4LAVA

Crystal structure analysis of fkbp52, crystal form ii
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
APLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
publication title Crystal Structures of the Free and Ligand-Bound FK1-FK2 Domain Segment of FKBP52 Reveal a Flexible Inter-Domain Hinge.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4lavA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4lavA02
4LAYA 2LJ4A 2MPHA 3I6CA 3O5PA 4C02B 1Q6IA 3CGNA 2XP3A 2XP6A 1Q6HA 1FAPA 3EY6A 1ROTA 2KI3A 3JYMA 4QT3A 2F4EA 3IK8A 3UI4A 3KZ7A 3VAWA 1JVWA 4MGVA 1D7IA 4TX0A 1ZK6A 3O5DA 3UQBA 4R0XA 4TW6A 2LGOA 5I98A 2M2AA 1D6OA 5HUAA 5HTGA 1FKSA 2DG9A 1QPFA 1Q1CA 2ITKA 1PBKA 2LKNA 2PV1A 3KABA 3LUOA 2VN1A 3ODKA 4JFIA 1FKTA 1FKKA 2M1IA 1FKBA 4U86A 4ODNA 4FAPA 4LAWA 2PBCA 5HKGA 2ZR6A 3O5IA 2PV3A 3RGCA 4DRNA 2KR7A 3O5OA 1JNSA 2M08A 2MNTA 3IKDA 3KAFA 5HW8A 1T11A 2FAPA 4GIVA 5D75A 2L2SA 4LAVA 1F8AB 2RUCA 4IQCA 3O5JA 2LPVA 4QT2A 4TW7A 2F2DA 5B8IC 1JNTA 1EYMA 5DIVA 3UQAA 4N19A 2XP8A 4ODPA 1FKGA 3JXVA 1NMVA 4G2PA 1PINA 2Q5AA 4MSPA 1R9HA 5HWCA 1FKLA 5HT1A 4J4OA 2N87A 2ZQSA 1N1AA 2KFWA 4DRHA 4NNRA 3MDYB 1J4RA 1L1PA 3OOBA 2MF9A 4TYOA 1P5QA 4ODMA 1Y0OA 1D7JA 1BKFA 1FKHA 2RQSA 3IHZA 3KAIA 2VCDA 2Y78A 2ZQUA 2XPAA 1Q6UA 3KADA 1FD9A 2RUQA 4DZ3A 4DRMA 1YATA 4ODLA 4TNSA 3PRBA 4DT4A 3IKGA 3NTPA 2RUDA 2KE0A 4JFKA 3JYJA 3TC5A 4O2TA 1ROUA 4G50A 3O5GA 3RFWA 4DRPA 2XP4A 4DRIA 2K8IA 2XP9A 2ZQTA 3O5QA 4JFJA 4W9OA 2XP5A 1HXVA 3KACA 4LAXA 2KGJA 2PPNA 1J4HA 3GPKA 3O5FA 3NRKA 4IPXA 4J4NA 3TCZA 4GGQA 4DZ2A 2MLXA 4U85A 4U84A 1B6CA 3TDBA 2FKEA 4ODQA 2KO7A 1D7HA 2ZR4A 4JYSA 3PA7A 3KAGA 3O5KA 2MLZA 4FN2A 2PV2A 4JFMA 4W9QA 4BF8A 5J6EA 4JFLA 2DG4A 4ITZA 2RSEA 1FKIA 1YW5A 2XPBA 3O5LA 2IF4A 4ODRA 1FKRA 1U79A 1M5YA 3FAPA 4DIPA 1FKDA 1W26A 1KT1A 2OFNA 2RURA 5HW6A 2DG3A 2PPPA 4ODKA 5GPGA 4QIBA 1NMWA 3UI5A 3WH0A 3PRDA 1F40A 1TCOC 3O5EA 3KAHA 2JZVA 2D9FA 2UZ5A 4W9PA 5DITA 1A7XA 4TW8A 1FJDA 1ZCNA 2MLYA 3O5MA 3UF8A 1J4IA 4IQ2A 3UI6A 3CGMA 3KCEA 3NI6A 4DRKA 4DRQA 4DH0A 3H9RB 1QPLA 2PPOA 3O5RA 3B7XA 3UQIA 5BXJA 1QZ2A 2AWGA 1J6YA 1NSGA 2ZR5A 1FKFA 4DROA 1FKJA 4ODOA 1C9HA 2F21A 5DIUA 5HW7A 1EQ3A 1KT0A 2ZQVA 4DRJA 1BL4A 5HWBA 2XP7A
chains in the Genus database with same CATH superfamily
4LAYA 1E15A 3CZ8A 3CGNA 1FAPA 2F4EA 3VAWA 3UQBA 4R0XA 1D6OA 1NWRA 4MNJA 1LQ0A 3ARSA 1XHGA 2ITKA 2DT0A 4JFIA 1LG1A 2O92A 2WM0A 3O5OA 1W1PA 1HJXA 1W9VA 2L2SA 4WKHA 4LAVA 4IQCA 4QT2A 1LL6A 5B8IC 2Q5AA 4MSPA 4Z2IA 4MAVA 4ML4A 1HKKA 1J4RA 4DWSA 2MF9A 4TYOA 3WD2A 3B9DA 4NZCA 2RQSA 3KAIA 2VCDA 2Y78A 4WKAA 2QF8A 1YATA 4ODLA 4DT4A 3NTPA 3JYJA 4O2TA 2AOSA 1HKMA 4Z2HA 3RFWA 1JNDA 2K8IA 3O5QA 1GRJA 3WKZA 2WLYA 4GGQA 4U85A 1B6CA 4ODQA 2ZR4A 4JYSA 3PA7A 1WNOA 3O5KA 4BF8A 3CHFA 4JFMA 5J6EA 4LGXA 4JFLA 4ITZA 5GQBA 2A3BA 3FAPA 3FXYA 1FKDA 1W26A 2OFNA 3PRAA 2PPPA 3WH0A 1NMWA 1JNEA 1GPFA 1OWQA 1ZB5A 4DWSB 5DITA 1E6RA 3CGMA 3KCEA 4DRKA 3WQVA 4DH0A 1XRVA 1EIBA 1QZ2A 3WL1A 1FKFA 4DROA 1TFVA 4DRMA 2XP7A 4URIA 3I6CA 4C02B 3CHDA 2XP3A 1FFQA 1Q6HA 3UI4A 2KI3A 4QT3A 1LJYA 4S3JA 4Q22A 3CHCA 1BL4A 3ARRA 5HTGA 3OA5A 1E44A 1FKSA 1FFRA 2DG9A 2B5UB 1PBKA 3ODKA 2A3CA 2VN1A 4FAPA 1FKTA 4HBOA 1FKBA 4U86A 4ODNA 1K9TA 1X6LA 4LAWA 1W1TA 2ZR6A 3O5IA 2PV3A 4DRNA 1NWSA 3GU0A 2MNTA 5HW8A 2FAPA 4GIVA 4ZPWR 5D75A 5HBFA 2F23A 1F8AB 1ZU8A 3AROA 3O5JA 3CHEA 4TW7A 1HKIA 4ODPA 4G2PA 1PINA 4MPKA 5HWCA 2WK2A 5HT1A 4J4OA 2N87A 2ZQSA 4NNRA 3RM8A 4P8UA 1P5QA 1D7JA 2B31A 1FKHA 2OLHA 4KQZA 2ZQUA 4UDMA 1Q6UA 3KADA 2RUQA 3G6LA 3RM9A 3PRBA 3AS1A 3ALGA 3TC5A 3AQUA 4Z2KA 4G50A 4DRPA 3G6MA 2XP4A 4DRIA 2IUZA 4HARA 4WK9A 4LAXA 3NRKA 2FDMA 2MLXA 4P8VA 1LL4A 3TDBA 2FKEA 2KO7A 1D7HA 2EULA 3KAGA 1O6IA 2MLZA 2DT3A 3ARXA 1YW5A 4ODRA 3ARUA 1M5YA 5HW6A 4ODKA 1HJWA 3PRDA 4WIWA 2JZVA 3O5MA 3NI6A 4DRQA 3H9RB 3W4RA 3WD3A 2PPOA 3UQIA 2YBUA 1OGBA 1HKJA 1H0GA 3ARVA 2ZR5A 1FKJA 5HW7A 5HWBA 3O5PA 3AS2A 1Q6IA 2XP6A 3EY6A 1ROTA 3IK8A 3KZ7A 4P8WA 2ESCA 1D7IA 4TX0A 5I98A 4TW6A 2LGOA 1QPFA 4WJXA 4WKFA 1JNSA 4NSBA 3LUOA 3UI6A 1EHNA 1FKKA 4S3KA 2DSVA 2PBCA 1OGGA 3RGCA 4L3NA 2KR7A 1W9PA 3KAFA 3IKDA 3B9AA 4Z2LA 3WD1A 1ZBVA 1KFWA 3WIJA 2RUCA 2DT2A 1EYMA 4DWSC 3UQAA 4N19A 3WD0A 1EDQA 1FKGA 3JXVA 1NMVA 2DSZA 2DT1A 2O9OA 1FKLA 1WAWA 2KFWA 4DRHA 1W9UA 3OOBA 1LG2A 3ALFA 4ODMA 1Y0OA 3IHZA 4IT6A 2XPAA 1FD9A 4TNSA 2RUDA 2KE0A 4JFKA 4R5EA 3FY1A 2G8ZA 4ZPVR 3O5GA 3GTYX 1UR8A 1ZBWA 4Q7NA 4DWSD 1X6NA 4JFJA 1HXVA 1E9LA 2XP5A 3KACA 2KGJA 2PPNA 1J4HA 3GPKA 4J4NA 2YBTA 4DZ2A 3ARPA 1HJVA 4MNLA 4Z2JA 2A3EA 3AS0A 5GPRA 3QOKA 3WD4A 2PV2A 1W1VA 4MNMA 2DG4A 2RSEA 3O5LA 1FKRA 1U79A 3AS3A 1KT1A 5GPGA 3UI5A 4MTVA 4W5UA 1F40A 1CTNA 2D9FA 1A7XA 3PR9A 4TW8A 2MLYA 3UF8A 1J4IA 4IQ2A 3B8SA 1E6NA 4ZS6A 5BXJA 1J6YA 1GUVA 1NSGA 4ODOA 2F21A 1EQ3A 1KT0A 2ZQVA 4DRJA 2LJ4A 2MPHA 5JH8A 4MNKA 4QZVB 3JYMA 1JVWA 4MGVA 1ZK6A 3ARWA 3O5DA 1LL7A 1IX5A 2M2AA 5HUAA 2G41A 4L72B 4P8XA 2DSWA 1Q1CA 2LKNA 2PV1A 3KABA 4DIPA 2DSUA 2M1IA 5HKGA 3B9EA 2A3AA 2M08A 1T11A 2WLZA 3BMBA 2PN0A 1WB0A 4IT4A 1SR0A 1E6ZA 2LPVA 3EIPA 4ZPTR 2F2DA 1E6PA 1JNTA 5DIVA 2XP8A 1R9HA 3RM4A 3ARYA 1N1AA 3MDYB 1L1PA 2ETNA 4Z2GA 2P4VA 3RMEA 1ZL1A 2PI6A 1VF8A 3ARQA 4DZ3A 1SYTA 3IKGA 2DPEA 5DF0A 1ROUA 1ZBKA 1ZBCA 1NH6A 3WL0A 4KR0B 2XP9A 2ZQTA 4W9OA 4IPXA 3O5FA 3TCZA 4HBEA 3WQWA 4U84A 1JCHB 5DEZA 1H0IA 4W9QA 4FN2A 3ARTA 1UR9A 5DO2A 1FKIA 1D2KA 2XPBA 2IF4A 4AY1A 1RD6A 3ARZA 2RURA 2DG3A 4QIBA 1TCOC 3O5EA 3KAHA 4W9PA 2UZ5A 4XAKA 1FJDA 1ZCNA 3BXWA 1NWUA 3CH9A 1ITXA 1QPLA 1GOIA 3O5RA 3B7XA 2AWGA 1NWTA 4PTMA 1C9HA 5DIUA 1BKFA 1W1YA
chains in the Genus database with same CATH topology
4LAYA 1E15A 3CZ8A 3CGNA 1FAPA 2F4EA 3VAWA 3UQBA 4R0XA 1D6OA 1NWRA 4MNJA 1LQ0A 3ARSA 1XHGA 2ITKA 2DT0A 4JFIA 1LG1A 2O92A 2WM0A 3O5OA 1W1PA 1HJXA 1W9VA 2L2SA 4WKHA 4LAVA 4IQCA 4QT2A 1LL6A 5B8IC 2Q5AA 4MSPA 4Z2IA 4MAVA 4ML4A 1HKKA 1J4RA 4DWSA 2MF9A 4TYOA 3WD2A 3B9DA 4NZCA 2RQSA 3KAIA 2VCDA 2Y78A 4WKAA 2QF8A 1YATA 4ODLA 4DT4A 3NTPA 3JYJA 4O2TA 2AOSA 1HKMA 4Z2HA 3RFWA 1JNDA 2K8IA 3O5QA 3WKZA 2WLYA 4GGQA 4U85A 1B6CA 4ODQA 2ZR4A 4JYSA 3PA7A 1WNOA 3O5KA 4BF8A 3CHFA 4JFMA 5J6EA 4LGXA 4JFLA 4ITZA 5GQBA 2A3BA 3FAPA 3FXYA 1FKDA 1W26A 2OFNA 3PRAA 2PPPA 3WH0A 1NMWA 1JNEA 1GPFA 1OWQA 1ZB5A 4DWSB 5DITA 1E6RA 3CGMA 3KCEA 4DRKA 3WQVA 4DH0A 1XRVA 1EIBA 1QZ2A 3WL1A 1FKFA 4DROA 1TFVA 4DRMA 2XP7A 4URIA 3I6CA 4C02B 3CHDA 2XP3A 1FFQA 1Q6HA 3UI4A 2KI3A 4QT3A 1LJYA 4S3JA 4Q22A 3CHCA 1BL4A 3ARRA 5HTGA 3OA5A 1FKSA 1FFRA 2DG9A 1PBKA 3ODKA 2A3CA 2VN1A 4FAPA 1FKTA 4HBOA 1FKBA 4U86A 4ODNA 1K9TA 1X6LA 4LAWA 1W1TA 2ZR6A 3O5IA 2PV3A 4DRNA 1NWSA 2MNTA 5HW8A 2FAPA 4GIVA 4ZPWR 5D75A 5HBFA 1F8AB 1ZU8A 3AROA 3O5JA 3CHEA 4TW7A 1HKIA 4ODPA 4G2PA 1PINA 4MPKA 5HWCA 2WK2A 5HT1A 4J4OA 2N87A 2ZQSA 4NNRA 3RM8A 4P8UA 1P5QA 1D7JA 2B31A 1FKHA 2OLHA 4KQZA 2ZQUA 1Q6UA 3KADA 2RUQA 3G6LA 3RM9A 3PRBA 3AS1A 3ALGA 3TC5A 3AQUA 4Z2KA 4G50A 4DRPA 3G6MA 2XP4A 4DRIA 2IUZA 4HARA 4WK9A 4LAXA 3NRKA 2FDMA 2MLXA 4P8VA 1LL4A 3TDBA 2FKEA 2KO7A 1D7HA 3KAGA 1O6IA 2MLZA 2DT3A 3ARXA 1YW5A 4ODRA 3ARUA 1M5YA 5HW6A 4ODKA 1HJWA 3PRDA 4WIWA 2JZVA 3O5MA 3NI6A 4DRQA 3H9RB 3W4RA 3WD3A 2PPOA 3UQIA 2YBUA 1OGBA 1HKJA 1H0GA 3ARVA 2ZR5A 1FKJA 5HW7A 5HWBA 3O5PA 3AS2A 1Q6IA 2XP6A 3EY6A 1ROTA 3IK8A 3KZ7A 4P8WA 2ESCA 1D7IA 4TX0A 5I98A 4TW6A 2LGOA 1QPFA 4WJXA 4WKFA 1JNSA 4NSBA 3LUOA 3UI6A 1EHNA 1FKKA 4S3KA 2DSVA 2PBCA 1OGGA 3RGCA 4L3NA 2KR7A 1W9PA 3KAFA 3IKDA 3B9AA 4Z2LA 3WD1A 1ZBVA 1KFWA 3WIJA 2RUCA 2DT2A 1EYMA 4DWSC 3UQAA 4N19A 3WD0A 1EDQA 1FKGA 3JXVA 1NMVA 2DSZA 2DT1A 2O9OA 1FKLA 1WAWA 2KFWA 4DRHA 1W9UA 3OOBA 1LG2A 3ALFA 4ODMA 1Y0OA 3IHZA 4IT6A 2XPAA 1FD9A 4TNSA 2RUDA 2KE0A 4JFKA 4R5EA 3FY1A 2G8ZA 4ZPVR 3O5GA 1UR8A 1ZBWA 4Q7NA 4DWSD 1X6NA 4JFJA 1HXVA 1E9LA 2XP5A 3KACA 2KGJA 2PPNA 1J4HA 3GPKA 4J4NA 2YBTA 4DZ2A 3ARPA 1HJVA 4MNLA 4Z2JA 2A3EA 3AS0A 5GPRA 3QOKA 3WD4A 2PV2A 1W1VA 4MNMA 2DG4A 2RSEA 3O5LA 1FKRA 1U79A 3AS3A 1KT1A 5GPGA 3UI5A 4MTVA 4W5UA 1F40A 1CTNA 2D9FA 1A7XA 3PR9A 4TW8A 2MLYA 3UF8A 1J4IA 4IQ2A 3B8SA 1E6NA 4ZS6A 5BXJA 1J6YA 1GUVA 1NSGA 4ODOA 2F21A 1EQ3A 1KT0A 2ZQVA 4DRJA 2LJ4A 2MPHA 5JH8A 4MNKA 4QZVB 3JYMA 1JVWA 4MGVA 1ZK6A 3ARWA 3O5DA 1LL7A 1IX5A 2M2AA 5HUAA 2G41A 4L72B 4P8XA 2DSWA 1Q1CA 2LKNA 2PV1A 3KABA 4DIPA 2DSUA 2M1IA 5HKGA 3B9EA 2A3AA 2M08A 1T11A 2WLZA 1WB0A 4IT4A 1SR0A 1E6ZA 2LPVA 4ZPTR 2F2DA 1E6PA 1JNTA 5DIVA 2XP8A 1R9HA 3RM4A 3ARYA 1N1AA 3MDYB 1L1PA 4Z2GA 3RMEA 1ZL1A 2PI6A 1VF8A 3ARQA 4DZ3A 1SYTA 3IKGA 2DPEA 5DF0A 1ROUA 1ZBKA 1ZBCA 1NH6A 3WL0A 4KR0B 2XP9A 2ZQTA 4W9OA 4IPXA 3O5FA 3TCZA 4HBEA 3WQWA 4U84A 5DEZA 1H0IA 4W9QA 4FN2A 3ARTA 1UR9A 5DO2A 1FKIA 1D2KA 2XPBA 2IF4A 4AY1A 1RD6A 3ARZA 2RURA 2DG3A 4QIBA 1TCOC 3O5EA 3KAHA 4W9PA 2UZ5A 4XAKA 1FJDA 1ZCNA 3BXWA 1NWUA 3CH9A 1ITXA 1QPLA 1GOIA 3O5RA 3B7XA 2AWGA 1NWTA 4PTMA 1C9HA 5DIUA 1BKFA 1W1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAY A;  2LJ4 A;  2MPH A;  3I6C A;  3O5P A;  4C02 B;  1Q6I A;  3CGN A;  2XP3 A;  2XP6 A;  1Q6H A;  1FAP A;  3EY6 A;  1ROT A;  2KI3 A;  3JYM A;  4QT3 A;  2F4E A;  3IK8 A;  3UI4 A;  3KZ7 A;  3VAW A;  1JVW A;  4MGV A;  1D7I A;  4TX0 A;  1ZK6 A;  3O5D A;  3UQB A;  4R0X A;  4TW6 A;  2LGO A;  5I98 A;  2M2A A;  1D6O A;  5HUA A;  5HTG A;  1FKS A;  2DG9 A;  1QPF A;  1Q1C A;  2ITK A;  1PBK A;  2LKN A;  2PV1 A;  3KAB A;  3LUO A;  2VN1 A;  3ODK A;  4JFI A;  1FKT A;  1FKK A;  2M1I A;  1FKB A;  4U86 A;  4ODN A;  4FAP A;  4LAW A;  2PBC A;  5HKG A;  2ZR6 A;  3O5I A;  2PV3 A;  3RGC A;  4DRN A;  2KR7 A;  3O5O A;  1JNS A;  2M08 A;  2MNT A;  3IKD A;  3KAF A;  5HW8 A;  1T11 A;  2FAP A;  4GIV A;  5D75 A;  2L2S A;  4LAV A;  1F8A B;  2RUC A;  4IQC A;  3O5J A;  2LPV A;  4QT2 A;  4TW7 A;  2F2D A;  5B8I C;  1JNT A;  1EYM A;  5DIV A;  3UQA A;  4N19 A;  2XP8 A;  4ODP A;  1FKG A;  3JXV A;  1NMV A;  4G2P A;  1PIN A;  2Q5A A;  4MSP A;  1R9H A;  5HWC A;  1FKL A;  5HT1 A;  4J4O A;  2N87 A;  2ZQS A;  1N1A A;  2KFW A;  4DRH A;  4NNR A;  3MDY B;  1J4R A;  1L1P A;  3OOB A;  2MF9 A;  4TYO A;  1P5Q A;  4ODM A;  1Y0O A;  1D7J A;  1BKF A;  1FKH A;  2RQS A;  3IHZ A;  3KAI A;  2VCD A;  2Y78 A;  2ZQU A;  2XPA A;  1Q6U A;  3KAD A;  1FD9 A;  2RUQ A;  4DZ3 A;  4DRM A;  1YAT A;  4ODL A;  4TNS A;  3PRB A;  4DT4 A;  3IKG A;  3NTP A;  2RUD A;  2KE0 A;  4JFK A;  3JYJ A;  3TC5 A;  4O2T A;  1ROU A;  4G50 A;  3O5G A;  3RFW A;  4DRP A;  2XP4 A;  4DRI A;  2K8I A;  2XP9 A;  2ZQT A;  3O5Q A;  4JFJ A;  4W9O A;  2XP5 A;  1HXV A;  3KAC A;  4LAX A;  2KGJ A;  2PPN A;  1J4H A;  3GPK A;  3O5F A;  3NRK A;  4IPX A;  4J4N A;  3TCZ A;  4GGQ A;  4DZ2 A;  2MLX A;  4U85 A;  4U84 A;  1B6C A;  3TDB A;  2FKE A;  4ODQ A;  2KO7 A;  1D7H A;  2ZR4 A;  4JYS A;  3PA7 A;  3KAG A;  3O5K A;  2MLZ A;  4FN2 A;  2PV2 A;  4JFM A;  4W9Q A;  4BF8 A;  5J6E A;  4JFL A;  2DG4 A;  4ITZ A;  2RSE A;  1FKI A;  1YW5 A;  2XPB A;  3O5L A;  2IF4 A;  4ODR A;  1FKR A;  1U79 A;  1M5Y A;  3FAP A;  4DIP A;  1FKD A;  1W26 A;  1KT1 A;  2OFN A;  2RUR A;  5HW6 A;  2DG3 A;  2PPP A;  4ODK A;  5GPG A;  4QIB A;  1NMW A;  3UI5 A;  3WH0 A;  3PRD A;  1F40 A;  1TCO C;  3O5E A;  3KAH A;  2JZV A;  2D9F A;  2UZ5 A;  4W9P A;  5DIT A;  1A7X A;  4TW8 A;  1FJD A;  1ZCN A;  2MLY A;  3O5M A;  3UF8 A;  1J4I A;  4IQ2 A;  3UI6 A;  3CGM A;  3KCE A;  3NI6 A;  4DRK A;  4DRQ A;  4DH0 A;  3H9R B;  1QPL A;  2PPO A;  3O5R A;  3B7X A;  3UQI A;  5BXJ A;  1QZ2 A;  2AWG A;  1J6Y A;  1NSG A;  2ZR5 A;  1FKF A;  4DRO A;  1FKJ A;  4ODO A;  1C9H A;  2F21 A;  5DIU A;  5HW7 A;  1EQ3 A;  1KT0 A;  2ZQV A;  4DRJ A;  1BL4 A;  5HWB A;  2XP7 A; 
#chains in the Genus database with same CATH topology
 4LAY A;  1E15 A;  3CZ8 A;  3CGN A;  1FAP A;  2F4E A;  3VAW A;  3UQB A;  4R0X A;  1D6O A;  1NWR A;  4MNJ A;  1LQ0 A;  3ARS A;  1XHG A;  2ITK A;  2DT0 A;  4JFI A;  1LG1 A;  2O92 A;  2WM0 A;  3O5O A;  1W1P A;  1HJX A;  1W9V A;  2L2S A;  4WKH A;  4LAV A;  4IQC A;  4QT2 A;  1LL6 A;  5B8I C;  2Q5A A;  4MSP A;  4Z2I A;  4MAV A;  4ML4 A;  1HKK A;  1J4R A;  4DWS A;  2MF9 A;  4TYO A;  3WD2 A;  3B9D A;  4NZC A;  2RQS A;  3KAI A;  2VCD A;  2Y78 A;  4WKA A;  2QF8 A;  1YAT A;  4ODL A;  4DT4 A;  3NTP A;  3JYJ A;  4O2T A;  2AOS A;  1HKM A;  4Z2H A;  3RFW A;  1JND A;  2K8I A;  3O5Q A;  1GRJ A;  3WKZ A;  2WLY A;  4GGQ A;  4U85 A;  1B6C A;  4ODQ A;  2ZR4 A;  4JYS A;  3PA7 A;  1WNO A;  3O5K A;  4BF8 A;  3CHF A;  4JFM A;  5J6E A;  4LGX A;  4JFL A;  4ITZ A;  5GQB A;  2A3B A;  3FAP A;  3FXY A;  1FKD A;  1W26 A;  2OFN A;  3PRA A;  2PPP A;  3WH0 A;  1NMW A;  1JNE A;  1GPF A;  1OWQ A;  1ZB5 A;  4DWS B;  5DIT A;  1E6R A;  3CGM A;  3KCE A;  4DRK A;  3WQV A;  4DH0 A;  1XRV A;  1EIB A;  1QZ2 A;  3WL1 A;  1FKF A;  4DRO A;  1TFV A;  4DRM A;  2XP7 A;  4URI A;  3I6C A;  4C02 B;  3CHD A;  2XP3 A;  1FFQ A;  1Q6H A;  3UI4 A;  2KI3 A;  4QT3 A;  1LJY A;  4S3J A;  4Q22 A;  3CHC A;  1BL4 A;  3ARR A;  5HTG A;  3OA5 A;  1E44 A;  1FKS A;  1FFR A;  2DG9 A;  2B5U B;  1PBK A;  3ODK A;  2A3C A;  2VN1 A;  4FAP A;  1FKT A;  4HBO A;  1FKB A;  4U86 A;  4ODN A;  1K9T A;  1X6L A;  4LAW A;  1W1T A;  2ZR6 A;  3O5I A;  2PV3 A;  4DRN A;  1NWS A;  3GU0 A;  2MNT A;  5HW8 A;  2FAP A;  4GIV A;  4ZPW R;  5D75 A;  5HBF A;  2F23 A;  1F8A B;  1ZU8 A;  3ARO A;  3O5J A;  3CHE A;  4TW7 A;  1HKI A;  4ODP A;  4G2P A;  1PIN A;  4MPK A;  5HWC A;  2WK2 A;  5HT1 A;  4J4O A;  2N87 A;  2ZQS A;  4NNR A;  3RM8 A;  4P8U A;  1P5Q A;  1D7J A;  2B31 A;  1FKH A;  2OLH A;  4KQZ A;  2ZQU A;  4UDM A;  1Q6U A;  3KAD A;  2RUQ A;  3G6L A;  3RM9 A;  3PRB A;  3AS1 A;  3ALG A;  3TC5 A;  3AQU A;  4Z2K A;  4G50 A;  4DRP A;  3G6M A;  2XP4 A;  4DRI A;  2IUZ A;  4HAR A;  4WK9 A;  4LAX A;  3NRK A;  2FDM A;  2MLX A;  4P8V A;  1LL4 A;  3TDB A;  2FKE A;  2KO7 A;  1D7H A;  2EUL A;  3KAG A;  1O6I A;  2MLZ A;  2DT3 A;  3ARX A;  1YW5 A;  4ODR A;  3ARU A;  1M5Y A;  5HW6 A;  4ODK A;  1HJW A;  3PRD A;  4WIW A;  2JZV A;  3O5M A;  3NI6 A;  4DRQ A;  3H9R B;  3W4R A;  3WD3 A;  2PPO A;  3UQI A;  2YBU A;  1OGB A;  1HKJ A;  1H0G A;  3ARV A;  2ZR5 A;  1FKJ A;  5HW7 A;  5HWB A;  3O5P A;  3AS2 A;  1Q6I A;  2XP6 A;  3EY6 A;  1ROT A;  3IK8 A;  3KZ7 A;  4P8W A;  2ESC A;  1D7I A;  4TX0 A;  5I98 A;  4TW6 A;  2LGO A;  1QPF A;  4WJX A;  4WKF A;  1JNS A;  4NSB A;  3LUO A;  3UI6 A;  1EHN A;  1FKK A;  4S3K A;  2DSV A;  2PBC A;  1OGG A;  3RGC A;  4L3N A;  2KR7 A;  1W9P A;  3KAF A;  3IKD A;  3B9A A;  4Z2L A;  3WD1 A;  1ZBV A;  1KFW A;  3WIJ A;  2RUC A;  2DT2 A;  1EYM A;  4DWS C;  3UQA A;  4N19 A;  3WD0 A;  1EDQ A;  1FKG A;  3JXV A;  1NMV A;  2DSZ A;  2DT1 A;  2O9O A;  1FKL A;  1WAW A;  2KFW A;  4DRH A;  1W9U A;  3OOB A;  1LG2 A;  3ALF A;  4ODM A;  1Y0O A;  3IHZ A;  4IT6 A;  2XPA A;  1FD9 A;  4TNS A;  2RUD A;  2KE0 A;  4JFK A;  4R5E A;  3FY1 A;  2G8Z A;  4ZPV R;  3O5G A;  3GTY X;  1UR8 A;  1ZBW A;  4Q7N A;  4DWS D;  1X6N A;  4JFJ A;  1HXV A;  1E9L A;  2XP5 A;  3KAC A;  2KGJ A;  2PPN A;  1J4H A;  3GPK A;  4J4N A;  2YBT A;  4DZ2 A;  3ARP A;  1HJV A;  4MNL A;  4Z2J A;  2A3E A;  3AS0 A;  5GPR A;  3QOK A;  3WD4 A;  2PV2 A;  1W1V A;  4MNM A;  2DG4 A;  2RSE A;  3O5L A;  1FKR A;  1U79 A;  3AS3 A;  1KT1 A;  5GPG A;  3UI5 A;  4MTV A;  4W5U A;  1F40 A;  1CTN A;  2D9F A;  1A7X A;  3PR9 A;  4TW8 A;  2MLY A;  3UF8 A;  1J4I A;  4IQ2 A;  3B8S A;  1E6N A;  4ZS6 A;  5BXJ A;  1J6Y A;  1GUV A;  1NSG A;  4ODO A;  2F21 A;  1EQ3 A;  1KT0 A;  2ZQV A;  4DRJ A;  2LJ4 A;  2MPH A;  5JH8 A;  4MNK A;  4QZV B;  3JYM A;  1JVW A;  4MGV A;  1ZK6 A;  3ARW A;  3O5D A;  1LL7 A;  1IX5 A;  2M2A A;  5HUA A;  2G41 A;  4L72 B;  4P8X A;  2DSW A;  1Q1C A;  2LKN A;  2PV1 A;  3KAB A;  4DIP A;  2DSU A;  2M1I A;  5HKG A;  3B9E A;  2A3A A;  2M08 A;  1T11 A;  2WLZ A;  3BMB A;  2PN0 A;  1WB0 A;  4IT4 A;  1SR0 A;  1E6Z A;  2LPV A;  3EIP A;  4ZPT R;  2F2D A;  1E6P A;  1JNT A;  5DIV A;  2XP8 A;  1R9H A;  3RM4 A;  3ARY A;  1N1A A;  3MDY B;  1L1P A;  2ETN A;  4Z2G A;  2P4V A;  3RME A;  1ZL1 A;  2PI6 A;  1VF8 A;  3ARQ A;  4DZ3 A;  1SYT A;  3IKG A;  2DPE A;  5DF0 A;  1ROU A;  1ZBK A;  1ZBC A;  1NH6 A;  3WL0 A;  4KR0 B;  2XP9 A;  2ZQT A;  4W9O A;  4IPX A;  3O5F A;  3TCZ A;  4HBE A;  3WQW A;  4U84 A;  1JCH B;  5DEZ A;  1H0I A;  4W9Q A;  4FN2 A;  3ART A;  1UR9 A;  5DO2 A;  1FKI A;  1D2K A;  2XPB A;  2IF4 A;  4AY1 A;  1RD6 A;  3ARZ A;  2RUR A;  2DG3 A;  4QIB A;  1TCO C;  3O5E A;  3KAH A;  4W9P A;  2UZ5 A;  4XAK A;  1FJD A;  1ZCN A;  3BXW A;  1NWU A;  3CH9 A;  1ITX A;  1QPL A;  1GOI A;  3O5R A;  3B7X A;  2AWG A;  1NWT A;  4PTM A;  1C9H A;  5DIU A;  1BKF A;  1W1Y A; 
#chains in the Genus database with same CATH homology
 4LAY A;  1E15 A;  3CZ8 A;  3CGN A;  1FAP A;  2F4E A;  3VAW A;  3UQB A;  4R0X A;  1D6O A;  1NWR A;  4MNJ A;  1LQ0 A;  3ARS A;  1XHG A;  2ITK A;  2DT0 A;  4JFI A;  1LG1 A;  2O92 A;  2WM0 A;  3O5O A;  1W1P A;  1HJX A;  1W9V A;  2L2S A;  4WKH A;  4LAV A;  4IQC A;  4QT2 A;  1LL6 A;  5B8I C;  2Q5A A;  4MSP A;  4Z2I A;  4MAV A;  4ML4 A;  1HKK A;  1J4R A;  4DWS A;  2MF9 A;  4TYO A;  3WD2 A;  3B9D A;  4NZC A;  2RQS A;  3KAI A;  2VCD A;  2Y78 A;  4WKA A;  2QF8 A;  1YAT A;  4ODL A;  4DT4 A;  3NTP A;  3JYJ A;  4O2T A;  2AOS A;  1HKM A;  4Z2H A;  3RFW A;  1JND A;  2K8I A;  3O5Q A;  3WKZ A;  2WLY A;  4GGQ A;  4U85 A;  1B6C A;  4ODQ A;  2ZR4 A;  4JYS A;  3PA7 A;  1WNO A;  3O5K A;  4BF8 A;  3CHF A;  4JFM A;  5J6E A;  4LGX A;  4JFL A;  4ITZ A;  5GQB A;  2A3B A;  3FAP A;  3FXY A;  1FKD A;  1W26 A;  2OFN A;  3PRA A;  2PPP A;  3WH0 A;  1NMW A;  1JNE A;  1GPF A;  1OWQ A;  1ZB5 A;  4DWS B;  5DIT A;  1E6R A;  3CGM A;  3KCE A;  4DRK A;  3WQV A;  4DH0 A;  1XRV A;  1EIB A;  1QZ2 A;  3WL1 A;  1FKF A;  4DRO A;  1TFV A;  4DRM A;  2XP7 A;  4URI A;  3I6C A;  4C02 B;  3CHD A;  2XP3 A;  1FFQ A;  1Q6H A;  3UI4 A;  2KI3 A;  4QT3 A;  1LJY A;  4S3J A;  4Q22 A;  3CHC A;  1BL4 A;  3ARR A;  5HTG A;  3OA5 A;  1FKS A;  1FFR A;  2DG9 A;  1PBK A;  3ODK A;  2A3C A;  2VN1 A;  4FAP A;  1FKT A;  4HBO A;  1FKB A;  4U86 A;  4ODN A;  1K9T A;  1X6L A;  4LAW A;  1W1T A;  2ZR6 A;  3O5I A;  2PV3 A;  4DRN A;  1NWS A;  2MNT A;  5HW8 A;  2FAP A;  4GIV A;  4ZPW R;  5D75 A;  5HBF A;  1F8A B;  1ZU8 A;  3ARO A;  3O5J A;  3CHE A;  4TW7 A;  1HKI A;  4ODP A;  4G2P A;  1PIN A;  4MPK A;  5HWC A;  2WK2 A;  5HT1 A;  4J4O A;  2N87 A;  2ZQS A;  4NNR A;  3RM8 A;  4P8U A;  1P5Q A;  1D7J A;  2B31 A;  1FKH A;  2OLH A;  4KQZ A;  2ZQU A;  1Q6U A;  3KAD A;  2RUQ A;  3G6L A;  3RM9 A;  3PRB A;  3AS1 A;  3ALG A;  3TC5 A;  3AQU A;  4Z2K A;  4G50 A;  4DRP A;  3G6M A;  2XP4 A;  4DRI A;  2IUZ A;  4HAR A;  4WK9 A;  4LAX A;  3NRK A;  2FDM A;  2MLX A;  4P8V A;  1LL4 A;  3TDB A;  2FKE A;  2KO7 A;  1D7H A;  3KAG A;  1O6I A;  2MLZ A;  2DT3 A;  3ARX A;  1YW5 A;  4ODR A;  3ARU A;  1M5Y A;  5HW6 A;  4ODK A;  1HJW A;  3PRD A;  4WIW A;  2JZV A;  3O5M A;  3NI6 A;  4DRQ A;  3H9R B;  3W4R A;  3WD3 A;  2PPO A;  3UQI A;  2YBU A;  1OGB A;  1HKJ A;  1H0G A;  3ARV A;  2ZR5 A;  1FKJ A;  5HW7 A;  5HWB A;  3O5P A;  3AS2 A;  1Q6I A;  2XP6 A;  3EY6 A;  1ROT A;  3IK8 A;  3KZ7 A;  4P8W A;  2ESC A;  1D7I A;  4TX0 A;  5I98 A;  4TW6 A;  2LGO A;  1QPF A;  4WJX A;  4WKF A;  1JNS A;  4NSB A;  3LUO A;  3UI6 A;  1EHN A;  1FKK A;  4S3K A;  2DSV A;  2PBC A;  1OGG A;  3RGC A;  4L3N A;  2KR7 A;  1W9P A;  3KAF A;  3IKD A;  3B9A A;  4Z2L A;  3WD1 A;  1ZBV A;  1KFW A;  3WIJ A;  2RUC A;  2DT2 A;  1EYM A;  4DWS C;  3UQA A;  4N19 A;  3WD0 A;  1EDQ A;  1FKG A;  3JXV A;  1NMV A;  2DSZ A;  2DT1 A;  2O9O A;  1FKL A;  1WAW A;  2KFW A;  4DRH A;  1W9U A;  3OOB A;  1LG2 A;  3ALF A;  4ODM A;  1Y0O A;  3IHZ A;  4IT6 A;  2XPA A;  1FD9 A;  4TNS A;  2RUD A;  2KE0 A;  4JFK A;  4R5E A;  3FY1 A;  2G8Z A;  4ZPV R;  3O5G A;  1UR8 A;  1ZBW A;  4Q7N A;  4DWS D;  1X6N A;  4JFJ A;  1HXV A;  1E9L A;  2XP5 A;  3KAC A;  2KGJ A;  2PPN A;  1J4H A;  3GPK A;  4J4N A;  2YBT A;  4DZ2 A;  3ARP A;  1HJV A;  4MNL A;  4Z2J A;  2A3E A;  3AS0 A;  5GPR A;  3QOK A;  3WD4 A;  2PV2 A;  1W1V A;  4MNM A;  2DG4 A;  2RSE A;  3O5L A;  1FKR A;  1U79 A;  3AS3 A;  1KT1 A;  5GPG A;  3UI5 A;  4MTV A;  4W5U A;  1F40 A;  1CTN A;  2D9F A;  1A7X A;  3PR9 A;  4TW8 A;  2MLY A;  3UF8 A;  1J4I A;  4IQ2 A;  3B8S A;  1E6N A;  4ZS6 A;  5BXJ A;  1J6Y A;  1GUV A;  1NSG A;  4ODO A;  2F21 A;  1EQ3 A;  1KT0 A;  2ZQV A;  4DRJ A;  2LJ4 A;  2MPH A;  5JH8 A;  4MNK A;  4QZV B;  3JYM A;  1JVW A;  4MGV A;  1ZK6 A;  3ARW A;  3O5D A;  1LL7 A;  1IX5 A;  2M2A A;  5HUA A;  2G41 A;  4L72 B;  4P8X A;  2DSW A;  1Q1C A;  2LKN A;  2PV1 A;  3KAB A;  4DIP A;  2DSU A;  2M1I A;  5HKG A;  3B9E A;  2A3A A;  2M08 A;  1T11 A;  2WLZ A;  1WB0 A;  4IT4 A;  1SR0 A;  1E6Z A;  2LPV A;  4ZPT R;  2F2D A;  1E6P A;  1JNT A;  5DIV A;  2XP8 A;  1R9H A;  3RM4 A;  3ARY A;  1N1A A;  3MDY B;  1L1P A;  4Z2G A;  3RME A;  1ZL1 A;  2PI6 A;  1VF8 A;  3ARQ A;  4DZ3 A;  1SYT A;  3IKG A;  2DPE A;  5DF0 A;  1ROU A;  1ZBK A;  1ZBC A;  1NH6 A;  3WL0 A;  4KR0 B;  2XP9 A;  2ZQT A;  4W9O A;  4IPX A;  3O5F A;  3TCZ A;  4HBE A;  3WQW A;  4U84 A;  5DEZ A;  1H0I A;  4W9Q A;  4FN2 A;  3ART A;  1UR9 A;  5DO2 A;  1FKI A;  1D2K A;  2XPB A;  2IF4 A;  4AY1 A;  1RD6 A;  3ARZ A;  2RUR A;  2DG3 A;  4QIB A;  1TCO C;  3O5E A;  3KAH A;  4W9P A;  2UZ5 A;  4XAK A;  1FJD A;  1ZCN A;  3BXW A;  1NWU A;  3CH9 A;  1ITX A;  1QPL A;  1GOI A;  3O5R A;  3B7X A;  2AWG A;  1NWT A;  4PTM A;  1C9H A;  5DIU A;  1BKF A;  1W1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...