4DH0A

X-ray crystal structure of 28-o-methylrapamycin complexed with fkbp12: is the cyclohexyl moiety part of the effector domain of rapamycin?
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
publication title X-ray Crystal Structure of 28-O-Methylrapamycin complexed with FKBP12: Is the Cyclohexyl Moiety Part of the Effector Domain of Rapamycin?
doi rcsb
source organism Homo sapiens
molecule tags Isomerase/immunosuppressant
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dh0A00
4DRMA 5HUAA 3KAFA 2LGOA 4QT2A 1N1AA 3KABA 4DRJA 3TCZA 4BF8A 1FKSA 2VN1A 1Q6HA 4U84A 1M5YA 1ROTA 4W9PA 5DIVA 4DZ3A 4DZ2A 1NMWA 4O2TA 1QPLA 3O5PA 4IQCA 4DRPA 2M1IA 2MLYA 3TC5A 1FKRA 3GPKA 2Q5AA 2RUCA 2IF4A 4ODMA 1D7IA 2VCDA 3O5RA 4ODQA 4IQ2A 2XP4A 2KE0A 2PPOA 4C02B 3O5DA 4TYOA 4W9QA 5HKGA 4TW6A 2PV3A 3LUOA 4J4OA 3O5OA 2ZQUA 3CGMA 3I6CA 1FKFA 4LAWA 3JYJA 2DG4A 3NTPA 1FKJA 1QZ2A 2XP8A 1Q6IA 4ODKA 4W9OA 2MLXA 2F2DA 4U85A 3NRKA 5HTGA 4TW8A 2MF9A 5DIUA 1J4HA 1W26A 3PA7A 1FKDA 3B7XA 4IPXA 3CGNA 4MSPA 2KGJA 3UF8A 3NI6A 4GIVA 2FKEA 1JVWA 4FN2A 2N87A 4JFKA 2KI3A 4LAVA 2K8IA 4N19A 5GPGA 2ZQVA 1ZCNA 1Q6UA 4DRHA 5HT1A 1FKKA 3FAPA 4GGQA 2DG9A 4G50A 2MNTA 5HW7A 3UQIA 3RFWA 1YATA 4TX0A 4FAPA 4ODOA 2Y78A 3OOBA 3O5MA 2FAPA 2MLZA 3IK8A 1ZK6A 1YW5A 1HXVA 2XP3A 3O5GA 4R0XA 5B8IC 4LAYA 3UI6A 2AWGA 3UI4A 4DRNA 1L1PA 4JFLA 3KZ7A 4ODNA 4DRKA 2XPAA 4DT4A 1KT0A 2UZ5A 2XP6A 3O5FA 2LKNA 2ITKA 1J6YA 2LPVA 2MPHA 4NNRA 3UI5A 2ZR4A 5I98A 2ZQTA 2DG3A 3O5EA 1EYMA 4JFIA 2ZR5A 1C9HA 2M2AA 3KAIA 3KCEA 2PPNA 3H9RB 1Y0OA 2KFWA 2PPPA 4ODPA 1U79A 1BL4A 1T11A 3EY6A 1P5QA 1B6CA 2RQSA 2OFNA 2RUQA 3KACA 3WH0A 4DRIA 4JFMA 1F8AB 2LJ4A 1NSGA 1PINA 4TW7A 2ZR6A 5HW8A 4QIBA 4TNSA 4DIPA 1PBKA 2XP7A 3VAWA 4QT3A 4G2PA 5HWBA 4JYSA 5HWCA 1EQ3A 4DROA 2PV2A 1Q1CA 5DITA 2XP9A 2PV1A 3O5LA 4ODRA 3UQAA 2F21A 3IHZA 4ITZA 2ZQSA 5D75A 3O5QA 1FD9A 3IKGA 1FAPA 2JZVA 4ODLA 1F40A 3O5JA 1JNSA 5HW6A 3JYMA 1TCOC 2RURA 1FKHA 1NMVA 3O5KA 5BXJA 3IKDA 3PRDA 3PRBA 1FKGA 1KT1A 2D9FA 3KAGA 1D7JA 4JFJA 3KADA 5J6EA 1BKFA 1JNTA 3JXVA 4DRQA 3RGCA 2PBCA 1D7HA 1ROUA 4MGVA 1FJDA 4DH0A 3MDYB 3ODKA 1FKLA 2L2SA 1J4IA 2M08A 1FKBA 3O5IA 1R9HA 2XP5A 4U86A 1D6OA 3TDBA 3KAHA 4J4NA 4LAXA 2F4EA 2RUDA 2XPBA 1A7XA 1QPFA 2KR7A 2KO7A 1FKIA 2RSEA 3UQBA 1J4RA 1FKTA
chains in the Genus database with same CATH superfamily
3WQVA 1E6ZA 3KAFA 2A3BA 4U84A 1OGGA 4W9PA 5DIVA 1NMWA 1QPLA 4P8VA 3B8SA 3B9DA 3GPKA 2Q5AA 4WJXA 2RUCA 3AS0A 1D7IA 1ZBVA 4IQ2A 3WD3A 4W9QA 3WL0A 1E6RA 2ZQUA 1FKFA 2A3AA 1QZ2A 2A3CA 2EULA 2XP8A 3RM9A 2MLXA 1HKJA 4U85A 3ALGA 3FXYA 4JFKA 4LAVA 1LJYA 1LL4A 1UR8A 2ZQVA 1WB0A 4GGQA 3PR9A 2PN0A 2FAPA 3ARUA 3IK8A 2ESCA 1YW5A 2DSVA 4LAYA 2AWGA 1NWRA 2DPEA 3BXWA 5DF0A 2UZ5A 4Z2IA 3O5FA 4HARA 4MTVA 2ZR4A 4QZVB 2DG3A 4MNJA 3O5EA 4JFIA 1C9HA 1W1YA 2M2AA 1NH6A 3KAIA 3KCEA 2DSUA 4MPKA 2PPPA 4ODPA 1ZBKA 1T11A 3AS1A 1P5QA 3BMBA 4MNKA 1WAWA 2RUQA 4QIBA 2XP7A 3VAWA 3ARWA 1W9VA 1HJVA 3AQUA 3O5QA 3IKGA 2JZVA 1RD6A 5DO2A 2RURA 1FKHA 3O5KA 1KT1A 4MAVA 1BKFA 4DRQA 3RGCA 2PBCA 4ZPTR 1FJDA 3G6MA 3MDYB 3QOKA 1O6IA 2M08A 2XP5A 2O9OA 3KAHA 4WK9A 2DT1A 1FFQA 2F4EA 2RUDA 1W9UA 1FKTA 1FFRA 4DRMA 3WD2A 4QT2A 1N1AA 3KABA 3TCZA 4BF8A 4HBEA 1Q6HA 4DZ2A 1ROTA 3WD4A 4DRPA 2M1IA 2MLYA 2IF4A 2VCDA 4IT6A 4ODQA 1LG1A 4ZPWR 4P8XA 3ARPA 1SR0A 2B5UB 1NWUA 4ODKA 1XHGA 3ARYA 4W9OA 2P4VA 4AY1A 4WKAA 5DIUA 5GPGA 1W26A 4MSPA 4PTMA 1JNDA 2KGJA 4Z2KA 3NI6A 2FKEA 1JVWA 2N87A 4N19A 2B31A 4UDMA 1LL7A 1FKKA 4G50A 2WM0A 5HW7A 3UQIA 3RFWA 3PRAA 4ODOA 4WKFA 1SYTA 3OOBA 1EHNA 3RM4A 2XP3A 3O5GA 3ARQA 4MNLA 3UI6A 3FY1A 1L1PA 1OWQA 4R5EA 4S3JA 1GPFA 1GOIA 4DWSA 2LKNA 2MPHA 5I98A 1HKIA 1HJWA 1VF8A 4DWSD 2PPNA 2DT0A 2PI6A 1Y0OA 5JH8A 3B9EA 1BL4A 4MNMA 1HKKA 1NSGA 1PINA 1PBKA 4QT3A 1X6LA 5HWCA 2QF8A 4DROA 2PV2A 3GTYX 4LGXA 4ODRA 5GPRA 4ITZA 3IHZA 5D75A 1FAPA 4ODLA 1F40A 3JYMA 5BXJA 2ETNA 4S3KA 1D7JA 4WKHA 5J6EA 1JNTA 3JXVA 4Z2JA 1D7HA 1UR9A 1JNEA 1NWSA 2DSWA 1FKBA 3O5IA 1R9HA 1W1VA 3CHEA 4J4NA 3WL1A 2XPBA 3ARTA 2RSEA 2KO7A 5DEZA 2YBUA 3RM8A 5HUAA 3CHCA 3ARVA 1LL6A 3WD0A 1E44A 4DZ3A 1M5YA 4IQCA 1FKRA 1KFWA 1W1TA 3O5RA 2PPOA 5HKGA 4TW6A 3O5OA 3I6CA 4LAWA 4XAKA 3JYJA 5GQBA 2DG4A 1FKJA 3NRKA 4TW8A 2MF9A 4KQZA 1LQ0A 3PA7A 4WIWA 1FKDA 3B7XA 1LG2A 3CGNA 4NZCA 4GIVA 4FN2A 2KI3A 4NSBA 1ZCNA 1Q6UA 5HT1A 3FAPA 3AS3A 2DG9A 2G41A 1YATA 1X6NA 1ITXA 2DT3A 4FAPA 4Z2LA 2MLZA 1ZK6A 1D2KA 3WQWA 3UI4A 4DRNA 4ODNA 4DT4A 1KT0A 1H0GA 2ITKA 1J6YA 4NNRA 3UI5A 2OLHA 1H0IA 2ZR5A 1E9LA 2WLZA 2AOSA 3H9RB 3WIJA 2KFWA 1GRJA 1B6CA 4KR0B 2OFNA 2WLYA 4ZPVR 3KACA 3WH0A 1F8AB 2LJ4A 4TW7A 5HW8A 1TFVA 3CH9A 4Z2HA 5HWBA 4G2PA 3GU0A 4P8WA 1Q1CA 5DITA 1ZL1A 2XP9A 2PV1A 1IX5A 3ALFA 3AS2A 1FD9A 3OA5A 3O5JA 1JNSA 1E15A 3IKDA 3PRBA 1FKGA 2D9FA 4Q22A 3KAGA 4JFJA 3KADA 1W1PA 4P8UA 1ROUA 1K9TA 4DH0A 2L2SA 3WKZA 3ARXA 3TDBA 2YBTA 1WNOA 4LAXA 4ML4A 3RMEA 2KR7A 2LGOA 4DRJA 1FKSA 5HBFA 2VN1A 4L72B 4O2TA 3O5PA 3TC5A 1E6PA 4ODMA 2XP4A 2KE0A 2O92A 4C02B 4TYOA 2PV3A 2DSZA 3LUOA 4J4OA 4DWSB 4URIA 3CGMA 3NTPA 3B9AA 1EIBA 1Q6IA 2F2DA 1OGBA 5HTGA 1J4HA 3CHDA 4IPXA 3UF8A 1ZB5A 4W5UA 2K8IA 4DRHA 2MNTA 1ZBCA 1HKMA 1GUVA 4TX0A 1W9PA 2FDMA 2Y78A 1EDQA 3O5MA 2G8ZA 1HXVA 4HBOA 4R0XA 2F23A 4Z2GA 5B8IC 1JCHB 3AROA 4JFLA 3KZ7A 4DRKA 2XPAA 2A3EA 3WD1A 2XP6A 2LPVA 1E6NA 2ZQTA 1EYMA 1XRVA 1U79A 3EY6A 2RQSA 1ZU8A 4ZS6A 4DRIA 1NWTA 4JFMA 2WK2A 2ZR6A 4Q7NA 4TNSA 4DIPA 3EIPA 2DT2A 1EQ3A 4JYSA 3CZ8A 3O5LA 3UQAA 2F21A 2ZQSA 5HW6A 1TCOC 1NMVA 3PRDA 1ZBWA 3ARRA 3G6LA 2IUZA 1CTNA 4MGVA 4IT4A 4L3NA 3ODKA 1FKLA 1J4IA 4U86A 1D6OA 3CHFA 3W4RA 3ARZA 1HJXA 1A7XA 1QPFA 3O5DA 1FKIA 3UQBA 1J4RA 3ARSA 4DWSC
chains in the Genus database with same CATH topology
3WQVA 1E6ZA 3KAFA 2A3BA 4U84A 1OGGA 4W9PA 5DIVA 1NMWA 1QPLA 4P8VA 3B8SA 3B9DA 3GPKA 2Q5AA 4WJXA 2RUCA 3AS0A 1D7IA 1ZBVA 4IQ2A 3WD3A 4W9QA 3WL0A 1E6RA 2ZQUA 1FKFA 2A3AA 1QZ2A 2A3CA 2XP8A 3RM9A 2MLXA 1HKJA 4U85A 3ALGA 3FXYA 4JFKA 4LAVA 1LJYA 1LL4A 1UR8A 2ZQVA 1WB0A 4GGQA 3PR9A 2FAPA 3ARUA 3IK8A 2ESCA 1YW5A 2DSVA 4LAYA 2AWGA 1NWRA 2DPEA 3BXWA 5DF0A 2UZ5A 4Z2IA 3O5FA 4HARA 4MTVA 2ZR4A 4QZVB 2DG3A 4MNJA 3O5EA 4JFIA 1C9HA 1W1YA 2M2AA 1NH6A 3KAIA 3KCEA 2DSUA 4MPKA 2PPPA 4ODPA 1ZBKA 1T11A 3AS1A 1P5QA 4MNKA 1WAWA 2RUQA 4QIBA 2XP7A 3VAWA 3ARWA 1W9VA 1HJVA 3AQUA 3O5QA 3IKGA 2JZVA 1RD6A 5DO2A 2RURA 1FKHA 3O5KA 1KT1A 4MAVA 1BKFA 4DRQA 3RGCA 2PBCA 4ZPTR 1FJDA 3G6MA 3MDYB 3QOKA 1O6IA 2M08A 2XP5A 2O9OA 3KAHA 4WK9A 2DT1A 1FFQA 2F4EA 2RUDA 1W9UA 1FKTA 1FFRA 4DRMA 3WD2A 4QT2A 1N1AA 3KABA 3TCZA 4BF8A 4HBEA 1Q6HA 4DZ2A 1ROTA 3WD4A 4DRPA 2M1IA 2MLYA 2IF4A 2VCDA 4IT6A 4ODQA 1LG1A 4ZPWR 4P8XA 3ARPA 1SR0A 1NWUA 4ODKA 1XHGA 3ARYA 4W9OA 4AY1A 4WKAA 5DIUA 5GPGA 1W26A 4MSPA 4PTMA 1JNDA 2KGJA 4Z2KA 3NI6A 2FKEA 1JVWA 2N87A 4N19A 2B31A 1LL7A 1FKKA 4G50A 2WM0A 5HW7A 3UQIA 3RFWA 3PRAA 4ODOA 4WKFA 1SYTA 3OOBA 1EHNA 3RM4A 2XP3A 3O5GA 3ARQA 4MNLA 3UI6A 3FY1A 1L1PA 1OWQA 4R5EA 4S3JA 1GPFA 1GOIA 4DWSA 2LKNA 2MPHA 5I98A 1HKIA 1HJWA 1VF8A 4DWSD 2PPNA 2DT0A 2PI6A 1Y0OA 5JH8A 3B9EA 1BL4A 4MNMA 1HKKA 1NSGA 1PINA 1PBKA 4QT3A 1X6LA 5HWCA 2QF8A 4DROA 2PV2A 4LGXA 4ODRA 5GPRA 4ITZA 3IHZA 5D75A 1FAPA 4ODLA 1F40A 3JYMA 5BXJA 4S3KA 1D7JA 4WKHA 5J6EA 1JNTA 3JXVA 4Z2JA 1D7HA 1UR9A 1JNEA 1NWSA 2DSWA 1FKBA 3O5IA 1R9HA 1W1VA 3CHEA 4J4NA 3WL1A 2XPBA 3ARTA 2RSEA 2KO7A 5DEZA 2YBUA 3RM8A 5HUAA 3CHCA 3ARVA 1LL6A 3WD0A 4DZ3A 1M5YA 4IQCA 1FKRA 1KFWA 1W1TA 3O5RA 2PPOA 5HKGA 4TW6A 3O5OA 3I6CA 4LAWA 4XAKA 3JYJA 5GQBA 2DG4A 1FKJA 3NRKA 4TW8A 2MF9A 4KQZA 1LQ0A 3PA7A 4WIWA 1FKDA 3B7XA 1LG2A 3CGNA 4NZCA 4GIVA 4FN2A 2KI3A 4NSBA 1ZCNA 1Q6UA 5HT1A 3FAPA 3AS3A 2DG9A 2G41A 1YATA 1X6NA 1ITXA 2DT3A 4FAPA 4Z2LA 2MLZA 1ZK6A 1D2KA 3WQWA 3UI4A 4DRNA 4ODNA 4DT4A 1KT0A 1H0GA 2ITKA 1J6YA 4NNRA 3UI5A 2OLHA 1H0IA 2ZR5A 1E9LA 2WLZA 2AOSA 3H9RB 3WIJA 2KFWA 1B6CA 4KR0B 2OFNA 2WLYA 4ZPVR 3KACA 3WH0A 1F8AB 2LJ4A 4TW7A 5HW8A 1TFVA 3CH9A 4Z2HA 5HWBA 4G2PA 4P8WA 1Q1CA 5DITA 1ZL1A 2XP9A 2PV1A 1IX5A 3ALFA 3AS2A 1FD9A 3OA5A 3O5JA 1JNSA 1E15A 3IKDA 3PRBA 1FKGA 2D9FA 4Q22A 3KAGA 4JFJA 3KADA 1W1PA 4P8UA 1ROUA 1K9TA 4DH0A 2L2SA 3WKZA 3ARXA 3TDBA 2YBTA 1WNOA 4LAXA 4ML4A 3RMEA 2KR7A 2LGOA 4DRJA 1FKSA 5HBFA 2VN1A 4L72B 4O2TA 3O5PA 3TC5A 1E6PA 4ODMA 2XP4A 2KE0A 2O92A 4C02B 4TYOA 2PV3A 2DSZA 3LUOA 4J4OA 4DWSB 4URIA 3CGMA 3NTPA 3B9AA 1EIBA 1Q6IA 2F2DA 1OGBA 5HTGA 1J4HA 3CHDA 4IPXA 3UF8A 1ZB5A 4W5UA 2K8IA 4DRHA 2MNTA 1ZBCA 1HKMA 1GUVA 4TX0A 1W9PA 2FDMA 2Y78A 1EDQA 3O5MA 2G8ZA 1HXVA 4HBOA 4R0XA 5B8IC 4Z2GA 3AROA 4JFLA 3KZ7A 4DRKA 2XPAA 2A3EA 3WD1A 2XP6A 2LPVA 1E6NA 2ZQTA 1EYMA 1XRVA 1U79A 3EY6A 2RQSA 1ZU8A 4ZS6A 4DRIA 1NWTA 4JFMA 2WK2A 2ZR6A 4Q7NA 4TNSA 4DIPA 2DT2A 1EQ3A 4JYSA 3CZ8A 3O5LA 3UQAA 2F21A 2ZQSA 5HW6A 1TCOC 1NMVA 3PRDA 1ZBWA 3ARRA 3G6LA 2IUZA 1CTNA 4MGVA 4IT4A 4L3NA 3ODKA 1FKLA 1J4IA 4U86A 1D6OA 3CHFA 3W4RA 3ARZA 1HJXA 1A7XA 1QPFA 3O5DA 1FKIA 3UQBA 1J4RA 3ARSA 4DWSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRM A;  5HUA A;  3KAF A;  2LGO A;  4QT2 A;  1N1A A;  3KAB A;  4DRJ A;  3TCZ A;  4BF8 A;  1FKS A;  2VN1 A;  1Q6H A;  4U84 A;  1M5Y A;  1ROT A;  4W9P A;  5DIV A;  4DZ3 A;  4DZ2 A;  1NMW A;  4O2T A;  1QPL A;  3O5P A;  4IQC A;  4DRP A;  2M1I A;  2MLY A;  3TC5 A;  1FKR A;  3GPK A;  2Q5A A;  2RUC A;  2IF4 A;  4ODM A;  1D7I A;  2VCD A;  3O5R A;  4ODQ A;  4IQ2 A;  2XP4 A;  2KE0 A;  2PPO A;  4C02 B;  3O5D A;  4TYO A;  4W9Q A;  5HKG A;  4TW6 A;  2PV3 A;  3LUO A;  4J4O A;  3O5O A;  2ZQU A;  3CGM A;  3I6C A;  1FKF A;  4LAW A;  3JYJ A;  2DG4 A;  3NTP A;  1FKJ A;  1QZ2 A;  2XP8 A;  1Q6I A;  4ODK A;  4W9O A;  2MLX A;  2F2D A;  4U85 A;  3NRK A;  5HTG A;  4TW8 A;  2MF9 A;  5DIU A;  1J4H A;  1W26 A;  3PA7 A;  1FKD A;  3B7X A;  4IPX A;  3CGN A;  4MSP A;  2KGJ A;  3UF8 A;  3NI6 A;  4GIV A;  2FKE A;  1JVW A;  4FN2 A;  2N87 A;  4JFK A;  2KI3 A;  4LAV A;  2K8I A;  4N19 A;  5GPG A;  2ZQV A;  1ZCN A;  1Q6U A;  4DRH A;  5HT1 A;  1FKK A;  3FAP A;  4GGQ A;  2DG9 A;  4G50 A;  2MNT A;  5HW7 A;  3UQI A;  3RFW A;  1YAT A;  4TX0 A;  4FAP A;  4ODO A;  2Y78 A;  3OOB A;  3O5M A;  2FAP A;  2MLZ A;  3IK8 A;  1ZK6 A;  1YW5 A;  1HXV A;  2XP3 A;  3O5G A;  4R0X A;  5B8I C;  4LAY A;  3UI6 A;  2AWG A;  3UI4 A;  4DRN A;  1L1P A;  4JFL A;  3KZ7 A;  4ODN A;  4DRK A;  2XPA A;  4DT4 A;  1KT0 A;  2UZ5 A;  2XP6 A;  3O5F A;  2LKN A;  2ITK A;  1J6Y A;  2LPV A;  2MPH A;  4NNR A;  3UI5 A;  2ZR4 A;  5I98 A;  2ZQT A;  2DG3 A;  3O5E A;  1EYM A;  4JFI A;  2ZR5 A;  1C9H A;  2M2A A;  3KAI A;  3KCE A;  2PPN A;  3H9R B;  1Y0O A;  2KFW A;  2PPP A;  4ODP A;  1U79 A;  1BL4 A;  1T11 A;  3EY6 A;  1P5Q A;  1B6C A;  2RQS A;  2OFN A;  2RUQ A;  3KAC A;  3WH0 A;  4DRI A;  4JFM A;  1F8A B;  2LJ4 A;  1NSG A;  1PIN A;  4TW7 A;  2ZR6 A;  5HW8 A;  4QIB A;  4TNS A;  4DIP A;  1PBK A;  2XP7 A;  3VAW A;  4QT3 A;  4G2P A;  5HWB A;  4JYS A;  5HWC A;  1EQ3 A;  4DRO A;  2PV2 A;  1Q1C A;  5DIT A;  2XP9 A;  2PV1 A;  3O5L A;  4ODR A;  3UQA A;  2F21 A;  3IHZ A;  4ITZ A;  2ZQS A;  5D75 A;  3O5Q A;  1FD9 A;  3IKG A;  1FAP A;  2JZV A;  4ODL A;  1F40 A;  3O5J A;  1JNS A;  5HW6 A;  3JYM A;  1TCO C;  2RUR A;  1FKH A;  1NMV A;  3O5K A;  5BXJ A;  3IKD A;  3PRD A;  3PRB A;  1FKG A;  1KT1 A;  2D9F A;  3KAG A;  1D7J A;  4JFJ A;  3KAD A;  5J6E A;  1BKF A;  1JNT A;  3JXV A;  4DRQ A;  3RGC A;  2PBC A;  1D7H A;  1ROU A;  4MGV A;  1FJD A;  4DH0 A;  3MDY B;  3ODK A;  1FKL A;  2L2S A;  1J4I A;  2M08 A;  1FKB A;  3O5I A;  1R9H A;  2XP5 A;  4U86 A;  1D6O A;  3TDB A;  3KAH A;  4J4N A;  4LAX A;  2F4E A;  2RUD A;  2XPB A;  1A7X A;  1QPF A;  2KR7 A;  2KO7 A;  1FKI A;  2RSE A;  3UQB A;  1J4R A;  1FKT A; 
#chains in the Genus database with same CATH topology
 3WQV A;  1E6Z A;  3KAF A;  2A3B A;  4U84 A;  1OGG A;  4W9P A;  5DIV A;  1NMW A;  1QPL A;  4P8V A;  3B8S A;  3B9D A;  3GPK A;  2Q5A A;  4WJX A;  2RUC A;  3AS0 A;  1D7I A;  1ZBV A;  4IQ2 A;  3WD3 A;  4W9Q A;  3WL0 A;  1E6R A;  2ZQU A;  1FKF A;  2A3A A;  1QZ2 A;  2A3C A;  2EUL A;  2XP8 A;  3RM9 A;  2MLX A;  1HKJ A;  4U85 A;  3ALG A;  3FXY A;  4JFK A;  4LAV A;  1LJY A;  1LL4 A;  1UR8 A;  2ZQV A;  1WB0 A;  4GGQ A;  3PR9 A;  2PN0 A;  2FAP A;  3ARU A;  3IK8 A;  2ESC A;  1YW5 A;  2DSV A;  4LAY A;  2AWG A;  1NWR A;  2DPE A;  3BXW A;  5DF0 A;  2UZ5 A;  4Z2I A;  3O5F A;  4HAR A;  4MTV A;  2ZR4 A;  4QZV B;  2DG3 A;  4MNJ A;  3O5E A;  4JFI A;  1C9H A;  1W1Y A;  2M2A A;  1NH6 A;  3KAI A;  3KCE A;  2DSU A;  4MPK A;  2PPP A;  4ODP A;  1ZBK A;  1T11 A;  3AS1 A;  1P5Q A;  3BMB A;  4MNK A;  1WAW A;  2RUQ A;  4QIB A;  2XP7 A;  3VAW A;  3ARW A;  1W9V A;  1HJV A;  3AQU A;  3O5Q A;  3IKG A;  2JZV A;  1RD6 A;  5DO2 A;  2RUR A;  1FKH A;  3O5K A;  1KT1 A;  4MAV A;  1BKF A;  4DRQ A;  3RGC A;  2PBC A;  4ZPT R;  1FJD A;  3G6M A;  3MDY B;  3QOK A;  1O6I A;  2M08 A;  2XP5 A;  2O9O A;  3KAH A;  4WK9 A;  2DT1 A;  1FFQ A;  2F4E A;  2RUD A;  1W9U A;  1FKT A;  1FFR A;  4DRM A;  3WD2 A;  4QT2 A;  1N1A A;  3KAB A;  3TCZ A;  4BF8 A;  4HBE A;  1Q6H A;  4DZ2 A;  1ROT A;  3WD4 A;  4DRP A;  2M1I A;  2MLY A;  2IF4 A;  2VCD A;  4IT6 A;  4ODQ A;  1LG1 A;  4ZPW R;  4P8X A;  3ARP A;  1SR0 A;  2B5U B;  1NWU A;  4ODK A;  1XHG A;  3ARY A;  4W9O A;  2P4V A;  4AY1 A;  4WKA A;  5DIU A;  5GPG A;  1W26 A;  4MSP A;  4PTM A;  1JND A;  2KGJ A;  4Z2K A;  3NI6 A;  2FKE A;  1JVW A;  2N87 A;  4N19 A;  2B31 A;  4UDM A;  1LL7 A;  1FKK A;  4G50 A;  2WM0 A;  5HW7 A;  3UQI A;  3RFW A;  3PRA A;  4ODO A;  4WKF A;  1SYT A;  3OOB A;  1EHN A;  3RM4 A;  2XP3 A;  3O5G A;  3ARQ A;  4MNL A;  3UI6 A;  3FY1 A;  1L1P A;  1OWQ A;  4R5E A;  4S3J A;  1GPF A;  1GOI A;  4DWS A;  2LKN A;  2MPH A;  5I98 A;  1HKI A;  1HJW A;  1VF8 A;  4DWS D;  2PPN A;  2DT0 A;  2PI6 A;  1Y0O A;  5JH8 A;  3B9E A;  1BL4 A;  4MNM A;  1HKK A;  1NSG A;  1PIN A;  1PBK A;  4QT3 A;  1X6L A;  5HWC A;  2QF8 A;  4DRO A;  2PV2 A;  3GTY X;  4LGX A;  4ODR A;  5GPR A;  4ITZ A;  3IHZ A;  5D75 A;  1FAP A;  4ODL A;  1F40 A;  3JYM A;  5BXJ A;  2ETN A;  4S3K A;  1D7J A;  4WKH A;  5J6E A;  1JNT A;  3JXV A;  4Z2J A;  1D7H A;  1UR9 A;  1JNE A;  1NWS A;  2DSW A;  1FKB A;  3O5I A;  1R9H A;  1W1V A;  3CHE A;  4J4N A;  3WL1 A;  2XPB A;  3ART A;  2RSE A;  2KO7 A;  5DEZ A;  2YBU A;  3RM8 A;  5HUA A;  3CHC A;  3ARV A;  1LL6 A;  3WD0 A;  1E44 A;  4DZ3 A;  1M5Y A;  4IQC A;  1FKR A;  1KFW A;  1W1T A;  3O5R A;  2PPO A;  5HKG A;  4TW6 A;  3O5O A;  3I6C A;  4LAW A;  4XAK A;  3JYJ A;  5GQB A;  2DG4 A;  1FKJ A;  3NRK A;  4TW8 A;  2MF9 A;  4KQZ A;  1LQ0 A;  3PA7 A;  4WIW A;  1FKD A;  3B7X A;  1LG2 A;  3CGN A;  4NZC A;  4GIV A;  4FN2 A;  2KI3 A;  4NSB A;  1ZCN A;  1Q6U A;  5HT1 A;  3FAP A;  3AS3 A;  2DG9 A;  2G41 A;  1YAT A;  1X6N A;  1ITX A;  2DT3 A;  4FAP A;  4Z2L A;  2MLZ A;  1ZK6 A;  1D2K A;  3WQW A;  3UI4 A;  4DRN A;  4ODN A;  4DT4 A;  1KT0 A;  1H0G A;  2ITK A;  1J6Y A;  4NNR A;  3UI5 A;  2OLH A;  1H0I A;  2ZR5 A;  1E9L A;  2WLZ A;  2AOS A;  3H9R B;  3WIJ A;  2KFW A;  1GRJ A;  1B6C A;  4KR0 B;  2OFN A;  2WLY A;  4ZPV R;  3KAC A;  3WH0 A;  1F8A B;  2LJ4 A;  4TW7 A;  5HW8 A;  1TFV A;  3CH9 A;  4Z2H A;  5HWB A;  4G2P A;  3GU0 A;  4P8W A;  1Q1C A;  5DIT A;  1ZL1 A;  2XP9 A;  2PV1 A;  1IX5 A;  3ALF A;  3AS2 A;  1FD9 A;  3OA5 A;  3O5J A;  1JNS A;  1E15 A;  3IKD A;  3PRB A;  1FKG A;  2D9F A;  4Q22 A;  3KAG A;  4JFJ A;  3KAD A;  1W1P A;  4P8U A;  1ROU A;  1K9T A;  4DH0 A;  2L2S A;  3WKZ A;  3ARX A;  3TDB A;  2YBT A;  1WNO A;  4LAX A;  4ML4 A;  3RME A;  2KR7 A;  2LGO A;  4DRJ A;  1FKS A;  5HBF A;  2VN1 A;  4L72 B;  4O2T A;  3O5P A;  3TC5 A;  1E6P A;  4ODM A;  2XP4 A;  2KE0 A;  2O92 A;  4C02 B;  4TYO A;  2PV3 A;  2DSZ A;  3LUO A;  4J4O A;  4DWS B;  4URI A;  3CGM A;  3NTP A;  3B9A A;  1EIB A;  1Q6I A;  2F2D A;  1OGB A;  5HTG A;  1J4H A;  3CHD A;  4IPX A;  3UF8 A;  1ZB5 A;  4W5U A;  2K8I A;  4DRH A;  2MNT A;  1ZBC A;  1HKM A;  1GUV A;  4TX0 A;  1W9P A;  2FDM A;  2Y78 A;  1EDQ A;  3O5M A;  2G8Z A;  1HXV A;  4HBO A;  4R0X A;  2F23 A;  4Z2G A;  5B8I C;  1JCH B;  3ARO A;  4JFL A;  3KZ7 A;  4DRK A;  2XPA A;  2A3E A;  3WD1 A;  2XP6 A;  2LPV A;  1E6N A;  2ZQT A;  1EYM A;  1XRV A;  1U79 A;  3EY6 A;  2RQS A;  1ZU8 A;  4ZS6 A;  4DRI A;  1NWT A;  4JFM A;  2WK2 A;  2ZR6 A;  4Q7N A;  4TNS A;  4DIP A;  3EIP A;  2DT2 A;  1EQ3 A;  4JYS A;  3CZ8 A;  3O5L A;  3UQA A;  2F21 A;  2ZQS A;  5HW6 A;  1TCO C;  1NMV A;  3PRD A;  1ZBW A;  3ARR A;  3G6L A;  2IUZ A;  1CTN A;  4MGV A;  4IT4 A;  4L3N A;  3ODK A;  1FKL A;  1J4I A;  4U86 A;  1D6O A;  3CHF A;  3W4R A;  3ARZ A;  1HJX A;  1A7X A;  1QPF A;  3O5D A;  1FKI A;  3UQB A;  1J4R A;  3ARS A;  4DWS C; 
#chains in the Genus database with same CATH homology
 3WQV A;  1E6Z A;  3KAF A;  2A3B A;  4U84 A;  1OGG A;  4W9P A;  5DIV A;  1NMW A;  1QPL A;  4P8V A;  3B8S A;  3B9D A;  3GPK A;  2Q5A A;  4WJX A;  2RUC A;  3AS0 A;  1D7I A;  1ZBV A;  4IQ2 A;  3WD3 A;  4W9Q A;  3WL0 A;  1E6R A;  2ZQU A;  1FKF A;  2A3A A;  1QZ2 A;  2A3C A;  2XP8 A;  3RM9 A;  2MLX A;  1HKJ A;  4U85 A;  3ALG A;  3FXY A;  4JFK A;  4LAV A;  1LJY A;  1LL4 A;  1UR8 A;  2ZQV A;  1WB0 A;  4GGQ A;  3PR9 A;  2FAP A;  3ARU A;  3IK8 A;  2ESC A;  1YW5 A;  2DSV A;  4LAY A;  2AWG A;  1NWR A;  2DPE A;  3BXW A;  5DF0 A;  2UZ5 A;  4Z2I A;  3O5F A;  4HAR A;  4MTV A;  2ZR4 A;  4QZV B;  2DG3 A;  4MNJ A;  3O5E A;  4JFI A;  1C9H A;  1W1Y A;  2M2A A;  1NH6 A;  3KAI A;  3KCE A;  2DSU A;  4MPK A;  2PPP A;  4ODP A;  1ZBK A;  1T11 A;  3AS1 A;  1P5Q A;  4MNK A;  1WAW A;  2RUQ A;  4QIB A;  2XP7 A;  3VAW A;  3ARW A;  1W9V A;  1HJV A;  3AQU A;  3O5Q A;  3IKG A;  2JZV A;  1RD6 A;  5DO2 A;  2RUR A;  1FKH A;  3O5K A;  1KT1 A;  4MAV A;  1BKF A;  4DRQ A;  3RGC A;  2PBC A;  4ZPT R;  1FJD A;  3G6M A;  3MDY B;  3QOK A;  1O6I A;  2M08 A;  2XP5 A;  2O9O A;  3KAH A;  4WK9 A;  2DT1 A;  1FFQ A;  2F4E A;  2RUD A;  1W9U A;  1FKT A;  1FFR A;  4DRM A;  3WD2 A;  4QT2 A;  1N1A A;  3KAB A;  3TCZ A;  4BF8 A;  4HBE A;  1Q6H A;  4DZ2 A;  1ROT A;  3WD4 A;  4DRP A;  2M1I A;  2MLY A;  2IF4 A;  2VCD A;  4IT6 A;  4ODQ A;  1LG1 A;  4ZPW R;  4P8X A;  3ARP A;  1SR0 A;  1NWU A;  4ODK A;  1XHG A;  3ARY A;  4W9O A;  4AY1 A;  4WKA A;  5DIU A;  5GPG A;  1W26 A;  4MSP A;  4PTM A;  1JND A;  2KGJ A;  4Z2K A;  3NI6 A;  2FKE A;  1JVW A;  2N87 A;  4N19 A;  2B31 A;  1LL7 A;  1FKK A;  4G50 A;  2WM0 A;  5HW7 A;  3UQI A;  3RFW A;  3PRA A;  4ODO A;  4WKF A;  1SYT A;  3OOB A;  1EHN A;  3RM4 A;  2XP3 A;  3O5G A;  3ARQ A;  4MNL A;  3UI6 A;  3FY1 A;  1L1P A;  1OWQ A;  4R5E A;  4S3J A;  1GPF A;  1GOI A;  4DWS A;  2LKN A;  2MPH A;  5I98 A;  1HKI A;  1HJW A;  1VF8 A;  4DWS D;  2PPN A;  2DT0 A;  2PI6 A;  1Y0O A;  5JH8 A;  3B9E A;  1BL4 A;  4MNM A;  1HKK A;  1NSG A;  1PIN A;  1PBK A;  4QT3 A;  1X6L A;  5HWC A;  2QF8 A;  4DRO A;  2PV2 A;  4LGX A;  4ODR A;  5GPR A;  4ITZ A;  3IHZ A;  5D75 A;  1FAP A;  4ODL A;  1F40 A;  3JYM A;  5BXJ A;  4S3K A;  1D7J A;  4WKH A;  5J6E A;  1JNT A;  3JXV A;  4Z2J A;  1D7H A;  1UR9 A;  1JNE A;  1NWS A;  2DSW A;  1FKB A;  3O5I A;  1R9H A;  1W1V A;  3CHE A;  4J4N A;  3WL1 A;  2XPB A;  3ART A;  2RSE A;  2KO7 A;  5DEZ A;  2YBU A;  3RM8 A;  5HUA A;  3CHC A;  3ARV A;  1LL6 A;  3WD0 A;  4DZ3 A;  1M5Y A;  4IQC A;  1FKR A;  1KFW A;  1W1T A;  3O5R A;  2PPO A;  5HKG A;  4TW6 A;  3O5O A;  3I6C A;  4LAW A;  4XAK A;  3JYJ A;  5GQB A;  2DG4 A;  1FKJ A;  3NRK A;  4TW8 A;  2MF9 A;  4KQZ A;  1LQ0 A;  3PA7 A;  4WIW A;  1FKD A;  3B7X A;  1LG2 A;  3CGN A;  4NZC A;  4GIV A;  4FN2 A;  2KI3 A;  4NSB A;  1ZCN A;  1Q6U A;  5HT1 A;  3FAP A;  3AS3 A;  2DG9 A;  2G41 A;  1YAT A;  1X6N A;  1ITX A;  2DT3 A;  4FAP A;  4Z2L A;  2MLZ A;  1ZK6 A;  1D2K A;  3WQW A;  3UI4 A;  4DRN A;  4ODN A;  4DT4 A;  1KT0 A;  1H0G A;  2ITK A;  1J6Y A;  4NNR A;  3UI5 A;  2OLH A;  1H0I A;  2ZR5 A;  1E9L A;  2WLZ A;  2AOS A;  3H9R B;  3WIJ A;  2KFW A;  1B6C A;  4KR0 B;  2OFN A;  2WLY A;  4ZPV R;  3KAC A;  3WH0 A;  1F8A B;  2LJ4 A;  4TW7 A;  5HW8 A;  1TFV A;  3CH9 A;  4Z2H A;  5HWB A;  4G2P A;  4P8W A;  1Q1C A;  5DIT A;  1ZL1 A;  2XP9 A;  2PV1 A;  1IX5 A;  3ALF A;  3AS2 A;  1FD9 A;  3OA5 A;  3O5J A;  1JNS A;  1E15 A;  3IKD A;  3PRB A;  1FKG A;  2D9F A;  4Q22 A;  3KAG A;  4JFJ A;  3KAD A;  1W1P A;  4P8U A;  1ROU A;  1K9T A;  4DH0 A;  2L2S A;  3WKZ A;  3ARX A;  3TDB A;  2YBT A;  1WNO A;  4LAX A;  4ML4 A;  3RME A;  2KR7 A;  2LGO A;  4DRJ A;  1FKS A;  5HBF A;  2VN1 A;  4L72 B;  4O2T A;  3O5P A;  3TC5 A;  1E6P A;  4ODM A;  2XP4 A;  2KE0 A;  2O92 A;  4C02 B;  4TYO A;  2PV3 A;  2DSZ A;  3LUO A;  4J4O A;  4DWS B;  4URI A;  3CGM A;  3NTP A;  3B9A A;  1EIB A;  1Q6I A;  2F2D A;  1OGB A;  5HTG A;  1J4H A;  3CHD A;  4IPX A;  3UF8 A;  1ZB5 A;  4W5U A;  2K8I A;  4DRH A;  2MNT A;  1ZBC A;  1HKM A;  1GUV A;  4TX0 A;  1W9P A;  2FDM A;  2Y78 A;  1EDQ A;  3O5M A;  2G8Z A;  1HXV A;  4HBO A;  4R0X A;  5B8I C;  4Z2G A;  3ARO A;  4JFL A;  3KZ7 A;  4DRK A;  2XPA A;  2A3E A;  3WD1 A;  2XP6 A;  2LPV A;  1E6N A;  2ZQT A;  1EYM A;  1XRV A;  1U79 A;  3EY6 A;  2RQS A;  1ZU8 A;  4ZS6 A;  4DRI A;  1NWT A;  4JFM A;  2WK2 A;  2ZR6 A;  4Q7N A;  4TNS A;  4DIP A;  2DT2 A;  1EQ3 A;  4JYS A;  3CZ8 A;  3O5L A;  3UQA A;  2F21 A;  2ZQS A;  5HW6 A;  1TCO C;  1NMV A;  3PRD A;  1ZBW A;  3ARR A;  3G6L A;  2IUZ A;  1CTN A;  4MGV A;  4IT4 A;  4L3N A;  3ODK A;  1FKL A;  1J4I A;  4U86 A;  1D6O A;  3CHF A;  3W4R A;  3ARZ A;  1HJX A;  1A7X A;  1QPF A;  3O5D A;  1FKI A;  3UQB A;  1J4R A;  3ARS A;  4DWS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...