4LAVA

Crystal structure analysis of fkbp52, crystal form ii
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
APLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Free and Ligand-Bound FK1-FK2 Domain Segment of FKBP52 Reveal a Flexible Inter-Domain Hinge.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
total genus 58
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4lavA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4lavA02
5DIUA 2KFWA 3UQAA 1QPLA 2XPAA 4J4NA 4TW8A 2M1IA 3UF8A 3IKGA 1JNTA 4QIBA 1KT0A 2ZQSA 3KAIA 4C02B 3O5DA 2PV1A 3LUOA 1FKDA 5GPGA 4DIPA 4DRNA 2XP4A 4ODNA 3KACA 4TX0A 2XP6A 2MPHA 4ODPA 3UI5A 4DH0A 1U79A 3B7XA 1FKGA 3JYJA 2F4EA 4DRJA 3PRBA 5HT1A 4DRIA 4ITZA 2ZQTA 4MSPA 2XP3A 3IKDA 3KAFA 3JXVA 3KZ7A 1Q6IA 3RGCA 1BKFA 1D7JA 3MDYB 1W26A 2RQSA 4DRPA 1FKBA 1D6OA 2FAPA 3O5GA 4FAPA 1N1AA 2ZR5A 1FJDA 2KGJA 3GPKA 3ODKA 1ROTA 4ODKA 1JNSA 3O5QA 3PRDA 4TW7A 2ZQVA 2PPPA 5HW6A 3O5EA 1FKHA 3IK8A 4JYSA 3NI6A 1Q6UA 2MNTA 5HWBA 2LJ4A 4JFKA 1YATA 2M2AA 5B8IC 4FN2A 4BF8A 2RURA 4U84A 1QPFA 1D7HA 1ZK6A 2MF9A 1T11A 3WH0A 1F40A 3H9RB 2N87A 3NRKA 1R9HA 2XP8A 1B6CA 4J4OA 4TNSA 1FKIA 3KAGA 4NNRA 1FKJA 3FAPA 4G50A 1EQ3A 2RSEA 2AWGA 2MLXA 4W9OA 5DITA 2XP5A 3O5IA 4U86A 2DG4A 4DZ3A 5I98A 4IQ2A 4LAWA 4GIVA 2XP9A 4JFJA 4ODMA 4IPXA 1BL4A 4JFLA 5DIVA 5HW7A 1FD9A 1HXVA 4TW6A 2JZVA 1FKLA 2LGOA 1FKRA 2LPVA 4DRHA 1NMVA 2FKEA 4LAYA 5HWCA 4O2TA 1NSGA 4MGVA 1L1PA 1EYMA 2DG3A 4ODOA 4DT4A 3O5JA 2Y78A 3TC5A 4JFIA 2KE0A 2F21A 2Q5AA 4TYOA 1D7IA 1P5QA 4QT2A 2PPOA 1JVWA 2PPNA 1J4HA 3KCEA 4LAXA 2OFNA 2ZR4A 3O5FA 2KI3A 3O5MA 1ROUA 4U85A 1PINA 1TCOC 4DRQA 5HKGA 3RFWA 2KO7A 1Q6HA 1Y0OA 2DG9A 3CGMA 3O5LA 1FKSA 4G2PA 2VCDA 2PV2A 2K8IA 1M5YA 2MLYA 2PBCA 2RUQA 1QZ2A 1J6YA 3KABA 3O5PA 2M08A 1KT1A 2ZR6A 3NTPA 2F2DA 1F8AB 1Q1CA 4GGQA 1A7XA 2XPBA 3PA7A 3I6CA 3OOBA 4DRKA 4R0XA 4IQCA 4ODLA 1NMWA 2KR7A 2XP7A 3KAHA 2VN1A 2L2SA 4ODRA 3CGNA 1FKFA 3O5OA 4DROA 2MLZA 4W9PA 4JFMA 1PBKA 3UI6A 1J4IA 2ZQUA 3KADA 5HTGA 1C9HA 3TDBA 2D9FA 3IHZA 3TCZA 4DRMA 4ODQA 1FKTA 5HUAA 3O5RA 3UQIA 5HW8A 3EY6A 3JYMA 4N19A 3VAWA 5J6EA 2IF4A 2RUDA 3O5KA 2UZ5A 2ITKA 1ZCNA 1J4RA 5D75A 3UI4A 2LKNA 2RUCA 4LAVA 4QT3A 2PV3A 5BXJA 4W9QA 4DZ2A 1FAPA 1YW5A 1FKKA 3UQBA
chains in the Genus database with same CATH superfamily
3PR9A 2DSUA 2PV1A 3LUOA 5GPGA 4ODNA 4AY1A 4TX0A 2XP6A 1U79A 2YBUA 1D2KA 4HARA 4DRIA 1W1VA 1HKJA 4MSPA 3RGCA 3KAFA 3JXVA 1Q6IA 4MNLA 3CHEA 1HJXA 1EHNA 3ARPA 4ODKA 4DWSB 1ROTA 3WL1A 1E9LA 5HW6A 1WB0A 1FKHA 3NI6A 1LG1A 2MNTA 1LJYA 4KQZA 2LJ4A 2F23A 1YATA 2M2AA 4S3JA 2RURA 2B31A 1R9HA 4NNRA 3FAPA 3ARWA 5HW8A 2MLXA 2DSWA 4DZ3A 3B9AA 3WD3A 5DF0A 3ARVA 4GIVA 1W1YA 1NH6A 4JFJA 1BL4A 3ARSA 1XRVA 1L1PA 2DG3A 4WKHA 2Y78A 1KFWA 2B5UB 4LGXA 1P5QA 1E44A 1K9TA 4WKFA 2KI3A 3BXWA 1H0GA 4DWSA 2A3AA 1FFQA 4MNJA 1Y0OA 1HJWA 2DT2A 3FXYA 2VCDA 1M5YA 4XAKA 2DSZA 1GOIA 3NTPA 4Z2IA 2F2DA 1F8AB 2XPBA 2O9OA 4DRKA 4R0XA 2PN0A 4HBOA 2KR7A 2XP7A 3ALFA 3UI6A 1J4IA 3KADA 5HTGA 3TCZA 1W9PA 4N19A 1HKIA 3EIPA 3UI4A 5DEZA 3WL0A 1JCHB 4QT3A 2PV3A 4NZCA 5DIUA 3ARQA 1QPLA 1SR0A 4J4NA 4TW8A 4P8WA 4WJXA 1JNTA 1VF8A 2ZQSA 4C02B 1FKDA 4MNKA 3AS1A 4DH0A 1OGBA 2DT0A 3JYJA 1CTNA 1ZU8A 3PRBA 2ZQTA 2ETNA 2XP3A 3IKDA 4WK9A 1BKFA 1D7JA 3WQVA 4DRPA 2DPEA 2FAPA 1FJDA 1H0IA 2DSVA 2KGJA 1LQ0A 3OA5A 3ODKA 3O5QA 1ZBVA 2ZQVA 2PPPA 1GUVA 4JFKA 1NWRA 2MF9A 2WLZA 3WD1A 1F40A 2N87A 4TNSA 1OWQA 1FKIA 2YBTA 4G50A 2RSEA 2AWGA 2XP5A 3O5IA 4U86A 2DG4A 4P8UA 4IQ2A 2DT1A 4LAWA 4ODMA 5DIVA 4JFLA 3ARRA 5HW7A 1E6PA 2LGOA 1FFRA 1WNOA 5HWCA 1NSGA 1EYMA 4ODOA 4DWSC 4R5EA 3TC5A 1GRJA 3RMEA 4LAXA 1ZBWA 3O5MA 3ARUA 3AS0A 1TCOC 5HKGA 1ZB5A 2KO7A 2DG9A 2G8ZA 1IX5A 1OGGA 2PV2A 2K8IA 2RUQA 2PBCA 4Z2LA 1QZ2A 4Q7NA 1J6YA 3KABA 2M08A 1X6NA 4GGQA 1A7XA 4NSBA 3WD2A 3PA7A 3I6CA 4ODLA 2A3EA 2L2SA 3CGNA 4Z2GA 2ESCA 4JFMA 2WK2A 1C9HA 1W1PA 1E6NA 1E6RA 3ARTA 1FKTA 4ODQA 3ARZA 3JYMA 5J6EA 3O5KA 1ZCNA 3BMBA 1XHGA 5D75A 1W9VA 1LL7A 4W9QA 1FKLA 4Z2HA 1YW5A 3UQBA 2XPAA 3UF8A 3IKGA 3W4RA 4L3NA 4Q22A 1KT0A 2WM0A 4DRNA 1RD6A 1JNEA 3KACA 1LG2A 2MPHA 1FKGA 2F4EA 4DRJA 2P4VA 5HT1A 3B9EA 4URIA 3MDYB 1GPFA 1W26A 2RQSA 1X6LA 4MTVA 3ARYA 2A3CA 3CHDA 1N1AA 4W5UA 1JNSA 3GTYX 1HJVA 3O5EA 2DT3A 4JYSA 3QOKA 1Q6UA 5HWBA 1ZBCA 1E15A 5HBFA 2QF8A 5B8IC 4MNMA 1D7HA 1ZK6A 4ZPTR 1T11A 3H9RB 3NRKA 4J4OA 2XP8A 1B6CA 1EQ3A 1FKJA 1ITXA 2XP9A 4IPXA 2EULA 4TW6A 1EIBA 4Z2JA 2LPVA 2FKEA 4LAYA 4O2TA 1O6IA 4MGVA 4DT4A 4MPKA 5DO2A 3FY1A 2KE0A 2F21A 2Q5AA 2G41A 4TYOA 1D7IA 4QT2A 2PPOA 3WQWA 2O92A 3O5FA 1ROUA 1UR8A 2IUZA 1PINA 3B9DA 3RFWA 1Q6HA 1FKSA 4G2PA 1ZL1A 4UDMA 3RM8A 3CZ8A 3O5PA 4MAVA 1Q1CA 1NWUA 1W1TA 3WD4A 4IQCA 4QZVB 5GQBA 1NMWA 3KAHA 3AQUA 1HKMA 2AOSA 4S3KA 1FKFA 3O5OA 4DROA 2MLZA 4W9PA 1PBKA 5GPRA 3O5RA 4WKAA 1HKKA 1NWTA 3VAWA 2UZ5A 2RUCA 4LAVA 5BXJA 1FAPA 1UR9A 3O5DA 4W9OA 3ARXA 4WIWA 2KFWA 3UQAA 2M1IA 4QIBA 3KAIA 4DIPA 2XP4A 3UI5A 4ODPA 3B7XA 3B8SA 4ITZA 4ML4A 4ZS6A 3KZ7A 3CHCA 3WKZA 1FKBA 3GU0A 1D6OA 3G6MA 3O5GA 4FAPA 2ZR5A 3GPKA 2FDMA 5JH8A 3PRDA 4IT4A 4TW7A 3CH9A 3IK8A 1TFVA 1JNDA 1W9UA 2WLYA 4FN2A 4BF8A 4U84A 1NWSA 1QPFA 2A3BA 3RM9A 3WH0A 2OLHA 3KAGA 3WD0A 3AS2A 5DITA 3RM4A 5I98A 1EDQA 1HXVA 4IT6A 1FD9A 3ALGA 2JZVA 1FKRA 4L72B 3PRAA 4DRHA 1NMVA 3CHFA 3G6LA 1LL6A 3O5JA 3WIJA 4JFIA 1JVWA 2PPNA 1J4HA 3KCEA 3AROA 2OFNA 2ZR4A 4U85A 4DRQA 3O5LA 4DWSD 3CGMA 2MLYA 1KT1A 2ZR6A 1SYTA 1LL4A 3OOBA 1ZBKA 4P8XA 1E6ZA 2VN1A 4PTMA 1WAWA 4ODRA 2PI6A 4HBEA 4Z2KA 2ZQUA 3TDBA 4DRMA 2D9FA 3IHZA 5HUAA 4P8VA 4KR0B 4ZPWR 3UQIA 3EY6A 2IF4A 2RUDA 2ITKA 1J4RA 4ZPVR 2LKNA 3AS3A 4DZ2A 1FKKA
chains in the Genus database with same CATH topology
3PR9A 2DSUA 2PV1A 3LUOA 5GPGA 4ODNA 4AY1A 4TX0A 2XP6A 1U79A 2YBUA 1D2KA 4HARA 4DRIA 1W1VA 1HKJA 4MSPA 3RGCA 3KAFA 3JXVA 1Q6IA 4MNLA 3CHEA 1HJXA 1EHNA 3ARPA 4ODKA 4DWSB 1ROTA 3WL1A 1E9LA 5HW6A 1WB0A 1FKHA 3NI6A 1LG1A 2MNTA 1LJYA 4KQZA 2LJ4A 1YATA 2M2AA 4S3JA 2RURA 2B31A 1R9HA 4NNRA 3FAPA 3ARWA 5HW8A 2MLXA 2DSWA 4DZ3A 3B9AA 3WD3A 5DF0A 3ARVA 4GIVA 1W1YA 1NH6A 4JFJA 1BL4A 3ARSA 1XRVA 1L1PA 2DG3A 4WKHA 2Y78A 1KFWA 4LGXA 1P5QA 1K9TA 4WKFA 2KI3A 3BXWA 1H0GA 4DWSA 2A3AA 1FFQA 4MNJA 1Y0OA 1HJWA 2DT2A 3FXYA 2VCDA 1M5YA 4XAKA 2DSZA 1GOIA 3NTPA 4Z2IA 2F2DA 1F8AB 2XPBA 2O9OA 4DRKA 4R0XA 4HBOA 2KR7A 2XP7A 3ALFA 3UI6A 1J4IA 3KADA 5HTGA 3TCZA 1W9PA 4N19A 1HKIA 3UI4A 5DEZA 3WL0A 4QT3A 2PV3A 4NZCA 5DIUA 3ARQA 1QPLA 1SR0A 4J4NA 4TW8A 4P8WA 4WJXA 1JNTA 1VF8A 2ZQSA 4C02B 1FKDA 4MNKA 3AS1A 4DH0A 1OGBA 2DT0A 3JYJA 1CTNA 1ZU8A 3PRBA 2ZQTA 2XP3A 3IKDA 4WK9A 1BKFA 1D7JA 3WQVA 4DRPA 2DPEA 2FAPA 1FJDA 1H0IA 2DSVA 2KGJA 1LQ0A 3OA5A 3ODKA 3O5QA 1ZBVA 2ZQVA 2PPPA 1GUVA 4JFKA 1NWRA 2MF9A 2WLZA 3WD1A 1F40A 2N87A 4TNSA 1OWQA 1FKIA 2YBTA 4G50A 2RSEA 2AWGA 2XP5A 3O5IA 4U86A 2DG4A 4P8UA 4IQ2A 2DT1A 4LAWA 4ODMA 5DIVA 4JFLA 3ARRA 5HW7A 1E6PA 2LGOA 1FFRA 1WNOA 5HWCA 1NSGA 1EYMA 4ODOA 4DWSC 4R5EA 3TC5A 3RMEA 4LAXA 1ZBWA 3O5MA 3ARUA 3AS0A 1TCOC 5HKGA 1ZB5A 2KO7A 2DG9A 2G8ZA 1IX5A 1OGGA 2PV2A 2K8IA 2RUQA 2PBCA 4Z2LA 1QZ2A 4Q7NA 1J6YA 3KABA 2M08A 1X6NA 4GGQA 1A7XA 4NSBA 3WD2A 3PA7A 3I6CA 4ODLA 2A3EA 2L2SA 3CGNA 4Z2GA 2ESCA 4JFMA 2WK2A 1C9HA 1W1PA 1E6NA 1E6RA 3ARTA 1FKTA 4ODQA 3ARZA 3JYMA 5J6EA 3O5KA 1ZCNA 1XHGA 5D75A 1W9VA 1LL7A 4W9QA 1FKLA 4Z2HA 1YW5A 3UQBA 2XPAA 3UF8A 3IKGA 3W4RA 4L3NA 4Q22A 1KT0A 2WM0A 4DRNA 1RD6A 1JNEA 3KACA 1LG2A 2MPHA 1FKGA 2F4EA 4DRJA 5HT1A 3B9EA 4URIA 3MDYB 1GPFA 1W26A 2RQSA 1X6LA 4MTVA 3ARYA 2A3CA 3CHDA 1N1AA 4W5UA 1JNSA 1HJVA 3O5EA 2DT3A 4JYSA 3QOKA 1Q6UA 5HWBA 1ZBCA 1E15A 5HBFA 2QF8A 5B8IC 4MNMA 1D7HA 1ZK6A 4ZPTR 1T11A 3H9RB 3NRKA 4J4OA 2XP8A 1B6CA 1EQ3A 1FKJA 1ITXA 2XP9A 4IPXA 4TW6A 1EIBA 4Z2JA 2LPVA 2FKEA 4LAYA 4O2TA 1O6IA 4MGVA 4DT4A 4MPKA 5DO2A 3FY1A 2KE0A 2F21A 2Q5AA 2G41A 4TYOA 1D7IA 4QT2A 2PPOA 3WQWA 2O92A 3O5FA 1ROUA 1UR8A 2IUZA 1PINA 3B9DA 3RFWA 1Q6HA 1FKSA 4G2PA 1ZL1A 3RM8A 3CZ8A 3O5PA 4MAVA 1Q1CA 1NWUA 1W1TA 3WD4A 4IQCA 4QZVB 5GQBA 1NMWA 3KAHA 3AQUA 1HKMA 2AOSA 4S3KA 1FKFA 3O5OA 4DROA 2MLZA 4W9PA 1PBKA 5GPRA 3O5RA 4WKAA 1HKKA 1NWTA 3VAWA 2UZ5A 2RUCA 4LAVA 5BXJA 1FAPA 1UR9A 3O5DA 4W9OA 3ARXA 4WIWA 2KFWA 3UQAA 2M1IA 4QIBA 3KAIA 4DIPA 2XP4A 3UI5A 4ODPA 3B7XA 3B8SA 4ITZA 4ML4A 4ZS6A 3KZ7A 3CHCA 3WKZA 1FKBA 1D6OA 3G6MA 3O5GA 4FAPA 2ZR5A 3GPKA 2FDMA 5JH8A 3PRDA 4IT4A 4TW7A 3CH9A 3IK8A 1TFVA 1JNDA 1W9UA 2WLYA 4FN2A 4BF8A 4U84A 1NWSA 1QPFA 2A3BA 3RM9A 3WH0A 2OLHA 3KAGA 3WD0A 3AS2A 5DITA 3RM4A 5I98A 1EDQA 1HXVA 4IT6A 1FD9A 3ALGA 2JZVA 1FKRA 4L72B 3PRAA 4DRHA 1NMVA 3CHFA 3G6LA 1LL6A 3O5JA 3WIJA 4JFIA 1JVWA 2PPNA 1J4HA 3KCEA 3AROA 2OFNA 2ZR4A 4U85A 4DRQA 3O5LA 4DWSD 3CGMA 2MLYA 1KT1A 2ZR6A 1SYTA 1LL4A 3OOBA 1ZBKA 4P8XA 1E6ZA 2VN1A 4PTMA 1WAWA 4ODRA 2PI6A 4HBEA 4Z2KA 2ZQUA 3TDBA 4DRMA 2D9FA 3IHZA 5HUAA 4P8VA 4KR0B 4ZPWR 3UQIA 3EY6A 2IF4A 2RUDA 2ITKA 1J4RA 4ZPVR 2LKNA 3AS3A 4DZ2A 1FKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DIU A;  2KFW A;  3UQA A;  1QPL A;  2XPA A;  4J4N A;  4TW8 A;  2M1I A;  3UF8 A;  3IKG A;  1JNT A;  4QIB A;  1KT0 A;  2ZQS A;  3KAI A;  4C02 B;  3O5D A;  2PV1 A;  3LUO A;  1FKD A;  5GPG A;  4DIP A;  4DRN A;  2XP4 A;  4ODN A;  3KAC A;  4TX0 A;  2XP6 A;  2MPH A;  4ODP A;  3UI5 A;  4DH0 A;  1U79 A;  3B7X A;  1FKG A;  3JYJ A;  2F4E A;  4DRJ A;  3PRB A;  5HT1 A;  4DRI A;  4ITZ A;  2ZQT A;  4MSP A;  2XP3 A;  3IKD A;  3KAF A;  3JXV A;  3KZ7 A;  1Q6I A;  3RGC A;  1BKF A;  1D7J A;  3MDY B;  1W26 A;  2RQS A;  4DRP A;  1FKB A;  1D6O A;  2FAP A;  3O5G A;  4FAP A;  1N1A A;  2ZR5 A;  1FJD A;  2KGJ A;  3GPK A;  3ODK A;  1ROT A;  4ODK A;  1JNS A;  3O5Q A;  3PRD A;  4TW7 A;  2ZQV A;  2PPP A;  5HW6 A;  3O5E A;  1FKH A;  3IK8 A;  4JYS A;  3NI6 A;  1Q6U A;  2MNT A;  5HWB A;  2LJ4 A;  4JFK A;  1YAT A;  2M2A A;  5B8I C;  4FN2 A;  4BF8 A;  2RUR A;  4U84 A;  1QPF A;  1D7H A;  1ZK6 A;  2MF9 A;  1T11 A;  3WH0 A;  1F40 A;  3H9R B;  2N87 A;  3NRK A;  1R9H A;  2XP8 A;  1B6C A;  4J4O A;  4TNS A;  1FKI A;  3KAG A;  4NNR A;  1FKJ A;  3FAP A;  4G50 A;  1EQ3 A;  2RSE A;  2AWG A;  2MLX A;  4W9O A;  5DIT A;  2XP5 A;  3O5I A;  4U86 A;  2DG4 A;  4DZ3 A;  5I98 A;  4IQ2 A;  4LAW A;  4GIV A;  2XP9 A;  4JFJ A;  4ODM A;  4IPX A;  1BL4 A;  4JFL A;  5DIV A;  5HW7 A;  1FD9 A;  1HXV A;  4TW6 A;  2JZV A;  1FKL A;  2LGO A;  1FKR A;  2LPV A;  4DRH A;  1NMV A;  2FKE A;  4LAY A;  5HWC A;  4O2T A;  1NSG A;  4MGV A;  1L1P A;  1EYM A;  2DG3 A;  4ODO A;  4DT4 A;  3O5J A;  2Y78 A;  3TC5 A;  4JFI A;  2KE0 A;  2F21 A;  2Q5A A;  4TYO A;  1D7I A;  1P5Q A;  4QT2 A;  2PPO A;  1JVW A;  2PPN A;  1J4H A;  3KCE A;  4LAX A;  2OFN A;  2ZR4 A;  3O5F A;  2KI3 A;  3O5M A;  1ROU A;  4U85 A;  1PIN A;  1TCO C;  4DRQ A;  5HKG A;  3RFW A;  2KO7 A;  1Q6H A;  1Y0O A;  2DG9 A;  3CGM A;  3O5L A;  1FKS A;  4G2P A;  2VCD A;  2PV2 A;  2K8I A;  1M5Y A;  2MLY A;  2PBC A;  2RUQ A;  1QZ2 A;  1J6Y A;  3KAB A;  3O5P A;  2M08 A;  1KT1 A;  2ZR6 A;  3NTP A;  2F2D A;  1F8A B;  1Q1C A;  4GGQ A;  1A7X A;  2XPB A;  3PA7 A;  3I6C A;  3OOB A;  4DRK A;  4R0X A;  4IQC A;  4ODL A;  1NMW A;  2KR7 A;  2XP7 A;  3KAH A;  2VN1 A;  2L2S A;  4ODR A;  3CGN A;  1FKF A;  3O5O A;  4DRO A;  2MLZ A;  4W9P A;  4JFM A;  1PBK A;  3UI6 A;  1J4I A;  2ZQU A;  3KAD A;  5HTG A;  1C9H A;  3TDB A;  2D9F A;  3IHZ A;  3TCZ A;  4DRM A;  4ODQ A;  1FKT A;  5HUA A;  3O5R A;  3UQI A;  5HW8 A;  3EY6 A;  3JYM A;  4N19 A;  3VAW A;  5J6E A;  2IF4 A;  2RUD A;  3O5K A;  2UZ5 A;  2ITK A;  1ZCN A;  1J4R A;  5D75 A;  3UI4 A;  2LKN A;  2RUC A;  4LAV A;  4QT3 A;  2PV3 A;  5BXJ A;  4W9Q A;  4DZ2 A;  1FAP A;  1YW5 A;  1FKK A;  3UQB A; 
#chains in the Genus database with same CATH topology
 3PR9 A;  2DSU A;  2PV1 A;  3LUO A;  5GPG A;  4ODN A;  4AY1 A;  4TX0 A;  2XP6 A;  1U79 A;  2YBU A;  1D2K A;  4HAR A;  4DRI A;  1W1V A;  1HKJ A;  4MSP A;  3RGC A;  3KAF A;  3JXV A;  1Q6I A;  4MNL A;  3CHE A;  1HJX A;  1EHN A;  3ARP A;  4ODK A;  4DWS B;  1ROT A;  3WL1 A;  1E9L A;  5HW6 A;  1WB0 A;  1FKH A;  3NI6 A;  1LG1 A;  2MNT A;  1LJY A;  4KQZ A;  2LJ4 A;  2F23 A;  1YAT A;  2M2A A;  4S3J A;  2RUR A;  2B31 A;  1R9H A;  4NNR A;  3FAP A;  3ARW A;  5HW8 A;  2MLX A;  2DSW A;  4DZ3 A;  3B9A A;  3WD3 A;  5DF0 A;  3ARV A;  4GIV A;  1W1Y A;  1NH6 A;  4JFJ A;  1BL4 A;  3ARS A;  1XRV A;  1L1P A;  2DG3 A;  4WKH A;  2Y78 A;  1KFW A;  2B5U B;  4LGX A;  1P5Q A;  1E44 A;  1K9T A;  4WKF A;  2KI3 A;  3BXW A;  1H0G A;  4DWS A;  2A3A A;  1FFQ A;  4MNJ A;  1Y0O A;  1HJW A;  2DT2 A;  3FXY A;  2VCD A;  1M5Y A;  4XAK A;  2DSZ A;  1GOI A;  3NTP A;  4Z2I A;  2F2D A;  1F8A B;  2XPB A;  2O9O A;  4DRK A;  4R0X A;  2PN0 A;  4HBO A;  2KR7 A;  2XP7 A;  3ALF A;  3UI6 A;  1J4I A;  3KAD A;  5HTG A;  3TCZ A;  1W9P A;  4N19 A;  1HKI A;  3EIP A;  3UI4 A;  5DEZ A;  3WL0 A;  1JCH B;  4QT3 A;  2PV3 A;  4NZC A;  5DIU A;  3ARQ A;  1QPL A;  1SR0 A;  4J4N A;  4TW8 A;  4P8W A;  4WJX A;  1JNT A;  1VF8 A;  2ZQS A;  4C02 B;  1FKD A;  4MNK A;  3AS1 A;  4DH0 A;  1OGB A;  2DT0 A;  3JYJ A;  1CTN A;  1ZU8 A;  3PRB A;  2ZQT A;  2ETN A;  2XP3 A;  3IKD A;  4WK9 A;  1BKF A;  1D7J A;  3WQV A;  4DRP A;  2DPE A;  2FAP A;  1FJD A;  1H0I A;  2DSV A;  2KGJ A;  1LQ0 A;  3OA5 A;  3ODK A;  3O5Q A;  1ZBV A;  2ZQV A;  2PPP A;  1GUV A;  4JFK A;  1NWR A;  2MF9 A;  2WLZ A;  3WD1 A;  1F40 A;  2N87 A;  4TNS A;  1OWQ A;  1FKI A;  2YBT A;  4G50 A;  2RSE A;  2AWG A;  2XP5 A;  3O5I A;  4U86 A;  2DG4 A;  4P8U A;  4IQ2 A;  2DT1 A;  4LAW A;  4ODM A;  5DIV A;  4JFL A;  3ARR A;  5HW7 A;  1E6P A;  2LGO A;  1FFR A;  1WNO A;  5HWC A;  1NSG A;  1EYM A;  4ODO A;  4DWS C;  4R5E A;  3TC5 A;  1GRJ A;  3RME A;  4LAX A;  1ZBW A;  3O5M A;  3ARU A;  3AS0 A;  1TCO C;  5HKG A;  1ZB5 A;  2KO7 A;  2DG9 A;  2G8Z A;  1IX5 A;  1OGG A;  2PV2 A;  2K8I A;  2RUQ A;  2PBC A;  4Z2L A;  1QZ2 A;  4Q7N A;  1J6Y A;  3KAB A;  2M08 A;  1X6N A;  4GGQ A;  1A7X A;  4NSB A;  3WD2 A;  3PA7 A;  3I6C A;  4ODL A;  2A3E A;  2L2S A;  3CGN A;  4Z2G A;  2ESC A;  4JFM A;  2WK2 A;  1C9H A;  1W1P A;  1E6N A;  1E6R A;  3ART A;  1FKT A;  4ODQ A;  3ARZ A;  3JYM A;  5J6E A;  3O5K A;  1ZCN A;  3BMB A;  1XHG A;  5D75 A;  1W9V A;  1LL7 A;  4W9Q A;  1FKL A;  4Z2H A;  1YW5 A;  3UQB A;  2XPA A;  3UF8 A;  3IKG A;  3W4R A;  4L3N A;  4Q22 A;  1KT0 A;  2WM0 A;  4DRN A;  1RD6 A;  1JNE A;  3KAC A;  1LG2 A;  2MPH A;  1FKG A;  2F4E A;  4DRJ A;  2P4V A;  5HT1 A;  3B9E A;  4URI A;  3MDY B;  1GPF A;  1W26 A;  2RQS A;  1X6L A;  4MTV A;  3ARY A;  2A3C A;  3CHD A;  1N1A A;  4W5U A;  1JNS A;  3GTY X;  1HJV A;  3O5E A;  2DT3 A;  4JYS A;  3QOK A;  1Q6U A;  5HWB A;  1ZBC A;  1E15 A;  5HBF A;  2QF8 A;  5B8I C;  4MNM A;  1D7H A;  1ZK6 A;  4ZPT R;  1T11 A;  3H9R B;  3NRK A;  4J4O A;  2XP8 A;  1B6C A;  1EQ3 A;  1FKJ A;  1ITX A;  2XP9 A;  4IPX A;  2EUL A;  4TW6 A;  1EIB A;  4Z2J A;  2LPV A;  2FKE A;  4LAY A;  4O2T A;  1O6I A;  4MGV A;  4DT4 A;  4MPK A;  5DO2 A;  3FY1 A;  2KE0 A;  2F21 A;  2Q5A A;  2G41 A;  4TYO A;  1D7I A;  4QT2 A;  2PPO A;  3WQW A;  2O92 A;  3O5F A;  1ROU A;  1UR8 A;  2IUZ A;  1PIN A;  3B9D A;  3RFW A;  1Q6H A;  1FKS A;  4G2P A;  1ZL1 A;  4UDM A;  3RM8 A;  3CZ8 A;  3O5P A;  4MAV A;  1Q1C A;  1NWU A;  1W1T A;  3WD4 A;  4IQC A;  4QZV B;  5GQB A;  1NMW A;  3KAH A;  3AQU A;  1HKM A;  2AOS A;  4S3K A;  1FKF A;  3O5O A;  4DRO A;  2MLZ A;  4W9P A;  1PBK A;  5GPR A;  3O5R A;  4WKA A;  1HKK A;  1NWT A;  3VAW A;  2UZ5 A;  2RUC A;  4LAV A;  5BXJ A;  1FAP A;  1UR9 A;  3O5D A;  4W9O A;  3ARX A;  4WIW A;  2KFW A;  3UQA A;  2M1I A;  4QIB A;  3KAI A;  4DIP A;  2XP4 A;  3UI5 A;  4ODP A;  3B7X A;  3B8S A;  4ITZ A;  4ML4 A;  4ZS6 A;  3KZ7 A;  3CHC A;  3WKZ A;  1FKB A;  3GU0 A;  1D6O A;  3G6M A;  3O5G A;  4FAP A;  2ZR5 A;  3GPK A;  2FDM A;  5JH8 A;  3PRD A;  4IT4 A;  4TW7 A;  3CH9 A;  3IK8 A;  1TFV A;  1JND A;  1W9U A;  2WLY A;  4FN2 A;  4BF8 A;  4U84 A;  1NWS A;  1QPF A;  2A3B A;  3RM9 A;  3WH0 A;  2OLH A;  3KAG A;  3WD0 A;  3AS2 A;  5DIT A;  3RM4 A;  5I98 A;  1EDQ A;  1HXV A;  4IT6 A;  1FD9 A;  3ALG A;  2JZV A;  1FKR A;  4L72 B;  3PRA A;  4DRH A;  1NMV A;  3CHF A;  3G6L A;  1LL6 A;  3O5J A;  3WIJ A;  4JFI A;  1JVW A;  2PPN A;  1J4H A;  3KCE A;  3ARO A;  2OFN A;  2ZR4 A;  4U85 A;  4DRQ A;  3O5L A;  4DWS D;  3CGM A;  2MLY A;  1KT1 A;  2ZR6 A;  1SYT A;  1LL4 A;  3OOB A;  1ZBK A;  4P8X A;  1E6Z A;  2VN1 A;  4PTM A;  1WAW A;  4ODR A;  2PI6 A;  4HBE A;  4Z2K A;  2ZQU A;  3TDB A;  4DRM A;  2D9F A;  3IHZ A;  5HUA A;  4P8V A;  4KR0 B;  4ZPW R;  3UQI A;  3EY6 A;  2IF4 A;  2RUD A;  2ITK A;  1J4R A;  4ZPV R;  2LKN A;  3AS3 A;  4DZ2 A;  1FKK A; 
#chains in the Genus database with same CATH homology
 3PR9 A;  2DSU A;  2PV1 A;  3LUO A;  5GPG A;  4ODN A;  4AY1 A;  4TX0 A;  2XP6 A;  1U79 A;  2YBU A;  1D2K A;  4HAR A;  4DRI A;  1W1V A;  1HKJ A;  4MSP A;  3RGC A;  3KAF A;  3JXV A;  1Q6I A;  4MNL A;  3CHE A;  1HJX A;  1EHN A;  3ARP A;  4ODK A;  4DWS B;  1ROT A;  3WL1 A;  1E9L A;  5HW6 A;  1WB0 A;  1FKH A;  3NI6 A;  1LG1 A;  2MNT A;  1LJY A;  4KQZ A;  2LJ4 A;  1YAT A;  2M2A A;  4S3J A;  2RUR A;  2B31 A;  1R9H A;  4NNR A;  3FAP A;  3ARW A;  5HW8 A;  2MLX A;  2DSW A;  4DZ3 A;  3B9A A;  3WD3 A;  5DF0 A;  3ARV A;  4GIV A;  1W1Y A;  1NH6 A;  4JFJ A;  1BL4 A;  3ARS A;  1XRV A;  1L1P A;  2DG3 A;  4WKH A;  2Y78 A;  1KFW A;  4LGX A;  1P5Q A;  1K9T A;  4WKF A;  2KI3 A;  3BXW A;  1H0G A;  4DWS A;  2A3A A;  1FFQ A;  4MNJ A;  1Y0O A;  1HJW A;  2DT2 A;  3FXY A;  2VCD A;  1M5Y A;  4XAK A;  2DSZ A;  1GOI A;  3NTP A;  4Z2I A;  2F2D A;  1F8A B;  2XPB A;  2O9O A;  4DRK A;  4R0X A;  4HBO A;  2KR7 A;  2XP7 A;  3ALF A;  3UI6 A;  1J4I A;  3KAD A;  5HTG A;  3TCZ A;  1W9P A;  4N19 A;  1HKI A;  3UI4 A;  5DEZ A;  3WL0 A;  4QT3 A;  2PV3 A;  4NZC A;  5DIU A;  3ARQ A;  1QPL A;  1SR0 A;  4J4N A;  4TW8 A;  4P8W A;  4WJX A;  1JNT A;  1VF8 A;  2ZQS A;  4C02 B;  1FKD A;  4MNK A;  3AS1 A;  4DH0 A;  1OGB A;  2DT0 A;  3JYJ A;  1CTN A;  1ZU8 A;  3PRB A;  2ZQT A;  2XP3 A;  3IKD A;  4WK9 A;  1BKF A;  1D7J A;  3WQV A;  4DRP A;  2DPE A;  2FAP A;  1FJD A;  1H0I A;  2DSV A;  2KGJ A;  1LQ0 A;  3OA5 A;  3ODK A;  3O5Q A;  1ZBV A;  2ZQV A;  2PPP A;  1GUV A;  4JFK A;  1NWR A;  2MF9 A;  2WLZ A;  3WD1 A;  1F40 A;  2N87 A;  4TNS A;  1OWQ A;  1FKI A;  2YBT A;  4G50 A;  2RSE A;  2AWG A;  2XP5 A;  3O5I A;  4U86 A;  2DG4 A;  4P8U A;  4IQ2 A;  2DT1 A;  4LAW A;  4ODM A;  5DIV A;  4JFL A;  3ARR A;  5HW7 A;  1E6P A;  2LGO A;  1FFR A;  1WNO A;  5HWC A;  1NSG A;  1EYM A;  4ODO A;  4DWS C;  4R5E A;  3TC5 A;  3RME A;  4LAX A;  1ZBW A;  3O5M A;  3ARU A;  3AS0 A;  1TCO C;  5HKG A;  1ZB5 A;  2KO7 A;  2DG9 A;  2G8Z A;  1IX5 A;  1OGG A;  2PV2 A;  2K8I A;  2RUQ A;  2PBC A;  4Z2L A;  1QZ2 A;  4Q7N A;  1J6Y A;  3KAB A;  2M08 A;  1X6N A;  4GGQ A;  1A7X A;  4NSB A;  3WD2 A;  3PA7 A;  3I6C A;  4ODL A;  2A3E A;  2L2S A;  3CGN A;  4Z2G A;  2ESC A;  4JFM A;  2WK2 A;  1C9H A;  1W1P A;  1E6N A;  1E6R A;  3ART A;  1FKT A;  4ODQ A;  3ARZ A;  3JYM A;  5J6E A;  3O5K A;  1ZCN A;  1XHG A;  5D75 A;  1W9V A;  1LL7 A;  4W9Q A;  1FKL A;  4Z2H A;  1YW5 A;  3UQB A;  2XPA A;  3UF8 A;  3IKG A;  3W4R A;  4L3N A;  4Q22 A;  1KT0 A;  2WM0 A;  4DRN A;  1RD6 A;  1JNE A;  3KAC A;  1LG2 A;  2MPH A;  1FKG A;  2F4E A;  4DRJ A;  5HT1 A;  3B9E A;  4URI A;  3MDY B;  1GPF A;  1W26 A;  2RQS A;  1X6L A;  4MTV A;  3ARY A;  2A3C A;  3CHD A;  1N1A A;  4W5U A;  1JNS A;  1HJV A;  3O5E A;  2DT3 A;  4JYS A;  3QOK A;  1Q6U A;  5HWB A;  1ZBC A;  1E15 A;  5HBF A;  2QF8 A;  5B8I C;  4MNM A;  1D7H A;  1ZK6 A;  4ZPT R;  1T11 A;  3H9R B;  3NRK A;  4J4O A;  2XP8 A;  1B6C A;  1EQ3 A;  1FKJ A;  1ITX A;  2XP9 A;  4IPX A;  4TW6 A;  1EIB A;  4Z2J A;  2LPV A;  2FKE A;  4LAY A;  4O2T A;  1O6I A;  4MGV A;  4DT4 A;  4MPK A;  5DO2 A;  3FY1 A;  2KE0 A;  2F21 A;  2Q5A A;  2G41 A;  4TYO A;  1D7I A;  4QT2 A;  2PPO A;  3WQW A;  2O92 A;  3O5F A;  1ROU A;  1UR8 A;  2IUZ A;  1PIN A;  3B9D A;  3RFW A;  1Q6H A;  1FKS A;  4G2P A;  1ZL1 A;  3RM8 A;  3CZ8 A;  3O5P A;  4MAV A;  1Q1C A;  1NWU A;  1W1T A;  3WD4 A;  4IQC A;  4QZV B;  5GQB A;  1NMW A;  3KAH A;  3AQU A;  1HKM A;  2AOS A;  4S3K A;  1FKF A;  3O5O A;  4DRO A;  2MLZ A;  4W9P A;  1PBK A;  5GPR A;  3O5R A;  4WKA A;  1HKK A;  1NWT A;  3VAW A;  2UZ5 A;  2RUC A;  4LAV A;  5BXJ A;  1FAP A;  1UR9 A;  3O5D A;  4W9O A;  3ARX A;  4WIW A;  2KFW A;  3UQA A;  2M1I A;  4QIB A;  3KAI A;  4DIP A;  2XP4 A;  3UI5 A;  4ODP A;  3B7X A;  3B8S A;  4ITZ A;  4ML4 A;  4ZS6 A;  3KZ7 A;  3CHC A;  3WKZ A;  1FKB A;  1D6O A;  3G6M A;  3O5G A;  4FAP A;  2ZR5 A;  3GPK A;  2FDM A;  5JH8 A;  3PRD A;  4IT4 A;  4TW7 A;  3CH9 A;  3IK8 A;  1TFV A;  1JND A;  1W9U A;  2WLY A;  4FN2 A;  4BF8 A;  4U84 A;  1NWS A;  1QPF A;  2A3B A;  3RM9 A;  3WH0 A;  2OLH A;  3KAG A;  3WD0 A;  3AS2 A;  5DIT A;  3RM4 A;  5I98 A;  1EDQ A;  1HXV A;  4IT6 A;  1FD9 A;  3ALG A;  2JZV A;  1FKR A;  4L72 B;  3PRA A;  4DRH A;  1NMV A;  3CHF A;  3G6L A;  1LL6 A;  3O5J A;  3WIJ A;  4JFI A;  1JVW A;  2PPN A;  1J4H A;  3KCE A;  3ARO A;  2OFN A;  2ZR4 A;  4U85 A;  4DRQ A;  3O5L A;  4DWS D;  3CGM A;  2MLY A;  1KT1 A;  2ZR6 A;  1SYT A;  1LL4 A;  3OOB A;  1ZBK A;  4P8X A;  1E6Z A;  2VN1 A;  4PTM A;  1WAW A;  4ODR A;  2PI6 A;  4HBE A;  4Z2K A;  2ZQU A;  3TDB A;  4DRM A;  2D9F A;  3IHZ A;  5HUA A;  4P8V A;  4KR0 B;  4ZPW R;  3UQI A;  3EY6 A;  2IF4 A;  2RUD A;  2ITK A;  1J4R A;  4ZPV R;  2LKN A;  3AS3 A;  4DZ2 A;  1FKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...