4LAVA

Crystal structure analysis of fkbp52, crystal form ii
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
APLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
publication title Crystal Structures of the Free and Ligand-Bound FK1-FK2 Domain Segment of FKBP52 Reveal a Flexible Inter-Domain Hinge.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 58
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4lavA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4lavA02
4LAXA 1J4IA 2K8IA 1FKTA 4TX0A 3GPKA 4J4NA 5DIUA 1HXVA 3RFWA 4JFLA 5HUAA 3O5QA 1JNTA 2PV3A 1J6YA 1D7HA 2RUQA 1FKHA 4DRIA 3B7XA 2M1IA 4R0XA 3UI4A 1P5QA 3KAFA 3CGNA 1J4HA 4DIPA 5I98A 3CGMA 3TC5A 4BF8A 1FJDA 3O5PA 3I6CA 2ZR4A 1PINA 1C9HA 1NMVA 2Y78A 4TYOA 4DRMA 1D6OA 2F4EA 2DG4A 3O5FA 2RURA 4FN2A 2AWGA 2MPHA 5DIVA 3KADA 1FKFA 4TW7A 1NSGA 1FKLA 1KT0A 2MF9A 2MLYA 3KZ7A 5HW8A 1FKBA 2RQSA 4W9PA 4G50A 4ITZA 2F2DA 2ITKA 3O5MA 2KR7A 1ROTA 2UZ5A 2XP6A 4IPXA 2ZQTA 1Q6HA 2IF4A 4JFJA 3IHZA 4FAPA 3IKDA 2ZR6A 5HTGA 2PPPA 2RUCA 3KABA 4LAWA 4ODQA 3NRKA 3IKGA 3O5RA 4QT3A 4ODOA 2LKNA 1D7IA 3ODKA 4MGVA 4MSPA 2PPNA 3UF8A 2MNTA 1YW5A 1B6CA 5HWCA 3PRDA 1F8AB 4NNRA 1BKFA 2KGJA 2M08A 3O5DA 4DRJA 3O5KA 2XP8A 2MLZA 1M5YA 4GIVA 4C02B 5D75A 4DRPA 4JYSA 3EY6A 2D9FA 3KAHA 1PBKA 1Q6IA 2DG9A 4DRQA 1FKRA 2KO7A 2XP9A 1TCOC 1FKKA 1FKIA 3O5LA 3TDBA 1FKGA 2FKEA 2FAPA 4W9QA 2RSEA 5J6EA 1YATA 1N1AA 4LAVA 3KCEA 3KACA 2PPOA 3UI6A 2PV1A 3LUOA 3NI6A 3O5JA 4J4OA 3MDYB 5HW7A 1D7JA 1Y0OA 2LJ4A 5HT1A 4JFMA 4DROA 2Q5AA 5BXJA 2XPAA 4DT4A 2XP3A 5HW6A 3UI5A 2KE0A 1FKJA 5B8IC 4ODRA 3UQIA 1FD9A 2DG3A 2PBCA 4DRHA 4GGQA 3UQBA 2KFWA 4IQCA 1KT1A 3OOBA 1EQ3A 3IK8A 1U79A 3O5GA 5HWBA 2VN1A 4DZ3A 2ZQUA 3WH0A 3KAIA 3O5IA 4IQ2A 2ZR5A 3O5OA 3VAWA 1FKSA 2XP4A 1ZK6A 3NTPA 3O5EA 3RGCA 1NMWA 4U85A 3TCZA 1W26A 4ODKA 4JFKA 2XPBA 3PRBA 2N87A 4ODPA 1A7XA 2PV2A 1JNSA 5DITA 1Q6UA 2XP7A 2XP5A 1T11A 4DRKA 4O2TA 5GPGA 4DZ2A 3JYJA 4JFIA 4U86A 2ZQVA 3H9RB 4DRNA 4QIBA 4LAYA 2MLXA 3FAPA 1EYMA 1FKDA 4U84A 2LGOA 1FAPA 2JZVA 2RUDA 3KAGA 4DH0A 1QPLA 4N19A 1F40A 2L2SA 1QPFA 4TNSA 1ROUA 4G2PA 2KI3A 2ZQSA 3PA7A 4QT2A 3UQAA 1ZCNA 2OFNA 4TW6A 1BL4A 2VCDA 1J4RA 1JVWA 2LPVA 4ODLA 4W9OA 2M2AA 3JXVA 3JYMA 2F21A 4TW8A 5HKGA 1R9HA 4ODMA 1L1PA 1Q1CA 4ODNA 1QZ2A
chains in the Genus database with same CATH superfamily
1ZU8A 1E9LA 1FKTA 3RFWA 4DWSA 3CH9A 2PV3A 4R0XA 4PTMA 3CGNA 4DIPA 3CGMA 3O5PA 1C9HA 1E6PA 2G41A 4FN2A 2RURA 4MNLA 5DIVA 1D2KA 1E6ZA 3KZ7A 5HW8A 4ZPTR 1FKBA 4W9PA 2F2DA 4WK9A 2ITKA 2ZQTA 4FAPA 5HTGA 3ARSA 2AOSA 3ARQA 3BMBA 1X6NA 4ODOA 3WD0A 3UF8A 3W4RA 1NWSA 2MLZA 4DRPA 1ZBKA 2D9FA 1Q6IA 3G6LA 2KO7A 3ALFA 1LG1A 1FKGA 4W9QA 3WL0A 2FDMA 2RSEA 3CHDA 3ARYA 3KCEA 3KACA 3UI6A 3O5JA 4J4OA 2WLYA 4JFMA 2O92A 1FKJA 1FD9A 1W1VA 1GOIA 1EIBA 3UQBA 2YBTA 4IQCA 1KT1A 1EQ3A 2VN1A 4DWSD 3WH0A 4HARA 3VAWA 2XP4A 1ZK6A 3TCZA 1NMWA 1UR8A 4KR0B 4MTVA 1HKKA 3WD1A 2N87A 4W5UA 1A7XA 2PV2A 1E6NA 1T11A 2PN0A 5GPGA 4NSBA 3H9RB 1OGGA 4QIBA 1TFVA 4U84A 2JZVA 3KAGA 4DWSC 3RM8A 2L2SA 4TNSA 3CHFA 2ZQSA 3PA7A 4QT2A 4XAKA 3QOKA 2OFNA 4TW6A 1BL4A 1EDQA 1J4RA 4ZPWR 3AS2A 2M2AA 3JXVA 3JYMA 4Z2HA 1R9HA 4ODMA 2DSWA 4LAXA 1NWTA 1ZBCA 5GPRA 2K8IA 2PI6A 4TX0A 4J4NA 2A3BA 4JFLA 5HUAA 4IT6A 1HKJA 1FKHA 3B7XA 3UI4A 3GU0A 1LQ0A 1K9TA 5I98A 1EHNA 4MPKA 4TYOA 4DWSB 1FFQA 2EULA 1FKLA 3FXYA 2RQSA 4G50A 1LG2A 4L3NA 2UZ5A 4IPXA 4Q7NA 2ZR6A 2PPPA 4ODQA 3KABA 4LAWA 4URIA 4QT3A 3ARXA 1D7IA 2OLHA 3ODKA 4MGVA 2MNTA 1B6CA 5HWCA 1ZL1A 2KGJA 2M08A 3O5DA 3O5KA 2A3EA 4GIVA 4JYSA 3EY6A 3KAHA 1PBKA 2DG9A 1WAWA 3ARRA 1X6LA 4P8UA 1TCOC 1FKKA 2DT3A 1FKIA 3AROA 3O5LA 4Q22A 4HBEA 4P8XA 2WM0A 1LL4A 5J6EA 1WNOA 2PPOA 3B9EA 2PV1A 3MDYB 4IT4A 1SR0A 3ARTA 1D7JA 1SYTA 3ARPA 2XPAA 2XP3A 4MNKA 2ETNA 2DT2A 2KFWA 3BXWA 1XHGA 2YBUA 3IK8A 3O5GA 3CHCA 4DZ3A 1W1PA 3O5IA 5HBFA 1FKSA 3O5EA 4UDMA 3WD3A 3AS1A 4S3JA 1JNSA 2XP5A 1W1YA 3G6MA 4DRKA 3GTYX 4WKAA 3WL1A 4DZ2A 3JYJA 4JFIA 4U86A 2ZQVA 4LAYA 4Z2IA 2MLXA 3FAPA 1EYMA 4WKHA 2RUDA 4DH0A 1QPLA 1QPFA 2QF8A 3WQWA 4ODLA 2VCDA 4W9OA 5HKGA 2Q5AA 1Q1CA 2A3AA 4Z2LA 1J4IA 3GPKA 2DT0A 1GRJA 1JNTA 1WB0A 1J6YA 1D7HA 1JCHB 3KAFA 1J4HA 4KQZA 4BF8A 1FJDA 1PINA 2Y78A 1D6OA 2AWGA 2MPHA 1FKFA 1NWUA 4TW7A 4ZS6A 1H0GA 1LL7A 1NSGA 1KT0A 2MLYA 5DEZA 5DF0A 4ITZA 3WD2A 4AY1A 1GUVA 3RMEA 2RUCA 3B9DA 3NRKA 3IKGA 1LJYA 3AS0A 1YW5A 1HJVA 1E6RA 1M5YA 5D75A 3CZ8A 2WLZA 1W9PA 4DRQA 1LL6A 1FKRA 2XP9A 4P8WA 2FKEA 2FAPA 1XRVA 4ML4A 3LUOA 3NI6A 4Z2GA 5HW7A 1Y0OA 5HT1A 1ITXA 1E15A 5BXJA 4MNMA 3AQUA 3WKZA 4DT4A 5HW6A 5JH8A 2DSVA 3UQIA 1HJWA 2DG3A 4DRHA 4GGQA 1VF8A 1ZBWA 3OOBA 1U79A 2ZQUA 3KAIA 2ZR5A 3O5OA 3RGCA 4U85A 1W26A 4R5EA 4JFKA 2XPBA 3PRBA 4ODPA 3WQVA 1RD6A 5DITA 1Q6UA 3B8SA 4NZCA 3WIJA 3CHEA 1O6IA 2A3CA 1KFWA 3PRAA 4N19A 1HJXA 1JNEA 1ROUA 4G2PA 2KI3A 2DPEA 4P8VA 1OGBA 1HKIA 1NH6A 5GQBA 3OA5A 1CTNA 4TW8A 2F21A 3ARUA 1E44A 1L1PA 5DIUA 1HXVA 1W1TA 2P4VA 3O5QA 1JNDA 2RUQA 4MNJA 4DRIA 1GPFA 1ZBVA 2M1IA 4QZVB 1P5QA 3TC5A 3I6CA 2ZR4A 1NMVA 4DRMA 2G8ZA 2F4EA 4ZPVR 2DG4A 3O5FA 1FFRA 5DO2A 3KADA 2MF9A 2O9OA 4Z2KA 3O5MA 2KR7A 1ROTA 2XP6A 1Q6HA 2IF4A 4JFJA 3IHZA 3IKDA 2DT1A 1W9UA 3RM4A 3O5RA 2LKNA 4MSPA 2PPNA 3PRDA 1F8AB 4NNRA 1BKFA 4DRJA 2XP8A 4C02B 3TDBA 4WKFA 3ALGA 1YATA 1N1AA 3ARVA 3PR9A 4LAVA 1HKMA 1NWRA 1H0IA 3ARWA 1UR9A 3EIPA 1W9VA 2LJ4A 2ESCA 4DROA 3UI5A 2KE0A 4LGXA 5B8IC 4ODRA 2PBCA 3ARZA 4L72B 5HWBA 1IX5A 4IQ2A 4MAVA 4WIWA 3B9AA 2WK2A 1ZB5A 3NTPA 4HBOA 4ODKA 1OWQA 2DSZA 3RM9A 3WD4A 2XP7A 4O2TA 3FY1A 4WJXA 4DRNA 2B31A 4Z2JA 2F23A 1FKDA 2LGOA 1FAPA 1F40A 2B5UB 2DSUA 3UQAA 1ZCNA 2LPVA 1JVWA 4S3KA 2IUZA 3AS3A 4ODNA 1QZ2A
chains in the Genus database with same CATH topology
1ZU8A 1E9LA 1FKTA 3RFWA 4DWSA 3CH9A 2PV3A 4R0XA 4PTMA 3CGNA 4DIPA 3CGMA 3O5PA 1C9HA 1E6PA 2G41A 4FN2A 2RURA 4MNLA 5DIVA 1D2KA 1E6ZA 3KZ7A 5HW8A 4ZPTR 1FKBA 4W9PA 2F2DA 4WK9A 2ITKA 2ZQTA 4FAPA 5HTGA 3ARSA 2AOSA 3ARQA 1X6NA 4ODOA 3WD0A 3UF8A 3W4RA 1NWSA 2MLZA 4DRPA 1ZBKA 2D9FA 1Q6IA 3G6LA 2KO7A 3ALFA 1LG1A 1FKGA 4W9QA 3WL0A 2FDMA 2RSEA 3CHDA 3ARYA 3KCEA 3KACA 3UI6A 3O5JA 4J4OA 2WLYA 4JFMA 2O92A 1FKJA 1FD9A 1W1VA 1GOIA 1EIBA 3UQBA 2YBTA 4IQCA 1KT1A 1EQ3A 2VN1A 4DWSD 3WH0A 4HARA 3VAWA 2XP4A 1ZK6A 3TCZA 1NMWA 1UR8A 4KR0B 4MTVA 1HKKA 3WD1A 2N87A 4W5UA 1A7XA 2PV2A 1E6NA 1T11A 5GPGA 4NSBA 3H9RB 1OGGA 4QIBA 1TFVA 4U84A 2JZVA 3KAGA 4DWSC 3RM8A 2L2SA 4TNSA 3CHFA 2ZQSA 3PA7A 4QT2A 4XAKA 3QOKA 2OFNA 4TW6A 1BL4A 1EDQA 1J4RA 4ZPWR 3AS2A 2M2AA 3JXVA 3JYMA 4Z2HA 1R9HA 4ODMA 2DSWA 4LAXA 1NWTA 1ZBCA 5GPRA 2K8IA 2PI6A 4TX0A 4J4NA 2A3BA 4JFLA 5HUAA 4IT6A 1HKJA 1FKHA 3B7XA 3UI4A 1LQ0A 1K9TA 5I98A 1EHNA 4MPKA 4TYOA 4DWSB 1FFQA 1FKLA 3FXYA 2RQSA 4G50A 1LG2A 4L3NA 2UZ5A 4IPXA 4Q7NA 2ZR6A 2PPPA 4ODQA 3KABA 4LAWA 4URIA 4QT3A 3ARXA 1D7IA 2OLHA 3ODKA 4MGVA 2MNTA 1B6CA 5HWCA 1ZL1A 2KGJA 2M08A 3O5DA 3O5KA 2A3EA 4GIVA 4JYSA 3EY6A 3KAHA 1PBKA 2DG9A 1WAWA 3ARRA 1X6LA 4P8UA 1TCOC 1FKKA 2DT3A 1FKIA 3AROA 3O5LA 4Q22A 4HBEA 4P8XA 2WM0A 1LL4A 5J6EA 1WNOA 2PPOA 3B9EA 2PV1A 3MDYB 4IT4A 1SR0A 3ARTA 1D7JA 1SYTA 3ARPA 2XPAA 2XP3A 4MNKA 2DT2A 2KFWA 3BXWA 1XHGA 2YBUA 3IK8A 3O5GA 3CHCA 4DZ3A 1W1PA 3O5IA 5HBFA 1FKSA 3O5EA 3WD3A 3AS1A 4S3JA 1JNSA 2XP5A 1W1YA 3G6MA 4DRKA 4WKAA 3WL1A 4DZ2A 3JYJA 4JFIA 4U86A 2ZQVA 4LAYA 4Z2IA 2MLXA 3FAPA 1EYMA 4WKHA 2RUDA 4DH0A 1QPLA 1QPFA 2QF8A 3WQWA 4ODLA 2VCDA 4W9OA 5HKGA 2Q5AA 1Q1CA 2A3AA 4Z2LA 1J4IA 3GPKA 2DT0A 1JNTA 1WB0A 1J6YA 1D7HA 3KAFA 1J4HA 4KQZA 4BF8A 1FJDA 1PINA 2Y78A 1D6OA 2AWGA 2MPHA 1NWUA 1FKFA 4TW7A 4ZS6A 1H0GA 1LL7A 1NSGA 1KT0A 2MLYA 5DEZA 5DF0A 4ITZA 3WD2A 4AY1A 1GUVA 3RMEA 2RUCA 3B9DA 3NRKA 3IKGA 1LJYA 3AS0A 1YW5A 1HJVA 1E6RA 1M5YA 5D75A 3CZ8A 2WLZA 1W9PA 4DRQA 1LL6A 1FKRA 2XP9A 4P8WA 2FKEA 2FAPA 1XRVA 4ML4A 3LUOA 3NI6A 4Z2GA 5HW7A 1Y0OA 5HT1A 1ITXA 1E15A 5BXJA 4MNMA 3AQUA 3WKZA 4DT4A 5HW6A 5JH8A 2DSVA 3UQIA 1HJWA 2DG3A 4DRHA 4GGQA 1VF8A 1ZBWA 3OOBA 1U79A 2ZQUA 3KAIA 2ZR5A 3O5OA 3RGCA 4U85A 1W26A 4R5EA 4JFKA 2XPBA 3PRBA 4ODPA 3WQVA 1RD6A 5DITA 1Q6UA 3B8SA 4NZCA 3WIJA 3CHEA 1O6IA 2A3CA 1KFWA 3PRAA 4N19A 1HJXA 1JNEA 1ROUA 4G2PA 2KI3A 2DPEA 4P8VA 1OGBA 1HKIA 1NH6A 5GQBA 3OA5A 1CTNA 4TW8A 2F21A 3ARUA 1L1PA 5DIUA 1HXVA 1W1TA 3O5QA 1JNDA 2RUQA 4MNJA 4DRIA 1GPFA 1ZBVA 2M1IA 4QZVB 1P5QA 3TC5A 3I6CA 2ZR4A 1NMVA 4DRMA 2G8ZA 2F4EA 4ZPVR 2DG4A 3O5FA 1FFRA 5DO2A 3KADA 2MF9A 2O9OA 4Z2KA 3O5MA 2KR7A 1ROTA 2XP6A 1Q6HA 2IF4A 4JFJA 3IHZA 3IKDA 2DT1A 1W9UA 3RM4A 3O5RA 2LKNA 4MSPA 2PPNA 3PRDA 1F8AB 4NNRA 1BKFA 4DRJA 2XP8A 4C02B 3TDBA 4WKFA 3ALGA 1YATA 1N1AA 3ARVA 3PR9A 4LAVA 1HKMA 1NWRA 1H0IA 3ARWA 1UR9A 1W9VA 2LJ4A 2ESCA 4DROA 3UI5A 2KE0A 4LGXA 5B8IC 4ODRA 2PBCA 3ARZA 4L72B 5HWBA 1IX5A 4IQ2A 4MAVA 4WIWA 3B9AA 2WK2A 1ZB5A 3NTPA 4HBOA 4ODKA 1OWQA 2DSZA 3RM9A 3WD4A 2XP7A 4O2TA 3FY1A 4WJXA 4DRNA 2B31A 4Z2JA 1FKDA 2LGOA 1FAPA 1F40A 2DSUA 3UQAA 1ZCNA 2LPVA 1JVWA 4S3KA 2IUZA 3AS3A 4ODNA 1QZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAX A;  1J4I A;  2K8I A;  1FKT A;  4TX0 A;  3GPK A;  4J4N A;  5DIU A;  1HXV A;  3RFW A;  4JFL A;  5HUA A;  3O5Q A;  1JNT A;  2PV3 A;  1J6Y A;  1D7H A;  2RUQ A;  1FKH A;  4DRI A;  3B7X A;  2M1I A;  4R0X A;  3UI4 A;  1P5Q A;  3KAF A;  3CGN A;  1J4H A;  4DIP A;  5I98 A;  3CGM A;  3TC5 A;  4BF8 A;  1FJD A;  3O5P A;  3I6C A;  2ZR4 A;  1PIN A;  1C9H A;  1NMV A;  2Y78 A;  4TYO A;  4DRM A;  1D6O A;  2F4E A;  2DG4 A;  3O5F A;  2RUR A;  4FN2 A;  2AWG A;  2MPH A;  5DIV A;  3KAD A;  1FKF A;  4TW7 A;  1NSG A;  1FKL A;  1KT0 A;  2MF9 A;  2MLY A;  3KZ7 A;  5HW8 A;  1FKB A;  2RQS A;  4W9P A;  4G50 A;  4ITZ A;  2F2D A;  2ITK A;  3O5M A;  2KR7 A;  1ROT A;  2UZ5 A;  2XP6 A;  4IPX A;  2ZQT A;  1Q6H A;  2IF4 A;  4JFJ A;  3IHZ A;  4FAP A;  3IKD A;  2ZR6 A;  5HTG A;  2PPP A;  2RUC A;  3KAB A;  4LAW A;  4ODQ A;  3NRK A;  3IKG A;  3O5R A;  4QT3 A;  4ODO A;  2LKN A;  1D7I A;  3ODK A;  4MGV A;  4MSP A;  2PPN A;  3UF8 A;  2MNT A;  1YW5 A;  1B6C A;  5HWC A;  3PRD A;  1F8A B;  4NNR A;  1BKF A;  2KGJ A;  2M08 A;  3O5D A;  4DRJ A;  3O5K A;  2XP8 A;  2MLZ A;  1M5Y A;  4GIV A;  4C02 B;  5D75 A;  4DRP A;  4JYS A;  3EY6 A;  2D9F A;  3KAH A;  1PBK A;  1Q6I A;  2DG9 A;  4DRQ A;  1FKR A;  2KO7 A;  2XP9 A;  1TCO C;  1FKK A;  1FKI A;  3O5L A;  3TDB A;  1FKG A;  2FKE A;  2FAP A;  4W9Q A;  2RSE A;  5J6E A;  1YAT A;  1N1A A;  4LAV A;  3KCE A;  3KAC A;  2PPO A;  3UI6 A;  2PV1 A;  3LUO A;  3NI6 A;  3O5J A;  4J4O A;  3MDY B;  5HW7 A;  1D7J A;  1Y0O A;  2LJ4 A;  5HT1 A;  4JFM A;  4DRO A;  2Q5A A;  5BXJ A;  2XPA A;  4DT4 A;  2XP3 A;  5HW6 A;  3UI5 A;  2KE0 A;  1FKJ A;  5B8I C;  4ODR A;  3UQI A;  1FD9 A;  2DG3 A;  2PBC A;  4DRH A;  4GGQ A;  3UQB A;  2KFW A;  4IQC A;  1KT1 A;  3OOB A;  1EQ3 A;  3IK8 A;  1U79 A;  3O5G A;  5HWB A;  2VN1 A;  4DZ3 A;  2ZQU A;  3WH0 A;  3KAI A;  3O5I A;  4IQ2 A;  2ZR5 A;  3O5O A;  3VAW A;  1FKS A;  2XP4 A;  1ZK6 A;  3NTP A;  3O5E A;  3RGC A;  1NMW A;  4U85 A;  3TCZ A;  1W26 A;  4ODK A;  4JFK A;  2XPB A;  3PRB A;  2N87 A;  4ODP A;  1A7X A;  2PV2 A;  1JNS A;  5DIT A;  1Q6U A;  2XP7 A;  2XP5 A;  1T11 A;  4DRK A;  4O2T A;  5GPG A;  4DZ2 A;  3JYJ A;  4JFI A;  4U86 A;  2ZQV A;  3H9R B;  4DRN A;  4QIB A;  4LAY A;  2MLX A;  3FAP A;  1EYM A;  1FKD A;  4U84 A;  2LGO A;  1FAP A;  2JZV A;  2RUD A;  3KAG A;  4DH0 A;  1QPL A;  4N19 A;  1F40 A;  2L2S A;  1QPF A;  4TNS A;  1ROU A;  4G2P A;  2KI3 A;  2ZQS A;  3PA7 A;  4QT2 A;  3UQA A;  1ZCN A;  2OFN A;  4TW6 A;  1BL4 A;  2VCD A;  1J4R A;  1JVW A;  2LPV A;  4ODL A;  4W9O A;  2M2A A;  3JXV A;  3JYM A;  2F21 A;  4TW8 A;  5HKG A;  1R9H A;  4ODM A;  1L1P A;  1Q1C A;  4ODN A;  1QZ2 A; 
#chains in the Genus database with same CATH topology
 1ZU8 A;  1E9L A;  1FKT A;  3RFW A;  4DWS A;  3CH9 A;  2PV3 A;  4R0X A;  4PTM A;  3CGN A;  4DIP A;  3CGM A;  3O5P A;  1C9H A;  1E6P A;  2G41 A;  4FN2 A;  2RUR A;  4MNL A;  5DIV A;  1D2K A;  1E6Z A;  3KZ7 A;  5HW8 A;  4ZPT R;  1FKB A;  4W9P A;  2F2D A;  4WK9 A;  2ITK A;  2ZQT A;  4FAP A;  5HTG A;  3ARS A;  2AOS A;  3ARQ A;  3BMB A;  1X6N A;  4ODO A;  3WD0 A;  3UF8 A;  3W4R A;  1NWS A;  2MLZ A;  4DRP A;  1ZBK A;  2D9F A;  1Q6I A;  3G6L A;  2KO7 A;  3ALF A;  1LG1 A;  1FKG A;  4W9Q A;  3WL0 A;  2FDM A;  2RSE A;  3CHD A;  3ARY A;  3KCE A;  3KAC A;  3UI6 A;  3O5J A;  4J4O A;  2WLY A;  4JFM A;  2O92 A;  1FKJ A;  1FD9 A;  1W1V A;  1GOI A;  1EIB A;  3UQB A;  2YBT A;  4IQC A;  1KT1 A;  1EQ3 A;  2VN1 A;  4DWS D;  3WH0 A;  4HAR A;  3VAW A;  2XP4 A;  1ZK6 A;  3TCZ A;  1NMW A;  1UR8 A;  4KR0 B;  4MTV A;  1HKK A;  3WD1 A;  2N87 A;  4W5U A;  1A7X A;  2PV2 A;  1E6N A;  1T11 A;  2PN0 A;  5GPG A;  4NSB A;  3H9R B;  1OGG A;  4QIB A;  1TFV A;  4U84 A;  2JZV A;  3KAG A;  4DWS C;  3RM8 A;  2L2S A;  4TNS A;  3CHF A;  2ZQS A;  3PA7 A;  4QT2 A;  4XAK A;  3QOK A;  2OFN A;  4TW6 A;  1BL4 A;  1EDQ A;  1J4R A;  4ZPW R;  3AS2 A;  2M2A A;  3JXV A;  3JYM A;  4Z2H A;  1R9H A;  4ODM A;  2DSW A;  4LAX A;  1NWT A;  1ZBC A;  5GPR A;  2K8I A;  2PI6 A;  4TX0 A;  4J4N A;  2A3B A;  4JFL A;  5HUA A;  4IT6 A;  1HKJ A;  1FKH A;  3B7X A;  3UI4 A;  3GU0 A;  1LQ0 A;  1K9T A;  5I98 A;  1EHN A;  4MPK A;  4TYO A;  4DWS B;  1FFQ A;  2EUL A;  1FKL A;  3FXY A;  2RQS A;  4G50 A;  1LG2 A;  4L3N A;  2UZ5 A;  4IPX A;  4Q7N A;  2ZR6 A;  2PPP A;  4ODQ A;  3KAB A;  4LAW A;  4URI A;  4QT3 A;  3ARX A;  1D7I A;  2OLH A;  3ODK A;  4MGV A;  2MNT A;  1B6C A;  5HWC A;  1ZL1 A;  2KGJ A;  2M08 A;  3O5D A;  3O5K A;  2A3E A;  4GIV A;  4JYS A;  3EY6 A;  3KAH A;  1PBK A;  2DG9 A;  1WAW A;  3ARR A;  1X6L A;  4P8U A;  1TCO C;  1FKK A;  2DT3 A;  1FKI A;  3ARO A;  3O5L A;  4Q22 A;  4HBE A;  4P8X A;  2WM0 A;  1LL4 A;  5J6E A;  1WNO A;  2PPO A;  3B9E A;  2PV1 A;  3MDY B;  4IT4 A;  1SR0 A;  3ART A;  1D7J A;  1SYT A;  3ARP A;  2XPA A;  2XP3 A;  4MNK A;  2ETN A;  2DT2 A;  2KFW A;  3BXW A;  1XHG A;  2YBU A;  3IK8 A;  3O5G A;  3CHC A;  4DZ3 A;  1W1P A;  3O5I A;  5HBF A;  1FKS A;  3O5E A;  4UDM A;  3WD3 A;  3AS1 A;  4S3J A;  1JNS A;  2XP5 A;  1W1Y A;  3G6M A;  4DRK A;  3GTY X;  4WKA A;  3WL1 A;  4DZ2 A;  3JYJ A;  4JFI A;  4U86 A;  2ZQV A;  4LAY A;  4Z2I A;  2MLX A;  3FAP A;  1EYM A;  4WKH A;  2RUD A;  4DH0 A;  1QPL A;  1QPF A;  2QF8 A;  3WQW A;  4ODL A;  2VCD A;  4W9O A;  5HKG A;  2Q5A A;  1Q1C A;  2A3A A;  4Z2L A;  1J4I A;  3GPK A;  2DT0 A;  1GRJ A;  1JNT A;  1WB0 A;  1J6Y A;  1D7H A;  1JCH B;  3KAF A;  1J4H A;  4KQZ A;  4BF8 A;  1FJD A;  1PIN A;  2Y78 A;  1D6O A;  2AWG A;  2MPH A;  1FKF A;  1NWU A;  4TW7 A;  4ZS6 A;  1H0G A;  1LL7 A;  1NSG A;  1KT0 A;  2MLY A;  5DEZ A;  5DF0 A;  4ITZ A;  3WD2 A;  4AY1 A;  1GUV A;  3RME A;  2RUC A;  3B9D A;  3NRK A;  3IKG A;  1LJY A;  3AS0 A;  1YW5 A;  1HJV A;  1E6R A;  1M5Y A;  5D75 A;  3CZ8 A;  2WLZ A;  1W9P A;  4DRQ A;  1LL6 A;  1FKR A;  2XP9 A;  4P8W A;  2FKE A;  2FAP A;  1XRV A;  4ML4 A;  3LUO A;  3NI6 A;  4Z2G A;  5HW7 A;  1Y0O A;  5HT1 A;  1ITX A;  1E15 A;  5BXJ A;  4MNM A;  3AQU A;  3WKZ A;  4DT4 A;  5HW6 A;  5JH8 A;  2DSV A;  3UQI A;  1HJW A;  2DG3 A;  4DRH A;  4GGQ A;  1VF8 A;  1ZBW A;  3OOB A;  1U79 A;  2ZQU A;  3KAI A;  2ZR5 A;  3O5O A;  3RGC A;  4U85 A;  1W26 A;  4R5E A;  4JFK A;  2XPB A;  3PRB A;  4ODP A;  3WQV A;  1RD6 A;  5DIT A;  1Q6U A;  3B8S A;  4NZC A;  3WIJ A;  3CHE A;  1O6I A;  2A3C A;  1KFW A;  3PRA A;  4N19 A;  1HJX A;  1JNE A;  1ROU A;  4G2P A;  2KI3 A;  2DPE A;  4P8V A;  1OGB A;  1HKI A;  1NH6 A;  5GQB A;  3OA5 A;  1CTN A;  4TW8 A;  2F21 A;  3ARU A;  1E44 A;  1L1P A;  5DIU A;  1HXV A;  1W1T A;  2P4V A;  3O5Q A;  1JND A;  2RUQ A;  4MNJ A;  4DRI A;  1GPF A;  1ZBV A;  2M1I A;  4QZV B;  1P5Q A;  3TC5 A;  3I6C A;  2ZR4 A;  1NMV A;  4DRM A;  2G8Z A;  2F4E A;  4ZPV R;  2DG4 A;  3O5F A;  1FFR A;  5DO2 A;  3KAD A;  2MF9 A;  2O9O A;  4Z2K A;  3O5M A;  2KR7 A;  1ROT A;  2XP6 A;  1Q6H A;  2IF4 A;  4JFJ A;  3IHZ A;  3IKD A;  2DT1 A;  1W9U A;  3RM4 A;  3O5R A;  2LKN A;  4MSP A;  2PPN A;  3PRD A;  1F8A B;  4NNR A;  1BKF A;  4DRJ A;  2XP8 A;  4C02 B;  3TDB A;  4WKF A;  3ALG A;  1YAT A;  1N1A A;  3ARV A;  3PR9 A;  4LAV A;  1HKM A;  1NWR A;  1H0I A;  3ARW A;  1UR9 A;  3EIP A;  1W9V A;  2LJ4 A;  2ESC A;  4DRO A;  3UI5 A;  2KE0 A;  4LGX A;  5B8I C;  4ODR A;  2PBC A;  3ARZ A;  4L72 B;  5HWB A;  1IX5 A;  4IQ2 A;  4MAV A;  4WIW A;  3B9A A;  2WK2 A;  1ZB5 A;  3NTP A;  4HBO A;  4ODK A;  1OWQ A;  2DSZ A;  3RM9 A;  3WD4 A;  2XP7 A;  4O2T A;  3FY1 A;  4WJX A;  4DRN A;  2B31 A;  4Z2J A;  2F23 A;  1FKD A;  2LGO A;  1FAP A;  1F40 A;  2B5U B;  2DSU A;  3UQA A;  1ZCN A;  2LPV A;  1JVW A;  4S3K A;  2IUZ A;  3AS3 A;  4ODN A;  1QZ2 A; 
#chains in the Genus database with same CATH homology
 1ZU8 A;  1E9L A;  1FKT A;  3RFW A;  4DWS A;  3CH9 A;  2PV3 A;  4R0X A;  4PTM A;  3CGN A;  4DIP A;  3CGM A;  3O5P A;  1C9H A;  1E6P A;  2G41 A;  4FN2 A;  2RUR A;  4MNL A;  5DIV A;  1D2K A;  1E6Z A;  3KZ7 A;  5HW8 A;  4ZPT R;  1FKB A;  4W9P A;  2F2D A;  4WK9 A;  2ITK A;  2ZQT A;  4FAP A;  5HTG A;  3ARS A;  2AOS A;  3ARQ A;  1X6N A;  4ODO A;  3WD0 A;  3UF8 A;  3W4R A;  1NWS A;  2MLZ A;  4DRP A;  1ZBK A;  2D9F A;  1Q6I A;  3G6L A;  2KO7 A;  3ALF A;  1LG1 A;  1FKG A;  4W9Q A;  3WL0 A;  2FDM A;  2RSE A;  3CHD A;  3ARY A;  3KCE A;  3KAC A;  3UI6 A;  3O5J A;  4J4O A;  2WLY A;  4JFM A;  2O92 A;  1FKJ A;  1FD9 A;  1W1V A;  1GOI A;  1EIB A;  3UQB A;  2YBT A;  4IQC A;  1KT1 A;  1EQ3 A;  2VN1 A;  4DWS D;  3WH0 A;  4HAR A;  3VAW A;  2XP4 A;  1ZK6 A;  3TCZ A;  1NMW A;  1UR8 A;  4KR0 B;  4MTV A;  1HKK A;  3WD1 A;  2N87 A;  4W5U A;  1A7X A;  2PV2 A;  1E6N A;  1T11 A;  5GPG A;  4NSB A;  3H9R B;  1OGG A;  4QIB A;  1TFV A;  4U84 A;  2JZV A;  3KAG A;  4DWS C;  3RM8 A;  2L2S A;  4TNS A;  3CHF A;  2ZQS A;  3PA7 A;  4QT2 A;  4XAK A;  3QOK A;  2OFN A;  4TW6 A;  1BL4 A;  1EDQ A;  1J4R A;  4ZPW R;  3AS2 A;  2M2A A;  3JXV A;  3JYM A;  4Z2H A;  1R9H A;  4ODM A;  2DSW A;  4LAX A;  1NWT A;  1ZBC A;  5GPR A;  2K8I A;  2PI6 A;  4TX0 A;  4J4N A;  2A3B A;  4JFL A;  5HUA A;  4IT6 A;  1HKJ A;  1FKH A;  3B7X A;  3UI4 A;  1LQ0 A;  1K9T A;  5I98 A;  1EHN A;  4MPK A;  4TYO A;  4DWS B;  1FFQ A;  1FKL A;  3FXY A;  2RQS A;  4G50 A;  1LG2 A;  4L3N A;  2UZ5 A;  4IPX A;  4Q7N A;  2ZR6 A;  2PPP A;  4ODQ A;  3KAB A;  4LAW A;  4URI A;  4QT3 A;  3ARX A;  1D7I A;  2OLH A;  3ODK A;  4MGV A;  2MNT A;  1B6C A;  5HWC A;  1ZL1 A;  2KGJ A;  2M08 A;  3O5D A;  3O5K A;  2A3E A;  4GIV A;  4JYS A;  3EY6 A;  3KAH A;  1PBK A;  2DG9 A;  1WAW A;  3ARR A;  1X6L A;  4P8U A;  1TCO C;  1FKK A;  2DT3 A;  1FKI A;  3ARO A;  3O5L A;  4Q22 A;  4HBE A;  4P8X A;  2WM0 A;  1LL4 A;  5J6E A;  1WNO A;  2PPO A;  3B9E A;  2PV1 A;  3MDY B;  4IT4 A;  1SR0 A;  3ART A;  1D7J A;  1SYT A;  3ARP A;  2XPA A;  2XP3 A;  4MNK A;  2DT2 A;  2KFW A;  3BXW A;  1XHG A;  2YBU A;  3IK8 A;  3O5G A;  3CHC A;  4DZ3 A;  1W1P A;  3O5I A;  5HBF A;  1FKS A;  3O5E A;  3WD3 A;  3AS1 A;  4S3J A;  1JNS A;  2XP5 A;  1W1Y A;  3G6M A;  4DRK A;  4WKA A;  3WL1 A;  4DZ2 A;  3JYJ A;  4JFI A;  4U86 A;  2ZQV A;  4LAY A;  4Z2I A;  2MLX A;  3FAP A;  1EYM A;  4WKH A;  2RUD A;  4DH0 A;  1QPL A;  1QPF A;  2QF8 A;  3WQW A;  4ODL A;  2VCD A;  4W9O A;  5HKG A;  2Q5A A;  1Q1C A;  2A3A A;  4Z2L A;  1J4I A;  3GPK A;  2DT0 A;  1JNT A;  1WB0 A;  1J6Y A;  1D7H A;  3KAF A;  1J4H A;  4KQZ A;  4BF8 A;  1FJD A;  1PIN A;  2Y78 A;  1D6O A;  2AWG A;  2MPH A;  1NWU A;  1FKF A;  4TW7 A;  4ZS6 A;  1H0G A;  1LL7 A;  1NSG A;  1KT0 A;  2MLY A;  5DEZ A;  5DF0 A;  4ITZ A;  3WD2 A;  4AY1 A;  1GUV A;  3RME A;  2RUC A;  3B9D A;  3NRK A;  3IKG A;  1LJY A;  3AS0 A;  1YW5 A;  1HJV A;  1E6R A;  1M5Y A;  5D75 A;  3CZ8 A;  2WLZ A;  1W9P A;  4DRQ A;  1LL6 A;  1FKR A;  2XP9 A;  4P8W A;  2FKE A;  2FAP A;  1XRV A;  4ML4 A;  3LUO A;  3NI6 A;  4Z2G A;  5HW7 A;  1Y0O A;  5HT1 A;  1ITX A;  1E15 A;  5BXJ A;  4MNM A;  3AQU A;  3WKZ A;  4DT4 A;  5HW6 A;  5JH8 A;  2DSV A;  3UQI A;  1HJW A;  2DG3 A;  4DRH A;  4GGQ A;  1VF8 A;  1ZBW A;  3OOB A;  1U79 A;  2ZQU A;  3KAI A;  2ZR5 A;  3O5O A;  3RGC A;  4U85 A;  1W26 A;  4R5E A;  4JFK A;  2XPB A;  3PRB A;  4ODP A;  3WQV A;  1RD6 A;  5DIT A;  1Q6U A;  3B8S A;  4NZC A;  3WIJ A;  3CHE A;  1O6I A;  2A3C A;  1KFW A;  3PRA A;  4N19 A;  1HJX A;  1JNE A;  1ROU A;  4G2P A;  2KI3 A;  2DPE A;  4P8V A;  1OGB A;  1HKI A;  1NH6 A;  5GQB A;  3OA5 A;  1CTN A;  4TW8 A;  2F21 A;  3ARU A;  1L1P A;  5DIU A;  1HXV A;  1W1T A;  3O5Q A;  1JND A;  2RUQ A;  4MNJ A;  4DRI A;  1GPF A;  1ZBV A;  2M1I A;  4QZV B;  1P5Q A;  3TC5 A;  3I6C A;  2ZR4 A;  1NMV A;  4DRM A;  2G8Z A;  2F4E A;  4ZPV R;  2DG4 A;  3O5F A;  1FFR A;  5DO2 A;  3KAD A;  2MF9 A;  2O9O A;  4Z2K A;  3O5M A;  2KR7 A;  1ROT A;  2XP6 A;  1Q6H A;  2IF4 A;  4JFJ A;  3IHZ A;  3IKD A;  2DT1 A;  1W9U A;  3RM4 A;  3O5R A;  2LKN A;  4MSP A;  2PPN A;  3PRD A;  1F8A B;  4NNR A;  1BKF A;  4DRJ A;  2XP8 A;  4C02 B;  3TDB A;  4WKF A;  3ALG A;  1YAT A;  1N1A A;  3ARV A;  3PR9 A;  4LAV A;  1HKM A;  1NWR A;  1H0I A;  3ARW A;  1UR9 A;  1W9V A;  2LJ4 A;  2ESC A;  4DRO A;  3UI5 A;  2KE0 A;  4LGX A;  5B8I C;  4ODR A;  2PBC A;  3ARZ A;  4L72 B;  5HWB A;  1IX5 A;  4IQ2 A;  4MAV A;  4WIW A;  3B9A A;  2WK2 A;  1ZB5 A;  3NTP A;  4HBO A;  4ODK A;  1OWQ A;  2DSZ A;  3RM9 A;  3WD4 A;  2XP7 A;  4O2T A;  3FY1 A;  4WJX A;  4DRN A;  2B31 A;  4Z2J A;  1FKD A;  2LGO A;  1FAP A;  1F40 A;  2DSU A;  3UQA A;  1ZCN A;  2LPV A;  1JVW A;  4S3K A;  2IUZ A;  3AS3 A;  4ODN A;  1QZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...