4MPKA

Crystal structure of the complex of buffalo signaling protein spb-40 with n-acetylglucosamine at 2.65 a resolution
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of the complex of buffalo signaling protein SPB-40 with N-acetylglucosamine at 2.65 A resolution
rcsb
molecule tags Signaling protein
total genus 120
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4mpkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mpkA01
3N1AA 1UHVA 4R27A 3T2QA 4FLOA 1ISXA 4DUXA 4MB3A 4BQ3A 3VGBA 2XWDA 1FFQA 3MMDA 3AJ7A 4N0RA 1GHRA 3EDKA 2PWEA 2BV9A 5E9AA 4BCEA 1WZLA 4XV0A 5A94A 2BS9A 2O92A 4M8UA 4D6DA 1V0MA 4KMQA 6CGTA 1FFRA 3ZJKA 3GBDA 3VD3A 1WDPA 3TTOA 1E1EA 1AVAA 4WSKA 2CESA 2NT1A 4OZOA 3QHNA 2WWDA 2NSXA 2BHZA 3WQ4A 3WIJA 3WL0A 2WM0A 2VRKA 2QF8A 1HKJA 1HP5A 1ISVA 4HA3A 3O9NA 1HNYA 1E6QM 5A2AA 4F79A 1UH3A 2XFRA 4BF7A 4WF7A 2VR4A 3OLDA 5CSYA 2J7DA 1EA9C 3OLIA 4LXFA 4DUVA 3PBGA 1LL6A 2Y5EA 3K4DA 4WKAA 4MAZA 1ODZA 4JL2A 2XSBA 3IAQA 5ABFA 3MSDA 1NWSA 1QHPA 5LYRA 2GFTA 3CMGA 1QNQA 3WNKA 4Z2GA 5HBFA 1YQ2A 3SUUA 5JBFA 2WC7A 4CD5A 2YLAA 1UKSA 3SURA 1GJUA 1KGXA 3PZVA 4GPNA 1V02E 3VVGA 1M7XA 5CLTA 1W1VA 3VOCA 4H41A 4AD1A 3IJ7A 2A3BA 4OBRA 1UKQA 4QLLA 1RPKA 1Q6EA 4ZXOA 4MNLA 2XG9A 3SCNA 1CLVA 3LPPA 1UH4A 2AMGA 2D0GA 3LMYA 1V6XA 4W7UA 1DP0A 1EO5A 1V0KA 3L4UA 4DWSC 3CLWA 1ZB5A 1CGTA 2GVYA 2YA1A 1HF6A 4AEEA 4IISA 2XM2A 1E3ZA 1SMDA 1HIZA 4JKKA 4MADA 1HL9A 1GVIA 2W67A 1JDDA 2NT0A 3O2LA 4MB4A 1GOOA 3DYMA 1PX3A 1JZ2A 2WHKA 3NUKA 1B3ZA 4PTWA 1WP6A 1BVNP 2XM1A 4GI9A 1M01A 4PCSA 3PZGA 1JF5A 1KXQA 2DH3A 1UR8A 3BH4A 2VRQA 1UD2A 3BMWA 4F8XA 4CVUA 1ZBKA 1Q6CA 2WNWA 1H09A 1V0LA 4J28A 3WELA 1LF1A 4P8VA 4NF7A 1WZKA 4B3LA 4EAMA 1ESWA 2DQXA 3NSNA 5CZKA 4NI3A 2YKKA 4MNJA 3WDIA 1V6WA 4DUWA 1J9YA 4H8UA 2WMIB 4M81A 2YL8A 3W6LA 1B0IA 2A3EA 2XVLA 1XGZA 3ZT6A 3BCDA 1OT2A 1MQPA 3FY1A 1VFMA 5HXMA 3CHFA 1OSEA 2WB5A 2GK1B 3WH7A 3ZT7A 2BVTA 1TVNA 3NYDA 3W82A 4F66A 4DWSA 2EEXA 1KWGA 1MW2A 2JIEA 2Q8XA 2WVTA 2EQDA 1I1XA 1M53A 2VCBA 3BCFA 1TUXA 1WZAA 2CXGA 3NSMA 1E9LA 5D9MA 2JF7A 4Z2IA 1OIFA 1TA3A 3GH4A 3WDPP 1J0ZA 5IDIA 2CKRA 4HOXA 3AHZA 2O9PA 5A6AA 3U7VA 2PWGA 6TAAA 4F9DA 3CUIA 4AEFA 5F7UA 5M3WA 1L8NA 4DM2A 2VVNA 2W62A 4E4PA 1VEOA 1KGWA 1V08A 1GORA 5D8ZA 2XJ7A 4AW7A 3KL5A 1UWTA 1JL8A 3PZIA 4N42A 3NSXA 3BGAA 2X1IA 5I3DA 4GXPA 1O7AA 1W32A 3AMKA 3VINA 2WMHA 2ZUTA 3ZQ9A 3ZM8A 5D8WA 3UG3A 1DWAM 5I78A 1E6ZA 3AXHA 1XHGA 4CD4A 1J0JA 4ZE5A 1QOXA 1CEOA 5ABFB 1OM0A 1H4PA 1WCGA 3ALGA 1I1WA 2FGLA 2Y4SA 2ZUMA 4URIA 4BS0A 5ABHA 3SUWA 1ZS2A 3MO4A 3T2PA 1WDSA 3ZT5A 1TG7A 3SCTA 3WNNA 1R85A 1MVYA 4CUCA 4UQEA 3WD0A 3I3BA 1V3IA 2UWFA 1NM9A 5A69A 3L4XA 1L0PA 3II1A 1CECA 1XH1A 4J7RA 4IUGA 4YHEA 3VILA 2VL4A 4W84A 1HN1A 1KQZA 4NZCA 4D6JA 1E55A 1UR9A 2DDXA 3AFBA 2PWDA 3IJ8A 3N9KA 3WEMA 1VFOA 3ECQA 1GOWA 1E73M 3WN6A 5A95A 2ZICA 2RGMA 2BHUA 1V3KA 4CCDA 3DYOA 2J79A 2ZUUA 1M03A 3W27A 2OWCA 4AZ5A 1H11A 1UWRA 1J18A 3AYSA 5I23A 4A3HA 1MFUA 3JUGA 4C7GA 1BYDA 4UOZA 3AS2A 4Z2KA 1CXEA 6A3HA 1CXIA 2GJXA 1M04A 2XWEA 1BHGA 1V6UA 3GYCA 4JAWA 5KEZA 5E6ZA 1UWSA 3AMGA 1EQPA 3RIKA 4YN5A 5JIWA 3SCUA 3OZOA 3FHQA 3VDCA 3B9DA 2J47A 2ZXQA 2ZX7A 8CGTA 1B3YA 3ALFA 3T0BA 2JALA 2OLHA 4X0VA 5FKYA 1FH7A 3FAWA 3BAIA 1E43A 4LPCA 3OZPA 2WKGA 2YA0A 1ZJBA 1H49A 2PWHA 5I79A 3AZRA 4HU0A 1CIUA 4PYSA 2J77A 3T2OA 2AOSA 2DIEA 5A6JA 1EO7A 3MV01 1J12A 1EDQA 5I24A 4HU8A 1C8QA 4DWSB 1UD8A 3QHMA 3OB8A 1JG9A 5C8BB 1VIWA 3UETA 3VGDA 4MAVA 2FH6A 1W3LA 2UY4A 1QHOA 4TVUA 3VIMA 3AIWA 1TA3B 3WF0A 2VVSA 3AZSA 5AC5A 1W9PA 3PZNA 3MANA 4OJYA 1E0WA 3GNOA 5I6SA 1V3JA 3MKKA 3AICA 1UWIA 3ZO9A 4U3CA 1JGIA 1KBBA 1KCKA 5CGMA 9CGTA 2CBIA 3N12A 3CGTA 1GUVA 3U57A 4R5EA 2PBGA 2IXVA 4AZ7A 1X1NA 1ISWA 1MXDA 3MUY1 3GH7A 3NJ3A 2YL6A 2YA2A 1EHAA 2VO5A 1TMQA 3TOPA 1XD0A 1QI2A 4J3VA 4QCFA 2ZIDA 2VZTA 4UFIA 2WCSA 4QFUA 4QP0A 2YBUA 3F4VA 4CD7A 1QHZA 5GNYA 1E6SM 5E70A 1E70M 3QR3A 3VUPA 1W9DM 2E8YA 3A4XA 2FH8A 3VIIA 2EPOA 3WUFA 1H1NA 1V03A 3N15A 1IZJA 3OGSA 1LL7A 2Z1SA 1VF8A 2Y2WA 2E0PA 1HKMA 4LYPA 2ZX8A 4JL1A 1KGUA 4JCLA 3WMSA 3WDHA 2F2HA 5A2CA 3PTKA 1J10A 2V38A 1ZJAA 3U7BA 4FK9A 3SEPA 5GQBA 4PSPA 4HTYA 1J11A 3RJXA 3VD9A 1CENA 5GNZA 3A4WA 2WSKA 2WW5A 1C93A 1G94A 1OB0A 5FL1A 3VM5A 1ZU8A 1UD3A 5KZ6A 1LL4A 3SIMA 4U5IA 3L4TA 4BA0A 1CXFA 1HKKA 3VTRA 3SCQA 3CZEA 1Z32X 4HZ8A 4PRWA 3THDA 3THCA 5CQ1A 2DEPA 1VBRA 3U5UA 3SCRA 2XTKA 2G3IA 1UD4A 3WEZA 4MJ2A 5AYIA 5A2BA 1JIBA 3OGVA 2CBJA 3WDJA 4MTVA 2DIJA 3DHUA 3S6TA 4W5ZA 2PF0A 4P7NA 5DFAA 2JIWA 3WD2A 4TTGA 3ZMRA 2WKLA 1UUQA 1TCMA 3AROA 2DT3A 2WMGA 3VPLA 1UR1A 4ZEPA 1UG6A 3CHCA 1CNVA 1OD0A 2J7GA 2J74A 3PZOA 2GJXB 1EGZA 2CPUA 3D5HA 3AXIA 2DGAA 2EO7A 3ARWA 5ABGA 1KR0A 1IV8A 5LA1A 1KFWA 3M07A 4AZCA 3W6MA 1MQQA 3EYPA 1JXJA 2JE8A 2A3HA 4BQ2A 2YBTA 4AD0A 1CTNA 2UY2A 2W61A 1HVXA 3MSGA 3VMNA 2IUZA 3EDFA 5DMYA 1FH8A 5DO8A 1VJSA 2ZX9A 2OWXA 2EPNA 3WQWA 5E6YA 2D24A 3WNLA 1FHLA 3D3AA 1DWGM 1HJUA 3SCSA 1TE1A 3KL0A 1HX0A 4TUFA 1A47A 3PZTA 3GM8A 4P8UA 3WQ6A 3VMOA 1KXVA 1K6AA 1UA3A 5DF0A 5DT7A 1UR0A 5M5DA 1X6NA 1XYFA 3WD1A 3VIKA 3AS0A 1KR1A 3FW6A 4AWEA 1KQYA 2G4FA 2O9TA 1W1PA 2VX5A 2V3DA 3AHYA 1VAHA 1HKIA 1W9UA 1GCYA 3WBEA 3ZJ8A 1X6LA 1E4LA 2V3GA 4U33A 1W9XA 1HP4A 3G6MA 4CVWA 1CDGA 4HZ7A 2D2OA 1C7TA 2OYKA 2WVUA 2E40A 1JF6A 3G6LA 3CUJA 4J3TA 1OIMA 1H5VA 3VGFA 1B9ZA 4PMVA 5FL0A 4ACZB 1US2A 1J0IA 1C8YA 1W9BM 3W4RA 4RL3A 2BXYA 2HISA 4UQAA 2EPLX 4AZIA 3PHAA 3CUHA 1E5NA 1NOWA 2WHMA 3W26A 1UD6A 1TFVA 1QNSA 3AYRA 4L4OA 2J62A 4WK9A 4S3JA 4B9YA 1D3CA 1CYGA 4S3KA 5BRPA 4HZ6A 2WMFA 4EE9A 3QHOA 4J3XA 2MANA 3S2CA 3U5YA 5HDRA 3FHAA 4ZE4A 5C71A 4HMEA 1C3FA 4KGJA 1WO2A 1PPIA 2JF6A 1WDQA 1PJ9A 1NOFA 3CUFA 4KWUA 4ACYA 3SUVA 5M03A 3EDJA 1BSIA 5IXEA 5CXPA 2FHCA 4X9YA 3A6OA 2WXDM 3VIPA 4UZSA 4W87A 1G9HA 2EPMX 3PZQA 3B8SA 1BG9A 3LPOA 8A3HA 3W38A 5HPOA 3VKKA 4PMYA 3ZR5A 2VX7A 2NW0A 2PI6A 3NDYA 5D9NA 3PN8A 2WC3A 3RJYA 3BXWA 1RP9A 5CLWA 3AOFA 1US3A 2WMJA 2TAAA 4UCFA 5DT5A 5JH8A 3PZUA 4YPJA 3T09A 2X09A 5E0FA 3HU7A 3B9EA 2C8NA 4PUEA 1J0KA 1QI4A 1ZBCA 4PMDA 1UWUA 3AMLA 2X05A 3CZKA 3BLKA 4PTXA 4PMZA 2ESCA 1B3VA 5EBAA 5BXSA 1U2YA 4TVDA 4H8HA 2D22A 5JUVA 4HMCA 1XH0A 5ECUA 1JNEA 2E9MA 1SYTA 2WVVA 4AZCB 5BXRA 3WQVA 4MJ4A 2VI0A 4GKLA 1TZ7A 3ARVA 3F5LA 3LPFA 4AD5A 3DYPA 3TA9A 1TVPA 2WC4A 4AY1A 3RM9A 2CKSA 2XHYA 3A4AA 1CZ1A 1BTCA 2O9OA 1K9FA 1AQMA 4LYQA 3WUEA 2DT2A 3NCOA 2ZXAA 2GDVA 3M46A 1VFUA 4ATLA 3W25A 4CU6A 4K68A 1CGWA 3WFZA 1GZJA 3WUGA 4B15A 4QLJA 4UFJA 1E56A 2W91A 4IPNB 1B3XA 3W29A 5A8MA 3CHEA 3OIHA 3GTNA 2WZIA 1JD9A 1HJSA 1BGGA 1CWYA 1E0XA 4PMXA 1FOBA 3WY1A 3W24A 3WD4A 2B31A 4M80A 1BYBA 4AIOA 3W0KA 1CLXA 1E72M 2JEPA 1NWTA 1E6PA 2VCAA 1UWQA 4AD3A 2X0YA 1WZMA 3EBVA 2ZX5A 2QLYA 4D6CA 3W37A 4MNMA 2ZUSA 4PMRA 5CPQA 2O9RA 1E5JA 1MW3A 5GPRA 2J75A 1QBBA 2ZUNA 1W2PA 1WDRA 2QHAA 1G5AA 2XVKA 5IHRA 1WAWA 4CD8A 4PSRA 4E2OA 1HT6A 2CEQA 4B16A 2D3NA 3OGRA 3HJEA 1H0IA 2WWCA 4LX4A 1DWFM 3L4WA 2D23A 3MMWA 4AD2A 4AMCA 4UFKA 3WQ8A 3PZ9A 2WLYA 2QV4A 4PUDA 5A1AA 1V3LA 2WCGA 5IHSA 1JXKA 4ATWA 4D71A 4PMNA 1ISYA 3ZSTA 1IZKA 1C91A 3CH9A 2OSXA 2W92A 2E4TA 3VIJA 4GQQA 2VX4A 4J3WA 4W8AA 2VUYA 1GHSA 2E9LA 5A3HA 1MYRA 2YIHA 3RDKA 3F5KA 1A3HA 3N04A 4L4PA 1V3HA 4TXEA 4CKQA 4J3SA 5IFPA 1W3JA 2DPEA 3BAJA 1JYWA 3VGGA 1XV8A 5IFTA 4LYRA 3WH9A 1K9DA 2QMKA 4W88A 4U3AA 2BY1A 3BAXA 1PX4A 5FCZA 5EB8A 1DWJM 4FLQA 3T0DA 5M17A 3BAWA 3N17A 1LLOA 1JYVA 2PB1A 3I3DA 3VIGA 2CITA 2VNCA 1NWRA 1OGSA 3KEHA 4KGLA 4WJXA 4GZEA 4U2YA 3UERA 4CN6A 1HJVA 2G3JA 2QMJA 4MPKA 1JD7A 3MV11 1DWHM 2EBNA 3K46A 1NARA 3AMDA 3A3HA 3A47A 2CBUA 1W91A 3ZOAA 2C0HA 5BXPA 2C7FA 1V6VA 2RGLA 1XD1A 5AY7A 1GPFA 2VJXA 4ZFMA 1B31A 1UZ4A 3GXDA 4NRSA 4V28A 3IK2A 5AC4A 1BFNA 3WH6A 3MU7A 3WD3A 1ITXA 1UYQA 2D0HA 1PAMA 1K9TA 3CMJA 1UH2A 1C8XA 2XPKA 1EHNA 1NOUA 3TTSA 2J25A 3FXYA 5A6BD 2DSZA 5FD0A 2WYSA 2BNJA 3VNYA 1EOKA 4GI8A 4V27A 2WVVB 3SCPA 4JKLA 2J8FA 1W9VA 1WNOA 2ZXDA 4P7LA 4HMDA 3RPMA 3POHA 2WMKA 3UCQA 1XRVA 1H2JA 4Z2JA 4CN1A 5JBDA 1RH9A 3CZJA 2FHFA 4M56A 1C90A 2PWFA 3AIVA 2YJQA 1C7SA 2WHJA 3EDEA 4TTUA 5CG0A 1QNRA 1B30A 2VT0A 2YDRA 4EANA 1E71M 3L4ZA 2E8ZA 3VO0A 1Q6GA 4ACZA 2V5DA 1Q6DA 1E6NA 4W86A 3GDBA 1JYXA 4HPGA 2Y8VA 3GZAA 4PEEA 5CGTA 1UQYA 4OOUA 1V6YA 4MDOA 4P8WA 1JYNA 3WDQA 2G8ZA 3GBEA 4UFLA 2AAAA 2WZHA 1UKOA 4H7VA 4FLRA 3KWXA 3ZR6A 1E4NA 4AIEA 2JEQA 4AC1X 3WMBA 3OBAA 1BVZA 4WLCA 2GSJA 4HP5A 4KH2A 2V3EA 3VX1A 3VDAA 1LWJA 4AZGA 1JDAA 1FP9A 5BCAA 4W89A 1W2VA 1CGVA 2CIPA 2CERA 3WFLA 1ITCA 3T0AA 1QI0A 4BZYA 5D9PA 5FOOA 2D0FA 3UEQA 4RE3A 4UQCA 1BLIA 4D6FA 1WB0A 1E6XM 1S46A 2ZUVA 5CJ5A 1CXKA 1GQKA 1E15A 4W8LA 2VZUA 1XSKA 4CCEA 2PC8A 3L2LA 4CCCA 2X2YA 3VNZA 4UOJA 3TONA 2D1ZA 1VBUA 3CUGA 3AI0A 4AZ6A 1RP8A 2VZVA 4H04A 2CBVA 2A3AA 1GQIA 2YL9A 3HN3A 4PTVA 4XX6A 3ARTA 3QOKA 1GNXA 4HA1A 3I3EA 3WF2A 5TD4A 2DSKA 5A6KA 4M1RA 2XFFA 4PTMA 3MUAA 1OD8A 1Q4NX 2CYGA 4FF5A 2QPUA 4W7WA 2VX6A 2VZOA 5LA2A 1PBGA 4KRTA 5I0DA 3DHPA 1JI1A 1JAKA 3TTQA 2Y8KA 2WCAA 5BROA 1CGXA 1F4HA 7CGTA 1GW1A 2XVPA 3L2MA 4UR9A 3AIBA 4JHZA 4WKHA 4P7QA 4XUYA 1KXHA 3GXFA 1QI3A 3N11A 1VFFA 4JFVA 4CN4A 4F9JA 3K8LA 5A6LA 2YOCA 4UFMA 4CU7A 1XH2A 2UY3A 1JNDA 3RO8A 2J8GA 3CZLA 5JBEA 1ZBVA 4M82A 1MWOA 2E9BA 1VJZA 2J7EA 2HVMA 3CIVA 1EQCA 4GIAA 2FGZA 3EMZA 4MNKA 4Z2HA 1N82A 2V3FA 1V0NA 1GONA 1JAEA 1Q6FA 4A3YA 3APGA 4PMQA 4U2ZA 2BVYA 4GQRA 1B90A 4IPLA 3ARZA 3AIUA 4ZENA 3VD5A 3RM8A 1JZ8A 2WANA 2ZX6A 3AISA 1NP0A 3WDRA 2X8RA 4GO9A 3VDHA 1JZ4A 2GDUA 1GJWA 1TR1A 4P8XA 3MUZ1 1B3WA 1UKTA 2VMFA 2BHYA 3KL3A 3PTMA 1UKPA 4XZWA 5A6MA 3WL1A 3RM4A 3AHXA 1QVBA 4AZBA 1FP8A 3BC9A 1MFVA 1E6RA 2DSVA 4GINA 4JKMA 3GXMA 1VEPA 1K9EA 1UD5A 2XYLA 2BY2A 2VCCA 3LPGA 1AMYA 1UR4A 5JIPA 1EIBA 3ARXA 1BQCA 1BYCA 3OG2A 4WIWA 1JI2A 3BSHA 4CU8A 4MB1A 1LWHA 3WNPA 4HA4A 2XIBA 2WHLA 2GUYA 5ABEA 1PIFA 2VQTA 2J7HA 4XB3A 1ECEA 1BG4A 1EXPA 4UOQA 4QDMA 2DSWA 2J4GA 3AZTA 3GXIA 1UQZA 4E8CA 5A8NA 2ZE0A 5HNNA 3J7HA 3W81A 1GQLA 3MMUA 4W85A 3HMCA 4BQ5A 2BY0A 2VC9A 2Y24A 1ZL1A 2BXZA 2D20A 1V02A 2VQUA 1R7AA 2OSWA 2EXOA 4EK7A 1C92A 2VOTA 3M6DA 4ZXLA 1DHKA 4BQ4A 1LJYA 4HPHA 1XCXA 1E3XA 1R86A 2W66A 1EDGA 1Y7VA 4AYSA 4UTFA 2J7FA 1U30A 4W93A 3N13A 2EPKX 2EJ1A 1HJQA 3QGVA 3SUSA 2CCRA 3ZJ7A 2G41A 3RCNA 1U33A 4M24A 3N18A 1VB9A 3BSGA 2WLZA 4X0NA 1PIGA 5CSUA 4AISA 1EOMA 4TX6A 2Z1KA 4D72A 1BYAA 1AQHA 4DWSD 4D1IA 1KXTA 1IT0A 1D7FA 5CPTA 4UQ9A 3GNPA 1XC6A 3ARUA 3BLPX 3NDZA 3DC0A 2CHOA 3VDBA 4JFSA 1DWIM 3UESA 3GNRA 5I2UA 2YL5A 2VTFA 4IM4A 3CZ8A 3IJ9A 1JDCA 5LA0A 2ZWYA 1KB3A 3AQUA 4V2XA 1LG2A 1GVYA 1ZBWA 3AMCA 3PZMA 3AHVA 1OT1A 5HOSA 1HVQA 2FDMA 4PMOA 3VIHA 4W8BA 2BVDA 4KRUA 1B2YA 3VX0A 1QW8A 1E4MM 3CBWA 4UFHA 4DM1A 5A8PA 1OBAA 1E40A 4TVCA 4MB5A 5A6SA 2VR5A 4UNIA 1H3GA 4J27A 4WSJA 1NH6A 2D3LA 1JZ5A 3F5JA 1J0YA 2OWWA 1P6WA 1PEZA 1HJXA 5D4YA 3W53A 1PX8A 3FAXA 4JFWA 4P7RA 3CHDA 1EDTA 1AQ0A 1W3HA 2OSYA 3VD4A 1KWKA 1D2KA 1CBGA 2XGBA 3AIEA 4OBSA 1LQ0A 1CXHA 2G3NA 2XIIA 2CHNA 4PMUA 3L4YA 1KCLA 2ZUWA 3BAKA 3FNDA 2FHBA 4H2CA 1FH9A 3NIYA 3CPUA 2VZSA 4JFTA 2GJRA 3WNMA 3K8KA 2YDQA 1GOKA 2IXUA 3SCVA 1MXGA 4U31A 4UZUA 1HXJA 2G3MA 1PZ2A 2V5CA 4OUEA 1OGGA 4M29A 4JHOA 1OCQA 4LGXA 4W5UA 1BF2A 4PBGA 1O6IA 1QI5A 1B1YA 2WVSA 3EMQA 3ARSA 3WMCA 1QPKA 2W4XA 1R7OA 3VIFA 2XVGA 2E3ZA 2X0HA 1E0VA 4Q22A 1BGAA 4Z2LA 4J3UA 4OKDA 3WEOA 1GOQA 4GZIA 5EFDA 3TTYA 4A4AA 3KE0A 2JFEX 1FA2A 3CTTA 1JZ6A 1E1FA 1GOMA 1XSIA 3CZGA 1CPUA 1R87A 2J78A 5CPSA 4GZJA 4HOWA 5C70A 3QOMA 4LQ1A 4D6HA 4NSBA 3OLGA 1JFXA 1F4AA 4ATDA 1SR0A 3ZIZA 4HOZA 2A3CA 1PZ3A 4Q7NA 1XCWA 1CGUA 4AZHA 4D6EA 4EKJA 3O6AA 3WF3A 1G1YA 3MS8A 3GH5A 1BAGA 3VD7A 3ARRA 1J0HA 4CD6A 2YDSA 3ARQA 1KBKA 3E1F1 3AIQA 5E09A 1W1TA 2VRJA 1UA7A 5BXTA 1VRXA 3AIRA 2F8QA 2OYMA 1R8LA 1QNPA 1G0CA 3EDDA 1UOKA 3FN9A 4QCEA 4UQBA 5BRQA 4D6IA 5FIPA 2GJPA 1J01A 2YLLA 4AXNA 1SMAA 4QLKA 4JIEA 1W1YA 4TOQA 2XFYA 4UQDA 3TP4A 3OA5A 4H8VA 4AIUA 2CNCA 4D1JA 3ARPA 3POCA 5E0CA 1CXLA 5I77A 5A8OA 4QAWA 4OIFA 1HJWA 2UY5A 1JZ7A 1WKYA 4Y7EA 3WF1A 1EH9A 4YHGA 2ZOXA 1G01A 2CETA 5AYBA 2XVNA 4RE2A 5EFFA 3WH8A 3IAPA 3IANA 3WBAA 4C7FA 2QPSA 3UR8A 1OWQA 2DH2A 5A6BA 7A3HA 4PCTA 1DTUA 1VEMA 4WKFA 3VMPA 2OYLA 3VGHA 4C7DA 2BFGA 2PBOA 3RMEA 3L4VA 1HL8A 1ODUA 1QBAA 1XSJA 1QW9A 4JCMA 4PN2A 4TX8A 2WAGA 3WUBA 2BY3A 3RILA 3AHTA 3MUIA 4RE4A 5HPCA 2ZWZA 2XSAA 3K8MA 3AS3A 2W63A 1MQRA 3AS1A 1MW0A 1NWUA 2WZEA 3WNOA 7TAAA 1RD6A 3K4AA 3UG4A 3SCOA 2XGIA 3SCWA 4JFUA 1NP2A 3WH5A 3AXXA 1JFHA 1OGBA 1GQJA 1XYZA 3BAYA 3WSUA 3OLEA 4MDPA 2J7CA 2WK2A 3ZJ6A 1I75A 1UR2A 3SUTA 2ZXBA 1LG1A 2DT1A 1MW1A 3ARYA 3CO4A 3UR7A 3KZSA 2W5FA 2WBGA 1QNOA 1UZ1A 4P7OA 1NQ6A 4GI6A 1WE5A 3ZSSA 4E8DA 1DEDA 1BPLB 1ISZA 1VENA 1V3MA 5I5RA 2VURA 1OINA 4W7VA 1WPCA 4GO8A 4NRRA 3VGEA 5DEZA 2F61A 5GNXA 5D9OA 3K1DA 3WKZA 2WPGA 4B3KA 3BMVA 3M7SA 4U5KA 1JZ3A 2WSPA 2XUCA 3W28A 4XZBA 4FLSA 3T08A 3B9AA 3PTQA 1E4IA 1H0GA 4D6GA 3DECA 3WQ5A 3UG5A 5BWFA 5EMYA 3VU2A 3WENA 4FMVA 2WMIA 1SFSA 3EMCA 5A8QA 1H41A 1FHDA 2J7BA 4ML4A 3VM7A 4B9ZA 4AD4A 2DT0A 5BYWA 1YHTA 1W3KA 4OOZA 1GOIA 2WBKA 2DSUA 3VIOA 2GK1A 4CGTA 4JZ5A 3WF4A 1CGYA
chains in the Genus database with same CATH superfamily
3N1AA 4LAZA 3T4WA 1ZCNA 3A23A 2HXTA 4FLOA 3G0XA 3W74A 5T26A 4N0RA 3PPHA 3M4HA 2PD5A 2BV9A 4BCEA 5A94A 2KO7A 1V0MA 1T0OA 5B8IC 1FFRA 4D8ZA 3ZJKA 1WDPA 3LQGA 2OEJA 2NT1A 2Q71A 4O12A 1CI1A 4R53A 1XINA 3JR2A 4HBEA 3QV7A 2WWDA 3ATYA 1REQB 3DKLA 1A0CA 2ACUA 5H8PA 3WIJA 3FVMA 3SY1A 4WHBA 1TQXA 2J88A 3FSUA 3BLOA 4HA3A 1E6QM 3HFTA 2QNEA 3RX4A 1EZ2A 2E28A 2ZRWA 4NXSA 1TE6A 3SGGA 3UXKA 3GHSA 5CSYA 2P3ZA 2E5BA 3PAJA 3I68A 3SGZA 3KACA 4FXSA 2XIMA 4WKAA 4MAZA 4FAMA 3BL3A 1VS1A 5LGXA 2PPGA 1RXOB 2XSBA 3MHUA 3QQ1A 3SZ8A 3IAQA 4IQLA 3A9BA 3UGRA 3MSDA 3GHRA 3NVDA 1QNQA 4Z2GA 3SUUA 1P1XA 4NG3A 3PSVA 2YLAA 3LRMA 1KFJA 5DBUA 1FKHA 3RRAA 2HQAA 4US5D 4GPNA 1V02E 1QJWA 2IPGA 2XPBA 4J4KA 4OBRA 4XAYA 1UKQA 3GUWA 1Q6EA 3C2VA 3PK7A 4ZXOA 1CLVA 3PA7A 3CEUA 2D0GA 1TV7A 3O5OA 1IGWA 4IL2A 4EX4A 2O7SA 1OFPA 1HF6A 3QTGA 4WVXA 2XM2A 4C1NB 3UJFA 1QPLA 1E3ZA 3B7XA 3CTLA 3EOUA 1EWEA 3HO8A 2W67A 1CLKA 2R14A 3MWCA 1ZNNA 2WHKA 3B04A 3NUKA 3V7PA 4ODLA 1WP6A 1BVNP 4XD5A 2C79A 4UMBA 3LOTA 2ZFAA 4O54A 3HGSA 4ICCX 4PCSA 1JF5A 1YRRA 3WK1A 2DH3A 4YMZA 3ID7A 1UR8A 3RN6A 4ERGA 3PVFA 2QCEA 3WK2A 5LIWX 1AJ0A 4CVUA 4NYYA 2GQ9A 1Q6CA 3S1GA 4JTRA 2CHRA 4IQJA 4LVBA 4LEFA 3TYDA 1SZFA 4HVXA 2IKGA 2PCEA 1V7YA 3UYCA 5IM51 1LF1A 4NF7A 1WZKA 4B3LA 4EAMA 1ESWA 2VC6A 1B54A 2V2HA 1J9YA 1KM0A 4KEVA 3KHJA 5CZTA 3W6LA 3CNYA 1XGZA 3CHFA 3HM7A 2O4MA 1ONEA 1FKFA 4F66A 4QZVB 1K7FA 2JIEA 4UNKA 1ZCOA 2C19A 3VOJA 3VKAA 1POJA 2VCBA 3IACA 5C5YA 1EXBA 4Z2IA 1TA3A 5LKYA 3W1LA 1DTNA 3OHIA 2PPNA 3WJYA 2PRLA 2NXHA 4DPQA 4HOXA 1NAL1 3SN0A 3U7VA 3QMRA 4BWLC 4F9DA 3K4WA 3P5ZA 2F84A 3C2RA 4MFDA 2VVNA 4L61A 4OQVA 2BGQA 1BKSA 1BF6A 1EFZA 1HKWA 3O5KA 1KTCA 2YX0A 5EBUA 3WQEA 1OQFA 2X1IA 3WCZA 4LAYA 4ZO9A 4Y8FA 2WMHA 3O63A 3MZ2A 3ZM8A 1R30A 1SO6A 3GNDA 3NEHA 4F0RA 1S5TA 1E6ZA 3ZZ1A 4ZMGA 3PRBA 5TNVA 4C1KA 3TROA 3Q4DA 1CEOA 1ML1A 1K6WA 1OM0A 2KX9A 2FAPA 1PIIA 3EA3A 1WCGA 3ALGA 2FGLA 2YDAA 4BS0A 3V3WA 2AL1A 4NNAA 1WBHA 3SUWA 3P8IA 3ZWTA 1WDSA 3GFZA 4EACA 2J9ZA 3ZT5A 3TR2A 1TG7A 2HBXA 3FEMA 2ON3A 2YXOA 1AL8A 5FSEC 2BG5A 4U86A 3I3BA 3V0TA 2UWFA 3SQLA 4GISA 1NM9A 4IMEA 5A69A 3L4XA 1GYLA 2P88A 4O8AA 1S5VA 1XH1A 1DJHA 1X7FA 2VGFA 2DDXA 2OQLA 1FKKA 4XVDA 3WEMA 3P81A 3IJQA 3T78A 2GVGA 1B3OA 1VFOA 2BMBA 1OCNA 3SIZA 1SW0A 5A95A 2PDGA 4WDUA 4ZCWA 4NAFB 4C6IA 1W5QA 4Q8UA 1XI3A 4JTLA 2VFHA 2J79A 2ZUUA 4U84A 3SB0A 5BOEA 3ERPA 2HE5A 5FJOA 4TMBA 5T9CE 2F23A 1PKNA 1Q3NA 1MFUA 3JUGA 5FI8A 4UOZA 3AS2A 2ZA1A 1QPQA 4Z2KA 1FXQA 4H01A 4A8NA 1FHUA 4ZQMA 4FO4A 1MDRA 1DJNA 1BHGA 3TA6A 3T4CA 3GYCA 1XUUA 2OQHA 3RIKA 1TX0A 1VYSX 3SCUA 3FHQA 1L6YA 3B9DA 3VDCA 1R38A 3NTYA 2PDBA 4DB7A 2I9EA 2OLHA 5LHEA 5FKYA 4RW5A 2PGRA 3FAWA 1E43A 4K6AA 2WKGA 4ICMA 5J04A 5I79A 4UIOA 2PPPA 4HU0A 4O13A 2J77A 2O55A 4NJGA 3VNJA 1QATA 3DFOA 2WPBA 2E6AA 3W1TA 1J12A 3QH2A 5ABTA 3OA3A 4DWSB 5C8BB 2NV9A 3VGDA 4TQTA 1JPKA 1DXFA 1W3LA 3MO7A 1JVNA 2UY4A 5C9ZA 2VVSA 5AC5A 1W9PA 3GNOA 3KM8A 4LUSA 5I6SA 1JPIA 3PG8A 4IICA 4E4FA 3MKKA 3PS7A 3N3MA 4U3CA 3H24A 3NL5A 2CBIA 2QCGA 3CGTA 3WJZA 4R5EA 2Z1VA 1XIJA 1XIFA 2IXVA 4AZ7A 1X1NA 1ISWA 3G18A 3R12A 1VR6A 1YW1A 5GJNA 1XX1A 2XH4A 1EHAA 1O1HA 2VO5A 3QN3A 1TMQA 3TOPA 1XD0A 1QI2A 2VFFA 3MJYA 1IEWA 5HNTA 2OLSA 1OK4A 3H22A 4IIBA 2QCCA 4QFUA 4M6QA 4QP0A 2YBUA 4QM1A 5GNYA 4OU1A 1E70M 3QR3A 3VUPA 4KIRA 3G1XA 1AH4A 2PDUA 1QUMA 3VIIA 3G22A 2EPOA 3INPA 2G37A 2Y5SA 2MLZA 3QBUA 3BV7A 1HKMA 3KCEA 1A80A 2Y1HA 3EWWA 1GEHA 5ENLA 1KGUA 3BWWA 1TPFA 5KZDA 1T96A 3WMSA 1Y5WA 4HA0A 1DHPA 3I7QA 4FK9A 3BLLA 3UWZA 2DUXA 4HKPA 4HTYA 3H26A 3RJXA 4W9OA 3QYSA 2OFNA 5M1TA 1G94A 3S4TA 5BOOA 4PA8A 3OZMA 5AYZA 5KZ6A 3SIMA 4ZFCA 2PTDA 1CXFA 2PDHA 4KS0A 4E38A 4WDTA 3O5FA 1Z32X 4HZ8A 4L56A 3MYPA 3THDA 3M0MA 3THCA 1VBRA 3RX2A 3MZNA 2XTKA 3WQOA 1O12A 1OF8A 4AF0B 4MJ2A 2WNZA 5A2BA 1QZ2A 3UNTA 4IJCA 3LCFA 1KFCA 2PF0A 3M6YA 3ITXA 3U2OA 2E25A 4AY8A 3GLCA 1C9DA 3ZMRA 2HNEA 3R0UA 3TJXA 3SECA 3DGRA 4R9XA 3GDKA 5AHEA 5MKGA 3VPLA 3H4WA 1Q8AA 3WYZA 4ZEPA 4WY0B 2KR7A 1UG6A 1MNSA 1RLCL 2J66A 4DYEA 3PZOA 1EGZA 2CPUA 3KBWA 4HU4A 3AXIA 4TNSA 1KKRA 1H50A 1KFWA 1CW2A 3UXAA 4AZCA 3BGJA 4LBRA 3EYPA 2YBTA 3B03A 2L2SA 2W61A 3VMNA 2IUZA 3EDFA 4I8DA 4V15A 3MBDA 3FJ6A 5E6YA 2D24A 1RUSA 3WNLA 2MUCA 3GR4A 3D3AA 3UCDA 1HJUA 4GJ1A 4WXYA 3STEA 3PJXA 2PEVA 3GM8A 2XPAA 3B0YA 1GOXA 3A64A 4ZSTA 4BKNA 3W7LA 4D2JA 3I6CA 2FMNA 3CV6A 1AJZA 2BWGA 3PULA 1X6NA 1FWBC 4JX5A 4WY0F 1H5YA 5TQLA 3I10A 4AWEA 3IK8A 1SFJA 4MWAE 2VX5A 3AHYA 3R94A 3LRKA 1VAHA 3GXPA 1HKIA 3ZJ8A 1X6LA 1PUDA 1W9XA 1HP4A 3MA8A 5B7ZA 4TYOA 1CDGA 1EYWA 5CC7A 3OG3A 4H19A 4DI8A 2OYKA 2WVUA 4K7VA 1K1DA 1OIMA 1JEZA 3VGFA 2ALDA 5FL0A 3B0XA 4M1BA 1A5BA 1U5JA 4XO6A 3MKCA 2W0UA 4O0KA 1YATA 2VEIA 2EPLX 4AZIA 3CUHA 3UQBA 1R2TA 1NOWA 2H9AB 2WHMA 3W26A 1QNSA 3AYRA 3O1NA 1H62A 5D2YA 4DAIA 4GK8A 4IIFA 1Q85A 4E2BA 3WMLA 1JDEA 5BRPA 4HZ6A 2WMFA 3RLHA 1E1CA 1GKRA 2YW4A 1TV3A 4J3XA 2QF7A 3TOYA 4ZE4A 1C3FA 3QXBA 3BO9A 1WDQA 2NQJA 3CUFA 3KWSA 3P84A 3SUVA 2FHCA 5FF7A 3TSMA 3A6OA 2WXDM 3R89A 1XW8A 1G9HA 1GYNA 1BG9A 3KTCA 3LPOA 3TC7A 8A3HA 4DJFC 5HQEA 5D09A 3VKKA 3VZYA 4LS0A 1NEYA 3QPZA 4K38A 5KZEA 1HZYA 3RJYA 3BXWA 2OT0A 3W1QA 5CLWA 4ODNA 1TZZA 4ZTYA 4K8GA 3ZFHA 5CZSA 2DJLA 2I5GA 3T09A 4IIDA 3M44A 2C8NA 3W85A 2AQVA 2HZGA 2Z4GA 4PTDA 4EOUA 2P50A 4IXXA 2Y88A 4LWWA 4AH7A 1ZBCA 1XBVA 4PMDA 1UWUA 1WA3A 3JW7A 1XC4A 3GFYA 4PTXA 3MJMA 1HO4A 3IGHX 3TW6A 4IMGA 5BXSA 1FKGA 3CK5A 3LLFA 1XH0A 2JQXA 3LSCA 3R6IA 1ICPA 3PNUA 1G4PA 5BXRA 2E7FA 4MJ4A 2VI0A 4GKLA 2HS6A 2Z1BA 3ABSA 4NNBA 4XBSA 3ARVA 1GEQA 3LPFA 1TSIA 4AY1A 3DXIA 3IUDA 4ZOBA 3LCXA 4UDMA 1AQMA 4LYQA 3W7JA 2G5WA 4BEUA 3M46A 3DKJA 3GNNA 4ATLA 4YU1A 2X16A 3W25A 4L1GA 3WFZA 1KFEA 4A35A 4B15A 4QLJA 2REQB 4UFJA 2W91A 3A5VA 5LNRA 3W29A 1YPFA 3UYIA 3LTYA 1THFD 4JIPA 1Q2RA 1TPH1 4UTWA 4XAPA 1FWNA 3IJDA 1V51A 3WD4A 4M80A 4AIOA 4R7WA 2WNQA 4IG2B 2JEPA 2J6XA 1F8AB 3ANVA 4ONVA 3G1SA 1I2QA 2QLYA 3W37A 5CPQA 4CQ8A 4US6A 5FJUA 5GPRA 1KCZA 4XD3A 1WDRA 5HWMA 2QHAA 1G5AA 5CZ0A 2CEQA 1FKIA 2D3NA 3KBNA 3KRUA 3OGRA 1ALDA 3VI2A 4LX4A 4IJRA 3W76A 2D23A 3N6HA 4AMCA 5G2HA 4GYJA 4PUDA 2ZQVA 3GUGA 4ODKA 3DEQA 1H63A 4ATWA 4D71A 2QR6A 4AB4A 1ISYA 3LA4A 3LEPA 2OX1A 1XGDA 1OC5A 2CXEA 1U79A 2DUAA 1MYRA 3B8VA 1J8VA 3IV8A 3CUXA 3N04A 4L4PA 2QJGA 1W3JA 1ZQ5A 1K77A 4FX6M 3W87A 3VGGA 2A6NA 3FS2A 2TPSA 4UBPC 2DV0A 2QMKA 3H7UA 5HJXA 1YNYA 4ZQNA 1P0KA 5EB8A 1DWJM 1T40A 1AMKA 3CB8A 4LC6A 4AX7A 3I3DA 4GMEA 3MT1A 4K37A 4C6JA 3U2ZA 3HV9A 3UERA 4GZEA 4TV6A 2QMJA 3A9IA 4MYAA 3TU9A 2QJMA 1IF2A 4JY9A 1DWHM 5DANA 1NARA 3AMDA 3DFTA 2WOQA 1W91A 3ZOAA 4CNPA 4U85A 4QX4A 5BXPA 2RGLA 1XD1A 4ZFMA 4WD0A 3LGDA 1J79A 3GXDA 4NRSA 3QQWA 1QOQA 3QY6A 4FALA 4L72B 1ITXA 1UYQA 1N2VA 1F40A 1DV7A 5JU6A 5IBXC 3VA8A 1AW5A 4GX9A 1FWWA 1HGYA 4S2CA 1I60A 4FX7A 1P5BA 1RV8A 5TAOA 3DDMA 3VNYA 1EOKA 4GI8A 4V27A 1OK6A 5HW6A 4JKLA 3KCLA 4P7LA 3Q58A 1G69A 2Q8ZA 1RLDA 4F40A 4LY4A 3P3BA 3POHA 3UCQA 1XRVA 1H2JA 1F74A 3CZJA 3GTFA 3L66A 1C90A 3M0ZA 1QPFA 3EDEA 4TTUA 5CG0A 1DJQA 3LUTA 1Q6GA 4TU1A 4ACZA 2V5DA 4O15A 5LIYX 2V82A 4E6MA 1Q6DA 1LUCB 3TC6A 3GZAA 4RNJA 5CGTA 1XXXA 4P8WA 1JYNA 3WDQA 4UFLA 2WZHA 2ANUA 3KWXA 1E4NA 3GD6A 2Z1XA 3RRXA 3RX3A 4AIEA 2JEQA 4AC1X 2O4QA 3OBAA 1FAPA 2PRHA 2GSJA 2CWNA 3WLKX 4ZGYA 2GZXA 3OVQA 4ILSA 1MEWA 4ROQA 7REQA 4E4UA 4MLRA 2ZVRA 4AZGA 5EU9A 4W89A 5G5IA 2QVHA 2HTMA 1Z3NA 3TFXA 3NURA 4H9XA 4W9PA 3UA4A 2WKJA 3VZXA 1EWDA 2OKOA 3UPWA 5HUAA 1NDWA 1U1JA 1A7XA 4MSPA 3R58A 3NA8A 4W8LA 1XSKA 4CCCA 3WBXA 3URNA 2X2YA 3PPGA 4RK8A 2HK1A 3TONA 2W27A 3AI0A 2E6YA 2A3AA 3HN3A 2YL9A 4YVVA 1G4TA 2Z6IA 3QOKA 3I3EA 3T8QA 4GIRA 5A6KA 3KXQA 3BJSA 4FF5A 2J9XA 3AWNA 4P5UA 4W7WA 2VZOA 3B3DA 1JI1A 1JAKA 3KCJA 1EPXA 2WCAA 5BROA 5T8GA 1U5VA 2F4EA 3AIBA 1TVLA 3A21A 1MRQA 1QI3A 2JK2A 2YOCA 3GHUA 3PFMA 1XH2A 2UY3A 1FDYA 1FRBA 3RO8A 8XIMA 1UASA 1RJRA 3C3NA 4OWGA 2D69A 5JBEA 1VJZA 3KAOA 2WJDA 1YNQA 1OY0A 3N34A 2HVMA 4FF7A 5A5WA 4GIAA 2E6FA 4MNKA 3GWQA 4LNCA 3PJTA 1R5YA 3OVGA 2X2GA 4U2ZA 4GQRA 1B90A 3PWIA 4JQ2A 5HMFA 5FF0A 1DOSA 3RFAA 4Z17A 3Q94A 5AZ0A 1S2TA 3RCYA 1R3WA 2GDUA 1TR1A 2Q3RA 2QW5A 3MUZ1 2FQIA 3R7MA 3PTMA 1K8YA 4Q8MA 2YSWA 2AKZA 3WL1A 2YFOA 1YPXA 4F0HA 2PDXA 3BC9A 3EKGA 1E6RA 2DSVA 3M47A 3UVIA 5HQMA 1S2UA 5K9XA 1VEPA 2WSQA 1K9EA 4G2PA 1WXZA 5JIPA 3JVAA 5CGQA 4KQZA 1ZPTA 1BYCA 3EPOA 1FCQA 3OQEA 4CEUC 1F6KA 4CU8A 1LWHA 3WNPA 1EIXA 2XIBA 2GUYA 4GIVA 1M7PA 2NX3A 5AC7A 5ABEA 2J7HA 4MGVA 4KWWA 4UOQA 4HD5A 1XYLA 3CEPA 3TQKA 4QDMA 2DSWA 1XLHA 1LOQA 4OBTA 3AZTA 2HDJA 3IVSA 5FEPA 4W85A 5B80A 3HMCA 2BY0A 2KI3A 2XU2A 2VC9A 2Y24A 1ZL1A 3W3OA 2D20A 1V02A 2ZZ6A 3OQ8A 2VOTA 3M6DA 3W86A 2C15A 4HPHA 3T40A 4F0MA 1E3XA 1R86A 2W66A 1EDGA 3UW6A 3N13A 2H8ZA 1J93A 3IRDA 2YYTA 1HJQA 3LB0A 2CCRA 4C02B 2G41A 3RCNA 4CEXC 3M5ZA 4R0XA 4M24A 3N18A 4KFNA 2H3DA 3R0DA 1D3HA 3HZ3A 3CIXA 2NQHA 1KFKA 1BYAA 4ZODA 3KRBA 3DERA 4CQDA 1IT0A 3BQ6A 5CPTA 4NIRA 1XLEA 1J4IA 2HJPA 4REQA 3NDZA 2J24A 5G1MA 3MUXA 3NI6A 5I2UA 3TNBA 4IM4A 3C5QA 3AQUA 1JCTA 2PPOA 1LG2A 3PC0A 1GVYA 3AMCA 3PZMA 4ICNA 4L5ZA 1OABA 2VDHA 2BVDA 5AVNA 2NQ9A 2PDMA 1B2YA 4I5UA 4LF2A 3SY8A 3VX0A 1JGMA 2X7WA 1E4MM 3JYMA 2V9DA 3G1VA 1OBAA 4TVCA 4HARA 4IQ2A 4DO4A 2VR5A 4UNIA 1SZNA 1W3NA 4AUBA 2Y7GA 3ZLGA 3DCPA 1XYBA 4B2DD 2YCLA 3QSRA 1RA0A 4QHRA 1J0YA 3EWYA 4NJKA 4JIRA 1F8IA 1P6WA 1PEZA 3AAMA 3OW1A 2QQ6A 4P7RA 2E1WA 3CHDA 4HZMA 4DYJA 3IJIA 4HCLA 3PR2A 1F3XA 4AEOA 4BJHA 1CBGA 1MZRA 5HK4A 4DJDC 3IIZA 1NQKA 3CQIA 2UBPC 3A12A 3TCEA 4Y8EA 1XICA 2PWUA 1ECQA 3UU0A 4LRSA 4UTTC 4AMAA 1H7OA 1FH9A 3O16A 4QNEA 1ZJHA 3K8KA 1GOKA 5MF5A 4QSHA 4HJFA 4U31A 1XLCA 5D37A 2V5CA 5D2VA 4PODA 3W7IA 4F0KA 3V0UA 4W5UA 4OGZA 1B57A 4L6HA 3ARSA 4DJEC 3CM4A 1QPKA 2NUWA 4BF9A 1H61A 4PUWA 1AG1O 3HBLA 3NDOA 4OKDA 3PRAA 2YCJA 1YYAA 4CNNA 1A5OC 4A4AA 3KE0A 1PHQA 2JFEX 2P10A 4JQ1A 4XWUA 3CTTA 5JXQA 1FUYA 1ADOA 1NFGA 1JZ6A 3PPCA 4LVFA 1GOMA 2FZNA 1EEXA 3UBPC 4IHCA 4A29A 4DO5A 4PUNA 3EWCA 3QOMA 2WJEA 1F4AA 1A5NC 4WOQA 3HPZA 2OZTA 2NZLA 1DBTA 3TXVA 1XCWA 1CGUA 1DIOA 2DZVA 4NXKA 2FTPA 4MZ8A 4PUUA 4AZHA 3DFYA 5EMKA 3QF0A 1G1YA 3E0IA 3GH5A 2Y89A 2OZ8A 1BAGA 3ARQA 5KETA 4JBRA 5FEXA 3AIQA 1OADA 1DJWA 2VRJA 1REQA 3AIRA 2OYMA 3IRSA 2R1PA 4E8GA 1YMYA 3UF9A 4NI8A 3D0CA 1R47A 3EDDA 4INFA 1PKLA 3VE9A 2PLMA 4R3UA 4DRSA 1PV8A 5FIPA 4BI7A 1J01A 1SMAA 2C71A 2W6RA 4JIEA 4ZTXA 4TOQA 5B7YA 4FIRA 3WLIA 1ZENA 3W7CA 2OXNA 3VNLA 3TP4A 4JYDA 4AWSA 1Z69A 3U3HA 2PU0A 4BR1A 4H7CA 1DQWA 2FVMA 3QW4B 4IFOA 4AQLA 4IL0A 1JZ7A 1QRQA 1HKVA 1P0DA 1EA0A 3APYA 1EKOA 4XZHA 2ZOXA 1NDYA 1X97A 1MUMA 5EFFA 3KCOA 4FHAA 3N4AA 3KLLA 4K7YA 7A3HA 3E74A 3VMPA 2OYLA 2EAWA 2BFGA 3M0VA 3KOXA 1XBYA 2FFIA 1QW9A 4PN2A 2QT3A 1RQBA 3NTPA 2ZWZA 4S3AA 3DHFA 4IGHA 2XSAA 4MOZA 2W63A 1MQRA 3LMZA 3DENA 3AS1A 1DJGA 1NWUA 2WZEA 3R5EA 3WNOA 4O2TA 4C1NA 7TAAA 1RD6A 3UG4A 3SCWA 3TQ0A 1O95A 3RGCA 4HNNA 5CPOA 1EF2A 3PB0A 2R1KA 1GQJA 1N1AA 4GJJA 3KOYA 4Z1BA 2CZEA 4MF4A 1JVWA 3E2RA 3WG6A 3BLIA 1EJTC 4G2DA 1B9BA 1L6WA 5G4EA 1Y65A 1VBJA 2WBGA 1QNOA 2LKNA 1UZ1A 1B6CA 2YR1A 1WE5A 3ZSSA 1DEDA 3TZFA 5EA9A 2XSXA 2VURA 2PDWA 1WPCA 4NRRA 4HK5A 5DEZA 3K1DA 1MDLA 3VK5A 3WKZA 4Z1CA 3FGCB 1NY1A 1UW9A 4ZB0A 4G5DA 2BP1A 4NZ1A 3BMVA 1BTMA 1FWDC 2EJAA 1FVPA 2XUCA 3KS6A 3LTPA 1W1IE 3FK4A 3M1ZA 4XZBA 3AYVA 4M0XA 1PKMA 3PTQA 1E4IA 2B4GA 3DECA 4N2YA 3VU2A 1Y5XA 3AWOA 4FMVA 3TFCA 1R6WA 1UIPA 1FHDA 5SWUA 2DVXA 3GSMA 2R24A 1LWIA 2DT0A 2MF9A 3O15A 1QK0A 3A4JA 1W3KA 3PUEA 5C9RA 3VIOA 1EPVA 3LG3A 2X1UA 1NF0A 3NYZA 1A5CA 3QKEA 3KAIA 3PJWA 3T2QA 4KEMA 1KBIA 4LUIA 3IIXA 2XWDA 1FFQA 1EP2A 3NQEA 4J3ZA 3AJ7A 2JKAA 2PWEA 3CYVA 4UTHA 3RF9A 1WZLA 4XV0A 4IIHA 3LLXA 5HAOA 3W7RA 3M16A 4M8UA 4D6DA 2P3EA 3QW3A 1FKSA 4XVEA 3MDWA 1AVAA 4Z1DA 1F76A 3MSYA 1DQUA 1IR2A 3EX4A 5AHMA 3F03K 2YCIX 2GQ8A 1GVQA 2WM0A 2VRKA 2QF8A 1ONXA 3H2AA 1ISVA 4IP7A 1DKWA 2BOEX 1UH3A 3H9RB 2VR4A 3L2IA 2ZR6A 3WQPA 4DUVA 3JZUA 1WOBA 1LL6A 4UUIA 3K4DA 4QJ1A 3ANUA 4FOUA 4K39A 2NUXA 5DBTA 2PZ0A 3N29A 5HULA 3B0VC 3TQPA 2PD9A 4EPDC 3SW6A 4TR9A 3CMGA 5CC3A 3CL6A 3CQJA 2VEPA 4I7UA 4CD5A 1AD4A 4LUSB 3LBMA 3HG2A 9XIMA 4JEJA 1R9ZA 3EWDA 2AQOA 2VN1A 1JQXA 3I6TA 4ORMA 4TW7A 5CLTA 1W1VA 3TYEA 4RV8A 3VOCA 2GVEA 1UC4A 1OYBA 1ZALA 2A3BA 3HG4A 1RPKA 3VUSA 4MNLA 1UH4A 2AMGA 3NAVA 3BVJA 2MLYA 4W7UA 3HQOA 5K4ZA 4N02A 2H6RA 1CGTA 1PYFA 1B5TA 4IISA 1F8MA 1Q8JA 4JKKA 4MWAA 2EG8A 2M2AA 3LM7A 2VYOA 4MADA 1HL9A 1JDDA 2AAMA 3O2LA 4AU0A 1PXGA 3L65A 3TAKA 1B3ZA 4PTWA 4H9TA 5EL1A 3SADA 4LBSA 4DAFA 4GE8A 3PZGA 4XO7A 3WK0A 1GVEA 4LAKA 4DO6A 3BH4A 1O5XA 4W4QA 3UQIA 4YVPA 4DBSA 2WNWA 1OFQA 2HBVA 4HCHA 2QDEA 4OUIA 1EP3A 5FAGA 1V0LA 1O1ZA 3TKFA 3WELA 3A13A 4AHPA 2F6KA 3LV6A 5CZKA 1TJ2A 3C61A 6XIMA 3L0GA 3NZRA 1VFHA 4DUWA 1XBZA 1L9WA 4NZ4A 2WMIB 4Y9AA 4M81A 1LQ2A 2A3EA 1JNSA 1PDZA 1TV5A 1OT2A 3PNZA 3BW3A 1OSEA 3ABXA 3GS6A 2GK1B 3NZPA 3WH7A 1LCOA 1KWGA 4DWSA 1MW2A 1WOAA 4O1DA 2OVLA 1XIDA 2WVTA 4O53A 2QULA 2EQDA 1I1XA 1M53A 1WZAA 4QAIA 1EGVA 1T8XA 3KABA 4AXKA 2FKEA 3GH4A 4RNHA 2EKGA 4AHOA 2CKRA 3SR7A 3V36A 2FGBA 1M7JA 3EKLA 3AHZA 3QMSA 2VEFA 4CNUA 1UBSA 6TAAA 4DJFD 4OFCA 1L8NA 3LENA 1L8PA 1DPMA 3P61A 4JFLA 4Y9MA 4DM2A 1XIIA 3REQA 4E4PA 4OE7A 3LBCA 3D47A 1V08A 1GORA 5D8ZA 1U22A 3W1UA 4YNGA 1AH0A 3RU6A 3QTPA 5LHFA 3BGAA 5CG7A 5K9CA 1O7AA 2I14A 3AMKA 4JTIA 3VINA 3ZQ9A 1GKQA 1R9HA 3RLGA 3CWHA 1VPQA 1DWAM 3N19B 7TIMA 1SVDA 2XISA 1R3YA 2BZNA 4CD4A 4Z1YA 4G7EA 4ZE5A 1FQ0A 5ABFB 4JN6A 1NTHA 4GY1A 3HPXA 4O50A 1H4PA 4GX8A 1I1WA 2ZC1A 4WRHA 2Y4SA 2ZUMA 4URIA 1IGSA 2WJFA 3PUDA 3T81A 2P0OA 4QEEA 2CLIA 1ZS2A 2ZC8A 1W31A 3CL7A 3SCTA 4KCUA 1R85A 3WNNA 5A8GA 1MVYA 4PUKA 4UQEA 3WD0A 3GQYA 4JNZA 4A2RA 1V3IA 4KWOA 4WCJA 3SM0A 4YTRA 1GYMA 1CECA 1IEVA 5EMLA 4EVZA 1K8ZA 4IUGA 3PBUA 4MZ1A 4YHEA 4WQ6A 4M3PA 4RV3A 1ZUAX 2FKPA 2Q3OA 4NZCA 4QT3A 1XGEA 2BOGX 5DY3A 3IJ8A 3N9KA 3B8DA 4RPPA 2CFFA 4GUGA 2XH0A 3ECQA 3B9NA 1F2JA 1FHVA 2R6OA 1IYXA 3E2SA 2VKZG 5BW6A 1SFLA 2QPXA 2RGMA 3DYOA 3TX9A 4ZQOA 4F0SA 2C91A 3W27A 1EC7A 4PCFA 4IPPA 1UWRA 1J18A 3AYSA 4A3HA 4C7GA 1R0MA 1OFOA 1TRIA 1PVNA 5J5RA 1CXIA 1NDVA 1XP3A 2PN0A 4E0CA 1OG6A 4O57A 4Q4QA 2J47A 2ZXQA 1LP6A 2XP5A 1B3YA 4X0VA 3HOJA 4PR4A 5BWAA 3R43A 5FF3A 4LPCA 3GO2A 3VC6A 3VDGA 1WUFA 2YA0A 1H49A 2PWHA 3AZRA 5GJMA 3T2OA 2GJLA 4J1OA 4D9PA 3PBMA 5TF0A 3GC2A 2VD9A 2PTYA 5BZAA 3WK3A 4RE0A 3LV5A 2D73A 1FDJA 3KHDA 3LERA 1C8QA 5CBIA 3W7NA 4X63A 2FTYA 1P5QA 4LAMA 1VIWA 3PBYA 3BG9A 1KRCC 4ITZA 3QVQA 3K30A 1QHOA 4TVUA 1D8WA 3HURA 1ELSA 3WF0A 4WEVX 1S3HA 4OJYA 1V3JA 4B5TA 3AICA 3QV9A 2OEMA 1JGIA 2PLKA 5LNSA 5HMSA 5C7VA 2C1HA 4Q4SA 4IP4A 1OG0A 1MXDA 1JDFA 1QU4A 4XBJA 3GH7A 3NJ3A 2CC0A 2YL6A 2YA2A 3JXVA 3V1HA 3R79A 2VXNA 3H54A 1G7UA 1XLAA 3IS4A 4UFIA 4LVDA 1M3UA 4CD7A 1QPOA 2VC5A 4GGBA 4LUJA 4DX3A 1W9DM 3A4XA 2FH8A 1K70A 3WUFA 3ITVA 3W22A 1H1NA 3N15A 1TV2A 2H9AA 2Z1SA 4FS9A 3PWAA 2E0PA 4LYPA 3W07A 3EZ4A 2ZX8A 4G50A 4IGMA 4JCLA 2QV5A 1JUEA 2F2HA 3PTKA 3C0LA 3FJNA 1MI3A 1ZJAA 4MJMA 3U7BA 1I0BA 5GQBA 3EIPA 3EOSA 1ZSXA 4PSPA 2J8TA 5DITA 3UF8A 1CENA 1P1MA 3A4WA 2WSKA 3LYEA 1C93A 1TMHA 1OB0A 4LSBA 1Z8AA 1SUXA 3VM5A 1KC7A 1ZU8A 3O8AA 1DJZA 1X8CA 3GYEA 3GZ3A 3L4TA 1D3GA 4BA0A 1W1B1 2H3BA 3JRKA 4F2TA 3VTRA 1ROUA 3I4KA 4D8LA 2Z2BA 4PRWA 1GK8A 1ICSA 4DWDA 3CMFA 1AJ2A 3FIGA 1BSLA 1EC9A 2F38A 3S2MA 3SCRA 5U4NA 1SQ7A 4Z0SA 4GKTA 1UD4A 1KRMA 4XD6A 4O16A 2F7FA 4C91A 3OGVA 4M7SA 1IEQA 3WDJA 4MTVA 2ISDA 2RDXA 2DUZA 4R7OA 1W5MA 4P7NA 3VABA 2XDFA 3ONBA 2FVLA 2WKLA 1UUQA 1TJRA 1TCMA 4B3ZA 2DT3A 2YBVA 1UR1A 1P6BA 2QUTA 2FPVA 7ODCA 3LM3A 4JIQA 4N4PA 2R1MA 1JQVA 3NVTA 3TK7A 1TPVA 4Y90A 2B81A 4RDVA 5CBBA 3HPSA 3S1XA 5ABGA 1IV8A 3O6CA 2C6QA 5DIUA 4O1EA 4WOZA 4QG9A 1J2BA 3W6MA 5KITA 1MQQA 4JX4A 1JXJA 1OZMA 2PP1A 4AD0A 3V1PA 2UY2A 1HVXA 5LIKX 3MSGA 5DMLA 1X8FA 3KOWA 5DMYA 4ZSUA 3WQWA 5HTGA 2BGSA 3UA3A 1FHLA 3KL0A 1A47A 3TSDA 2BLEA 4MZYA 2QIWA 4I5RA 3DI1A 4TW8A 3VMOA 1D7IA 2P53A 1K6AA 2REQA 4FEZA 4EXQA 1YX1A 5DT7A 5M5DA 2OTDA 3NO1A 4W9QA 2W3ZA 3WD1A 4DRQA 2YZ5A 3I4EA 2RUQA 1KQYA 4L3NA 1P48A 1KM3A 1V5XA 3BLDA 9XIAA 5EYWA 2DQWA 2V3GA 4GFIA 2V5LA 1JCYA 1OHLA 2X1SA 2E40A 2AWGA 3M41A 4DRHA 4IZGA 1J5TA 2V63A 1L6SA 3EWZA 3G6LA 3CUJA 2M08A 2OGYA 4NAEA 5TBOA 4J4OA 4IT1A 1B9ZA 1H1ZA 4ACZB 3GR7A 3QEZA 1W9BM 1C8YA 3W4RA 4RL3A 5EGRA 5AKQA 1NSJA 2BXYA 2HISA 4UQAA 3DBNA 3N4EA 4KR0B 4PUMA 1DJYA 1UD6A 1XYCA 4L4OA 1XBXA 1X6UA 2NSOA 1D3CA 5HW7A 1CYGA 1UJQA 4YS1A 3UG8A 1IR1A 3KVKA 4OV9A 4JTHA 4S3KA 1Z42A 2IPWA 4EE9A 3S3GA 4GBDA 5F4XA 2MANA 1IHIA 3S2CA 3L7RA 4HMEA 3BQ5A 3W1MA 2PV2A 1JCXA 2CLEA 1K7XA 4DRPA 4ACYA 2Y8UA 5D05A 3E96A 4Z1AA 4IFKA 5CXPA 4I90A 4ODMA 3KBVA 4W87A 2QZRA 3AXMA 3QZAA 4ZR8A 1XDMA 5F1UA 1EJVC 4PMYA 3ZR5A 1V79A 3HQNA 2NW0A 2PI6A 1Z48A 4O10A 5I09A 2OELA 1UJPA 5D9NA 3PN8A 3VNDA 1DL3A 3CV1A 1RP9A 3EXSA 2WMJA 4UCFA 3MDUA 2PDKA 3NPXA 4LUYA 1FWTA 5JH8A 4IGNA 2X09A 1X38A 1DORA 1TJ0A 3HU7A 3B9EA 3VKJA 3BJTA 1CB7B 2DZPA 3TCZA 2ZVIA 3WQFA 4PUEA 1J0KA 3BMBA 1FY6A 2C3ZA 1KBLA 3AMLA 2VHLA 3TYZA 2ESCA 2MNRA 4ZQCA 3C0JA 1YIXA 3IHZA 2PV1A 4O1CA 3L5LA 3TC3A 2J13A 3KDNA 3O5QA 2E9MA 3WLTA 2QS8A 3CGNA 2Z2UA 1QFEA 1BQGA 3QGKC 3DIPA 4B4HA 1EYEA 4QR6A 4UTJA 2R82A 2B7QA 4M6VA 1Q6QA 3TA9A 2QCNA 1TVPA 1FKWA 1LYXA 2CKSA 3V75A 3A4AA 2QDDA 4JTQA 1BTCA 3S1UA 4QE1A 3OYZA 1L6FA 2ZXAA 4X22A 3R13A 1LUCA 3BUVA 1VFUA 3E5PA 5LZLA 1AUSL 2PLJA 2DG4A 4AG0A 1H7NA 4CU6A 3DFQA 8XIAA 4KIEA 1JUBA 2VGGA 1Q7ZA 4FPSA 3VKBA 2WZIA 1KT0A 3ZYZA 1KM6A 1K03A 4H9MA 3GB6A 1NFBA 1CWYA 4PMXA 4H2HA 1KLYA 3C2OA 3VFCA 3W24A 1X96A 2YGYA 4L1WA 1FTXA 3WLHA 2VDGA 3W0KA 1DQXA 5E9XA 1E72M 1E6PA 3DU0A 2FJKA 2PDIA 3O5GA 2D2HA 3DOPA 3U48A 1WZMA 2ZX5A 2QAFA 1A3XA 4EPBC 2O9RA 2XINA 2F6XA 5HT1A 1D8CA 2ZUNA 4DF1A 1W2PA 1GVRA 3O5LA 2XVKA 1A5LC 1PDYA 4CD8A 4LCRA 4PSRA 1HT6A 4E2OA 4B16A 2RDWA 3HJEA 4PUJA 4DIAA 3AC0A 2HSAA 5GPGA 5HWBA 1VIZA 2BOFX 4AC7C 5JVLA 1KFBA 3NL3A 4UFKA 2A85A 4FP1A 2WLYA 3TW7A 2I5QA 4DJDD 5A1AA 2WCGA 4CNTA 1KBJA 1A0DA 4GIEA 1M5YA 4JS3A 4R34A 3O5IA 4L4MA 4XIAA 3ZSTA 1TKKA 3CH9A 3EPMA 2W92A 3LCIA 2QAPA 4LS1A 2OG9A 4W8AA 2VUYA 1GHSA 1I6NA 2E9LA 5A3HA 1O60A 2POTA 3MW7A 3RDKA 3O5RA 1Q4WA 4ZZ9A 1V3HA 4CKQA 4UTUA 5IFPA 1XV8A 1HL2A 2G95A 5IFTA 3ZVIA 1RSCA 4W88A 4U3AA 2O0TA 2BY1A 5FCZA 4DJED 1O5RA 5D2WA 2PB1A 1H1YA 4JFIA 1SJAA 3QLLA 3MPGA 1OGSA 1HJVA 3OPSA 4H6RA 3N6JA 4IT4A 4IUOA 3K46A 2ZKMX 2A5HA 2PA6A 3SSZA 5AY7A 1XIBA 2Y70A 3CLMA 1GPFA 3N9SA 4GGHA 4V28A 4EF9A 3IK2A 1W8GA 5LXXA 1H7XA 5AC4A 1BFNA 1W26A 3WH6A 5H91A 3MU7A 1TWZA 2DW7A 2NVDA 4KCVA 2DG3A 1FWHC 3P7YA 1EHNA 4M19A 2J25A 3FXYA 3OHMB 5A6BD 2CLKA 4R33A 2WYSA 3FDKA 4ZBCA 2WVVB 1S1RA 3G8EA 2J8FA 1W9VA 2ZXDA 4O52A 4HMDA 2YXGA 2VWSA 2WMKA 5BMWA 4CN1A 2JGYA 5JBDA 3TN5A 2OU4A 4UC5A 2YPIA 1XWYA 3VKDA 1GGOA 1X1OA 1QNRA 4GUFA 4EANA 2VT0A 4UWMA 1Z41A 3AALA 3L4ZA 2E8ZA 1LRTA 1V7AA 3CV7A 3EB2A 4W86A 4NL1A 1PB0A 3MWAA 4A05A 4PEEA 3DI0A 4FZIA 3E12A 4F48A 4MDOA 1IX5A 2AAAA 4LFYA 3SGUA 4LVGA 1XM3A 1U83A 4MFEA 3WMBA 1XLLA 1BVZA 2I17A 4HP5A 3PY2A 3H23A 2V3EA 4QG6A 4UMCA 4NU7A 4I7VA 2YYUA 1VQTA 1JDAA 1FP9A 1X1ZA 4N9CA 2CIPA 2CERA 3WFLA 3PTDA 2ODOA 2I9UA 4J2MA 3LI1A 4FI4A 5FOOA 3IARA 3UEQA 4UQCA 3UQAA 2IF4A 1WB0A 5CJ5A 3GVRA 3THQA 3USZA 2QJHA 1FD9A 3L9CA 4KF1A 1PBKA 2E6DA 2Y78A 4AZ6A 1QAPA 1OCBA 1WBJA 3UWQA 1GQIA 2A3LA 5AB3A 1JUKA 1VH7A 3N2OA 3N3TA 2Y7DA 3WF2A 4LB4A 2A7RA 4M1RA 4HHMA 3VOHA 4PTMA 3MUAA 1OD8A 4U10A 3S42A 2QPUA 2V0TA 2YCEA 1ZHAA 2PDLA 5LA2A 4X61A 2ONEA 3DHPA 3LK6A 1CGXA 2XVPA 4J35A 3TC5A 4JHZA 1EEPA 1V77A 2RURA 1KXHA 3GVGA 1EQ3A 3GXFA 1EJSC 4CN4A 4F9JA 3KP1A 5A6LA 4QIUA 2ISFA 1Y5VA 4IP5A 1NU5A 4LAOA 4N4QA 3MI3A 3W88A 3E6EA 2E9BA 5FJJA 3VOGA 3MC5A 3BURA 1F6YA 2ACQA 3KRSA 3I7RA 3KTXA 2J7EA 3EMZA 3QPEA 1F5ZA 1JAEA 1Q6FA 2ZQTA 2J9YA 4PMQA 2GGJA 3M5XA 3QV6A 3L12A 2GUUA 3U2CA 4IPLA 3NPWA 3SN1A 4ZENA 1DE5A 3VD5A 1UWAA 3QKZA 2ZX6A 2WNNA 3WDRA 3B40A 1QTWA 1J4EA 2Y61A 1TTJA 3G5EA 1GJWA 4WDXA 4GNVA 4P8XA 1B3WA 1UBPC 1UKTA 3FJLA 4HIBA 3UI4A 4ODPA 3LQLA 3ATZA 4PGLA 5A6MA 4HHLA 1XDLA 3HB9A 3DZ1A 4H6EA 1QVBA 4K1WA 3IKGA 1XKJA 4XQ6A 4GBUA 1FP8A 1KM5A 4GINA 3UWYA 1JULA 3GXMA 3UD6A 2PDNA 3QC0A 2XYLA 2BY2A 1I0DA 4I9JA 1DXEA 2OPJA 2VCCA 3LPGA 1AMYA 3ARXA 2PBCA 4YWSA 4GNKB 3C6CA 3GPKA 4JFMA 3S5YA 1AFSA 4Q8NA 3BSHA 2DW6A 2G96A 2P4VA 3KUMA 4LUTA 3E3HA 2VUNA 2VQTA 1BG4A 1EXPA 1I2OA 3NFUA 4ORIA 4JD4A 2J4GA 1QNVA 4HYVA 4E8CA 5AZ1A 3W73A 4BHYA 3O5DA 5DRIA 3HQ1A 4DZ2A 2DZAA 4W9TA 5D75A 3ABZA 3V16A 3GKFA 3UZXA 4RLIA 4LV9A 3UY7A 3H55A 1R7AA 1IXQA 2EXOA 1IE7C 1NELA 3W2LA 4ZXLA 1Z9AA 3W2JA 1XCXA 4LF1A 2G97A 4Q4PA 3TJLA 1QDSA 2J7FA 2ZRXA 5HJYA 2E67A 1US0A 3DGBA 2EPKX 3FLUA 1FWSA 3R25A 2EJ1A 5DQPA 5DMNA 1VBHA 4TX0A 4GJIA 3ZJ7A 4UXDA 4IX2A 3H53A 1VB9A 3C0SA 3LS9A 4GY0A 4BEQA 1QMLA 5RUBA 5D03A 3KADA 2FYMA 3Q2DA 4PL2A 1UP0A 3TNOA 4KQNA 3QYQA 3GNPA 5CC5A 2I5IA 1XRTA 3BLPX 2IKHA 4C6PA 3VDBA 1ZAHA 3UESA 5DLCA 2YL5A 2VTFA 4JTTA 5C2CA 5LA0A 2QCDA 4V2XA 2OQYA 3TN6A 3AHVA 1OT1A 5HOSA 4ASTA 1XFBA 2HNHA 3GRIA 2VGBA 1VPXA 1BXCA 3UWWA 3CBWA 3IGXA 3MP4A 2PODA 1SFTA 2R1NA 3AXKA 5AYXA 3N25A 4S3FA 3C4UA 6REQB 4PB4A 4X9SA 4GVIA 2GOKA 4B92A 4WSJA 2DORA 1NH6A 2D3LA 2INFA 3Q37A 4JICA 4NX5A 3TLQA 3WBWA 1TWSA 1BWVA 4E2VA 2OWWA 1PCWA 5D4YA 6ENLA 3W53A 5F2MA 2XP6A 1ONWA 3ANYA 4TMCA 3FAXA 4NHVA 1W5PA 1EDTA 1AQ0A 2VM8A 2OSYA 3VD4A 3KOZA 1KWKA 3OVRA 3OZYA 2XGBA 3AIEA 4OBSA 1LQ0A 3FDGA 1CXHA 3H8AA 2P8BA 5H2ZA 5BOFA 2EGZA 2TSYA 5BXJA 4DF0A 2FFCA 1RVKA 2Y7FA 2DZTA 4BF8A 4M6PA 5CBJA 1GRJA 2CZVA 2X30A 3UCCA 3CPUA 2KFWA 1XRSA 2IXUA 1KW1A 3H2OA 3SCVA 2HRWA 2V2CA 4C6LA 5FJRA 4UZUA 2PURA 1OGGA 4K36A 4LGXA 2ZZ5A 2CLFA 4KW2A 1B1YA 1ICQA 2WVSA 3EMQA 3T6CA 3FGCA 3WJWA 1SSGA 3K13A 3TW9A 3QMTA 1R7OA 3VIFA 4N9EA 4B5WA 2X0HA 1WDDA 1XLGA 4GZIA 4MY8A 3TTYA 3NZ1A 2BXVA 4A3QA 2IQTA 1R3QA 4S2BA 3A3XA 4X60A 3LTSA 4PB3A 4MWAB 1XSIA 4C90A 1R87A 2J78A 5CPSA 3NXLA 3L5AA 4GZJA 4HOWA 5C70A 1AK5A 4LQ1A 4D6HA 4NSBA 3SAZA 5IRPA 3BZJA 3PUGA 3LU2A 3ZIZA 2VENA 4AVOA 1FWCC 4NZ3A 4HOZA 2A3CA 1S5NA 4D6EA 4XTIA 2MNTA 1TZ9A 4ES4A 2XP7A 5HUPA 4E2DA 4WJEA 4JTDA 1FBAA 5E09A 2KGJA 4MYXA 5BXTA 1VRXA 3O7UA 4I6VA 1NJJA 3NL6A 1N55A 5DO2A 2A6LA 5I3JA 3BGGA 3S1WA 1U5HA 1XJBA 4LV4A 4UQBA 3HA1A 1ME7A 3BV4A 3DH7A 4FB7A 4QLKA 1XIGA 3HG3A 4UQDA 4MHBA 3H2CA 4H8VA 3W1PA 4L9XA 4DRIA 5I3HA 3ARPA 2Q09A 1CXLA 2IKJA 5A8OA 1FWGC 2P8CA 1HJWA 3MI6A 1WKYA 3UR2A 3RO6A 4Y7EA 3IUHA 3PSWA 1EH9A 3WF1A 4IFRA 4YHGA 3UWUA 1XF0A 1FKTA 4RE2A 5AHFA 1AZ1A 3BLFA 3LZ5A 1C8VA 3G1AA 3PG9A 4C7FA 2QPSA 1Z7AA 2DH2A 2EF9A 4PCTA 4WKFA 1YADA 3RMEA 1HL8A 3REQB 3WX7A 1LBLA 2ZTKA 4TX8A 4U28A 2WAGA 4EXAA 4QDPA 4JEQA 1EJ7L 4LW7A 2P76A 1XYMA 4ZQPA 3BG5A 2VR2A 1W56A 2A79A 4JR5A 1MW0A 3GDRA 4UR7A 1KV8A 3VOIA 2XIOA 5FJPA 1AH3A 1TWDA 3W7DA 3BAYA 4G7EB 3OLEA 4DBEA 3EOOA 5LIXX 3ZJ6A 4HBKA 1I75A 1UR2A 3O3RA 3SUTA 4DIPA 5K2ZA 1YW5A 1A4MA 3ARYA 1M9HA 1RR2A 3O5PA 1ZAIA 4AY7A 1BPLB 1ISZA 4KCWA 1OINA 1E0UA 4DPPA 4GO8A 1SU5A 4MY9A 4UTLA 2F61A 4PZVA 1A5UA 4L6OA 4N19A 1EBHA 2PP0A 1LLZA 4B3KA 2NWSA 2LLEA 4NJHA 4RJEA 4GYPA 2D9FA 3B9AA 1MO0A 3OOBA 1H0GA 2XGZA 4D6GA 5EMYA 4JNYA 1TWIA 2WMIA 5A8QA 3EMCA 3UFYA 1H41A 2J7BA 4ML4A 3QZ6A 4B9ZA 4A8LA 3K1GA 4ODOA 1YHTA 3RFWA 1GOIA 1Z6KA 4ZA0A 1Q5MA 2DSUA 2GK1A 3RLUA 4JZ5A 3WF4A 1CGYA 3MVTA 4NNRA 3OOQA 4JXCA 3TSBA 2NVCA 2DVUA 4DUXA 4BQ3A 3BZGA 2B0MA 3WLRA 3LX9A 3BCJA 1ZCCA 1N7KA 1OEPA 1F07A 5KSWA 4GGQA 2E5CA 3CJPA 3EDKA 3O5EA 2Q6ZA 5E9AA 5GJPA 2ZADA 3C8FA 4O18A 2O92A 1YXYA 4KMQA 3TTOA 4Y96A 3WZ0E 1E1EA 2Y7EA 4JTJA 4WSKA 4OZOA 2NSXA 3E9AA 1S5MA 3WQ4A 3WL0A 1W1ZA 4MWAC 2Y85A 1HKJA 3NM1A 2VFGA 1HP5A 3O9NA 3C8NA 4AWTA 4BF7A 4WF7A 3EXTA 3NQBA 1UROA 5DIVA 3QRHA 3HF3A 2J7DA 3KFTA 2RQSA 4QXIA 3PBGA 4FIQA 1KM4A 1ODZA 4FNSA 1SO4A 4JL2A 4JQ3A 3MTWA 1GPWA 2C16A 3G3MA 1C9WA 5ABFA 3U4AA 5LYRA 1H7PA 2WQPA 1YQ2A 5JBFA 4IGSA 2G50A 2N87A 1UPMB 4G7FA 4PTNA 1UKSA 3S83A 5I02A 1GJUA 1QASA 5DN1A 4PE8A 3ZVHA 4QTGA 4H41A 1GZGA 3GW3A 5EMUA 2QYGA 4AD1A 3EWUA 1WKEA 3IJ7A 1AW1A 3RU8X 4A3UA 1Q45A 3SCNA 2XG9A 1OC6A 3S5NA 3WQGA 5CCZA 3SRHA 4LC8A 4GHRA 1DP0A 4DWSC 4IIGA 4DYKA 4WGHA 1KRBC 4B5XA 1P7TB 3FA5A 4AEEA 1SMDA 3FCPA 3GE7A 4AYGA 4LAVA 1JR1A 1L6GA 2GWNA 3LN3A 2NT0A 3V18A 2PDYA 3DYMA 1PX3A 3EEGA 2ZCGA 4JIIX 3VYLA 2XM1A 4HJWA 1M01A 4UTIA 3LNMA 2JBMA 2HCVA 1KXQA 1MZHA 1UD2A 4NNCA 2GQAA 3BMWA 1ZBKA 3B05A 2Y6ZA 4XAKA 4J28A 1PCKA 4IOTA 1TMLA 4P8VA 1WXYA 3RGTA 3W23A 3NSNA 4NI3A 1BWLA 1VFSA 2YKKA 4ZS6A 4HPXA 4DUOA 1V6WA 3WBYA 3TEVA 5AYYA 1TREA 2V5BA 3GAYA 1B0IA 4UNLA 4RDWA 4HTBA 3KW3A 1NF7A 3UY8A 1MQPA 3FY1A 1VFMA 4RPQA 1TJ1A 2BVTA 1TVNA 3S2JA 3W82A 2EEXA 4XKYA 3GC4A 4H7ZA 1VYPX 1IXNA 3NR0A 2A1YA 3P60A 3H7VA 1TUXA 3NSMA 5D9MA 3M0YA 3ITYA 1XR2A 5IDIA 1OJXA 1GQNA 4DQWA 2OOFA 4NZ5A 2PWGA 3GTYX 3CUIA 1NIUA 4RXFA 4AEFA 3T42A 3G1HA 1UMLA 4K3ZA 1GVFA 4Q7IA 5D02A 2ZTJA 1VEOA 3QQ0A 5K7JA 1LQAA 4AW7A 3KL5A 1UWTA 3NSXA 4DZ5A 4GQ0A 5I3DA 2X0SA 1SM9A 1W32A 2ZUTA 4YTTA 1LDCA 4RDYA 5D8WA 3K2GA 3UG3A 3DFSA 2VFEA 2ZDRA 3H12A 1IWAA 3AXHA 1DJIA 1QOXA 1BVWA 1I45A 3S47A 1PTDA 3ZR4A 4Q32A 2Y0FA 3R1ZA 1YDNA 4GZ7A 3EPNA 5ABHA 2CLLA 3MO4A 2PDQA 3IV3A 3LXBA 1E51A 3NQ2A 4AFYA 2A4AA 2X41A 4MKSA 4OECA 3KAHA 2PAJA 1R2SA 3O6DA 4ZO8A 4I5XA 2ZQUA 4CUCA 4H9ZA 3G2GA 1VD6A 3II1A 2OEKA 5CJNA 1Z44A 2Q01A 2W79A 1TCOC 2HV5A 4W84A 3W2NA 4NAEB 4XZNX 4D6JA 1EJXC 1UR9A 1A3WA 2RDUA 2PWDA 2GVJA 5BNKA 3OBKA 4L65A 2ISSA 3SO7A 1GOWA 1E73M 5I3KA 4WSHA 2BHUA 1W37A 4YYFA 4CCDA 4LT9A 3I7SA 2IQDA 5MHBA 4JTAA 1M03A 1LORA 4JPGA 5JQ9A 1OFRA 2PUZA 3ICJA 4X3ZA 1DE6A 2OWCA 4AZ5A 4FSAA 1H11A 5I23A 1UCWA 3ZLHA 2PTZA 3GC5A 3LCHA 1CXEA 1EBGA 1M04A 3UJ2A 1YDOA 3ABOA 1V6UA 4JHMA 3V5OA 3BANA 5KEZA 2CW6A 4IFKB 3FVDA 1EQPA 3RMJA 4YN5A 2Z6JA 5JIWA 1HTIA 2ZX7A 8CGTA 3ALFA 1XLBA 3T0BA 3VE7A 3FX4A 3MCNA 1FH7A 3BAIA 2C0AA 3ITOA 3M0KA 4S38A 1CIUA 3UWVA 4IJBA 3PP7A 1SJBA 5TIMA 4LU0A 4H83A 3URAA 2DJXA 4Q8TA 3NZQA 1DJXA 3MV01 1EDQA 5I24A 4L6DA 3NPVA 3T8LA 3QHMA 1I2NA 1M41A 3TWBA 2QCFA 3TQVA 4FXFA 3MDYB 3NM3A 3UETA 3EWXA 2A7NA 4PULA 2V2DA 4C1LA 4ECLA 4LH8A 3AIWA 4H3DA 2R9RA 3AZSA 1LM1A 3MANA 3PZNA 3TN4A 5AOUA 2PC4A 3ZO9A 5D2TA 1KBBA 9CGTA 4PCNA 3P6LA 3EA2A 3N12A 1D9EA 2X1RA 3WH0A 3IPWA 3C3UA 1FCVA 1XRFA 1BKFA 1M7OA 1ZFJA 4H6QA 5G2WA 3EOEA 4FR1A 1ROTA 4NUWA 3F2CA 2ZIDA 5I7GA 3EX6A 4Q8WA 1QHZA 1E6SM 5E70A 1J2WA 1QPNA 1GW9A 4Z08A 3L5MA 2E8YA 1YPIA 1V03A 1W8SA 4O28A 5DCEA 1VF8A 4MGGA 3BK0A 4Q7BA 1WDWA 1HO1A 2PSNA 1POKA 4Q6XA 1ZK6A 3NRKA 3WDHA 4PFMA 2HVOA 1J10A 2V38A 3B8UA 5AC6A 1K4GA 1RK5A 2ZA2A 3CU2A 4TX9A 3GVWA 4ZOEA 4LBUA 4IT6A 1KRAC 3EX1A 4DZHA 2WW5A 4PB5A 4IQDA 5FL1A 4N9BA 3AYTA 2QJJA 4U5IA 4JOMA 1GTEA 1HKKA 3CT7A 3I65A 1IT8A 3S9YA 3I6RA 4DEFA 2QGHA 4R9OA 3R2GA 3K5XA 3FJ4A 2G3IA 3WJXA 4C6DA 3VAVA 1TJPA 5AYIA 3LBOA 1JIBA 4XZIA 2XP9A 4G1KA 2DP3A 3TUUA 2DIJA 1F3WA 3HGOA 4W5ZA 1C29A 4HU3A 4GCAA 5DFAA 5IOBA 3S5SA 4NT0A 1FWRA 3QV8A 1BKHA 2BSLA 3KX6A 3G1RA 5LXEA 3QJAA 4S39A 1TV4A 3H70A 3L68A 3TXZA 1XISA 3FYPA 3GR8A 3ME3A 1CNVA 3EGJA 3KS5A 3ZWSA 3RUBL 5CC6A 4D8AA 1KCXA 2J74A 4KKXA 4HK7A 5HR6A 2GJXB 2RJHA 4M7TA 3QZEA 2EO7A 3YPIA 3FYYA 3M07A 4JTEA 5L6UA 2ACSA 3MP3A 4EAYA 4RX0A 1UOZA 2VWTA 4RDZA 1R9YA 4NYUA 2OO6A 2JE8A 4BQ2A 2QJNA 4ZPVR 3P2VA 3URBA 1FH8A 1VJSA 2OWXA 2EPNA 1KLZA 3THUA 1DWGM 4FXJA 4C60A 1TE1A 1HX0A 2IS7A 4TUFA 3PZTA 3GU1A 4PEKA 4LNYA 1JPHA 2NVAA 2QDGA 4Q8QA 3W7MA 3Q45A 4ADUA 3C86A 3MHGA 1BL4A 3WQ6A 4OTKA 2QCHA 1KXVA 4C6MA 4HNCA 5DF0A 5L9FA 5HW8A 2NQLA 1UR0A 4NZFA 4IF2A 4HNOA 2INZA 2V69A 3VIKA 3TV8A 3AS0A 1KR1A 4I9MA 3FW6A 4XG1A 3W1AA 3L0NA 4HBOA 3NQFA 1QT1A 1ME8A 2V3DA 4HNVA 4HNLA 3DC8A 1W9UA 3GDMA 1GCYA 3WBEA 3KVJA 1E4LA 4JYFA 4HZ7A 9RUBA 1C7TA 3CUZA 1OC7A 2WZTA 5FSDC 2PDPA 3TYBA 1TRDA 3QR1A 1S1PA 3GTHA 3GG0A 1D7JA 3UWEA 1VJIA 4YTUA