  2MF9 A;  2L2S A;  5HWB A;  2DSV A;  2VN1 A;  2P4V A;  1FKR A;  2DSZ A;  2EUL A;  3MDY B;  3UI6 A;  4NZC A;  2PI6 A;  2PPP A;  1FFQ A;  2LGO A;  2MLY A;  3G6M A;  4ITZ A;  1WB0 A;  3O5E A;  4ODL A;  3KZ7 A;  2XP8 A;  4FN2 A;  1J6Y A;  1LG2 A;  4GGQ A;  4KQZ A;  2KE0 A;  2RUD A;  4DT4 A;  4IPX A;  1W1V A;  4UDM A;  1SYT A;  1CTN A;  1Q1C A;  1E15 A;  1HKJ A;  4MNL A;  2M08 A;  1RD6 A;  2Y78 A;  3KCE A;  4ZPW R;  1HJX A;  2WM0 A;  1WNO A;  4DRQ A;  3KAC A;  4U85 A;  2O92 A;  2IUZ A;  1JVW A;  1EIB A;  2ZQV A;  3CGM A;  3IKD A;  4DRI A;  1NWR A;  1R9H A;  2XP4 A;  1K9T A;  3JYM A;  2M2A A;  3TDB A;  4HBE A;  3KAI A;  4Q7N A;  1J4H A;  2O9O A;  3ARV A;  2Q5A A;  4ZPT R;  1OGG A;  2PN0 A;  1J4I A;  3ARP A;  3O5D A;  2RUQ A;  2KFW A;  3JYJ A;  1JCH B;  3PA7 A;  1FKD A;  3KAH A;  2DG4 A;  1D7H A;  3AS3 A;  1N1A A;  3CHD A;  1Q6H A;  2ZR5 A;  4ODQ A;  4J4N A;  2AWG A;  5HKG A;  1FD9 A;  3B8S A;  2VCD A;  3O5M A;  3I6C A;  1ZBV A;  1EYM A;  2KGJ A;  2ZQU A;  5I98 A;  2WLZ A;  3CGN A;  4Z2K A;  4DZ2 A;  1Y0O A;  2OFN A;  4QT2 A;  3WH0 A;  1NMW A;  1YW5 A;  1NH6 A;  1F8A B;  4QZV B;  2K8I A;  2LKN A;  1NMV A;  4P8X A;  1X6N A;  1FAP A;  2KI3 A;  4R0X A;  3GU0 A;  1D7J A;  2FAP A;  1WAW A;  4ODP A;  4N19 A;  2XP5 A;  5HUA A;  1T11 A;  3ART A;  3JXV A;  2A3B A;  3WL0 A;  4WJX A;  4KR0 B;  1LL7 A;  3KAG A;  2ZR6 A;  5BXJ A;  2LPV A;  5DIU A;  2UZ5 A;  3GTY X;  4JFL A;  1J4R A;  2DPE A;  4DRJ A;  1NSG A;  1ZK6 A;  3ARY A;  1FKI A;  2MNT A;  3UQB A;  1W1P A;  2DG9 A;  3RME A;  3NI6 A;  4DIP A;  2DT1 A;  3CHF A;  4Z2I A;  4FAP A;  4PTM A;  3CHE A;  1U79 A;  1VF8 A; 
#chains in the Genus database with same CATH homology
 3O5G A;  3WQV A;  1P5Q A;  4ODN A;  4AY1 A;  4JFJ A;  1ROU A;  4MGV A;  2ZQS A;  1KT0 A;  2WLY A;  1E6N A;  1ZCN A;  3CZ8 A;  2YBT A;  2M1I A;  2A3A A;  5HW8 A;  4LGX A;  1B6C A;  2DSU A;  3B7X A;  1C9H A;  3B9E A;  3ARR A;  1TCO C;  3WD0 A;  5J6E A;  3RFW A;  1EDQ A;  2PBC A;  1E6Z A;  2RUR A;  2XP6 A;  3ALG A;  1GUV A;  4WK9 A;  2PV3 A;  4Z2L A;  3NRK A;  1ZU8 A;  1EQ3 A;  3IKG A;  4MNJ A;  4Z2H A;  1ZBC A;  1KFW A;  5HWC A;  3ARO A;  4DRM A;  3UI4 A;  3CH9 A;  4TNS A;  4LAX A;  5HW6 A;  3PRB A;  3WQW A;  3ARZ A;  3UQA A;  4DRN A;  4S3J A;  1UR9 A;  3RM4 A;  5HTG A;  1X6L A;  3RM8 A;  4Z2J A;  1FKF A;  4U84 A;  3WD4 A;  1FFR A;  1FKB A;  1HJW A;  2FDM A;  1W9P A;  3AS1 A;  2PV2 A;  3OA5 A;  1QZ2 A;  5DIV A;  2FKE A;  2G8Z A;  3ALF A;  1E6P A;  2XP9 A;  1IX5 A;  4L72 B;  4ODO A;  2MLX A;  1YAT A;  3ARX A;  2F4E A;  4URI A;  5GQB A;  4GIV A;  2RQS A;  1H0G A;  1D2K A;  1SR0 A;  2A3C A;  2ZR4 A;  1W26 A;  1E6R A;  3TC5 A;  4WKF A;  1LL4 A;  1GOI A;  1M5Y A;  2DSW A;  1LL6 A;  4Q22 A;  1FKT A;  1FKH A;  1LG1 A;  3TCZ A;  1LQ0 A;  1Q6U A;  4R5E A;  4ODK A;  4WKA A;  1BL4 A;  4JFM A;  4TYO A;  1L1P A;  4P8U A;  3AQU A;  4ODM A;  3G6L A;  4W5U A;  3ARW A;  5HBF A;  4P8W A;  4IQC A;  3AS0 A;  3IK8 A;  2DT3 A;  1ZL1 A;  1UR8 A;  2KR7 A;  4WIW A;  4DWS C;  2F21 A;  4QT3 A;  4L3N A;  1E9L A;  5JH8 A;  3FXY A;  4ODR A;  4NNR A;  4XAK A;  1NWU A;  1O6I A;  1HJV A;  1JNE A;  2B31 A;  3B9A A;  1FKK A;  1BKF A;  3OOB A;  5DIT A;  1ROT A;  4TX0 A;  2DT0 A;  2PV1 A;  4S3K A;  4HBO A;  4U86 A;  3QOK A;  1HKM A;  3WL1 A;  3KAB A;  4IT6 A;  1D6O A;  4HAR A;  1ZB5 A;  3PRA A;  4DWS B;  4ZS6 A;  1W1T A;  2LJ4 A;  1HKK A;  4MNK A;  1PIN A;  4C02 B;  3PR9 A;  5D75 A;  3NTP A;  3VAW A;  4TW6 A;  1KT1 A;  4MNM A;  4WKH A;  2ESC A;  1FKS A;  4LAW A;  4Z2G A;  1JNS A;  1JNT A;  4JYS A;  4MAV A;  3ODK A;  4ZPV R;  5DO2 A;  3FY1 A;  1H0I A;  1GPF A;  4JFI A;  2ITK A;  1XRV A;  2A3E A;  2OLH A;  5HT1 A;  3RM9 A;  2PPO A;  3O5F A;  2XP7 A;  3WD2 A;  1QPL A;  3O5O A;  4MSP A;  2DT2 A;  3IHZ A;  3CHC A;  5DF0 A;  5B8I C;  3WD3 A;  1ZBW A;  4LAY A;  4DWS D;  1D7I A;  3UI5 A;  4W9O A;  1NWT A;  2F2D A;  4DRP A;  4NSB A;  3H9R B;  3O5L A;  3GPK A;  4MTV A;  2RUC A;  3O5I A;  3ARU A;  2PPN A;  3UQI A;  3KAD A;  4DH0 A;  3WIJ A;  2KO7 A;  1ITX A;  1TFV A;  4JFK A;  4BF8 A;  4P8V A;  5GPG A;  3EY6 A;  1W9V A;  3PRD A;  1HKI A;  3O5J A;  4DWS A;  1W1Y A;  2MPH A;  3UF8 A;  1JND A;  1NWS A;  1QPF A;  4IQ2 A;  3WKZ A;  3ARS A;  1F40 A;  4QIB A;  1A7X A;  4ML4 A;  2QF8 A;  4TW8 A;  2JZV A;  1FKJ A;  4DRK A;  2WK2 A;  1OWQ A;  3FAP A;  1ZBK A;  2XPB A;  3KAF A;  4DRO A;  1HXV A;  1PBK A;  4O2T A;  5GPR A;  4J4O A;  2N87 A;  2MLZ A;  4TW7 A;  2YBU A;  2DG3 A;  4DZ3 A;  1LJY A;  2G41 A;  4LAV A;  5HW7 A;  1FKL A;  1XHG A;  2D9F A;  1Q6I A;  3B9D A;  4G50 A;  3LUO A;  3W4R A;  4MPK A;  1W9U A;  3O5Q A;  4DRH A;  2IF4 A;  3O5R A;  1FKG A;  3O5K A;  2ZQT A;  2XP3 A;  4W9Q A;  5DEZ A;  4G2P A;  3ARQ A;  3O5P A;  4W9P A;  1EHN A;  2XPA A;  3RGC A;  2RSE A;  3WD1 A;  1OGB A;  3AS2 A;  3BXW A;  1FJD A;  2AOS A;  4IT4 A;  2MF9 A;  2L2S A;  5HWB A;  2DSV A;  2VN1 A;  1FKR A;  2DSZ A;  3MDY B;  3UI6 A;  4NZC A;  2PI6 A;  2PPP A;  1FFQ A;  2LGO A;  2MLY A;  3G6M A;  4ITZ A;  1WB0 A;  3O5E A;  4ODL A;  3KZ7 A;  2XP8 A;  4FN2 A;  1J6Y A;  1LG2 A;  4GGQ A;  4KQZ A;  2KE0 A;  2RUD A;  4DT4 A;  4IPX A;  1W1V A;  1SYT A;  1CTN A;  1Q1C A;  1E15 A;  1HKJ A;  4MNL A;  2M08 A;  1RD6 A;  2Y78 A;  3KCE A;  4ZPW R;  1HJX A;  2WM0 A;  1WNO A;  4DRQ A;  3KAC A;  4U85 A;  2O92 A;  2IUZ A;  1JVW A;  1EIB A;  2ZQV A;  3CGM A;  3IKD A;  4DRI A;  1NWR A;  1R9H A;  2XP4 A;  1K9T A;  3JYM A;  2M2A A;  3TDB A;  4HBE A;  3KAI A;  4Q7N A;  1J4H A;  2O9O A;  3ARV A;  2Q5A A;  4ZPT R;  1OGG A;  1J4I A;  3ARP A;  3O5D A;  2RUQ A;  2KFW A;  3JYJ A;  3PA7 A;  1FKD A;  3KAH A;  2DG4 A;  1D7H A;  3AS3 A;  1N1A A;  3CHD A;  1Q6H A;  2ZR5 A;  4ODQ A;  4J4N A;  2AWG A;  5HKG A;  1FD9 A;  3B8S A;  2VCD A;  3O5M A;  3I6C A;  1ZBV A;  1EYM A;  2KGJ A;  2ZQU A;  5I98 A;  2WLZ A;  3CGN A;  4Z2K A;  4DZ2 A;  1Y0O A;  2OFN A;  4QT2 A;  3WH0 A;  1NMW A;  1YW5 A;  1NH6 A;  1F8A B;  4QZV B;  2K8I A;  2LKN A;  1NMV A;  4P8X A;  1X6N A;  1FAP A;  2KI3 A;  4R0X A;  1D7J A;  2FAP A;  1WAW A;  4ODP A;  4N19 A;  2XP5 A;  5HUA A;  1T11 A;  3ART A;  3JXV A;  2A3B A;  3WL0 A;  4WJX A;  4KR0 B;  1LL7 A;  3KAG A;  2ZR6 A;  5BXJ A;  2LPV A;  5DIU A;  2UZ5 A;  4JFL A;  1J4R A;  2DPE A;  4DRJ A;  1NSG A;  1ZK6 A;  3ARY A;  1FKI A;  2MNT A;  3UQB A;  1W1P A;  2DG9 A;  3RME A;  3NI6 A;  4DIP A;  2DT1 A;  3CHF A;  4Z2I A;  4FAP A;  4PTM A;  3CHE A;  1U79 A;  1VF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...