4MPKA

Crystal structure of the complex of buffalo signaling protein spb-40 with n-acetylglucosamine at 2.65 a resolution
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of the complex of buffalo signaling protein SPB-40 with N-acetylglucosamine at 2.65 A resolution
rcsb
total genus 120
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4mpkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mpkA01
2BY3A 5CSUA 4D1IA 1QOXA 4CD4A 3N9KA 2XVKA 5D9MA 3WSUA 1VF8A 2XJ7A 3BAWA 2UY4A 3HMCA 5CPTA 3SCNA 3SCTA 2CNCA 3FAXA 1FA2A 5A94A 1HF6A 3WNKA 4D6HA 2DPEA 3WMCA 3WD3A 3VX1A 1V3LA 1J01A 4W87A 1W9XA 3EYPA 4UTFA 2WKLA 3POHA 1W9VA 3WF4A 3VGHA 2YLAA 1BYDA 3SUVA 1HKKA 4WSJA 4F79A 3SUSA 2CESA 1A47A 1XSIA 1C8QA 4ATLA 1UWRA 3GNPA 3WUEA 2D3NA 2VQUA 2ZUMA 3ZT5A 3K8KA 2WBKA 4Q7NA 1HVXA 2G3NA 4V28A 3TTOA 3G6LA 5E0CA 1MWOA 4GZJA 5D9PA 1OB0A 3OLIA 5D8ZA 5CPSA 4TX6A 1JYVA 3QOMA 2J7DA 1TR1A 3GXDA 4UFJA 1JIBA 4W89A 1VRXA 4NRSA 1BFNA 2XGBA 3W4RA 2VX7A 3AIEA 3WENA 3AFBA 3SCSA 4MDPA 3GNRA 1XCWA 1UYQA 3VIIA 2QPSA 5LA0A 2E9LA 2WMFA 1WAWA 3PZVA 1J0KA 3DHPA 4WK9A 4F66A 2WK2A 4NSBA 4H41A 3AQUA 2Y24A 3MKKA 5A8PA 1E1EA 4R27A 2XFFA 3AROA 5A2BA 4KGJA 1CPUA 4EAMA 2WMIB 2O9RA 1GHSA 3FW6A 1XYZA 3RCNA 3BAIA 4HZ7A 5CG0A 4JL1A 1WZLA 3W0KA 1PJ9A 4QCEA 3W29A 1KXQA 3AISA 3VGGA 2CBUA 1E71M 2DQXA 2DH2A 4M29A 4PYSA 1EDGA 3SCWA 3WQ6A 2Z1KA 1PX3A 4CVWA 4P7QA 1BYCA 2XFYA 1DWIM 3BMVA 3NIYA 3T08A 1ITXA 3CTTA 1E73M 1HJWA 1CLXA 5D4YA 4H8HA 4AZ7A 1JZ7A 1LG2A 1LWHA 4QFUA 1W3JA 3AZRA 3WEMA 2XIBA 1QNOA 4M81A 2VTFA 2XSBA 3WEZA 3ZIZA 5ABEA 1W9DM 1UKPA 2XVLA 4GQQA 1V02A 1WO2A 4HU8A 2EEXA 2W62A 5A6SA 1LLOA 4KH2A 4MNKA 5CSYA 1M01A 1V3HA 1DWJM 1X6LA 1OWQA 2VCAA 1GQIA 2V3FA 3AMGA 4XB3A 3GH5A 3VU2A 5HBFA 4JFVA 4F8XA 3ARRA 5DEZA 3AZSA 2VZVA 4C7FA 3F5JA 1MFVA 4PMRA 4CCDA 1EQPA 3KL5A 4UNIA 3CUJA 4TTUA 2WVVA 2DH3A 4ZE5A 3TP4A 2GJXB 2Y8VA 3WDJA 2CHOA 4PTVA 3B9AA 4W7UA 2JALA 1BLIA 4N42A 5I6SA 2QLYA 4J3WA 4M8UA 4YHGA 1E5JA 4GQRA 4EKJA 1B3WA 6A3HA 2YL9A 2VC9A 3RJXA 2GUYA 3AICA 3NSNA 4PMQA 3ARWA 3UERA 3MMWA 5ECUA 2XM2A 1MW1A 1ZU8A 2UY2A 3PN8A 1ISYA 3T0DA 3VGBA 4L4OA 4DM2A 3OG2A 4QLKA 4M24A 1GOKA 1BG4A 2FH6A 3M6DA 5LA1A 5D9NA 3NDZA 1ISVA 2YBUA 1J0ZA 4GZIA 3WBAA 1B9ZA 2WZIA 3FHQA 2CEQA 4J7RA 4HZ8A 4MNJA 1E6XM 1NOWA 3LPFA 3A4AA 2PBOA 1V03A 2J7GA 1OD0A 3ARUA 2ZE0A 1VAHA 3WH8A 1R7AA 2DSKA 4MAZA 3WNPA 1HKJA 1XH2A 1CGXA 1WDPA 2C0HA 4JKLA 2ZUUA 1W1YA 4UQAA 1QPKA 5A6LA 3U7BA 3ZT6A 4H04A 1D3CA 4U3AA 4H8UA 1CGVA 1OGSA 4W8AA 3F5LA 3M46A 3WQ5A 2J25A 2VMFA 4PTWA 1VENA 4W86A 2EBNA 3SUUA 5CZKA 5JH8A 1XSJA 1E0WA 1TUXA 5E6ZA 3AIWA 3N18A 3DYMA 1JNDA 4JKKA 1CTNA 1AVAA 4JFSA 2Y2WA 1PX8A 1W9UA 3FY1A 4MDOA 1MW2A 2WVUA 2ZICA 3EMQA 1CGYA 4AEFA 5BXRA 4D72A 1KFWA 2ZXQA 3ZJKA 1BYAA 4D6EA 7A3HA 2CIPA 3CHEA 4JL2A 4PMUA 2WLYA 4B9ZA 3CZ8A 3FHAA 5KEZA 2WCGA 1JXKA 4JFWA 1UA7A 1DEDA 3D5HA 3CBWA 3AS3A 2WANA 1GOWA 5A8QA 3BAXA 5HNNA 1M04A 1ZBCA 4PSPA 2J7EA 1JF5A 3N17A 3DC0A 1OT2A 1E1FA 4BS0A 3GBEA 3WH5A 1WZAA 1B31A 4XX6A 3ZSSA 1QW8A 2O92A 3PZTA 1OBAA 4D6JA 3VGEA 1ESWA 2VZUA 2VURA 4A3HA 1EGZA 3ARPA 3IJ7A 1AQHA 4RE4A 2BV9A 4JHOA 1DHKA 4V27A 1J0JA 3N12A 1WDQA 4NF7A 3ARVA 1MYRA 3PZOA 1I75A 2PI6A 1VJZA 3BSHA 3BLKA 4E2OA 4P8WA 1UR0A 3OIHA 4AZGA 1OGBA 4XV0A 2WBGA 3MV11 7TAAA 2WC4A 2D0FA 1JZ4A 1S46A 4HPGA 4BF7A 2IXVA 3RM8A 3WUBA 3ZR6A 5FL1A 4OBRA 5TD4A 2HVMA 3AIBA 1E6SM 3HN3A 4HP5A 4NI3A 1BHGA 1UR1A 5I79A 3SURA 5KZ6A 4W5ZA 2RGLA 3VX0A 3DECA 3RPMA 3VMPA 3GNOA 1GVIA 4AYSA 4PMDA 3SCPA 1TA3A 1H0GA 4IISA 2VZTA 5GNYA 2ZOXA 1QI2A 3QOKA 4UQDA 1C7TA 5C71A 4AZIA 2ZUWA 2FHCA 5JIPA 1O7AA 1DWFM 1TCMA 3NYDA 4FLSA 3VINA 1E6QM 4EANA 1E9LA 2D0HA 2PWGA 7CGTA 3WDIA 2A3AA 1F4HA 2FHBA 2ZX7A 4ZXOA 3GH7A 2YDQA 3S6TA 1VJSA 2G8ZA 1W1VA 2ZXAA 1BGGA 3PZNA 4LX4A 1CENA 4AZHA 2WVSA 1G01A 1Q6CA 4AZCB 4GIAA 3UR7A 1V6YA 5E09A 1VEOA 3A47A 2E8YA 4MNLA 2XSAA 4BQ5A 4J3XA 1VFFA 1WDSA 1AQ0A 2J7FA 1JDDA 5A2CA 3AI0A 1XC6A 2DSUA 2UY3A 5M17A 2GDVA 3VD7A 1ECEA 2WMKA 3NSXA 3IAPA 4HOWA 5A2AA 3SIMA 2CBVA 1UD3A 2XVNA 3UEQA 4U31A 3APGA 2BHYA 2JFEX 1PPIA 2ZWYA 3DYOA 3NJ3A 1J0HA 1NOUA 3K8LA 1B0IA 3PBGA 4AZ5A 1R87A 2WHMA 4ZENA 3L4WA 2XIIA 4KMQA 4PUEA 4H8VA 1H41A 1NQ6A 1WDRA 3W6LA 3G6MA 4JAWA 4UQCA 3DHUA 3ECQA 3WF2A 4MPKA 3T2QA 3VIFA 3K4AA 4PMOA 4CGTA 4MADA 1JZ5A 2X1IA 2CKRA 2WSKA 3WF1A 3KZSA 3VMOA 1JZ6A 3A4WA 4IM4A 1C92A 3VDAA 1UR2A 3WH7A 1KXTA 3WMSA 1J18A 4UFMA 3AZTA 1R8LA 2E8ZA 4MJ2A 1QBBA 1NWRA 1JDAA 2BXYA 4AZCA 3BAYA 3OGVA 1MQRA 3LPOA 1RPKA 1J10A 3ZQ9A 3GXMA 1YHTA 4F9JA 5DO8A 2YA0A 3W25A 1CGUA 3VKKA 1JZ3A 3N15A 4P7LA 1KGXA 2WKGA 4OKDA 2X09A 4U33A 2WWCA 5CXPA 3VIKA 4D6CA 4X0VA 1X6NA 1VFUA 3WY1A 2W4XA 2OLHA 4GI6A 4IPNB 2A3HA 3OZOA 4Z2GA 2D2OA 2J78A 1B90A 1GJUA 2Y4SA 1NP0A 2PF0A 4PUDA 5A69A 2CKSA 1BF2A 3OGRA 1V0KA 1UD6A 3SUWA 3CZJA 3AYRA 1E5NA 2J8FA 2DSVA 2CHNA 1M7XA 1W2PA 1U2YA 1Q6FA 1W9PA 4JHZA 3WNLA 1XCXA 5A6BD 4HA1A 3S2CA 3AHXA 1B3ZA 4PMZA 3WFZA 4CU8A 3E1F1 2OSXA 5FD0A 3WDHA 1OT1A 1OD8A 4EK7A 2XVPA 4ACZA 3EMCA 4CD5A 2C8NA 2WYSA 5GNXA 2F61A 2XWDA 3WNOA 2J62A 2YBTA 1W91A 2WVVB 4LPCA 3CHDA 5IHRA 1JL8A 4X9YA 3RILA 1PIGA 1MXGA 3BH4A 3FN9A 2NT0A 1QBAA 5I0DA 3WNMA 2VT0A 1Q4NX 4LXFA 2J8GA 1EOMA 3U7VA 1CDGA 2YDRA 5E0FA 2BFGA 2OSYA 4PRWA 3EBVA 3GTNA 1R86A 2J7HA 4BQ4A 2VCBA 4W85A 2PWHA 1QW9A 1UR4A 5CGMA 2V3DA 2WCAA 4DM1A 4RL3A 4OIFA 4U2ZA 4D6IA 3NUKA 3OA5A 2QMKA 3OGSA 5FOOA 3AIRA 1G9HA 3GYCA 2PWFA 2XVGA 5AC5A 1J0IA 3RDKA 4D6FA 3GBDA 1Y7VA 4XZWA 4Z2KA 4UCFA 1EQCA 1GOOA 1OSEA 1HJSA 2O9OA 1BG9A 2FHFA 3PTMA 1CXLA 1UD2A 4WJXA 3N13A 1SR0A 4BCEA 4BQ2A 3WKZA 5EFFA 1US3A 2XFRA 1D7FA 4M56A 4CUCA 4B9YA 1UWQA 1OIFA 2WSPA 3AIVA 2X2YA 4GINA 5DF0A 2A3EA 4AD2A 4AY1A 1UQZA 1RP8A 5E9AA 2O9TA 2W66A 2WMJA 3GH4A 3N04A 5CLTA 1UKOA 2WB5A 1JI2A 1FOBA 1CGWA 5D9OA 1JYXA 3EDKA 1WE5A 1G0CA 4AISA 4YPJA 3T2PA 1JZ8A 1WNOA 3WH6A 4UZUA 1YQ2A 1HXJA 2ZX5A 1U33A 1UKTA 2DT1A 1HL8A 1JYNA 1VBUA 4HOZA 1KBBA 3PZUA 3K1DA 4LQ1A 2VX4A 5LYRA 2GDUA 2VZOA 3WELA 1GHRA 1TG7A 4LGXA 3HJEA 2GJRA 1A3HA 4U3CA 4B3LA 3T2OA 3RMEA 5I78A 3B8SA 4TOQA 1UR9A 2Z1SA 2WXDM 1FH9A 1B3XA 2ZUVA 1DP0A 2WHLA 1WZMA 2ZX9A 4FK9A 4WKHA 3AHTA 3AMCA 4MJ4A 1Q6GA 2G41A 4D71A 1JNEA 2VOTA 2ZUTA 4Q22A 1VFMA 2PWEA 5FL0A 2GSJA 1G5AA 3AHZA 3PZMA 1EO7A 1ISZA 1LQ0A 3ZJ8A 1CZ1A 5ABGA 4CD6A 2O9PA 2BHUA 3L4XA 3CMGA 4HOXA 1LL4A 1E3XA 1ODZA 1N82A 3A4XA 5HPOA 1WPCA 3RIKA 2UWFA 3VM5A 4MB3A 3AYSA 1VBRA 3VIJA 1ISWA 1IV8A 2ZUSA 3LPPA 3AXIA 4MAVA 3AHVA 4D6DA 3CUIA 3OLGA 2G3JA 1FFQA 1GCYA 2QMJA 2EPOA 2VRQA 4PMVA 1NH6A 1BAGA 4S3KA 3VGFA 5BXSA 2VRJA 1E0XA 1GONA 2PB1A 1AMYA 3CHFA 3L4UA 3MMDA 1E6PA 1UWUA 2X0YA 2ZIDA 1V0LA 3ARQA 3CZEA 1I1WA 1XSKA 4HU0A 3WN6A 1V3JA 2J75A 3NDYA 1UHVA 3CGTA 2Y8KA 2A3BA 3IJ8A 1CIUA 3A3HA 4P8UA 1KCKA 3VNYA 4P8XA 2D24A 4QLJA 4GPNA 5CJ5A 3GXFA 4ZEPA 2EPMX 4H7VA 4L4PA 1FHLA 4EE9A 4TVUA 3CO4A 1QI3A 2OWCA 2AOSA 1M03A 1B3YA 3UCQA 1FH8A 3VD9A 2YA1A 1H2JA 1KR1A 1E4LA 2DT0A 1TA3B 4QDMA 3M07A 4F9DA 4PEEA 1HKMA 1KB3A 1GQKA 2E3ZA 3WD1A 1UUQA 1OCQA 4HPHA 3B9DA 1E6NA 1E6ZA 1TFVA 4GI9A 5I5RA 5DT5A 4BQ3A 3VNZA 1J11A 3EDJA 3WBEA 4KRTA 3MS8A 2Y5EA 1ODUA 1UA3A 5IFTA 2CYGA 2GJPA 1V0NA 4PMYA 2VUYA 3VIGA 2ZWZA 1KQYA 1EOKA 4XUYA 2D3LA 1HJQA 3UR8A 1H3GA 3LPGA 5JBFA 1SMAA 1ZL1A 1KQZA 1V6XA 1BTCA 1BVZA 3WD4A 3AOFA 4XZBA 1B3VA 1DWGM 2ZUNA 4WLCA 5GNZA 3BLPX 3FXYA 1JFHA 1ZJBA 2D22A 2WC3A 1W32A 2J74A 2NW0A 3RM4A 1NOFA 8CGTA 5F7UA 1GUVA 4P7OA 3ZT7A 2X05A 1XV8A 1E70M 2YLLA 4AD3A 4CN6A 2DT3A 3VD5A 3ALGA 2JIEA 1DWAM 3CLWA 4TXEA 1CECA 1WKYA 4WSKA 3W28A 5ABFB 3TONA 2BVYA 1ZB5A 1UZ1A 2Q8XA 4U2YA 1J9YA 2PC8A 2BY2A 3QGVA 3CUGA 4UR9A 3WIJA 1ZBVA 1MW0A 5HPCA 1E15A 1HJUA 4W7VA 1HP4A 1RP9A 3AJ7A 2E9MA 3ZMRA 1JXJA 3L4ZA 1L0PA 4DWSB 3GDBA 2AMGA 3SCUA 3RJYA 2ZX8A 3UG5A 5BWFA 4AD0A 3MU7A 3MUZ1 1P6WA 2BHZA 2DSZA 1PX4A 1C7SA 2XTKA 2V5CA 3BSGA 1GZJA 4ATDA 1EH9A 1SYTA 1H49A 1UKQA 5I24A 1HJVA 3IAQA 4OOUA 1E55A 1CGTA 2JF6A 1E4IA 1UH3A 4OOZA 3AMKA 4UFIA 5EBAA 3ZJ6A 1MQPA 4M80A 1HL9A 3J7HA 5A1AA 4CU6A 5I2UA 2WM0A 2BXZA 3L2MA 4LYRA 4CU7A 1E72M 3NCOA 3POCA 5GQBA 1QVBA 4Z2JA 3WMBA 5AY7A 1J0YA 4HMCA 2NT1A 5C8BB 4IPLA 5CLWA 1EDTA 4AEEA 1WCGA 5AYIA 4BZYA 5ABFA 3CZKA 3O2LA 1VIWA 2DSWA 1GOQA 2WC7A 2WW5A 2CCRA 4CD8A 1GQLA 4WKFA 1G94A 2IXUA 1XD0A 4W84A 1K6AA 3TOPA 3MSDA 6TAAA 4W8LA 4S3JA 4WF7A 3M7SA 4AIOA 2E0PA 4DWSA 4ACZB 5A6JA 3ARTA 1UD5A 1KR0A 1GNXA 2VVNA 2CBJA 1E3ZA 4IUGA 1MVYA 4N0RA 3AXXA 3OLEA 2DIEA 4Z2IA 1KCLA 3IJ9A 4J3UA 4WKAA 2YL5A 3PZ9A 3UG4A 9CGTA 4J28A 3VD3A 1KXVA 4LYPA 3VDHA 1EIBA 3ZOAA 3ZM8A 4OZOA 3EDDA 1PZ3A 3OZPA 3KL0A 3AS0A 2FH8A 1KGWA 2F2HA 3L4VA 1NWUA 5FKYA 3SCRA 1ZBWA 1X1NA 4J3VA 1V3IA 1MFUA 4NRRA 1BYBA 1LF1A 3PZGA 1MQQA 1K9EA 1UWTA 3N11A 4OJYA 4UQ9A 4GO9A 1B2YA 5JIWA 3CUFA 4J3TA 2VCCA 2EPKX 3SCQA 2GK1B 3CHCA 1OM0A 3SCVA 4A4AA 3ARXA 1NWSA 3WDRA 2DIJA 1H4PA 1HKIA 2WWDA 1WB0A 4R5EA 1PEZA 1ISXA 1RH9A 1E6RA 3UG3A 3II1A 3TTQA 1M53A 1XH1A 1HNYA 3GXIA 4AXNA 4ATWA 5ABHA 1QI5A 2VL4A 2X8RA 1FH7A 4ZXLA 3EDFA 3WDQA 1PBGA 4K68A 1UQYA 3AMDA 4PCSA 3SCOA 4E8CA 1KWGA 4Z2HA 4U5KA 4MB4A 4CN4A 3CZLA 2J47A 4M82A 2E9BA 2YKKA 1W2VA 2F8QA 1BGAA 4V2XA 5A6BA 1XYFA 2J4GA 4AD5A 4KGLA 3W38A 5BROA 1QNQA 3PHAA 4J3SA 2E40A 3BAKA 4AWEA 3A6OA 4QP0A 1JG9A 2NSXA 4TVDA 4WIWA 2BNJA 5IXEA 3BCDA 1E4MM 1UWSA 6CGTA 1XH0A 3PTKA 2ZXBA 5A6AA 1H1NA 1C3FA 2V3EA 5LA2A 2AAAA 4GI8A 3DYPA 3VUPA 3N1AA 3VPLA 3ARYA 4D6GA 3ARSA 2YOCA 2JE8A 4HTYA 2GK1A 2YDSA 4HA3A 2DGAA 5BXPA 2YJQA 2BY1A 2MANA 2W61A 2GFTA 4M1RA 3U5YA 2CETA 1PAMA 3WQ4A 3GM8A 3WEOA 2G3MA 1KBKA 2YIHA 2WVTA 4UQEA 3MO4A 1K9TA 4RE3A 4JIEA 4ZE4A 1IZJA 3WQ8A 4PMNA 2D20A 5HOSA 1HJXA 1CXKA 1JFXA 3LMYA 1IT0A 3F5KA 1FFRA 1US2A 1QHZA 3CMJA 1UH4A 1MXDA 2EO7A 4ACYA 2JIWA 2A3CA 4OBSA 2WCSA 1PIFA 3W6MA 1H0IA 3K8MA 2OYMA 1EO5A 2OYKA 3AS2A 4GO8A 2J7CA 2DT2A 2FGLA 3WF3A 2BY0A 4TTGA 1W1TA 2YA2A 1MW3A 3O6AA 1V6UA 1H09A 4UFKA 1JF6A 3SEPA 5A6KA 1NM9A 4AC1X 2WMIA 5AC4A 1SMDA 1BPLB 1V0MA 1O6IA 1JD9A 1L8NA 4E8DA 5IHSA 3OLDA 3K46A 1XHGA 1CEOA 4RE2A 1CWYA 4UFLA 1TE1A 1JAEA 2VVSA 4AD1A 2OWXA 3ZJ7A 4W7WA 1HVQA 1C90A 2PBGA 2JEPA 1EHNA 3THCA 1VB9A 1HN1A 4JZ5A 1UH2A 1NARA 1Q6EA 1KXHA 2XUCA 3WL1A 2XYLA 3VGDA 4D1JA 1EDQA 1QHPA 2XGIA 1W3HA 2OSWA 1HP5A 1ZS2A 4W8BA 1GW1A 1G1YA 1UD8A 4C7GA 4TX8A 3VDBA 2VJXA 2VX5A 5A8NA 1UD4A 1VEPA 1LJYA 3ARZA 3WL0A 2EXOA 3IK2A 5EMYA 3GZAA 4B3KA 3T0BA 4QAWA 2X0HA 4W88A 3QHNA 3CPUA 2JEQA 3KE0A 4UOZA 3L4TA 2PWDA 2YL8A 2QF8A 4QLLA 2VZSA 1C8XA 3ZO9A 1JD7A 1DTUA 4TUFA 2HISA 4MNMA 4CCCA 2VR5A 1GORA 3MV01 4AZBA 5FIPA 2EPLX 1JZ2A 1W3KA 4P8VA 4FLQA 4HMEA 1EXPA 2XHYA 4PN2A 1TMQA 3MMUA 2CERA 1KGUA 5JUVA 4UQBA 3OBAA 1GVYA 4CD7A 4W93A 3AIUA 2VO5A 3CUHA 5M03A 3VILA 4UFHA 4AMCA 2ZX6A 4DUWA 4MTVA 2BVDA 5DMYA 3D3AA 4OUEA 2WPGA 1FP9A 2WHKA 4UZSA 1LWJA 2GJXA 2WZHA 1BQCA 2W91A 4YN5A 1NWTA 4A3YA 5M5DA 5CPQA 1JI1A 1OINA 1TVNA 1WP6A 5A8MA 3PTQA 1GQJA 3VTRA 4HMDA 2G3IA 3BC9A 1R85A 4UOQA 2CITA 2D1ZA 3ZSTA 5A8OA 2V38A 2QHAA 4CVUA 1B30A 1E56A 2D23A 2XWEA 3BMWA 1E0VA 4Y7EA 1K9FA 4P7NA 3CZGA 3QHOA 3AMLA 2G4FA 1BSIA 2WHJA 5CGTA 3ZR5A 1QNSA 3BGAA 4AIUA 4MB1A 3W37A 5JBDA 4PTMA 5I23A 4HZ6A 4KRUA 3TTYA 2ZXDA 4JKMA 1CYGA 3I3DA 3KEHA 3T0AA 2V3GA 2RGMA 3UETA 3SUTA 3W82A 3TTSA 1CXHA 1FP8A 4PTXA 1W3LA 1PZ2A 2J77A 2DEPA 2JF7A 5IDIA 5A3HA 5FCZA 2W63A 4H2CA 5I3DA 5A95A 1V6VA 4QCFA 5D8WA 2QV4A 3VIPA 1AQMA 4URIA 3PZIA 1XRVA 1VEMA 2OYLA 3U5UA 3VD4A 5I77A 2ESCA 1BVNP 4FF5A 4CCEA 3QHMA 1W1PA 2WMGA 1UG6A 1JDCA 2VI0A 1LL7A 3VIMA 3W81A 3BXWA 1V3KA 4LYQA 3VIHA 3WUGA 3WNNA 1E4NA 1OGGA 5BRPA 4TVCA 4MB5A 3IANA 1HIZA 2WNWA 1CXEA 4ZFMA 2GVYA 4B15A 3MANA 2WAGA 1XD1A 4PCTA 3MSGA 3RM9A 3WFLA 3VOCA 3AXHA 3KL3A 3VDCA 1E40A 1CXIA 3W27A 1V08A 3AS1A 3EDEA 5BRQA 1K9DA 4PMXA 4AD4A 1B1YA 4DUXA 4AIEA 1CXFA 3QR3A 3W24A 1R7OA 1C8YA 3WF0A 5BCAA 1SFSA 4JCMA 1GJWA 1GOIA 4ML4A 2CXGA 4AW7A 1EHAA 3VIOA 3KWXA 2WZEA 1EA9C 1HX0A 1QNPA 1V6WA 3B9EA 3L4YA 1H11A 4BA0A 4JCLA 1GPFA 4FLOA 3MUAA 1NP2A 3TA9A 5GPRA 4HA4A 3JUGA 5BYWA 1VFOA 3ALFA 5EB8A 4GZEA 3VM7A 1F4AA 5HXMA 2BVTA 4E4PA 3WH9A 3W26A 3WD0A 4X0NA 2D0GA 3MUIA 5IFPA 1LL6A 1OIMA 1UOKA 3K4DA 2C7FA 4J27A 1QI0A 4P7RA 3EMZA 4AZ6A 2FGZA 5E6YA 1ZBKA 2WMHA 4DWSC 2J7BA 2XG9A 4W5UA 2VNCA 3AIQA 5EFDA 4U5IA 2J79A 3CH9A 1TZ7A 2EJ1A 3PZQA 4C7DA 1RD6A 3U57A 1V02E 3UESA 1WZKA 1UR8A 2UY5A 2QPUA 2B31A 4PSRA 4UOJA 4KWUA 2EQDA 4JFUA 1I1XA 4GXPA 1HT6A 2W5FA 4YHEA 2BS9A 5CQ1A 1CLVA 5M3WA 4FMVA 5AYBA 3NSMA 1D2KA 5DFAA 1JAKA 4PBGA 2DDXA 2OWWA 8A3HA 2EPNA 4NZCA 1JYWA 1Z32X 1QI4A 1QNRA 2TAAA 2W92A 1KWKA 1ITCA 2YL6A 1CNVA 1IZKA 1Q6DA 3W53A 2VRKA 3AHYA 3MUY1 1FHDA 3F4VA 3THDA 3O9NA 3HU7A 1J12A 5E70A 1DWHM 2FDMA 2VR4A 3BCFA 3L2LA 2VX6A 3RO8A 1W9BM 2V5DA 4B16A 4CKQA 1H5VA 4DWSD 2XPKA 5C70A 3VMNA 1V3MA 3T09A 2CBIA 3VO0A 3WD2A 1U30A 4CN1A 3FNDA 1JGIA 2VQTA 2CPUA 3VVGA 2W67A 3WDPP 1TVPA 3I3EA 3FAWA 4FLRA 1LG1A 3WQWA 3BAJA 5JBEA 1ZJAA 1UZ4A 3OB8A 2IUZA 3WQVA 1GOMA 2E4TA 1C91A 3CIVA 4DUVA 3WUFA 1CBGA 1UWIA 2XM1A 1C93A 4GKLA 1QHOA 1XGZA 5DT7A 1UKSA 4JFTA 5A6MA 2WLZA 5BXTA 3I3BA 5HDRA 4Z2LA 1E43A
chains in the Genus database with same CATH superfamily
7ENLA 2Y1HA 5CSUA 4D1IA 1QOXA 4L65A 3DG6A 3FK4A 2QUVA 5D9MA 1LBMA 2I5IA 2XJ7A 1M6JA 3BAWA 3SCNA 3HMCA 4AUBA 1R3WA 3KUMA 3WNKA 4D6HA 2HE5A 4JTAA 3GDMA 3WD3A 3VX1A 3ICJA 1W9XA 3EYPA 2OG9A 3REQA 4DI8A 1WXJA 4O0ZA 4ZQMA 3N14A 2QDEA 1PYFA 1W8SA 4F79A 3TMLA 3NZGA 1EUAA 3QYQA 5EMKA 3SUSA 2CESA 4ATLA 1P7TA 3LGEA 1O12A 2VQUA 4YU1A 3ZXWA 3O7UA 2R9RA 4RNIA 1SJAA 4DY1A 1X8FA 3TW7A 1IEVA 2PDFA 1MWOA 4GZJA 1X8CA 3O1NA 5D9PA 1OB0A 3OLIA 4DJFC 4LUIA 3RLGA 3QOMA 2J7DA 1IXNA 2ZQTA 5CBBA 4XISA 3W7PA 3GTFA 3WENA 1XBXA 4H6KA 3GNRA 3S46A 3VIIA 4WSHA 2E9LA 2WMFA 1WAWA 2FKPA 3NVTA 3P84A 1OFRA 1WDWA 4GY1A 5U4NA 3LMZA 5HR7A 1KD0A 1UPMB 2Y24A 3PPHA 5A8PA 1VQTA 1VPQA 3BW2A 1Z3NA 1BWKA 3WLRA 4EAMA 1K6WA 1TIMA 2ZTJA 3RCNA 3UWZA 4HZ7A 4R53A 4FSAA 1GWJA 2CLPA 4JL1A 4CCZA 1EC7A 4QG6A 2XIMA 1PJ9A 2DUAA 3HBLA 5SWUA 3PP7A 3AISA 3MVIA 4S3CA 4GBDA 2PC4A 4M29A 2CW6A 4PUNA 3KLLA 2VEPA 1LWIA 3LV5A 4CVWA 3NIYA 3DHDA 4M0XA 2RUSA 3WEMA 5C2XA 2XIBA 4M81A 1HW6A 2GUBA 2VTFA 1RY8A 2AQVA 4JFMA 1UKPA 2EEXA 1NF7A 4H83A 4PB4A 5FJRA 3KVMA 2ZA3A 4LH8A 3GU2A 1OWQA 4HSOA 4NI8A 2PGWA 3AMGA 3GH5A 1MUMA 5HBFA 1ONXA 2PDKA 1MZRA 2F21A 1ROTA 2R8WA 4WDWA 2HNHA 4UNIA 4QE5A 4TTUA 2WVVA 4FOJA 3S1WA 3KBSA 4PZVA 5EA9A 4PFMA 4PA8A 4S3FA 3LSCA 3D6NA 3MPGA 2O7SA 3UQAA 1KT1A 1BLIA 3G5EA 4FX6M 5I6SA 3BMXA 3LA4A 2QLYA 4M8UA 4C5ZA 4I7VA 4GQRA 1Z9AA 3ZVHA 5LIUX 4KW2A 3LLFA 1IIHA 6A3HA 4BR1A 2YL9A 1RQEA 3AICA 3NSNA 1S5TA 3ABOA 2BOEX 5D2WA 3K1GA 1U22A 2BSLA 3CV2A 4I8DA 1ZU8A 3B03A 3ENLA 2UY2A 4RNJA 3PN8A 1KM2A 1XFCA 4O14A 3VNLA 3W7OA 1K8CA 4L4OA 1FCVA 3W1RA 3SN0A 5LA1A 1TKKA 1E0TA 3NDZA 4HU3A 2YBUA 1J0ZA 2PCEA 1B9ZA 3VCNA 3FHQA 4J7RA 3S1UA 1E9IA 3NZQA 1RVKA 3V4BA 4MMWA 3APYA 2EF9A 1M65A 1V03A 5FSEC 5G4EA 1V5XA 5BMWA 3UGRA 1XH2A 1YLVA 1T0OA 4EAYA 4GFSA 4UTLA 5CPOA 3UNDA 3TOYA 1VP5A 1Q5MA 4HA0A 4YTQA 4H8UA 1R9XA 1H51A 3TAKA 3M46A 3GSMA 2R91A 1RHCA 1VENA 2EBNA 4ASTA 5CZKA 3VZZA 5JH8A 4TR9A 1TUXA 3ZS4A 1YNQA 3OIXA 3WBXA 1JNDA 5D2YA 2OKTA 4JKKA 1CTNA 1J6PA 1KCZA 3O15A 1CGYA 1KFWA 3IKGA 2VFDA 3ZJKA 4HU4A 2Y8UA 3CT7A 4CNUA 3CHEA 4IX0A 2FZDA 4JL2A 4PMUA 4LVAA 3NM1A 1LP6A 2PUZA 3UQIA 3W1AA 1U83A 3SGZA 4DRIA 2PTDA 1R30A 2LPVA 2I7GA 5KEZA 1JXKA 1OFDA 3D5HA 1GOWA 3BAXA 6XIAA 4JPGA 2ISDA 4W4QA 1XF0A 3LUOA 2P8BA 1FCBA 1TWSA 2DZBA 1V51A 3HGJA 3N17A 4YJ5A 4C1LA 4GD0A 1VS1A 4O2TA 1OT2A 2PGRA 1I0DA 3V0UA 4ZQNA 5AYYA 3OHMB 1H7WA 3O16A 3ZSSA 3NYZA 3TROA 3PZTA 1GVSA 4WOQA 1S38A 4I5RA 2VZUA 3ARPA 3HPAA 5C2GA 3KTXA 1DIOA 4RE4A 3MMTA 4ZR8A 4JHOA 5AZ1A 3SZ8A 5DCEA 1EBHA 1WDQA 4GIYA 1NY1A 3NFUA 2MF9A 3U3HA 3TN3A 3LU2A 2YW3A 2KAUC 1MYRA 4H4IA 3PZOA 2PI6A 1VJZA 3QQWA 3FYPA 2YFOA 4NAEA 1UUOA 2YR1A 4AZGA 4ZSTA 4HARA 4XV0A 1DJWA 2WBGA 1HL2A 2WC4A 3IHZA 3RM8A 2PWUA 3G1XA 4UTTC 1J4RA 4OBRA 4L7ZA 3EOLA 5AFDA 3IUIA 1E6SM 4DXXA 1W3NA 4NI3A 3UY8A 5CEWA 3QZAA 4ERAA 2K8IA 4W5ZA 1XLAA 3P8JA 1A5MC 5GJMA 4Y9PA 3SCPA 1TA3A 1XWYA 4JQ2A 1E1CA 1QI2A 3QOKA 4LF2A 3MW7A 2PGFA 4LS0A 3ONCA 3W84A 3C2YA 3UJRA 4FLSA 3AWOA 2PDXA 4FF7A 2ZX7A 3S6TA 4ZXOA 3GH7A 2YDQA 2G8ZA 2ZXAA 1BGGA 3OA3A 5H8PA 2GVGA 4AZHA 1AQFA 4GIAA 4JDBA 3SJ3A 2IPFA 1V6YA 2VFGA 4LCSA 2OELA 2HEJA 1FWAC 2V2CA 3AI0A 5A2CA 3OODA 5HMEA 2P88A 4XD4A 3REQB 3BDKA 3C0QA 3E49A 1VCGA 3M0IA 3NPUA 3NSXA 1P7TB 4F4RA 2CBVA 1W5NA 2VEMA 2PURA 2J88A 3UWUA 4AAJA 3H22A 4DROA 1AMKA 4AQLA 2CFFA 2EG6A 2HPMA 3V5FA 3K8LA 1B0IA 3PBGA 4EPBC 1R87A 5HA7A 2NZLA 3SADA 4ZENA 1TPWA 1A0CA 4KMQA 3KDNA 3G24A 1WDRA 2OZ8A 4UQCA 2XPAA 2NX1A 2VFIA 3ECQA 4LB4A 4O54A 4PBEA 3I7SA 3KABA 4KPLA 3KS5A 1JZ5A 3R58A 3ME3A 1POJA 3KZSA 1FXQA 1JZ6A 3EEGA 3U2ZA 2ZDSA 3TQPA 4UIOA 1JR1A 5TNVA 4RDWA 4ZBCA 4O57A 4G6CA 5CZSA 3PBVA 1F05A 2ZBTA 2XPBA 1YNYA 2JBMA 3VAWA 2E09A 3BAYA 4LB3A 3T05A 1XLGA 1UP2A 2GDQA 3C3UA 3LPOA 1FKTA 3TR9A 3TA6A 1J10A 3GC4A 3ZQ9A 4KEVA 3TH6A 4DNMA 4MIMA 4B4HA 2Z1XA 4MFDA 3KZ7A 4GQGA 3MWAA 1DJXA 1FUYA 2YA0A 1IR1A 3VKKA 3LM7A 4P7LA 2VWTA 4A2RA 5FF7A 4U33A 2INZA 5CXPA 3N6QA 1TTJA 3R12A 1AK5A 4Z1DA 2OPJA 3NQMA 2OLHA 4UTWC 5DRIA 4W9PA 4US6A 1GJUA 5DMNA 2Y4SA 4F2TA 2ZZ2A 1BXCA 1W5QA 2ETNA 5A69A 1V0KA 1H62A 5JH2A 3CZJA 1PDZA 3AYRA 1E5NA 2J8FA 4Q4SA 2DSVA 1XIGA 4JY9A 2TODA 2QDGA 2CLIA 2PDQA 3W7JA 3WNLA 3EXSA 3WFZA 2GQ3A 2OSXA 2L2SA 4WY0A 2OFNA 3BLFA 5FF3A 4O0KA 3E0FA 3TK7A 2A7NA 1R47A 3EMCA 3RITA 2F61A 2XWDA 2VC6A 3WNOA 2PP1A 4IIHA 3DFSA 2WVVB 1RA0A 2CLEA 3CHDA 3KHDA 2POZA 4UB9A 2V82A 1AZ2A 4ZVJA 3LQLA 2VT0A 4GVGA 1EOMA 2KX9A 3ZVHB 1AL8A 5E0FA 1EYMA 3SM0A 3EBVA 2D2HA 4MYXA 3BTNA 2J7HA 2WSQA 4DLFA 2VCBA 2VDGA 3PR9A 3B8TA 2UZ9A 2F7FA 1GPWA 1MDRA 2WCAA 4RL3A 4R88A 1SJBA 5FOOA 5AC5A 5EU9A 4Y8FA 3RDKA 4Z2KA 3SRHA 1EQCA 2FIQA 2HV5A 2RQSA 2DZAA 3ABQA 4QDPA 1FD9A 4Y96A 2O9OA 1BG9A 1C8VA 2FHFA 1YMYA 3V5OA 2HNEA 1YXDA 1SR0A 2ACQA 4HCDA 1US3A 4CUCA 3CGNA 3AIVA 1PHWA 2A3EA 2XIJA 1UQZA 1XLKA 5E9AA 1FCQA 2O9TA 3M5XA 1EC9A 2WM1A 3AUJA 3HPFA 2BTMA 2YCLA 3KP0A 1P6BA 1GW9A 5XIMA 3R5EA 4AISA 4EP8C 4YPJA 1RQBA 4C6BA 1YQ2A 2ZX5A 1U33A 5BW6A 4L9YA 1Q6UA 4NY2A 1R0MA 3QH2A 5H8MA 3E2RA 2BGQA 4HOZA 3ERPA 3GG1A 1B4EA 2VX4A 4DRSA 1XL9A 4GA8A 1NJJA 2GDUA 4YWIA 3HJEA 4MLJA 1A3HA 4B3LA 3L0NA 1NFBA 3S2JA 2DUXA 5J5DA 3B8SA 1NEYA 4GYPC 2YZ5A 1FH9A 4IOTA 2ZX9A 4ML9A 3UPWA 1Q6GA 4D71A 2VOTA 3B8VA 1KLYA 1P43A 2IPJA 1QUMA 4LUJA 4C60A 2IKGA 3TC7A 4YCPA 3VOHA 1EUNA 5ABGA 2BHUA 5PTDA 5G1MA 1ODZA 3W7KA 1N82A 4GXWA 2UWFA 4YLWA 4IZGA 3VIJA 3QY8A 4HYRA 4D6DA 3OLGA 1RK5A 3W01A 1TR9A 2QVNA 2VRQA 2NVAA 1WX0A 4H8NA 3LCHA 4ZTYA 1I2PA 4TYOA 5LNVA 2OLSA 5BXSA 2VRJA 4MSPA 1I2OA 5LNWA 3L4UA 2NQLA 1E6PA 2ISFA 3LDVA 1W1IE 3VKDA 1FWGC 3GUWA 4CNNA 4DXVA 3PAJA 1X1ZA 1YPFA 5MKGA 1FKXA 5BNKA 5JU6A 1ZY9A 2V63A 3OOQA 1I1WA 3CM4A 4NAEB 1V3JA 3CGTA 2PZ0A 3TU9A 3IJ8A 3HQPA 3ZYZA 2B7OA 3AAMA 4BJHA 3DCPA 2QR6A 2D24A 1UASA 2WQDA 4HIBA 5CJ5A 3GXFA 2DVUA 3MO7A 2VFHA 3HG3A 2EPMX 3H7RA 3TC3A 4TVUA 1JUKA 4GNJA 1QI3A 3RF9A 1RR2A 2OWCA 1Z41A 3M0ZA 4QNWA 1X6UA 4H9XA 2YA1A 1KR1A 1E4LA 5AVHA 2IKJA 4Z0JA 1TA3B 1ZSXA 4QDMA 3URAA 3GVVA 1E1CB 1HKMA 4WRHA 1N8IA 3VC6A 1V79A 3WJZA 4N2YA 1IT7A 3B9DA 1I45A 3H2NA 1JCLA 5RUBA 3G1VA 2P53A 1J11A 4KRTA 1J5SA 2C19A 4LNCA 1ODUA 3WX7A 3ABSA 5IFTA 2F23A 2GJPA 1V0NA 5FACA 1XLHA 4DH0A 2ZQ0A 3T40A 3LBMA 2VUYA 4KS0A 4LUTA 2ZWZA 3UR2A 2OQYA 3W7QA 5HWNA 1YX1A 1TWIA 2EKCA 3W1PA 3OYXA 3DI1A 4GVFA 1OFBA 1BTCA 4IJBA 4XZBA 4O16A 1MMFA 4RW3A 2ZUNA 3QFEA 5GNZA 3G8RA 4LUYA 1JFHA 1ZJBA 3EB4A 2WC3A 1W32A 5HJLA 2Z7KA 2NW0A 3E02A 1MNSA 3TWAA 3RGCA 1NOFA 5F7UA 1N8FA 3ZT7A 4UDMA 2V5LA 1FKKA 1XLIA 4JNZA 4O18A 2X1UA 4RXFA 4DNHA 4IPXA 2YLLA 5AOUA 4AD3A 5FF4A 3LV6A 1DWAM 4WSKA 1CECA 1WKYA 1R3QA 5LXEA 3W28A 1K77A 3IKDA 4QE1A 1ZB5A 2Q8XA 1H50A 4U2YA 3TEVA 3C0SA 3WIJA 1ZBVA 2C6QA 4Z1AA 3GYEA 4EWJA 1ZP3A 3WH0A 1XPGA 2KO7A 3AJ7A 1ZHAA 3M0KA 2AMGA 1UW9A 3IIPA 2ZX8A 3UG5A 5BWFA 1V8EA 2QKFA 3HGOA 3MUZ1 3D0CA 1P6WA 4ORIA 3BSGA 1GZJA 1LLWA 3URBA 4MKNA 3UFYA 2V5JA 1HUVA 1HJVA 3QGKC 4LEFA 2PU0A 3B97A 3QR1A 4JTSA 1ZUAX 4OOUA 4E8GA 4XO7A 4OOZA 1TZ9A 3AMKA 1MQPA 1DVJA 1Y65A 1D3HA 5A1AA 6REQA 3RLUA 2WM0A 2FFCA 1AW5A 5I3HA 3MCOA 1TWWA 1BXNA 2MLYA 2PRLA 4N4PA 3H2AA 1JJKA 4P2VA 2REQA 4C5YA 3HV9A 4AH7A 1WCGA 3ITTA 1F61A 1JPHA 1AJ0A 2UBPC 1XS2A 1F3WA 3BJSA 4A3UA 1GQLA 3NURA 4RNFA 4WKFA 2PWVA 3USBA 4FAMA 3ES8A 1XD0A 1K6AA 1VD6A 4GJJA 1D8WA 4W8LA 4KKXA 4WY0B 4WF7A 3KAHA 3H2EA 1GVEA 2JKAA 1JDFA 4DWSA 3IV8A 3WK0A 1TV2A 2BZNA 1OJXA 4JQ3A 3RYSA 1H7NA 3BOFA 1X39A 2IPWA 4IUGA 4KESA 4J4OA 3R4IA 1NFGA 3OTRA 3SQSA 3I6TA 1FAPA 3W72A 9CGTA 3DFPA 4LYPA 1X96A 3KXQA 3KL0A 3AS0A 2F2HA 3M0HA 1A5AA 1MO0A 1MQQA 1K9EA 4UQ9A 4OJYA 5JIWA 3P0WA 2GWNA 4NXKA 3SCQA 3GHSA 4UWMA 1OM0A 2Y6ZA 2NQ5A 5EYWA 2QUMA 3SCVA 3ARXA 4FNRA 3N4AA 1NWSA 1G4SA 2P0OA 3DH7A 3IS4A 1H4PA 3EX6A 1XP3A 5FA5A 2VC7A 2YX0A 3W3OA 3UG3A 2ZC8A 2R6OA 3H21A 3O0FA 3M4HA 4JYFA 3GXIA 5HUOA 4C91A 4E3VA 3KACA 3QY6A 2DZUA 4FNUA 5FF0A 3AMDA 4JNYA 1DBTA 4U5KA 4J35A 4MF4A 4U4MA 4M82A 4AHQA 2R1LA 4DYEA 2YCLB 4GC3A 1BGAA 4GFIA 1XYFA 2YXGA 3GHUA 2VM8A 4AD5A 1QCWA 4KGLA 3LGGA 1ME9A 2OX4A 3BAKA 4AWEA 3A6OA 2XP8A 2YCEA 3N6HA 1KTNA 3S42A 2FTPA 3W83A 6CGTA 3PWAA 3KOFA 3PTKA 5AHEA 5A6AA 1H1NA 4QM1A 1TRDA 5LA2A 2XISA 3IGSA 1G7VA 4HGXA 3OVPA 3ARYA 3C0LA 4HTYA 4DJEA 3BVJA 4ZO8A 3AC0A 2J27A 4I9MA 3DFTA 5LIXX 2J24A 4J5NA 3FJ6A 4M1RA 3ELFA 1A0EA 3O5PA 1KLZA 3TC5A 1KBKA 4OQVA 3IRDA 4JTEA 3XINA 1FKIA 2FGBA 4JIEA 3STGA 1IZJA 2OT1A 3GB6A 4L72B 1OFAA 2OGJA 1WV2A 3O0KA 2D20A 4IUOA 4C1NA 4N6FA 1JGMA 1W31A 3P60A 2HPIA 4IXHA 1KBLA 3TMQA 3SW6A 4ACYA 4O1FA 3WLOA 2A3CA 2OYMA 3C2RA 5B8IC 2OB3A 2DT2A 3B40A 2BY0A 4OV4A 3KAGA 3PBYA 3NXLA 3GXPA 4XZ9A 3GIYA 3RX2A 1NM9A 2H90A 1SMDA 4XAZA 4IP7A 1V0MA 4FP1A 3AALA 4E8DA 4QHRA 1ZJHA 2WOQA 4TW7A 3U2OA 3CS2A 4RE2A 1CWYA 2PODA 5TIMA 4AD1A 1Z8AA 4GX8A 4FNSA 3IARA 4W7WA 1OFOA 2PBGA 1ZAJA 3OG3A 3VKJA 1HN1A 1FBAA 1NARA 1Q6EA 2XUCA 5GJNA 4E0CA 1XDMA 1W3HA 3B0UX 3R8GA 3SIZA 1NDWA 1GW1A 1TV7A 3IGHX 3TVAA 1PXGA 2QYGA 5IBXC 2VWSA 3WL0A 5EMYA 3GZAA 3MJMA 2X0HA 4TQTA 3L4TA 2YL8A 3O63A 3G1RA 3GW3A 1Q7ZA 5K9XA 7XIMA 2YCIX 3PB2A 4NASA 1TJPA 4AZBA 1W3KA 2PDMA 1EXPA 2EPHA 1SJDA 1HGYA 1ICPA 5JUVA 3LD5A 5G2HA 2VFEA 3OVQA 2VO5A 2Y5SA 4X9SA 4GGHA 4MTVA 2BVDA 2H3DA 5DMYA 1TJ2A 2RDWA 2GJXA 2WZHA 4YN5A 2BMBA 1WOAA 1M7JA 2Z2AA 2FZ9A 3Q2DA 2PDYA 1NMWA 3FEMA 4NJKA 1TVNA 1WP6A 4LUTB 2E7FA 1I0BA 1Q65A 3BC9A 3I6EA 1XISA 4F40A 5B7YA 4CVUA 4DRHA 1B30A 2D23A 2XWEA 1E0VA 4P7NA 4ZFCA 4YL2A 1OG6A 2G4FA 1OABA 3EXTA 3W7MA 4GISA 3BGAA 5C9RA 3CU2A 2N87A 4ZSUA 4PTMA 5I23A 1I8JA 2ZXDA 3VKBA 5H91A 5I3GA 1CYGA 5AVNA 3C2VA 3SGGA 1FWWA 2PRMA 4BK9A 1VGAA 3H54A 2V68A 1GKQA 3B04A 2C91A 4IFOA 2NLYA 3RN6A 2OQLA 1PZ2A 5AC8A 5IDIA 1Q6RA 2V5KA 5EKYA 2Z1BA 5FCZA 9XIMA 2GJNA 3CUXA 3L68A 2QPXA 3CYVA 1V6VA 4ERIA 5D8WA 3VIPA 1AH0A 3UI4A 4UTKA 5E9XA 1VEMA 3PRDA 2OYLA 2B0MA 9RUBA 4CCEA 4JTDA 1VYPX 3THQA 2HDJA 3FEQA 1W1PA 3WLLA 1R3RA 2HXTA 3HMJG 1JDCA 2FYMA 1LL7A 1UUMA 3BXWA 4JN8A 3WNNA 3ITCA 5BRPA 1C9HA 1UOZA 4MPQA 1HIZA 3ISIX 4EXAA 4RUBA 2WAGA 4PCTA 1GRJA 3VOCA 1O1ZA 4OECA 2VELA 3LYEA 5AB3A 2Q3RA 1E40A 3MDWA 3AS1A 4LRTA 3LS9A 5BRQA 4PMXA 4HPNA 1QW7A 2X2GA 1MUWA 4AIEA 1CXFA 1YXYA 1R7OA 1SFJA 1C8YA 1P48A 5BCAA 4JCMA 1IHIA 2AWGA 3FA5A 4AW7A 4JTFA 1EA9C 3VNKA 5H1WA 6REQB 1H11A 1M1BA 3WQCA 1LORA 2VEIA 5FEPA 2TYSA 1O5RA 3DGBA 4K2SA 4ITZA 3UA3A 4FLOA 3QV6A 3TA9A 4HA4A 2R1MA 3Q94A 5BYWA 2OJPA 2W79A 3SY1A 5HMFA 2B81A 3VM7A 2REQB 1JULA 4LEQA 3SFWA 3WD0A 4BFAA 3UW6A 1KCXA 1ZK6A 2VDIA 3WO8A 2O4MA 1UOKA 3E2QA 2C7FA 1B54A 4BEUA 1IF2A 1JCTA 4L4MA 2FGZA 5E6YA 7REQA 5JQ9A 1RXOB 4DO4A 1K70A 4J4NA 3MQTA 1P5BA 4ZPVR 2QUUA 3PZQA 2HJPA 1R9YA 3UESA 3JZEA 1WZKA 4PC8A 3DZ1A 2PTYA 3C2OA 2B31A 2ZQSA 1A0DA 4GH1A 4UOJA 3AWNA 4GY0A 1OK4A 1CLVA 3NM3A 2RUDA 3IIVA 2WJDA 3NSMA 2OT0A 4ZB5A 3O5OA 3HJZA 4PBGA 3CQJA 4HZMA 2X41A 4C6KA 4G9PA 3U48A 2ISSA 4N7QA 2W92A 1KWKA 2YL6A 4MHBA 1Q6DA 2SFPA 1FHDA 3O9NA 3HU7A 3PFMA 1V93A 2GLKA 3R7MA 5E70A 3F2DA 2FDMA 2VR4A 3BCFA 3HOJA 2VX6A 3RO8A 4I6KA 1M7OA 2ZA2A 1HO4A 2GYIA 5BU6A 3E2SA 4LVDA 3F03K 3VMNA 4DXKA 4QRNA 3L67A 1U30A 1LT8A 2D2JA 3LG3A 4WX2A 1KM3A 4RZ4A 1IEWA 2W67A 3WDPP 3NXFA 1T5AA 1TVPA 4FLRA 3SDOA 4JIQA 1H7PA 1UZ4A 3CIVA 1JPIA 3WUFA 2XM1A 3VCCA 3TQ0A 3C5QA 1HQTA 1QASA 4CD4A 1A50A 1TPEA 3UF8A 3N9KA 4KIRA 4EPDC 2KI3A 4RR4A 3SCTA 3FAXA 3IJ6A 3TN5A 1IEIA 1HF6A 4I9JA 5MHBA 3F4DA 1J01A 3Q37A 4W87A 5FEXA 2NVCA 1PTAA 1W9VA 3POHA 3WF4A 2YLAA 3QKZA 1EXBA 3M5YA 4WSJA 1OK6A 2Z25A 1TJ1A 2XH2A 1A47A 1VKFA 1XSIA 3RFAA 1UWRA 3WUEA 3CXOA 1JCJA 3ZT5A 3NL3A 3K8KA 4HTBA 4US5D 1HVXA 1XICA 4V28A 5D8ZA 2E1DA 5CPSA 5DIVA 4TX6A 3O5QA 2JK2A 1JYVA 3GXDA 4O50A 4UFJA 4W89A 4MY1A 1ZENA 3OZMA 4QIUA 3W7IA 3W02A 3W4RA 3AIEA 3SCSA 1DE5A 1XYCA 3T6CA 2OX1A 3T0TA 1UYQA 3DEQA 3GDRA 3RUBL 3QRHA 2Y85A 1RA5A 4F66A 2WK2A 4NSBA 4H41A 4ZA0A 4R7JA 5AYZA 1LROA 4M7SA 4ZZ9A 1R3YA 3QC0A 4L1WA 2C1IA 3UQNA 2B5UB 1XYZA 3FW6A 3WLNA 3LB0A 4L80A 3VKAA 4DBUA 4QCEA 4FI4A 4N9DA 4DVOA 1F8AB 1W1B1 5HNRA 2NQZA 2DH2A 5C55A 1BF6A 2V30A 2XP4A 3BGGA 3SCWA 3WQ6A 4P7QA 3T08A 3NR0A 1HJWA 5D4YA 3RRXA 4H8HA 2YGYA 1LG2A 1W3JA 2O56A 3MHGA 4WXYA 2NXGA 2PPOA 2PPNA 2XSBA 3WLJA 3WEZA 3GU9A 3EA1A 2XVLA 1EEXA 5DELA 2P0IA 3NZPA 1DWJM 1Q7QA 2PLCA 4YYCA 4UR7A 3PJXA 2VCAA 2V3FA 4XB3A 3H23A 4F0HA 4NVTA 2H9AA 5CBIA 4F8XA 3AZSA 2VZVA 3F5JA 1MFVA 3MP3A 4DAFA 4M6PA 5I98A 3KL5A 1F6YA 1PWMA 1TX0A 4M6VA 4R34A 3UXDA 3NQEA 2DH3A 2GJXB 3SY5A 1YDNA 3WDJA 2CHOA 3KVLA 4W7UA 2JALA 5CAHA 4PUWA 4J3WA 4HK7A 1PZ1A 1E5JA 4IMCA 1YE6A 3NPXA 1DIEA 4ZQPA 3QPZA 4PMQA 3MMWA 5BWAA 2Z2BA 1RJRA 1ISYA 4HB7A 3VGBA 4DM2A 1GOKA 3UR5A 4IGMA 4HBEA 4WZHA 1XG3A 4MNJA 3BLLA 4ILSA 4DJDA 3KRUA 3A4AA 5HQMA 2PBOA 2OZTA 1EJTC 1KRCC 3ANYA 1X98A 3ARUA 3GFYA 2NUYA 3ITYA 4E4UA 1HKJA 2DJLA 1WOBA 4XIAA 5LNSA 1R9HA 4UQAA 1QPKA 1FWNA 4TW8A 1F7BA 3DOPA 4IMDA 4LYKA 3U7BA 1TWZA 3GAYA 5A6TC 1PCWA 1D3CA 6XIMA 4WHBA 5KZDA 4QG8A 2NV9A 4UR8A 1RALA 3WQ5A 4HSHA 4MG4A 1JRBA 2VMFA 4PTWA 4A2SA 2B7NA 4W86A 1PS9A 1XSJA 2RDTA 5E6ZA 3N18A 4Y9AA 1HGWA 2ACRA 5K4XA 3KVKA 1AVAA 2QJNA 2Y2WA 1PX8A 1MW2A 2WVUA 1PCKA 5BXRA 4D72A 2ZXQA 2RKXA 2B4GA 2CIPA 3M64A 1HZYA 2FZMA 1O95A 4K8GA 3S2LA 1RAKA 2NVDA 1FX6A 1UP0A 2OR2A 1CB2A 4N4QA 4LFYA 2WCGA 2WQPA 5TAOA 1DOSA 2WANA 5GJPA 5HNNA 1DE6A 1ZBCA 2VHLA 3KOXA 4PSPA 1TQJA 1OYBA 1HTIA 4NKCA 1K1DA 1GZGA 4X2PA 3DC0A 5TF0A 4BWLC 1K02A 3TZNA 3TN6A 4YVXA 3F4NA 4BS0A 3LERA 1ZGDA 1WZAA 1YDOA 4Q6JA 1JPDX 1YTDA 2O92A 4F48A 3WLPA 4GIRA 1KBIA 5F4WA 1TB3A 1OBAA 3VGEA 3K30A 1ESWA 1SO5A 4DZ3A 1VPYA 4A3HA 1EGZA 3IJ7A 3E12A 3A22A 4DRQA 3N12A 3HO8A 3DIPA 1IZCA 4NNAA 1LUCB 1XG4A 4NF7A 2QCNA 1KFJA 1XLJA 2V8ZA 1GYMA 2ICSA 4BF8A 4H7ZA 1K7XA 3CAWA 4E2OA 4P8WA 1TVLA 1UR0A 1AUSL 1OGBA 7PTDA 3MV11 7TAAA 1S1RA 4HPGA 3EAUA 1BD0A 4JYEA 1ROUA 3PRAA 1ITQA 3WUBA 2QXWA 1FDZA 5TD4A 3AO0A 2HVMA 3AIBA 3HN3A 2FJUB 2VFFA 3R1ZA 3SURA 2EULA 4O8AA 3BK0A 2RGLA 4H9MA 3VMPA 2ALRA 5D02A 1GVIA 1JRCA 5J8LA 2XH4A 3UCDA 1H0GA 4IISA 4Y90A 5GNYA 3EKLA 3NQFA 4UQDA 3PBMA 2H6RA 1C7TA 3HFTA 3TJXA 3S1VA 3VNIA 5JIPA 1O7AA 1DWFM 3NYDA 4ONVA 3VINA 4EANA 3BL3A 5EMUA 2D0HA 3IJQA 3WDIA 3EX2A 1A5CA 1RBAA 2QJJA 3B4UA 4JTLA 4AZCB 3QV9A 1RD5A 2WKJA 5E09A 3A47A 4MNLA 3PWIA 1XDJA 4BQ5A 2HS6A 3HGRA 3P61A 5HR6A 2E6AA 2J7FA 1JDDA 3PWGA 1XC6A 2DSUA 2OMAA 2UY3A 4YS1A 1Y5VA 4IQ2A 1ONRA 1Z48A 4UMBA 1F8MA 5KETA 1TWDA 5JXQA 3BG9A 1RJPA 3PSVA 3UEQA 4XSMA 5D32A 1IX5A 2BHYA 2ZZ4A 2E77A 4K37A 1FKHA 3GNXA 4JTIA 4C6PA 3NJ3A 2D9FA 3VXGA 3H7VA 1ONWA 2A5HA 1XC4A 5EMJA 3T44A 3L4WA 4PUEA 5E5CA 4H8VA 1H41A 1WBHA 1CT5A 3G6MA 1K3UA 3SSZA 2IMRA 2ACSA 3CQHA 3DHUA 1TREA 1TMLA 3WF2A 5FJIA 3VIFA 2OU4A 4CGTA 1J2WA 2F9RA 4FNQA 2WSKA 3E74A 4PB5A 2BOFX 3VDAA 1G69A 1UR2A 1KXTA 1TJRA 3GUGA 1SFTA 4MJ2A 4IQCA 3FAPA 4CNPA 1JDAA 2BXYA 4PRTA 1N2VA 1SQ7A 2QDDA 3SAZA 4R9OA 1P6CA 3W1LA 3T07A 3QTGA 2HSAA 4AY8A 3URQA 3WFAA 1N7KA 3N15A 1KGXA 3R13A 3T78A 4EIVA 1FWJC 2X09A 2WWCA 3VIKA 4D6CA 1NFPA 3UYCA 3GVQA 1S1PA 1PWLA 4H9ZA 2ZVIA 4A3QA 4Z1YA 2Y7GA 2YBVA 1VFTA 2J78A 1NP0A 2GQ8A 1ITUA 2RDUA 2CKSA 3OGRA 3SUWA 5DO2A 3Q65A 1M7XA 1W2PA 2I17A 4JHZA 3O8AA 3AHXA 4HK5A 3OYZA 4WXZA 1QOQA 1V4YA 1VYRA 3KWSA 5C9UA 5F1UA 4RPQA 4HBOA 3E38A 2H9AB 1Q6IA 1V7AA 2C8NA 1H7RA 4FNTA 1QWGA 3THAA 5I03A 2PLKA 3K13A 1W91A 2RFGA 2IF4A 4Z0SA 1JL8A 4ZO6A 3RILA 4DJED 3LQGA 4PRRA 3BH4A 3GG8A 3FN9A 2NXHA 2RAGA 3TSBA 2FB3A 4ODPA 2P50A 2J8GA 2PLMA 5DY2A 2INFA 3TWBA 2OSYA 1M41A 2M08A 1VH7A 1R86A 4BQ4A 4B2DD 2HRWA 2VEFA 1YW1A 1QW9A 1UR4A 3ITLA 4LSBA 4XZNX 5DCBA 3HPZA 3EOUA 3N9RA 3NUKA 2VD9A 4IH3A 5CPNA 1G9HA 2XVGA 4D6FA 1UR3M 3GBDA 5J6EA 1OX4A 3FVMA 1OSEA 3LRKA 4ECLA 3PTMA 3QPYA 4ICMA 4V33A 1UD2A 1CCWB 4WJXA 3N13A 4NZ3A 4BCEA 4QDWA 3M43A 3CV6A 1IT8A 1S5NA 1D7FA 3BQ6A 2V2DA 4B9YA 1EL3A 1DJHA 2ATSA 3GU1A 1UWQA 1OIFA 5HJXA 3ITOA 2X2YA 4GINA 5DF0A 1OFPA 1S2CA 3TX9A 4NG3A 3WMLA 1S2TA 1PTDA 4BF5A 3N04A 3O5JA 1PHQA 1VRDA 1JYXA 3OBKA 1WE5A 1ZCOA 4HNNA 3N4FA 1YE4A 3WH6A 4Q8PA 4UZUA 1KC7A 1QR7A 4Q4KA 1PB0A 1SW0A 1HL8A 3R0KA 3QZ6A 1KBBA 3PZUA 2G96A 3BW4A 3STCA 4JX5A 5HINA 5LYRA 1TG7A 1A3WA 2PAJA 1Z89A 1UR9A 1A5LC 1XUZA 1FWTA 1WZMA 4M5PA 4PCNA 2DZWA 4NJHA 4FK9A 4Q8VA 3LRMA 3NDOA 5CAKA 2Y89A 3QFWA 3EGJA 3FLUA 4UUIA 2ZUTA 1VFMA 2OGYA 3G1SA 5LIYX 3W7GA 1LQ0A 3ZJ8A 1CZ1A 3L4XA 4XVEA 4HOXA 1DJYA 1E3XA 3UYIA 5HPOA 1O94A 2BGSA 3H8AA 4O15A 3UXIA 3A9BA 2RJHA 3AYSA 1O5XA 5G5IA 1PTGA 3S6DA 1IV8A 3LCXA 4UC5A 3LPPA 3AXIA 3WLIA 3AHVA 3MKVA 1K8XA 2G3JA 3QY7A 4ES4A 1FFQA 1GCYA 3KCEA 1NH6A 2XIOA 3EWWA 4B5XA 2FMNA 4R0XA 2XN2A 1AMYA 1BWVA 1X97A 2IPGA 1KFEA 4EPEC 1ZJIA 1UWUA 3FFSA 2ZIDA 1Z7AA 1VFLA 1QT1A 3TYAA 3ARQA 5C9WA 1S5MA 3CZEA 2X7VA 3TJIA 4AU0A 3R8RA 4OVXA 3WN6A 3L12A 2J75A 3O5LA 3P5YA 4XZMX 1RCXB 2A3BA 1CIUA 5M2FX 4P8UA 2A79A 2J9XA 4P8XA 4QLJA 4GPNA 1RSCA 1KM6A 3N34A 3QTPA 5EMLA 1A49A 2Q71A 1FHLA 1N1AA 1FY6A 4G7FA 4MZ8A 4GX9A 3CO4A 5EBUA 3L7RA 3MUCA 2AOSA 2ITKA 4AF0A 1B3YA 1YDVA 4MGGA 2YFNA 4JQ1A 4YTSA 3WCZA 1OVDA 1A3XA 3CEPA 4LBSA 4WJ8A 1KB3A 2DZXA 2WSRA 4KRZA 1TPC1 1KO0A 1TYGA 4KEUA 4MOZA 3WD1A 3G1HA 2BX7A 3UP8A 1PDYA 3VDGA 1Q2SA 1TFVA 4GI9A 2PE4A 2OEMA 2CZVA 4BQ3A 3WBEA 3WBWA 4GQBA 4W9QA 1XBYA 7ODCA 7TIMA 3F2CA 3FDGA 2CC0A 2GQAA 2CYGA 4PMYA 2HVNA 1XIIA 4I6VA 3WK2A 4ODLA 2PDHA 4NX0A 4POCA 3VIGA 1KQYA 4XUYA 2D3LA 4DBEA 1HJQA 4H2HA 3T1GA 3KBVA 1THFD 1H3GA 3A5VA 1FWCC 4ZMGA 3EWBX 1Y0OA 1SMAA 1Q6OA 1KQZA 1V6XA 5AC7A 1BVZA 3WD4A 3EKGA 3S2MA 3LENA 3AOFA 2OODA 4QS5A 1U1JA 3S9ZA 1W5OA 4WLCA 1NDYA 3BLPX 1KFCA 3E5BA 4LAYA 1ADOA 3CPGA 3TXZA 3LCLA 8CGTA 2UV8G 3N73A 2OEJA 1QMLA 3C8NA 4MYAA 2FVMA 2X05A 4KF1A 4E4FA 5D75A 2QIIA 3ZFHA 2DT3A 2ZZ6A 3VD5A 2HVOA 2IQDA 4TXEA 3IPWA 2J8TA 4TNSA 2QCDB 5CCZA 2BVYA 4J40A 4IMAA 3QGVA 4NJGA 1MW0A 3GAKA 1E15A 4L6HA 2GZXA 1P0KA 3ZMRA 3L5AA 3PG9A 3MT1A 3L4ZA 4MWAE 4LAWA 1M3UA 1GG0A 3MU7A 3TQVA 2BHZA 1XLDA 2J13A 2WJEA 2DSZA 2ZCGA 1PX4A 2AKMA 1F9CA 4R7WA 3HQNA 3W75A 2XTKA 3UJSA 3MUXA 3G3MA 3TYZA 1SYTA 4AWTA 2QCGA 3QVQA 3G18A 4OGZA 2F84A 5G1TA 2JF6A 1FJDA 1E4IA 4UFIA 5EBAA 4ZB2A 4TW6A 4Z1CA 3G1FA 4TX0A 3QC3A 2ONEA 4CU6A 3M41A 3L2MA 3JZUA 4NL1A 3PUGA 2X16A 3NCOA 4ZOAA 1NSGA 1QVBA 3DFNA 1R3SA 2I5QA 2Q01A 1O66A 5C8BB 4IPLA 5CLWA 3CIWA 1EDTA 3DI0A 1W5PA 1M9HA 4EXQA 4BZYA 2PCQA 1L6FA 4QJ4B 5ABFA 1E9YB 1VIWA 2DSWA 3M1ZA 4RX0A 1QO5A 3U4FA 3VOFA 2IXUA 1G94A 1SZEA 3ITGA 4JR5A 3TOPA 4ZO7A 3LCWA 5LKYA 3GTYX 3M7SA 4ALDA 3RU6A 4QJ5B 3R11A 3TFCA 1US0A 3ARTA 3S5OA 3FV9A 3PFRA 1E3ZA 1JCNA 1MVYA 5BRBA 3BURA 3QEZA 4B5VA 4N0RA 3AXXA 3OLEA 5XIAA 3MBFA 4Z2IA 4KEMA 1TPH1 2VXNA 4H19A 4FALA 2NV2A 3CWNA 1Q1CA 3OBEA 4MFEA 4WKAA 3PZ9A 3UG4A 4J28A 1KXVA 4HSNA 2Y63A 2JKEA 4OZOA 5LNUA 3FYOA 1KGWA 2QCLA 4Q7IA 3L4VA 2YZRA 4X60A 3ID7A 3RR4A 4IJCA 4IPIA 1X1NA 1D8CA 2AMXA 3W2NA 1W17A 2BBFA 3KBJA 4NRRA 4XZHA 1BYBA 5I3JA 3CV1A 3WLKX 3IUHA 2ZVRA 4GO9A 3NQDA 4ORMA 5E1QA 1AFSA 1RV8A 4DIPA 1OC7A 5CC5A 4CQBA 5LHFA 1AJ2A 4ZQOA 4OHQA 4C6EA 3CHCA 3QMTA 3MC5A 4QAIA 3PB0A 4K38A 2CZ5A 1OX4B 4PEKA 1ZPTA 3PJWA 2QDHA 2DIJA 2WWDA 3B9OA 1RH9A 2PDNA 4K36A 3YPIA 3SB0A 3DU0A 4GLEA 3E3HA 1M53A 3TTQA 1XH1A 1I60A 1D6OA 1FKFA 4JY8A 1S5VA 4TO8A 2VL4A 1RJQA 3K5XA 2X8RA 2ZADA 3WQGA 4ZXLA 3TNOA 3PBUA 4K68A 1UQYA 4IFRA 2VENA 4PCSA 4E8CA 1SSDA 2YKKA 1W2VA 1L9WA 3CL6A 1LLZA 2J4GA 3N2OA 5L6UA 1GKRA 1T8QA 3LBCA 3PHAA 1I2NA 4E38A 1JG9A 5LSMA 2NSXA 1RLDA 2PRHA 2G0WA 4WIWA 2NQJA 2BNJA 5FEWA 1GOXA 2VGFA 2GGIA 1VFHA 1C3FA 3DC8A 3S83A 2F38A 3DYPA 3I6RA 1SZRA 2XU2A 3TE9A 4ZS6A 2JE8A 2GK1A 2YDSA 4HA3A 3IIZA 3T55A 1T7LA 2YJQA 2R82A 4ZOCA 3LEPA 2MANA 4XAKA 3RK8A 4Q8TA 2GFTA 3IK4A 3PF3A 5T9CE 1W6TA 4A8IA 2PA6A 2G3MA 2Z1WA 2YIHA 2WVTA 4MWAA 3W1XA 4EWND 4HNTA 4JTGA 1K9TA 4AWUA 1IR2A 1J5TA 5D09A 3QV8A 1WXYA 2EG7A 4JIHA 4R85A 3QXBA 6ENLA 3UG8A 1CXKA 1S2WA 4XBSA 1FFRA 3CMJA 4HCLA 2EO7A 2GGGA 1ZQ5A 2EG8A 4OBSA 3LHZA 2HTMA 4GO8A 2Y7EA 2J7CA 2FGLA 3WF3A 1W1TA 1QRQA 4UFKA 2X42A 3SEPA 4AC1X 3C2FA 5AC4A 3NQAA 5LGXA 1BPLB 1AG1O 2HZGA 4GKTA 1O6IA 1JD9A 5IHSA 3OLDA 1PKMA 1CEOA 4LWWA 3HG2A 4UBPC 3W7DA 3ZJ7A 1ZAHA 2PN0A 4LC6A 3ES7A 1C90A 1J4IA 1EHNA 1ICSA 3KFTA 3W87A 1FCUA 1HKVA 1G4PA 1UH2A 4WR3A 5DCDA 4DJDD 5F1VA 2XYLA 3H2OA 1QHPA 3EWUA 4ROQA 2GGHA 3L65A 1ZS2A 4W8BA 3SFKA 6ALDA 1G1YA 1UD8A 4C7GA 3BMBA 4TX8A 1BQGA 3VDBA 2VX5A 3CGMA 1G67A 1H1YA 4NILA 1VEPA 4C6MA 2EXOA 2P5NA 1EF3A 4MM1A 4KEZA 3E9AA 4B91A 4JTKA 4GCXA 2Y70A 3CPUA 4IQJA 3HQ1A 3A4JA 4OBTA 2QF8A 4AF0B 4QLLA 1Q6LA 3W2MA 3ZVIA 1DTUA 2GVLA 1J4HA 4TUFA 3RLVA 4CCCA 2VR5A 4TV6A 1GORA 4EX4A 5FIPA 4HMEA 2OEKA 4FLQA 2XHYA 4PUMA 1KGUA 1SO4A 1SZFA 2OOFA 3AIUA 4GWEA 2YXXA 2AL1A 3D3AA 3TZFA 3EWYA 1EGVA 2WPGA 4OUEA 3CK5A 4HHMA 2WHKA 1LWJA 1TV5A 2W91A 3MA8A 1NVMA 5C9XA 4GACA 3LCFA 2ANUA 5M5DA 3W71A 1OINA 5A8MA 1BKFA 1GQJA 3VTRA 8XIMA 4LVGA 1XLBA 2CITA 2V38A 2QHAA 3LLXA 4Y7EA 3OW1A 3PUDA 1BSIA 2WHJA 3ZR5A 1XLFA 4CQDA 4DO7A 1Q3NA 4XBKA 4QSFA 4HZ6A 4GYKA 3I3DA 3HQOA 3KCOA 3H2MA 5ENLA 3WLHA 3GQYA 2V3GA 3SUTA 5JVLA 3IIXA 1JPKA 3G22A 4PL2A 5IM51 1W3LA 2ZZ7A 1K8YA 4WGHA 1MRAA 4O19A 4S3AA 1UMLA 3KDOA 4HJWA 3OOBA 3LXAA 3HB9A 4QCFA 5LHEA 1JCXA 3BZGA 4URIA 4JOMA 5C2CA 1DQUA 4GI4A 4FN2A 3VD4A 2ESCA 3QHMA 1OC5A 3MYPA 3STPA 3PY2A 2VI0A 3W81A 4TMCA 4HNVA 4S3DA 1V3KA 3NO3A 2DV0A 3BE7A 1I2RA 4TU1A 4TVCA 4MB5A 1LOQA 3G0SA 3IANA 2WNWA 1CXEA 4AB4A 3PK7A 4B15A 4KFOA 5HQEA 3MSGA 3RM9A 3BLDA 4LS2A 1OG0A 4ODNA 4U85A 3RMJA 1JEZA 3T42A 1V08A 4IGSA 5CH9A 4V1YA 1SFLA 4XUGA 1GGOA 3GG0A 3QR3A 3H2FA 3WF0A 1SFSA 1GJWA 4ML4A 1Q13A 2CXGA 1EHAA 1HX0A 3STFA 1QNPA 3B9EA 2YW4A 1DJIA 2ACUA 3FGCA 1GPFA 3MP4A 4IX2A 5GPRA 3BWWA 2Y78A 2R24A 1W54A 3ALFA 1S39A 5EB8A 4GZEA 5IOBA 3VOIA 4JTTA 1FDJA 3O07A 4E4PA 4GIEA 3WH9A 4AC7C 2AQOA 3IV3A 4LY8A 5AECA 4F0RA 1I2QA 3MUIA 3KTCA 5DMMA 4J27A 1XUUA 2J6XA 3O6YX 1QI0A 3QV7A 1YPXA 4QE4A 2Z24A 4GXMA 1R38A 2VNCA 3AIQA 5EFDA 3H55A 1QK2A 1FRBA 3BARA 3FSTA 4HNUA 4NAFA 2J79A 1TZ7A 2OKOA 2EJ1A 3P80A 6PTDA 4KCVA 3ODKA 4RXGA 1RQHA 3VOJA 2C14A 4WD0A 2QT3A 1D3GA 1V02E 1ADDA 4GCAA 2LKNA 1MZHA 1UR8A 4Q8MA 3A5FA 2GSHA 3E0VA 4S3BA 1OZQA 4N6EA 2W5FA 4YHEA 5CQ1A 5AYBA 2POTA 3UGVA 1FKSA 1D2KA 4Q33A 3L23A 4RJEA 2DDXA 2OWWA 3RHGA 4GH3A 4NNCA 1MSSA 1AH3A 1QNRA 2E5DA 2YDAA 2TAAA 3NEVA 4KQNA 2PDWA 4DYKA 1PUDA 4S1FA 3THDA 2FFIA 2KR7A 3PPFA 5BXJA 3INPA 1LRTA 1W9BM 3DX5A 3LN3A 3T4WA 2C16A 4CKQA 3G2GA 1EPXA 3CQ0A 1XKJA 3U2EA 1B6CA 1LZOA 2CBIA 3VO0A 1QTWA 1PL9A 4CN1A 4H00A 1F3XA 1EJSC 3LCGA 3P82A 2HK0A 1JGIA 2X40A 4NU7A 5HMSA 3VVGA 1QPOA 1LRQA 1YW5A 4I5XA 3WQWA 3BAJA 3WG6A 4XZLX 1DQWA 1FKLA 3W1QA 2RUCA 1C91A 4GKLA 3GS6A 1XGZA 2WO5A 1F76A 5DT7A 1EKOA 3IIOA 4JFTA 4O13A 5A6MA 2WLZA 4KCWA 5HDRA 4Z2LA 1IYXA 3VE7A 1TE6A 4LBUA 4FR6A 2XVKA 5FJTA 3WSUA 1VF8A 4G1KA 4Q8NA 4MUZA 2CNCA 2GSEA 1FA2A 1F73A 3R43A 3ANVA 3WMCA 3CTLA 1V3LA 2FPYA 5CZ0A 5HMDA 4UTFA 2WKLA 3GVGA 3W6YA 1BYDA 3SUVA 1HKKA 3FX4A 1SVDA 3R6IA 1A5SA 3RXZA 2ATMA 3M0MA 4M6QA 3AXMA 3S9YA 1FWEC 3GNPA 1L1PA 3GKFA 2AKZA 3S5NA 3TTOA 3G6LA 4MWAB 2PPGA 1TR1A 2ISVA 3W1TA 1VRXA 5XINA 2DZPA 4L4LA 1BFNA 3AFBA 1B4KA 4CNSA 1LYXA 4MDPA 1XCWA 2QPSA 5LA0A 1GZ1A 1DQXA 3B0YA 4O1DA 3TN4A 1W5MA 3DHPA 4WK9A 1P4CA 3TDBA 4ADTA 3AQUA 4DRKA 1RVGA 3CB8A 5CC6A 3MVTA 3FJLA 3NO1A 3R2GA 3UJFA 2INEA 3UT0A 1H1ZA 5A2BA 4QJ1A 3SN4A 2O9RA 1TV8A 1GHSA 4HT3A 3EXRA 3BAIA 2WNZA 2OO6A 5CG0A 1WZLA 2WNQA 3W0KA 4NZFA 1AZ1A 2MLXA 3W29A 3JVAA 1PZ0A 2PDJA 3VGGA 4UXDA 1E71M 3STEA 2DQXA 1ZALA 3EX4A 3NI6A 1BRLA 1HO1A 2PGEA 3GR4A 1J79A 4FXRA 1BYCA 3UI6A 2XFYA 3LM3A 1ITXA 3CTTA 3V16A 1XGEA 1CLXA 2DW7A 4AZ7A 3NA8A 3FA4A 1TTQA 3AZRA 5DRCA 1TCOC 2DORA 2QV5A 4DZ2A 4Y9MA 1I4NA 3UPBA 1ELSA 5ABEA 1AJZA 4GQQA 1V02A 1WO2A 3GNNA 4O17A 2QULA 2W62A 1LLOA 3W76A 4MNKA 5CSYA 2Y7FA 1RPXA 3NOYA 4XTDA 1QAPA 3QLDA 3S9IA 1P1MA 5JMUA 1BKHA 1SJCA 3GR8A 3P62A 2G3FA 3ARRA 3NQGA 2Q8LA 4PMRA 4GNVA 3M44A 3WJYA 4FS9A 4I5UA 3CUJA 4XD5A 1FKBA 3NTYA 3TP4A 1ZRQA 4PTVA 3B9AA 4N42A 4X2RA 4CLMA 3NGJA 1XGDA 4O52A 5ABTA 1REQA 4MJMA 2RUQA 3N25A 4JIIX 3EX3A 2A7RA 2GUYA 3VZYA 1IXOA 4Q3MA 2H8ZA 1MW1A 3TIMA 2R1NA 4MZYA 3T0DA 3TC6A 3OJGA 3PSWA 1H60A 3MHUA 3I7RA 3OG2A 4QLKA 2C71A 2L5HA 4M24A 3PANA 5D9NA 1ISVA 2WZIA 4F2BA 4JDYA 1SUXA 1B9BA 3NPVA 5IRPA 1YIXA 3B0VC 1E6XM 4LC8A 3NG3A 3LPFA 4CQ9A 2J7GA 1XX1A 4GABA 4XKYA 1VJIA 4LCRA 3WH8A 1R7AA 2DSKA 4MAZA 3WNPA 3SY8A 1CGXA 1WKDA 2C0HA 4JKLA 2ZUUA 1W1YA 5A6LA 3RLHA 2AGKA 3UBPC 3ZT6A 3ZLFA 4E3TA 2ZE3A 4U3AA 5C7VA 1CGVA 4YTUA 4ZQCA 1ONEA 4JQ4A 3W2KA 3EWXA 1FTXA 4F2UA 1QJWA 3UD6A 3AIWA 5I7GA 4LU0A 3WLQA 1X38A 4IT4A 4JFSA 3QPEA 1W9UA 4MDOA 1RUSA 1R2SA 3EMQA 4AEFA 3UA4A 4F3HA 4PTNA 5FJOA 3MBDA 5BOEA 1BYAA 3THUA 7A3HA 4CQAA 4MUPA 3GHRA 3FGCB 4CEUC 1KV5A 4RDVA 1D7KA 5DLCA 1CI1A 4GIVA 3EIPA 4GJ1A 3LY0A 3FHAA 4LV4A 3W85A 1K03A 3EPMA 3N3MA 1DEDA 2VD8A 3QQ1A 4GGBA 3AS3A 3MI2A 3GZ3A 3GVRA 9XIAA 5A8QA 1XFBA 3BANA 5HJYA 1ML1A 1M04A 2G95A 1UPPA 4GK8A 3R0DA 1E51A 1YXCA 2J66A 1FXPA 1JF5A 1SU5A 3BJFA 3IGUA 2NWSA 3RX4A 1XRSA 2OOGA 4JBRA 3GHTA 2PS2A 1T41A 3N4EA 3NQVA 1L6YA 3MI3A 4NAFB 1B31A 4XX6A 3GK0A 4D6JA 3UXLA 3LHVA 2BV9A 3GRIA 4H1ZA 1DHKA 4V27A 4C90A 1J0JA 4HVXA 4PCPA 1S3HA 2BVWA 3P8IA 1XIJA 4HJFA 3ARVA 4NIRA 1EFZA 3FOKA 1KM1A 1BXBA 1I75A 3HGSA 3KP1A 4IGNA 3BLKA 4J2PA 3DN5A 3TSMA 4RCXA 4ZPWR 1ME8A 1F6KA 1POKA 2D0FA 1IIGA 1S46A 3TLLA 2IXVA 2KE0A 3TCEA 4RW5A 3CAQA 1JNTA 1FHVA 4HP5A 1BHGA 1UR1A 2MPHA 3O5MA 4FPSA 4Q8UA 2PV2A 5KZ6A 4HD5A 1W26A 2FVKA 2DG4A 2PDUA 1E9ZB 1L6WA 1BEUA 1EJ7L 4AYSA 1GQNA 2YCJA 3RR1A 4KFNA 4EACA 4IT6A 4A8RA 2VZTA 5CGQA 1NIUA 4LBRA 4UTHA 3PUOA 4WUIA 4C02B 2ZUWA 5DQPA 5KITA 4H01A 4C6DA 2FHCA 1FWDC 4F0LA 4AYGA 1E6QM 5JH1A 1E9LA 1O60A 3G1DA 3EWZA 1F4HA 1VJSA 2VEKA 1W1VA 1D7JA 3P81A 3PZNA 3C52A 1EGMA 1G01A 3HIJA 3UR7A 2E8YA 4S2BA 4J3XA 3UWVA 3N19B 2I5GA 2IW0A 4QTGA 3UZJA 1ECQA 4QXIA 3RX3A 2NQ9A 2O4QA 5HTGA 4F0KA 2GDVA 3I10A 2HCVA 1ECEA 4HOWA 5A2AA 3SIMA 4I7UA 1MRQA 2XVNA 2DZVA 3OO2A 3APGA 1ZNNA 5AHIA 3IUDA 4F0SA 4XZIA 2JFEX 3DYOA 3MP5A 1J0HA 1M7PA 1NOUA 2W27A 5LXXA 3BLOA 4AZ5A 1JCMP 4KBXA 3NAVA 4XG1A 3HG5A 1TZZA 2GQ9A 4OFCA 1ADSA 1EYEA 3SQMA 2Z1VA 1H7XA 3W6LA 4JAWA 4LS1A 4O4VA 1Z44A 5ECVA 4RPPA 1JCHB 4MPKA 3BG5A 4A3RA 2X1IA 2CKRA 4QIBA 4U28A 3UCCA 1LBLA 1DHPA 3A4WA 1JNSA 4IM4A 3H4GA 1PKLA 4MVAA 3A64A 3WH7A 3RNDA 3C86A 3WMSA 3AYTA 1J18A 4UFMA 3AZTA 1R8LA 3RG6A 3V36A 1QBBA 1F2JA 3RFWA 1NWRA 1EYWA 3RO6A 5A8GA 3TYUA 5CPMA 3BV4A 1XIBA 3MY9A 4GY7A 5REQA 1RPKA 2HE8A 4GG9A 3GXMA 5T9BG 1YHTA 5C6MA 2I16A 1JZ3A 4GUJA 4MJZA 4DJEC 3QF0A 1BRLB 5D04C 4LANA 2W4XA 4DHGA 2PBCA 1R3VA 2ZZ1A 4GUFA 2MNTA 2MUCA 5M1TA 4DBWA 4Z08A 2Z6IA 1AODA 4BF9A 5FSDC 1DJQA 3TCSA 1EX5A 2PZNA 3ITXA 1BF2A 4ODRA 3F7JA 1N55A 3DBPA 1Q6FA 3NEHA 2LLEA 5KINA 3S2CA 3BLIA 4PMZA 5DN1A 4UTIA 4CU8A 2O0TA 3E2VA 5FD0A 3ZR4A 2DU2A 4HNLA 2PF8A 2E6FA 4DO5A 2CZDA 2BGNE 3UWWA 1RCQA 4RV3A 4ACZA 4MSSA 4PUUA 4JX4A 5GNXA 4GVIA 4H9VA 3A23A 1XKYA 1KTCA 3KLKA 2ZC1A 4M1BA 4QX4A 4X9YA 3UZWA 3OVRA 5H6HA 3E0IA 5I0DA 3C56A 5CSRA 3DXIA 1REQB 2E1WA 4MWAD 2YDRA 3BSMA 4ODKA 2BFGA 3BOXA 4GUGA 3E96A 2AGTA 4C6QA 1JUEA 5H2ZA 3MSYA 3CV7A 4NYYA 3LLDA 4Q32A 4U2ZA 4D6IA 5DXYA 1ZTVA 1A80A 3OGSA 2ZTKA 3W07A 5AN7A 5IDZA 3GYCA 1J0IA 2XIQA 1DIKA 3P67A 2E5CA 4XZWA 2HK1A 4RDYA 3WQPA 1HJSA 2CU0A 3OEXA 1CXLA 4FHAA 3PPGA 2P76A 3GDLA 4H6EA 2XP6A 4FO4A 1XIHA 4DJFA 4PCFA 4BQ2A 5EFFA 3LHTA 4ODQA 1P0NA 4XKYB 2X1TA 2PTZA 1VR6A 3TYEA 1M5YA 4GE8A 3V0TA 3UWQA 4AY1A 2C3ZA 4L3NA 2M1IA 2W66A 3RCMA 4AY7A 3EPNA 3GH4A 3QJAA 4Q4QA 4EXBA 1XYBA 1FKDA 5CLTA 1UKOA 1B3OA 2ZKMX 2QCEA 1FWHC 5F2GA 1TTIA 1FOBA 3H9RB 1XIFA 1R9ZA 1T6MA 2XZ7A 5KSWA 3EDKA 3T2PA 3S47A 1JZ8A 1WNOA 4NQ1A 5HNTA 5EL1A 4O28A 4WEVX 2QNEA 1QZ2A 1HXJA 2DY3A 2X30A 4JQAA 2ZYFA 1VBUA 3TFXA 4UCGA 4IWWA 3I4KA 2J9ZA 4S3EA 2VZOA 3QZEA 3WELA 3WJSA 3O5GA 5MKGB 2JGYA 3IJLA 5I78A 2RSEA 4TOQ<