3O5MA

Fk1 domain mutant a19t of fkbp51, crystal form ii
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
127
structure length
127
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 35
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5mA00
1KT1A 1J4IA 3UI4A 1Y0OA 4C02B 5B8IC 5I98A 1F8AB 3IK8A 4J4NA 2XPBA 3KZ7A 4JFJA 3JXVA 1BKFA 2RUQA 4ODLA 3UQBA 1FKFA 2JZVA 2LJ4A 1QPLA 3UQIA 3O5RA 4TW7A 3WH0A 2ITKA 1JNSA 3KAHA 4W9QA 3O5KA 3O5MA 4ODQA 3CGNA 3NI6A 4QIBA 4TYOA 2KO7A 5GPGA 4DH0A 4MSPA 4LAXA 2XP5A 4IQCA 3EY6A 2PV3A 2KR7A 3RGCA 4ODMA 4W9OA 2RSEA 2DG9A 4ODNA 4ODOA 2MLXA 2DG3A 4LAWA 4DRMA 4IPXA 5HT1A 1J4RA 3O5QA 2FKEA 2XP6A 3PRBA 4GIVA 4W9PA 2ZR6A 1FKKA 3CGMA 1FKRA 1YATA 2L2SA 1F40A 1PBKA 1ZK6A 2F4EA 5DITA 2PV2A 1M5YA 3KAFA 3KABA 4ITZA 5HTGA 3KCEA 3MDYB 2XPAA 4ODRA 4DRKA 1Q1CA 4DRIA 1J6YA 3UI6A 3JYJA 2KI3A 5HUAA 2RQSA 3B7XA 4DZ2A 1TCOC 4DRNA 1FKSA 1YW5A 3O5DA 4J4OA 2Q5AA 3O5LA 1W26A 4JFIA 3UF8A 4DIPA 3LUOA 4DRJA 3ODKA 2D9FA 1KT0A 3O5PA 1J4HA 2RUDA 4JYSA 5J6EA 3O5GA 5HKGA 3GPKA 5BXJA 4BF8A 4FAPA 1NMVA 3UQAA 4MGVA 4NNRA 3IKDA 1ZCNA 1FAPA 3KAGA 4DZ3A 5HWBA 1HXVA 2FAPA 1FKDA 2ZR5A 1B6CA 1N1AA 3IHZA 3KADA 4G2PA 4U85A 1NMWA 4DROA 4QT3A 2DG4A 2ZR4A 3KAIA 5HW7A 2MLZA 4TX0A 2LGOA 3PRDA 3NTPA 4JFMA 4LAVA 1FKIA 4TW8A 2PBCA 4G50A 1FKGA 4N19A 1FKBA 4TW6A 4JFLA 2N87A 2K8IA 2KE0A 2LKNA 4R0XA 3RFWA 4DRPA 2F2DA 2VN1A 2ZQVA 5D75A 3OOBA 4DRHA 2MF9A 1FKLA 1PINA 3O5OA 4DT4A 4TNSA 5HW6A 2XP9A 3TC5A 3VAWA 3PA7A 2ZQTA 4DRQA 2RURA 2KFWA 1JVWA 3O5JA 2OFNA 1Q6IA 2PPOA 2PPPA 3O5FA 3NRKA 2PPNA 1EYMA 2ZQUA 1L1PA 2VCDA 1EQ3A 1D7HA 2XP8A 1C9HA 1JNTA 2M2AA 4ODPA 1QZ2A 2LPVA 1BL4A 2Y78A 1QPFA 4QT2A 1NSGA 2MLYA 1FD9A 3H9RB 3O5IA 5DIUA 3TDBA 3I6CA 5HWCA 1FKTA 2AWGA 1A7XA 4LAYA 2PV1A 4ODKA 3FAPA 1D6OA 1FKJA 1ROTA 1Q6UA 2F21A 2M1IA 2IF4A 1T11A 2MPHA 2XP3A 2ZQSA 2KGJA 2MNTA 2XP7A 4U86A 1Q6HA 1R9HA 1ROUA 3KACA 3O5EA 5HW8A 1FJDA 4IQ2A 1U79A 2RUCA 2UZ5A 4GGQA 1FKHA 4O2TA 5DIVA 3JYMA 3IKGA 1D7JA 2XP4A 1P5QA 3UI5A 1D7IA 4JFKA 4U84A 4FN2A 2M08A 3TCZA
chains in the Genus database with same CATH superfamily
3BXWA 1J4IA 3UI4A 4C02B 1LL7A 5I98A 4J4NA 3FXYA 2XPBA 3KZ7A 4ZPTR 3ARPA 3B8SA 3CHCA 2RUQA 1FKFA 1W1TA 3W4RA 1JNSA 2QF8A 1ZBCA 4ODQA 2G41A 4LAXA 4IQCA 3EY6A 3ALGA 4ODOA 1LL4A 1EHNA 4LAWA 5HT1A 2FKEA 1OWQA 4GIVA 3WL0A 2ZR6A 1K9TA 2L2SA 2PV2A 2PN0A 1EIBA 3KABA 4ITZA 5HBFA 3ARUA 2XPAA 4Z2GA 2RQSA 4DZ2A 1YW5A 2EULA 3O5DA 3WKZA 4JFIA 4DRJA 1UR9A 2DSWA 3IKDA 5HWBA 3IHZA 3ARWA 5DF0A 2DG4A 3BMBA 5HW7A 1HJXA 3PRDA 1ZB5A 2DT3A 1FKIA 1FKGA 3CZ8A 4JFLA 2K8IA 2KE0A 3WD3A 2WLZA 4Z2JA 4DRHA 2MF9A 4MNJA 3VAWA 3RM9A 3WD0A 2A3BA 4R5EA 3O5FA 1NWUA 2PPNA 5JH8A 1W9UA 2ZQUA 2DT0A 2VCDA 1EQ3A 1D7HA 2XP8A 1C9HA 1E6PA 4ODPA 1L1PA 4Z2IA 1ZU8A 3O5IA 3TDBA 2PV1A 4LGXA 1D6OA 2OLHA 3MDYB 2M1IA 2IF4A 4Q7NA 1CTNA 2KGJA 2MNTA 1U79A 2RUCA 2UZ5A 1FKHA 4O2TA 3JYMA 1D7JA 1H0GA 2XP4A 1D7IA 2M08A 3TCZA 4HARA 1KT1A 1HJWA 5DEZA 4P8XA 3AS1A 3JXVA 1BKFA 2JZVA 1QPLA 1ZBVA 2ESCA 3O5RA 4HBEA 4TW7A 1HKMA 2ITKA 3AS3A 4W9QA 3O5KA 2DPEA 5GPRA 3CGNA 3WH0A 4WKAA 4TYOA 1W1YA 4WKFA 3OA5A 4W9OA 2RSEA 1LQ0A 4ODNA 2MLXA 2A3EA 2O9OA 4MNLA 1X6LA 1HJVA 4ML4A 4DWSA 4WIWA 1FKKA 2G8ZA 3AS0A 3ARRA 1XHGA 4UDMA 5HTGA 4DRKA 3UI6A 4P8VA 1FKSA 3O5LA 1W26A 3ODKA 4W5UA 1HKIA 3O5PA 1RD6A 2DSZA 3O5GA 1E9LA 3GPKA 4BF8A 1NMVA 3KAGA 1FAPA 3UQIA 4U85A 4G2PA 4DROA 2P4VA 2LGOA 3RM4A 3NTPA 1E6ZA 1ITXA 2PBCA 4TW6A 1FKBA 1UR8A 4R0XA 2F2DA 2ZQVA 1GOIA 1PINA 2XP9A 3TC5A 3ARTA 1JNDA 2O92A 3GU0A 3PA7A 4S3KA 4ZPVR 2KFWA 3PR9A 4XAKA 3O5JA 2OFNA 2PPPA 3NRKA 3WIJA 1EYMA 1WNOA 1JNTA 3ARVA 2LPVA 3CHDA 1SYTA 2MLYA 1FD9A 5DIUA 2AOSA 1OGBA 2AWGA 4LAYA 4S3JA 4ODKA 2MPHA 2F21A 1T11A 1Q6HA 3O5EA 1XRVA 5GQBA 1E6NA 4GGQA 1W9VA 4FN2A 2ETNA 4ZS6A 2FDMA 1Y0OA 5B8IC 3QOKA 4PTMA 1EDQA 4Z2LA 1FFRA 2WK2A 4WKHA 2LJ4A 3UQBA 4DWSC 3KAHA 3O5MA 4P8UA 3CHEA 4ZPWR 1LL6A 4NSBA 4QIBA 4DH0A 3WD4A 1WB0A 2XP5A 2KR7A 4ODMA 3CH9A 3ALFA 3ARXA 2DG3A 4DRMA 2B5UB 1LG1A 2A3AA 4IPXA 4QZVB 1J4RA 3O5QA 1FKRA 3WD2A 1F40A 3CHFA 5DITA 1M5YA 4ODRA 5HUAA 1TCOC 4KQZA 4DRNA 3G6LA 4J4OA 2Q5AA 2DT1A 3LUOA 3B9EA 2D9FA 1J4HA 4JYSA 1E15A 5J6EA 4AY1A 5HKGA 4FAPA 1OGGA 3UQAA 4DZ3A 1ZCNA 2FAPA 1FFQA 1GPFA 1NMWA 4QT3A 3ARQA 2ZR4A 1ZL1A 4TX0A 1D2KA 3ARSA 4TW8A 2DT2A 2IUZA 2LKNA 4KR0B 4DRPA 2VN1A 5D75A 2PI6A 3FY1A 3WQWA 1KFWA 4TNSA 5HW6A 2ZQTA 4DRQA 1JCHB 1JVWA 1JNEA 1Q6IA 1WAWA 1E44A 1TFVA 1QZ2A 1BL4A 1NSGA 4MNMA 4IT4A 3I6CA 5HWCA 3FAPA 1FKJA 1HXVA 1Q6UA 5DIVA 4DWSB 3WL1A 4U86A 2XP7A 1NH6A 3KACA 1ROUA 1GUVA 3B9AA 4URIA 1FJDA 3GTYX 1LJYA 4IQ2A 2B31A 4L3NA 4MPKA 2F23A 3UI5A 4JFKA 3B9DA 2YBTA 1X6NA 4P8WA 3AQUA 1F8AB 4MNKA 1ZBKA 4JFJA 4MAVA 4ODLA 3WD1A 4Z2HA 3NI6A 5GPGA 2KO7A 4MSPA 2PV3A 3RGCA 2DG9A 3PRAA 1LG2A 4MTVA 3AS2A 2XP6A 3PRBA 4W9PA 3CGMA 1W1PA 5DO2A 1YATA 4DWSD 1PBKA 1ZK6A 2F4EA 4Q22A 3KAFA 2WM0A 3KCEA 1W1VA 1Q1CA 4DRIA 1J6YA 1NWRA 2YBUA 3JYJA 4WK9A 2KI3A 3B7XA 1HKKA 3UF8A 4DIPA 1SR0A 1KT0A 2RUDA 5BXJA 1H0IA 4MGVA 4NNRA 1W9PA 2ZR5A 1FKDA 2DSUA 1B6CA 1N1AA 3KADA 3KAIA 1NWSA 1VF8A 2MLZA 4LAVA 4JFMA 3G6MA 1E6RA 4G50A 4N19A 2N87A 3RFWA 3OOBA 1NWTA 1FKLA 1O6IA 3O5OA 4DT4A 3WQVA 2RURA 4HBOA 3RMEA 4NZCA 1ZBWA 2PPOA 1GRJA 3ARZA 2WLYA 4L72B 3EIPA 2M2AA 4Z2KA 2Y78A 1QPFA 4QT2A 1IX5A 3H9RB 2A3CA 3ARYA 1FKTA 1A7XA 4WJXA 4IT6A 2ZQSA 3IK8A 1ROTA 1HKJA 3RM8A 2XP3A 1R9HA 5HW8A 2DSVA 3AROA 3IKGA 1P5QA 4U84A
chains in the Genus database with same CATH topology
3BXWA 1J4IA 3UI4A 4C02B 1LL7A 5I98A 4J4NA 3FXYA 2XPBA 3KZ7A 4ZPTR 3ARPA 3B8SA 3CHCA 2RUQA 1FKFA 1W1TA 3W4RA 1JNSA 2QF8A 1ZBCA 4ODQA 2G41A 4LAXA 4IQCA 3EY6A 3ALGA 4ODOA 1LL4A 1EHNA 4LAWA 5HT1A 2FKEA 1OWQA 4GIVA 3WL0A 2ZR6A 1K9TA 2L2SA 2PV2A 1EIBA 3KABA 4ITZA 5HBFA 3ARUA 2XPAA 4Z2GA 2RQSA 4DZ2A 1YW5A 3O5DA 3WKZA 4JFIA 4DRJA 1UR9A 2DSWA 3IKDA 5HWBA 3IHZA 3ARWA 5DF0A 2DG4A 5HW7A 1HJXA 3PRDA 1ZB5A 2DT3A 1FKIA 1FKGA 3CZ8A 4JFLA 2K8IA 2KE0A 3WD3A 2WLZA 4Z2JA 4DRHA 2MF9A 4MNJA 3VAWA 3RM9A 3WD0A 2A3BA 4R5EA 3O5FA 1NWUA 2PPNA 5JH8A 1W9UA 2ZQUA 2DT0A 2VCDA 1EQ3A 1D7HA 2XP8A 1C9HA 1E6PA 4ODPA 1L1PA 4Z2IA 1ZU8A 3O5IA 3TDBA 2PV1A 4LGXA 1D6OA 2OLHA 3MDYB 2M1IA 2IF4A 4Q7NA 1CTNA 2KGJA 2MNTA 1U79A 2RUCA 2UZ5A 1FKHA 4O2TA 3JYMA 1D7JA 1H0GA 2XP4A 1D7IA 2M08A 3TCZA 4HARA 1KT1A 1HJWA 5DEZA 4P8XA 3AS1A 3JXVA 1BKFA 2JZVA 1QPLA 1ZBVA 2ESCA 3O5RA 4HBEA 4TW7A 1HKMA 2ITKA 3AS3A 4W9QA 3O5KA 2DPEA 5GPRA 3CGNA 3WH0A 4WKAA 4TYOA 1W1YA 4WKFA 3OA5A 4W9OA 2RSEA 1LQ0A 4ODNA 2MLXA 2A3EA 2O9OA 4MNLA 1X6LA 1HJVA 4ML4A 4DWSA 4WIWA 1FKKA 2G8ZA 3AS0A 3ARRA 1XHGA 5HTGA 4DRKA 3UI6A 4P8VA 1FKSA 3O5LA 1W26A 3ODKA 4W5UA 1HKIA 3O5PA 1RD6A 2DSZA 3O5GA 1E9LA 3GPKA 4BF8A 1NMVA 3KAGA 1FAPA 3UQIA 4U85A 4G2PA 4DROA 2LGOA 3RM4A 3NTPA 1E6ZA 1ITXA 2PBCA 4TW6A 1FKBA 1UR8A 4R0XA 2F2DA 2ZQVA 1GOIA 1PINA 2XP9A 3TC5A 3ARTA 1JNDA 2O92A 3PA7A 4S3KA 4ZPVR 2KFWA 3PR9A 4XAKA 3O5JA 2OFNA 2PPPA 3NRKA 3WIJA 1EYMA 1WNOA 1JNTA 3ARVA 2LPVA 3CHDA 1SYTA 2MLYA 1FD9A 5DIUA 2AOSA 1OGBA 2AWGA 4LAYA 4S3JA 4ODKA 2MPHA 2F21A 1T11A 1Q6HA 3O5EA 1XRVA 5GQBA 1E6NA 4GGQA 1W9VA 4FN2A 4ZS6A 2FDMA 1Y0OA 5B8IC 3QOKA 4PTMA 1EDQA 4Z2LA 1FFRA 2WK2A 4WKHA 2LJ4A 3UQBA 4DWSC 3KAHA 3O5MA 4P8UA 3CHEA 4ZPWR 1LL6A 4NSBA 4QIBA 4DH0A 3WD4A 1WB0A 2XP5A 2KR7A 4ODMA 3CH9A 3ALFA 3ARXA 2DG3A 4DRMA 1LG1A 2A3AA 4IPXA 4QZVB 1J4RA 3O5QA 1FKRA 3WD2A 1F40A 3CHFA 5DITA 1M5YA 4ODRA 5HUAA 1TCOC 4KQZA 4DRNA 3G6LA 4J4OA 2Q5AA 2DT1A 3LUOA 3B9EA 2D9FA 1J4HA 4JYSA 1E15A 5J6EA 4AY1A 5HKGA 4FAPA 1OGGA 3UQAA 4DZ3A 1ZCNA 2FAPA 1FFQA 1GPFA 1NMWA 4QT3A 3ARQA 2ZR4A 1ZL1A 4TX0A 1D2KA 3ARSA 4TW8A 2DT2A 2IUZA 2LKNA 4KR0B 4DRPA 2VN1A 5D75A 2PI6A 3FY1A 3WQWA 1KFWA 4TNSA 5HW6A 2ZQTA 4DRQA 1JVWA 1JNEA 1Q6IA 1WAWA 1TFVA 1QZ2A 1BL4A 1NSGA 4MNMA 4IT4A 3I6CA 5HWCA 3FAPA 1FKJA 1HXVA 1Q6UA 5DIVA 4DWSB 3WL1A 4U86A 2XP7A 1NH6A 3KACA 1ROUA 1GUVA 3B9AA 4URIA 1FJDA 4IQ2A 1LJYA 2B31A 4L3NA 4MPKA 3UI5A 4JFKA 3B9DA 2YBTA 1X6NA 4P8WA 3AQUA 1F8AB 4MNKA 1ZBKA 4JFJA 4MAVA 4ODLA 3WD1A 4Z2HA 3NI6A 5GPGA 2KO7A 4MSPA 2PV3A 3RGCA 2DG9A 3PRAA 1LG2A 4MTVA 3AS2A 2XP6A 3PRBA 4W9PA 3CGMA 1W1PA 5DO2A 1YATA 4DWSD 1PBKA 1ZK6A 2F4EA 4Q22A 3KAFA 2WM0A 3KCEA 1W1VA 1Q1CA 4DRIA 1J6YA 1NWRA 2YBUA 3JYJA 4WK9A 2KI3A 3B7XA 1HKKA 3UF8A 4DIPA 1SR0A 1KT0A 2RUDA 5BXJA 1H0IA 4MGVA 4NNRA 1W9PA 2ZR5A 1FKDA 2DSUA 1B6CA 1N1AA 3KADA 3KAIA 1NWSA 1VF8A 2MLZA 4LAVA 4JFMA 3G6MA 1E6RA 4G50A 4N19A 2N87A 3RFWA 3OOBA 1NWTA 1FKLA 1O6IA 3O5OA 4DT4A 3WQVA 2RURA 4HBOA 3RMEA 4NZCA 1ZBWA 2PPOA 3ARZA 2WLYA 4L72B 2M2AA 4Z2KA 2Y78A 1QPFA 4QT2A 1IX5A 3H9RB 2A3CA 3ARYA 1FKTA 1A7XA 4WJXA 4IT6A 2ZQSA 3IK8A 1ROTA 1HKJA 3RM8A 2XP3A 1R9HA 5HW8A 2DSVA 3AROA 3IKGA 1P5QA 4U84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KT1 A;  1J4I A;  3UI4 A;  1Y0O A;  4C02 B;  5B8I C;  5I98 A;  1F8A B;  3IK8 A;  4J4N A;  2XPB A;  3KZ7 A;  4JFJ A;  3JXV A;  1BKF A;  2RUQ A;  4ODL A;  3UQB A;  1FKF A;  2JZV A;  2LJ4 A;  1QPL A;  3UQI A;  3O5R A;  4TW7 A;  3WH0 A;  2ITK A;  1JNS A;  3KAH A;  4W9Q A;  3O5K A;  3O5M A;  4ODQ A;  3CGN A;  3NI6 A;  4QIB A;  4TYO A;  2KO7 A;  5GPG A;  4DH0 A;  4MSP A;  4LAX A;  2XP5 A;  4IQC A;  3EY6 A;  2PV3 A;  2KR7 A;  3RGC A;  4ODM A;  4W9O A;  2RSE A;  2DG9 A;  4ODN A;  4ODO A;  2MLX A;  2DG3 A;  4LAW A;  4DRM A;  4IPX A;  5HT1 A;  1J4R A;  3O5Q A;  2FKE A;  2XP6 A;  3PRB A;  4GIV A;  4W9P A;  2ZR6 A;  1FKK A;  3CGM A;  1FKR A;  1YAT A;  2L2S A;  1F40 A;  1PBK A;  1ZK6 A;  2F4E A;  5DIT A;  2PV2 A;  1M5Y A;  3KAF A;  3KAB A;  4ITZ A;  5HTG A;  3KCE A;  3MDY B;  2XPA A;  4ODR A;  4DRK A;  1Q1C A;  4DRI A;  1J6Y A;  3UI6 A;  3JYJ A;  2KI3 A;  5HUA A;  2RQS A;  3B7X A;  4DZ2 A;  1TCO C;  4DRN A;  1FKS A;  1YW5 A;  3O5D A;  4J4O A;  2Q5A A;  3O5L A;  1W26 A;  4JFI A;  3UF8 A;  4DIP A;  3LUO A;  4DRJ A;  3ODK A;  2D9F A;  1KT0 A;  3O5P A;  1J4H A;  2RUD A;  4JYS A;  5J6E A;  3O5G A;  5HKG A;  3GPK A;  5BXJ A;  4BF8 A;  4FAP A;  1NMV A;  3UQA A;  4MGV A;  4NNR A;  3IKD A;  1ZCN A;  1FAP A;  3KAG A;  4DZ3 A;  5HWB A;  1HXV A;  2FAP A;  1FKD A;  2ZR5 A;  1B6C A;  1N1A A;  3IHZ A;  3KAD A;  4G2P A;  4U85 A;  1NMW A;  4DRO A;  4QT3 A;  2DG4 A;  2ZR4 A;  3KAI A;  5HW7 A;  2MLZ A;  4TX0 A;  2LGO A;  3PRD A;  3NTP A;  4JFM A;  4LAV A;  1FKI A;  4TW8 A;  2PBC A;  4G50 A;  1FKG A;  4N19 A;  1FKB A;  4TW6 A;  4JFL A;  2N87 A;  2K8I A;  2KE0 A;  2LKN A;  4R0X A;  3RFW A;  4DRP A;  2F2D A;  2VN1 A;  2ZQV A;  5D75 A;  3OOB A;  4DRH A;  2MF9 A;  1FKL A;  1PIN A;  3O5O A;  4DT4 A;  4TNS A;  5HW6 A;  2XP9 A;  3TC5 A;  3VAW A;  3PA7 A;  2ZQT A;  4DRQ A;  2RUR A;  2KFW A;  1JVW A;  3O5J A;  2OFN A;  1Q6I A;  2PPO A;  2PPP A;  3O5F A;  3NRK A;  2PPN A;  1EYM A;  2ZQU A;  1L1P A;  2VCD A;  1EQ3 A;  1D7H A;  2XP8 A;  1C9H A;  1JNT A;  2M2A A;  4ODP A;  1QZ2 A;  2LPV A;  1BL4 A;  2Y78 A;  1QPF A;  4QT2 A;  1NSG A;  2MLY A;  1FD9 A;  3H9R B;  3O5I A;  5DIU A;  3TDB A;  3I6C A;  5HWC A;  1FKT A;  2AWG A;  1A7X A;  4LAY A;  2PV1 A;  4ODK A;  3FAP A;  1D6O A;  1FKJ A;  1ROT A;  1Q6U A;  2F21 A;  2M1I A;  2IF4 A;  1T11 A;  2MPH A;  2XP3 A;  2ZQS A;  2KGJ A;  2MNT A;  2XP7 A;  4U86 A;  1Q6H A;  1R9H A;  1ROU A;  3KAC A;  3O5E A;  5HW8 A;  1FJD A;  4IQ2 A;  1U79 A;  2RUC A;  2UZ5 A;  4GGQ A;  1FKH A;  4O2T A;  5DIV A;  3JYM A;  3IKG A;  1D7J A;  2XP4 A;  1P5Q A;  3UI5 A;  1D7I A;  4JFK A;  4U84 A;  4FN2 A;  2M08 A;  3TCZ A; 
#chains in the Genus database with same CATH topology
 3BXW A;  1J4I A;  3UI4 A;  4C02 B;  1LL7 A;  5I98 A;  4J4N A;  3FXY A;  2XPB A;  3KZ7 A;  4ZPT R;  3ARP A;  3B8S A;  3CHC A;  2RUQ A;  1FKF A;  1W1T A;  3W4R A;  1JNS A;  2QF8 A;  1ZBC A;  4ODQ A;  2G41 A;  4LAX A;  4IQC A;  3EY6 A;  3ALG A;  4ODO A;  1LL4 A;  1EHN A;  4LAW A;  5HT1 A;  2FKE A;  1OWQ A;  4GIV A;  3WL0 A;  2ZR6 A;  1K9T A;  2L2S A;  2PV2 A;  2PN0 A;  1EIB A;  3KAB A;  4ITZ A;  5HBF A;  3ARU A;  2XPA A;  4Z2G A;  2RQS A;  4DZ2 A;  1YW5 A;  2EUL A;  3O5D A;  3WKZ A;  4JFI A;  4DRJ A;  1UR9 A;  2DSW A;  3IKD A;  5HWB A;  3IHZ A;  3ARW A;  5DF0 A;  2DG4 A;  3BMB A;  5HW7 A;  1HJX A;  3PRD A;  1ZB5 A;  2DT3 A;  1FKI A;  1FKG A;  3CZ8 A;  4JFL A;  2K8I A;  2KE0 A;  3WD3 A;  2WLZ A;  4Z2J A;  4DRH A;  2MF9 A;  4MNJ A;  3VAW A;  3RM9 A;  3WD0 A;  2A3B A;  4R5E A;  3O5F A;  1NWU A;  2PPN A;  5JH8 A;  1W9U A;  2ZQU A;  2DT0 A;  2VCD A;  1EQ3 A;  1D7H A;  2XP8 A;  1C9H A;  1E6P A;  4ODP A;  1L1P A;  4Z2I A;  1ZU8 A;  3O5I A;  3TDB A;  2PV1 A;  4LGX A;  1D6O A;  2OLH A;  3MDY B;  2M1I A;  2IF4 A;  4Q7N A;  1CTN A;  2KGJ A;  2MNT A;  1U79 A;  2RUC A;  2UZ5 A;  1FKH A;  4O2T A;  3JYM A;  1D7J A;  1H0G A;  2XP4 A;  1D7I A;  2M08 A;  3TCZ A;  4HAR A;  1KT1 A;  1HJW A;  5DEZ A;  4P8X A;  3AS1 A;  3JXV A;  1BKF A;  2JZV A;  1QPL A;  1ZBV A;  2ESC A;  3O5R A;  4HBE A;  4TW7 A;  1HKM A;  2ITK A;  3AS3 A;  4W9Q A;  3O5K A;  2DPE A;  5GPR A;  3CGN A;  3WH0 A;  4WKA A;  4TYO A;  1W1Y A;  4WKF A;  3OA5 A;  4W9O A;  2RSE A;  1LQ0 A;  4ODN A;  2MLX A;  2A3E A;  2O9O A;  4MNL A;  1X6L A;  1HJV A;  4ML4 A;  4DWS A;  4WIW A;  1FKK A;  2G8Z A;  3AS0 A;  3ARR A;  1XHG A;  4UDM A;  5HTG A;  4DRK A;  3UI6 A;  4P8V A;  1FKS A;  3O5L A;  1W26 A;  3ODK A;  4W5U A;  1HKI A;  3O5P A;  1RD6 A;  2DSZ A;  3O5G A;  1E9L A;  3GPK A;  4BF8 A;  1NMV A;  3KAG A;  1FAP A;  3UQI A;  4U85 A;  4G2P A;  4DRO A;  2P4V A;  2LGO A;  3RM4 A;  3NTP A;  1E6Z A;  1ITX A;  2PBC A;  4TW6 A;  1FKB A;  1UR8 A;  4R0X A;  2F2D A;  2ZQV A;  1GOI A;  1PIN A;  2XP9 A;  3TC5 A;  3ART A;  1JND A;  2O92 A;  3GU0 A;  3PA7 A;  4S3K A;  4ZPV R;  2KFW A;  3PR9 A;  4XAK A;  3O5J A;  2OFN A;  2PPP A;  3NRK A;  3WIJ A;  1EYM A;  1WNO A;  1JNT A;  3ARV A;  2LPV A;  3CHD A;  1SYT A;  2MLY A;  1FD9 A;  5DIU A;  2AOS A;  1OGB A;  2AWG A;  4LAY A;  4S3J A;  4ODK A;  2MPH A;  2F21 A;  1T11 A;  1Q6H A;  3O5E A;  1XRV A;  5GQB A;  1E6N A;  4GGQ A;  1W9V A;  4FN2 A;  2ETN A;  4ZS6 A;  2FDM A;  1Y0O A;  5B8I C;  3QOK A;  4PTM A;  1EDQ A;  4Z2L A;  1FFR A;  2WK2 A;  4WKH A;  2LJ4 A;  3UQB A;  4DWS C;  3KAH A;  3O5M A;  4P8U A;  3CHE A;  4ZPW R;  1LL6 A;  4NSB A;  4QIB A;  4DH0 A;  3WD4 A;  1WB0 A;  2XP5 A;  2KR7 A;  4ODM A;  3CH9 A;  3ALF A;  3ARX A;  2DG3 A;  4DRM A;  2B5U B;  1LG1 A;  2A3A A;  4IPX A;  4QZV B;  1J4R A;  3O5Q A;  1FKR A;  3WD2 A;  1F40 A;  3CHF A;  5DIT A;  1M5Y A;  4ODR A;  5HUA A;  1TCO C;  4KQZ A;  4DRN A;  3G6L A;  4J4O A;  2Q5A A;  2DT1 A;  3LUO A;  3B9E A;  2D9F A;  1J4H A;  4JYS A;  1E15 A;  5J6E A;  4AY1 A;  5HKG A;  4FAP A;  1OGG A;  3UQA A;  4DZ3 A;  1ZCN A;  2FAP A;  1FFQ A;  1GPF A;  1NMW A;  4QT3 A;  3ARQ A;  2ZR4 A;  1ZL1 A;  4TX0 A;  1D2K A;  3ARS A;  4TW8 A;  2DT2 A;  2IUZ A;  2LKN A;  4KR0 B;  4DRP A;  2VN1 A;  5D75 A;  2PI6 A;  3FY1 A;  3WQW A;  1KFW A;  4TNS A;  5HW6 A;  2ZQT A;  4DRQ A;  1JCH B;  1JVW A;  1JNE A;  1Q6I A;  1WAW A;  1E44 A;  1TFV A;  1QZ2 A;  1BL4 A;  1NSG A;  4MNM A;  4IT4 A;  3I6C A;  5HWC A;  3FAP A;  1FKJ A;  1HXV A;  1Q6U A;  5DIV A;  4DWS B;  3WL1 A;  4U86 A;  2XP7 A;  1NH6 A;  3KAC A;  1ROU A;  1GUV A;  3B9A A;  4URI A;  1FJD A;  3GTY X;  1LJY A;  4IQ2 A;  2B31 A;  4L3N A;  4MPK A;  2F23 A;  3UI5 A;  4JFK A;  3B9D A;  2YBT A;  1X6N A;  4P8W A;  3AQU A;  1F8A B;  4MNK A;  1ZBK A;  4JFJ A;  4MAV A;  4ODL A;  3WD1 A;  4Z2H A;  3NI6 A;  5GPG A;  2KO7 A;  4MSP A;  2PV3 A;  3RGC A;  2DG9 A;  3PRA A;  1LG2 A;  4MTV A;  3AS2 A;  2XP6 A;  3PRB A;  4W9P A;  3CGM A;  1W1P A;  5DO2 A;  1YAT A;  4DWS D;  1PBK A;  1ZK6 A;  2F4E A;  4Q22 A;  3KAF A;  2WM0 A;  3KCE A;  1W1V A;  1Q1C A;  4DRI A;  1J6Y A;  1NWR A;  2YBU A;  3JYJ A;  4WK9 A;  2KI3 A;  3B7X A;  1HKK A;  3UF8 A;  4DIP A;  1SR0 A;  1KT0 A;  2RUD A;  5BXJ A;  1H0I A;  4MGV A;  4NNR A;  1W9P A;  2ZR5 A;  1FKD A;  2DSU A;  1B6C A;  1N1A A;  3KAD A;  3KAI A;  1NWS A;  1VF8 A;  2MLZ A;  4LAV A;  4JFM A;  3G6M A;  1E6R A;  4G50 A;  4N19 A;  2N87 A;  3RFW A;  3OOB A;  1NWT A;  1FKL A;  1O6I A;  3O5O A;  4DT4 A;  3WQV A;  2RUR A;  4HBO A;  3RME A;  4NZC A;  1ZBW A;  2PPO A;  1GRJ A;  3ARZ A;  2WLY A;  4L72 B;  3EIP A;  2M2A A;  4Z2K A;  2Y78 A;  1QPF A;  4QT2 A;  1IX5 A;  3H9R B;  2A3C A;  3ARY A;  1FKT A;  1A7X A;  4WJX A;  4IT6 A;  2ZQS A;  3IK8 A;  1ROT A;  1HKJ A;  3RM8 A;  2XP3 A;  1R9H A;  5HW8 A;  2DSV A;  3ARO A;  3IKG A;  1P5Q A;  4U84 A; 
#chains in the Genus database with same CATH homology
 3BXW A;  1J4I A;  3UI4 A;  4C02 B;  1LL7 A;  5I98 A;  4J4N A;  3FXY A;  2XPB A;  3KZ7 A;  4ZPT R;  3ARP A;  3B8S A;  3CHC A;  2RUQ A;  1FKF A;  1W1T A;  3W4R A;  1JNS A;  2QF8 A;  1ZBC A;  4ODQ A;  2G41 A;  4LAX A;  4IQC A;  3EY6 A;  3ALG A;  4ODO A;  1LL4 A;  1EHN A;  4LAW A;  5HT1 A;  2FKE A;  1OWQ A;  4GIV A;  3WL0 A;  2ZR6 A;  1K9T A;  2L2S A;  2PV2 A;  1EIB A;  3KAB A;  4ITZ A;  5HBF A;  3ARU A;  2XPA A;  4Z2G A;  2RQS A;  4DZ2 A;  1YW5 A;  3O5D A;  3WKZ A;  4JFI A;  4DRJ A;  1UR9 A;  2DSW A;  3IKD A;  5HWB A;  3IHZ A;  3ARW A;  5DF0 A;  2DG4 A;  5HW7 A;  1HJX A;  3PRD A;  1ZB5 A;  2DT3 A;  1FKI A;  1FKG A;  3CZ8 A;  4JFL A;  2K8I A;  2KE0 A;  3WD3 A;  2WLZ A;  4Z2J A;  4DRH A;  2MF9 A;  4MNJ A;  3VAW A;  3RM9 A;  3WD0 A;  2A3B A;  4R5E A;  3O5F A;  1NWU A;  2PPN A;  5JH8 A;  1W9U A;  2ZQU A;  2DT0 A;  2VCD A;  1EQ3 A;  1D7H A;  2XP8 A;  1C9H A;  1E6P A;  4ODP A;  1L1P A;  4Z2I A;  1ZU8 A;  3O5I A;  3TDB A;  2PV1 A;  4LGX A;  1D6O A;  2OLH A;  3MDY B;  2M1I A;  2IF4 A;  4Q7N A;  1CTN A;  2KGJ A;  2MNT A;  1U79 A;  2RUC A;  2UZ5 A;  1FKH A;  4O2T A;  3JYM A;  1D7J A;  1H0G A;  2XP4 A;  1D7I A;  2M08 A;  3TCZ A;  4HAR A;  1KT1 A;  1HJW A;  5DEZ A;  4P8X A;  3AS1 A;  3JXV A;  1BKF A;  2JZV A;  1QPL A;  1ZBV A;  2ESC A;  3O5R A;  4HBE A;  4TW7 A;  1HKM A;  2ITK A;  3AS3 A;  4W9Q A;  3O5K A;  2DPE A;  5GPR A;  3CGN A;  3WH0 A;  4WKA A;  4TYO A;  1W1Y A;  4WKF A;  3OA5 A;  4W9O A;  2RSE A;  1LQ0 A;  4ODN A;  2MLX A;  2A3E A;  2O9O A;  4MNL A;  1X6L A;  1HJV A;  4ML4 A;  4DWS A;  4WIW A;  1FKK A;  2G8Z A;  3AS0 A;  3ARR A;  1XHG A;  5HTG A;  4DRK A;  3UI6 A;  4P8V A;  1FKS A;  3O5L A;  1W26 A;  3ODK A;  4W5U A;  1HKI A;  3O5P A;  1RD6 A;  2DSZ A;  3O5G A;  1E9L A;  3GPK A;  4BF8 A;  1NMV A;  3KAG A;  1FAP A;  3UQI A;  4U85 A;  4G2P A;  4DRO A;  2LGO A;  3RM4 A;  3NTP A;  1E6Z A;  1ITX A;  2PBC A;  4TW6 A;  1FKB A;  1UR8 A;  4R0X A;  2F2D A;  2ZQV A;  1GOI A;  1PIN A;  2XP9 A;  3TC5 A;  3ART A;  1JND A;  2O92 A;  3PA7 A;  4S3K A;  4ZPV R;  2KFW A;  3PR9 A;  4XAK A;  3O5J A;  2OFN A;  2PPP A;  3NRK A;  3WIJ A;  1EYM A;  1WNO A;  1JNT A;  3ARV A;  2LPV A;  3CHD A;  1SYT A;  2MLY A;  1FD9 A;  5DIU A;  2AOS A;  1OGB A;  2AWG A;  4LAY A;  4S3J A;  4ODK A;  2MPH A;  2F21 A;  1T11 A;  1Q6H A;  3O5E A;  1XRV A;  5GQB A;  1E6N A;  4GGQ A;  1W9V A;  4FN2 A;  4ZS6 A;  2FDM A;  1Y0O A;  5B8I C;  3QOK A;  4PTM A;  1EDQ A;  4Z2L A;  1FFR A;  2WK2 A;  4WKH A;  2LJ4 A;  3UQB A;  4DWS C;  3KAH A;  3O5M A;  4P8U A;  3CHE A;  4ZPW R;  1LL6 A;  4NSB A;  4QIB A;  4DH0 A;  3WD4 A;  1WB0 A;  2XP5 A;  2KR7 A;  4ODM A;  3CH9 A;  3ALF A;  3ARX A;  2DG3 A;  4DRM A;  1LG1 A;  2A3A A;  4IPX A;  4QZV B;  1J4R A;  3O5Q A;  1FKR A;  3WD2 A;  1F40 A;  3CHF A;  5DIT A;  1M5Y A;  4ODR A;  5HUA A;  1TCO C;  4KQZ A;  4DRN A;  3G6L A;  4J4O A;  2Q5A A;  2DT1 A;  3LUO A;  3B9E A;  2D9F A;  1J4H A;  4JYS A;  1E15 A;  5J6E A;  4AY1 A;  5HKG A;  4FAP A;  1OGG A;  3UQA A;  4DZ3 A;  1ZCN A;  2FAP A;  1FFQ A;  1GPF A;  1NMW A;  4QT3 A;  3ARQ A;  2ZR4 A;  1ZL1 A;  4TX0 A;  1D2K A;  3ARS A;  4TW8 A;  2DT2 A;  2IUZ A;  2LKN A;  4KR0 B;  4DRP A;  2VN1 A;  5D75 A;  2PI6 A;  3FY1 A;  3WQW A;  1KFW A;  4TNS A;  5HW6 A;  2ZQT A;  4DRQ A;  1JVW A;  1JNE A;  1Q6I A;  1WAW A;  1TFV A;  1QZ2 A;  1BL4 A;  1NSG A;  4MNM A;  4IT4 A;  3I6C A;  5HWC A;  3FAP A;  1FKJ A;  1HXV A;  1Q6U A;  5DIV A;  4DWS B;  3WL1 A;  4U86 A;  2XP7 A;  1NH6 A;  3KAC A;  1ROU A;  1GUV A;  3B9A A;  4URI A;  1FJD A;  4IQ2 A;  1LJY A;  2B31 A;  4L3N A;  4MPK A;  3UI5 A;  4JFK A;  3B9D A;  2YBT A;  1X6N A;  4P8W A;  3AQU A;  1F8A B;  4MNK A;  1ZBK A;  4JFJ A;  4MAV A;  4ODL A;  3WD1 A;  4Z2H A;  3NI6 A;  5GPG A;  2KO7 A;  4MSP A;  2PV3 A;  3RGC A;  2DG9 A;  3PRA A;  1LG2 A;  4MTV A;  3AS2 A;  2XP6 A;  3PRB A;  4W9P A;  3CGM A;  1W1P A;  5DO2 A;  1YAT A;  4DWS D;  1PBK A;  1ZK6 A;  2F4E A;  4Q22 A;  3KAF A;  2WM0 A;  3KCE A;  1W1V A;  1Q1C A;  4DRI A;  1J6Y A;  1NWR A;  2YBU A;  3JYJ A;  4WK9 A;  2KI3 A;  3B7X A;  1HKK A;  3UF8 A;  4DIP A;  1SR0 A;  1KT0 A;  2RUD A;  5BXJ A;  1H0I A;  4MGV A;  4NNR A;  1W9P A;  2ZR5 A;  1FKD A;  2DSU A;  1B6C A;  1N1A A;  3KAD A;  3KAI A;  1NWS A;  1VF8 A;  2MLZ A;  4LAV A;  4JFM A;  3G6M A;  1E6R A;  4G50 A;  4N19 A;  2N87 A;  3RFW A;  3OOB A;  1NWT A;  1FKL A;  1O6I A;  3O5O A;  4DT4 A;  3WQV A;  2RUR A;  4HBO A;  3RME A;  4NZC A;  1ZBW A;  2PPO A;  3ARZ A;  2WLY A;  4L72 B;  2M2A A;  4Z2K A;  2Y78 A;  1QPF A;  4QT2 A;  1IX5 A;  3H9R B;  2A3C A;  3ARY A;  1FKT A;  1A7X A;  4WJX A;  4IT6 A;  2ZQS A;  3IK8 A;  1ROT A;  1HKJ A;  3RM8 A;  2XP3 A;  1R9H A;  5HW8 A;  2DSV A;  3ARO A;  3IKG A;  1P5Q A;  4U84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...