3O5MA

Fk1 domain mutant a19t of fkbp51, crystal form ii
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
127
structure length
127
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 35
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5mA00
2MLZA 3UI5A 1KT1A 5HW7A 5HTGA 4N19A 1R9HA 4ITZA 4TX0A 4TYOA 2RUDA 2LKNA 3IKGA 2XPAA 1Y0OA 4JFIA 4DRMA 1JNSA 4O2TA 5HWBA 2Q5AA 2FAPA 3O5QA 1YW5A 2PV1A 4TW7A 4FAPA 2XP3A 2XP4A 4LAVA 4ODQA 2FKEA 1FKIA 3KADA 2D9FA 5DIVA 1ZCNA 3VAWA 3O5GA 4LAWA 4DZ2A 1T11A 3KAIA 4TW8A 3PRBA 2KO7A 1N1AA 1YATA 2ZQUA 4G50A 4LAXA 3TCZA 4ODOA 2MPHA 5HKGA 2XP6A 1NSGA 4MGVA 3RGCA 2PPOA 4DROA 1PBKA 2L2SA 4DRIA 1D7JA 1F8AB 2XP5A 2KFWA 4U86A 2XP9A 1EQ3A 2OFNA 4W9PA 3GPKA 2AWGA 3PA7A 1QPFA 1HXVA 2K8IA 2IF4A 4U84A 5HW8A 3KAGA 1FKDA 1FD9A 2F21A 4QT3A 2RQSA 4DZ3A 1ROUA 1JVWA 5J6EA 3IHZA 1Q6HA 4GGQA 4DH0A 2DG3A 3OOBA 2ZQVA 2PPPA 1ROTA 1FKBA 4IPXA 3RFWA 1PINA 4C02B 4FN2A 1QPLA 2M08A 4JFLA 2DG9A 4G2PA 3WH0A 2KR7A 3NTPA 3O5OA 1J4IA 1M5YA 2KGJA 3KAFA 1Q6IA 2F4EA 3H9RB 4R0XA 5DITA 3TDBA 2KE0A 1FKJA 5HW6A 1FKSA 2VCDA 4BF8A 5HT1A 4IQ2A 1D6OA 2MF9A 4NNRA 1B6CA 3MDYB 3UQIA 5BXJA 4DRQA 3TC5A 4DIPA 1J6YA 3KCEA 1W26A 4ODMA 1F40A 2RSEA 1BL4A 4JFJA 4U85A 4ODPA 2PV2A 2MLYA 2JZVA 1Q1CA 4DRNA 4MSPA 3I6CA 5D75A 1EYMA 3UI4A 5B8IC 3UQAA 1TCOC 4ODNA 3O5DA 1FKLA 4W9OA 2ZR4A 3O5IA 1J4HA 1FKGA 3O5MA 1D7HA 3O5JA 4JYSA 1FKRA 5HUAA 4DRHA 2RUCA 3KABA 5GPGA 5HWCA 2VN1A 1FKKA 3JXVA 3KAHA 3O5EA 3O5PA 2Y78A 2KI3A 4DRJA 4DRKA 1A7XA 3PRDA 5I98A 1P5QA 4J4OA 3JYJA 2F2DA 4QIBA 4IQCA 1FAPA 2LGOA 3KACA 1ZK6A 2MLXA 2PV3A 2XPBA 2UZ5A 2RUQA 3O5KA 1Q6UA 3IK8A 2XP8A 3ODKA 4LAYA 3EY6A 3CGNA 4TNSA 2LPVA 1FKHA 1L1PA 1NMWA 4TW6A 3UI6A 1KT0A 3O5RA 2PPNA 2ZR5A 1JNTA 4DT4A 1FJDA 2M2AA 2MNTA 2N87A 2XP7A 2PBCA 2ZQSA 3CGMA 2LJ4A 2M1IA 3LUOA 3UQBA 3O5LA 4W9QA 1QZ2A 2ZR6A 4JFKA 3NI6A 5DIUA 1FKFA 3NRKA 3O5FA 3B7XA 1NMVA 4ODRA 1C9HA 1BKFA 1U79A 4J4NA 4JFMA 4ODKA 4GIVA 3IKDA 2RURA 2ITKA 1J4RA 3UF8A 1FKTA 1D7IA 4DRPA 4ODLA 2ZQTA 3FAPA 3KZ7A 3JYMA 2DG4A 4QT2A
chains in the Genus database with same CATH superfamily
3ARPA 2MLZA 3WD2A 1EHNA 3ARZA 4ITZA 4ZPVR 2LKNA 3IKGA 1NWUA 1HKJA 5HWBA 2Q5AA 2PV1A 1E6RA 4HARA 3OA5A 3RM8A 4FAPA 4Z2LA 2XP4A 3B9EA 4ODQA 4ZS6A 3VAWA 1ZCNA 1HKIA 4LAWA 3WD3A 1O6IA 4TW8A 2KO7A 4LAXA 3CH9A 2G41A 3RM9A 4MGVA 3RGCA 4DROA 1PBKA 1ZBCA 2L2SA 1D7JA 1F8AB 1JNDA 1NWRA 2KFWA 4U86A 4ZPTR 2OFNA 2AWGA 2A3CA 4U84A 5GPRA 4QT3A 5J6EA 3IHZA 4GGQA 1ITXA 2PPPA 1ROTA 4IPXA 3RFWA 4Z2KA 3WH0A 1OWQA 1NH6A 1CTNA 2F4EA 2OLHA 3B8SA 2DSVA 3WL1A 2VCDA 4BF8A 4IQ2A 3TC5A 4ODMA 4S3KA 4ODPA 2MLYA 3I6CA 3UI4A 1EIBA 1X6LA 4R5EA 3O5DA 1FKLA 4KR0B 4W9OA 1H0IA 2ZR4A 3O5MA 3O5JA 5HUAA 4MTVA 2RUCA 3KABA 5GPGA 5JH8A 2VN1A 3JXVA 1A7XA 1P5QA 4J4OA 3ARWA 2LGOA 4L3NA 1ZK6A 2MLXA 2PV3A 2UZ5A 3O5KA 1ZBVA 1Q6UA 3ODKA 4LAYA 3EY6A 2YBTA 4TNSA 1NMWA 3ARUA 3UI6A 2ZR5A 1ZU8A 4DT4A 2DSUA 2XP7A 2PBCA 2B5UB 3UQBA 1TFVA 4JFKA 5DIUA 3NRKA 3WIJA 1WB0A 4ODKA 2A3EA 4GIVA 1D7IA 4WKFA 1KT1A 4IT6A 4N19A 1H0GA 1Y0OA 4O2TA 3O5QA 4TW7A 1WAWA 3AQUA 4W5UA 2ETNA 4LAVA 1FKIA 2D9FA 4WKHA 1T11A 3PRBA 1YATA 5HKGA 2XP6A 1NSGA 3W4RA 3EIPA 4AY1A 3CZ8A 4DRIA 1VF8A 2K8IA 5HW8A 3KAGA 1FKDA 2O92A 3WD4A 4NZCA 4DH0A 4C02B 2A3AA 1HKMA 1QPLA 4XAKA 3NTPA 1EDQA 3TDBA 5DITA 2KE0A 1FKJA 4ZPWR 1FKSA 3UQIA 1D6OA 4NNRA 1B6CA 4MNJA 1J6YA 4DIPA 3CHCA 4PTMA 1W26A 2YBUA 4L72B 4U85A 4MAVA 4MSPA 5D75A 1EYMA 4ODNA 2AOSA 1LJYA 2PN0A 1J4HA 1E6ZA 2A3BA 1LG2A 3KAHA 3O5EA 3O5PA 3RMEA 2Y78A 2KI3A 4MNMA 3ARXA 3AS3A 3IK8A 1X6NA 1E6NA 1E44A 1KT0A 3B9DA 3CHFA 3AS2A 2PPNA 1JNTA 1FJDA 2M2AA 2MNTA 2N87A 3CGMA 4UDMA 2M1IA 3CHDA 2O9OA 1RD6A 2PI6A 1QZ2A 3O5LA 1ZBKA 3B7XA 3AS0A 1KFWA 5DO2A 4JFMA 2WLZA 3IKDA 3ARRA 2RURA 4NSBA 1JNEA 1D2KA 4WJXA 5DF0A 1GUVA 3WD0A 4FN2A 3UI5A 1LQ0A 4WIWA 5HW7A 1WNOA 2DT0A 4TX0A 4TYOA 2RUDA 4JFIA 4DRMA 1JNSA 4P8UA 3PRAA 2DSWA 2FKEA 2EULA 1W1PA 1HJXA 3O5GA 2G8ZA 3KAIA 2ZQUA 2QF8A 3WQWA 4ODOA 2MPHA 2PPOA 2P4VA 2DSZA 2XP5A 1XHGA 2XP9A 1FFQA 1GRJA 3ARTA 1EQ3A 4W9PA 3GPKA 4S3JA 3PA7A 1QPFA 2IF4A 1NWSA 1FD9A 2F21A 1W9UA 2RQSA 3AS1A 4DZ3A 1ROUA 1JVWA 4Z2JA 1Q6HA 1LL6A 3WD1A 2ZQVA 2M08A 4JFLA 2DG9A 4G2PA 3O5OA 1M5YA 2KGJA 4R0XA 3H9RB 1LL7A 1E15A 2MF9A 3MDYB 3GTYX 3KCEA 2RSEA 4Z2IA 2PV2A 1Q1CA 3ARSA 1W9VA 4P8XA 3UQAA 3FY1A 3WL0A 4ML4A 1FKGA 1NWTA 2B31A 4DRHA 1UR8A 4MNLA 4P8WA 5HWCA 4QZVB 4Q7NA 4DRJA 4DRKA 3PRDA 4Z2GA 2F2DA 1FAPA 4Q22A 2XP8A 2F23A 3WQVA 3PR9A 4WKAA 3ALGA 3ALFA 1GOIA 4DWSB 2LJ4A 3LUOA 4W9QA 3NI6A 1W1YA 1NMVA 1U79A 4DWSA 2DT2A 2ITKA 5DEZA 4DWSD 1J4RA 3UF8A 1FKTA 1XRVA 4ODLA 3JYMA 2DG4A 4P8VA 1UR9A 5HTGA 1R9HA 2WLYA 3QOKA 2XPAA 1E6PA 2FAPA 1YW5A 1JCHB 3CHEA 2XP3A 1FFRA 3KADA 5DIVA 1ZB5A 4DZ2A 2DPEA 1W1TA 1N1AA 3TCZA 4IT4A 4G50A 4MPKA 1HKKA 4HBOA 1W1VA 1HXVA 4HBEA 2DT3A 2WM0A 1SR0A 5GQBA 1OGGA 2DG3A 3G6MA 3OOBA 4KQZA 1ZL1A 1FKBA 1PINA 3FXYA 3ARVA 3AROA 2KR7A 1J4IA 3KAFA 1Q6IA 5HW6A 4MNKA 4Z2HA 5HT1A 5BXJA 2WK2A 3ARYA 1W9PA 4DRQA 1E9LA 1F40A 1BL4A 1HJVA 3BMBA 4JFJA 1K9TA 2JZVA 4DRNA 5B8IC 1TCOC 3O5IA 4URIA 1D7HA 4JYSA 1FKRA 4DWSC 1OGBA 2ESCA 3WKZA 1FKKA 5I98A 3GU0A 3JYJA 4QIBA 4IQCA 2DT1A 3KACA 2XPBA 2RUQA 3CGNA 2LPVA 1FKHA 1L1PA 4TW6A 3O5RA 1ZBWA 1SYTA 4WK9A 1LG1A 3BXWA 1LL4A 2FDMA 2ZQSA 2ZR6A 3G6LA 1FKFA 3O5FA 3ARQA 4ODRA 3B9AA 4LGXA 1C9HA 1BKFA 5HBFA 4J4NA 1GPFA 1HJWA 3RM4A 4DRPA 2ZQTA 2IUZA 3FAPA 3KZ7A 1IX5A 4QT2A
chains in the Genus database with same CATH topology
3ARPA 2MLZA 3WD2A 1EHNA 3ARZA 4ITZA 4ZPVR 2LKNA 3IKGA 1NWUA 1HKJA 5HWBA 2Q5AA 2PV1A 1E6RA 4HARA 3OA5A 3RM8A 4FAPA 4Z2LA 2XP4A 3B9EA 4ODQA 4ZS6A 3VAWA 1ZCNA 1HKIA 4LAWA 3WD3A 1O6IA 4TW8A 2KO7A 4LAXA 3CH9A 2G41A 3RM9A 4MGVA 3RGCA 4DROA 1PBKA 1ZBCA 2L2SA 1D7JA 1F8AB 1JNDA 1NWRA 2KFWA 4U86A 4ZPTR 2OFNA 2AWGA 2A3CA 4U84A 5GPRA 4QT3A 5J6EA 3IHZA 4GGQA 1ITXA 2PPPA 1ROTA 4IPXA 3RFWA 4Z2KA 3WH0A 1OWQA 1NH6A 1CTNA 2F4EA 2OLHA 3B8SA 2DSVA 3WL1A 2VCDA 4BF8A 4IQ2A 3TC5A 4ODMA 4S3KA 4ODPA 2MLYA 3I6CA 3UI4A 1EIBA 1X6LA 4R5EA 3O5DA 1FKLA 4KR0B 4W9OA 1H0IA 2ZR4A 3O5MA 3O5JA 5HUAA 4MTVA 2RUCA 3KABA 5GPGA 5JH8A 2VN1A 3JXVA 1A7XA 1P5QA 4J4OA 3ARWA 2LGOA 4L3NA 1ZK6A 2MLXA 2PV3A 2UZ5A 3O5KA 1ZBVA 1Q6UA 3ODKA 4LAYA 3EY6A 2YBTA 4TNSA 1NMWA 3ARUA 3UI6A 2ZR5A 1ZU8A 4DT4A 2DSUA 2XP7A 2PBCA 3UQBA 1TFVA 4JFKA 5DIUA 3NRKA 3WIJA 1WB0A 4ODKA 2A3EA 4GIVA 1D7IA 4WKFA 1KT1A 4IT6A 4N19A 1H0GA 1Y0OA 4O2TA 3O5QA 4TW7A 1WAWA 3AQUA 4W5UA 4LAVA 1FKIA 2D9FA 4WKHA 1T11A 3PRBA 1YATA 5HKGA 2XP6A 1NSGA 3W4RA 4AY1A 3CZ8A 4DRIA 1VF8A 2K8IA 5HW8A 3KAGA 1FKDA 2O92A 3WD4A 4NZCA 4DH0A 4C02B 2A3AA 1HKMA 1QPLA 4XAKA 3NTPA 1EDQA 3TDBA 5DITA 2KE0A 1FKJA 4ZPWR 1FKSA 3UQIA 1D6OA 4NNRA 1B6CA 4MNJA 1J6YA 4DIPA 3CHCA 4PTMA 1W26A 2YBUA 4L72B 4U85A 4MAVA 4MSPA 5D75A 1EYMA 4ODNA 2AOSA 1LJYA 1J4HA 1E6ZA 2A3BA 1LG2A 3KAHA 3O5EA 3O5PA 3RMEA 2Y78A 2KI3A 4MNMA 3ARXA 3AS3A 3IK8A 1X6NA 1E6NA 1KT0A 3B9DA 3CHFA 3AS2A 2PPNA 1JNTA 1FJDA 2M2AA 2MNTA 2N87A 3CGMA 2M1IA 3CHDA 2O9OA 1RD6A 2PI6A 1QZ2A 3O5LA 1ZBKA 3B7XA 3AS0A 1KFWA 5DO2A 4JFMA 2WLZA 3IKDA 3ARRA 2RURA 4NSBA 1JNEA 1D2KA 4WJXA 5DF0A 1GUVA 3WD0A 4FN2A 3UI5A 1LQ0A 4WIWA 5HW7A 1WNOA 2DT0A 4TX0A 4TYOA 2RUDA 4JFIA 4DRMA 1JNSA 4P8UA 3PRAA 2DSWA 2FKEA 1W1PA 1HJXA 3O5GA 2G8ZA 3KAIA 2ZQUA 2QF8A 3WQWA 4ODOA 2MPHA 2PPOA 2DSZA 2XP5A 1XHGA 2XP9A 1FFQA 3ARTA 1EQ3A 4W9PA 3GPKA 4S3JA 3PA7A 1QPFA 2IF4A 1NWSA 1FD9A 2F21A 1W9UA 2RQSA 3AS1A 4DZ3A 1ROUA 1JVWA 4Z2JA 1Q6HA 1LL6A 3WD1A 2ZQVA 2M08A 4JFLA 2DG9A 4G2PA 3O5OA 1M5YA 2KGJA 4R0XA 3H9RB 1LL7A 1E15A 2MF9A 3MDYB 3KCEA 2RSEA 4Z2IA 2PV2A 1Q1CA 3ARSA 1W9VA 4P8XA 3UQAA 3FY1A 3WL0A 4ML4A 1FKGA 1NWTA 2B31A 4DRHA 1UR8A 4MNLA 4P8WA 5HWCA 4QZVB 4Q7NA 4DRJA 4DRKA 3PRDA 4Z2GA 2F2DA 1FAPA 4Q22A 2XP8A 3WQVA 3PR9A 4WKAA 3ALGA 3ALFA 1GOIA 4DWSB 2LJ4A 3LUOA 4W9QA 3NI6A 1W1YA 1NMVA 1U79A 4DWSA 2DT2A 2ITKA 5DEZA 4DWSD 1J4RA 3UF8A 1FKTA 1XRVA 4ODLA 3JYMA 2DG4A 4P8VA 1UR9A 5HTGA 1R9HA 2WLYA 3QOKA 2XPAA 1E6PA 2FAPA 1YW5A 3CHEA 2XP3A 1FFRA 3KADA 5DIVA 1ZB5A 4DZ2A 2DPEA 1W1TA 1N1AA 3TCZA 4IT4A 4G50A 4MPKA 1HKKA 4HBOA 1W1VA 1HXVA 4HBEA 2DT3A 2WM0A 1SR0A 5GQBA 1OGGA 2DG3A 3G6MA 3OOBA 4KQZA 1ZL1A 1FKBA 1PINA 3FXYA 3ARVA 3AROA 2KR7A 1J4IA 3KAFA 1Q6IA 5HW6A 4MNKA 4Z2HA 5HT1A 5BXJA 2WK2A 3ARYA 1W9PA 4DRQA 1E9LA 1F40A 1BL4A 1HJVA 4JFJA 1K9TA 2JZVA 4DRNA 5B8IC 1TCOC 3O5IA 4URIA 1D7HA 4JYSA 1FKRA 4DWSC 1OGBA 2ESCA 3WKZA 1FKKA 5I98A 3JYJA 4QIBA 4IQCA 2DT1A 3KACA 2XPBA 2RUQA 3CGNA 2LPVA 1FKHA 1L1PA 4TW6A 3O5RA 1ZBWA 1SYTA 4WK9A 1LG1A 3BXWA 1LL4A 2FDMA 2ZQSA 2ZR6A 3G6LA 1FKFA 3O5FA 3ARQA 4ODRA 3B9AA 4LGXA 1C9HA 1BKFA 5HBFA 4J4NA 1GPFA 1HJWA 3RM4A 4DRPA 2ZQTA 2IUZA 3FAPA 3KZ7A 1IX5A 4QT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLZ A;  3UI5 A;  1KT1 A;  5HW7 A;  5HTG A;  4N19 A;  1R9H A;  4ITZ A;  4TX0 A;  4TYO A;  2RUD A;  2LKN A;  3IKG A;  2XPA A;  1Y0O A;  4JFI A;  4DRM A;  1JNS A;  4O2T A;  5HWB A;  2Q5A A;  2FAP A;  3O5Q A;  1YW5 A;  2PV1 A;  4TW7 A;  4FAP A;  2XP3 A;  2XP4 A;  4LAV A;  4ODQ A;  2FKE A;  1FKI A;  3KAD A;  2D9F A;  5DIV A;  1ZCN A;  3VAW A;  3O5G A;  4LAW A;  4DZ2 A;  1T11 A;  3KAI A;  4TW8 A;  3PRB A;  2KO7 A;  1N1A A;  1YAT A;  2ZQU A;  4G50 A;  4LAX A;  3TCZ A;  4ODO A;  2MPH A;  5HKG A;  2XP6 A;  1NSG A;  4MGV A;  3RGC A;  2PPO A;  4DRO A;  1PBK A;  2L2S A;  4DRI A;  1D7J A;  1F8A B;  2XP5 A;  2KFW A;  4U86 A;  2XP9 A;  1EQ3 A;  2OFN A;  4W9P A;  3GPK A;  2AWG A;  3PA7 A;  1QPF A;  1HXV A;  2K8I A;  2IF4 A;  4U84 A;  5HW8 A;  3KAG A;  1FKD A;  1FD9 A;  2F21 A;  4QT3 A;  2RQS A;  4DZ3 A;  1ROU A;  1JVW A;  5J6E A;  3IHZ A;  1Q6H A;  4GGQ A;  4DH0 A;  2DG3 A;  3OOB A;  2ZQV A;  2PPP A;  1ROT A;  1FKB A;  4IPX A;  3RFW A;  1PIN A;  4C02 B;  4FN2 A;  1QPL A;  2M08 A;  4JFL A;  2DG9 A;  4G2P A;  3WH0 A;  2KR7 A;  3NTP A;  3O5O A;  1J4I A;  1M5Y A;  2KGJ A;  3KAF A;  1Q6I A;  2F4E A;  3H9R B;  4R0X A;  5DIT A;  3TDB A;  2KE0 A;  1FKJ A;  5HW6 A;  1FKS A;  2VCD A;  4BF8 A;  5HT1 A;  4IQ2 A;  1D6O A;  2MF9 A;  4NNR A;  1B6C A;  3MDY B;  3UQI A;  5BXJ A;  4DRQ A;  3TC5 A;  4DIP A;  1J6Y A;  3KCE A;  1W26 A;  4ODM A;  1F40 A;  2RSE A;  1BL4 A;  4JFJ A;  4U85 A;  4ODP A;  2PV2 A;  2MLY A;  2JZV A;  1Q1C A;  4DRN A;  4MSP A;  3I6C A;  5D75 A;  1EYM A;  3UI4 A;  5B8I C;  3UQA A;  1TCO C;  4ODN A;  3O5D A;  1FKL A;  4W9O A;  2ZR4 A;  3O5I A;  1J4H A;  1FKG A;  3O5M A;  1D7H A;  3O5J A;  4JYS A;  1FKR A;  5HUA A;  4DRH A;  2RUC A;  3KAB A;  5GPG A;  5HWC A;  2VN1 A;  1FKK A;  3JXV A;  3KAH A;  3O5E A;  3O5P A;  2Y78 A;  2KI3 A;  4DRJ A;  4DRK A;  1A7X A;  3PRD A;  5I98 A;  1P5Q A;  4J4O A;  3JYJ A;  2F2D A;  4QIB A;  4IQC A;  1FAP A;  2LGO A;  3KAC A;  1ZK6 A;  2MLX A;  2PV3 A;  2XPB A;  2UZ5 A;  2RUQ A;  3O5K A;  1Q6U A;  3IK8 A;  2XP8 A;  3ODK A;  4LAY A;  3EY6 A;  3CGN A;  4TNS A;  2LPV A;  1FKH A;  1L1P A;  1NMW A;  4TW6 A;  3UI6 A;  1KT0 A;  3O5R A;  2PPN A;  2ZR5 A;  1JNT A;  4DT4 A;  1FJD A;  2M2A A;  2MNT A;  2N87 A;  2XP7 A;  2PBC A;  2ZQS A;  3CGM A;  2LJ4 A;  2M1I A;  3LUO A;  3UQB A;  3O5L A;  4W9Q A;  1QZ2 A;  2ZR6 A;  4JFK A;  3NI6 A;  5DIU A;  1FKF A;  3NRK A;  3O5F A;  3B7X A;  1NMV A;  4ODR A;  1C9H A;  1BKF A;  1U79 A;  4J4N A;  4JFM A;  4ODK A;  4GIV A;  3IKD A;  2RUR A;  2ITK A;  1J4R A;  3UF8 A;  1FKT A;  1D7I A;  4DRP A;  4ODL A;  2ZQT A;  3FAP A;  3KZ7 A;  3JYM A;  2DG4 A;  4QT2 A; 
#chains in the Genus database with same CATH topology
 3ARP A;  2MLZ A;  3WD2 A;  1EHN A;  3ARZ A;  4ITZ A;  4ZPV R;  2LKN A;  3IKG A;  1NWU A;  1HKJ A;  5HWB A;  2Q5A A;  2PV1 A;  1E6R A;  4HAR A;  3OA5 A;  3RM8 A;  4FAP A;  4Z2L A;  2XP4 A;  3B9E A;  4ODQ A;  4ZS6 A;  3VAW A;  1ZCN A;  1HKI A;  4LAW A;  3WD3 A;  1O6I A;  4TW8 A;  2KO7 A;  4LAX A;  3CH9 A;  2G41 A;  3RM9 A;  4MGV A;  3RGC A;  4DRO A;  1PBK A;  1ZBC A;  2L2S A;  1D7J A;  1F8A B;  1JND A;  1NWR A;  2KFW A;  4U86 A;  4ZPT R;  2OFN A;  2AWG A;  2A3C A;  4U84 A;  5GPR A;  4QT3 A;  5J6E A;  3IHZ A;  4GGQ A;  1ITX A;  2PPP A;  1ROT A;  4IPX A;  3RFW A;  4Z2K A;  3WH0 A;  1OWQ A;  1NH6 A;  1CTN A;  2F4E A;  2OLH A;  3B8S A;  2DSV A;  3WL1 A;  2VCD A;  4BF8 A;  4IQ2 A;  3TC5 A;  4ODM A;  4S3K A;  4ODP A;  2MLY A;  3I6C A;  3UI4 A;  1EIB A;  1X6L A;  4R5E A;  3O5D A;  1FKL A;  4KR0 B;  4W9O A;  1H0I A;  2ZR4 A;  3O5M A;  3O5J A;  5HUA A;  4MTV A;  2RUC A;  3KAB A;  5GPG A;  5JH8 A;  2VN1 A;  3JXV A;  1A7X A;  1P5Q A;  4J4O A;  3ARW A;  2LGO A;  4L3N A;  1ZK6 A;  2MLX A;  2PV3 A;  2UZ5 A;  3O5K A;  1ZBV A;  1Q6U A;  3ODK A;  4LAY A;  3EY6 A;  2YBT A;  4TNS A;  1NMW A;  3ARU A;  3UI6 A;  2ZR5 A;  1ZU8 A;  4DT4 A;  2DSU A;  2XP7 A;  2PBC A;  2B5U B;  3UQB A;  1TFV A;  4JFK A;  5DIU A;  3NRK A;  3WIJ A;  1WB0 A;  4ODK A;  2A3E A;  4GIV A;  1D7I A;  4WKF A;  1KT1 A;  4IT6 A;  4N19 A;  1H0G A;  1Y0O A;  4O2T A;  3O5Q A;  4TW7 A;  1WAW A;  3AQU A;  4W5U A;  2ETN A;  4LAV A;  1FKI A;  2D9F A;  4WKH A;  1T11 A;  3PRB A;  1YAT A;  5HKG A;  2XP6 A;  1NSG A;  3W4R A;  3EIP A;  4AY1 A;  3CZ8 A;  4DRI A;  1VF8 A;  2K8I A;  5HW8 A;  3KAG A;  1FKD A;  2O92 A;  3WD4 A;  4NZC A;  4DH0 A;  4C02 B;  2A3A A;  1HKM A;  1QPL A;  4XAK A;  3NTP A;  1EDQ A;  3TDB A;  5DIT A;  2KE0 A;  1FKJ A;  4ZPW R;  1FKS A;  3UQI A;  1D6O A;  4NNR A;  1B6C A;  4MNJ A;  1J6Y A;  4DIP A;  3CHC A;  4PTM A;  1W26 A;  2YBU A;  4L72 B;  4U85 A;  4MAV A;  4MSP A;  5D75 A;  1EYM A;  4ODN A;  2AOS A;  1LJY A;  2PN0 A;  1J4H A;  1E6Z A;  2A3B A;  1LG2 A;  3KAH A;  3O5E A;  3O5P A;  3RME A;  2Y78 A;  2KI3 A;  4MNM A;  3ARX A;  3AS3 A;  3IK8 A;  1X6N A;  1E6N A;  1E44 A;  1KT0 A;  3B9D A;  3CHF A;  3AS2 A;  2PPN A;  1JNT A;  1FJD A;  2M2A A;  2MNT A;  2N87 A;  3CGM A;  4UDM A;  2M1I A;  3CHD A;  2O9O A;  1RD6 A;  2PI6 A;  1QZ2 A;  3O5L A;  1ZBK A;  3B7X A;  3AS0 A;  1KFW A;  5DO2 A;  4JFM A;  2WLZ A;  3IKD A;  3ARR A;  2RUR A;  4NSB A;  1JNE A;  1D2K A;  4WJX A;  5DF0 A;  1GUV A;  3WD0 A;  4FN2 A;  3UI5 A;  1LQ0 A;  4WIW A;  5HW7 A;  1WNO A;  2DT0 A;  4TX0 A;  4TYO A;  2RUD A;  4JFI A;  4DRM A;  1JNS A;  4P8U A;  3PRA A;  2DSW A;  2FKE A;  2EUL A;  1W1P A;  1HJX A;  3O5G A;  2G8Z A;  3KAI A;  2ZQU A;  2QF8 A;  3WQW A;  4ODO A;  2MPH A;  2PPO A;  2P4V A;  2DSZ A;  2XP5 A;  1XHG A;  2XP9 A;  1FFQ A;  1GRJ A;  3ART A;  1EQ3 A;  4W9P A;  3GPK A;  4S3J A;  3PA7 A;  1QPF A;  2IF4 A;  1NWS A;  1FD9 A;  2F21 A;  1W9U A;  2RQS A;  3AS1 A;  4DZ3 A;  1ROU A;  1JVW A;  4Z2J A;  1Q6H A;  1LL6 A;  3WD1 A;  2ZQV A;  2M08 A;  4JFL A;  2DG9 A;  4G2P A;  3O5O A;  1M5Y A;  2KGJ A;  4R0X A;  3H9R B;  1LL7 A;  1E15 A;  2MF9 A;  3MDY B;  3GTY X;  3KCE A;  2RSE A;  4Z2I A;  2PV2 A;  1Q1C A;  3ARS A;  1W9V A;  4P8X A;  3UQA A;  3FY1 A;  3WL0 A;  4ML4 A;  1FKG A;  1NWT A;  2B31 A;  4DRH A;  1UR8 A;  4MNL A;  4P8W A;  5HWC A;  4QZV B;  4Q7N A;  4DRJ A;  4DRK A;  3PRD A;  4Z2G A;  2F2D A;  1FAP A;  4Q22 A;  2XP8 A;  2F23 A;  3WQV A;  3PR9 A;  4WKA A;  3ALG A;  3ALF A;  1GOI A;  4DWS B;  2LJ4 A;  3LUO A;  4W9Q A;  3NI6 A;  1W1Y A;  1NMV A;  1U79 A;  4DWS A;  2DT2 A;  2ITK A;  5DEZ A;  4DWS D;  1J4R A;  3UF8 A;  1FKT A;  1XRV A;  4ODL A;  3JYM A;  2DG4 A;  4P8V A;  1UR9 A;  5HTG A;  1R9H A;  2WLY A;  3QOK A;  2XPA A;  1E6P A;  2FAP A;  1YW5 A;  1JCH B;  3CHE A;  2XP3 A;  1FFR A;  3KAD A;  5DIV A;  1ZB5 A;  4DZ2 A;  2DPE A;  1W1T A;  1N1A A;  3TCZ A;  4IT4 A;  4G50 A;  4MPK A;  1HKK A;  4HBO A;  1W1V A;  1HXV A;  4HBE A;  2DT3 A;  2WM0 A;  1SR0 A;  5GQB A;  1OGG A;  2DG3 A;  3G6M A;  3OOB A;  4KQZ A;  1ZL1 A;  1FKB A;  1PIN A;  3FXY A;  3ARV A;  3ARO A;  2KR7 A;  1J4I A;  3KAF A;  1Q6I A;  5HW6 A;  4MNK A;  4Z2H A;  5HT1 A;  5BXJ A;  2WK2 A;  3ARY A;  1W9P A;  4DRQ A;  1E9L A;  1F40 A;  1BL4 A;  1HJV A;  3BMB A;  4JFJ A;  1K9T A;  2JZV A;  4DRN A;  5B8I C;  1TCO C;  3O5I A;  4URI A;  1D7H A;  4JYS A;  1FKR A;  4DWS C;  1OGB A;  2ESC A;  3WKZ A;  1FKK A;  5I98 A;  3GU0 A;  3JYJ A;  4QIB A;  4IQC A;  2DT1 A;  3KAC A;  2XPB A;  2RUQ A;  3CGN A;  2LPV A;  1FKH A;  1L1P A;  4TW6 A;  3O5R A;  1ZBW A;  1SYT A;  4WK9 A;  1LG1 A;  3BXW A;  1LL4 A;  2FDM A;  2ZQS A;  2ZR6 A;  3G6L A;  1FKF A;  3O5F A;  3ARQ A;  4ODR A;  3B9A A;  4LGX A;  1C9H A;  1BKF A;  5HBF A;  4J4N A;  1GPF A;  1HJW A;  3RM4 A;  4DRP A;  2ZQT A;  2IUZ A;  3FAP A;  3KZ7 A;  1IX5 A;  4QT2 A; 
#chains in the Genus database with same CATH homology
 3ARP A;  2MLZ A;  3WD2 A;  1EHN A;  3ARZ A;  4ITZ A;  4ZPV R;  2LKN A;  3IKG A;  1NWU A;  1HKJ A;  5HWB A;  2Q5A A;  2PV1 A;  1E6R A;  4HAR A;  3OA5 A;  3RM8 A;  4FAP A;  4Z2L A;  2XP4 A;  3B9E A;  4ODQ A;  4ZS6 A;  3VAW A;  1ZCN A;  1HKI A;  4LAW A;  3WD3 A;  1O6I A;  4TW8 A;  2KO7 A;  4LAX A;  3CH9 A;  2G41 A;  3RM9 A;  4MGV A;  3RGC A;  4DRO A;  1PBK A;  1ZBC A;  2L2S A;  1D7J A;  1F8A B;  1JND A;  1NWR A;  2KFW A;  4U86 A;  4ZPT R;  2OFN A;  2AWG A;  2A3C A;  4U84 A;  5GPR A;  4QT3 A;  5J6E A;  3IHZ A;  4GGQ A;  1ITX A;  2PPP A;  1ROT A;  4IPX A;  3RFW A;  4Z2K A;  3WH0 A;  1OWQ A;  1NH6 A;  1CTN A;  2F4E A;  2OLH A;  3B8S A;  2DSV A;  3WL1 A;  2VCD A;  4BF8 A;  4IQ2 A;  3TC5 A;  4ODM A;  4S3K A;  4ODP A;  2MLY A;  3I6C A;  3UI4 A;  1EIB A;  1X6L A;  4R5E A;  3O5D A;  1FKL A;  4KR0 B;  4W9O A;  1H0I A;  2ZR4 A;  3O5M A;  3O5J A;  5HUA A;  4MTV A;  2RUC A;  3KAB A;  5GPG A;  5JH8 A;  2VN1 A;  3JXV A;  1A7X A;  1P5Q A;  4J4O A;  3ARW A;  2LGO A;  4L3N A;  1ZK6 A;  2MLX A;  2PV3 A;  2UZ5 A;  3O5K A;  1ZBV A;  1Q6U A;  3ODK A;  4LAY A;  3EY6 A;  2YBT A;  4TNS A;  1NMW A;  3ARU A;  3UI6 A;  2ZR5 A;  1ZU8 A;  4DT4 A;  2DSU A;  2XP7 A;  2PBC A;  3UQB A;  1TFV A;  4JFK A;  5DIU A;  3NRK A;  3WIJ A;  1WB0 A;  4ODK A;  2A3E A;  4GIV A;  1D7I A;  4WKF A;  1KT1 A;  4IT6 A;  4N19 A;  1H0G A;  1Y0O A;  4O2T A;  3O5Q A;  4TW7 A;  1WAW A;  3AQU A;  4W5U A;  4LAV A;  1FKI A;  2D9F A;  4WKH A;  1T11 A;  3PRB A;  1YAT A;  5HKG A;  2XP6 A;  1NSG A;  3W4R A;  4AY1 A;  3CZ8 A;  4DRI A;  1VF8 A;  2K8I A;  5HW8 A;  3KAG A;  1FKD A;  2O92 A;  3WD4 A;  4NZC A;  4DH0 A;  4C02 B;  2A3A A;  1HKM A;  1QPL A;  4XAK A;  3NTP A;  1EDQ A;  3TDB A;  5DIT A;  2KE0 A;  1FKJ A;  4ZPW R;  1FKS A;  3UQI A;  1D6O A;  4NNR A;  1B6C A;  4MNJ A;  1J6Y A;  4DIP A;  3CHC A;  4PTM A;  1W26 A;  2YBU A;  4L72 B;  4U85 A;  4MAV A;  4MSP A;  5D75 A;  1EYM A;  4ODN A;  2AOS A;  1LJY A;  1J4H A;  1E6Z A;  2A3B A;  1LG2 A;  3KAH A;  3O5E A;  3O5P A;  3RME A;  2Y78 A;  2KI3 A;  4MNM A;  3ARX A;  3AS3 A;  3IK8 A;  1X6N A;  1E6N A;  1KT0 A;  3B9D A;  3CHF A;  3AS2 A;  2PPN A;  1JNT A;  1FJD A;  2M2A A;  2MNT A;  2N87 A;  3CGM A;  2M1I A;  3CHD A;  2O9O A;  1RD6 A;  2PI6 A;  1QZ2 A;  3O5L A;  1ZBK A;  3B7X A;  3AS0 A;  1KFW A;  5DO2 A;  4JFM A;  2WLZ A;  3IKD A;  3ARR A;  2RUR A;  4NSB A;  1JNE A;  1D2K A;  4WJX A;  5DF0 A;  1GUV A;  3WD0 A;  4FN2 A;  3UI5 A;  1LQ0 A;  4WIW A;  5HW7 A;  1WNO A;  2DT0 A;  4TX0 A;  4TYO A;  2RUD A;  4JFI A;  4DRM A;  1JNS A;  4P8U A;  3PRA A;  2DSW A;  2FKE A;  1W1P A;  1HJX A;  3O5G A;  2G8Z A;  3KAI A;  2ZQU A;  2QF8 A;  3WQW A;  4ODO A;  2MPH A;  2PPO A;  2DSZ A;  2XP5 A;  1XHG A;  2XP9 A;  1FFQ A;  3ART A;  1EQ3 A;  4W9P A;  3GPK A;  4S3J A;  3PA7 A;  1QPF A;  2IF4 A;  1NWS A;  1FD9 A;  2F21 A;  1W9U A;  2RQS A;  3AS1 A;  4DZ3 A;  1ROU A;  1JVW A;  4Z2J A;  1Q6H A;  1LL6 A;  3WD1 A;  2ZQV A;  2M08 A;  4JFL A;  2DG9 A;  4G2P A;  3O5O A;  1M5Y A;  2KGJ A;  4R0X A;  3H9R B;  1LL7 A;  1E15 A;  2MF9 A;  3MDY B;  3KCE A;  2RSE A;  4Z2I A;  2PV2 A;  1Q1C A;  3ARS A;  1W9V A;  4P8X A;  3UQA A;  3FY1 A;  3WL0 A;  4ML4 A;  1FKG A;  1NWT A;  2B31 A;  4DRH A;  1UR8 A;  4MNL A;  4P8W A;  5HWC A;  4QZV B;  4Q7N A;  4DRJ A;  4DRK A;  3PRD A;  4Z2G A;  2F2D A;  1FAP A;  4Q22 A;  2XP8 A;  3WQV A;  3PR9 A;  4WKA A;  3ALG A;  3ALF A;  1GOI A;  4DWS B;  2LJ4 A;  3LUO A;  4W9Q A;  3NI6 A;  1W1Y A;  1NMV A;  1U79 A;  4DWS A;  2DT2 A;  2ITK A;  5DEZ A;  4DWS D;  1J4R A;  3UF8 A;  1FKT A;  1XRV A;  4ODL A;  3JYM A;  2DG4 A;  4P8V A;  1UR9 A;  5HTG A;  1R9H A;  2WLY A;  3QOK A;  2XPA A;  1E6P A;  2FAP A;  1YW5 A;  3CHE A;  2XP3 A;  1FFR A;  3KAD A;  5DIV A;  1ZB5 A;  4DZ2 A;  2DPE A;  1W1T A;  1N1A A;  3TCZ A;  4IT4 A;  4G50 A;  4MPK A;  1HKK A;  4HBO A;  1W1V A;  1HXV A;  4HBE A;  2DT3 A;  2WM0 A;  1SR0 A;  5GQB A;  1OGG A;  2DG3 A;  3G6M A;  3OOB A;  4KQZ A;  1ZL1 A;  1FKB A;  1PIN A;  3FXY A;  3ARV A;  3ARO A;  2KR7 A;  1J4I A;  3KAF A;  1Q6I A;  5HW6 A;  4MNK A;  4Z2H A;  5HT1 A;  5BXJ A;  2WK2 A;  3ARY A;  1W9P A;  4DRQ A;  1E9L A;  1F40 A;  1BL4 A;  1HJV A;  4JFJ A;  1K9T A;  2JZV A;  4DRN A;  5B8I C;  1TCO C;  3O5I A;  4URI A;  1D7H A;  4JYS A;  1FKR A;  4DWS C;  1OGB A;  2ESC A;  3WKZ A;  1FKK A;  5I98 A;  3JYJ A;  4QIB A;  4IQC A;  2DT1 A;  3KAC A;  2XPB A;  2RUQ A;  3CGN A;  2LPV A;  1FKH A;  1L1P A;  4TW6 A;  3O5R A;  1ZBW A;  1SYT A;  4WK9 A;  1LG1 A;  3BXW A;  1LL4 A;  2FDM A;  2ZQS A;  2ZR6 A;  3G6L A;  1FKF A;  3O5F A;  3ARQ A;  4ODR A;  3B9A A;  4LGX A;  1C9H A;  1BKF A;  5HBF A;  4J4N A;  1GPF A;  1HJW A;  3RM4 A;  4DRP A;  2ZQT A;  2IUZ A;  3FAP A;  3KZ7 A;  1IX5 A;  4QT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...