3O5MA

Fk1 domain mutant a19t of fkbp51, crystal form ii
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
127
structure length
127
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5mA00
1BKFA 2KGJA 2KO7A 1FKIA 1FKJA 2DG3A 2MLYA 1HXVA 4DT4A 3UF8A 2RSEA 5BXJA 3O5JA 1F8AB 2PV1A 3CGMA 5DIUA 2IF4A 4C02B 1Q6IA 4QT3A 2RUQA 3KCEA 2LKNA 2MLZA 2RUDA 3O5OA 4JFIA 4JFMA 3PRDA 4LAXA 2LJ4A 4DRMA 5HUAA 4DIPA 1F40A 2ZR4A 1U79A 2VCDA 4W9OA 5HW7A 2DG9A 4ODKA 2FAPA 4TNSA 1Q1CA 3KAFA 3O5RA 4GGQA 4U84A 1T11A 4DRKA 1A7XA 4DZ2A 4DH0A 3WH0A 4DZ3A 3ODKA 3UI6A 3I6CA 5D75A 5HW8A 1ZK6A 2RURA 1J4IA 3O5KA 2KFWA 3KACA 1FJDA 1KT0A 2XP6A 2XP5A 4DROA 2XP3A 3O5GA 4DRJA 1D7HA 2RQSA 3TDBA 1FKSA 2XP8A 1JVWA 3TC5A 1W26A 3KZ7A 1PBKA 1NMWA 5DIVA 2FKEA 1FD9A 1ROUA 3O5DA 2JZVA 1FKLA 2F21A 2MLXA 1ROTA 1YATA 2PPOA 3CGNA 3KAIA 4DRIA 1B6CA 2M08A 2PV3A 4TW7A 4JFJA 3MDYB 3UQAA 2Q5AA 2L2SA 3FAPA 1JNSA 1N1AA 3B7XA 1M5YA 2D9FA 1FKFA 1D7JA 2ZQVA 2Y78A 2ZR5A 4JYSA 1BL4A 1YW5A 3KAHA 4ODLA 4QIBA 4R0XA 4FAPA 3UI4A 2XPAA 2N87A 4J4OA 3LUOA 4ITZA 4ODMA 1EQ3A 4IQ2A 2XP9A 4ODNA 3RFWA 5HKGA 3O5MA 3O5IA 3JYMA 4W9PA 4DRNA 1Q6HA 2KE0A 5I98A 1ZCNA 4G2PA 3UQIA 1KT1A 2DG4A 1Q6UA 4LAWA 3VAWA 2AWGA 3JXVA 1QZ2A 1FKRA 3NRKA 2XPBA 1FKDA 3O5EA 1C9HA 4MGVA 5HTGA 5J6EA 1J4HA 1FAPA 3KAGA 2PPPA 4G50A 4ODOA 2ZR6A 4QT2A 1EYMA 2ZQUA 2PV2A 3JYJA 1FKHA 2F2DA 2VN1A 4BF8A 4ODPA 1D6OA 1QPLA 5HT1A 3RGCA 4DRHA 3TCZA 2MF9A 3IHZA 4J4NA 4MSPA 3UI5A 5B8IC 3IK8A 4TYOA 1NSGA 3KABA 4GIVA 4JFLA 2M2AA 4LAYA 3GPKA 2LGOA 5GPGA 2MNTA 4ODQA 5DITA 2F4EA 4NNRA 4W9QA 1Y0OA 2RUCA 4TX0A 2ITKA 4IPXA 1JNTA 2PBCA 1PINA 3O5LA 3UQBA 2MPHA 3NI6A 3O5QA 1FKBA 3PA7A 1NMVA 1FKTA 3OOBA 4FN2A 4N19A 3EY6A 2ZQSA 2OFNA 4TW8A 4IQCA 1FKGA 1QPFA 4ODRA 4DRPA 4LAVA 4U85A 2KR7A 3KADA 4JFKA 1D7IA 4O2TA 5HW6A 3O5FA 1J6YA 2XP4A 5HWBA 1R9HA 1FKKA 3H9RB 1P5QA 2UZ5A 2KI3A 5HWCA 3PRBA 1TCOC 3IKDA 1L1PA 2ZQTA 2M1IA 4U86A 2K8IA 2LPVA 3IKGA 3O5PA 3NTPA 2PPNA 4TW6A 4DRQA 1J4RA 2XP7A
chains in the Genus database with same CATH superfamily
1BKFA 2KGJA 3PR9A 1XRVA 1ITXA 3BXWA 2DG3A 4LGXA 2WK2A 3O5JA 3CGMA 2PI6A 1HJWA 2RUDA 3B8SA 2LJ4A 4DRMA 5HUAA 4DIPA 1F40A 2VCDA 1OGGA 1NH6A 2O9OA 4ODKA 5HBFA 2FAPA 1EHNA 4ZS6A 3KAFA 4GGQA 4Q22A 2AOSA 4NSBA 4DH0A 4DZ3A 1WAWA 3ODKA 1E15A 3UI6A 5HW8A 1W9PA 2KFWA 3RM4A 4Z2IA 2XP6A 2XP5A 3TDBA 1WB0A 1JVWA 2XP8A 5DEZA 2FKEA 3O5DA 1ROTA 2PPOA 4DRIA 1B6CA 4DWSB 2Q5AA 2L2SA 2PN0A 3B7XA 1FKFA 1D7JA 2Y78A 1GUVA 4J4OA 2DSVA 4ODMA 3ARYA 2XP9A 3RFWA 4DRNA 1HKJA 1Q6HA 4IT4A 4WKAA 5I98A 1HJXA 1ZCNA 3UQIA 4Z2HA 2AWGA 1FKRA 1FAPA 4Z2LA 3KAGA 4G50A 1W9VA 4QT2A 1EYMA 2ZQUA 1ZU8A 1FKHA 4MNLA 4ODPA 5GQBA 4DRHA 1W1VA 3TCZA 2MF9A 3AS1A 3WD0A 1UR9A 4GIVA 4WIWA 2PBCA 3O5LA 3NI6A 3O5QA 3PA7A 4FN2A 1EIBA 4U85A 3KADA 4JFKA 4O2TA 3CH9A 1J6YA 5HWBA 2A3BA 3H9RB 2UZ5A 2KI3A 1NWRA 4QZVB 1TCOC 1L1PA 4ML4A 3WL0A 3WD4A 1SR0A 3O5PA 4DZ2A 1JCHB 1JNDA 3WKZA 3FXYA 3RMEA 3WL1A 4MNKA 1O6IA 1FKJA 2FDMA 3UF8A 5BXJA 5DIUA 4C02B 1Q6IA 2LKNA 3PRDA 3W4RA 3B9AA 2ZR4A 5HW7A 1LG2A 1EDQA 3QOKA 1Q1CA 4Z2JA 4U84A 1JNEA 5DO2A 2B31A 3WH0A 3ARWA 5D75A 4WJXA 3B9EA 3O5GA 4DRJA 1E44A 1HKKA 1OWQA 1GOIA 3KAIA 2P4VA 4URIA 4MPKA 1W9UA 2WLYA 4JFJA 4IT6A 2ZQVA 2WLZA 1BL4A 1YW5A 2QF8A 3ARZA 3UI4A 2XPAA 2N87A 4ZPVR 4ITZA 4IQ2A 5HKGA 1GRJA 3O5MA 3O5IA 3JYMA 4W9PA 4Z2KA 2KE0A 4KQZA 1W1YA 4P8UA 1HKIA 2A3EA 4DWSA 4LAWA 2DT0A 2DT2A 3AS2A 3NRKA 1FKDA 1J4HA 4ODOA 2PPPA 2PV2A 4WKHA 2F2DA 4BF8A 3ARSA 3IHZA 4J4NA 5B8IC 3UI5A 1HKMA 3IK8A 4TYOA 3KABA 3GPKA 2LGOA 5DITA 4W9QA 2RUCA 2ITKA 1PINA 1LJYA 1HJVA 1E6NA 3OOBA 4TW8A 1FKGA 1QPFA 1ZBCA 5HW6A 1ZB5A 2XP4A 1FKKA 3ARTA 4W5UA 1SYTA 3IKDA 3EIPA 2ZQTA 3AROA 4U86A 1E9LA 2DSZA 4TW6A 4DRQA 2XP7A 4Z2GA 2KO7A 1OGBA 4MAVA 1HXVA 4DT4A 1ZBKA 2RSEA 1F8AB 2PV1A 3ARXA 2IF4A 4P8VA 4QT3A 2RUQA 3O5OA 4JFIA 4LAXA 1NWSA 1U79A 4W9OA 4P8WA 2DG9A 4TNSA 1ZBVA 2B5UB 1E6ZA 2DPEA 3G6MA 1LL7A 1UR8A 3BMBA 2RURA 1J4IA 3O5KA 4DROA 1WNOA 2XP3A 1D7HA 3ARVA 3FY1A 1FD9A 1ROUA 1FKLA 2F21A 2DSWA 1YATA 3CGNA 4KR0B 4TW7A 1JNSA 1N1AA 1M5YA 2D9FA 3ARQA 2ZR5A 4ZPTR 1W1PA 3KAHA 4QIBA 4UDMA 4FAPA 1X6NA 1IX5A 3LUOA 3GU0A 3ALFA 4ODNA 3CHEA 3ALGA 4XAKA 1RD6A 3JXVA 1QZ2A 2XPBA 4MGVA 5HTGA 1H0IA 1ZBWA 3JYJA 2VN1A 1QPLA 3RGCA 4L3NA 2A3AA 1NSGA 1W1TA 4JFLA 2M2AA 2DSUA 4LAYA 3CHCA 4Q7NA 2MNTA 1LQ0A 2F4EA 2IUZA 4NNRA 1Y0OA 3RM9A 1JNTA 3UQBA 4DWSC 2MPHA 1GPFA 3ARRA 2F23A 2YBUA 2OFNA 3WQWA 4IQCA 4DRPA 4ODRA 1VF8A 4R5EA 4LAVA 1D7IA 3CHFA 4DWSD 1R9HA 3WD3A 5HWCA 3PRBA 1TFVA 3WD2A 1NWUA 4MTVA 1X6LA 1J4RA 1FKIA 2MLYA 3OA5A 4NZCA 3ARPA 3KCEA 2MLZA 4JFMA 1ZL1A 2G8ZA 4HARA 4MNJA 3O5RA 2ESCA 3AS0A 1T11A 4DRKA 1A7XA 2OLHA 3I6CA 3RM8A 1ZK6A 3KACA 1FJDA 1KT0A 3AS3A 2RQSA 3TC5A 1FKSA 1KFWA 3CZ8A 1W26A 3KZ7A 1PBKA 1NMWA 5DIVA 3CHDA 2JZVA 4HBEA 2MLXA 1CTNA 3G6LA 1LL4A 1LG1A 1LL6A 2M08A 2PV3A 1FFQA 3MDYB 3UQAA 3FAPA 4AY1A 4JYSA 4ODLA 4R0XA 5DF0A 5JH8A 3GTYX 2YBTA 1EQ3A 3WQVA 4G2PA 2O92A 1KT1A 2DG4A 2EULA 1Q6UA 3WIJA 3VAWA 2DT3A 3O5EA 1C9HA 5J6EA 2ETNA 4ZPWR 2ZR6A 2A3CA 1K9TA 1D2KA 4L72B 1D6OA 5HT1A 4HBOA 2G41A 1XHGA 3ARUA 3WD1A 4MSPA 4P8XA 2DT1A 4WKFA 1E6RA 5GPGA 1E6PA 4ODQA 4TX0A 4IPXA 4S3JA 1FKBA 1NMVA 3AQUA 1FKTA 4MNMA 4N19A 3B9DA 3EY6A 5GPRA 2ZQSA 4WK9A 2KR7A 3O5FA 1FFRA 1P5QA 1H0GA 4S3KA 4PTMA 2WM0A 2M1IA 2K8IA 3PRAA 2LPVA 3IKGA 3NTPA 2PPNA 1NWTA
chains in the Genus database with same CATH topology
1BKFA 2KGJA 3PR9A 1XRVA 1ITXA 3BXWA 2DG3A 4LGXA 2WK2A 3O5JA 3CGMA 2PI6A 1HJWA 2RUDA 3B8SA 2LJ4A 4DRMA 5HUAA 4DIPA 1F40A 2VCDA 1OGGA 1NH6A 2O9OA 4ODKA 5HBFA 2FAPA 1EHNA 4ZS6A 3KAFA 4GGQA 4Q22A 2AOSA 4NSBA 4DH0A 4DZ3A 1WAWA 3ODKA 1E15A 3UI6A 5HW8A 1W9PA 2KFWA 3RM4A 4Z2IA 2XP6A 2XP5A 3TDBA 1WB0A 1JVWA 2XP8A 5DEZA 2FKEA 3O5DA 1ROTA 2PPOA 4DRIA 1B6CA 4DWSB 2Q5AA 2L2SA 3B7XA 1FKFA 1D7JA 2Y78A 1GUVA 4J4OA 2DSVA 4ODMA 3ARYA 2XP9A 3RFWA 4DRNA 1HKJA 1Q6HA 4IT4A 4WKAA 5I98A 1HJXA 1ZCNA 3UQIA 4Z2HA 2AWGA 1FKRA 1FAPA 4Z2LA 3KAGA 4G50A 1W9VA 4QT2A 1EYMA 2ZQUA 1ZU8A 1FKHA 4MNLA 4ODPA 5GQBA 4DRHA 1W1VA 3TCZA 2MF9A 3AS1A 3WD0A 1UR9A 4GIVA 4WIWA 2PBCA 3O5LA 3NI6A 3O5QA 3PA7A 4FN2A 1EIBA 4U85A 3KADA 4JFKA 4O2TA 3CH9A 1J6YA 5HWBA 2A3BA 3H9RB 2UZ5A 2KI3A 1NWRA 4QZVB 1TCOC 1L1PA 4ML4A 3WL0A 3WD4A 1SR0A 3O5PA 4DZ2A 1JNDA 3WKZA 3FXYA 3RMEA 3WL1A 4MNKA 1O6IA 1FKJA 2FDMA 3UF8A 5BXJA 5DIUA 4C02B 1Q6IA 2LKNA 3PRDA 3W4RA 3B9AA 2ZR4A 5HW7A 1LG2A 1EDQA 3QOKA 1Q1CA 4Z2JA 4U84A 1JNEA 5DO2A 2B31A 3WH0A 3ARWA 5D75A 4WJXA 3B9EA 3O5GA 4DRJA 1HKKA 1OWQA 1GOIA 3KAIA 4URIA 4MPKA 1W9UA 2WLYA 4JFJA 4IT6A 2ZQVA 2WLZA 1BL4A 1YW5A 2QF8A 3ARZA 3UI4A 2XPAA 2N87A 4ZPVR 4ITZA 4IQ2A 5HKGA 3O5MA 3O5IA 3JYMA 4W9PA 4Z2KA 2KE0A 4KQZA 1W1YA 4P8UA 1HKIA 2A3EA 4DWSA 4LAWA 2DT0A 2DT2A 3AS2A 3NRKA 1FKDA 1J4HA 4ODOA 2PPPA 2PV2A 4WKHA 2F2DA 4BF8A 3ARSA 3IHZA 4J4NA 5B8IC 3UI5A 1HKMA 3IK8A 4TYOA 3KABA 3GPKA 2LGOA 5DITA 4W9QA 2RUCA 2ITKA 1PINA 1LJYA 1HJVA 1E6NA 3OOBA 4TW8A 1FKGA 1QPFA 1ZBCA 5HW6A 1ZB5A 2XP4A 1FKKA 3ARTA 4W5UA 1SYTA 3IKDA 2ZQTA 3AROA 4U86A 1E9LA 2DSZA 4TW6A 4DRQA 2XP7A 4Z2GA 2KO7A 1OGBA 4MAVA 1HXVA 4DT4A 1ZBKA 2RSEA 1F8AB 2PV1A 3ARXA 2IF4A 4P8VA 4QT3A 2RUQA 3O5OA 4JFIA 4LAXA 1NWSA 1U79A 4W9OA 4P8WA 2DG9A 4TNSA 1ZBVA 1E6ZA 2DPEA 3G6MA 1LL7A 1UR8A 2RURA 1J4IA 3O5KA 4DROA 1WNOA 2XP3A 1D7HA 3ARVA 3FY1A 1FD9A 1ROUA 1FKLA 2F21A 2DSWA 1YATA 3CGNA 4KR0B 4TW7A 1JNSA 1N1AA 1M5YA 2D9FA 3ARQA 2ZR5A 4ZPTR 1W1PA 3KAHA 4QIBA 1IX5A 4FAPA 1X6NA 3LUOA 3ALFA 4ODNA 3CHEA 3ALGA 4XAKA 1RD6A 3JXVA 1QZ2A 2XPBA 4MGVA 5HTGA 1H0IA 1ZBWA 3JYJA 2VN1A 1QPLA 3RGCA 4L3NA 2A3AA 1NSGA 1W1TA 4JFLA 2M2AA 2DSUA 4LAYA 3CHCA 4Q7NA 2MNTA 1LQ0A 2F4EA 2IUZA 4NNRA 1Y0OA 3RM9A 1JNTA 3UQBA 4DWSC 2MPHA 1GPFA 3ARRA 2YBUA 2OFNA 3WQWA 4IQCA 4DRPA 4ODRA 1VF8A 4R5EA 4LAVA 1D7IA 3CHFA 4DWSD 1R9HA 3WD3A 5HWCA 3PRBA 1TFVA 3WD2A 1NWUA 4MTVA 1X6LA 1J4RA 1FKIA 2MLYA 3OA5A 4NZCA 3ARPA 3KCEA 2MLZA 4JFMA 1ZL1A 2G8ZA 4HARA 4MNJA 3O5RA 2ESCA 3AS0A 1T11A 4DRKA 1A7XA 2OLHA 3I6CA 3RM8A 1ZK6A 3KACA 1FJDA 1KT0A 3AS3A 2RQSA 3TC5A 1FKSA 1KFWA 3CZ8A 1W26A 3KZ7A 1PBKA 1NMWA 5DIVA 3CHDA 2JZVA 4HBEA 2MLXA 1CTNA 3G6LA 1LL4A 1LG1A 1LL6A 2M08A 2PV3A 1FFQA 3MDYB 3UQAA 3FAPA 4AY1A 4JYSA 4ODLA 4R0XA 5DF0A 5JH8A 2YBTA 1EQ3A 3WQVA 4G2PA 2O92A 1KT1A 2DG4A 1Q6UA 3WIJA 3VAWA 2DT3A 3O5EA 1C9HA 5J6EA 4ZPWR 2ZR6A 2A3CA 1K9TA 1D2KA 4L72B 1D6OA 5HT1A 4HBOA 2G41A 1XHGA 3ARUA 3WD1A 4MSPA 4P8XA 2DT1A 4WKFA 1E6RA 5GPGA 1E6PA 4ODQA 4TX0A 4IPXA 4S3JA 1FKBA 1NMVA 3AQUA 1FKTA 4MNMA 4N19A 3B9DA 3EY6A 5GPRA 2ZQSA 4WK9A 2KR7A 3O5FA 1FFRA 1P5QA 1H0GA 4S3KA 4PTMA 2WM0A 2M1IA 2K8IA 3PRAA 2LPVA 3IKGA 3NTPA 2PPNA 1NWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BKF A;  2KGJ A;  2KO7 A;  1FKI A;  1FKJ A;  2DG3 A;  2MLY A;  1HXV A;  4DT4 A;  3UF8 A;  2RSE A;  5BXJ A;  3O5J A;  1F8A B;  2PV1 A;  3CGM A;  5DIU A;  2IF4 A;  4C02 B;  1Q6I A;  4QT3 A;  2RUQ A;  3KCE A;  2LKN A;  2MLZ A;  2RUD A;  3O5O A;  4JFI A;  4JFM A;  3PRD A;  4LAX A;  2LJ4 A;  4DRM A;  5HUA A;  4DIP A;  1F40 A;  2ZR4 A;  1U79 A;  2VCD A;  4W9O A;  5HW7 A;  2DG9 A;  4ODK A;  2FAP A;  4TNS A;  1Q1C A;  3KAF A;  3O5R A;  4GGQ A;  4U84 A;  1T11 A;  4DRK A;  1A7X A;  4DZ2 A;  4DH0 A;  3WH0 A;  4DZ3 A;  3ODK A;  3UI6 A;  3I6C A;  5D75 A;  5HW8 A;  1ZK6 A;  2RUR A;  1J4I A;  3O5K A;  2KFW A;  3KAC A;  1FJD A;  1KT0 A;  2XP6 A;  2XP5 A;  4DRO A;  2XP3 A;  3O5G A;  4DRJ A;  1D7H A;  2RQS A;  3TDB A;  1FKS A;  2XP8 A;  1JVW A;  3TC5 A;  1W26 A;  3KZ7 A;  1PBK A;  1NMW A;  5DIV A;  2FKE A;  1FD9 A;  1ROU A;  3O5D A;  2JZV A;  1FKL A;  2F21 A;  2MLX A;  1ROT A;  1YAT A;  2PPO A;  3CGN A;  3KAI A;  4DRI A;  1B6C A;  2M08 A;  2PV3 A;  4TW7 A;  4JFJ A;  3MDY B;  3UQA A;  2Q5A A;  2L2S A;  3FAP A;  1JNS A;  1N1A A;  3B7X A;  1M5Y A;  2D9F A;  1FKF A;  1D7J A;  2ZQV A;  2Y78 A;  2ZR5 A;  4JYS A;  1BL4 A;  1YW5 A;  3KAH A;  4ODL A;  4QIB A;  4R0X A;  4FAP A;  3UI4 A;  2XPA A;  2N87 A;  4J4O A;  3LUO A;  4ITZ A;  4ODM A;  1EQ3 A;  4IQ2 A;  2XP9 A;  4ODN A;  3RFW A;  5HKG A;  3O5M A;  3O5I A;  3JYM A;  4W9P A;  4DRN A;  1Q6H A;  2KE0 A;  5I98 A;  1ZCN A;  4G2P A;  3UQI A;  1KT1 A;  2DG4 A;  1Q6U A;  4LAW A;  3VAW A;  2AWG A;  3JXV A;  1QZ2 A;  1FKR A;  3NRK A;  2XPB A;  1FKD A;  3O5E A;  1C9H A;  4MGV A;  5HTG A;  5J6E A;  1J4H A;  1FAP A;  3KAG A;  2PPP A;  4G50 A;  4ODO A;  2ZR6 A;  4QT2 A;  1EYM A;  2ZQU A;  2PV2 A;  3JYJ A;  1FKH A;  2F2D A;  2VN1 A;  4BF8 A;  4ODP A;  1D6O A;  1QPL A;  5HT1 A;  3RGC A;  4DRH A;  3TCZ A;  2MF9 A;  3IHZ A;  4J4N A;  4MSP A;  3UI5 A;  5B8I C;  3IK8 A;  4TYO A;  1NSG A;  3KAB A;  4GIV A;  4JFL A;  2M2A A;  4LAY A;  3GPK A;  2LGO A;  5GPG A;  2MNT A;  4ODQ A;  5DIT A;  2F4E A;  4NNR A;  4W9Q A;  1Y0O A;  2RUC A;  4TX0 A;  2ITK A;  4IPX A;  1JNT A;  2PBC A;  1PIN A;  3O5L A;  3UQB A;  2MPH A;  3NI6 A;  3O5Q A;  1FKB A;  3PA7 A;  1NMV A;  1FKT A;  3OOB A;  4FN2 A;  4N19 A;  3EY6 A;  2ZQS A;  2OFN A;  4TW8 A;  4IQC A;  1FKG A;  1QPF A;  4ODR A;  4DRP A;  4LAV A;  4U85 A;  2KR7 A;  3KAD A;  4JFK A;  1D7I A;  4O2T A;  5HW6 A;  3O5F A;  1J6Y A;  2XP4 A;  5HWB A;  1R9H A;  1FKK A;  3H9R B;  1P5Q A;  2UZ5 A;  2KI3 A;  5HWC A;  3PRB A;  1TCO C;  3IKD A;  1L1P A;  2ZQT A;  2M1I A;  4U86 A;  2K8I A;  2LPV A;  3IKG A;  3O5P A;  3NTP A;  2PPN A;  4TW6 A;  4DRQ A;  1J4R A;  2XP7 A; 
#chains in the Genus database with same CATH topology
 1BKF A;  2KGJ A;  3PR9 A;  1XRV A;  1ITX A;  3BXW A;  2DG3 A;  4LGX A;  2WK2 A;  3O5J A;  3CGM A;  2PI6 A;  1HJW A;  2RUD A;  3B8S A;  2LJ4 A;  4DRM A;  5HUA A;  4DIP A;  1F40 A;  2VCD A;  1OGG A;  1NH6 A;  2O9O A;  4ODK A;  5HBF A;  2FAP A;  1EHN A;  4ZS6 A;  3KAF A;  4GGQ A;  4Q22 A;  2AOS A;  4NSB A;  4DH0 A;  4DZ3 A;  1WAW A;  3ODK A;  1E15 A;  3UI6 A;  5HW8 A;  1W9P A;  2KFW A;  3RM4 A;  4Z2I A;  2XP6 A;  2XP5 A;  3TDB A;  1WB0 A;  1JVW A;  2XP8 A;  5DEZ A;  2FKE A;  3O5D A;  1ROT A;  2PPO A;  4DRI A;  1B6C A;  4DWS B;  2Q5A A;  2L2S A;  2PN0 A;  3B7X A;  1FKF A;  1D7J A;  2Y78 A;  1GUV A;  4J4O A;  2DSV A;  4ODM A;  3ARY A;  2XP9 A;  3RFW A;  4DRN A;  1HKJ A;  1Q6H A;  4IT4 A;  4WKA A;  5I98 A;  1HJX A;  1ZCN A;  3UQI A;  4Z2H A;  2AWG A;  1FKR A;  1FAP A;  4Z2L A;  3KAG A;  4G50 A;  1W9V A;  4QT2 A;  1EYM A;  2ZQU A;  1ZU8 A;  1FKH A;  4MNL A;  4ODP A;  5GQB A;  4DRH A;  1W1V A;  3TCZ A;  2MF9 A;  3AS1 A;  3WD0 A;  1UR9 A;  4GIV A;  4WIW A;  2PBC A;  3O5L A;  3NI6 A;  3O5Q A;  3PA7 A;  4FN2 A;  1EIB A;  4U85 A;  3KAD A;  4JFK A;  4O2T A;  3CH9 A;  1J6Y A;  5HWB A;  2A3B A;  3H9R B;  2UZ5 A;  2KI3 A;  1NWR A;  4QZV B;  1TCO C;  1L1P A;  4ML4 A;  3WL0 A;  3WD4 A;  1SR0 A;  3O5P A;  4DZ2 A;  1JCH B;  1JND A;  3WKZ A;  3FXY A;  3RME A;  3WL1 A;  4MNK A;  1O6I A;  1FKJ A;  2FDM A;  3UF8 A;  5BXJ A;  5DIU A;  4C02 B;  1Q6I A;  2LKN A;  3PRD A;  3W4R A;  3B9A A;  2ZR4 A;  5HW7 A;  1LG2 A;  1EDQ A;  3QOK A;  1Q1C A;  4Z2J A;  4U84 A;  1JNE A;  5DO2 A;  2B31 A;  3WH0 A;  3ARW A;  5D75 A;  4WJX A;  3B9E A;  3O5G A;  4DRJ A;  1E44 A;  1HKK A;  1OWQ A;  1GOI A;  3KAI A;  2P4V A;  4URI A;  4MPK A;  1W9U A;  2WLY A;  4JFJ A;  4IT6 A;  2ZQV A;  2WLZ A;  1BL4 A;  1YW5 A;  2QF8 A;  3ARZ A;  3UI4 A;  2XPA A;  2N87 A;  4ZPV R;  4ITZ A;  4IQ2 A;  5HKG A;  1GRJ A;  3O5M A;  3O5I A;  3JYM A;  4W9P A;  4Z2K A;  2KE0 A;  4KQZ A;  1W1Y A;  4P8U A;  1HKI A;  2A3E A;  4DWS A;  4LAW A;  2DT0 A;  2DT2 A;  3AS2 A;  3NRK A;  1FKD A;  1J4H A;  4ODO A;  2PPP A;  2PV2 A;  4WKH A;  2F2D A;  4BF8 A;  3ARS A;  3IHZ A;  4J4N A;  5B8I C;  3UI5 A;  1HKM A;  3IK8 A;  4TYO A;  3KAB A;  3GPK A;  2LGO A;  5DIT A;  4W9Q A;  2RUC A;  2ITK A;  1PIN A;  1LJY A;  1HJV A;  1E6N A;  3OOB A;  4TW8 A;  1FKG A;  1QPF A;  1ZBC A;  5HW6 A;  1ZB5 A;  2XP4 A;  1FKK A;  3ART A;  4W5U A;  1SYT A;  3IKD A;  3EIP A;  2ZQT A;  3ARO A;  4U86 A;  1E9L A;  2DSZ A;  4TW6 A;  4DRQ A;  2XP7 A;  4Z2G A;  2KO7 A;  1OGB A;  4MAV A;  1HXV A;  4DT4 A;  1ZBK A;  2RSE A;  1F8A B;  2PV1 A;  3ARX A;  2IF4 A;  4P8V A;  4QT3 A;  2RUQ A;  3O5O A;  4JFI A;  4LAX A;  1NWS A;  1U79 A;  4W9O A;  4P8W A;  2DG9 A;  4TNS A;  1ZBV A;  2B5U B;  1E6Z A;  2DPE A;  3G6M A;  1LL7 A;  1UR8 A;  3BMB A;  2RUR A;  1J4I A;  3O5K A;  4DRO A;  1WNO A;  2XP3 A;  1D7H A;  3ARV A;  3FY1 A;  1FD9 A;  1ROU A;  1FKL A;  2F21 A;  2DSW A;  1YAT A;  3CGN A;  4KR0 B;  4TW7 A;  1JNS A;  1N1A A;  1M5Y A;  2D9F A;  3ARQ A;  2ZR5 A;  4ZPT R;  1W1P A;  3KAH A;  4QIB A;  4UDM A;  4FAP A;  1X6N A;  1IX5 A;  3LUO A;  3GU0 A;  3ALF A;  4ODN A;  3CHE A;  3ALG A;  4XAK A;  1RD6 A;  3JXV A;  1QZ2 A;  2XPB A;  4MGV A;  5HTG A;  1H0I A;  1ZBW A;  3JYJ A;  2VN1 A;  1QPL A;  3RGC A;  4L3N A;  2A3A A;  1NSG A;  1W1T A;  4JFL A;  2M2A A;  2DSU A;  4LAY A;  3CHC A;  4Q7N A;  2MNT A;  1LQ0 A;  2F4E A;  2IUZ A;  4NNR A;  1Y0O A;  3RM9 A;  1JNT A;  3UQB A;  4DWS C;  2MPH A;  1GPF A;  3ARR A;  2F23 A;  2YBU A;  2OFN A;  3WQW A;  4IQC A;  4DRP A;  4ODR A;  1VF8 A;  4R5E A;  4LAV A;  1D7I A;  3CHF A;  4DWS D;  1R9H A;  3WD3 A;  5HWC A;  3PRB A;  1TFV A;  3WD2 A;  1NWU A;  4MTV A;  1X6L A;  1J4R A;  1FKI A;  2MLY A;  3OA5 A;  4NZC A;  3ARP A;  3KCE A;  2MLZ A;  4JFM A;  1ZL1 A;  2G8Z A;  4HAR A;  4MNJ A;  3O5R A;  2ESC A;  3AS0 A;  1T11 A;  4DRK A;  1A7X A;  2OLH A;  3I6C A;  3RM8 A;  1ZK6 A;  3KAC A;  1FJD A;  1KT0 A;  3AS3 A;  2RQS A;  3TC5 A;  1FKS A;  1KFW A;  3CZ8 A;  1W26 A;  3KZ7 A;  1PBK A;  1NMW A;  5DIV A;  3CHD A;  2JZV A;  4HBE A;  2MLX A;  1CTN A;  3G6L A;  1LL4 A;  1LG1 A;  1LL6 A;  2M08 A;  2PV3 A;  1FFQ A;  3MDY B;  3UQA A;  3FAP A;  4AY1 A;  4JYS A;  4ODL A;  4R0X A;  5DF0 A;  5JH8 A;  3GTY X;  2YBT A;  1EQ3 A;  3WQV A;  4G2P A;  2O92 A;  1KT1 A;  2DG4 A;  2EUL A;  1Q6U A;  3WIJ A;  3VAW A;  2DT3 A;  3O5E A;  1C9H A;  5J6E A;  2ETN A;  4ZPW R;  2ZR6 A;  2A3C A;  1K9T A;  1D2K A;  4L72 B;  1D6O A;  5HT1 A;  4HBO A;  2G41 A;  1XHG A;  3ARU A;  3WD1 A;  4MSP A;  4P8X A;  2DT1 A;  4WKF A;  1E6R A;  5GPG A;  1E6P A;  4ODQ A;  4TX0 A;  4IPX A;  4S3J A;  1FKB A;  1NMV A;  3AQU A;  1FKT A;  4MNM A;  4N19 A;  3B9D A;  3EY6 A;  5GPR A;  2ZQS A;  4WK9 A;  2KR7 A;  3O5F A;  1FFR A;  1P5Q A;  1H0G A;  4S3K A;  4PTM A;  2WM0 A;  2M1I A;  2K8I A;  3PRA A;  2LPV A;  3IKG A;  3NTP A;  2PPN A;  1NWT A; 
#chains in the Genus database with same CATH homology
 1BKF A;  2KGJ A;  3PR9 A;  1XRV A;  1ITX A;  3BXW A;  2DG3 A;  4LGX A;  2WK2 A;  3O5J A;  3CGM A;  2PI6 A;  1HJW A;  2RUD A;  3B8S A;  2LJ4 A;  4DRM A;  5HUA A;  4DIP A;  1F40 A;  2VCD A;  1OGG A;  1NH6 A;  2O9O A;  4ODK A;  5HBF A;  2FAP A;  1EHN A;  4ZS6 A;  3KAF A;  4GGQ A;  4Q22 A;  2AOS A;  4NSB A;  4DH0 A;  4DZ3 A;  1WAW A;  3ODK A;  1E15 A;  3UI6 A;  5HW8 A;  1W9P A;  2KFW A;  3RM4 A;  4Z2I A;  2XP6 A;  2XP5 A;  3TDB A;  1WB0 A;  1JVW A;  2XP8 A;  5DEZ A;  2FKE A;  3O5D A;  1ROT A;  2PPO A;  4DRI A;  1B6C A;  4DWS B;  2Q5A A;  2L2S A;  3B7X A;  1FKF A;  1D7J A;  2Y78 A;  1GUV A;  4J4O A;  2DSV A;  4ODM A;  3ARY A;  2XP9 A;  3RFW A;  4DRN A;  1HKJ A;  1Q6H A;  4IT4 A;  4WKA A;  5I98 A;  1HJX A;  1ZCN A;  3UQI A;  4Z2H A;  2AWG A;  1FKR A;  1FAP A;  4Z2L A;  3KAG A;  4G50 A;  1W9V A;  4QT2 A;  1EYM A;  2ZQU A;  1ZU8 A;  1FKH A;  4MNL A;  4ODP A;  5GQB A;  4DRH A;  1W1V A;  3TCZ A;  2MF9 A;  3AS1 A;  3WD0 A;  1UR9 A;  4GIV A;  4WIW A;  2PBC A;  3O5L A;  3NI6 A;  3O5Q A;  3PA7 A;  4FN2 A;  1EIB A;  4U85 A;  3KAD A;  4JFK A;  4O2T A;  3CH9 A;  1J6Y A;  5HWB A;  2A3B A;  3H9R B;  2UZ5 A;  2KI3 A;  1NWR A;  4QZV B;  1TCO C;  1L1P A;  4ML4 A;  3WL0 A;  3WD4 A;  1SR0 A;  3O5P A;  4DZ2 A;  1JND A;  3WKZ A;  3FXY A;  3RME A;  3WL1 A;  4MNK A;  1O6I A;  1FKJ A;  2FDM A;  3UF8 A;  5BXJ A;  5DIU A;  4C02 B;  1Q6I A;  2LKN A;  3PRD A;  3W4R A;  3B9A A;  2ZR4 A;  5HW7 A;  1LG2 A;  1EDQ A;  3QOK A;  1Q1C A;  4Z2J A;  4U84 A;  1JNE A;  5DO2 A;  2B31 A;  3WH0 A;  3ARW A;  5D75 A;  4WJX A;  3B9E A;  3O5G A;  4DRJ A;  1HKK A;  1OWQ A;  1GOI A;  3KAI A;  4URI A;  4MPK A;  1W9U A;  2WLY A;  4JFJ A;  4IT6 A;  2ZQV A;  2WLZ A;  1BL4 A;  1YW5 A;  2QF8 A;  3ARZ A;  3UI4 A;  2XPA A;  2N87 A;  4ZPV R;  4ITZ A;  4IQ2 A;  5HKG A;  3O5M A;  3O5I A;  3JYM A;  4W9P A;  4Z2K A;  2KE0 A;  4KQZ A;  1W1Y A;  4P8U A;  1HKI A;  2A3E A;  4DWS A;  4LAW A;  2DT0 A;  2DT2 A;  3AS2 A;  3NRK A;  1FKD A;  1J4H A;  4ODO A;  2PPP A;  2PV2 A;  4WKH A;  2F2D A;  4BF8 A;  3ARS A;  3IHZ A;  4J4N A;  5B8I C;  3UI5 A;  1HKM A;  3IK8 A;  4TYO A;  3KAB A;  3GPK A;  2LGO A;  5DIT A;  4W9Q A;  2RUC A;  2ITK A;  1PIN A;  1LJY A;  1HJV A;  1E6N A;  3OOB A;  4TW8 A;  1FKG A;  1QPF A;  1ZBC A;  5HW6 A;  1ZB5 A;  2XP4 A;  1FKK A;  3ART A;  4W5U A;  1SYT A;  3IKD A;  2ZQT A;  3ARO A;  4U86 A;  1E9L A;  2DSZ A;  4TW6 A;  4DRQ A;  2XP7 A;  4Z2G A;  2KO7 A;  1OGB A;  4MAV A;  1HXV A;  4DT4 A;  1ZBK A;  2RSE A;  1F8A B;  2PV1 A;  3ARX A;  2IF4 A;  4P8V A;  4QT3 A;  2RUQ A;  3O5O A;  4JFI A;  4LAX A;  1NWS A;  1U79 A;  4W9O A;  4P8W A;  2DG9 A;  4TNS A;  1ZBV A;  1E6Z A;  2DPE A;  3G6M A;  1LL7 A;  1UR8 A;  2RUR A;  1J4I A;  3O5K A;  4DRO A;  1WNO A;  2XP3 A;  1D7H A;  3ARV A;  3FY1 A;  1FD9 A;  1ROU A;  1FKL A;  2F21 A;  2DSW A;  1YAT A;  3CGN A;  4KR0 B;  4TW7 A;  1JNS A;  1N1A A;  1M5Y A;  2D9F A;  3ARQ A;  2ZR5 A;  4ZPT R;  1W1P A;  3KAH A;  4QIB A;  1IX5 A;  4FAP A;  1X6N A;  3LUO A;  3ALF A;  4ODN A;  3CHE A;  3ALG A;  4XAK A;  1RD6 A;  3JXV A;  1QZ2 A;  2XPB A;  4MGV A;  5HTG A;  1H0I A;  1ZBW A;  3JYJ A;  2VN1 A;  1QPL A;  3RGC A;  4L3N A;  2A3A A;  1NSG A;  1W1T A;  4JFL A;  2M2A A;  2DSU A;  4LAY A;  3CHC A;  4Q7N A;  2MNT A;  1LQ0 A;  2F4E A;  2IUZ A;  4NNR A;  1Y0O A;  3RM9 A;  1JNT A;  3UQB A;  4DWS C;  2MPH A;  1GPF A;  3ARR A;  2YBU A;  2OFN A;  3WQW A;  4IQC A;  4DRP A;  4ODR A;  1VF8 A;  4R5E A;  4LAV A;  1D7I A;  3CHF A;  4DWS D;  1R9H A;  3WD3 A;  5HWC A;  3PRB A;  1TFV A;  3WD2 A;  1NWU A;  4MTV A;  1X6L A;  1J4R A;  1FKI A;  2MLY A;  3OA5 A;  4NZC A;  3ARP A;  3KCE A;  2MLZ A;  4JFM A;  1ZL1 A;  2G8Z A;  4HAR A;  4MNJ A;  3O5R A;  2ESC A;  3AS0 A;  1T11 A;  4DRK A;  1A7X A;  2OLH A;  3I6C A;  3RM8 A;  1ZK6 A;  3KAC A;  1FJD A;  1KT0 A;  3AS3 A;  2RQS A;  3TC5 A;  1FKS A;  1KFW A;  3CZ8 A;  1W26 A;  3KZ7 A;  1PBK A;  1NMW A;  5DIV A;  3CHD A;  2JZV A;  4HBE A;  2MLX A;  1CTN A;  3G6L A;  1LL4 A;  1LG1 A;  1LL6 A;  2M08 A;  2PV3 A;  1FFQ A;  3MDY B;  3UQA A;  3FAP A;  4AY1 A;  4JYS A;  4ODL A;  4R0X A;  5DF0 A;  5JH8 A;  2YBT A;  1EQ3 A;  3WQV A;  4G2P A;  2O92 A;  1KT1 A;  2DG4 A;  1Q6U A;  3WIJ A;  3VAW A;  2DT3 A;  3O5E A;  1C9H A;  5J6E A;  4ZPW R;  2ZR6 A;  2A3C A;  1K9T A;  1D2K A;  4L72 B;  1D6O A;  5HT1 A;  4HBO A;  2G41 A;  1XHG A;  3ARU A;  3WD1 A;  4MSP A;  4P8X A;  2DT1 A;  4WKF A;  1E6R A;  5GPG A;  1E6P A;  4ODQ A;  4TX0 A;  4IPX A;  4S3J A;  1FKB A;  1NMV A;  3AQU A;  1FKT A;  4MNM A;  4N19 A;  3B9D A;  3EY6 A;  5GPR A;  2ZQS A;  4WK9 A;  2KR7 A;  3O5F A;  1FFR A;  1P5Q A;  1H0G A;  4S3K A;  4PTM A;  2WM0 A;  2M1I A;  2K8I A;  3PRA A;  2LPV A;  3IKG A;  3NTP A;  2PPN A;  1NWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...