4MPKA

Crystal structure of the complex of buffalo signaling protein spb-40 with n-acetylglucosamine at 2.65 a resolution
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of the complex of buffalo signaling protein SPB-40 with N-acetylglucosamine at 2.65 A resolution
rcsb
molecule tags Signaling protein
total genus 120
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4mpkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mpkA01
1KXVA 3PBGA 1HNYA 3WF4A 2EPMX 1JDAA 2X09A 5CGTA 5HXMA 1H2JA 2XFRA 5JBDA 4PUEA 4XZWA 3BLPX 3VIMA 1E73M 1UA7A 4W8AA 4BQ3A 4H7VA 2CYGA 1NWUA 4GZEA 1SFSA 4Z2IA 1BYBA 1W3JA 4ZXLA 3CHEA 1GQKA 1QI3A 4AZBA 3VIPA 3HJEA 3SCQA 1WNOA 4P7OA 2ZUTA 3OB8A 4GZIA 2DQXA 3F4VA 3WMCA 3AISA 1ESWA 4E8DA 1E56A 1QNSA 1GQIA 3KL0A 3CO4A 1GOKA 3U7BA 2BS9A 1KBKA 3MANA 3PTKA 3K8KA 1MFUA 2CESA 4RE4A 5BROA 1CENA 4W8BA 3G6MA 1VJZA 3QOMA 5D9NA 3NDZA 3IAQA 4OZOA 3ALGA 1QW8A 2E0PA 4BQ5A 2O92A 1UWRA 4QLJA 3AROA 3WD0A 2DEPA 1LQ0A 4M1RA 1ODZA 4J27A 3LPPA 4NF7A 1PPIA 2JF6A 3QHMA 3W6MA 4AD3A 2OWCA 3SUTA 5BWFA 2RGLA 4H8VA 3MUZ1 4Z2GA 5DT5A 1E1FA 3VIOA 1HVQA 3WH9A 3OGVA 1JZ4A 2AOSA 1JL8A 3FHAA 5A6KA 1XYZA 1OGBA 3OIHA 1CWYA 1JAKA 2XVPA 4J3SA 1TFVA 4JCLA 3WNKA 1JFHA 1LG1A 1HXJA 2CKRA 3W81A 2MANA 1MFVA 3VGBA 3AIRA 3DECA 3POCA 5BYWA 5A6JA 3WF2A 3VD7A 2V3GA 2VR5A 4U31A 3NCOA 1IT0A 2WWCA 2Z1SA 3VD3A 3WDIA 3T0DA 3SCUA 3WQ6A 4XV0A 1OT1A 2PBOA 1KFWA 1BG9A 3VD4A 2WAGA 3A3HA 4ATDA 4Y7EA 3SEPA 2V3FA 3BGAA 5HBFA 1HIZA 3W37A 3TP4A 4AXNA 3FHQA 3CUIA 4GZJA 1UH3A 3W4RA 2Z1KA 2GVYA 1WE5A 4GO9A 3CPUA 1BYCA 2DT3A 1GOMA 1GJUA 5ABGA 3D5HA 4UNIA 1Q6EA 2CBJA 4PMVA 1XH1A 1EO7A 5KEZA 1B30A 3N17A 1G1YA 1UD5A 3WF3A 1QI4A 3W53A 2WZIA 3RIKA 1M04A 1M7XA 1W3KA 4UOZA 3OZPA 1JD7A 2IXVA 4D6GA 1E6PA 1QNPA 3QGVA 3RJXA 4AZGA 1UKSA 4HMCA 4HPHA 4J7RA 3W28A 2OYMA 3WEZA 1VFFA 3CIVA 4XX6A 2W67A 4LYQA 1UOKA 2WHMA 1WP6A 4PTMA 3VD9A 3WELA 2C0HA 5I79A 3AZRA 1ODUA 4DWSD 2VL4A 3GH7A 1QHZA 1W3LA 3M07A 4FLQA 1RPKA 4TX8A 2WHKA 1BTCA 1W9PA 4KH2A 3ZSSA 1PZ3A 1D7FA 4XB3A 3SURA 1FOBA 1UWIA 2Y8KA 5IDIA 3RM4A 2GDVA 1KXTA 3IK2A 2XIBA 5I78A 1WZLA 2EJ1A 1R85A 4D72A 3FAWA 3GNOA 4TTGA 1UR8A 1GJWA 2ZXAA 1CGYA 1D3CA 3M7SA 2YA2A 4NSBA 1R7OA 1V3IA 1HF6A 2CPUA 3BLKA 2XVGA 4AD5A 4CN1A 5ABEA 1CXHA 3WY1A 1VBRA 2J7BA 3K1DA 2ZUUA 3N13A 5A1AA 3RCNA 1LL4A 4ATWA 5AC4A 5DFAA 1GNXA 3PTQA 5E6ZA 4OKDA 2D3LA 4PSPA 3MUAA 2ZX9A 2HVMA 4OOZA 5D9OA 1H0GA 3ZJ8A 5HPOA 4HZ7A 4C7GA 4D1JA 4B3LA 1UD8A 5HOSA 1WZMA 3AFBA 4GQRA 3KZSA 2Y24A 1AQHA 3OGRA 2BV9A 4CCCA 2X05A 4WJXA 3EDDA 1E72M 4MJ4A 2EO7A 2J74A 4M24A 3AHTA 3MKKA 2YLAA 2ZE0A 1VF8A 1CXIA 2PWEA 4PMNA 3BCDA 2C7FA 3SCVA 4JKKA 1JIBA 1NOWA 3ARZA 2XGBA 3CTTA 5M03A 1J0IA 1BPLB 1RH9A 4J3VA 1DHKA 2J62A 4GPNA 4BQ2A 1G01A 4TVDA 3GXFA 3AMDA 2F61A 2VRJA 1WDRA 3OLDA 1BG4A 2WHLA 4JKLA 4MNMA 5JBFA 5A6LA 1FFRA 4JFWA 3THDA 1W1TA 1L0PA 1KXQA 4EE9A 2J7HA 1HL8A 3ZJKA 7A3HA 1US3A 1X6LA 1E15A 4CD8A 3WBEA 1GCYA 1C8YA 1OINA 3DYOA 4CD7A 5DO8A 1LJYA 2VX5A 4W8LA 2DT0A 3GBEA 1M03A 4U5KA 2WPGA 5JUVA 3RJYA 2XSBA 2F8QA 5D4YA 5BXSA 2E8ZA 1WZAA 3PZTA 4QDMA 3SCPA 1XGZA 2CEQA 3ARWA 3VDCA 2J7CA 4AEFA 1B0IA 1XYFA 1J9YA 3AMLA 4F8XA 3QOKA 1B9ZA 1US2A 3II1A 2QHAA 4GI8A 5EFDA 4M81A 5GQBA 1VFMA 2WC4A 1VEPA 4TVCA 3PZVA 1L8NA 3WH8A 3F5JA 4W7VA 2GUYA 4CKQA 1E5JA 1BF2A 2DGAA 1UA3A 1ISXA 3NSXA 3EMQA 4U3CA 1ECEA 2ZIDA 3MSDA 4MAVA 4RE2A 1JYVA 5HDRA 1NARA 2XYLA 1G9HA 3PZQA 2D23A 3AMGA 3WH6A 1EOKA 4A3HA 3VIHA 4M82A 2VURA 3EYPA 5BRQA 3VIGA 3AHXA 3WQVA 3CZJA 3WNLA 4S3JA 7CGTA 1QVBA 5FKYA 1AQ0A 4FF5A 3PN8A 1HX0A 5A6AA 5BXPA 2PWDA 4TXEA 2XFYA 3N15A 1FHDA 1XC6A 1HT6A 1J12A 4UFHA 2J77A 2BVYA 3ZM8A 5A6BD 1BYDA 3IJ7A 1HJUA 4OOUA 4X9YA 1UZ4A 3SUWA 1W1VA 1W1YA 1NH6A 1TVNA 1UKPA 2DSUA 1OIFA 3BAIA 4Z2JA 3E1F1 1V6VA 1KQYA 2E9LA 4MNLA 3WNNA 2WMHA 2QLYA 2CBVA 3ZT7A 3AS2A 1RD6A 4CD4A 4DM2A 4AYSA 3KL5A 3UG3A 3AXXA 4OBRA 2X8RA 1OGGA 2QPUA 2VVNA 4X0NA 3PZIA 3WD3A 1EHAA 1DWIM 1KCLA 3AI0A 3OLGA 4YHGA 1E5NA 2WNWA 5LA1A 4P8XA 1CXFA 4J3XA 5IFTA 1OSEA 1B1YA 1GVIA 1FP9A 5JIWA 3AIQA 1KGWA 4J28A 1B3VA 3CUFA 1WAWA 3GM8A 1O6IA 1UG6A 1FFQA 2VR4A 2ZICA 1EO5A 1QBAA 2W5FA 1J10A 3CHCA 1AVAA 4B15A 1Q6FA 4UOQA 4ACZA 2Y8VA 2JALA 2BXYA 4UZUA 3B9AA 1W9VA 5JH8A 1TR1A 1J0YA 3WH5A 1V6YA 1CXLA 2GDUA 2VRQA 1JG9A 1AQMA 2DSKA 1MQPA 4CD5A 4EANA 2D0HA 1UQYA 1JZ8A 1B3XA 3OLIA 2WLYA 1E40A 2UY5A 1H4PA 3TTQA 1UUQA 3BSHA 4L4PA 2BNJA 1VENA 3WQWA 1E0WA 2WBKA 3ZJ7A 2PWGA 2UY3A 2ZX6A 4JFTA 4DUXA 1HKMA 4UCFA 3VNZA 1MW1A 4WSJA 2W92A 3LPFA 2O9PA 3SCNA 2WK2A 3FY1A 3AZTA 2GJXA 4AZ5A 1PX3A 1W32A 4UTFA 2UWFA 5GNXA 2EQDA 1SYTA 2V5CA 2WCSA 4E2OA 5HPCA 2JEPA 4HMEA 3VO0A 2WVTA 2VZOA 2QF8A 4W7UA 4NZCA 2O9OA 2EPLX 5CQ1A 4LYRA 5CXPA 2XJ7A 4WKFA 4KGJA 4PMUA 2FHBA 3SCWA 2JF7A 4QP0A 4RL3A 5AYBA 1CDGA 1X1NA 3GH4A 1W1PA 4YPJA 3M46A 4ACZB 4DUVA 4DWSA 1KGXA 4M8UA 4P8WA 5GNZA 2YL5A 4P8VA 2YA1A 5CSYA 5D8WA 1CLXA 2NW0A 2XWDA 2DSVA 1JFXA 1V6XA 1ZB5A 3PZNA 2GJPA 4H2CA 4M80A 1J0ZA 2PBGA 5ABFA 3L4VA 1WPCA 4KRUA 1GHRA 2VI0A 3FN9A 3ZIZA 4D6JA 2OSXA 3AXHA 2BFGA 3OBAA 4BQ4A 5DEZA 3VOCA 4B9ZA 2YBUA 4JCMA 5EBAA 1JF5A 1CECA 2GJXB 3GNPA 3VM7A 4IPLA 2D3NA 3WDQA 2W66A 1GPFA 1W3HA 5CPQA 1XSIA 4UR9A 1FP8A 1CNVA 3WDHA 2DIJA 4JFUA 1H5VA 5CG0A 2A3BA 1XH0A 4NI3A 1KBBA 2X0HA 1JZ3A 2OYLA 4PTVA 3L4TA 2NT1A 1RP9A 1U30A 2WMJA 4EK7A 3L2MA 1NOUA 4UQBA 1DTUA 2EPKX 1XD0A 4JZ5A 3AMKA 3EDKA 1LWJA 1VB9A 4E4PA 4DWSB 3LMYA 3K8LA 1OD8A 4TX6A 1EOMA 3U5UA 3S6TA 1KCKA 1MQQA 2XPKA 1EXPA 2JFEX 4ML4A 3RO8A 3ZOAA 2V3EA 4D6CA 4BCEA 3AYRA 1PZ2A 5FL1A 2E9BA 4LXFA 5ABFB 3DYMA 1M53A 4D6IA 4ZE5A 1GW1A 3MMUA 4S3KA 2E4TA 1GOQA 3HU7A 3GH5A 2YL9A 2XIIA 2G41A 4HA3A 4TOQA 1I1WA 1H41A 1VEMA 4W5ZA 1VBUA 5A3HA 4MB5A 1U2YA 2GSJA 1V0KA 3GXDA 2CETA 1HKJA 1PAMA 3VINA 5BRPA 1XCWA 1HKIA 2J7GA 3GDBA 4MADA 3CUJA 3T09A 1OIMA 4WK9A 2J8FA 4AEEA 4HZ6A 2DIEA 1E9LA 3CLWA 1KGUA 1E6SM 4J3WA 3N11A 4UQ9A 1C8QA 4MDOA 1ITXA 3WIJA 3VUPA 4FMVA 3F5KA 3MMDA 4AY1A 3WENA 4D1IA 1E6XM 4LGXA 3UG5A 1CBGA 1JNEA 3OG2A 1JYNA 1EIBA 2NT0A 2HISA 1SMDA 1ZS2A 2VZUA 2CKSA 3W27A 2XWEA 1FH7A 5KZ6A 3VGGA 1EH9A 3EDEA 1OD0A 5EFFA 1HKKA 3AIUA 4A4AA 6TAAA 4W87A 4QAWA 3WQ8A 4GIAA 5FD0A 2VT0A 1XRVA 3CZLA 9CGTA 3RM8A 1UKOA 1W2PA 1V3HA 3DHUA 1E6QM 2DH2A 2VCAA 2WKLA 3APGA 1WDPA 1XHGA 8A3HA 2A3HA 5FL0A 4CGTA 1B90A 1F4HA 2B31A 2WMIA 4PTWA 2YIHA 3ARRA 1V6WA 1DEDA 3T0AA 1OT2A 4KWUA 4P7QA 2VUYA 1E4NA 5ECUA 3J7HA 4UZSA 1UD4A 4LX4A 3DYPA 2OLHA 3B9EA 1MWOA 5DF0A 3WUGA 1NP0A 3NJ3A 2FHCA 1MYRA 1NWSA 3MV01 3AZSA 2WCAA 1KWKA 1UR2A 4OUEA 3ZJ6A 1CPUA 3MO4A 1K9DA 3K46A 3TTYA 5I6SA 5A6BA 2BY3A 4FLOA 1C93A 1VJSA 1BLIA 4W89A 3O6AA 2XVNA 3A4AA 3ZR6A 2V5DA 2YDQA 4UFLA 5D8ZA 3CGTA 4CD6A 2RGMA 3NUKA 2OYKA 1JF6A 3VIIA 1WZKA 4FK9A 5F7UA 4AD1A 1IV8A 2CERA 4QCFA 1UR1A 1GZJA 1JZ6A 2PF0A 2WMKA 4Q7NA 1UHVA 3WQ4A 4JL2A 2J7EA 1UZ1A 1B3WA 5JBEA 3TONA 3CZ8A 1P6WA 3GBDA 4H8HA 1WCGA 3WF1A 2ZXQA 2J7FA 2UY2A 4AIUA 4HTYA 2PC8A 3W24A 4EAMA 3ARTA 4P7NA 3DC0A 4N42A 4CU7A 1HN1A 1N82A 4AZHA 3VGHA 4EKJA 2WMIB 3D3AA 3GTNA 3VGDA 1JD9A 3FW6A 4F66A 4AZCA 4MB1A 4LPCA 1J0HA 1BYAA 4OJYA 4JL1A 3LPGA 3ZSTA 4HPGA 2WVVA 3WN6A 3BAWA 3AIEA 4DUWA 3N1AA 2V3DA 2YKKA 5CGMA 1UR4A 5ABHA 4MPKA 3AICA 4GKLA 5I2UA 1JZ7A 4D6HA 2G3NA 3ARSA 2YBTA 2YLLA 1PIFA 3VMPA 4GXPA 2VX4A 3U5YA 2TAAA 3CUHA 2D0FA 1HP5A 2WMFA 1KXHA 1CGTA 1H1NA 3AIWA 5I5RA 2FH8A 2W62A 3WD1A 2D24A 1JNDA 4PRWA 3SCTA 5I3DA 1CGUA 1MW3A 5IFPA 2AAAA 4PEEA 3JUGA 2IUZA 3A6OA 2ZUSA 3UEQA 3ARVA 4B3KA 1IZJA 3U57A 3WEMA 5A8NA 2BHUA 2J79A 1MXGA 2F2HA 1J01A 2QMJA 2D22A 3T2OA 1E6ZA 3WQ5A 1KQZA 3NDYA 2WXDM 2VJXA 4W88A 1JXKA 2ZX8A 3UG4A 1EDQA 4H04A 3PZ9A 2E3ZA 3AS3A 4AZCB 1HP4A 2VMFA 4JIEA 4R5EA 4AIOA 4TUFA 2BVTA 3AHVA 1E70M 4HOZA 5A6MA 2WVVB 2G3IA 4V28A 5CPSA 1NQ6A 1R87A 3IJ8A 4UOJA 4GO8A 4AD2A 1CGVA 3I3DA 1QBBA 5CLWA 1UWUA 4UFKA 3WDJA 1Q6GA 4N0RA 2EBNA 5M17A 1J18A 5EB8A 1B2YA 2WZHA 4TVUA 5A2CA 2E40A 1I1XA 3AIVA 5FOOA 4B16A 2WCGA 4AZ7A 1NM9A 1Z32X 3RDKA 1V3KA 4UFJA 2WVUA 4IISA 3VILA 4WF7A 1MXDA 5M5DA 3ZT5A 1HJQA 3AIBA 2BVDA 3WKZA 4U3AA 3ARXA 3MSGA 4HOXA 4YN5A 1XCXA 3WBAA 3VGEA 3CHFA 2XFFA 1K6AA 4WKAA 4CVUA 4H8UA 2J7DA 2VCBA 1ZJAA 3ALFA 1JI1A 4CN6A 2VZVA 1QHPA 4R27A 1H0IA 3BAKA 3QHNA 1DWGM 1GOWA 1PX8A 1XSJA 2J25A 2XVLA 4U33A 4AW7A 3VDAA 1E0VA 1TZ7A 2OWWA 1ZL1A 2X2YA 2ZUWA 2W4XA 4CU8A 1DP0A 1TUXA 4AZ6A 1VIWA 3TTOA 1PEZA 1PBGA 2E8YA 1MQRA 2Y2WA 3EMZA 2BHYA 1OWQA 3ARYA 4MJ2A 4PTXA 3WEOA 2ZXDA 4AD4A 3EBVA 3ZR5A 1QNQA 4URIA 1BVZA 5JIPA 1OB0A 4WIWA 1C7TA 1W2VA 5GPRA 3OZOA 2WB5A 1KR0A 3ZQ9A 4W86A 3IANA 1K9FA 2WC3A 1UH4A 5A8QA 5EMYA 6CGTA 5A94A 1E71M 4MB3A 1DWJM 3WUFA 1V6UA 1CLVA 4IUGA 5IHRA 3CHDA 1KWGA 1GOOA 1V02E 3WL1A 5BCAA 5C8BB 1LWHA 1QW9A 3TA9A 2OSYA 4D6FA 3M6DA 1NOFA 4DM1A 4XUYA 1HJWA 2G3JA 3L4YA 3UERA 5D9MA 3DHPA 3W25A 1CGWA 2W63A 3MUY1 1B3ZA 4HMDA 4ATLA 1K9TA 1W9XA 2VX6A 2VQUA 5IHSA 3VPLA 2D1ZA 3UR7A 3AJ7A 3W26A 1V0MA 4PUDA 3QR3A 4CVWA 3MS8A 1DWAM 1X6NA 3PTMA 4U5IA 1QPKA 4AWEA 1VRXA 3VTRA 1ZU8A 3L4XA 4PMOA 1O7AA 1B31A 4FLSA 5A8PA 4M29A 2CIPA 2WC7A 3AHZA 3EDFA 4KMQA 5A6SA 1E4LA 3SCRA 1EQPA 1W91A 3WNOA 4UQDA 3RM9A 2WSPA 2X0YA 5BXRA 5LA2A 5E09A 2QPSA 1D2KA 2WW5A 1OM0A 1TVPA 1UWTA 2ZXBA 2ZUVA 3MUIA 1UYQA 1E3ZA 3AS0A 1G94A 3SCOA 3VNYA 5CSUA 1WDQA 3CZEA 1YQ2A 1UD6A 3I3EA 2QV4A 5E70A 3OA5A 3A4XA 4MB4A 3THCA 7TAAA 2PWFA 2V38A 5TD4A 3VGFA 1EA9C 1UR0A 1LLOA 4L4OA 3A4WA 2DPEA 1MW2A 5BXTA 2XTKA 1A47A 2J8GA 1EQCA 3VDBA 1V0LA 2BY2A 5A2AA 4CCDA 1Q6CA 4QLKA 3WMBA 4V2XA 2VC9A 4ZEPA 3ZMRA 4XZBA 2G3MA 4UQCA 2AMGA 2DDXA 4KRTA 2CNCA 2NSXA 3SCSA 1JDCA 1TMQA 4PN2A 1CZ1A 3K4DA 1KR1A 2E9MA 2UY4A 2DT1A 1UD3A 2EXOA 4HZ8A 3CMGA 5HNNA 1QI0A 1JDDA 1GVYA 4WSKA 1HJVA 1ZJBA 2ZUMA 3VX0A 4LQ1A 1FHLA 4P7LA 2FHFA 4Z2LA 1ISZA 1JYXA 4ZE4A 4IM4A 4W84A 3AHYA 5FCZA 1V03A 1LF1A 1V08A 4P8UA 1XH2A 3PHAA 1H09A 3WMSA 1JYWA 2XHYA 1VFOA 2ZWYA 4YHEA 4W5UA 3ECQA 3VIFA 4AMCA 3WNMA 1E0XA 4D71A 1HL9A 5LA0A 1M01A 4ZFMA 4QLLA 4WKHA 3WD2A 4BF7A 3VMOA 1WO2A 2O9TA 3K8MA 1QOXA 2VOTA 3VIJA 5A2BA 4HA4A 5IXEA 1ZBWA 2WLZA 2FDMA 2W91A 4J3TA 1R8LA 2C8NA 1C8XA 3L4ZA 1TG7A 2BXZA 3CMJA 4Z2KA 1A3HA 4PMDA 2PWHA 4JFVA 2CITA 3RMEA 2G8ZA 1G0CA 1GUVA 3AQUA 2CBIA 3BMWA 4KGLA 5C70A 3POHA 1E6NA 3CUGA 3WUBA 3QHOA 3KEHA 4HOWA 1W9DM 3T2QA 3RPMA 3LPOA 2WKGA 3WF0A 4F79A 3ARQA 2VZTA 1V0NA 5CJ5A 2WWDA 2WBGA 2EPNA 1EGZA 3N12A 3WL0A 2CBUA 1GONA 5I24A 4PMZA 2DSZA 1F4AA 5CZKA 3NIYA 5I23A 3CH9A 1JZ5A 3VIKA 1UQZA 1TA3A 2J4GA 4E8CA 1KB3A 2DT2A 1C7SA 4GI9A 2XM1A 3VKKA 2VCCA 1PIGA 1J0KA 3HN3A 3NYDA 3BMVA 3L4WA 1H49A 4CU6A 1EDGA 3T2PA 3PZUA 3L2LA 3UETA 3WNPA 4M56A 2BY0A 4JHOA 4D6DA 1LL7A 1QHOA 4GI6A 1W9UA 2PI6A 1R7AA 1CEOA 4AD0A 3U7VA 3WUEA 5A95A 2J78A 1ITCA 3EMCA 1E4IA 1E6RA 1NWRA 4V27A 6A3HA 4PYSA 1Q4NX 3MU7A 2IXUA 4Q22A 1GQJA 5AYIA 1SR0A 5AY7A 3ARUA 3I3BA 1UWQA 3SUSA 1PX4A 1OBAA 1WB0A 3FAXA 2BHZA 3PZMA 4U2YA 4TTUA 2WM0A 2X1IA 1HJSA 1WKYA 5M3WA 3WSUA 1BQCA 1BVNP 1CGXA 3CZGA 2XVKA 1ZBCA 4MNKA 3CZKA 8CGTA 1C3FA 3BSGA 3PZOA 2ZOXA 4ZXOA 4GINA 1EDTA 5LYRA 3TTSA 3G6LA 1E55A 4JAWA 1AMYA 2OWXA 3CBWA 1K9EA 1TA3B 3IAPA 1UKQA 3GXIA 3VX1A 1DWHM 1R86A 3W38A 3GXMA 2Y5EA 4PBGA 2Y4SA 1VFUA 2VRKA 4BA0A 5A8OA 2VX7A 2XG9A 2DSWA 1QI5A 3ZO9A 2DH3A 4BZYA 2VTFA 1J11A 2CXGA 3VD5A 1U33A 3W29A 1PJ9A 1C92A 2FGLA 4B9YA 4UQEA 2JEQA 3B8SA 1CXEA 2GJRA 2VVSA 1LG2A 1JI2A 5DMYA 2XM2A 3F5LA 1XV8A 3FNDA 1G5AA 1TE1A 4MNJA 4K68A 2YOCA 3BAXA 4C7DA 3WD4A 1MW0A 3ARPA 2O9RA 1EHNA 2WANA 4RE3A 3A47A 3OGSA 4X0VA 5I0DA 4OIFA 5E6YA 1YHTA 3OLEA 4ACYA 1FA2A 4PCSA 1C90A 1OGSA 1XD1A 3PZGA 1UWSA 5DT7A 5D9PA 2EPOA 3IJ9A 3W6LA 2GK1A 4C7FA 1NP2A 4Z2HA 2WVSA 4HA1A 1VEOA 1V3MA 4JHZA 2VZSA 1CXKA 4D6EA 3BH4A 4PMYA 1E4MM 3SUVA 1HVXA 4MAZA 1FH8A 2WYSA 3ZT6A 4MDPA 3GYCA 3AOFA 3O2LA 3WFZA 3BXWA 2YDSA 1ZBVA 4UFMA 3BAJA 4AIEA 3NSMA 3VU2A 2D20A 1ISVA 2ZX5A 5E9AA 4DWSC 1XSKA 4JKMA 3B9DA 2WMGA 2G4FA 4A3YA 2YL8A 5FIPA 2GFTA 1BAGA 4NRRA 3GNRA 1ISWA 2XUCA 3VMNA 4F9JA 1QI2A 1WDSA 1GQLA 1UKTA 1H3GA 2VQTA 3WFLA 3AMCA 1BFNA 3MV11 3RILA 1CTNA 5A8MA 3K4AA 3WH7A 2BY1A 3UCQA 3N9KA 3VVGA 1RP8A 4UFIA 1DWFM 4ZENA 2JIEA 3MMWA 4HP5A 4NRSA 4W85A 4PMRA 1IZKA 5C71A 2A3AA 2J75A 1C91A 1H11A 2WSKA 4GQQA 3AYSA 4LYPA 5AC5A 3BAYA 2GK1B 1JGIA 3L4UA 4HU0A 4CN4A 2WZEA 1HJXA 1E1EA 3GZAA 4CUCA 3BCFA 2D2OA 3N18A 2FGZA 2XSAA 5GNYA 2WHJA 2ESCA 1BGAA 2A3EA 2ZX7A 3T08A 2ZUNA 4AZIA 3KE0A 1UR9A 4HU8A 1JXJA 1TCMA 1E43A 1GOIA 4J3UA 4JFSA 2J47A 3S2CA 4AISA 3O9NA 3WDRA 1MVYA 4AC1X 2CCRA 2VO5A 4PSRA 1GORA 1CYGA 4CCEA 3UESA 2PB1A 4BS0A 2YJQA 2YL6A 4IPNB 2JE8A 5E0CA 3KWXA 1ZBKA 3SIMA 1UD2A 1BSIA 1W9BM 1QNRA 3HMCA 2OSWA 3WDPP 1S46A 1UH2A 2XGIA 4PMXA 2JIWA 1BGGA 3AXIA 5CPTA 4PMQA 4QFUA 2W61A 2VNCA 3T0BA 1BHGA 2YDRA 1VAHA 5CLTA 4WLCA 1SMAA 1CIUA 2FH6A 1V3JA 4PCTA 4P7RA 1QNOA 2CHOA 3VM5A 2EEXA 3KL3A 1J0JA 1V3LA 3N04A 1NWTA 1GHSA 4UQAA 3VDHA 2CHNA 1E3XA 2Q8XA 3SUUA 4W93A 2A3CA 4QCEA 4OBSA 3UR8A 1B3YA 3FXYA 3NSNA 1I75A 4W7WA 2YA0A 3EDJA 1FH9A 3TOPA 5I77A 1Y7VA 1JZ2A 2D0GA 1V02A 1Q6DA 4F9DA 4FLRA 2ZWZA 1ISYA 3BC9A 4MTVA 2QMKA 1JAEA 1OCQA 4H41A 5E0FA 4U2ZA 3W82A 3W0KA 3AS1A 5A69A 1LL6A
chains in the Genus database with same CATH superfamily
1O5RA 4NASA 4DT4A 1A4MA 2EPMX 1KW1A 3DHFA 2OPJA 5EKYA 4Z1DA 1BWVA 1SO5A 3LXAA 1SZRA 4H7VA 5F4WA 4IFKB 4JTTA 3Q65A 4Z2IA 1BYBA 3QM3A 2ZCGA 2WNNA 1ZFJA 4G7FA 3VIPA 7PTDA 4MUPA 3QMTA 1E44A 4NL1A 2YW4A 4GYPA 1W3NA 5C9RA 1FWJC 1E56A 1QNSA 4H19A 4H9UA 4KIRA 2DZSA 3U7BA 3B97A 4HTBA 3THAA 2CESA 4H00A 4ODMA 1J8VA 1VJZA 2M1IA 5D9NA 3GR4A 3QKZA 2XN1A 1DE5A 4ORMA 3TW7A 4AEOA 1W31A 3VOFA 2ZR5A 2QCDA 2XSXA 4EVZA 1GVFA 3WD0A 3LCIA 3W86A 3UR5A 4I8DA 4M1RA 3LPPA 4NF7A 4RLIA 1PPIA 3QHMA 5CPNA 1I9CB 3JZUA 3NGJA 1VQTA 3SUTA 2EHHA 2RGLA 3ZLHA 1NELA 5DT5A 3WLTA 4FNQA 3WH9A 3OGVA 3JU2A 2PGRA 3FHAA 1OGBA 4WDTA 1HFBA 2XVPA 4J3SA 4JCLA 4A29A 1TELA 2NQHA 1LG1A 5HT1A 4PR4A 2CKRA 4ERIA 2MANA 1TWDA 3VE7A 3UXLA 1RCQA 4LUTB 4FXRA 4B92A 2EGZA 3KAGA 4ZQRA 3UCCA 1YE6A 1VGAA 4C1NB 5FI8A 1SJCA 2VR5A 4LT9A 2Z1SA 3KOYA 1ONXA 3YPIA 3WQ6A 4XV0A 4JIHA 3CGMA 1LUCA 5FAJA 3VD4A 3LK6A 4YTSA 2WAGA 3A3HA 2VFEA 3SEPA 2V3FA 3W37A 3CUIA 5BZAA 3NZRA 2Z1KA 3LHUA 4GO9A 2DT3A 3PJXA 4UNIA 1Q6EA 2CBJA 3Q2DA 5KEZA 1B30A 3N17A 4UTHA 4S3DA 3W53A 4CEUC 1W3KA 3QPZA 1AJ2A 3NPWA 1ZAHA 3R0KA 1QNPA 1W5PA 5EYWA 4HMCA 4J7RA 5A5WA 3IKDA 4ERGA 2VKZG 2F21A 3LHVA 3DBNA 4KPLA 4GNVA 3R8RA 1AJZA 5D2TA 3VD9A 2IQDA 2VEPA 5I79A 3FA4A 3T0TA 3GH7A 4DI9A 4M1BA 1W3LA 3H70A 3M07A 1IYXA 4NNCA 2G37A 3TEVA 1BTCA 4QIUA 2P4VA 3M0XA 2QUVA 5IDIA 2O55A 3RM4A 2GDVA 3GWQA 4A3RA 1SFJA 2PDFA 3L7RA 5FJJA 2EF9A 3FAWA 5LIWX 1FY6A 1VH7A 2YA2A 4WQ6A 3S3GA 3NZQA 1CW2A 1GQNA 4C02B 3BLKA 3W1NA 4CN1A 5ABEA 3AU6A 1PTDA 1VBRA 3H2CA 1QT1A 1POJA 3L0KA 2J6XA 2A4AA 1IT8A 5LXEA 2D3LA 2XP5A 4RV3A 3DHDA 1ZP3A 2V81A 3L65A 3ZJ8A 4C6KA 1Q13A 2WM1A 4D1JA 3T40A 2H3BA 1QW7A 2RUCA 4OV4A 1FKGA 2OEMA 5HOSA 1TREA 4GQRA 1Z48A 2X05A 3BQ5A 3EDDA 1E72M 4MWAD 4MJ4A 3I6CA 4LBUA 4M24A 3PWIA 2F6UA 5LIKX 2YLAA 1VF8A 1CXIA 3O16A 4JFMA 3STGA 4YNGA 4HNTA 2R91A 4GFSA 1NOWA 2XGZA 1RBLA 2A7PA 2UBPC 4ZTXA 3W00A 4US5D 2HNHA 1G01A 2OTDA 3SRHA 2F61A 3SQMA 4R0XA 2VRJA 3OLDA 3V35A 3JXVA 3GW0A 4MNMA 4IMEA 1R2TA 1RSCA 1FFRA 3G1FA 1ZP4A 4C1KA 1U22A 3UZWA 1L0PA 2A7NA 2QAFA 5HWNA 2Y6ZA 1HQTA 2J7HA 3ZJKA 1X6LA 4A21A 2XPAA 4DBSA 4UBPC 5K4ZA 4KWWA 2BDQA 3FJLA 4ML9A 1EP2A 1DIEA 2WPGA 3JYMA 4XD3A 1WV2A 4H8NA 2F8QA 3M0KA 2YFOA 2E8ZA 2FPTA 4QDMA 3E2RA 3STEA 4DF2A 4YWSA 2J7CA 4RXGA 3KDNA 3IGSA 4AEFA 3AMLA 4V1XA 2Z1VA 3UGRA 3O5RA 3A22A 1US2A 3ZVHA 2OGJA 4GI8A 4RZ5A 3R5EA 5GQBA 1YKWA 1Q65A 4HSOA 3QFWA 1MXSA 1AL7A 3PAOA 1KM2A 4RZ6A 1ISXA 4DZ2A 4U3CA 1ECEA 4L1WA 4MAVA 4DJEA 5HA7A 1R3RA 3OVQA 2ZRWA 1S2UA 3TQKA 3SY5A 1R0MA 4ZQPA 2KX9A 3QR1A 4NZ5A 3VIHA 5HATA 5KITA 1Q5MA 5BRQA 4QDWA 1A5UA 4QAIA 4LAVA 3CZJA 3FKRA 7CGTA 1BSLA 3OW1A 1M68A 2OX1A 3WBYA 3BG9A 4HNUA 1OX6A 2R1LA 1K7FA 2PWDA 3URAA 3N2MA 5KMYA 3F4CA 4GBDA 4UFHA 3V0SA 5A6BD 4JIIX 1BYDA 3T1GA 2CLPA 4PODA 1FXPA 4E6MA 1HJUA 4L9YA 3SUWA 3B0YA 3R12A 4U84A 1OC7A 4N02A 4C6EA 1HO4A 1FWNA 3WLLA 4DX3A 4BF9A 1FCQA 1KQYA 1JDFA 2E9LA 1JPHA 3JS3A 1XIBA 3I4KA 1RD6A 4CD4A 3KL5A 3UG3A 1F40A 3CQHA 1JRCA 4M6UA 2C91A 3CAKA 1ME7A 4DAFA 1KV5A 1K1DA 4MHBA 1QO5A 4GUJA 1W0MA 4YHGA 1FKIA 5LA1A 4P8XA 4J3XA 3C8FA 1B1YA 4GLEA 5JIWA 4PEKA 4KQZA 3QYQA 1FFQA 2PDLA 4YTTA 1KTNA 2AWGA 1J10A 3BK0A 3FA5A 1F3EA 3DH7A 3AYTA 1AVAA 3QV7A 2BXVA 5DMMA 2EKCA 2RDUA 3GTYX 1K4GA 1FVPA 3S5YA 2GGIA 5JH8A 2INFA 4G2DA 3S5OA 5DIUA 3GPKA 1JG9A 4JBRA 2R9RA 1MQPA 4EANA 1JZ8A 2LGOA 1VIZA 3S9IA 1E40A 1RAKA 3LRMA 1NDZA 1UUQA 1Z3NA 3BSHA 2QULA 3ATYA 4LTSA 2R94A 2ZX6A 5M2FX 5PTDA 1TJRA 4DUXA 1HKMA 2P1FA 4UCFA 3K1GA 4ZO8A 1PTGA 3WK2A 2A6LA 5GNXA 2EQDA 1SYTA 1V7AA 2E1WA 1LYXA 3N2BA 3L5LA 1OZQA 4HMEA 3VO0A 3NYZA 2QF8A 4NZCA 1OFEA 1A5SA 1PE1A 4WDXA 3BTNA 4GQBA 4PB3A 2AGKA 4NZ4A 4LAYA 1W54A 1O94A 5AHEA 4WKFA 3B0UX 3L0NA 3SCWA 5JMUA 3PNZA 3W1TA 3PWGA 4ADTA 4RL3A 1FAPA 4DROA 1X1NA 4O54A 3UJFA 4ACZB 3MT1A 5FJOA 3W87A 4P8WA 1SR9A 3S2LA 4G8TA 5CSYA 4TYOA 1F5ZA 1V6XA 4KEUA 1I2OA 2GJPA 5DXXA 4H2CA 1XICA 3CC1A 3TZNA 3B8DA 1VD6A 1ADOA 5REQA 4KRUA 3FN9A 2VI0A 3KP0A 3IGUA 1ZUAX 3WLPA 2FYMA 1GYMA 5EBAA 2J27A 2GJXB 3WDQA 4Q4OA 1IR1A 1XSIA 4BY3A 1CNVA 3QLLA 5CG0A 1B4KA 2X0HA 3P6LA 3USZA 1JZ3A 2OYLA 4IZGA 2NT1A 1KBLA 4EK7A 3L2MA 2Z1XA 1DTUA 2EPKX 5LNSA 4ERAA 4JZ5A 4GIEA 4F48A 2A3LA 3VCNA 1XS2A 3ODKA 3EDKA 4MWAA 5FEWA 1LWJA 1VB9A 2PZNA 4E4PA 4DWSB 1Z42A 2HK0A 5DITA 3S6TA 3W1UA 2NX1A 1KRBC 2QCNA 1MUMA 4DQWA 1YPXA 4X9SA 1LBMA 2JFEX 5FEZA 4JFKA 4Q8VA 4YL2A 2V3EA 5FF4A 4D6CA 3HMJG 3NM1A 3PPCA 4US5A 5FL1A 3RXZA 3LEPA 4LRSA 2DU2A 2D2HA 1F7BA 2CLEA 4S3KA 2E4TA 5HKGA 3PF3A 1M1BA 2RUSA 1VZWA 1VEMA 5G2IA 3C0JA 1VR6A 4K8HA 2YCEA 3M6YA 3S8HA 3G5EA 1HKIA 1OIMA 4REQB 5EGRA 3HA1A 3HJZA 2MNTA 3ORWA 1KGUA 1XRSA 1W26A 4UQ9A 4TQTA 1EA0A 1ITXA 3WIJA 1VLIA 4FMVA 3F5KA 2A85A 3W70A 4AFYA 4QROA 4Q4QA 1EJTC 1CBGA 3VFLA 3ELFA 2TPSA 3OG2A 1PUDA 3TSDA 1SMDA 2VZUA 2Z2AA 1FH7A 2NQZA 1EH9A 3P74A 1NSJA 3EDEA 5EFFA 3RU8X 3C2EA 5I3HA 1F73A 1YYAA 1PHWA 3LHYA 4MGGA 4GIAA 5FD0A 2Q01A 1XRVA 2FIQA 4RDZA 1HUVA 4GWEA 4MMWA 3MJMA 4IL0A 1W2PA 1V3HA 1UIPA 3SW6A 1E6QM 2DH2A 2WKLA 2ZQTA 3FGCA 1XHGA 1SQ7A 1A0EA 2PA6A 4ICMA 1XLJA 2GDQA 3QBUA 4PTWA 2YIHA 1NQKA 1DEDA 1E4NA 2DG3A 1DJHA 1S5VA 1UD4A 3IARA 3S1WA 2GGGA 1OABA 4AX6A 2OLHA 3B9EA 3GU0A 1OC5A 1MWOA 3WUGA 4AUBA 3INPA 1XIEA 4MYAA 4Q8MA 1L6YA 4L9XA 3RCYA 1UR2A 4YJ5A 3C5QA 1CPUA 9RUBA 3K46A 3TTYA 5A6BA 2C14A 5BU6A 2PDQA 2BY3A 4PUUA 1KD0A 3FJ4A 7ENLA 2XP6A 4LUJA 3E02A 3WJSA 5D8ZA 3NUKA 2OYKA 1JF6A 5I07A 1WZKA 3LBMA 4E2DA 2EKGA 3I10A 3HF3A 3LCFA 3KAHA 1XIHA 3G1VA 3GTFA 1ITUA 3C2OA 4B5TA 3KX6A 3B3DA 1UZ1A 4KW2A 5JBEA 4PB5A 1TV2A 1EUNA 2E25A 4AIUA 3UQAA 1V6TA 2PGEA 3CNYA 3GVGA 4LAZA 4H9TA 1S2CA 3E5PA 1N82A 1REQB 4OQVA 3HG4A 5C9UA 2WMIB 1J5TA 3VGDA 4F66A 4K1GA 4MB1A 4GFIA 3N6JA 4OJYA 4WY0F 2HEJA 4JL1A 3ZSTA 4PL2A 4HPGA 2K8IA 2IQ0A 2TODA 1AA1B 2CLLA 1BVWA 3BSMA 4M51A 4MKNA 5ABHA 3G8RA 1Y0OA 3C2FA 3TA6A 2BGSA 3MZNA 3A9BA 3M5VA 3MKVA 4UMAA 1MNZA 1NIUA 1MSSA 1PIFA 4WJ8A 3IVUA 3PSVA 1KXHA 3CQKA 4HJWA 1ELSA 1J6YA 5I5RA 4L64A 2W62A 4HNVA 3TC5A 1OYCA 1H61A 4DUOA 3LGDA 1EJXC 4OECA 2PP3A 5I3DA 3MC5A 5KZDA 3L5AA 2QEZA 4QJ5B 3A6OA 1TTJA 5A8NA 4X60A 1J01A 2QMJA 4LEQA 2D22A 4N9DA 1PBKA 1EYMA 2QDEA 4W88A 4MFEA 3WJYA 1ZJIA 2ASHA 3VOHA 4GY1A 2VEKA 2E3ZA 1SZNA 3KADA 4CQAA 1GT8A 4TUFA 3C3UA 2Y7EA 1HO1A 2WVVB 3TFCA 1HW6A 4V28A 1P5QA 3KVKA 4Z1CA 3FSUA 4UOJA 2FB2A 1CGVA 2VDGA 2IKIA 1M5WA 3TMLA 3AWOA 3G1AA 2C1HA 4N4QA 2EBNA 2ZADA 4UMCA 2FPYA 2EPHA 3TW9A 1I1XA 5FOOA 3GG1A 4ZQCA 2WCGA 4B16A 1Z32X 3SAZA 4KEVA 3VILA 4WF7A 4TW7A 3PNUA 1HJQA 4GABA 4IIHA 4TR9A 1HXVA 1Y5WA 4UB9A 1E9IA 2PTXA 3A21A 3VGEA 4HARA 4HSNA 4H8UA 3I6RA 3UF9A 4CNPA 3ALFA 4CN6A 1OQFA 1TIWA 3ZFHA 2VZVA 1AD1A 1DL3A 2HNEA 2I1OA 4XO7A 3BAKA 5C9XA 4PULA 1KO0A 1TPFA 3W7JA 1ADDA 3V18A 1TZ7A 4TNSA 3O5MA 2ZZ7A 5GPGA 1VIWA 3TTOA 1PEZA 2GYIA 1QXLA 1OWQA 2Y62A 2F9RA 3F4NA 3LS9A 4XISA 2ZDSA 3WEOA 2ZXDA 4S2BA 5HWCA 2HTMA 1QNQA 2Z24A 4URIA 1FKXA 1SW7A 3TWBA 5T91A 2YDAA 4HK5A 4PUMA 1J4HA 1GVOA 1O68A 1TWWA 2YPIA 1SPQA 2WC3A 6CGTA 3I7QA 2ABAA 3WUFA 4LC8A 1V6UA 4D2JA 3GTHA 3CHDA 1KWGA 1KCXA 1V02E 1RJRA 5BCAA 1G4TA 1LWHA 3S0CA 1QW9A 4D6FA 2PN0A 1ENUA 5DCEA 1NOFA 1HJWA 2PTYA 4L1XA 3BG5A 3UJRA 2W63A 1EF2A 3B8WA 3MUY1 3QF0A 4LS0A 3S5NA 2VQUA 4EPEC 3GYEA 3IK4A 4M7SA 1V0MA 2FTWA 4K2SA 4F40A 4QISA 3MS8A 4HYWA 2RJHA 1QPKA 1XG4A 4AWEA 3L66A 5CKSA 1B31A 5KZEA 3FCPA 4M29A 5DMNA 4FP1A 3D47A 5A6SA 2Z4GA 4C6DA 2BLEA 2YGYA 1CX9A 3DCPA 4FAMA 4OWGA 1XIIA 4NT0A 1UWTA 4POCA 4JY8A 1IE7C 1VYSX 5TAOA 2VGIA 3PRDA 5DQPA 3AS0A 3OVGA 3F2CA 3R79A 3CZEA 1EJSC 3E74A 3MZ2A 1XR2A 1RVKA 5DRIA 5E70A 3A4XA 3QTGA 1EKOA 2IPGA 5TD4A 5C5YA 3V5CA 3NZGA 4O13A 1UR0A 2DW6A 1LLOA 5H1WA 4YIWA 3V3WA 3PPFA 2NSOA 4K8EA 2KGJA 2V68A 5DBTA 3EOSA 3P14A 3V75A 3KFTA 5A2AA 1DV7A 4QLKA 1PTAA 3E2QA 1OFPA 2G3MA 4UQCA 1EFZA 2AMGA 2HQAA 4J2MA 1RA0A 3K4DA 4GE8A 3EB3A 4IIBA 2EXOA 1W3TA 2RUDA 1Y65A 3W7MA 2HBXA 1YADA 4LQ1A 3ITVA 1Y0EA 4ILSA 4ZE4A 4WX2A 3GIQA 4W9QA 4ZTYA 5IRPA 5ECVA 1WA3A 2H9AB 3PHAA 3N25A 4ZOEA 4G1NA 1H09A 2J13A 1FKSA 3TLLA 2XZ9A 2WSRA 1X96A 3OVPA 2ODOA 4UTWC 3N4FA 1XM3A 3S2JA 3U4FA 3LENA 4ZZ9A 1DIKA 4O53A 1E0XA 1YRRA 2PDXA 4OT7A 2PEVA 4K7YA 4DHGA 3B06A 4RKAA 1M01A 1Q6UA 4ZFMA 2IW0A 4QLLA 1OYAA 4ONVA 3EGJA 4JGDA 1XLKA 1QOXA 2AQOA 2WV8A 3VIJA 4HA4A 5IXEA 3VNDA 1ZBWA 3C0LA 3PRBA 1R9HA 4J3TA 3M5YA 7XIMA 1KBJA 3NL6A 2PF8A 3SRFA 2BXZA 4NYYA 3UI4A 4Z2KA 1BWLA 3VAVA 3O6CA 1S5WA 4GCXA 3RMEA 1G0CA 2ADAA 3AQUA 3V7PA 4GNKB 1G7VA 2C1GA 3ZS4A 5C70A 1F8IA 1Q6IA 3EOEA 3CUGA 2OZ8A 2R24A 2CWNA 3WUBA 3KRZA 3R1ZA 4HOWA 2WOQA 1W9DM 4HNLA 4F79A 3ARQA 2NZLA 1Q2RA 1QMLA 3A4JA 4PCFA 2I9UA 4Y96A 1EGZA 5BMWA 3H4XA 3VKBA 1GONA 2VP8A 5I24A 1F4AA 5I23A 3CH9A 5FJRA 1JZ5A 4DNHA 1OFQA 1SZEA 4KCUA 2VGBA 5DRCA 4ZFCA 2J4GA 1VCGA 1E0UA 4DO5A 2RSEA 4PUJA 5U7SA 1XCFA 3O15A 3ZZ1A 1KRCC 4AY7A 4CNTA 1ZRQA 1GVQA 4XKYA 3PRAA 2GQ3A 3HN3A 2O0TA 2F38A 1H49A 1JUKA 4B5UA 1I0DA 3UETA 3WNPA 4JNMA 4D6DA 1QPLA 1LL7A 3O5GA 2VOMA 4DXXA 2ZBTA 3WLNA 2X2GA 3JW7A 5FEXA 5D33A 4G6CA 2RAGA 3CH0A 3QW3A 3VDGA 2CLMA 2G97A 1GK8A 1Q4NX 5C2GA 1XQLA 1OHLA 1H60A 1GQJA 3S6DA 3EZ4A 1TSIA 3IJQA 4H9MA 4P61A 4HPJA 2YXXA 1WB0A 1A5NC 3FAXA 4G7EB 1OF6A 3VUSA 4GJ1A 1HJSA 4NNRA 1SSGA 2BG5A 5TF0A 2HE5A 1BQCA 1QDSA 4LAMA 3WSUA 3PVFA 4O19A 2XVKA 3CUXA 1ZBCA 4MNKA 3CZKA 1RK6A 3U2ZA 8CGTA 4Q8TA 4XAKA 3NL2A 2YXGA 2WJEA 1UC4A 4ZXOA 1FCUA 2VFFA 2Y70A 3S1UA 3G6LA 1E55A 3NWRA 1AMYA 3CPGA 1K9EA 4JTRA 5M1TA 3P82A 4YXGA 3GXIA 2Y78A 3VX1A 3UJEA 1R86A 2BOEX 2RKXA 3ID7A 1I8JA 2D2JA 2DZBA 2GVGA 2Y5EA 1X6UA 1FQ0A 4J2PA 4A8IA 2CZEA 5LHEA 2HXTA 1QI5A 3RCMA 2J8TA 2DH3A 3DBPA 3MDUA 4JIRA 4LNCA 4DY1A 3LGEA 2NQ9A 3W29A 9XIAA 3QZAA 2OVLA 3DN5A 4IT6A 2INZA 4H3DA 5BWAA 1WDDA 1CXEA 2VVSA 3DI1A 1RK5A 3SECA 1KA9F 1WAUA 2ISDA 9XIMA 1G5AA 4GNJA 1FKHA 2YOCA 3PANA 3EOLA 3QLDA 4ZPWR 1MW0A 2O9RA 2GOUA 4DZHA 4X0VA 2CZDA 4GIRA 1AMKA 5E6YA 2JGQA 3OLEA 4ACYA 3O1NA 3G0SA 1C90A 1XD1A 2RUQA 5DT7A 4Z1YA 1UC5A 3W6LA 5F1VA 2GK1A 3FYPA 1NP2A 4HA1A 1ONWA 3BMXA 3TQ0A 2VZSA 3PFRA 4D6EA 2C1IA 1A5MC 1TYGA 3L2IA 4A3UA 2WSYA 1HVXA 2C79A 3H2FA 3HGSA 2WYSA 5AVNA 3TR9A 1GWJA 1PCKA 3GYCA 5D02A 3O7UA 4FNPA 3WBXA 2P0IA 3NSMA 1GVRA 1T8XA 2D20A 1ISVA 4A3QA 2G4FA 1W5NA 1ZPTA 1TV5A 2GFTA 4NRRA 3VNMA 4LB3A 3GNRA 6ALDA 2XUCA 2ZRZA 2GVJA 5F2GA 2OZ0A 1UKTA 2VQTA 3WFLA 2J9ZA 3NQ2A 4NAFB 3T05A 1BFNA 3T0CA 5IBXC 1SO4A 3B04A 1CTNA 1GEQA 1KM1A 3S1GA 3WH7A 5DELA 3RU6A 3HQNA 4DO6A 1NF7A 3GXNA 2JIEA 3GDMA 4TW6A 2CLIA 3E2VA 2P8BA 4W85A 5FF2A 3W75A 1XBXA 3VCRA 1EWDA 2GUBA 4JN8A 2EAWA 4ZA0A 5CEWA 3HG2A 5AC5A 5AHMA 3TW6A 1JGIA 3UQIA 4HU0A 4CN4A 1FWEC 1FKLA 2QZRA 2F2DA 3FIGA 1MZHA 2FVMA 1K8CA 2FGZA 4RNJA 1JRBA 2ESCA 1OY0A 4QEEA 3C56A 2A3EA 3FLUA 1EBHA 2PDIA 2XP4A 2ZUNA 3CUZA 3TYCA 2PURA 4Q8WA 3NGFA 3MUCA 1ZAJA 1TCMA 1E43A 3KUMA 3S2CA 4AISA 1MVYA 5E0KA 3U3HA 1GORA 4LV4A 2PB1A 2P88A 4PTDA 1HZYA 2ZRUA 3GRIA 3KWXA 1ZBKA 2DQWA 3SIMA 4JTFA 5I3GA 3H53A 3WDPP 4N19A 3ANUA 5I03A 4PMXA 2JIWA 3EPOA 3GTXA 3STCA 3TJXA 1YDYA 4PMQA 4QFUA 2W61A 1W5QA 1BHGA 2YDRA 4K1WA 2G3FA 4WLCA 1SMAA 3APTA 2PDUA 1V3JA 3TIMA 2B7PA 4P7RA 5I09A 1QNOA 3KAIA 1L8PA 4LY8A 1KFLA 1XFBA 2AL1A 1J0JA 3N04A 4NJJA 4Z1AA 2NLYA 1GHSA 4FIQA 3NR0A 3SO7A 2NV1A 3L5MA 2VEFA 2RJGA 3TOPA 4A2SA 1V02A 1Q6DA 1KM4A 4MLRA 2FTYA 3LNPA 5G2HA 1RVGA 4HK7A 4MTVA 4I8YA 4H41A 2B7QA 1C29A 1QOPA 1NTHA 1LL6A 3WQCA 2ITKA 4NJHA 1RALA 3PBGA 2VWSA 3CL6A 2FGBA 2X09A 5FSEC 3H4WA 1PDZA 2XFRA 5JBDA 4XZWA 1BXCA 2GGEA 3HGRA 1KT1A 1UA7A 3SJ3A 2XPBA 4W8AA 4Q3MA 2I5GA 4LH8A 3RK8A 1NWUA 3HPFA 4KF1A 1QI3A 1IF2A 4O0KA 1DJIA 1XIFA 5TQLA 1Q7QA 2QVHA 1WNOA 4P7OA 5F1UA 3TOYA 5AYXA 2VFGA 3OB8A 3GNXA 1S38A 3MCMA 3WMCA 2GL5A 3T42A 1ESWA 4RJEA 2KO7A 3QMSA 2OEKA 1K77A 1DJGA 1GOKA 3PTKA 3W3OA 3AO0A 5BROA 3UU0A 1QU4A 4W8BA 3G6MA 2Y85A 1SJBA 3TXZA 3NDZA 1YW1A 3P8IA 2GSEA 2PUZA 1S1PA 2O92A 3AROA 4HBEA 3MI3A 1PV8A 2P76A 5TNVA 3TR2A 2JF6A 3W6MA 2QUNA 5J6EA 2OWCA 5BWFA 3MUZ1 4Z2GA 1NF0A 1E1FA 3PJUA 1HVQA 2HROA 1LRTA 3TDFA 1XYZA 4YWIA 3UF8A 4QT2A 1NEYA 3E49A 1JAKA 3NQVA 3WNKA 3OZMA 2A2IA 1HXJA 5C9WA 4FOJA 3P7YA 3W81A 1E1CA 3LZ3A 1T6MA 1MFVA 3MBFA 3VGBA 3AIRA 4DJFC 4Y9MA 4GISA 4IMFA 5A6JA 1KKRA 3WF2A 4XAZA 4U31A 3FAPA 3OBEA 3REQA 3NCOA 3W2LA 4LVAA 1IT0A 5GJNA 5C54A 3VD3A 3HOJA 1G67A 1RUSA 4UDMA 1XLDA 3W2NA 4A6GA 1KFWA 4LUYA 2EULA 5HBFA 3NVDA 4C91A 4L56A 4NVTA 5G1YA 3FHQA 1UH3A 3I7SA 2GVYA 1WE5A 4O28A 3D5HA 1EO7A 5BOEA 1G1YA 4GMEA 4HPXA 4YCPA 4PL1A 3R43A 4PUKA 1M7XA 4DBDA 3OZPA 4D6GA 4M6VA 2QJJA 4ZOAA 3B4UA 1XISA 2OOFA 4AZGA 3W28A 1PSCA 2OYMA 3B8TA 3CYVA 1RXOB 3M5ZA 4XX6A 4DZAA 2W67A 4O17A 1ICSA 1IXOA 3Q94A 4PTMA 1VBHA 4I9JA 5D03A 3WELA 1IEIA 4RW5A 3CB8A 4I6VA 4JPGA 4NAEA 1QHZA 3FV9A 4U10A 3P67A 4LCSA 1FKDA 3TN3A 4GCAA 3LLXA 3SURA 2ZZ6A 4I5RA 4J5NA 1K6WA 5CPLA 4LVBA 3UPBA 4AWUA 5MKGB 2PWUA 2Y8KA 3BURA 2PGFA 2ZA3A 1WZLA 2EJ1A 1JDEA 1QFEA 2FZ9A 4U86A 1CGYA 1L2QA 3VE9A 3M7SA 3BICA 4NSBA 1R7OA 1HF6A 5IDZA 4AD5A 2XVGA 3LI0A 3Q58A 2V0TA 2ZUUA 5A1AA 3RCNA 4OKDA 3A5VA 1OC6A 1TV3A 4MZ8A 2VD8A 2VC7A 2NQLA 4H9XA 4IL2A 1X7FA 5I7GA 2Z29A 1KM0A 2DORA 1OADA 4RPQA 1WZMA 1Z44A 3AFBA 4UCGA 4ROPA 3OGRA 1EYEA 3UWZA 3GNDA 4W9TA 2EO7A 2XP8A 1T8QA 4DAIA 2QV5A 2ZRVA 4PMNA 5J5RA 4XQ6A 2ATMA 4GACA 3SCVA 2X7VA 3NQ8A 2CZ5A 3ARZA 1IEWA 5M03A 1RH9A 1RQHA 4J3VA 2J62A 5KINA 4RDWA 3GXFA 3AMDA 1WDRA 6PTDA 1KFJA 2WHLA 1PDYA 1JEZA 4HPNA 3OIXA 3NPVA 1W1TA 4LAXA 1R47A 4XIMA 4R53A 3P3BA 4E4FA 4EE9A 1EJRC 4LUSB 4NZ1A 4UTWA 2GVEA 7A3HA 3KACA 3P5YA 4D8AA 1A5OC 4IOTA 3QJAA 1G4PA 3WBEA 1VC4A 4Z08A 2FKPA 5H91A 3DYOA 3EX6A 2Q8LA 1L6WA 4W8LA 2DT0A 3GBEA 1AW2A 5DY3A 1W17A 1TCOC 2BMBA 3V4BA 1YDOA 4A8RA 3S5ZA 3RJYA 1W1IE 2QXWA 1KKOA 1J4IA 5EBUA 2JKEA 3EWXA 5BXSA 4FN2A 3SCPA 1A5KC 1XGZA 1GZGA 2VFHA 2QJGA 3CM4A 3NPUA 5CCZA 2ZQSA 1B0IA 1J9YA 2PD9A 2PRMA 4JIPA 4I9MA 4MY9A 1S3HA 3T81A 4HBOA 2QPXA 3H2EA 5DLCA 4C6IA 3MHUA 1DORA 3STPA 4TX0A 4TVCA 2XISA 4QJ3B 4BI5A 3F5JA 1XL9A 4MG4A 1MEIA 1XX1A 2DGAA 3UPMA 1Q1CA 4MKSA 4EAYA 1JYVA 1NARA 4A35A 4L6DA 2HCVA 1DPMA 3CL7A 3DIPA 3PZQA 2MUCA 4LF1A 2CLFA 2D23A 3AMGA 3W1XA 1EOKA 4A3HA 4NNAA 4NILA 5MF5A 3EXTA 2VURA 3EYPA 4DVOA 3WQVA 1VS1A 1BRLA 1QVBA 1OG6A 3M4HA 2YW3A 1FDZA 5D2WA 4TXEA 2XFYA 3ABSA 1FHDA 4NZFA 3V16A 1GOXA 2NXHA 1B4EA 4L5ZA 3ZXWA 1FWTA 3RX3A 4OOUA 4X9YA 1UZ4A 4L80A 3ITLA 3Q37A 1UKPA 1I45A 1U1JA 1OIFA 2CLHA 2YCLB 4HU3A 4Z2JA 4NJGA 5D2YA 4AB4A 3WNNA 2WMHA 2QLYA 3LRKA 2CBVA 1GG1A 3N3MA 4DM2A 4V1YA 1QRQA 2ZTJA 3AXXA 4OBRA 1CB2A 2X8RA 2QPUA 4L6HA 4DJFD 3QYSA 3W6YA 1ZY9A 3IV8A 4JN7A 1EHAA 5AC7A 3W72A 3AI0A 1JUBA 2AL2B 4XZIA 4O8AA 1XBZA 2C19A 3OO2A 3PFMA 1FJDA 3CQIA 1KGWA 1W1B1 3GM8A 1PVNA 1F6YA 1UG6A 2QR6A 2A1YA 2VR4A 1M6JA 4DO4A 2ZICA 1EO5A 1Q8AA 1PO9A 4QBXA 3HB9A 4QM1A 1POKA 3N34A 1EC9A 3CHCA 3VKAA 4NUWA 5K3VA 3R10A 2PV1A 2JALA 3B9AA 1W9VA 4CNOA 3SN1A 1J0YA 3QMRA 4AG0A 4I3GA 3GAYA 3E12A 3EAUA 4CD5A 3A24A 2P5NA 1R3TA 4NYUA 1HKVA 4XZLX 4GUGA 2UY5A 2R14A 1TX2A 1OX5A 3OODA 3TTQA 4L4PA 1YTKA 2BNJA 2WBKA 5RUBA 4JFTA 3DFSA 1MW1A 4WSJA 4G1KA 3LPFA 1O12A 3LXCA 1R5YA 2JZVA 3CPRA 3VNKA 4GX8A 4BR1A 4AZ5A 1PX3A 2UWFA 3M0ZA 2V5CA 2WCSA 2A21A 3IIVA 2XP9A 4E2OA 2W27A 2JEPA 1LP6A 2W9MA 4W7UA 1Q6RA 2VFDA 3P8JA 1QTWA 3GD6A 3L23A 3RLVA 4R9XA 1M7OA 4Q32A 5F4SA 2IS7A 2FHBA 2WNZA 4QP0A 1T96A 1CDGA 3GH4A 3N3TA 4UIOA 1VJIA 4ODNA 4WEVX 2DUXA 2ONEA 3W23A 4M8UA 2G95A 1FUYA 2YL5A 3EKGA 1EC8A 2YA1A 2E5CA 1JFXA 3HV8A 1Q66A 4M80A 1UP2A 5AC8A 3PJWA 5IBXA 2PBGA 4MVAA 4RXFA 1G4SA 4Q4RA 2WO5A 4LV9A 4H7ZA 4HJFA 3H22A 4L61A 1KM5A 3AXHA 2BFGA 4BQ4A 4B9ZA 2YBUA 1QCWA 1G69A 3P0XA 4WHBA 1CECA 2H3DA 2QVNA 3FKKA 1S2VA 3PPGA 2D3NA 4NP7A 3N2CA 1FP8A 4Q8UA 3FVMA 4IICA 4C60A 2DIJA 4JFUA 4H9YA 1FKKA 3B8VA 2LPVA 4QXIA 4KKXA 1X1ZA 4LAKA 2X30A 3L4TA 3RNDA 3LUTA 3BZGA 2LLEA 1TTPA 3EEZA 1UZHA 4KFNA 4Q4PA 2HBVA 1EOMA 1AW1A 4BHYA 4F2UA 1KCKA 2VENA 5BMXA 3TTEA 1TMHA 3B0VC 2KI3A 4BCEA 1XDMA 2OX4A 3KWSA 2E9BA 4LXFA 3MHFA 2A6NA 5ABFB 3DYMA 2ZQ0A 3T4CA 4ZE5A 1GW1A 4H9VA 1RJQA 2G5WA 3GH5A 4PRTA 4HA3A 2CWXA 4C6NA 5K9DA 3H2OA 3DI0A 4TW8A 4J1OA 2XH0A 3XISA 5AB3A 3MCOA 3TNOA 5E5CA 1ZLPA 2ZVRA 3G3MA 3BLIA 1RBAA 4XSMA 2J8FA 3ANVA 5J04A 2DIEA 1Q3NA 4J3WA 1C8QA 2GWGA 4IX0A 2NUWA 1P0KA 3EB4A 1RQEA 3VUPA 4G5DA 5LNVA 4AF0A 4C65A 3MMDA 4AY1A 3WENA 1E6XM 3C4UA 5H2ZA 5LSMA 4Q4SA 4RX0A 1JPMA 3TYAA 3N4AA 2NT0A 2WZMA 3DU0A 3W27A 3GS6A 1TWIA 4JQ3A 3AIUA 1FWFC 3CQJA 1IWPA 4QNWA 4W87A 1J96A 3RM8A 2CZFA 4GA8A 5J5DA 2WQPA 3AC0A 3E0FA 4TV5A 3NQFA 1UKOA 3CASA 4FPSA 3P60A 1Q8JA 3GG7A 1G7UA 1XGDA 4G2PA 5FL0A 4CGTA 3M16A 1B90A 3DEQA 2WZTA 4YTUA 3GY1A 3OHIA 5AECA 4P7QA 3N2TA 5ECUA 2P0OA 4XTDA 1XKJA 3TSBA 3A3WA 5DF0A 3H24A 3NJ3A 2J6VA 3F2BA 3CJPA 1NWSA 3MV01 1LZOA 4OUEA 1D3HA 3LD5A 1F9CA 1K9DA 4F0MA 2A0NA 4UXDA 5JH2A 4NY2A 4PRRA 4PMJA 3T8LA 2HPIA 1C93A 1JQVA 2GPTA 1JCNA 1BLIA 1VJSA 5ENLA 3TN4A 4PB4A 5I3FA 3ZR6A 4K38A 2V5DA 5G2WA 4KEMA 2OOGA 2P50A 3OJGA 3OP2A 4B5WA 4CD6A 2RGMA 3W73A 2E7FA 5F7UA 3AUOA 1SO6A 4AD1A 1DQWA 2QIIA 1KT0A 2CERA 3B9OA 3PG9A 1UR1A 1GZJA 1JZ6A 3WK0A 1PXGA 2GUUA 2Y89A 4Q7NA 4X63A 1UHVA 4Y9AA 1FKBA 4RUBA 4JL2A 4DJFA 3ITGA 3TONA 4YU1A 5CC7A 1WCGA 3WF1A 3W24A 3GVWA 3ARTA 4IWWA 4XAYA 3LX9A 3O63A 4DO7A 2IKJA 7REQA 3QW4B 4EKJA 2INEA 2Z1WA 4LPCA 1J0HA 2PTWA 2QW5A 2PLKA 1U1HA 4D8ZA 3O3RA 3BAWA 4EACA 2BVWA 2CLKA 3N1AA 1Z6KA 1K70A 1O5QA 1UR4A 1IWBA 3H12A 5J8LA 3KBNA 4GKLA 5I2UA 3TXVA 2VCDA 3LSCA 2QUUA 1OX4B 5EMUA 4LOCA 1L6SA 3UWWA 4O16A 2VX4A 3CUHA 2D0FA 1HP5A 3MDYB 1SZGA 3BMBA 3MI6A 3NZPA 1H1NA 3AIWA 3KTCA 3NQEA 1RCOB 5I3KA 1UZDA 2D24A 2PDHA 3LU2A 1K03A 1XIMA 3FX4A 3N9SA 4IFOA 1JNDA 2KZHA 5IFPA 4PEEA 3JUGA 4UWMA 5AHLA 4R88A 2W79A 3UBPC 4KS0A 3QTPA 3IWPA 1IZJA 3VZXA 3TN5A 3TUUA 2MLZA 3T2OA 1KQZA 2V69A 2WXDM 4RPPA 2VJXA 5FF3A 5JVLA 1JXKA 3UG4A 4H04A 2NWRA 4GYFA 3PZ9A 2RDTA 4AZCB 1HP4A 1ZCOA 4AIOA 4FOUA 2OMAA 3QY6A 3LTYA 1E70M 2HZGA 3DFQA 3M0VA 1OFDA 1C8VA 3NQ7A 1UB3A 2G3IA 1QR7A 3UW6A 3IJ8A 1UR3M 1KTCA 5GJPA 4AD2A 3BZJA 3W7HA 3HTWA 2YCJA 4ZMGA 3I3DA 5CBBA 3GFZA 1UWUA 2Q5AA 5XINA 4XK2A 1BKFA 5AHFA 1J18A 5A2CA 2E40A 2PP0A 4ENLA 5IM51 4DYJA 2HDJA 3MQTA 1DTNA 2QNEA 1JPDX 4GKTA 1NMWA 1A3XA 4IISA 1TWSA 3U6WA 1MXDA 3AIBA 3R8GA 4IMCA 2BVDA 1UIOA 4U3AA 3R7MA 4YN5A 3WBAA 4WUIA 3SFKA 2XFFA 1NU5A 4WKAA 3HQPA 3T6CA 3ZWTA 2HS8A 3COTA 2R1MA 4LCQA 4YVXA 3LHZA 3BE7A 1H7XA 1H0IA 2FMNA 4HB7A 3UI6A 4S23A 4O1EA 5EMJA 4FR1A 1AH4A 1XSJA 1MNSA 5I02A 2XVLA 4XZMX 2ZR4A 2ISFA 2ZKMX 3UVAA 3UXDA 2OJPA 1XINA 3FEQA 2OWWA 2X2YA 2DVXA 2ZUWA 1DBTA 1TUXA 5HINA 5CC5A 3IGXA 1MQRA 2HSAA 2Y2WA 4LF2A 3EMZA 4GJJA 4QE4A 4TX9A 1KRAC 3NL3A 1EJ7L 4P5UA 4AD4A 3ZR5A 2RURA 3N2OA 4HQVA 5JIPA 4JQ1A 1W2VA 3PTDA 2IKGA 2WB5A 4JQAA 2FKEA 3A64A 1LQAA 4KR0B 3A9IA 3H7UA 3ZQ9A 3HPAA 4W86A 3IANA 3S83A 1UH4A 1EGMA 5EMYA 4IP7A 3QC3A 3WLKX 1B6CA 2ZE3A 3URBA 4I90A 4H6KA 3MA8A 1TZ9A 6TIMA 3KTXA 3E3HA 3ISIX 3TX9A 4DM1A 2ZA2A 4QEHA 3CGNA 4X2PA 1ME8A 2OR2A 2XN2A 5D9MA 3T4WA 3DHPA 3QQ0A 1B3ZA 5F2IA 4W9PA 4QX4A 3KCOA 2VX6A 4TIMA 4KCWA 2P8CA 3O5EA 4LFYA 1GPWA 3QR3A 4I5UA 5CZ0A 4O4VA 3PTMA 4AIBA 5A6TC 3VTRA 4PMOA 5I00A 2UV8G 1XLBA 1N8FA 3LM7A 3EDFA 3WQOA 1BKHA 1KV8A 3SCRA 1EQPA 3WNOA 4UQDA 3RM9A 1L6FA 1AG1O 3BO9A 2QPSA 1MRAA 1D2KA 2WW5A 2O4MA 2ZUVA 1X8FA 3TWAA 3QPEA 1G94A 3TYDA 3JZEA 3VNYA 1NDWA 1WDQA 4DN1A 4F0LA 4DRJA 1UD6A 1IXQA 3OA5A 2QYGA 5JQ9A 3M0JA 2F7FA 2ALRA 4JTEA 1EA9C 3A4WA 2REQA 2X0SA 2DPEA 1LROA 1MW2A 2QIWA 2NWSA 3LERA 5BXTA 3WBWA 1Y8BA 3WQEA 4ADSA 4K6AA 4GVIA 2VWTA 4XAGA 3B0PA 4QQUA 1RLDA 3THUA 2DZUA 3QXBA 3BWWA 2Q3RA 3EA3A 3EPNA 1Q6CA 4V2XA 3O5KA 3ZMRA 4XZBA 1MDLA 2R1PA 1FWCC 2DDXA 2CNCA 5U4NA 2NSXA 3SCSA 3P0WA 4DJDC 4PN2A 2F2KA 1O66A 1CZ1A 1IIGA 2QKFA 4OFCA 1GRJA 4NIRA 2QDDA 2DT1A 3CMGA 5HNNA 4PUWA 1GVYA 4WSKA 3EX2A 3UNDA 1ZJBA 2WJFA 4IFRA 2ZUMA 1ROUA 3VCCA 2PV3A 2X40A 4MWAE 1UW9A 4W84A 3AHYA 5FCZA 1SSDA 1QPQA 1G6CA 4IG2B 4EF9A 3VK5A 1XYMA 3WMSA 1JYWA 1UJQA 2ZA1A 4GGQA 3LDVA 4YHEA 3GZ3A 4W5UA 1E9ZB 3ECQA 3VIFA 2PV2A 1MEHA 3H26A 3W1LA 4WCJA 1NSGA 3W7LA 3S4TA 1WX0A 4WKHA 3VMOA 1WO2A 2I5IA 4K37A 3K8MA 5A2BA 3BUVA 5G4EA 1W56A 1QPNA 3VC6A 3N29A 3OYXA 2FDMA 2IKHA 3WLIA 3C2RA 3CAWA 2X1RA 3R4IA 1C8XA 3L4ZA 1TG7A 4JYSA 1TQJA 1P7TB 2XIJA 2G8ZA 3HPSA 2ZR6A 4H7CA 4KFOA 3SRKA 2CBIA 3JYJA 6REQA 3RG6A 1JGMA 4KGLA 1IEVA 3LHTA 2XDFA 4BKNA 3O06A 3QHOA 3KEHA 3ITXA 2B81A 2WKGA 3WF0A 2V9DA 1V0NA 5CJ5A 2YB1A 2EPNA 1QUMA 3N12A 4PMZA 3KCLA 1EF3A 5CZKA 3NG3A 4I9AA 3VIKA 1UQZA 5CSRA 4KQNA 3E9AA 4Q8OA 4KRZA 3B0XA 1KB3A 4WRHA 2DT2A 1OK6A 2DVTA 4JY9A 3FK4A 2XM1A 4MGVA 3RGTA 3VKKA 2VCCA 2D69A 1WXJA 1M3UA 3ABXA 1PIGA 4PC8A 2B0MA 3EOOA 1EDGA 3DDMA 3PZUA 3W01A 4M56A 2BY0A 3C2VA 1R7AA 3ABQA 4C6QA 3DX5A 1EJVC 2J78A 3KLKA 4JQ4A 1R9ZA 1E6RA 1NWRA 3NM3A 4V27A 2IXUA 4H6RA 4GQ0A 5AYIA 1JCHB 1IWAA 2TYSA 5H8UA 3SUSA 3UXIA 1PX4A 1OBAA 4RZ4A 4DRSA 2Z7KA 4IHCA 3PZMA 4U2YA 3NRKA 2J88A 1X1OA 1V5XA 1OCNA 1ONEA 4L7ZA 1BVNP 1R3SA 4KFPA 4ODQA 3BSGA 1PYMA 3SRDA 1KFKA 3ITOA 4GINA 1EDTA 1XKYA 2Z26A 3CV7A 4JAWA 1TA3B 5TBOA 2FTPA 5I3JA 5K2ZA 2FVLA 3EEGA 4W4QA 1Z41A 2Y4SA 3FSTA 1EUAA 4KWVA 1D6OA 1K8YA 1C9DA 1NDYA 3ZO9A 3AXKA 3S2NA 4BZYA 4HVXA 1A53A 2VTFA 3KVMA 1KFEA 1PCWA 4HHPA 4UQEA 5HR6A 2E68A 3BLEA 3HO8A 1JPKA 3M1ZA 5AC6A 3XINA 3C86A 5B7YA 4C6BA 3FNDA 1TE1A 2PDNA 3NPXA 4K68A 3G1HA 3KOFA 2PPGA 4GRSA 5HWMA 2X1TA 1EHNA 4RE3A 5I0DA 4OIFA 3KS6A 4PCSA 4BEUA 2QGYA 1OGSA 4DPQA 4WSHA 1QO2A 1TPVA 4BEQA 4AWTA 2EPOA 3KVJA 4TV6A 1YXCA 4QG8A 4JIQA 1VEOA 4M5PA 4JX5A 3S6OA 4JHZA 4LEFA 3BH4A 4PMYA 1E4MM 1ZZMA 3UXKA 4J40A 4UTTA 3ZT6A 4UC5A 3G8EA 3E0LA 1XRTA 3CWNA 2ETNA 3BV7A 3BAJA 1XQKA 1YX1A 4MLJA 2OZ3A 3VU2A 1R2SA 4G50A 3TV8A 4DWSC 4A3YA 2YL8A 4RZBA 2OODA 3G1SA 4N9EA 1MZRA 4WY0B 3MSYA 1UROA 4F9JA 1H3GA 4UR7A 1ZCCA 3MMTA 3EB2A 1FHVA 3EWYA 1PIIA 1BXNA 1YDNA 2BY1A 3CV1A 4B5VA 3N9KA 4DJDD 4UFIA 1UBPC 3UWUA 4H9ZA 3MMWA 3N9RA 3F2DA 1AODA 4NRSA 1IZKA 4JHMA 2VELA 3AYVA 4ES4A 1H11A 3BLOA 4GQQA 1B54A 3C52A 4LYPA 3KP1A 4N4PA 3BAYA 3GU9A 1JUEA 2RDXA 4H6QA 4HYRA 4CQ8A 1JCJA 2KE0A 3M43A 1I60A 2FFIA 3TLQA 5D37A 2WHJA 3M64A 1L1PA 1LWIA 4Y90A 3P80A 4DZ5A 5T26A 4HU8A 3EIPA 2ZZ1A 1SU5A 1GOIA 1U79A 4EXAA 3WDRA 4IFKA 2VO5A 3WO8A 4FZIA 4CEXC 2YJQA 4RDVA 1K02A 5G4HC 1PKYA 1BSIA 1W9BM 5CPOA 3HMCA 1TPUA 2TSYA 4DRPA 4O15A 2FB3A 5CPTA 5HR7A 2VNCA 3T0BA 4A8NA 4LRTA 4MSPA 5CLTA 3MSRA 3LY0A 1YBQB 3LUOA 3DESA 2CHOA 2XH7A 5HMFA 1W1A1 4ZODA 3SUUA 1A0DA 4W93A 1LRNA 1GW9A 4OBSA 1B3YA 1TJ0A 5AOUA 4FXJA 1FH9A 1JZ2A 3FVDA 2D0GA 5K4XA 4F9DA 1A0CA 1ISYA 3T8QA 1JAEA 3W82A 3ABOA 3W0KA 3R94A 3WJWA 1Z89A 3EX4A 1P6CA 4L9ZA 2PD5A 1KXVA 4DF0A 3DG7A 1IXNA 4JEJA 2XH4A 3OOBA 1JDAA 4HGXA 4PUEA 3BLPX 1GKRA 2VGGA 4Y8FA 1M65A 3BQ6A 4ZXLA 3H2NA 4LUTA 1G4EA 4C1NA 1O95A 4GZIA 3F4VA 2OQLA 5CGQA 4E8DA 1GQIA 2SFPA 3KL0A 3CO4A 3DFHA 1IXPA 3MANA 4NXSA 2NVCA 3K8KA 1MFUA 3IJDA 4RE4A 2HPMA 1SM9A 3QOMA 2P10A 4I7VA 4B5NA 4OZOA 2E0PA 4BQ5A 1UWRA 3WYZA 2E5BA 2HMCA 4E4UA 1LQ0A 3UI5A 1ODZA 3LQGA 2QJIA 3MDWA 5HNTA 4HHLA 3VKJA 1VLWA 4AD3A 3CWHA 3ICJA 4M3PA 4H8VA 4IGHA 3TCEA 3P93A 1KFBA 3RRAA 1HGYA 3VIOA 4Y9OA 4YYFA 3PK7A 3TAOA 4DBWA 5K9XA 3HQ1A 3NO5A 4FB7A 1JFHA 4R85A 4AVNA 1CCWB 5T9BG 1A5BA 4ODRA 1MEWA 2OKOA 6XIAA 1MUCA 3W02A 3DECA 3W71A 5BYWA 1H63A 1WUEA 4GZ7A 3VD7A 3ITYA 2FDSA 2YXOA 1CLKA 2WSQA 4UMBA 3WLRA 1MMFA 3SCUA 1OT1A 1U83A 3UZZA 3H2MA 4Q8QA 1QPFA 4Y7EA 1HIZA 1XYAA 3ME3A 2PLCA 1PYFA 3TP4A 4I7WA 3H7VA 4HYVA 4HU4A 4O10A 2QCDB 2AMXA 4YS1A 1Q6HA 2Z2UA 3W4RA 1BYCA 1AL8A 1GOMA 2GGHA 4PMVA 3S2MA 1UD5A 5CG7A 3WF3A 4R7JA 1OK4A 1M04A 3O07A 3RX2A 5CPMA 1E6PA 3RJXA 4HPHA 5AHNA 1R3QA 2CU0A 1VFFA 1XDJA 3WEZA 4F0KA 4F2BA 3APYA 2P3ZA 2F6KA 4LAUA 4LYQA 2WHMA 4FNTA 5FF7A 2C0HA 4DWSD 2A79A 1EPXA 2I16A 2WHKA 4O18A 1D9EA 1W9PA 4KH2A 1PZ3A 4MKVA 2L5HA 4XB3A 1FOBA 4ZSTA 4R7WA 1FDJA 1UWIA 1OZMA 3CTLA 1KXTA 3IK2A 2XIBA 2OELA 3PB2A 3OG3A 1LUCB 4D72A 1J93A 4S38A 4TTGA 1XLGA 1UR8A 1GJWA 4L6OA 1D3CA 4R3UA 4RR4A 3EX3A 3GU2A 3WZ0E 1M9HA 2J7BA 3SR7A 3R2GA 3S5SA 4LC6A 5AC4A 1GNXA 1HG3A 3KDOA 2ZX9A 4OOZA 5D9OA 3GUGA 2PODA 3BDKA 4H2HA 3PBYA 4HZ7A 5HPOA 4C7GA 4B3LA 1UD8A 3UP8A 3MWCA 2Z25A 1T5AA 1ZQ5A 2GVLA 3P81A 4PBFA 2PCQA 1X98A 1YPFA 3KZSA 1XUZA 1AQHA 4CCCA 4WJXA 4DJDA 1BWKA 3GR7A 2J74A 2XN0A 3AHTA 3RAOA 3MKKA 2QCGA 3CXOA 2ZE0A 3LSBA 2IPFA 2CW6A 3BCDA 4R9OA 2C7FA 1O5KA 4JKKA 1JIBA 3HV9A 3P2VA 3PM6A 1BPLB 2EG6A 1OCBA 1DHKA 1LTDA 4DXVA 4GPNA 4BQ2A 4ZOCA 1WKDA 4PUNA 2PLMA 3GHRA 3MTWA 4JKLA 5A6LA 1TV4A 1UMLA 4JFWA 2Y61A 3THDA 1TV7A 1P0BA 2CHRA 4MY8A 1HL8A 3ZLGA 1B5TA 4E3VA 1R9XA 4IPXA 1RQBA 1C8YA 2QDHA 1Z8AA 3LN3A 4G9PA 4NJIA 4CD7A 1LJYA 1TTQA 2VX5A 3TCSA 1ALDA 4FNUA 1SW0A 3SFWA 1MI3A 4IQLA 3UPWA 3PZTA 1WZAA 2GJLA 3VDCA 3DFTA 3MPGA 3S1XA 5KETA 5CH9A 1LT7A 3RFWA 3CMFA 4XD6A 3QOKA 3HPXA 1B9ZA 3ZR4A 2UZ5A 2QHAA 5EFDA 5D2VA 4M81A 1KM6A 1VFMA 2WC4A 1VEPA 1XC4A 4O0QA 5A8GA 3RITA 3XIMA 3PZVA 1L8NA 1UBSA 4ZBCA 4W7VA 4O2TA 1EWEA 1FRBA 3I4EA 3GE7A 1E5JA 1BF2A 3U9IA 3KVLA 1SJDA 3EMQA 5G1MA 2ZIDA 3MY9A 4RE2A 5HDRA 4Y2WA 2XYLA 1G9HA 1ZHAA 2POZA 3P62A 4FIRA 1VPQA 1NFGA 3EXSA 4O52A 5L9FA 1JJKA 5KZMA 4M82A 1LLZA 1P0DA 4IGMA 3UY8A 3AHXA 3VIGA 1WBHA 3C6CA 3WNLA 4S3JA 3JVAA 3OTRA 4GH1A 5H6HA 1AQ0A 3VZZA 1DJYA 3PN8A 5A6AA 3STFA 3CIWA 3MO7A 1WXYA 4XVDA 4J4NA 1HT6A 1XC6A 4OV9A 1J12A 2XIMA 4KBXA 2J77A 3IJ7A 4X3ZA 3LOTA 1W1VA 3M0HA 1VHCA 3BW4A 1NH6A 5EMLA 2J9XA 1YPIA 3GB6A 3BJFA 1DXIA 3BAIA 5HMSA 3GO2A 3LCHA 4MOZA 1NMVA 2BASA 3KRSA 3HFTA 3NVTA 3ZT7A 3AS2A 3ZVHB 4AYSA 1F3WA 2BB0A 1TPWA 4GD0A 4C6PA 3UWEA 2PU1A 3PZIA 3WD3A 5CSSA 4WXYA 2FLIA 4ZS6A 1CXFA 1YIXA 3T44A 5IFTA 3NQAA 1OSEA 1T99A 1FCVA 1GVIA 3UZXA 3BLLA 4ITZA 3QGAC 3AIQA 2YBVA 4J28A 1B3VA 3CUFA 2V67A 4NHVA 1WAWA 3W88A 1O6IA 2PDGA 4NZ3A 1XBVA 1GEHA 1WXZA 2PGWA 4S3EA 1H51A 1VFLA 1YTDA 2QF7A 1SVDA 3GSMA 1W8GA 1Q6FA 2C6QA 4UOQA 4ACZA 1S5TA 1JCXA 5AFDA 4OHQA 4UZUA 1Q45A 2C15A 3WH5A 1CXLA 4QE1A 3MP3A 1AQMA 2E6YA 1CT5A 2N87A 3DG6A 3EWDA 1UQYA 1XIDA 1B3XA 3KOWA 1H4PA 1K3UA 5C55A 4IUOA 1VENA 3GLCA 2UY3A 1D7HA 3UVIA 3C2YA 3VNZA 1PZ0A 2W92A 2O9PA 4KERA 3SCNA 4NNBA 5FACA 1J6PA 2GJXA 1W32A 2QUTA 4DB7A 1VPXA 4U4MA 5HPCA 2F6XA 1DYSA 4HIBA 3QGKC 4C6JA 4QHRA 1R9YA 4DLMA 3GQYA 2O9OA 1VYPX 3TE9A 3EWBX 4ZO7A 2EPLX 3AJXA 5CXPA 4JFLA 6XIMA 2JKAA 2QCEA 3DKLA 3GIYA 5HUOA 1J4EA 2JF7A 1V8EA 3SN4A 4F2TA 1OFAA 3D3FA 4YPJA 1W37A 1O5XA 4D8LA 3U48A 4DWSA 1XLFA 5GNZA 2OCZA 4G56A 1RCXB 4XAPA 4P8VA 1CLXA 4ZGYA 2XWDA 5D09A 4MPQA 4UTLA 3PB0A 2HVNA 1P0EA 4HKPA 4JNZA 1WPCA 2OFJA 4AU0A 5HNRA 2DZWA 3ZIZA 4D6JA 2DW7A 3EA2A 2R1NA 3OBAA 1EBGA 4NKCA 5DEZA 3W1PA 1D8WA 4JCMA 5B80A 5DN1A 4Q4KA 1JF5A 1F74A 3GNPA 1EEPA 3UWYA 2W66A 3LRLA 4UR9A 2Z1BA 4GJIA 4REQA 5T9CE 3WDHA 4C6MA 1TUFA 2A3BA 1I4NA 5TIMA 4K8GA 3NURA 4NI3A 5GVJA 1KBBA 1RA5A 2OG9A 4C90A 4PTVA 1RP9A 4B91A 3QZ6A 3CEPA 3UNTA 3W7GA 4OBTA 3BW3A 3ES8A 3V1HA 1XJBA 1TPEA 3AMKA 4QT3A 4E2BA 2P3EA 5CC6A 5D30A 1D7KA 2AAMA 4FI4A 1EXPA 3H21A 3V0TA 1WOBA 4ML4A 1DQUA 5JXQA 3ZOAA 1V77A 1PZ2A 5IOBA 3TZFA 3GX9A 3O5PA 1M53A 4YVVA 4D6IA 5REQB 4JTIA 3A5FA 3MMUA 1GOQA 1SGJA 2QAPA 2V8ZA 2YL9A 3BGJA 3F4DA 5HANA 2JQXA 1H41A 5A3HA 4O8RA 1SJAA 1U2YA 3OU8A 4EIVA 4IX2A 1V0KA 1HGWA 2R8WA 1XIGA 1HKJA 1PAMA 2ANUA 3VINA 5BRPA 1XCWA 4ALDA 4MADA 3GDBA 4JX6A 3CUJA 4WK9A 2IMRA 4AEEA 3BANA 1LRQA 1E9LA 3R25A 3WG6A 5DBUA 4UTMA 3GDKA 3N11A 3C61A 3H9RB 3TYZA 1OCJA 1TPB1 1JCLA 2EJAA 2VC6A 2ZC1A 4IPIA 2JGYA 4LGXA 1WBJA 3O5LA 1VP5A 1EIBA 2NUXA 2HISA 4MWAB 1ZS2A 3WLJA 2ACQA 5D38A 1MRQA 1MUWA 3VGGA 2Z0IA 4GG9A 1OD0A 3T9PA 3RYSA 3GXPA 2Q6ZA 2PE4A 1OEPA 2VR2A 6TAAA 3OA3A 2VD9A 3FJNA 4I5XA 3GR8A 5HQLA 3NXFA 2VYOA 3BV4A 4AWSA 4XAFA 4GIYA 4PCNA 2BTMA 4B5XA 4HN8A 1REQA 1UP3A 2FAPA 5CZTA 1WKFA 1XDLA 3TDBA 3HZ3A 1F4HA 2B31A 4NX5A 2RDWA 2WMIA 3W2KA 4DXKA 1N1AA 3T0AA 4KWUA 4O1DA