3O5MA

Fk1 domain mutant a19t of fkbp51, crystal form ii
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
127
structure length
127
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
molecule tags Isomerase
source organism Homo sapiens
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
total genus 35
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5mA00
1FKSA 2PV3A 4DRHA 3IKGA 4C02B 3GPKA 2XPAA 2RQSA 1M5YA 2UZ5A 4ODRA 1FKDA 4TW8A 3VAWA 4DRNA 2ZQUA 1J4IA 1Q6IA 4DZ3A 4ITZA 1NMVA 1HXVA 1JNSA 1Q1CA 2L2SA 2RUQA 4LAWA 1J4HA 3O5FA 3O5JA 3O5GA 3UQBA 4QT2A 5B8IC 1QPLA 2DG9A 3FAPA 2ZR6A 3UI6A 1FKTA 1FKJA 3NI6A 1FKLA 2ZQVA 3NRKA 4IQ2A 3EY6A 2JZVA 1D7IA 2AWGA 4JFJA 2MPHA 2RUCA 1ZK6A 3JYMA 4O2TA 3B7XA 4JFMA 4U85A 3PRBA 4FN2A 2F2DA 1C9HA 2XP4A 1KT0A 2PBCA 2XPBA 3CGNA 1JVWA 2VN1A 4LAVA 3TC5A 2M08A 2LPVA 2DG3A 3CGMA 3O5IA 3PA7A 4LAXA 4LAYA 3UQIA 2LKNA 1D7JA 1EYMA 3O5RA 4U84A 5HW7A 2KO7A 4GIVA 5HW8A 1FJDA 2PPOA 1A7XA 1F8AB 4U86A 4DRIA 5GPGA 3KACA 2F21A 3IKDA 3IK8A 4DRMA 1U79A 3UF8A 1KT1A 1BL4A 1PINA 2PPPA 3O5EA 1PBKA 4J4NA 2KGJA 5HWCA 3O5LA 1QPFA 4N19A 1TCOC 4DIPA 3ODKA 3WH0A 5HT1A 4QIBA 5I98A 3I6CA 3KABA 3NTPA 3OOBA 1J4RA 4DRPA 4TNSA 4FAPA 1YATA 1W26A 2ITKA 1Q6HA 2MLXA 2XP3A 1Y0OA 3PRDA 4IQCA 4W9OA 4IPXA 1FKRA 1ROTA 4TW6A 4J4OA 5HWBA 2DG4A 4ODMA 2OFNA 4G50A 2RURA 3TDBA 1NMWA 1YW5A 2PV1A 4MGVA 3KZ7A 3TCZA 1BKFA 4R0XA 3LUOA 4G2PA 1QZ2A 4NNRA 3UQAA 4ODKA 1FKFA 3KCEA 5HKGA 3RGCA 2Y78A 4ODPA 4GGQA 4ODNA 1FKIA 4DRJA 1L1PA 3H9RB 4W9QA 5DIVA 1P5QA 2RUDA 2N87A 4W9PA 4BF8A 4TW7A 5HTGA 2Q5AA 2KR7A 2XP8A 2LJ4A 2ZQTA 3O5KA 3O5QA 3O5DA 4ODOA 4DRKA 1J6YA 1FKKA 3O5OA 3KAFA 3RFWA 4QT3A 2M1IA 3KAGA 1JNTA 2XP7A 4ODQA 5J6EA 2MLYA 2K8IA 2ZQSA 5DITA 2MLZA 3UI4A 3IHZA 4TYOA 1D7HA 3UI5A 5HW6A 2XP5A 1B6CA 1FKHA 4JFKA 2XP6A 1D6OA 4MSPA 4DT4A 1R9HA 2KE0A 3MDYB 3JXVA 5D75A 2LGOA 1T11A 2KI3A 2MNTA 2RSEA 1NSGA 1N1AA 3O5PA 2M2AA 1Q6UA 2ZR4A 3O5MA 4DZ2A 4DRQA 4DH0A 2IF4A 1FKBA 4JYSA 2VCDA 1EQ3A 1FKGA 3KADA 3JYJA 5DIUA 4JFLA 1FAPA 1ROUA 2PPNA 5BXJA 2D9FA 1ZCNA 2PV2A 4TX0A 1FD9A 2KFWA 4ODLA 2XP9A 2MF9A 4DROA 5HUAA 2F4EA 2FKEA 1F40A 2FAPA 4JFIA 3KAIA 2ZR5A 3KAHA
chains in the Genus database with same CATH superfamily
1FKSA 4DRHA 4C02B 1HJWA 4TW8A 1JNDA 3VAWA 4DRNA 1GPFA 2DT2A 1ZBVA 2L2SA 1J4HA 1ZB5A 3O5GA 1VF8A 4ZPVR 2ESCA 4Z2JA 4QT2A 2DT1A 3FY1A 1FKTA 3NI6A 4DWSC 2ZQVA 2DSZA 2RUCA 4P8VA 1E6RA 4JFMA 2F2DA 2XP4A 2XPBA 3TC5A 2VN1A 4P8XA 3O5IA 3PA7A 3CGMA 2LKNA 1D7JA 1ZBWA 3WD0A 5HW7A 1FJDA 4MNKA 4U86A 2O9OA 4DWSD 1PINA 2PPPA 2QF8A 3BXWA 1WAWA 1CTNA 3G6MA 3O5LA 3ARWA 3ODKA 3WH0A 1HKIA 5I98A 2G8ZA 4TNSA 3AROA 4W9OA 2A3CA 1ROTA 4ODMA 1YW5A 4Z2HA 3KZ7A 2AOSA 3TCZA 3CH9A 1BKFA 4R0XA 1H0IA 3ARYA 5JH8A 2DSUA 4ZS6A 3KCEA 1LG1A 3H9RB 5DIVA 3GU0A 4W9PA 2PN0A 4P8UA 5HTGA 2ZQTA 3O5QA 1J6YA 3O5OA 4WKHA 1LL6A 2M1IA 1EIBA 1JNTA 1GOIA 2WK2A 1X6NA 1LG2A 3UI5A 3ALFA 1TFVA 1B6CA 1E9LA 4MSPA 3WD1A 1R9HA 3AS0A 3O5PA 2M2AA 4MTVA 3CHEA 5HBFA 1FKBA 3PRAA 1ROUA 2PPNA 2PI6A 4TX0A 2KFWA 2B31A 4Z2IA 2FKEA 1W9VA 2ZR5A 1FKDA 2A3BA 1HKJA 1Q6IA 4DZ3A 1GRJA 4ITZA 4WJXA 2WLZA 1XRVA 2RUQA 5B8IC 1QPLA 2DG9A 3FAPA 2ZR6A 1W9UA 1IX5A 4Z2KA 3FXYA 1XHGA 4WIWA 2JZVA 4ZPWR 1OGBA 3B7XA 3PRBA 4FN2A 2A3AA 4HBOA 1EDQA 2PBCA 3CGNA 1JVWA 3WQWA 2P4VA 1NWRA 4GIVA 4Z2LA 1LL4A 3RM9A 5GPGA 3CHCA 4Q7NA 1U79A 3ARSA 1LJYA 1EHNA 1BL4A 1KT1A 5HWCA 1TCOC 4DIPA 3I6CA 3NTPA 1J4RA 1JNEA 2ITKA 2MLXA 4HBEA 1Y0OA 4IPXA 4TW6A 3PR9A 4S3KA 2OFNA 3TDBA 2FDMA 3LUOA 4G2PA 1QZ2A 4HARA 1E15A 4NNRA 4ODKA 3WD2A 2Y78A 1ITXA 1FFRA 1W1PA 1H0GA 1P5QA 3O5DA 2XP8A 3O5KA 4DRKA 4QT3A 2XP7A 5J6EA 1NWUA 1K9TA 1O6IA 2K8IA 3UI4A 3IHZA 2DT0A 2XP5A 3ARPA 5DF0A 4NSBA 3MDYB 4R5EA 5GQBA 2LGOA 2KI3A 1Q6UA 2ZR4A 3WKZA 3O5MA 1WB0A 1GUVA 1FKGA 3KADA 3ARQA 3B9DA 1FAPA 3GTYX 2DSVA 2IUZA 3CHFA 1FD9A 4ODLA 4L3NA 2F4EA 1F40A 1FFQA 2PV3A 4ODRA 1LL7A 2UZ5A 3AS2A 4LGXA 3RM8A 4AY1A 3B8SA 4ML4A 3AS1A 3WD4A 1NMVA 1JNSA 1Q1CA 4LAWA 3O5FA 3WL1A 3ARTA 2O92A 1JCHB 1ZBCA 4MNJA 4URIA 4IQ2A 3EY6A 1RD6A 1D7IA 2AWGA 4JFJA 4MNLA 3JYMA 3EIPA 1HJVA 1OWQA 3ARUA 4P8WA 1C9HA 4NZCA 5DEZA 4LAVA 2M08A 1ZU8A 2DG3A 2YBTA 4LAYA 3UQIA 3ALGA 4UDMA 4U84A 2PPOA 1F8AB 4DRIA 2EULA 2F21A 4L72B 4DRMA 3O5EA 3CZ8A 1PBKA 4J4NA 2KGJA 4N19A 5HT1A 4QIBA 3W4RA 3KABA 4DRPA 4FAPA 1YATA 1W26A 4IQCA 1NWSA 1HJXA 4J4OA 5HWBA 2DG4A 4G50A 2WLYA 3G6LA 4MGVA 1KFWA 2F23A 4MNMA 4MAVA 4WK9A 5HKGA 3CHDA 4ODPA 4GGQA 4ODNA 1FKIA 3OA5A 2DPEA 2RUDA 2N87A 4BF8A 4TW7A 2Q5AA 2KR7A 4ODOA 3RFWA 2WM0A 1ZL1A 1HKKA 1W9PA 3ARZA 4DWSB 2ZQSA 5HW6A 4KQZA 4JFKA 2XP6A 1D6OA 3RMEA 4IT6A 2KE0A 3WL0A 5D75A 1T11A 4PTMA 3AS3A 1N1AA 1W1TA 4DWSA 1E6PA 4DZ2A 4DRQA 4DH0A 2IF4A 2VCDA 2YBUA 1EQ3A 5DIUA 4JFLA 5BXJA 1E44A 3QOKA 1W1VA 1X6LA 2D9FA 1NWTA 2DSWA 4DROA 2XP9A 5HUAA 3KAIA 1OGGA 3PRDA 3IKGA 3GPKA 1E6ZA 2RQSA 1M5YA 2G41A 2XPAA 5DO2A 2ZQUA 1J4IA 1HXVA 4S3JA 1D2KA 3O5JA 3UQBA 4XAKA 1UR8A 3UI6A 3AQUA 1FKJA 2B5UB 1FKLA 3WD3A 3NRKA 1SYTA 1E6NA 2MPHA 4U85A 1ZK6A 4O2TA 4W5UA 3ARVA 3B9AA 1KT0A 5GPRA 1LQ0A 2LPVA 4LAXA 1EYMA 4Q22A 3O5RA 2KO7A 5HW8A 1A7XA 3KACA 3IKDA 3IK8A 3UF8A 4QZVB 4MPKA 1QPFA 2OLHA 3OOBA 2XP3A 1Q6HA 3WIJA 1FKRA 1ZBKA 2RURA 1NMWA 2PV1A 4KR0B 3ARRA 3UQAA 1WNOA 1FKFA 3RGCA 3RM4A 4DRJA 1NH6A 1L1PA 4W9QA 3WQVA 2LJ4A 1FKKA 3KAFA 3KAGA 4Z2GA 4ODQA 2A3EA 2MLYA 5DITA 2MLZA 4WKAA 4TYOA 1UR9A 1D7HA 4IT4A 1FKHA 3BMBA 4DT4A 3JXVA 2MNTA 2RSEA 1NSGA 3B9EA 4JYSA 4ZPTR 1SR0A 3JYJA 3ARXA 1HKMA 2ETNA 2PV2A 1ZCNA 1W1YA 2DT3A 4WKFA 2MF9A 2FAPA 4JFIA 3KAHA
chains in the Genus database with same CATH topology
1FKSA 4DRHA 4C02B 1HJWA 4TW8A 1JNDA 3VAWA 4DRNA 1GPFA 2DT2A 1ZBVA 2L2SA 1J4HA 1ZB5A 3O5GA 1VF8A 4ZPVR 2ESCA 4Z2JA 4QT2A 2DT1A 3FY1A 1FKTA 3NI6A 4DWSC 2ZQVA 2DSZA 2RUCA 4P8VA 1E6RA 4JFMA 2F2DA 2XP4A 2XPBA 3TC5A 2VN1A 4P8XA 3O5IA 3PA7A 3CGMA 2LKNA 1D7JA 1ZBWA 3WD0A 5HW7A 1FJDA 4MNKA 4U86A 2O9OA 4DWSD 1PINA 2PPPA 2QF8A 3BXWA 1WAWA 1CTNA 3G6MA 3O5LA 3ARWA 3ODKA 3WH0A 1HKIA 5I98A 2G8ZA 4TNSA 3AROA 4W9OA 2A3CA 1ROTA 4ODMA 1YW5A 4Z2HA 3KZ7A 2AOSA 3TCZA 3CH9A 1BKFA 4R0XA 1H0IA 3ARYA 5JH8A 2DSUA 4ZS6A 3KCEA 1LG1A 3H9RB 5DIVA 4W9PA 4P8UA 5HTGA 2ZQTA 3O5QA 1J6YA 3O5OA 4WKHA 1LL6A 2M1IA 1EIBA 1JNTA 1GOIA 2WK2A 1X6NA 1LG2A 3UI5A 3ALFA 1TFVA 1B6CA 1E9LA 4MSPA 3WD1A 1R9HA 3AS0A 3O5PA 2M2AA 4MTVA 3CHEA 5HBFA 1FKBA 3PRAA 1ROUA 2PI6A 2PPNA 4TX0A 2KFWA 2B31A 4Z2IA 2FKEA 1W9VA 2ZR5A 1FKDA 2A3BA 1HKJA 1Q6IA 4DZ3A 4ITZA 4WJXA 2WLZA 1XRVA 2RUQA 5B8IC 1QPLA 2DG9A 3FAPA 2ZR6A 1W9UA 1IX5A 4Z2KA 3FXYA 1XHGA 4WIWA 2JZVA 4ZPWR 1OGBA 3B7XA 3PRBA 4FN2A 2A3AA 4HBOA 1EDQA 2PBCA 3CGNA 1JVWA 3WQWA 1NWRA 4GIVA 4Z2LA 1LL4A 3RM9A 5GPGA 3CHCA 4Q7NA 1U79A 3ARSA 1LJYA 1EHNA 1BL4A 1KT1A 5HWCA 1TCOC 4DIPA 3I6CA 3NTPA 1J4RA 1JNEA 2ITKA 2MLXA 4HBEA 1Y0OA 4IPXA 4TW6A 3PR9A 4S3KA 2OFNA 3TDBA 2FDMA 3LUOA 4G2PA 1QZ2A 4HARA 1E15A 4NNRA 4ODKA 3WD2A 2Y78A 1ITXA 1FFRA 1W1PA 1H0GA 1P5QA 3O5DA 2XP8A 3O5KA 4DRKA 4QT3A 2XP7A 5J6EA 1NWUA 1K9TA 1O6IA 2K8IA 3UI4A 3IHZA 2DT0A 2XP5A 3ARPA 5DF0A 4NSBA 3MDYB 4R5EA 5GQBA 2LGOA 2KI3A 1Q6UA 2ZR4A 3WKZA 3O5MA 1WB0A 1GUVA 1FKGA 3KADA 3ARQA 3B9DA 1FAPA 2DSVA 2IUZA 3CHFA 1FD9A 4ODLA 4L3NA 2F4EA 1F40A 1FFQA 2PV3A 4ODRA 1LL7A 2UZ5A 3AS2A 4LGXA 3RM8A 4AY1A 3B8SA 4ML4A 3AS1A 3WD4A 1NMVA 1JNSA 1Q1CA 4LAWA 3O5FA 3WL1A 3ARTA 2O92A 1ZBCA 4MNJA 4URIA 4IQ2A 3EY6A 1RD6A 1D7IA 2AWGA 4JFJA 4MNLA 3JYMA 1HJVA 1OWQA 3ARUA 4P8WA 1C9HA 4NZCA 5DEZA 4LAVA 2M08A 1ZU8A 2DG3A 2YBTA 4LAYA 3UQIA 3ALGA 4U84A 2PPOA 1F8AB 4DRIA 2F21A 4L72B 4DRMA 3O5EA 3CZ8A 1PBKA 4J4NA 2KGJA 4N19A 5HT1A 4QIBA 3W4RA 3KABA 4DRPA 4FAPA 1YATA 1W26A 4IQCA 1NWSA 1HJXA 4J4OA 5HWBA 2DG4A 4G50A 2WLYA 3G6LA 4MGVA 1KFWA 4MNMA 4MAVA 4WK9A 5HKGA 3CHDA 4ODPA 4GGQA 4ODNA 1FKIA 3OA5A 2DPEA 2RUDA 2N87A 4BF8A 4TW7A 2Q5AA 2KR7A 4ODOA 3RFWA 2WM0A 1ZL1A 1HKKA 1W9PA 3ARZA 4DWSB 2ZQSA 5HW6A 4KQZA 4JFKA 2XP6A 1D6OA 3RMEA 4IT6A 2KE0A 3WL0A 5D75A 1T11A 4PTMA 3AS3A 1N1AA 1W1TA 4DWSA 1E6PA 4DZ2A 4DRQA 4DH0A 2IF4A 2VCDA 2YBUA 1EQ3A 5DIUA 4JFLA 5BXJA 2D9FA 3QOKA 1X6LA 1W1VA 1NWTA 2DSWA 4DROA 2XP9A 5HUAA 3KAIA 1OGGA 3PRDA 3IKGA 3GPKA 1E6ZA 2RQSA 1M5YA 2G41A 2XPAA 5DO2A 2ZQUA 1J4IA 1HXVA 4S3JA 1D2KA 3O5JA 3UQBA 4XAKA 1UR8A 3UI6A 3AQUA 1FKJA 1FKLA 3WD3A 3NRKA 1SYTA 1E6NA 2MPHA 4U85A 1ZK6A 4O2TA 4W5UA 3ARVA 3B9AA 1KT0A 5GPRA 1LQ0A 2LPVA 4LAXA 1EYMA 4Q22A 3O5RA 2KO7A 5HW8A 1A7XA 3KACA 3IKDA 3IK8A 3UF8A 4QZVB 4MPKA 1QPFA 2OLHA 3OOBA 2XP3A 1Q6HA 3WIJA 1FKRA 1ZBKA 2RURA 1NMWA 2PV1A 4KR0B 3ARRA 3UQAA 1WNOA 1FKFA 3RGCA 3RM4A 4DRJA 1NH6A 1L1PA 4W9QA 3WQVA 2LJ4A 1FKKA 3KAFA 3KAGA 4Z2GA 4ODQA 2A3EA 2MLYA 5DITA 2MLZA 4WKAA 4TYOA 1UR9A 1D7HA 4IT4A 1FKHA 4DT4A 3JXVA 2MNTA 2RSEA 1NSGA 3B9EA 4JYSA 4ZPTR 1SR0A 3JYJA 3ARXA 1HKMA 1ZCNA 2PV2A 1W1YA 2DT3A 4WKFA 2MF9A 2FAPA 4JFIA 3KAHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKS A;  2PV3 A;  4DRH A;  3IKG A;  4C02 B;  3GPK A;  2XPA A;  2RQS A;  1M5Y A;  2UZ5 A;  4ODR A;  1FKD A;  4TW8 A;  3VAW A;  4DRN A;  2ZQU A;  1J4I A;  1Q6I A;  4DZ3 A;  4ITZ A;  1NMV A;  1HXV A;  1JNS A;  1Q1C A;  2L2S A;  2RUQ A;  4LAW A;  1J4H A;  3O5F A;  3O5J A;  3O5G A;  3UQB A;  4QT2 A;  5B8I C;  1QPL A;  2DG9 A;  3FAP A;  2ZR6 A;  3UI6 A;  1FKT A;  1FKJ A;  3NI6 A;  1FKL A;  2ZQV A;  3NRK A;  4IQ2 A;  3EY6 A;  2JZV A;  1D7I A;  2AWG A;  4JFJ A;  2MPH A;  2RUC A;  1ZK6 A;  3JYM A;  4O2T A;  3B7X A;  4JFM A;  4U85 A;  3PRB A;  4FN2 A;  2F2D A;  1C9H A;  2XP4 A;  1KT0 A;  2PBC A;  2XPB A;  3CGN A;  1JVW A;  2VN1 A;  4LAV A;  3TC5 A;  2M08 A;  2LPV A;  2DG3 A;  3CGM A;  3O5I A;  3PA7 A;  4LAX A;  4LAY A;  3UQI A;  2LKN A;  1D7J A;  1EYM A;  3O5R A;  4U84 A;  5HW7 A;  2KO7 A;  4GIV A;  5HW8 A;  1FJD A;  2PPO A;  1A7X A;  1F8A B;  4U86 A;  4DRI A;  5GPG A;  3KAC A;  2F21 A;  3IKD A;  3IK8 A;  4DRM A;  1U79 A;  3UF8 A;  1KT1 A;  1BL4 A;  1PIN A;  2PPP A;  3O5E A;  1PBK A;  4J4N A;  2KGJ A;  5HWC A;  3O5L A;  1QPF A;  4N19 A;  1TCO C;  4DIP A;  3ODK A;  3WH0 A;  5HT1 A;  4QIB A;  5I98 A;  3I6C A;  3KAB A;  3NTP A;  3OOB A;  1J4R A;  4DRP A;  4TNS A;  4FAP A;  1YAT A;  1W26 A;  2ITK A;  1Q6H A;  2MLX A;  2XP3 A;  1Y0O A;  3PRD A;  4IQC A;  4W9O A;  4IPX A;  1FKR A;  1ROT A;  4TW6 A;  4J4O A;  5HWB A;  2DG4 A;  4ODM A;  2OFN A;  4G50 A;  2RUR A;  3TDB A;  1NMW A;  1YW5 A;  2PV1 A;  4MGV A;  3KZ7 A;  3TCZ A;  1BKF A;  4R0X A;  3LUO A;  4G2P A;  1QZ2 A;  4NNR A;  3UQA A;  4ODK A;  1FKF A;  3KCE A;  5HKG A;  3RGC A;  2Y78 A;  4ODP A;  4GGQ A;  4ODN A;  1FKI A;  4DRJ A;  1L1P A;  3H9R B;  4W9Q A;  5DIV A;  1P5Q A;  2RUD A;  2N87 A;  4W9P A;  4BF8 A;  4TW7 A;  5HTG A;  2Q5A A;  2KR7 A;  2XP8 A;  2LJ4 A;  2ZQT A;  3O5K A;  3O5Q A;  3O5D A;  4ODO A;  4DRK A;  1J6Y A;  1FKK A;  3O5O A;  3KAF A;  3RFW A;  4QT3 A;  2M1I A;  3KAG A;  1JNT A;  2XP7 A;  4ODQ A;  5J6E A;  2MLY A;  2K8I A;  2ZQS A;  5DIT A;  2MLZ A;  3UI4 A;  3IHZ A;  4TYO A;  1D7H A;  3UI5 A;  5HW6 A;  2XP5 A;  1B6C A;  1FKH A;  4JFK A;  2XP6 A;  1D6O A;  4MSP A;  4DT4 A;  1R9H A;  2KE0 A;  3MDY B;  3JXV A;  5D75 A;  2LGO A;  1T11 A;  2KI3 A;  2MNT A;  2RSE A;  1NSG A;  1N1A A;  3O5P A;  2M2A A;  1Q6U A;  2ZR4 A;  3O5M A;  4DZ2 A;  4DRQ A;  4DH0 A;  2IF4 A;  1FKB A;  4JYS A;  2VCD A;  1EQ3 A;  1FKG A;  3KAD A;  3JYJ A;  5DIU A;  4JFL A;  1FAP A;  1ROU A;  2PPN A;  5BXJ A;  2D9F A;  1ZCN A;  2PV2 A;  4TX0 A;  1FD9 A;  2KFW A;  4ODL A;  2XP9 A;  2MF9 A;  4DRO A;  5HUA A;  2F4E A;  2FKE A;  1F40 A;  2FAP A;  4JFI A;  3KAI A;  2ZR5 A;  3KAH A; 
#chains in the Genus database with same CATH topology
 1FKS A;  4DRH A;  4C02 B;  1HJW A;  4TW8 A;  1JND A;  3VAW A;  4DRN A;  1GPF A;  2DT2 A;  1ZBV A;  2L2S A;  1J4H A;  1ZB5 A;  3O5G A;  1VF8 A;  4ZPV R;  2ESC A;  4Z2J A;  4QT2 A;  2DT1 A;  3FY1 A;  1FKT A;  3NI6 A;  4DWS C;  2ZQV A;  2DSZ A;  2RUC A;  4P8V A;  1E6R A;  4JFM A;  2F2D A;  2XP4 A;  2XPB A;  3TC5 A;  2VN1 A;  4P8X A;  3O5I A;  3PA7 A;  3CGM A;  2LKN A;  1D7J A;  1ZBW A;  3WD0 A;  5HW7 A;  1FJD A;  4MNK A;  4U86 A;  2O9O A;  4DWS D;  1PIN A;  2PPP A;  2QF8 A;  3BXW A;  1WAW A;  1CTN A;  3G6M A;  3O5L A;  3ARW A;  3ODK A;  3WH0 A;  1HKI A;  5I98 A;  2G8Z A;  4TNS A;  3ARO A;  4W9O A;  2A3C A;  1ROT A;  4ODM A;  1YW5 A;  4Z2H A;  3KZ7 A;  2AOS A;  3TCZ A;  3CH9 A;  1BKF A;  4R0X A;  1H0I A;  3ARY A;  5JH8 A;  2DSU A;  4ZS6 A;  3KCE A;  1LG1 A;  3H9R B;  5DIV A;  3GU0 A;  4W9P A;  2PN0 A;  4P8U A;  5HTG A;  2ZQT A;  3O5Q A;  1J6Y A;  3O5O A;  4WKH A;  1LL6 A;  2M1I A;  1EIB A;  1JNT A;  1GOI A;  2WK2 A;  1X6N A;  1LG2 A;  3UI5 A;  3ALF A;  1TFV A;  1B6C A;  1E9L A;  4MSP A;  3WD1 A;  1R9H A;  3AS0 A;  3O5P A;  2M2A A;  4MTV A;  3CHE A;  5HBF A;  1FKB A;  3PRA A;  1ROU A;  2PPN A;  2PI6 A;  4TX0 A;  2KFW A;  2B31 A;  4Z2I A;  2FKE A;  1W9V A;  2ZR5 A;  1FKD A;  2A3B A;  1HKJ A;  1Q6I A;  4DZ3 A;  1GRJ A;  4ITZ A;  4WJX A;  2WLZ A;  1XRV A;  2RUQ A;  5B8I C;  1QPL A;  2DG9 A;  3FAP A;  2ZR6 A;  1W9U A;  1IX5 A;  4Z2K A;  3FXY A;  1XHG A;  4WIW A;  2JZV A;  4ZPW R;  1OGB A;  3B7X A;  3PRB A;  4FN2 A;  2A3A A;  4HBO A;  1EDQ A;  2PBC A;  3CGN A;  1JVW A;  3WQW A;  2P4V A;  1NWR A;  4GIV A;  4Z2L A;  1LL4 A;  3RM9 A;  5GPG A;  3CHC A;  4Q7N A;  1U79 A;  3ARS A;  1LJY A;  1EHN A;  1BL4 A;  1KT1 A;  5HWC A;  1TCO C;  4DIP A;  3I6C A;  3NTP A;  1J4R A;  1JNE A;  2ITK A;  2MLX A;  4HBE A;  1Y0O A;  4IPX A;  4TW6 A;  3PR9 A;  4S3K A;  2OFN A;  3TDB A;  2FDM A;  3LUO A;  4G2P A;  1QZ2 A;  4HAR A;  1E15 A;  4NNR A;  4ODK A;  3WD2 A;  2Y78 A;  1ITX A;  1FFR A;  1W1P A;  1H0G A;  1P5Q A;  3O5D A;  2XP8 A;  3O5K A;  4DRK A;  4QT3 A;  2XP7 A;  5J6E A;  1NWU A;  1K9T A;  1O6I A;  2K8I A;  3UI4 A;  3IHZ A;  2DT0 A;  2XP5 A;  3ARP A;  5DF0 A;  4NSB A;  3MDY B;  4R5E A;  5GQB A;  2LGO A;  2KI3 A;  1Q6U A;  2ZR4 A;  3WKZ A;  3O5M A;  1WB0 A;  1GUV A;  1FKG A;  3KAD A;  3ARQ A;  3B9D A;  1FAP A;  3GTY X;  2DSV A;  2IUZ A;  3CHF A;  1FD9 A;  4ODL A;  4L3N A;  2F4E A;  1F40 A;  1FFQ A;  2PV3 A;  4ODR A;  1LL7 A;  2UZ5 A;  3AS2 A;  4LGX A;  3RM8 A;  4AY1 A;  3B8S A;  4ML4 A;  3AS1 A;  3WD4 A;  1NMV A;  1JNS A;  1Q1C A;  4LAW A;  3O5F A;  3WL1 A;  3ART A;  2O92 A;  1JCH B;  1ZBC A;  4MNJ A;  4URI A;  4IQ2 A;  3EY6 A;  1RD6 A;  1D7I A;  2AWG A;  4JFJ A;  4MNL A;  3JYM A;  3EIP A;  1HJV A;  1OWQ A;  3ARU A;  4P8W A;  1C9H A;  4NZC A;  5DEZ A;  4LAV A;  2M08 A;  1ZU8 A;  2DG3 A;  2YBT A;  4LAY A;  3UQI A;  3ALG A;  4UDM A;  4U84 A;  2PPO A;  1F8A B;  4DRI A;  2EUL A;  2F21 A;  4L72 B;  4DRM A;  3O5E A;  3CZ8 A;  1PBK A;  4J4N A;  2KGJ A;  4N19 A;  5HT1 A;  4QIB A;  3W4R A;  3KAB A;  4DRP A;  4FAP A;  1YAT A;  1W26 A;  4IQC A;  1NWS A;  1HJX A;  4J4O A;  5HWB A;  2DG4 A;  4G50 A;  2WLY A;  3G6L A;  4MGV A;  1KFW A;  2F23 A;  4MNM A;  4MAV A;  4WK9 A;  5HKG A;  3CHD A;  4ODP A;  4GGQ A;  4ODN A;  1FKI A;  3OA5 A;  2DPE A;  2RUD A;  2N87 A;  4BF8 A;  4TW7 A;  2Q5A A;  2KR7 A;  4ODO A;  3RFW A;  2WM0 A;  1ZL1 A;  1HKK A;  1W9P A;  3ARZ A;  4DWS B;  2ZQS A;  5HW6 A;  4KQZ A;  4JFK A;  2XP6 A;  1D6O A;  3RME A;  4IT6 A;  2KE0 A;  3WL0 A;  5D75 A;  1T11 A;  4PTM A;  3AS3 A;  1N1A A;  1W1T A;  4DWS A;  1E6P A;  4DZ2 A;  4DRQ A;  4DH0 A;  2IF4 A;  2VCD A;  2YBU A;  1EQ3 A;  5DIU A;  4JFL A;  5BXJ A;  1E44 A;  3QOK A;  1W1V A;  1X6L A;  2D9F A;  1NWT A;  2DSW A;  4DRO A;  2XP9 A;  5HUA A;  3KAI A;  1OGG A;  3PRD A;  3IKG A;  3GPK A;  1E6Z A;  2RQS A;  1M5Y A;  2G41 A;  2XPA A;  5DO2 A;  2ZQU A;  1J4I A;  1HXV A;  4S3J A;  1D2K A;  3O5J A;  3UQB A;  4XAK A;  1UR8 A;  3UI6 A;  3AQU A;  1FKJ A;  2B5U B;  1FKL A;  3WD3 A;  3NRK A;  1SYT A;  1E6N A;  2MPH A;  4U85 A;  1ZK6 A;  4O2T A;  4W5U A;  3ARV A;  3B9A A;  1KT0 A;  5GPR A;  1LQ0 A;  2LPV A;  4LAX A;  1EYM A;  4Q22 A;  3O5R A;  2KO7 A;  5HW8 A;  1A7X A;  3KAC A;  3IKD A;  3IK8 A;  3UF8 A;  4QZV B;  4MPK A;  1QPF A;  2OLH A;  3OOB A;  2XP3 A;  1Q6H A;  3WIJ A;  1FKR A;  1ZBK A;  2RUR A;  1NMW A;  2PV1 A;  4KR0 B;  3ARR A;  3UQA A;  1WNO A;  1FKF A;  3RGC A;  3RM4 A;  4DRJ A;  1NH6 A;  1L1P A;  4W9Q A;  3WQV A;  2LJ4 A;  1FKK A;  3KAF A;  3KAG A;  4Z2G A;  4ODQ A;  2A3E A;  2MLY A;  5DIT A;  2MLZ A;  4WKA A;  4TYO A;  1UR9 A;  1D7H A;  4IT4 A;  1FKH A;  3BMB A;  4DT4 A;  3JXV A;  2MNT A;  2RSE A;  1NSG A;  3B9E A;  4JYS A;  4ZPT R;  1SR0 A;  3JYJ A;  3ARX A;  1HKM A;  2ETN A;  2PV2 A;  1ZCN A;  1W1Y A;  2DT3 A;  4WKF A;  2MF9 A;  2FAP A;  4JFI A;  3KAH A; 
#chains in the Genus database with same CATH homology
 1FKS A;  4DRH A;  4C02 B;  1HJW A;  4TW8 A;  1JND A;  3VAW A;  4DRN A;  1GPF A;  2DT2 A;  1ZBV A;  2L2S A;  1J4H A;  1ZB5 A;  3O5G A;  1VF8 A;  4ZPV R;  2ESC A;  4Z2J A;  4QT2 A;  2DT1 A;  3FY1 A;  1FKT A;  3NI6 A;  4DWS C;  2ZQV A;  2DSZ A;  2RUC A;  4P8V A;  1E6R A;  4JFM A;  2F2D A;  2XP4 A;  2XPB A;  3TC5 A;  2VN1 A;  4P8X A;  3O5I A;  3PA7 A;  3CGM A;  2LKN A;  1D7J A;  1ZBW A;  3WD0 A;  5HW7 A;  1FJD A;  4MNK A;  4U86 A;  2O9O A;  4DWS D;  1PIN A;  2PPP A;  2QF8 A;  3BXW A;  1WAW A;  1CTN A;  3G6M A;  3O5L A;  3ARW A;  3ODK A;  3WH0 A;  1HKI A;  5I98 A;  2G8Z A;  4TNS A;  3ARO A;  4W9O A;  2A3C A;  1ROT A;  4ODM A;  1YW5 A;  4Z2H A;  3KZ7 A;  2AOS A;  3TCZ A;  3CH9 A;  1BKF A;  4R0X A;  1H0I A;  3ARY A;  5JH8 A;  2DSU A;  4ZS6 A;  3KCE A;  1LG1 A;  3H9R B;  5DIV A;  4W9P A;  4P8U A;  5HTG A;  2ZQT A;  3O5Q A;  1J6Y A;  3O5O A;  4WKH A;  1LL6 A;  2M1I A;  1EIB A;  1JNT A;  1GOI A;  2WK2 A;  1X6N A;  1LG2 A;  3UI5 A;  3ALF A;  1TFV A;  1B6C A;  1E9L A;  4MSP A;  3WD1 A;  1R9H A;  3AS0 A;  3O5P A;  2M2A A;  4MTV A;  3CHE A;  5HBF A;  1FKB A;  3PRA A;  1ROU A;  2PI6 A;  2PPN A;  4TX0 A;  2KFW A;  2B31 A;  4Z2I A;  2FKE A;  1W9V A;  2ZR5 A;  1FKD A;  2A3B A;  1HKJ A;  1Q6I A;  4DZ3 A;  4ITZ A;  4WJX A;  2WLZ A;  1XRV A;  2RUQ A;  5B8I C;  1QPL A;  2DG9 A;  3FAP A;  2ZR6 A;  1W9U A;  1IX5 A;  4Z2K A;  3FXY A;  1XHG A;  4WIW A;  2JZV A;  4ZPW R;  1OGB A;  3B7X A;  3PRB A;  4FN2 A;  2A3A A;  4HBO A;  1EDQ A;  2PBC A;  3CGN A;  1JVW A;  3WQW A;  1NWR A;  4GIV A;  4Z2L A;  1LL4 A;  3RM9 A;  5GPG A;  3CHC A;  4Q7N A;  1U79 A;  3ARS A;  1LJY A;  1EHN A;  1BL4 A;  1KT1 A;  5HWC A;  1TCO C;  4DIP A;  3I6C A;  3NTP A;  1J4R A;  1JNE A;  2ITK A;  2MLX A;  4HBE A;  1Y0O A;  4IPX A;  4TW6 A;  3PR9 A;  4S3K A;  2OFN A;  3TDB A;  2FDM A;  3LUO A;  4G2P A;  1QZ2 A;  4HAR A;  1E15 A;  4NNR A;  4ODK A;  3WD2 A;  2Y78 A;  1ITX A;  1FFR A;  1W1P A;  1H0G A;  1P5Q A;  3O5D A;  2XP8 A;  3O5K A;  4DRK A;  4QT3 A;  2XP7 A;  5J6E A;  1NWU A;  1K9T A;  1O6I A;  2K8I A;  3UI4 A;  3IHZ A;  2DT0 A;  2XP5 A;  3ARP A;  5DF0 A;  4NSB A;  3MDY B;  4R5E A;  5GQB A;  2LGO A;  2KI3 A;  1Q6U A;  2ZR4 A;  3WKZ A;  3O5M A;  1WB0 A;  1GUV A;  1FKG A;  3KAD A;  3ARQ A;  3B9D A;  1FAP A;  2DSV A;  2IUZ A;  3CHF A;  1FD9 A;  4ODL A;  4L3N A;  2F4E A;  1F40 A;  1FFQ A;  2PV3 A;  4ODR A;  1LL7 A;  2UZ5 A;  3AS2 A;  4LGX A;  3RM8 A;  4AY1 A;  3B8S A;  4ML4 A;  3AS1 A;  3WD4 A;  1NMV A;  1JNS A;  1Q1C A;  4LAW A;  3O5F A;  3WL1 A;  3ART A;  2O92 A;  1ZBC A;  4MNJ A;  4URI A;  4IQ2 A;  3EY6 A;  1RD6 A;  1D7I A;  2AWG A;  4JFJ A;  4MNL A;  3JYM A;  1HJV A;  1OWQ A;  3ARU A;  4P8W A;  1C9H A;  4NZC A;  5DEZ A;  4LAV A;  2M08 A;  1ZU8 A;  2DG3 A;  2YBT A;  4LAY A;  3UQI A;  3ALG A;  4U84 A;  2PPO A;  1F8A B;  4DRI A;  2F21 A;  4L72 B;  4DRM A;  3O5E A;  3CZ8 A;  1PBK A;  4J4N A;  2KGJ A;  4N19 A;  5HT1 A;  4QIB A;  3W4R A;  3KAB A;  4DRP A;  4FAP A;  1YAT A;  1W26 A;  4IQC A;  1NWS A;  1HJX A;  4J4O A;  5HWB A;  2DG4 A;  4G50 A;  2WLY A;  3G6L A;  4MGV A;  1KFW A;  4MNM A;  4MAV A;  4WK9 A;  5HKG A;  3CHD A;  4ODP A;  4GGQ A;  4ODN A;  1FKI A;  3OA5 A;  2DPE A;  2RUD A;  2N87 A;  4BF8 A;  4TW7 A;  2Q5A A;  2KR7 A;  4ODO A;  3RFW A;  2WM0 A;  1ZL1 A;  1HKK A;  1W9P A;  3ARZ A;  4DWS B;  2ZQS A;  5HW6 A;  4KQZ A;  4JFK A;  2XP6 A;  1D6O A;  3RME A;  4IT6 A;  2KE0 A;  3WL0 A;  5D75 A;  1T11 A;  4PTM A;  3AS3 A;  1N1A A;  1W1T A;  4DWS A;  1E6P A;  4DZ2 A;  4DRQ A;  4DH0 A;  2IF4 A;  2VCD A;  2YBU A;  1EQ3 A;  5DIU A;  4JFL A;  5BXJ A;  2D9F A;  3QOK A;  1X6L A;  1W1V A;  1NWT A;  2DSW A;  4DRO A;  2XP9 A;  5HUA A;  3KAI A;  1OGG A;  3PRD A;  3IKG A;  3GPK A;  1E6Z A;  2RQS A;  1M5Y A;  2G41 A;  2XPA A;  5DO2 A;  2ZQU A;  1J4I A;  1HXV A;  4S3J A;  1D2K A;  3O5J A;  3UQB A;  4XAK A;  1UR8 A;  3UI6 A;  3AQU A;  1FKJ A;  1FKL A;  3WD3 A;  3NRK A;  1SYT A;  1E6N A;  2MPH A;  4U85 A;  1ZK6 A;  4O2T A;  4W5U A;  3ARV A;  3B9A A;  1KT0 A;  5GPR A;  1LQ0 A;  2LPV A;  4LAX A;  1EYM A;  4Q22 A;  3O5R A;  2KO7 A;  5HW8 A;  1A7X A;  3KAC A;  3IKD A;  3IK8 A;  3UF8 A;  4QZV B;  4MPK A;  1QPF A;  2OLH A;  3OOB A;  2XP3 A;  1Q6H A;  3WIJ A;  1FKR A;  1ZBK A;  2RUR A;  1NMW A;  2PV1 A;  4KR0 B;  3ARR A;  3UQA A;  1WNO A;  1FKF A;  3RGC A;  3RM4 A;  4DRJ A;  1NH6 A;  1L1P A;  4W9Q A;  3WQV A;  2LJ4 A;  1FKK A;  3KAF A;  3KAG A;  4Z2G A;  4ODQ A;  2A3E A;  2MLY A;  5DIT A;  2MLZ A;  4WKA A;  4TYO A;  1UR9 A;  1D7H A;  4IT4 A;  1FKH A;  4DT4 A;  3JXV A;  2MNT A;  2RSE A;  1NSG A;  3B9E A;  4JYS A;  4ZPT R;  1SR0 A;  3JYJ A;  3ARX A;  1HKM A;  1ZCN A;  2PV2 A;  1W1Y A;  2DT3 A;  4WKF A;  2MF9 A;  2FAP A;  4JFI A;  3KAH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...