4MPKA

Crystal structure of the complex of buffalo signaling protein spb-40 with n-acetylglucosamine at 2.65 a resolution
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex of buffalo signaling protein SPB-40 with N-acetylglucosamine at 2.65 A resolution
rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 120
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4mpkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mpkA01
1L0PA 1W32A 4ZFMA 1WKYA 4ATLA 1E72M 4U3AA 4F9DA 4TVCA 4EKJA 3L2LA 2IXVA 2QF8A 1NP0A 3W81A 2FHBA 1E43A 1XHGA 3U7BA 5HPCA 5IHRA 2CEQA 1BYDA 3BAYA 1OGGA 4W93A 3VGEA 1JXJA 1DWHM 3BAJA 1PAMA 3ARZA 4NZCA 1US3A 3AFBA 3MMWA 1W9UA 3WIJA 1E5JA 4XV0A 3UCQA 1BGAA 2G3NA 4P8UA 2V3DA 3OIHA 1MVYA 3VIFA 3CGTA 4NSBA 1V3MA 3WFZA 2V3GA 3AS0A 4CVUA 1E6PA 3T2PA 4TXEA 3U57A 1VRXA 4QAWA 4Q7NA 3FY1A 1KXVA 3K8MA 3CHCA 1BTCA 1MW3A 3EDEA 4DUWA 5M5DA 2OWWA 1JGIA 3RMEA 3WNKA 3CZ8A 2DIJA 1B30A 3ZT6A 3ZSTA 2J7EA 3MS8A 1IT0A 1U33A 2Y4SA 2W67A 1DP0A 2CETA 1QHZA 1C3FA 2WHLA 4P8VA 2MANA 5GPRA 4D72A 1DTUA 1GQLA 2X05A 1BG9A 5FD0A 1RPKA 1FFRA 3GZAA 1GW1A 2G3JA 1Q4NX 1VAHA 1H3GA 3LMYA 4YHEA 4MDOA 2HISA 4JFWA 3VIGA 1XD1A 5I3DA 2CBIA 3CIVA 3VDBA 3SUUA 1KBKA 4E8DA 3VIHA 4K68A 2EJ1A 1HP4A 2GJXB 2E9MA 4CCDA 2VMFA 1UD4A 3AXHA 5BRPA 3KZSA 2J79A 1XCWA 4AZCA 1HXJA 4CUCA 2Y2WA 1WZLA 3AMKA 5I23A 3SCNA 3WEZA 3SUVA 3QHOA 1VJZA 2CHNA 3ARSA 3EYPA 2ZWYA 3UESA 3WQ4A 2YJQA 3A4WA 5CG0A 4CGTA 1BPLB 3VD9A 3AIRA 2VQTA 2VTFA 1XSIA 2ZX8A 4J3UA 3VIJA 4AZHA 2AAAA 3WN6A 4W7UA 1VJSA 1JYNA 1HX0A 1TFVA 1XH1A 1CENA 2GSJA 2WMHA 3N11A 4ZENA 1F4AA 2UWFA 2WPGA 4TVUA 1ZJBA 4ZXLA 1JYVA 3WELA 2QPSA 4WSKA 4PEEA 3AXIA 4PBGA 4LXFA 5EFFA 3FXYA 2YOCA 3AMCA 1EQCA 4MNJA 2CBVA 2VX5A 2ZUTA 1CPUA 1MW1A 5FIPA 5A8PA 3ARQA 2CPUA 1QW9A 4F9JA 1E5NA 1PPIA 1BAGA 3OGRA 4GI8A 3W6LA 2Z1KA 1JAKA 4HMDA 2C0HA 3VIMA 1JI2A 1B90A 1MXGA 5IFPA 4UQAA 3DYMA 2OYMA 3WUFA 1CNVA 3OZOA 1E70M 3AMLA 4M81A 1UQZA 4TTUA 2XG9A 1GCYA 3AIWA 2AOSA 4MB5A 1KR0A 1GOQA 5JH8A 3VGBA 4KGJA 4AD1A 1EA9C 2Y5EA 1R8LA 2CBUA 3WF3A 4QLJA 2EPLX 3LPGA 1JNDA 4HOXA 2G41A 4MPKA 1V6WA 5JBFA 3ZR5A 3D5HA 2J8GA 1V3IA 2DEPA 4RE3A 1XV8A 2D0FA 2FHCA 1UWIA 3MUIA 4URIA 3CLWA 4E2OA 1HJWA 3L4TA 2OYLA 5A6MA 3WQWA 4Z2KA 3WQ6A 1JDAA 3EDKA 1E6XM 4ATWA 4C7GA 1UZ4A 2YDSA 2GK1B 1BSIA 1G0CA 3W0KA 3AHZA 3WEOA 1HN1A 3WF0A 5D9MA 1M04A 1AMYA 2XIIA 3N04A 4AZ6A 6A3HA 2W92A 2WK2A 1E1EA 4J3TA 2EPMX 2VRQA 1UD6A 2JIEA 3N9KA 2A3EA 4LYQA 2G3MA 4AIUA 6CGTA 2Q8XA 4UQDA 4AXNA 1AQ0A 2WZHA 3VU2A 3PZUA 3CZGA 4S3KA 1V0MA 1UKPA 4JHOA 5CPTA 1WDQA 3QHNA 2OSXA 1QNPA 4KRTA 2VQUA 3FNDA 1Q6DA 3U7VA 1YHTA 3RM4A 1XSKA 5I77A 2E4TA 3KE0A 1LWJA 3TOPA 3ZJ8A 1Y7VA 1I1WA 3AMGA 2DDXA 1C8QA 4DWSA 4W88A 1UQYA 2GDUA 4LPCA 5LA2A 3CUFA 3M6DA 1V0LA 1E4IA 4M82A 2VX7A 5EMYA 2WHJA 5HXMA 4CD4A 4B9YA 4AW7A 1CLVA 2WLYA 1JFXA 4B9ZA 1R86A 1W2VA 4W86A 4H8VA 3EDJA 3SCUA 2CKRA 2NW0A 4D6EA 1CZ1A 2A3BA 1JYXA 4UCFA 2O9PA 1LG2A 3AIUA 3MV11 4PMRA 1GVYA 2JFEX 4AIOA 3RCNA 1SYTA 3DHUA 3L4UA 3F5KA 3I3EA 2O9TA 4H8HA 4D6JA 1HKIA 2PWEA 2Y8KA 3RDKA 1UR8A 2WCAA 3MUY1 1UOKA 2CHOA 7TAAA 2J7HA 2BNJA 1XRVA 4P8XA 4HZ7A 3T0AA 3NIYA 2YBTA 2A3HA 3AQUA 1OM0A 4UOZA 1BHGA 1CBGA 2WBKA 3VM7A 1CGVA 3SCPA 2IUZA 2WAGA 3W82A 2VZOA 4U2ZA 4UQCA 1GZJA 2XVGA 5JIWA 1W1YA 4NI3A 2BY2A 3BXWA 3K4AA 3ZSSA 3PZGA 3WNNA 1WAWA 2CCRA 2E40A 3K4DA 2GJXA 1JNEA 3RJYA 1KGWA 4BQ4A 4CN4A 2OLHA 2E3ZA 3M07A 3MO4A 1PX8A 3WDPP 1E4LA 4D6HA 2GDVA 3AS1A 3WD1A 1UD8A 4DWSC 3RPMA 4DM2A 1NARA 2QMKA 2QPUA 3VGFA 5ABFA 3CZEA 2BY0A 2X8RA 3ARYA 2WC4A 1JI1A 1KXQA 3BAKA 1B3YA 1GPFA 4GXPA 3TTSA 1LL6A 4U3CA 1UZ1A 4D6GA 1E4MM 4CU6A 1FH9A 1EGZA 3AIEA 2WYSA 1MFVA 1GOWA 2CYGA 3G6LA 1BVZA 2WM0A 4U5KA 3SIMA 3W53A 3L4VA 4Z2HA 3VOCA 3VDAA 2XUCA 3PBGA 3VIOA 1EH9A 2NT0A 3HU7A 4AD2A 3ZR6A 4C7FA 5FOOA 1KR1A 5A6SA 1OD8A 2NSXA 4W8BA 1X6LA 1E6SM 1JF5A 3JUGA 5BXPA 1C8XA 1DWIM 4X0NA 4D6FA 2EBNA 1OIMA 1CXHA 1B3XA 2W91A 5A6LA 1ZBCA 2ZXQA 3WL0A 1HF6A 2Y24A 1OBAA 2PF0A 3CPUA 4MDPA 4PMXA 3VDCA 1IZJA 1J01A 1MW2A 3WFLA 5DO8A 3WD4A 5BWFA 1RD6A 4GPNA 5CSYA 3PZNA 3W27A 1KCLA 1UR2A 5FCZA 1WDRA 2D22A 1JAEA 3N1AA 1C91A 3OG2A 1GQIA 1UH2A 3WNMA 2YLAA 4PMZA 5GQBA 3WF2A 3WMCA 1OINA 3N15A 4B3KA 1XYFA 4WKFA 4WF7A 3WD3A 1H0IA 1D7FA 1ISXA 4U5IA 2PBOA 4J7RA 2ZUWA 2XFYA 1J0YA 2ZXDA 1GJWA 4DM1A 6TAAA 4OIFA 4J3XA 1UWTA 2G3IA 3CZJA 2PC8A 4E4PA 5BCAA 1JIBA 5CSUA 1QW8A 2VL4A 5E9AA 3WQ5A 2XFFA 3CUGA 1VIWA 2PB1A 1LLOA 2E0PA 3T2QA 3ARXA 4ZE5A 3TA9A 4MADA 2ZX5A 3OGSA 5LA0A 2GVYA 1CGUA 3WNPA 3TTYA 2V3EA 3ALGA 1UKTA 1XD0A 3IAQA 3VNZA 4GZJA 3GXFA 3TP4A 1B3WA 2W63A 1TA3B 1KWKA 4BS0A 3AISA 3AYSA 2JF7A 3WH9A 1HJVA 4UFHA 1CWYA 3PZIA 3BMWA 4PMOA 1UD5A 3AHTA 3GXDA 3K8LA 2ZX6A 4YN5A 2WC7A 4MB4A 1W9PA 4CVWA 3APGA 2D24A 3EMCA 5TD4A 1B9ZA 1HP5A 3BLKA 2YIHA 3FHAA 1QPKA 2YDQA 3GXIA 4PTMA 1G5AA 4WIWA 3O2LA 2DPEA 5CGMA 3DC0A 3B9EA 2XFRA 4UQBA 4LYRA 4QCEA 3ARRA 1E56A 2XSAA 4AZIA 3ZO9A 4LGXA 1UR9A 1DHKA 4HPHA 5GNYA 2C8NA 5IXEA 1H5VA 2BY3A 5D4YA 3I3BA 4M24A 2JIWA 1JG9A 4WK9A 4JCMA 1J12A 4PUDA 1JZ5A 4IPNB 4PMYA 4OOUA 1W9XA 1QHOA 3F5JA 3DHPA 1X6NA 3PZOA 1V3KA 4JIEA 1K9TA 2UY4A 1ISWA 1C7TA 2JALA 4WKHA 2FHFA 1CEOA 2QHAA 1PZ2A 1UYQA 3RM9A 2D2OA 4PYSA 1AQHA 1QI2A 2WNWA 2DQXA 2ZUVA 4GIAA 1FA2A 2PBGA 1LQ0A 1EOKA 4AY1A 1JL8A 3AHXA 1E15A 3PTKA 2WKLA 3UERA 2X2YA 4A4AA 3LPPA 3W24A 1H2JA 3GM8A 3WQVA 1EDGA 1W3LA 1P6WA 3QOKA 1JD7A 2WKGA 4HMEA 2XGBA 2PWFA 4B3LA 2XSBA 1TVPA 1HNYA 1OCQA 1XSJA 1EO5A 4UFKA 2VRJA 4UR9A 4OBRA 3W37A 2XM1A 4P8WA 3SUSA 4AZBA 1UR4A 4LX4A 1BFNA 3L4XA 2OSWA 3W28A 4JAWA 2Z1SA 4L4PA 1QVBA 2WMJA 3RJXA 2J47A 5LA1A 3NCOA 1TE1A 3EMZA 3O9NA 3G6MA 1UUQA 1YQ2A 1GQJA 3DYOA 2D3LA 1MWOA 3F5LA 4KH2A 4GINA 2PWHA 1V3HA 1D3CA 3AZRA 1ECEA 1QI3A 3CZLA 2FGZA 2XWDA 5E6YA 2UY5A 5D8WA 1E6NA 4W8LA 4L4OA 3ARWA 3WBAA 2BY1A 3MUZ1 1V02A 2X0YA 4BQ3A 4OUEA 1EHAA 2WXDM 4UQEA 1GOMA 1TVNA 2BS9A 1OT1A 3WBEA 2OYKA 4AEEA 1VB9A 4CCCA 4EANA 1OD0A 1JZ3A 4B16A 1ZS2A 4F66A 4R27A 1PJ9A 2W4XA 4DWSB 1LG1A 1O6IA 2JEPA 4UFMA 2EO7A 5CGTA 5E70A 2XM2A 1E0VA 3GDBA 4TX8A 2ZICA 3ALFA 4HOWA 5CXPA 2B31A 1A47A 3PZTA 1QOXA 2F8QA 2ZUUA 4JHZA 5I6SA 5EB8A 2DT3A 3THCA 2RGLA 3N17A 4H2CA 3VM5A 2J4GA 1C90A 4PMNA 4OBSA 3OLGA 5I0DA 2ZE0A 5BROA 3WH5A 2JEQA 1SR0A 3QOMA 3WD0A 1Q6GA 2CIPA 3O6AA 3BAIA 4PMQA 2CKSA 3A6OA 3PTMA 3RM8A 5A8NA 2EPKX 4LQ1A 2J77A 1CXEA 1GONA 4HPGA 3WH6A 5CZKA 1NM9A 2DSKA 2VI0A 3HMCA 1JZ4A 4KMQA 3VMPA 2HVMA 3CUIA 2VCCA 3MSGA 2ZX9A 3T2OA 5AY7A 1JDCA 1FP9A 2VURA 2WSKA 1DEDA 4P7OA 2VX6A 1A3HA 2ZOXA 1XCXA 4AZ7A 2WVUA 4GO9A 2QV4A 3N13A 5A2AA 5M03A 1GHSA 5DF0A 2ZXAA 1G01A 4MB1A 1H49A 1LWHA 2D23A 3W6MA 2GK1A 3POCA 4ZXOA 3WY1A 1W3KA 1J0IA 1XH2A 1KQYA 4M1RA 3AIBA 3SCTA 4PCTA 3DYPA 4GQRA 5BXTA 2WZIA 3FW6A 2QLYA 2J7CA 3AMDA 2VO5A 5CJ5A 1V3JA 1GNXA 3AXXA 2BHZA 4AYSA 1V6YA 2WCGA 4NF7A 2VCAA 4UFLA 4PSPA 2W5FA 3ZT7A 1D2KA 2A3CA 2XYLA 4MTVA 3K8KA 4OZOA 4YHGA 3NSXA 3NJ3A 2DT2A 3GYCA 1OIFA 3KL5A 1W3JA 4AEFA 5M3WA 2J62A 1EIBA 4BQ5A 1V0KA 4WSJA 2D1ZA 2YL9A 3AHYA 4PCSA 1MFUA 5D9OA 5E6ZA 4AZ5A 4A3HA 4EE9A 1CIUA 2VX4A 1ESWA 1QBAA 4WKAA 2VOTA 4ML4A 4PSRA 4YPJA 1UR1A 2DIEA 1OT2A 3GNPA 5JIPA 4PTWA 3LPFA 1H0GA 1E0XA 1KBBA 4UZSA 1JF6A 2PWDA 4TOQA 1ZB5A 2WMGA 1JYWA 2PI6A 4J3VA 1CXLA 1E73M 1QNOA 3OZPA 3WENA 5KEZA 2EPOA 5E09A 1QNRA 1E1FA 1JZ7A 1B3ZA 3CHFA 3WNLA 1OB0A 4FK9A 2DSZA 4FLQA 3VMNA 5A69A 1PZ3A 1W9DM 3VDHA 5A2BA 4TVDA 4IISA 1E40A 2WVTA 1LL4A 2DT0A 3UETA 4CU7A 2FDMA 1XYZA 2ZWZA 2WBGA 2WWDA 2XWEA 4MB3A 4MNMA 4JZ5A 3UG4A 3OGVA 1V08A 3VIIA 5A94A 1E0WA 3W29A 4PTXA 1UR0A 2BHYA 1WCGA 1BYAA 1V6UA 3AS2A 1CXFA 4IPLA 1S46A 1HKMA 1R85A 3VTRA 3WNOA 5ABHA 3GBEA 2WSPA 2EQDA 4MAZA 3IJ8A 1JFHA 1TG7A 2BXZA 1C8YA 4W7WA 1ZL1A 1VEPA 3WF1A 2OWCA 5E0FA 4PTVA 3VMOA 1CDGA 3CO4A 3W38A 1KXHA 1UG6A 1ISZA 1GQKA 4QCFA 1DWFM 3VNYA 2UY3A 1FOBA 1PBGA 1FHLA 1QHPA 2BXYA 2BFGA 3ZQ9A 1R7AA 1CGTA 3ZM8A 2CESA 3POHA 1CTNA 2A3AA 3CH9A 5BRQA 2BHUA 4AMCA 1BGGA 3EDFA 1Z32X 1EQPA 2TAAA 3ARPA 3AZTA 1UH4A 3NSNA 3IAPA 1B3VA 3EDDA 1XGZA 2FGLA 3CMJA 4M80A 4P7RA 3GH5A 1BYCA 5HOSA 3SUWA 3BH4A 4F8XA 3CBWA 3VIPA 2GFTA 4U33A 1B31A 1KFWA 3EBVA 1FHDA 1FP8A 4Z2GA 4CD8A 1GOIA 3MMDA 4EK7A 2WCSA 1J0JA 4JCLA 5A6JA 3BSHA 2WMKA 3IK2A 3ARVA 3RO8A 3BAXA 3GH4A 1ZBWA 2X1IA 1HJQA 1FH7A 1V6VA 5I78A 3MANA 5A6AA 4PUEA 2EPNA 4CN6A 1E6QM 1CGWA 2J78A 2W62A 1V6XA 4PMVA 2OWXA 1HL8A 3ZOAA 4W8AA 1NOUA 5IHSA 3WMBA 2VVNA 3ECQA 2EEXA 7CGTA 5AYBA 5FL0A 1V0NA 2UY2A 4QLKA 4UOQA 3B8SA 5A6KA 4XZBA 7A3HA 1HJXA 4UNIA 2F61A 1DWGM 4S3JA 1CLXA 3KL0A 1WZKA 3AYRA 5CLTA 4MJ4A 5GNZA 1NH6A 3ZMRA 1NWRA 5HNNA 4XX6A 3VGHA 1R87A 1E6RA 3N18A 1KWGA 2WZEA 5CLWA 2J74A 4QP0A 1VBRA 3ZJKA 2D0HA 4DUXA 1JZ8A 2WMIB 3T0BA 1CYGA 2XVNA 2DH3A 1LF1A 1NWTA 1N82A 4PN2A 3ARUA 4ACZB 4HZ8A 4HA3A 1DWJM 3ZT5A 4DUVA 4Q22A 2V3FA 1RP8A 1EDTA 2VR5A 5A6BD 3LPOA 4HA1A 3AOFA 3VINA 4RE2A 4Z2LA 1EHNA 2DSUA 4ACZA 1CGXA 5CPSA 1R7OA 1VFUA 2E8YA 5D9PA 2CITA 1WZMA 5A8OA 3ZJ6A 1LJYA 5ABFB 5LYRA 1U2YA 4ZEPA 3M7SA 2FH6A 2WMIA 3NSMA 4BA0A 2PWGA 3VUPA 3VVGA 2O92A 3I3DA 5HDRA 1VFFA 3N12A 3NDZA 5DT7A 3WDJA 1MQQA 2JF6A 4BQ2A 1Q6FA 3FN9A 1GHRA 3WF4A 4KRUA 4H04A 4NRRA 3ZJ7A 1SMDA 5BXRA 3WSUA 3CHDA 3CHEA 2ZXBA 4HA4A 2CERA 1UWSA 3WUEA 3MUAA 5AC5A 1QNQA 4HOZA 1EDQA 3OLDA 4JL1A 1GVIA 1OGSA 4CKQA 1ITCA 3AZSA 4Z2IA 5ABEA 4P7NA 1AQMA 1OWQA 2E9BA 3VPLA 3KEHA 1M01A 3MKKA 3VD5A 4ZE4A 1UKQA 2ZX7A 4W87A 1H41A 4P7LA 3VGDA 3WD2A 4AZGA 2YA2A 4UFJA 3WDRA 1EOMA 3QGVA 1HVXA 2YBUA 4Z2JA 5BXSA 1HIZA 1NQ6A 4MAVA 5CQ1A 4F79A 2AMGA 4MJ2A 1GUVA 4U2YA 1PIFA 4WJXA 1UKSA 2WC3A 5CPQA 3UG3A 5JUVA 1BYBA 5I24A 4QFUA 5FKYA 4OKDA 2VNCA 4AC1X 4E8CA 1LL7A 4LYPA 4W5UA 4HU8A 2EXOA 1ZBVA 3UEQA 1XH0A 1PX4A 2WHMA 5FL1A 1HVQA 5C71A 5JBDA 2VC9A 3U5YA 4DWSD 1J9YA 5A3HA 1PIGA 3DECA 3PZVA 3T09A 5DMYA 4N0RA 1Q6EA 3W4RA 2WVSA 2FH8A 4X9YA 2VZSA 1IZKA 1WE5A 1TMQA 1W2PA 1JDDA 4A3YA 3S2CA 4V27A 4P7QA 1W9BM 4JKMA 3UR7A 2YDRA 5AC4A 1QI0A 1NWSA 3MU7A 1BF2A 4AISA 2OSYA 4X0VA 1W1VA 1WPCA 3CTTA 3OLEA 3TTOA 3KL3A 1ITXA 4XZWA 3TONA 4MNLA 4H41A 4UTFA 2C7FA 1HT6A 1MQRA 1O7AA 1US2A 4TTGA 2X09A 4U31A 4QDMA 2J8FA 1KGUA 1J10A 2VJXA 2BVTA 2IXUA 4JFSA 4J3SA 1J18A 3VO0A 3MSDA 1K9FA 3K46A 5DEZA 5IFTA 1CXKA 2XGIA 4W7VA 1H09A 3SURA 4UQ9A 5BYWA 1W3HA 2XJ7A 3WH7A 1OGBA 3L4WA 4M29A 3VILA 4D6IA 4FLRA 1ZU8A 3WH8A 1FFQA 1CECA 3OBAA 3RIKA 1MYRA 2WWCA 3FHQA 1H4PA 2XTKA 1KQZA 2GJPA 3PHAA 2YKKA 4GZIA 3II1A 1SFSA 3T0DA 3AHVA 1J11A 3WDHA 3AJ7A 3GBDA 1MQPA 4JKLA 3S6TA 2QMJA 2VRKA 3CUJA 1DWAM 4CD5A 4D6CA 2V5DA 1EO7A 1GJUA 3VIKA 4V2XA 1OSEA 3CMGA 1B2YA 5ECUA 3OLIA 4UZUA 1VFMA 4CD7A 1UKOA 1BQCA 1WO2A 3F4VA 4AD0A 3SCQA 4GQQA 4AWEA 2D3NA 4HTYA 1HKKA 4D6DA 9CGTA 1UWRA 1E3ZA 1TZ7A 2DSVA 3BGAA 2ZUNA 4IUGA 4PMDA 2JE8A 4JFUA 3GNRA 4XUYA 2E8ZA 2VCBA 5F7UA 3WMSA 1W1TA 3B9AA 3HN3A 3VD3A 2G8ZA 2V38A 1JZ2A 3MMUA 1J0KA 2J7FA 3D3AA 3SCSA 2J25A 3SCRA 5GNXA 1PEZA 4W89A 4FF5A 4AIEA 4GKLA 3AROA 3B9DA 2VR4A 3VX0A 5I2UA 1M03A 2RGMA 1UH3A 4FMVA 2BVDA 2ZUSA 4XB3A 3OA5A 3WQ8A 2D20A 2J7DA 3SCOA 1NOWA 1ZBKA 1ISYA 4BF7A 3QHMA 1C7SA 1AVAA 1NP2A 2CNCA 1I75A 4JFTA 3WDQA 2J7GA 5C70A 4M8UA 4NRSA 2G4FA 1B0IA 1E55A 1M7XA 3NUKA 3PTQA 4W85A 3BLPX 1UA3A 5A8MA 3VKKA 1W9VA 1SMAA 1VEOA 2E9LA 1E71M 1KCKA 4H7VA 1I1XA 1TA3A 4W5ZA 3VX1A 1C92A 3EMQA 1ODUA 1FH8A 1G9HA 3THDA 4AD5A 3NDYA 2WW5A 5JBEA 4MNKA 2DGAA 4M56A 3GTNA 2VVSA 4UOJA 3ARTA 3M46A 1V03A 1XC6A 4PRWA 8CGTA 1W1PA 4UFIA 1E6ZA 3PZQA 1QI4A 4C7DA 1MW0A 1WP6A 2DH2A 1GOKA 1JZ6A 3PN8A 1BVNP 3GNOA 5ABGA 1NWUA 2XVPA 1X1NA 3VD7A 1CXIA 1IV8A 4EAMA 1VF8A 1KXTA 4JKKA 4HMCA 5HBFA 3GH7A 1HKJA 3U5UA 2X0HA 1VEMA 2WANA 1WDPA 2J7BA 5D9NA 1K9EA 1H11A 3A4XA 1M53A 1ODZA 3T08A 1GORA 2VUYA 1UHVA 1B1YA 3UG5A 2GUYA 1HJSA 3KWXA 1KB3A 1KGXA 4JL2A 1HL9A 2WB5A 3W26A 2YL5A 4GZEA 1JXKA 4ATDA 1C93A 1V02E 4B15A 4WLCA 5DFAA 4J3WA 1BLIA 4KWUA 3WUGA 5KZ6A 3PZ9A 3QR3A 3CZKA 1QI5A 1J0HA 1TR1A 4V28A 2VZVA 5EBAA 3SCVA 2ZUMA 4AD4A 2XVLA 3HJEA 3WDIA 2J75A 1UA7A 4J27A 2XVKA 1UD3A 2YLLA 1RH9A 1HJUA 3BCFA 4HZ6A 3WL1A 2CXGA 2ZIDA 5A1AA 4RL3A 3SEPA 4OJYA 2CBJA 1UWUA 1VENA 2WHKA 4BCEA 5I79A 2VZTA 1JD9A 3A4AA 1G1YA 1WDSA 5A95A 4QLLA 3IANA 2WVVB 5A6BA 1V3LA 1VFOA 1ISVA 4TX6A 2DSWA 1QNSA 4CN1A 4D1JA 3SUTA 1U30A 3FAWA 1BG4A 1H1NA 5DT5A 5EFDA 1Q6CA 2D0GA 5D8ZA 4AZCB 1TCMA 4J28A 3BSGA 4H8UA 5AYIA 4PMUA 3AICA 2O9OA 2BV9A 1E3XA 2VZUA 1WNOA 3AIQA 1E9LA 3K1DA 3VGGA 2NT1A 4CD6A 1F4HA 1WZAA 3TTQA 4R5EA 3UR8A 2XPKA 3RILA 3OB8A 2DT1A 3A3HA 4GO8A 3BMVA 3E1F1 4JFVA 2XHYA 5E0CA 4W84A 4KGLA 4D71A 3WUBA 3CUHA 3GXMA 3IJ7A 2YA0A 4FLOA 4TUFA 5I5RA 5M17A 1ZJAA 1L8NA 5A8QA 3IJ9A 3L4YA 3WKZA 5IDIA 4D1IA 3L4ZA 1GOOA 1CGYA 1E4NA 2XIBA 2WLZA 4ACYA 3FAXA 1QBBA 3A47A 2W61A 4IM4A 1PX3A 3W25A 4AD3A 1MXDA 4GI6A 8A3HA 4GI9A 3ZIZA 3AIVA 3PZMA 5A2CA 5HPOA 2YL8A 2BVYA 3SCWA 3L2MA 1WB0A 2F2HA 3BCDA 2YA1A 4CCEA 2O9RA 1K9DA 3WEMA 1W91A 3VD4A 4FLSA 3NYDA 4HP5A 3BC9A 1UD2A 2V5CA 4CU8A 2Y8VA 3AS3A 2W66A 2GJRA 3AI0A 1TUXA 3J7HA 3BAWA 2YL6A 4OOZA 4BZYA 1G94A 1J0ZA 1VBUA 1UWQA 2WVVA 1EXPA 1NOFA 4RE4A 5C8BB 4HU0A 2WMFA 2ESCA 4N42A 3MV01 4Y7EA 1K6AA 1RP9A 2VT0A
chains in the Genus database with same CATH superfamily
1UBSA 4DBDA 4IJCA 5FF0A 4QE5A 5XIAA 2A1YA 4U3AA 4F9DA 1C9HA 4HBOA 3K4WA 4C6JA 5I00A 5JH1A 1OX4A 3O5DA 5CZ0A 4C1KA 4JYSA 3M5XA 3U7BA 3W71A 3CQIA 1PVNA 2CEQA 2ZZ3A 2X41A 1OGGA 3VGEA 3NQ2A 3KCEA 3GG8A 1UJQA 3EWXA 3S5YA 1O66A 3QY8A 4DBSA 4NZCA 4S38A 1US3A 2Q02A 3AFBA 3MMWA 1E5JA 1SO3A 1IR2A 4TO8A 2OMAA 3CHVA 2V3DA 4L4LA 1W1ZA 3BG5A 3VIFA 3CGTA 4NSBA 1V3MA 4I9TA 1RJQA 3VAWA 3GVWA 4FHAA 4NNCA 3BK0A 2WOQA 1E6PA 4LCRA 5HNRA 4QAWA 1TPUA 4KFOA 4B5WA 2ZDSA 1MW3A 3SN4A 1QWGA 2PTWA 4EOUA 1LUCB 3ZSTA 2J7EA 3Q45A 3TMLA 1IT0A 3M0LA 1OFOA 4MHBA 4JDBA 3G8RA 3TYBA 4P8VA 3VKCA 3IRDA 4D72A 2P3EA 1DTUA 1GQLA 1OFEA 2GJNA 3LQLA 3FJ6A 3CK5A 4JFJA 3PWIA 3ZWTA 3UXKA 3EIPA 3ITGA 4HIBA 2X1UA 3RG6A 1RPKA 3CL7A 3LENA 3USZA 3GZAA 1Q4NX 1R2RA 3ITCA 1L2QA 4CEXC 3LMYA 2NUXA 4MDOA 3TYUA 2HISA 1V79A 4YMZA 3PPFA 3WJSA 2IMRA 3CIVA 3VDBA 1KBKA 1P48A 4GNKB 4E8DA 2GJXB 2VEIA 4XO6A 1IXNA 3W1NA 5BRPA 2J79A 4ODKA 4JGDA 1GYNA 2Y2WA 3RU6A 1WZLA 3BL3A 3AALA 5DXYA 4MKSA 4UMAA 1LOLA 3HGRA 3T0CA 2OU4A 1VJZA 2CHNA 3ARSA 2PCEA 3OP2A 2MNRA 2ZWYA 3UESA 3TYZA 4AAJA 4CGTA 3VD9A 1BPLB 1PKYA 3TYEA 3VIJA 1XWYA 3FSUA 3IVUA 2WMHA 2A3LA 3L2IA 1Q2SA 1KO0A 1ECQA 1F4AA 2V5BA 4H9VA 2WZTA 1W26A 1O4UA 1VPQA 2QJNA 2BDQA 5T91A 5D2XA 3AAMA 3R8GA 4ZXLA 1LLWA 3AXIA 3FXYA 3AMCA 1EQCA 2VD8A 1ZCOA 4MNJA 1CPUA 3UF8A 5A8PA 3ARQA 3NO1A 1KTCA 2CPUA 3SADA 1W37A 4F9JA 4ITZA 1QXLA 4IMGA 4UDMA 3A5FA 3OGRA 4G8TA 4GI8A 1JAKA 1SSDA 5LHEA 1B90A 3KOWA 1MXGA 3JR2A 4D8AA 1D7HA 3DYMA 3HG5A 1CNVA 4KWOA 4R7WA 1ITUA 4RZ6A 1O95A 1FCVA 3NOEA 2XG9A 1V51A 4GC3A 4MB5A 3P84A 1HW6A 1UC4A 3INPA 3GHTA 3WF3A 2EPLX 4ZMGA 3HJZA 1UP2A 3S1GA 4DRSA 3QGKC 2G41A 2WKJA 1V6WA 1M7OA 3TCEA 2HPMA 3KBWA 2ZYFA 4RE3A 6ENLA 1XV8A 2D0FA 3BOLA 3MUIA 4URIA 3CWHA 1ZJIA 4Z2KA 3CB3A 3MP4A 4ASTA 5KSWA 3HGJA 4NZ4A 3GLCA 3CWNA 1U5JA 3KRBA 1LT8A 1HN1A 3WF0A 2PZ0A 4B5VA 3PWGA 4GUHA 3O5QA 4NI8A 5DITA 1GEHA 1R3SA 2L5HA 2EPMX 2VRQA 2OX1A 4CQCA 6CGTA 3S1UA 1ZJHA 4YWIA 2QS8A 2OZ8A 3PZUA 4DZ5A 3DFQA 1JULA 4S3KA 3I6EA 1V0MA 4JHOA 5CPTA 2VHLA 1WDQA 3QHNA 4O1CA 4K7VA 3OU8A 1NVMA 1RK5A 1Q6DA 2ABAA 3U7VA 1YHTA 3BICA 1XX1A 1XSKA 4UNKA 3AMGA 2YFOA 1C8QA 4PODA 3CUFA 1KT1A 3R5EA 3WMLA 3M6DA 4UC5A 1V0LA 1AG1O 3S1VA 4AX7A 3XISA 3CT2A 2FZBA 4B9YA 4AW7A 4BEQA 4K36A 1JFXA 1T96A 4W86A 1JCLA 3EDJA 4LT9A 2J66A 4LAKA 3I7RA 2NW0A 2FTWA 4U85A 2WZMA 4WOQA 4A8RA 5HQMA 1TCOC 1GWJA 4AIOA 2PTZA 4KRZA 3V75A 3RCNA 3DHUA 4BEUA 3I3EA 1HKIA 1XUZA 4Q4PA 2Y8KA 3A9IA 3HG3A 4CQ8A 4ZO7A 1OCNA 3MUY1 3EX6A 3QEZA 4HYRA 5LNVA 2BNJA 1XRVA 4P8XA 2YBTA 5AYZA 1OM0A 2WBKA 2XH4A 5BMWA 2WAGA 3M43A 1KM6A 4U2ZA 1GZJA 5H6HA 1EPXA 3ZVHA 5KMYA 4NUWA 2BY2A 2E68A 4ADUA 2OO6A 1FJDA 3FYYA 4K38A 2NV1A 1WAWA 2E40A 4ICNA 1H7WA 3UU0A 3SN1A 2W6RA 2VM8A 2VDHA 1AQFA 1JNEA 3RJYA 1MRAA 2FB3A 2E3ZA 3TCZA 1PX8A 3WDPP 2R1KA 4G5DA 3GIYA 3STFA 1UD8A 2ALDA 3RPMA 3DG3A 3VGFA 1I60A 3CZEA 1YRRA 3S9ZA 2BY0A 5C9WA 4IFKA 1DJNA 2HZGA 3KRUA 1PDZA 3BAKA 4RDVA 3T0TA 4GXPA 1DJWA 1N8IA 1XLMA 5LHFA 3OTRA 5I03A 4CU6A 3LBCA 2XISA 3AIEA 1MFVA 1FQ0A 5C5YA 3KDOA 1WUFA 3O5RA 4CNSA 4IPIA 3SY1A 3SIMA 4H1ZA 3QZEA 4JTSA 3SFWA 5C54A 3VDAA 2Z2AA 2XUCA 3PBGA 4GK8A 2C91A 4AD2A 3ZR6A 5A6SA 2ZKMX 2LKNA 1OD8A 2NSXA 1PZ0A 3CEPA 1JF5A 1P0DA 4A22A 4QG8A 3EX4A 2PP3A 1WXZA 4C1LA 3A9BA 2ZVRA 4XBJA 1B3XA 1YXDA 2W91A 4L7ZA 3TZFA 4MJZA 1QFEA 4A3QA 2AGKA 1OBAA 5D09A 1Q6RA 2PU0A 4JQ4A 3XIMA 3JZEA 1IZJA 5D05A 1GKRA 4PTNA 1EZ2A 2XIJA 4PRTA 1WA3A 1RD6A 5CSYA 4H7CA 1TRDA 5FCZA 3FAPA 3N34A 5KETA 3OG2A 3WNMA 4DZIA 3RYSA 1HZYA 3PBMA 5AECA 5GQBA 4PCNA 4WEVX 1XYFA 1F8AB 3WD3A 1DQUA 1IEXA 4QXIA 1ISXA 4U5IA 4XVEA 2GUUA 2PBOA 4J7RA 4U28A 5H91A 2C1IA 4QNEA 2ZUWA 4UTUA 2XFYA 4QR6A 1GJWA 1D8CA 1YDNA 1CT5A 2YXXA 6TAAA 4M6UA 4OIFA 3WLOA 2RJGA 4IMCA 1S2WA 3VOHA 1OF8A 4HNTA 4LAYA 3M0ZA 4DJFD 1KM0A 4PUMA 1LRQA 5AHEA 2RFGA 4I8YA 1R6WA 3T8LA 1XCFA 2BWGA 3CUGA 4LF1A 4JTHA 2QF7A 3VCCA 3NPVA 3TA9A 3OGSA 2O7QA 2GVYA 1VR6A 4C6FA 4FXJA 1ZP3A 3ALGA 3UWEA 1UKTA 5HUAA 3VAVA 3I4KA 3B9OA 3W87A 2FB2A 5K9XA 2C0AA 2W63A 3LHVA 4A29A 5IBXA 1YPFA 3TQVA 4RPPA 1S5NA 4UTTC 2P88A 3T4WA 3K1GA 4IX0A 4YU1A 1UD5A 3QBUA 5DCDA 1IXOA 2WC7A 4XIMA 4UTWC 5TD4A 3TU9A 4JEQA 1B9ZA 1X7FA 4OV9A 4QE4A 3FHAA 4ROQA 4PTMA 4GVHA 3A24A 4WIWA 1QK2A 3F4NA 3B9EA 3R89A 3W01A 4AZIA 1AFSA 1FWRA 2XIMA 4YTSA 2R14A 3KTXA 3Q65A 2WQDA 2IW0A 4QDPA 3CAVA 1A0EA 1YMYA 2FQIA 4LB4A 4GNJA 1IYXA 2QT3A 4JCMA 4IPNB 5KITA 4PMYA 1W9XA 5C55A 3LRLA 4GIEA 1X6NA 3PZOA 1F40A 1K9TA 4JIEA 3VA8A 2UY4A 1ISWA 1BQGA 4M1BA 1DBTA 3EX2A 2AL2A 3QV6A 1PZ2A 2VEGA 3RM9A 1S3TC 2D2OA 3C3NA 1AQHA 3CAQA 3FYPA 1F3WA 3MBFA 4YTRA 3UERA 2X2YA 1EDGA 3BCJA 3V0SA 4WUIA 1W3LA 4H00A 1THFD 1JD7A 3VNIA 2XGBA 3I7QA 2XSBA 4DZAA 3PNUA 4KIRA 4NZFA 1XFBA 3SGUA 4WXZA 3SFKA 3KBSA 4M7SA 1J4RA 4OTKA 2VEMA 2XH7A 4ADSA 3GKAA 4KCUA 1Q63A 2XM1A 4BI5A 2C13A 5TIMA 5HNTA 1ICSA 2KGJA 3W28A 1WX0A 4L80A 1QTWA 3ZYZA 3PRAA 3PBUA 4YJ5A 1WV2A 3FJLA 3MTWA 1TE1A 2QKFA 3EKGA 4NJGA 2PRHA 3WBWA 1CI1A 3G6MA 2ZZ4A 4DXKA 1MWOA 1RVKA 4RNHA 1L6GA 1IWPA 1WQ5A 3STCA 3GDRA 1D3CA 1ECEA 1OZQA 1QI3A 3CZLA 3FEQA 3PBWA 2DJXA 1E6NA 1KCXA 1W31A 3NQAA 5KZMA 1YE6A 2PDPA 1SU5A 1SFLA 2GGHA 1R9HA 4CQBA 4GA8A 1KM2A 3T1GA 3QTGA 3V5OA 2H9AB 2WXDM 5D04C 3COTA 4ZA0A 1TVNA 4Q4KA 1JEZA 3QF0A 2V5LA 1KBIA 4AHQA 3KAHA 4PGLA 2OYKA 4H8NA 3ONBA 4AEEA 1VB9A 2PDWA 3URNA 3UJFA 2OEJA 4MM1A 4N02A 1XYCA 4DWSB 2XM2A 4MYXA 3KS5A 3RK8A 3WLTA 3UCDA 3CQJA 3E5PA 3ES7A 2PPGA 3MKVA 1C29A 1QOXA 2F8QA 3UJRA 2IQTA 3TSBA 4F3HA 2Z7GA 5EB8A 1X98A 3CNYA 4ZB0A 2Q6ZA 1C90A 1OFRA 4UMBA 2ZE0A 3F03K 5BROA 3WH5A 4AF0A 2YFNA 3UWVA 4DELA 4AWTA 2DG9A 1SSGA 3LGGA 3RM8A 3NGJA 5G1YA 4IQEA 2J77A 4HPGA 5FF2A 4EVZA 3ITXA 2DSKA 3H2CA 4JTJA 3WLKX 4KMQA 1VLWA 2I1OA 4UUIA 2PDCA 7REQA 2ZX9A 3T2OA 4BF9A 5AY7A 1FP9A 1XRSA 1DEDA 2R9RA 1YW1A 1I0DA 2ZOXA 3W7OA 1XCXA 3H7UA 1VBHA 4GKTA 4MZYA 1QDSA 3N13A 3UYIA 4FNUA 1NQKA 1GHSA 2C18A 5DF0A 1JCNA 1H7RA 4IXHA 4YNGA 5DCEA 5KINA 1G01A 1GGOA 2QEZA 2A7RA 2GK1A 3POCA 4ZXOA 3WY1A 1W3KA 3JW7A 4PH6A 4C6KA 1A4MA 2FZ8A 4LS2A 3RLGA 3GK0A 1AL7A 2WZIA 3BE7A 1EUNA 1TV4A 2BXVA 5MHBA 2X7WA 4P61A 2VO5A 4U84A 3AXXA 1V6YA 1M65A 3O5LA 1N8WA 4UFLA 1FDJA 4K7YA 3SY8A 3ZT7A 4IPPA 3MW7A 1D2KA 2XYLA 4DXVA 4MTVA 2RJHA 2E1WA 3LTPA 2OO0A 3C61A 2NUWA 5M3WA 2J62A 4XZNX 1EIBA 1K1DA 2D1ZA 3AHYA 3BUVA 5E6ZA 1L6FA 1QBAA 4PSRA 3RF9A 2DIEA 3GNPA 5JIPA 3NTYA 4EIVA 1REQB 1H0GA 1JF6A 2PWDA 3P7YA 2HROA 1ZB5A 4IP7A 1YPXA 4RUBA 3FSTA 4UTTA 2PI6A 3C0SA 1ITQA 3NZ1A 4GQ0A 1CXLA 1E73M 1QNOA 4HHPA 2Z0IA 3BJSA 1B3ZA 3PANA 4RNFA 1OB0A 1AJ0A 2GOKA 2ZRYA 2DSZA 1S2UA 3VMNA 3VDHA 4KQNA 1OVDA 4ZS6A 1E40A 3NGFA 4B4HA 3WLSA 3ABQA 1BKFA 4JTRA 2DT0A 4CU7A 1UOZA 2ZWZA 1XQLA 4ODNA 3I10A 4JZ5A 3OGVA 1V08A 4P5UA 1E0WA 4PTXA 1V6UA 3AS2A 5ABHA 3GBEA 1XLKA 2AQOA 5B8IC 1C8YA 2OZ3A 5LKYA 3MVTA 1VEPA 2P0OA 4NHVA 4TMBA 1CDGA 2G97A 5HW7A 1ISZA 4QCFA 1DWFM 1TUFA 1FOBA 1FHLA 4GHRA 3WLIA 4PCPA 1AD4A 1DQXA 2V5JA 3EA3A 3ZQ9A 2R94A 2REQB 2CESA 3POHA 1I4NA 1KV8A 2WJEA 2V8ZA 3AWNA 1FWTA 2A3AA 2XP7A 3R43A 2BHUA 4EWND 1NF7A 5FAGA 5I3HA 1BGGA 3NYZA 7REQB 3N9SA 3VNJA 4DJEA 3ARPA 3AZTA 3GTFA 2CC0A 1VBGA 3PPCA 2J27A 3EDDA 4JTEA 1XGZA 4P7RA 4M80A 3QYSA 5HOSA 3VIPA 2GFTA 1XLAA 2VFIA 1KFWA 2VDGA 3LI1A 2DP3A 2VOMA 4GXWA 1WKEA 5CG7A 1GOIA 1FWGC 4NVTA 1AH3A 5CSRA 5DMMA 3HQOA 1HJQA 1VKFA 1FH7A 5AYYA 1V6VA 2GSHA 5U7SA 3KRSA 4G50A 4FEZA 4CN6A 4MFEA 3NM1A 1LRNA 1CGWA 2XSXA 3UCCA 4F2TA 7ENLA 2ZE3A 3QFEA 1HL8A 3WMBA 1XISA 4NJIA 3CT7A 4XAFA 3TYCA 5AYBA 2ETNA 5FL0A 1DIKA 2UY2A 3UQIA 1UZHA 5A6KA 4G7EA 3UVIA 4UNIA 4GVIA 1DWGM 4S3JA 4O53A 1WZKA 2QCFA 3AYRA 5CLTA 1U83A 4YIWA 5HNNA 1R87A 3RUBL 1KWGA 4LVGA 3IIZA 1VBRA 3ZJKA 2XP4A 2G50A 3UI6A 3TDFA 2HJPA 3T0BA 4KPLA 2DH3A 1LF1A 3OJGA 2HWGA 1N82A 4PN2A 4ACZB 1YATA 1J93A 3MA8A 2HXUA 3OODA 1DWJM 3N29A 4K8EA 4MSSA 1RP8A 4EX4A 1R3YA 5A6BD 2PDLA 3DG6A 1POJA 4RE2A 4C02B 3TDBA 1WKDA 3ABXA 4ACZA 1TKKA 1R7OA 2Q09A 2V63A 1WZMA 5A8OA 3ZJ6A 5ABFB 3GTIA 3NSMA 2DU2A 1E51A 3VVGA 3T4CA 2O92A 4OBTA 1F3EA 4GQGA 3TH6A 5HDRA 4DPQA 3GRIA 3FN9A 3W1AA 4LAOA 1VYPX 4Z42C 4YYCA 1GHRA 3WF4A 5HINA 3KVJA 4H04A 4Q8OA 2ZDRA 1SMDA 2CLEA 1IEQA 3QQWA 4HA4A 2CERA 2OT0A 1RBOB 3ZZ1A 1ZFJA 1QNQA 4R88A 3WQEA 4HOZA 3Q94A 4XBKA 1TWSA 3OLDA 1SPQA 2CLKA 4S3FA 2HNHA 3DERA 5G2HA 3H2AA 4GACA 1XBVA 2E9BA 2CWNA 4LC6A 1Q2RA 2YW4A 3KEHA 3W7CA 3G1DA 1UKQA 3BLLA 4AZGA 3WD2A 1EOMA 1HVXA 2YBUA 5J5RA 1KRCC 5BXSA 4LV9A 4MAVA 3RHGA 5K9CA 3PK7A 2B0MA 3WK2A 5LIKX 2GQ3A 1GUVA 1HFBA 4U2YA 3T81A 3QLDA 2GSEA 2ABBA 3MSYA 1JPHA 3SO7A 5JUVA 3G1VA 2RUDA 4JFLA 1DE5A 2NWSA 4LSBA 4HBKA 5BZAA 4O15A 3QC3A 2VNCA 3DI0A 3OPSA 4O1DA 4GZ7A 5BXJA 1NDZA 2I16A 3UZWA 4LBUA 3PVFA 4FOJA 1P6BA 2VC9A 2F2DA 4DWSD 1J9YA 5A3HA 3STPA 5DMYA 1CW2A 1Q6EA 3UZXA 4GUFA 2FH8A 2OB3A 4IQJA 4KS0A 1XM3A 5M2FX 1P7TB 2YX0A 1O1HA 3SECA 3UR7A 2DJLA 1BF2A 1VHNA 4X0VA 3W2LA 3TTOA 4XZWA 3S2NA 3AYVA 3TONA 2JKEA 4UTJA 4PUUA 3FLUA 3MI3A 4H9XA 1GRJA 1V7YA 3GKFA 2X09A 4QDMA 2W0UA 2J6XA 2VJXA 3N6JA 3ITVA 4JFSA 2P53A 3LXCA 4MVAA 3VNMA 1HXVA 1S5TA 3MYOA 5IFTA 2PFHA 2D2GA 2HRWA 4W7VA 3IRSA 2GGJA 1X97A 4JNZA 1Y5XA 4N9DA 1J6OA 4FLRA 3WH8A 4GYJA 1CECA 1P0EA 4DN1A 3PSVA 3UJ2A 3G1XA 1D7KA 4A2SA 1Z8AA 1R3VA 1KM3A 2OG9A 2ZTKA 3GD6A 2YKKA 1GW9A 3AU2A 4GZIA 3KOXA 1S5MA 3II1A 1SFSA 1FKTA 2D2HA 5AB3A 2PDNA 3WDHA 3GBDA 3OA3A 3CUJA 4CD5A 2V5DA 3DHFA 1GZGA 3N19B 3G2GA 1B2YA 1UBPC 5ECUA 4UZUA 1VFMA 1F9CA 2F9RA 4A8IA 2R6OA 3KLKA 3WLJA 2C15A 1WO2A 1ML1A 3TVAA 2PBCA 4AD0A 1A5AA 4GQQA 4HTYA 1TJ0A 9CGTA 4B90A 1QASA 2PZNA 4PMDA 2PURA 4Y9PA 2AAMA 3TQPA 2MF9A 3MYPA 2VCBA 3RPDA 1W6TA 5F7UA 3EXRA 3DKLA 1R30A 4DX3A 3HN3A 2G8ZA 2QCLA 3MWCA 3HQ1A 1J0KA 2ZRUA 2G96A 4GQBA 5GNXA 2TPSA 4WR3A 3N2TA 3UXIA 4E8GA 3H7VA 3R10A 3UWQA 1UH3A 2HE8A 2ZR4A 4LY8A 2ZUSA 3B0XA 1NTHA 3WQ8A 4HNNA 1ISYA 3EKLA 1RY8A 2I5GA 3APYA 1C7SA 3CL6A 2FLIA 1GYLA 1XW8A 5F4WA 3V36A 1I75A 2J7GA 1G4TA 4XAZA 3OHMB 4IPXA 4V1YA 2ZA2A 4FSAA 2Y5JA 1A5SA 3N25A 3N9RA 1FH8A 4F0KA 3DFHA 4IIDA 3LK6A 3IJLA 4L9YA 3LBOA 4HHHA 3MMTA 1Q6IA 4RDWA 4DZ2A 3RN6A 1X7IA 4XAGA 3W1TA 1RA5A 5TNVA 8CGTA 4CQDA 4YVVA 1E6ZA 5J04A 4JQ2A 1L8PA 1QI4A 4GIYA 4C7DA 1MW0A 1YBQA 1JCYA 3QV7A 1BVNP 4UTIA 1PYFA 2A7NA 4GRSA 1QPRA 4JKKA 5HBFA 5BU9A 3IWPA 3M0XA 1ONEA 4DRIA 1WDPA 3L9CA 4LUTB 4DI8A 4ES4A 4JQ3A 4Q4OA 1UHVA 2ZRWA 1LM1A 3W7MA 1HL9A 5HMDA 5CC6A 2CXEA 1KFJA 3PWAA 1US0A 1ZENA 3U2ZA 3EWUA 3WJXA 4MSPA 4MF4A 1V02E 1N2VA 2BZNA 5DFAA 1BLIA 2V0TA 2XP3A 1J0HA 1UP0A 4DH0A 2M08A 4V28A 4I7VA 3KCOA 4AQLA 5EBAA 1XBZA 5MF5A 3EOEA 4GWEA 3WDIA 1O5QA 1RH9A 1HJUA 4O57A 1IXQA 2XH2A 3HOJA 5A1AA 2CZEA 4PE8A 3SEPA 1F2JA 2L2SA 5FJOA 4RNJA 1VENA 3ZLHA 1N8FA 4L5ZA 4QLLA 3GQYA 5EMUA 3HQNA 1RLCL 5J6EA 3GS6A 4IJBA 2DSWA 1EQ3A 1QNSA 5HJXA 5DBUA 1U30A 2ACRA 2OXNA 3FAWA 5EFDA 1XBYA 1QZ2A 5H8PA 4AZCB 3VKAA 3VUSA 4GNVA 3DENA 5FEXA 4H8UA 1RD5A 2OCZA 1GK8A 3S6DA 1E3XA 2VZUA 2PV2A 3AIQA 3OYZA 1WZAA 1K4HA 2IKJA 2QW5A 3DFPA 3UR8A 3A3HA 3UBPC 4RZ4A 2HVOA 4W84A 5EMJA 4KGLA 1IEVA 3CGMA 1TPWA 3GIPA 2VFDA 1BD0A 4YS1A 5IDIA 3PSWA 1SZRA 5TBOA 3HG4A 1E4NA 3PUEA 3O63A 2XIBA 2WLZA 1TVLA 3JZUA 4GUGA 3NA8A 1PX3A 3W25A 4C65A 3E49A 5K4ZA 4GI6A 4QAIA 1YNYA 5HPOA 3L2MA 3BCDA 4HNLA 1K9DA 3VD4A 3F4CA 3NYDA 1L9WA 5F1UA 2X30A 3WK3A 4NZJA 2E1DA 2W66A 2GJRA 1T8QA 2C1HA 3AI0A 3V1HA 1P1MA 1IXPA 2ZVIA 1V8EA 1E0UA 2CLPA 1UWQA 3IIOA 3BO9A 2A0NA 4J4NA 5C8BB 4HU0A 2WMFA 2ESCA 4I8DA 2VT0A 2PRMA 1PE1A 1W32A 4IFRA 4ZQMA 4JNYA 3L66A 2X1RA 5FA5A 4AIBA 3PPGA 3L2LA 2F6XA 4HMNA 2EJAA 1IEWA 2IXVA 4EPKA 3WCZA 1NP0A 3W81A 1AUSL 2I5QA 5HPCA 2O7SA 4DJFC 3PJUA 3BAJA 4DO4A 5CEWA 1PAMA 1OYBA 4US5D 2VFFA 2ONEA 3VZZA 3W7NA 2PWVA 1ZSXA 3W02A 3KZ7A 3BSMA 4XV0A 4XD4A 3UCQA 2G37A 1BGAA 1FUYA 2W3ZA 4DYJA 3S5SA 1Q66A 2PD9A 4RPQA 3GW0A 3LHTA 5FSEC 2H6RA 3S9YA 4CNTA 3U57A 1S3HA 1VRXA 2QCMA 4NU7A 2PRLA 4IIEA 2J88A 3PBVA 3CHCA 1RBAA 3E2SA 3EDEA 2V68A 5M5DA 2A6NA 1MEHA 5E0KA 4W9TA 4O17A 3WNKA 4ODRA 3CZ8A 1B30A 3FEMA 4GUIA 3TXVA 3H4XA 1YX1A 2GYIA 5D02A 1C3FA 2Z26A 2WHLA 5HMSA 1T6MA 3DEQA 2X1SA 4GIRA 5REQB 2X05A 2PDJA 3HPAA 5FD0A 1LBFA 3B05A 2F6KA 3IEBA 4S23A 1ZAIA 2BLEA 4Q4QA 1BXBA 3NWRA 4AUBA 2GQAA 3CUXA 3OO2A 1VAHA 3TC6A 1ZPTA 2IPFA 1VHCA 3H2NA 3SRDA 4LBRA 2OQHA 1EJVC 5I3DA 2CBIA 3ZS4A 4JYDA 1F05A 2G3FA 1EP1A 1JPDX 3KW3A 2EJ1A 1HP4A 1SR9A 3N4AA 1S5VA 3BDKA 1H7XA 1HXJA 4CUCA 1P5QA 1DL3A 1TJ1A 1HTIA 3BWWA 1VFTA 2YZ5A 2PDBA 2FFIA 3SCNA 2GVEA 3WEZA 4I9MA 3SUVA 1UP3A 2HCVA 2CZFA 3KDNA 3EYPA 3CC1A 2VQTA 2ZX8A 4J3UA 1DORA 4IQDA 3FFSA 4XBSA 4WD0A 2AAAA 1JYNA 2DZTA 1XH1A 2Q5AA 1CENA 1PIIA 1QWKA 4R85A 3H2FA 1Q65A 3ATZA 2UWFA 4PBFA 3IKDA 3GFXA 1SQ7A 1ZJBA 3BJTA 3HF3A 4WSKA 4LF2A 5D32A 3TFCA 5CPLA 4MY8A 3T05A 2CBVA 1R3TA 2ZUTA 3TQKA 5FIPA 1CB7B 3S46A 1E5NA 3P67A 1NJJA 1PPIA 1BAGA 3RR1A 3BMBA 1FCUA 4Q8QA 2GWGA 2C0HA 4FX8A 5IFPA 4UQAA 2G4JA 1XLIA 3CB8A 2FPTA 1L6WA 3AMLA 4Y8EA 5K2ZA 1UQZA 4L3NA 1FWWA 2OQLA 3QN3A 3VC6A 5JH8A 3VGBA 4KGJA 1EA9C 1VFLA 1GEQA 4UTHA 4LRTA 4QLJA 3P93A 5FF3A 4LWWA 3RMJA 3TMQA 3SGZA 4F2BA 2VDIA 4G6CA 4MPKA 3APTA 2E6DA 3CO8A 2VGBA 1HL2A 3LCFA 3TN6A 4G1NA 1RQHA 2FHCA 1UWIA 2H90A 2C79A 5LIUX 2Z00A 4E2OA 3WLHA 1HJWA 1TPC1 3WQWA 1ROUA 1JDAA 2ZRVA 3EDKA 5BOFA 1E6XM 3T07A 3PB0A 4C7GA 4R7OA 2YDSA 3W7IA 4WGXA 3NZPA 1BSIA 3VCRA 3W0KA 1MMFA 5C2CA 5D9MA 4DXXA 4XZHA 2YZRA 2FGBA 4L1GA 4L56A 4RV3A 2X42A 4PL1A 2C3ZA 4H9YA 1UB3A 3PUOA 3WLPA 1M41A 3TJ4A 1A5OC 1UD6A 3XINA 4EXBA 4LYQA 3GFZA 4AIUA 3O7UA 4AXNA 1AQ0A 3VU2A 3MCOA 4TU1A 1UKPA 2XP5A 3MT1A 2E5BA 4PUJA 4IICA 2OSXA 3EB2A 4J4KA 3TOYA 2FMNA 1NMWA 2VQUA 1BSLA 1KBJA 1R9XA 3RM4A 2E4TA 3ZJ8A 2R1MA 1NF0A 2VC5A 4DWSA 4FNQA 1S1PA 1UQYA 2GDUA 1OHLA 3VCNA 1VZWA 1R2SA 5DXXA 1E4IA 1X8CA 3LV6A 2WHJA 3M0YA 5HXMA 1QK0A 1R9ZA 1CLVA 3QY6A 1I45A 1R86A 1DXIA 1I2NA 4NX5A 2PDUA 1SJBA 2E6AA 4XKYB 1I2QA 2O9PA 3QGAC 1LG2A 3AIUA 2C16A 4PMRA 2JFEX 1DKWA 1H7PA 3P5ZA 4IL0A 1XC4A 2PWEA 1TV8A 4W9PA 4ROPA 4G7FA 4O2TA 2CHOA 4IWWA 5G1MA 2O56A 3H9RB 1SO5A 4JTAA 3T0AA 4HARA 4Q6XA 2A3HA 1RBLA 1CBGA 2QJJA 1CGVA 3SCPA 1B3OA 4S3DA 1ZAJA 3W82A 4BHYA 3UI4A 4KWSA 4V15A 5AHLA 5JIWA 1W1YA 4NI3A 3SQLA 5F2MA 3ZSSA 1J96A 1JNTA 2CCRA 4D8LA 3K4DA 1O12A 2FZNA 1DJIA 4Z1DA 3TE9A 4BQ4A 3M07A 4J2MA 1E4LA 3UZYA 1NAL1 4RLIA 1W0MA 2OR2A 4DWSC 4PUWA 4DM2A 3I6TA 4JX6A 2X8RA 3CLMA 1TJ2A 2WC4A 3H22A 1KA9F 3MO7A 2H3DA 1OF6A 5REQA 3CXOA 4HK7A 3TTSA 1LL6A 1O5XA 4L4MA 3C8NA 1E4MM 3WLRA 4LY4A 3N14A 1XIHA 1D8WA 3UGVA 3GU1A 4WY0A 4JQAA 2YCLB 1GOWA 2CYGA 3G6LA 1FAPA 3ITLA 2WM0A 4HK6A 4U5KA 1MXSA 3W53A 3L4VA 1U1HA 4Z2HA 3VOCA 4AVFA 1ADOA 3FKRA 3PY2A 3VIOA 4Q33A 5BU6A 5FOOA 1KR1A 2E77A 3H23A 4W8BA 1E6SM 3KADA 3EPOA 5FJPA 4C6QA 4NJHA 5GJMA 4UIOA 3TW7A 1XYLA 3GDMA 4NYYA 3TAOA 4QITA 4N4QA 2EULA 4NAEA 5EGRA 2NQHA 1ZBCA 2Z1BA 1A4LA 1HF6A 2Y24A 5HQEA 3H2EA 2C19A 3CPUA 3MJMA 4ADTA 1G69A 3WD4A 1VP5A 4FP1A 4D8ZA 4FXFA 3CYJA 3S0CA 1KCLA 1JAEA 3N1AA 1IIGA 5B80A 1KKOA 4GYPC 1GQIA 1UH2A 2XDFA 4DEFA 4PMZA 4PBEA 4AVNA 1FKHA 1OINA 3UZZA 4C90A 4WDXA 1H0IA 1OQFA 2Y70A 4BWLA 3H54A 4PFHA 4XSLA 4DM1A 3P61A 1Z3NA 2PDQA 1T7LA 1M68A 3R1ZA 4QX4A 4E4PA 5BCAA 3W9ZA 4UWMA 4X60A 4YYFA 1JIBA 4IX2A 1A5UA 1EJUC 3WQ5A 3N3TA 3BARA 1VIWA 2PB1A 4M6VA 4GFSA 1V93A 3MUXA 2RDUA 4US6A 1Z69A 3H26A 5LA0A 4YTUA 4QS6A 2PDIA 2HTMA 4LALA 3WNPA 4HPJA 5LXEA 2I9EA 3MUCA 4TR9A 3KXQA 4GZJA 3TP4A 1B3WA 3R13A 4H83A 4BS0A 5C0QA 2BTMA 1Q7MA 3AISA 7ODCA 2M2AA 3GVRA 3UJEA 2BGSA 3B9NA 1DV7A 1I2OA 2C14A 3K8LA 2Z27A 2ZX6A 4YN5A 4MB4A 1W9PA 2DZPA 3D6NA 4UMCA 3E2QA 3CEUA 1EYEA 1HP5A 1H50A 1VQTA 1EX5A 5E1QA 5AC8A 4FR6A 2DPEA 1JUEA 4O10A 4LYRA 3ARRA 4MLJA 3EOLA 1KFEA 4WXYA 4DVOA 3ANUA 4RR4A 1QRQA 4Y8FA 3VOFA 1FKGA 4HPHA 2C8NA 3N2MA 3F2BA 1ENUA 4M24A 3IK8A 2JIWA 2QDEA 1LTDA 1Z9AA 1ADSA 4OOUA 1QHOA 3DHPA 2VR2A 1V3KA 4XAYA 4L9XA 5D2WA 1C7TA 2JALA 2FHFA 2FKPA 2QHAA 1AL8A 1UYQA 3GY1A 5LNWA 1Z89A 7PTDA 4JXCA 3W86A 3NVTA 1F3TA 2DQXA 2ZUVA 1EBHA 1R3RA 3IGUA 2ODOA 3KRZA 3O15A 1E15A 3PTKA 4I9JA 3LPPA 4K39A 4QZVB 1Q85A 3QOKA 5K3VA 4B3LA 1TVPA 2W79A 3TFXA 5DLCA 1LRTA 1Q6LA 3D3FA 3ID7A 2ACUA 1GTHA 3R7MA 1QT1A 3MZNA 2YGYA 3LN3A 3SUSA 1UR4A 1IF2A 2Z1SA 1KLZA 2WMJA 4ZPTR 3RJXA 3PAJA 4UTMA 3NCOA 3EMZA 3O9NA 3RPTA 1UUQA 1YQ2A 2YCJA 3DYOA 1WYIA 3F5LA 3UXAA 3VYLA 1V3HA 4GX8A 1SZFA 1TQJA 1A5KC 2FGZA 5E6YA 2UY5A 5D8WA 1AW5A 5EMKA 2PDKA 3ARWA 1OEPA 4GYFA 1SJCA 1PTDA 3WO8A 2BY1A 4HCDA 4KWVA 3W23A 1QPOA 2V81A 4XO7A 4DJEC 3PJXA 4QTGA 3CYVA 5K9DA 2CLMA 4HU4A 3RX3A 4CCCA 4EANA 1JZ3A 1HO4A 4ODQA 3B8DA 1PJ9A 3E0IA 2YPIA 4UNLA 4US5A 1LG1A 2JEPA 4UFMA 5CGTA 2ZQSA 2OPJA 2Z28A 3LV5A 3UWWA 4WY0F 4ZQOA 4LUJA 3I65A 1EYWA 2B31A 4PRRA 2ADAA 3O0KA 5HMEA 4DY1A 4NIRA 5K7JA 5CAKA 1EJTC 1XLGA 2FDSA 4IPJA 4QNWA 1JCTA 4L6OA 3VM5A 4O28A 3UQAA 2J4GA 4PMNA 4OBSA 4RXGA 5I0DA 3S5OA 1GJPA 3LXAA 3FDKA 1EF2A 2WNNA 3NPXA 1Q6GA 2IPWA 3H2OA 5FF7A 2Q3OA 3O6AA 1LZOA 4HBEA 2CKSA 3A6OA 4ONVA 4K1GA 3ODKA 5A8NA 2VEFA 5HNUA 4A05A 4DRMA 2QCDA 2NVDA 1NM9A 3HMCA 4IFOA 1KFBA 2YSWA 3NZRA 2BASA 4JDYA 4ORIA 1D7JA 4B4FA 1TYGA 4MUZA 4K1WA 2WSKA 3ITOA 4P7OA 4D2JA 2VX6A 2PN0A 4ZSUA 4AZ7A 5JXQA 2WVUA 1R0MA 2AL1A 2QV4A 3KHJA 1DJHA 2J9YA 4FNSA 1Q45A 2TMDA 1WOAA 5C2XA 1H49A 2BGNE 4WDUA 4IMEA 5EA9A 2GDQA 3DIPA 4FB7A 4DPPA 1ZUAX 4FNPA 4HYWA 3SCTA 2ZCGA 1Q4WA 2J7CA 1XINA 1TTPA 1FWIC 5CJ5A 1IGWA 4AYSA 2CLHA 1VLIA 1WXJA 4NF7A 2DW6A 4R53A 2A3CA 4AY7A 5D2TA 3QSTA 3K8KA 4YHGA 1XXXA 3NJ3A 2DT2A 3GYCA 1W3JA 3RFWA 4AEFA 1R2TA 1KFKA 5DRIA 4BQ5A 4WSJA 4PCSA 1MFUA 1RUSA 1KRAC 1B57A 4UXDA 1O68A 3AYTA 3HQPA 3VFCA 2JKPA 3WQGA 3B8WA 2YYUA 3B97A 3NAVA 3DN5A 1W1IE 2FYMA 3E38A 1HKWA 1OC5A 2WMGA 3RX4A 1JYWA 1YKWA 3EOOA 3OZPA 3WENA 3W85A 5DQPA 2DG3A 2BMBA 3CHFA 4GJIA 1FKDA 2V69A 3LU2A 2DQWA 1O94A 3GYEA 1PZ3A 4I6VA 2DZAA 5A2BA 4IISA 4N7QA 1RLDA 1FX6A 3RRXA 1B4EA 4D9PA 2QPXA 3PC0A 3UETA 4MKNA 2WBGA 4LVFA 6XIAA 3UG4A 4E3VA 3HBLA 1WKFA 2PMQA 3W29A 1GG1A 1GKPA 1BYAA 1MO0A 1HKMA 3QW3A 3VTRA 3O5PA 2WSPA 3AC0A 5H1WA 4MAZA 1TG7A 2BXZA 1DPMA 1XG4A 2E6FA 3ATYA 4PTVA 3VMOA 3H53A 3CO4A 1XUUA 3W38A 3GDKA 4WOZA 1UG6A 1GQKA 3RLHA 5AZ1A 4OT7A 5BWAA 3W83A 4MZ1A 3W7EA 2BXYA 1PSCA 2BFGA 4Q8WA 1B5TA 5E93A 5XIMA 3LLFA 1BWKA 3QJAA 1REQA 2PLMA 1CTNA 3B0YA 1QMLA 4XSMA 1YDOA 3P14A 3LGDA 4QRNA 3HZ3A 3PB2A 1B54A 4LEFA 1A3WA 5CSSA 4PC8A 5BRQA 2XN1A 1RV8A 1FKWA 1XLEA 5DIUA 2LJ4A 3NSNA 1B3VA 3QR0A 1T5AA 2FGLA 3DFNA 4BI6A 4N9CA 4Y90A 1ROTA 3BH4A 2E25A 5AFDA 3L21A 4U33A 1B31A 1P43A 3EPNA 1FHDA 1FP8A 1IE7C 5LGZA 1TREA 4Z2GA 3V35A 4EK7A 1PS9A 5I3IA 1J0JA 4JCLA 3BSHA 3TK7A 3O5OA 4X2PA 4UCGA 5CPNA 1UROA 1P4CA 3HTWA 3ABZA 1UPPA 3GH4A 1ZBWA 2X1IA 5I78A 4NNBA 1OFQA 4INFA 4PUEA 3UF9A 2Y88A 2ZC8A 4M6PA 1XDLA 2W62A 3TJLA 1MEIA 3O5IA 3STGA 2AKMA 2OWXA 4LU0A 3ZOAA 2VVNA 2PPNA 3PAOA 3QH2A 1QW7A 1NFBA 1G4SA 3VC5A 1V0NA 4UOQA 3ABRA 3CIWA 1FKJA 2QAFA 3EA1A 3IUHA 4Y9OA 4Z1CA 3OVGA 2F61A 3R94A 4ZO6A 5GNZA 1NWRA 3VGHA 4JFKA 3N18A 5LSMA 4GI4A 2V82A 1H5YA 3E74A 4DUXA 1FDZA 3EWDA 2WMIB 4ICMA 4DJDC 1CYGA 1XLFA 3ARUA 2Z6IA 3OZMA 4ZCWA 5A8GA 4HZ8A 3DI1A 3WQCA 3A13A 3TYAA 3FVMA 2V3FA 2VR5A 4HA1A 2Y63A 3AOFA 3HV8A 1A53A 1D3GA 3W1RA 4ZOAA 4M3PA 2PGWA 4RE0A 4JY9A 4ZEPA 2FZDA 4BA0A 2PWGA 3LCIA 3I3DA 2HSAA 1KRBC 2OJPA 1OJXA 4CCZA 1XPYA 1MQQA 2XP6A 1ZRQA 3H8AA 4QG9A 1SW0A 1X1OA 3UFYA 3UA3A 9RUBA 1NSGA 3CHDA 1SFJA 4LTSA 1UIOA 1GVIA 4Q8PA 1OGSA 5B7ZA 4F0LA 1BKHA 3AZSA 4X61A 1PKNA 3FGCB 3VPLA 3VD5A 2R91A 3DGRA 2ZX7A 4ZOBA 3LQGA 2PLCA 3QGVA 4Z2JA 4AMAA 3LSBA 4XK2A 1NQ6A 3UVAA 4IIBA 4F79A 2AMGA 5HWJA 3M47A 1PIFA 3L0KA 3UG3A 3M0KA 5D38A 1BL4A 3QPYA 1BYBA 1VCVA 3AUJA 4RXFA 1VFSA 1AJ2A 5G4HC 3P0XA 4Q7BA 4NG3A 4C6PA 4AC1X 2B7NA 1GVOA 1RJRA 2A85A 1F6KA 3KWSA 9XIMA 3SQSA 3B40A 1BKSA 4FALA 2WHMA 5FL1A 3C0LA 2I7GA 3U5YA 1PIGA 2PDXA 3DECA 4HSHA 3T09A 2HXTA 4N0RA 4N4PA 1TPEA 3GVVA 3KCLA 1F61A 4O18A 3WK0A 1IZKA 3C2OA 3HV9A 3NM3A 4EF8A 4GE8A 3S2CA 3NVDA 4V27A 4P7QA 2AGTA 3NQ6A 1NWSA 3MU7A 3OLEA 1ITXA 1IWAA 4EACA 1KTNA 1AZ1A 2ISFA 3N3MA 1US2A 1MI3A 5DY2A 5I98A 1GKQA 2HK1A 1K6WA 3G1RA 4J4OA 2IXUA 2Z2BA 4J3SA 3MSDA 5DX7A 4FZIA 3ISIX 2EAWA 3OVQA 1CXKA 3G1HA 2YXGA 1ZHAA 1DIEA 3TUUA 3SZ8A 2XJ7A 1OGBA 4ZR8A 3N2BA 5HA7A 3GR8A 2X1TA 1TPVA 3VILA 3QXBA 4ZQCA 1ZU8A 2EG7A 1FFQA 2YR1A 1Q8JA 3GR7A 4NAFB 4ML9A 4A35A 3IV3A 3PHAA 3EA2A 3GSMA 4W4QA 2TSYA 2PDFA 4GJ1A 1TX2A 1MQPA 4HK5A 3S6TA 1Y0EA 2PF8A 3SJNA 1GJUA 4GVGA 4IJRA 3CMGA 1QPLA 2ZBTA 4HZMA 5T9CE 4NXSA 4CD7A 4ZB5A 3RGCA 4B2DA 1BQCA 1I8JA 3F4VA 1J6PA 3QC0A 3SCQA 3IKGA 1Y5WA 4AWEA 2WV8A 4FXRA 4D6DA 1UWRA 1E3ZA 1GQNA 3ONCA 4ICCX 2DSVA 3N2OA 1EWEA 4IUGA 2GQ8A 3N73A 2E8ZA 4M6QA 1KLYA 3HPSA 1W1TA 1L6YA 4E5TA 2FVKA 2V38A 2J7FA 3D3AA 1B4KA 2BOFX 3S47A 2J25A 2EKGA 1PEZA 1MZRA 4W89A 3AROA 5HKGA 1YXCA 4DAFA 5I2UA 2VR4A 2JQXA 1AA1B 1E44A 4FMVA 4EAYA 4XB3A 3LUOA 2D20A 2J7DA 3G1FA 5D37A 3MVIA 1NOWA 3SCOA 1H60A 4BF7A 3QHMA 3BPWA 3GAYA 2B81A 3IPWA 3MZ2A 1NP2A 2Y0FA 4M8UA 1E55A 4C6OA 1H7OA 3E2VA 1O5RA 5A8MA 3VKKA 3LMZA 2I9UA 1SMAA 3TEVA 2E9LA 4GY1A 1IHIA 2G95A 1E71M 1KCKA 3QRHA 1TA3A 3W2JA 4YCPA 4F40A 2VYOA 1ODUA 3EMQA 4AD5A 3GHSA 3NDYA 1NDVA 5JBEA 3U0HA 3LM3A 4J2PA 3ARTA 4X22A 3M46A 2HQAA 3UQNA 5I7GA 3CS2A 1W8SA 2NX3A 1W1PA 4KT2A 1DJYA 4UFIA 3PZQA 1W5PA 4LUTA 5I3KA 1J2BA 2HS6A 1S39A 2VGFA 4GGQA 3PFMA 1WP6A 4H9UA 4O0KA 3A3XA 1JZ6A 5G1TA 5ABGA 2H9AA 3BZGA 4A21A 2XVPA 4JEJA 4EAMA 4MUPA 1LCOA 2UBPC 1FVPA 1PKLA 3GH7A 3C86A 3U5UA 5JU6A 2X0HA 1LBLA 1V7AA 4QG6A 2E09A 4DRPA 3BOFA 3LOTA 2DVUA 3A4XA 1M53A 1ODZA 1KD0A 3PG8A 2D9FA 4ZO9A 4JL2A 4FNRA 3R12A 3W26A 4GZEA 1JXKA 5C7HA 3CH0A 3KHDA 4WY0B 4B15A 5JH2A 1A5CA 3NXLA 3SSJA 3WUGA 4LAVA 2QULA 3CZKA 4DO6A 4B5SA 4R7JA 1TR1A 5JQ9A 1RCOB 4DNHA 4O0QA 3K2GA 1YNPA 3M44A 2ZUMA 2MLYA 3AJXA 3RCMA 2J75A 2CZDA 3HB9A 2SFPA 2JGYA 2QDDA 3C2YA 3KX6A 3HO8A 2VGIA 4OJYA 2CBJA 1UWUA 2QVHA 1PHQA 1VS1A 2WM1A 5I06A 5I79A 2ZQUA 2VZTA 1FKRA 3A4AA 4HCHA 3MQTA 4R9OA 3IANA 3UW6A 2RUSA 2WVVB 1K7EA 1K70A 1H1NA 4IH3A 2D0GA 2NXIA 1TIWA 4OFCA 3HPXA 5DMNA 4MMWA 1TCMA 3BSGA 4ZPWR 4KF1A 2CLOA 2RAGA 4KCWA 1PL9A 4WCJA 3W07A 5AYIA 4S2BA 2BV9A 1J2WA 1WNOA 1E9LA 3K1DA 3VGGA 3SIZA 3UP8A 4MWAD 1W3TA 3TTQA 4R5EA 3OB8A 3VK5A 3KACA 3E12A 3ICJA 3BMVA 1QO2A 4E0CA 5E0CA 4D71A 1ZZMA 3QSRA 3UQBA 3CUHA 3GXMA 2TYSA 3C0JA 3IJIA 3IJ7A 3EOSA 5I5RA 4B91A 4ZB2A 1ZJAA 1GZ1A 4IGNA 4QBXA 1L8NA 5A8QA 1OK6A 2GJLA 4ILSA 3WKZA 4D1IA 2PGEA 4QT3A 3DOPA 3WQOA 2Y89A 4GH1A 1TR9A 5AZ0A 2IKHA 1UUOA 1XRTA 4ZFCA 2UZ5A 1MXDA 4N2YA 1P1XA 3V18A 5HJLA 5A2CA 1K4GA 3SCWA 2Z1VA 4K2SA 4W9QA 4IQCA 2VFEA 3WEMA 1W91A 1TZ9A 2LPVA 4QSFA 3SSZA 4FLSA 4RCXA 3PRBA 3BC9A 3KBJA 3S4TA 1BWLA 1TUXA 3J7HA 2YL6A 1YADA 4BZYA 1G94A 1J0ZA 4JS3A 1U79A 2WVVA 2Y7GA 3BW2A 4JOMA 4F0RA 3LZ5A 3MV01 4Y7EA 1PHWA 1MEWA 4NASA 4TW6A 2Q8ZA 4ZFMA 2P0IA 1D3HA 2GL5A 3RITA 1WKYA 3BLIA 3MDWA 4M19A 4ATLA 4MLRA 4XQ6A 2O0TA 2A7PA 1QAPA 4LW7A 1Q6QA 1WUEA 2I57A 4I6KA 3CV1A 5IHRA 2VFHA 1BYDA 3E5BA 3BAYA 1LROA 1JXJA 3H7RA 5G2IA 1DWHM 3ARZA 3QZAA 4A6GA 1IR1A 1SZNA 1YTEA 5T26A 4ECLA 1T99A 2PTDA 1EX1A 1DTNA 1QR7A 3OIHA 4MOZA 1M6JA 1IWBA 2V3GA 4X63A 3T2PA 4TXEA 1RJPA 2INZA 3FY1A 6TIMA 5ABTA 4N19A 3K8MA 1BTCA 1EL3A 3ZVIA 3ZR4A 4DUWA 4DROA 1JGIA 1TWIA 4BJHA 2W27A 1JPMA 4DAIA 3LRMA 3ZT6A 3MS8A 2QXWA 4G9PA 2Y4SA 2W67A 2Z1WA 3P81A 4B5XA 2MANA 1N7KA 4L61A 2I14A 1FWFC 3B7XA 4XKMA 4K6AA 3O5KA 4G1KA 2ZFAA 2Q8LA 4NZ5A 1KM1A 1FFRA 1GW1A 2Y8UA 1H3GA 2NX1A 3UWZA 1NMVA 2DUXA 4HN4A 2ZRXA 2IF4A 4RW5A 1D7IA 4Q8NA 3A23A 3VIGA 4A3RA 1XD1A 4JHMA 2QUMA 3ZLFA 3VIHA 4U10A 4NP7A 1AH0A 4CCDA 5HULA 3AXHA 4RDYA 5AHNA 1P0NA 2ZA1A 1JCJA 3BQ5A 4AZCA 7TIMA 1N1AA 2HVNA 1H51A 3VNKA 3NQMA 3AMKA 5DN1A 2INEA 4IG2B 1JCMP 2P10A 2PUZA 1V6TA 3O5GA 2YJQA 1Z6KA 5CG0A 3BVJA 3AIRA 2VTFA 1XLBA 1XSIA 1A5BA 3C6CA 3N2XA 3NL6A 3IHZA 1VJSA 1TFVA 3TSDA 1VCGA 3NQBA 3QKZA 4ZENA 1TV7A 5GJNA 3CPGA 3UY8A 2WPGA 4TVUA 4XZ9A 5CJNA 5BW6A 1KM4A 5LZLA 4UB9A 1FWHC 4Y2WA 1JYVA 2QPSA 4LXFA 5EFFA 4E3TA 2YOCA 1L1PA 5HW8A 2P76A 2J9XA 2VX5A 3DFSA 1R5YA 4DRJA 2WSRA 3OQ8A 1XYMA 3L5LA 5HTGA 1FCQA 2Z1KA 4O14A 4HMDA 3UT0A 3VIMA 1JI2A 1ZGDA 4PL2A 2GUBA 2GGGA 1TTJA 5CBBA 3OZOA 3B0PA 1E70M 4C5ZA 3M5ZA 2DVXA 2DW7A 2E7FA 5C9ZA 4C6DA 3AIWA 1GCYA 4FS9A 4GBUA 1Q6OA 2J8TA 1R8LA 1JNDA 4WQ6A 4QEHA 2EG6A 3UPMA 3QQ0A 3OQEA 3SW6A 5D30A 3IIPA 3PUDA 3KVMA 4A8NA 1TPDA 3ZR5A 4EPDC 1LORA 1MUWA 2J8GA 4CQ9A 1CB2A 1V3IA 2DEPA 4XZMX 2OKTA 3VZYA 3WQPA 3L4TA 5A6MA 3WQ6A 3KBNA 4REQB 2WPBA 2BOEX 3KM8A 1AODA 4IG2A 2GK1B 2IKIA 1JDFA 3CL8A 3AHZA 3ZVHB 1M04A 1AMYA 1ZCCA 2XIIA 2D2JA 5EYWA 6A3HA 2W92A 2WK2A 1E1EA 4J3TA 3N9KA 4XTDA 4NQ1A 4A3UA 3QTPA 3GC2A 3PA7A 2Q8XA 1X38A 2WZHA 1HQTA 4GJJA 4AFYA 3HM7A 3GG0A 1EJWC 1QATA 5F4XA 2KAUC 2BP1A 4KRTA 1TWWA 5AHIA 1PDYA 3KOFA 3TN4A 3BGJA 2KE0A 3GVQA 4XIAA 3KE0A 1LWJA 3TOPA 4UTLA 1Y7VA 1FKIA 1RPXA 3BTNA 4WSHA 2OGJA 2QJMA 4LPCA 3F4WA 5LA2A 1LLZA 1MSSA 2VX7A 1OC6A 1A7XA 4CD4A 2WLYA 4B9ZA 3P5YA 3EB4A 1VIZA 1W2VA 3OYXA 3SCUA 2DFAA 4TX9A 1CZ1A 4J9JA 1JYXA 5C9XA 3JU2A 3MV11 1OZMA 1GVYA 3KOZA 3GG7A 3P6LA 3AUOA 3S5ZA 1UCWA 1OX5A 4O16A 2RURA 1YEYA 3L4UA 3E0WA 3ZWSA 4J1OA 2O9TA 3S3GA 4D6JA 4FOUA 1SM9A 1FY6A 3URAA 3P74A 1AJZA 1TJRA 2KO7A 7TAAA 2J7HA 4U86A 3DFYA 3O5FA 4LEQA 3AQUA 3NPUA 3U8GA 2LGOA 4DRHA 2IUZA 3ORWA 1EXBA 2NQ9A 2VZOA 1E1CA 2UV8G 1EJSC 1KV5A 2NZLA 3PZGA 1FWJC 2GJXA 4FPSA 4H9MA 3KTCA 1KGWA 5C9UA 3L23A 1U1JA 1HUVA 2FFCA 4ZTYA 4CN4A 1LOSA 2ATSA 6PTDA 8XIAA 2OLHA 4Q8UA 3MO4A 3UGRA 2GDVA 3AS1A 3T8QA 2VCDA 2IPGA 2F4EA 3WD1A 5XINA 3F2DA 1S2CA 3Q2DA 1NARA 4R9XA 2Z7KA 5ABFA 1EGVA 4B2DD 3WBXA 2B7PA 2PV1A 3T6CA 1KXQA 2FMOA 1GPFA 3NTPA 5LGXA 4U3CA 1UZ1A 3EB3A 4D6GA 5D2YA 5IOBA 1YW5A 1FH9A 4LAZA 2XZ7A 1EGZA 2WYSA 1BVZA 3KS6A 2RSEA 4MJMA 5AHFA 3M1ZA 4TW7A 4HPXA 2NT0A 3T78A 4C60A 4C7FA 4LNCA 4LUSA 4ERIA 6XIMA 3UA4A 3JUGA 1B6CA 3CV7A 1VBJA 1W5QA 1C8XA 1DWIM 1MDRA 3FOKA 4ORMA 1XPGA 3ES8A 5LIWX 4D6FA 2EBNA 3C2EA 1OIMA 2W9MA 2ZXQA 5I3FA 2NQJA 3WL0A 1OABA 5HWNA 1RHCA 4ZQPA 3VDCA 2XN2A 3BLDA 3S83A 3T7VA 1SW3A 4ZO8A 4QS5A 3ME3A 1DHPA 4GY7A 5BWFA 5CAHA 1EKOA 2QV5A 3PZNA 3W27A 4HSNA 4JTLA 2D22A 1WOBA 3RXZA 3URQA 1J5SA 4ZTXA 1C91A 3WLMA 5H2ZA 2YLAA 1NFPA 3BZJA 3H21A 3Q4DA 3WF2A 3N15A 5L6UA 4FX7A 3M64A 4S3GA 4WF7A 2ZC1A 4HHLA 1DJGA 3LS9A 4YXGA 3W2MA 1IGSA 2ALRA 3GU9A 4HQVA 1NSJA 1J0YA 2ZXDA 4O52A 1C9WA 1TX0A 1UWTA 3IGHX 2G3IA 1O5KA 3GXTA 2ZRZA 3I68A 3M0MA 1VYSX 3GU2A 4O50A 1QW8A 2VL4A 3P2VA 3RAOA 1Y5VA 1AZ2A 1LLOA 2E0PA 5D75A 8XIMA 4ZE5A 4MADA 2ZX5A 3S6OA 1YPIA 3O5EA 2ZZ7A 4E2DA 1S2AA 1ADDA 2V3EA 3G0XA 1XD0A 4QHRA 3GXFA 3GTXA 1TA3B 1KWKA 5CBIA 4GOAA 3AYSA 2JF7A 4NAEB 1HJVA 3PZIA 2MUCA 3BMWA 4PMOA 3JXVA 5ECVA 1ZLPA 4CVWA 2QZRA 4OV4A 3DHDA 4M5PA 3VDGA 3BLKA 4ODOA 1YTDA 1E9YB 1QPKA 2QYGA 3GXIA 3O2LA 2QUTA 1IZCA 2XFWA 1F3XA 3AXKA 3UY7A 3V7PA 4Z1AA 3C2RA 3NZGA 2PGRA 4AC7C 2XFRA 1XIDA 3LDVA 1PKMA 3CPRA 2A4AA 1E56A 2XSAA 5KZDA 3UR5A 4QJ3B 3U2EA 4LC8A 1UR9A 1DHKA 3MY9A 5IXEA 2ZZ2A 3C0QA 2BY3A 1XKYA 5D4YA 4PA8A 1JG9A 2OEKA 3CMFA 3BV4A 4WK9A 1JZ5A 4KESA 3F5JA 1YYAA 1NEYA 2MLXA 2V6AA 4E4FA 2OTDA 3TQ0A 1CEOA 1K03A 5U4NA 3NFUA 3W7DA 2JBMA 1UUMA 4EF9A 1OX6A 2ZADA 4GIAA 4H6RA 2PBGA 1LQ0A 1EOKA 4DYKA 4LAMA 1JL8A 3R4IA 1E9ZB 5EKYA 2WNZA 2WKLA 1LUCA 4ZL1A 3N6QA 3W24A 3GM8A 4EP8C 4KKXA 1P6WA 2WKGA 2ISSA 2PWFA 3MHUA 1Q7QA 3WLNA 5I02A 3VZXA 3R0KA 1VYRA 1HNYA 1QPQA 1VFHA 4EPBC 4DHGA 1ELSA 1XSJA 1EO5A 3MP5A 1TIMA 4UFKA 4UR9A 1KFLA 4OBRA 1TE6A 2DIKA 4HHMA 3JRKA 3ERPA 1XJBA 4P8WA 4N6FA 2PWUA 4MZ8A 5A6TC 2PPOA 2NQZA 4AZBA 3M0IA 2C6QA 1R9YA 4L4PA 2RDXA 3W88A 3MPGA 3F2CA 1VPYA 4YLWA 5LA1A 4HT3A 1EA0A 2PGFA 2D3LA 2XH0A 2PP1A 2PWHA 2DZUA 2OFJA 3SBFA 5HK4A 4JYFA 3AZRA 3E2RA 3WJWA 4GBDA 4W8LA 3P82A 3T40A 3UG8A 2BBFA 3RRAA 3MUZ1 2X0YA 3MI6A 3G5EA 3WQDA 1GOMA 2BS9A 1OT1A 3WBEA 2EG8A 5CJMA 4TQTA 1YDVA 1OD0A 3WBYA 1X96A 1ZS2A