4LAVA

Crystal structure analysis of fkbp52, crystal form ii
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
APLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
publication title Crystal Structures of the Free and Ligand-Bound FK1-FK2 Domain Segment of FKBP52 Reveal a Flexible Inter-Domain Hinge.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 58
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4lavA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4lavA02
4DH0A 2KE0A 2PBCA 1J4HA 3JYJA 4ODRA 2PPOA 1FKIA 3GPKA 2MNTA 4ODNA 4TNSA 2UZ5A 2IF4A 2PPPA 3NTPA 3O5EA 4TW8A 4DROA 1ZCNA 4DZ2A 1FKJA 2XP6A 2LKNA 1N1AA 3UI4A 4C02B 1A7XA 4TW7A 2KO7A 2M08A 4U84A 4J4NA 2PV1A 1Q1CA 1JNTA 1Q6UA 3JXVA 1U79A 4QT3A 5HWBA 5I98A 4ODQA 1JNSA 4DRNA 3UQIA 1W26A 2Y78A 2MLZA 1YW5A 2XP3A 5DIVA 3VAWA 5B8IC 3KACA 4JFIA 2RURA 1BKFA 3I6CA 2RQSA 2LJ4A 3UQAA 3O5GA 3NRKA 4W9PA 3UI6A 3O5QA 3TCZA 3KAIA 1M5YA 2MF9A 2ZQTA 4MSPA 1TCOC 1QPFA 5HW8A 2DG4A 2K8IA 4R0XA 1FJDA 3O5RA 5DIUA 1KT0A 2XPBA 2DG3A 4JFMA 3TC5A 2ZR4A 3ODKA 3UI5A 4ITZA 4IQCA 4DRPA 3CGNA 1FKRA 4DRQA 3O5IA 3O5OA 1FKGA 2LPVA 3MDYB 4NNRA 2LGOA 1QPLA 2Q5AA 2ITKA 1FAPA 5HT1A 1C9HA 3EY6A 4JFKA 5HW7A 3TDBA 3UQBA 2AWGA 4TW6A 2D9FA 4TX0A 5GPGA 3KZ7A 5DITA 3LUOA 1T11A 3JYMA 3PA7A 3O5PA 2XP8A 1FKBA 3KAGA 4IPXA 2VCDA 4ODOA 1ZK6A 4DRKA 3FAPA 4GGQA 4DIPA 5HWCA 4GIVA 2DG9A 3O5FA 4W9QA 4DRJA 2RUDA 1P5QA 4JYSA 2XP4A 1Y0OA 4W9OA 2KGJA 3O5LA 3CGMA 4G2PA 1FKTA 4J4OA 5BXJA 2MLYA 2RUCA 2FKEA 2ZQVA 2F4EA 3WH0A 1J4RA 3KABA 3UF8A 3IKDA 3RFWA 4LAVA 2N87A 5HUAA 1F8AB 1ROTA 5D75A 1EQ3A 1L1PA 4N19A 4DRIA 1NSGA 1D7JA 1R9HA 5HKGA 4ODLA 1EYMA 1FKSA 4ODPA 2RSEA 4LAXA 5HTGA 2PPNA 2XP7A 3KCEA 4JFJA 4ODMA 3O5JA 1J6YA 2FAPA 2OFNA 1FKHA 2PV3A 4QT2A 2RUQA 4JFLA 2MPHA 3O5KA 1NMWA 4DZ3A 3IK8A 3OOBA 1ROUA 4TYOA 4U85A 4DRMA 2F21A 3RGCA 4LAYA 4FAPA 1NMVA 1FD9A 1D7HA 1D7IA 1PBKA 1Q6HA 1Q6IA 1YATA 2ZQUA 3KADA 4ODKA 1PINA 3PRBA 2XP5A 3KAFA 4MGVA 1BL4A 2F2DA 2M1IA 2ZR5A 3KAHA 4LAWA 4U86A 1KT1A 1D6OA 4IQ2A 1J4IA 2XP9A 5J6EA 2ZR6A 5HW6A 2L2SA 1FKKA 4O2TA 1B6CA 3O5DA 4QIBA 3O5MA 3H9RB 2KFWA 2KR7A 3IKGA 3B7XA 1FKFA 2XPAA 2ZQSA 1QZ2A 1FKLA 2JZVA 3NI6A 4DRHA 2MLXA 1F40A 1FKDA 2VN1A 4FN2A 3IHZA 2KI3A 2M2AA 3PRDA 1JVWA 4G50A 4DT4A 1HXVA 2PV2A 4BF8A
chains in the Genus database with same CATH superfamily
2KE0A 1J4HA 3JYJA 2PPOA 1ZB5A 4TNSA 1EIBA 1EDQA 3O5EA 1H0GA 3AS0A 4DZ2A 1A7XA 1O6IA 2WLZA 1W1TA 1JCHB 5I98A 4DRNA 3UQIA 3RM8A 5DIVA 4JFIA 1BKFA 3I6CA 3UQAA 4QZVB 3WD2A 3NRKA 4MSPA 1IX5A 4MTVA 1EHNA 4Q7NA 2DG4A 4R0XA 4JFMA 3ODKA 1HKJA 3CGNA 3O5IA 2LPVA 4S3KA 4DWSC 1VF8A 2ITKA 3G6LA 3CHDA 3PRAA 1W1PA 4TW6A 1E6RA 5GPGA 3KZ7A 3LUOA 1ZL1A 1E6ZA 1HKIA 4IPXA 2VCDA 1ZK6A 1X6NA 4GGQA 2YBUA 4DIPA 4W9QA 4ZS6A 2RUDA 2A3EA 1SYTA 2XP4A 4W9OA 2DPEA 2DT1A 3WKZA 1FKTA 1HKKA 4J4OA 2ZQVA 2F4EA 2N87A 5HUAA 1F8AB 3WD0A 1D7JA 5HKGA 4R5EA 4ODLA 3FXYA 1OGBA 2RSEA 4MNKA 3AS2A 1TFVA 3O5JA 1NH6A 1NWUA 2PV3A 3IK8A 3OOBA 1ROUA 4TYOA 4DRMA 3ARZA 4MAVA 3RGCA 1FD9A 1D7HA 1LG1A 2DSWA 5B8IC 2DSVA 2QF8A 1X6LA 1LL7A 1WB0A 3B9EA 2L2SA 5HW6A 1WNOA 4Z2KA 3H9RB 2KFWA 1FKFA 2XPAA 4S3JA 1CTNA 4PTMA 4WKHA 1E6PA 2DT3A 4FN2A 2KI3A 2M2AA 3PRDA 3ARUA 1HXVA 1LJYA 2PV2A 2DSZA 2ETNA 4DH0A 2PBCA 3WD3A 4ODRA 3AQUA 1FKIA 3ARVA 2IF4A 4DROA 4NZCA 4MNMA 2DSUA 3ARXA 4C02B 4TW7A 2A3AA 2M08A 4U84A 4J4NA 1HKMA 1Q6UA 1JNTA 2PV1A 4NSBA 3JXVA 2A3BA 2B5UB 2Y78A 4IT6A 4Z2GA 2RQSA 2LJ4A 4URIA 1QPFA 1FJDA 4DWSA 5DIUA 2PI6A 1E15A 4ITZA 4IQCA 1FKRA 2EULA 1FKGA 2LGOA 1QPLA 5GQBA 4JFKA 3UQBA 3RM4A 2DT0A 3JYMA 5DEZA 3O5PA 3FAPA 2G8ZA 2AOSA 4GIVA 3O5FA 4HARA 4DRJA 1ITXA 3G6MA 1W9VA 1WAWA 3CHFA 5BXJA 2MLYA 2DT2A 2FKEA 1GUVA 3WH0A 1J4RA 3KABA 4UDMA 3IKDA 3UF8A 4ZPWR 3RFWA 2A3CA 1EQ3A 1H0IA 4ODPA 4ODMA 3ARWA 1ZBWA 4LGXA 1FKHA 1NMWA 4U85A 2OLHA 1NMVA 3KADA 1NWTA 1Q6IA 1K9TA 4WIWA 4MGVA 2F2DA 2M1IA 2P4VA 2ZR5A 1KT1A 1D6OA 4IQ2A 2XP9A 4O2TA 1FKKA 1HJWA 4Z2IA 3ARQA 1F40A 4DWSD 1FKDA 1FFRA 3IHZA 3AS3A 4BF8A 2WM0A 3OA5A 4ODNA 4P8WA 2PPPA 4TW8A 2ESCA 1FKJA 1N1AA 4ML4A 3RMEA 1NWSA 1U79A 5HWBA 4L72B 1ZU8A 4P8VA 1YW5A 2XP3A 4Q22A 1OWQA 2O92A 3O5GA 4DRPA 3UI6A 3O5QA 5JH8A 3KAIA 1M5YA 2ZQTA 1HJVA 5HW8A 4ZPVR 2K8IA 3O5RA 4WK9A 3FY1A 3TC5A 1LL4A 2ZR4A 1W1VA 4DRQA 2G41A 3O5OA 3MDYB 4NNRA 3EIPA 2Q5AA 1FAPA 5HT1A 3GTYX 1C9HA 3EY6A 3QOKA 1OGGA 5HW7A 2AWGA 2D9FA 2FDMA 4TX0A 5DO2A 5DITA 1KFWA 1T11A 3PA7A 3KAGA 1W1YA 1UR8A 4DWSB 1LL6A 4AY1A 2DG9A 1P5QA 1JNEA 1GOIA 3WL0A 1SR0A 2KGJA 3O5LA 4G2PA 1UR9A 2RUCA 1W9PA 2B31A 5D75A 1L1PA 1NSGA 1D2KA 4KQZA 1GPFA 4LAXA 5HTGA 2XP7A 3KCEA 1J6YA 1XRVA 1ZBVA 2FAPA 2OFNA 2RUQA 1ZBKA 4JFLA 3RM9A 2F21A 3GU0A 4LAYA 4WJXA 3BMBA 4FAPA 4ODKA 1PBKA 1Q6HA 1YATA 3W4RA 2IUZA 3PRBA 2XP5A 3KAFA 5HBFA 3KAHA 3B9AA 1J4IA 1XHGA 3CHEA 1B6CA 3O5DA 4WKFA 4Z2JA 3ARSA 3IKGA 3B7XA 2ZQSA 4HBEA 1FKLA 2JZVA 4DRHA 2MLXA 1E6NA 1JVWA 4HBOA 3WQWA 3GPKA 2MNTA 3ALGA 2YBTA 2UZ5A 4ZPTR 3NTPA 3B9DA 1ZCNA 2XP6A 2LKNA 3UI4A 2KO7A 3CZ8A 1Q1CA 4P8XA 4QT3A 4ODQA 1JNSA 1W26A 2MLZA 3VAWA 3KACA 2RURA 4W9PA 3PR9A 3B8SA 3TCZA 2MF9A 1E9LA 1TCOC 1KT0A 2XPBA 2DG3A 1LQ0A 2WK2A 3UI5A 1ZBCA 3ARRA 4MNJA 1GRJA 3TDBA 3WQVA 1W9UA 3ARPA 2PN0A 1NWRA 2XP8A 1FKBA 3CHCA 4IT4A 4KR0B 4ODOA 4DRKA 2WLYA 3AROA 5HWCA 1FFQA 2O9OA 2F23A 4JYSA 5GPRA 5DF0A 1Y0OA 3WL1A 4W5UA 3CGMA 4L3NA 4MPKA 4LAVA 3WD1A 1ROTA 4N19A 4DRIA 1R9HA 3WIJA 1EYMA 1FKSA 3CH9A 2PPNA 4WKAA 4JFJA 4Z2HA 3AS1A 4XAKA 4P8UA 4QT2A 2MPHA 1JNDA 3O5KA 4DZ3A 1D7IA 1RD6A 2ZQUA 3BXWA 1PINA 3ARTA 4MNLA 3ALFA 1BL4A 4LAWA 1LG2A 4U86A 5J6EA 2ZR6A 4QIBA 3O5MA 2KR7A 1HJXA 1QZ2A 3ARYA 3NI6A 2VN1A 4G50A 1E44A 4DT4A 4Z2LA 3WD4A
chains in the Genus database with same CATH topology
2KE0A 1J4HA 3JYJA 2PPOA 1ZB5A 4TNSA 1EIBA 1EDQA 3O5EA 1H0GA 3AS0A 4DZ2A 1A7XA 1O6IA 2WLZA 1W1TA 5I98A 4DRNA 3UQIA 3RM8A 5DIVA 4JFIA 1BKFA 3I6CA 3UQAA 4QZVB 3WD2A 3NRKA 4MSPA 1IX5A 4MTVA 1EHNA 4Q7NA 2DG4A 4R0XA 4JFMA 3ODKA 1HKJA 3CGNA 3O5IA 2LPVA 4S3KA 4DWSC 1VF8A 2ITKA 3G6LA 3CHDA 3PRAA 1W1PA 4TW6A 1E6RA 5GPGA 3KZ7A 3LUOA 1ZL1A 1E6ZA 1HKIA 4IPXA 2VCDA 1ZK6A 1X6NA 4GGQA 2YBUA 4DIPA 4W9QA 4ZS6A 2RUDA 2A3EA 1SYTA 2XP4A 4W9OA 2DPEA 2DT1A 3WKZA 1FKTA 1HKKA 4J4OA 2ZQVA 2F4EA 2N87A 5HUAA 1F8AB 3WD0A 1D7JA 5HKGA 4R5EA 4ODLA 3FXYA 1OGBA 2RSEA 4MNKA 3AS2A 1TFVA 3O5JA 1NH6A 1NWUA 2PV3A 3IK8A 3OOBA 1ROUA 4TYOA 4DRMA 3ARZA 4MAVA 3RGCA 1FD9A 1D7HA 1LG1A 2DSWA 5B8IC 2DSVA 2QF8A 1X6LA 1LL7A 1WB0A 3B9EA 2L2SA 5HW6A 1WNOA 4Z2KA 3H9RB 2KFWA 1FKFA 2XPAA 4S3JA 1CTNA 4PTMA 4WKHA 1E6PA 2DT3A 4FN2A 2KI3A 2M2AA 3PRDA 3ARUA 1HXVA 1LJYA 2PV2A 2DSZA 4DH0A 2PBCA 3WD3A 4ODRA 3AQUA 1FKIA 3ARVA 2IF4A 4DROA 4NZCA 4MNMA 2DSUA 3ARXA 4C02B 4TW7A 2A3AA 2M08A 4U84A 4J4NA 1HKMA 1Q6UA 1JNTA 2PV1A 4NSBA 3JXVA 2A3BA 2Y78A 4IT6A 4Z2GA 2RQSA 2LJ4A 4URIA 1QPFA 1FJDA 4DWSA 5DIUA 2PI6A 1E15A 4ITZA 4IQCA 1FKRA 1FKGA 2LGOA 1QPLA 5GQBA 4JFKA 3UQBA 3RM4A 2DT0A 3JYMA 5DEZA 3O5PA 3FAPA 2G8ZA 2AOSA 4GIVA 3O5FA 4HARA 4DRJA 1ITXA 3G6MA 1W9VA 1WAWA 3CHFA 5BXJA 2MLYA 2DT2A 2FKEA 1GUVA 3WH0A 1J4RA 3KABA 3UF8A 3IKDA 4ZPWR 3RFWA 2A3CA 1EQ3A 1H0IA 4ODPA 4ODMA 3ARWA 1ZBWA 4LGXA 1FKHA 1NMWA 4U85A 2OLHA 1NMVA 3KADA 1NWTA 1Q6IA 1K9TA 4WIWA 4MGVA 2F2DA 2M1IA 2ZR5A 1KT1A 1D6OA 4IQ2A 2XP9A 4O2TA 1FKKA 1HJWA 4Z2IA 3ARQA 1F40A 4DWSD 1FKDA 1FFRA 3IHZA 3AS3A 4BF8A 2WM0A 3OA5A 4ODNA 4P8WA 2PPPA 4TW8A 2ESCA 1FKJA 1N1AA 4ML4A 3RMEA 1NWSA 1U79A 5HWBA 4L72B 1ZU8A 4P8VA 1YW5A 2XP3A 4Q22A 1OWQA 2O92A 3O5GA 4DRPA 3UI6A 3O5QA 5JH8A 3KAIA 1M5YA 2ZQTA 1HJVA 5HW8A 4ZPVR 2K8IA 3O5RA 4WK9A 3FY1A 3TC5A 1LL4A 2ZR4A 1W1VA 4DRQA 2G41A 3O5OA 3MDYB 4NNRA 2Q5AA 1FAPA 5HT1A 1C9HA 3EY6A 3QOKA 1OGGA 5HW7A 2AWGA 2D9FA 2FDMA 4TX0A 5DO2A 5DITA 1KFWA 1T11A 3PA7A 3KAGA 1W1YA 1UR8A 4DWSB 1LL6A 4AY1A 2DG9A 1P5QA 1JNEA 1GOIA 3WL0A 1SR0A 2KGJA 3O5LA 4G2PA 1UR9A 2RUCA 1W9PA 2B31A 5D75A 1L1PA 1NSGA 1D2KA 4KQZA 1GPFA 4LAXA 5HTGA 2XP7A 3KCEA 1J6YA 1XRVA 1ZBVA 2FAPA 2OFNA 2RUQA 1ZBKA 4JFLA 3RM9A 2F21A 4LAYA 4WJXA 4FAPA 4ODKA 1PBKA 1Q6HA 1YATA 3W4RA 2IUZA 3PRBA 2XP5A 3KAFA 5HBFA 3KAHA 3B9AA 1J4IA 1XHGA 3CHEA 1B6CA 3O5DA 4WKFA 4Z2JA 3ARSA 3IKGA 3B7XA 2ZQSA 4HBEA 1FKLA 2JZVA 4DRHA 2MLXA 1E6NA 1JVWA 4HBOA 3WQWA 3GPKA 2MNTA 3ALGA 2YBTA 2UZ5A 4ZPTR 3NTPA 3B9DA 1ZCNA 2XP6A 2LKNA 3UI4A 2KO7A 3CZ8A 1Q1CA 4P8XA 4QT3A 4ODQA 1JNSA 1W26A 2MLZA 3VAWA 3KACA 2RURA 4W9PA 3PR9A 3B8SA 3TCZA 2MF9A 1E9LA 1TCOC 1KT0A 2XPBA 2DG3A 1LQ0A 2WK2A 3UI5A 1ZBCA 3ARRA 4MNJA 3TDBA 3WQVA 1W9UA 3ARPA 1NWRA 2XP8A 1FKBA 3CHCA 4IT4A 4KR0B 4ODOA 4DRKA 2WLYA 3AROA 5HWCA 1FFQA 2O9OA 4JYSA 5GPRA 5DF0A 1Y0OA 3WL1A 4W5UA 3CGMA 4L3NA 4MPKA 4LAVA 3WD1A 1ROTA 4N19A 4DRIA 1R9HA 3WIJA 1EYMA 1FKSA 3CH9A 2PPNA 4WKAA 4JFJA 4Z2HA 3AS1A 4XAKA 4P8UA 4QT2A 2MPHA 1JNDA 3O5KA 4DZ3A 1D7IA 1RD6A 2ZQUA 3BXWA 1PINA 3ARTA 4MNLA 3ALFA 1BL4A 4LAWA 1LG2A 4U86A 5J6EA 2ZR6A 4QIBA 3O5MA 2KR7A 1HJXA 1QZ2A 3ARYA 3NI6A 2VN1A 4G50A 4DT4A 4Z2LA 3WD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DH0 A;  2KE0 A;  2PBC A;  1J4H A;  3JYJ A;  4ODR A;  2PPO A;  1FKI A;  3GPK A;  2MNT A;  4ODN A;  4TNS A;  2UZ5 A;  2IF4 A;  2PPP A;  3NTP A;  3O5E A;  4TW8 A;  4DRO A;  1ZCN A;  4DZ2 A;  1FKJ A;  2XP6 A;  2LKN A;  1N1A A;  3UI4 A;  4C02 B;  1A7X A;  4TW7 A;  2KO7 A;  2M08 A;  4U84 A;  4J4N A;  2PV1 A;  1Q1C A;  1JNT A;  1Q6U A;  3JXV A;  1U79 A;  4QT3 A;  5HWB A;  5I98 A;  4ODQ A;  1JNS A;  4DRN A;  3UQI A;  1W26 A;  2Y78 A;  2MLZ A;  1YW5 A;  2XP3 A;  5DIV A;  3VAW A;  5B8I C;  3KAC A;  4JFI A;  2RUR A;  1BKF A;  3I6C A;  2RQS A;  2LJ4 A;  3UQA A;  3O5G A;  3NRK A;  4W9P A;  3UI6 A;  3O5Q A;  3TCZ A;  3KAI A;  1M5Y A;  2MF9 A;  2ZQT A;  4MSP A;  1TCO C;  1QPF A;  5HW8 A;  2DG4 A;  2K8I A;  4R0X A;  1FJD A;  3O5R A;  5DIU A;  1KT0 A;  2XPB A;  2DG3 A;  4JFM A;  3TC5 A;  2ZR4 A;  3ODK A;  3UI5 A;  4ITZ A;  4IQC A;  4DRP A;  3CGN A;  1FKR A;  4DRQ A;  3O5I A;  3O5O A;  1FKG A;  2LPV A;  3MDY B;  4NNR A;  2LGO A;  1QPL A;  2Q5A A;  2ITK A;  1FAP A;  5HT1 A;  1C9H A;  3EY6 A;  4JFK A;  5HW7 A;  3TDB A;  3UQB A;  2AWG A;  4TW6 A;  2D9F A;  4TX0 A;  5GPG A;  3KZ7 A;  5DIT A;  3LUO A;  1T11 A;  3JYM A;  3PA7 A;  3O5P A;  2XP8 A;  1FKB A;  3KAG A;  4IPX A;  2VCD A;  4ODO A;  1ZK6 A;  4DRK A;  3FAP A;  4GGQ A;  4DIP A;  5HWC A;  4GIV A;  2DG9 A;  3O5F A;  4W9Q A;  4DRJ A;  2RUD A;  1P5Q A;  4JYS A;  2XP4 A;  1Y0O A;  4W9O A;  2KGJ A;  3O5L A;  3CGM A;  4G2P A;  1FKT A;  4J4O A;  5BXJ A;  2MLY A;  2RUC A;  2FKE A;  2ZQV A;  2F4E A;  3WH0 A;  1J4R A;  3KAB A;  3UF8 A;  3IKD A;  3RFW A;  4LAV A;  2N87 A;  5HUA A;  1F8A B;  1ROT A;  5D75 A;  1EQ3 A;  1L1P A;  4N19 A;  4DRI A;  1NSG A;  1D7J A;  1R9H A;  5HKG A;  4ODL A;  1EYM A;  1FKS A;  4ODP A;  2RSE A;  4LAX A;  5HTG A;  2PPN A;  2XP7 A;  3KCE A;  4JFJ A;  4ODM A;  3O5J A;  1J6Y A;  2FAP A;  2OFN A;  1FKH A;  2PV3 A;  4QT2 A;  2RUQ A;  4JFL A;  2MPH A;  3O5K A;  1NMW A;  4DZ3 A;  3IK8 A;  3OOB A;  1ROU A;  4TYO A;  4U85 A;  4DRM A;  2F21 A;  3RGC A;  4LAY A;  4FAP A;  1NMV A;  1FD9 A;  1D7H A;  1D7I A;  1PBK A;  1Q6H A;  1Q6I A;  1YAT A;  2ZQU A;  3KAD A;  4ODK A;  1PIN A;  3PRB A;  2XP5 A;  3KAF A;  4MGV A;  1BL4 A;  2F2D A;  2M1I A;  2ZR5 A;  3KAH A;  4LAW A;  4U86 A;  1KT1 A;  1D6O A;  4IQ2 A;  1J4I A;  2XP9 A;  5J6E A;  2ZR6 A;  5HW6 A;  2L2S A;  1FKK A;  4O2T A;  1B6C A;  3O5D A;  4QIB A;  3O5M A;  3H9R B;  2KFW A;  2KR7 A;  3IKG A;  3B7X A;  1FKF A;  2XPA A;  2ZQS A;  1QZ2 A;  1FKL A;  2JZV A;  3NI6 A;  4DRH A;  2MLX A;  1F40 A;  1FKD A;  2VN1 A;  4FN2 A;  3IHZ A;  2KI3 A;  2M2A A;  3PRD A;  1JVW A;  4G50 A;  4DT4 A;  1HXV A;  2PV2 A;  4BF8 A; 
#chains in the Genus database with same CATH topology
 2KE0 A;  1J4H A;  3JYJ A;  2PPO A;  1ZB5 A;  4TNS A;  1EIB A;  1EDQ A;  3O5E A;  1H0G A;  3AS0 A;  4DZ2 A;  1A7X A;  1O6I A;  2WLZ A;  1W1T A;  1JCH B;  5I98 A;  4DRN A;  3UQI A;  3RM8 A;  5DIV A;  4JFI A;  1BKF A;  3I6C A;  3UQA A;  4QZV B;  3WD2 A;  3NRK A;  4MSP A;  1IX5 A;  4MTV A;  1EHN A;  4Q7N A;  2DG4 A;  4R0X A;  4JFM A;  3ODK A;  1HKJ A;  3CGN A;  3O5I A;  2LPV A;  4S3K A;  4DWS C;  1VF8 A;  2ITK A;  3G6L A;  3CHD A;  3PRA A;  1W1P A;  4TW6 A;  1E6R A;  5GPG A;  3KZ7 A;  3LUO A;  1ZL1 A;  1E6Z A;  1HKI A;  4IPX A;  2VCD A;  1ZK6 A;  1X6N A;  4GGQ A;  2YBU A;  4DIP A;  4W9Q A;  4ZS6 A;  2RUD A;  2A3E A;  1SYT A;  2XP4 A;  4W9O A;  2DPE A;  2DT1 A;  3WKZ A;  1FKT A;  1HKK A;  4J4O A;  2ZQV A;  2F4E A;  2N87 A;  5HUA A;  1F8A B;  3WD0 A;  1D7J A;  5HKG A;  4R5E A;  4ODL A;  3FXY A;  1OGB A;  2RSE A;  4MNK A;  3AS2 A;  1TFV A;  3O5J A;  1NH6 A;  1NWU A;  2PV3 A;  3IK8 A;  3OOB A;  1ROU A;  4TYO A;  4DRM A;  3ARZ A;  4MAV A;  3RGC A;  1FD9 A;  1D7H A;  1LG1 A;  2DSW A;  5B8I C;  2DSV A;  2QF8 A;  1X6L A;  1LL7 A;  1WB0 A;  3B9E A;  2L2S A;  5HW6 A;  1WNO A;  4Z2K A;  3H9R B;  2KFW A;  1FKF A;  2XPA A;  4S3J A;  1CTN A;  4PTM A;  4WKH A;  1E6P A;  2DT3 A;  4FN2 A;  2KI3 A;  2M2A A;  3PRD A;  3ARU A;  1HXV A;  1LJY A;  2PV2 A;  2DSZ A;  2ETN A;  4DH0 A;  2PBC A;  3WD3 A;  4ODR A;  3AQU A;  1FKI A;  3ARV A;  2IF4 A;  4DRO A;  4NZC A;  4MNM A;  2DSU A;  3ARX A;  4C02 B;  4TW7 A;  2A3A A;  2M08 A;  4U84 A;  4J4N A;  1HKM A;  1Q6U A;  1JNT A;  2PV1 A;  4NSB A;  3JXV A;  2A3B A;  2B5U B;  2Y78 A;  4IT6 A;  4Z2G A;  2RQS A;  2LJ4 A;  4URI A;  1QPF A;  1FJD A;  4DWS A;  5DIU A;  2PI6 A;  1E15 A;  4ITZ A;  4IQC A;  1FKR A;  2EUL A;  1FKG A;  2LGO A;  1QPL A;  5GQB A;  4JFK A;  3UQB A;  3RM4 A;  2DT0 A;  3JYM A;  5DEZ A;  3O5P A;  3FAP A;  2G8Z A;  2AOS A;  4GIV A;  3O5F A;  4HAR A;  4DRJ A;  1ITX A;  3G6M A;  1W9V A;  1WAW A;  3CHF A;  5BXJ A;  2MLY A;  2DT2 A;  2FKE A;  1GUV A;  3WH0 A;  1J4R A;  3KAB A;  4UDM A;  3IKD A;  3UF8 A;  4ZPW R;  3RFW A;  2A3C A;  1EQ3 A;  1H0I A;  4ODP A;  4ODM A;  3ARW A;  1ZBW A;  4LGX A;  1FKH A;  1NMW A;  4U85 A;  2OLH A;  1NMV A;  3KAD A;  1NWT A;  1Q6I A;  1K9T A;  4WIW A;  4MGV A;  2F2D A;  2M1I A;  2P4V A;  2ZR5 A;  1KT1 A;  1D6O A;  4IQ2 A;  2XP9 A;  4O2T A;  1FKK A;  1HJW A;  4Z2I A;  3ARQ A;  1F40 A;  4DWS D;  1FKD A;  1FFR A;  3IHZ A;  3AS3 A;  4BF8 A;  2WM0 A;  3OA5 A;  4ODN A;  4P8W A;  2PPP A;  4TW8 A;  2ESC A;  1FKJ A;  1N1A A;  4ML4 A;  3RME A;  1NWS A;  1U79 A;  5HWB A;  4L72 B;  1ZU8 A;  4P8V A;  1YW5 A;  2XP3 A;  4Q22 A;  1OWQ A;  2O92 A;  3O5G A;  4DRP A;  3UI6 A;  3O5Q A;  5JH8 A;  3KAI A;  1M5Y A;  2ZQT A;  1HJV A;  5HW8 A;  4ZPV R;  2K8I A;  3O5R A;  4WK9 A;  3FY1 A;  3TC5 A;  1LL4 A;  2ZR4 A;  1W1V A;  4DRQ A;  2G41 A;  3O5O A;  3MDY B;  4NNR A;  3EIP A;  2Q5A A;  1FAP A;  5HT1 A;  3GTY X;  1C9H A;  3EY6 A;  3QOK A;  1OGG A;  5HW7 A;  2AWG A;  2D9F A;  2FDM A;  4TX0 A;  5DO2 A;  5DIT A;  1KFW A;  1T11 A;  3PA7 A;  3KAG A;  1W1Y A;  1UR8 A;  4DWS B;  1LL6 A;  4AY1 A;  2DG9 A;  1P5Q A;  1JNE A;  1GOI A;  3WL0 A;  1SR0 A;  2KGJ A;  3O5L A;  4G2P A;  1UR9 A;  2RUC A;  1W9P A;  2B31 A;  5D75 A;  1L1P A;  1NSG A;  1D2K A;  4KQZ A;  1GPF A;  4LAX A;  5HTG A;  2XP7 A;  3KCE A;  1J6Y A;  1XRV A;  1ZBV A;  2FAP A;  2OFN A;  2RUQ A;  1ZBK A;  4JFL A;  3RM9 A;  2F21 A;  3GU0 A;  4LAY A;  4WJX A;  3BMB A;  4FAP A;  4ODK A;  1PBK A;  1Q6H A;  1YAT A;  3W4R A;  2IUZ A;  3PRB A;  2XP5 A;  3KAF A;  5HBF A;  3KAH A;  3B9A A;  1J4I A;  1XHG A;  3CHE A;  1B6C A;  3O5D A;  4WKF A;  4Z2J A;  3ARS A;  3IKG A;  3B7X A;  2ZQS A;  4HBE A;  1FKL A;  2JZV A;  4DRH A;  2MLX A;  1E6N A;  1JVW A;  4HBO A;  3WQW A;  3GPK A;  2MNT A;  3ALG A;  2YBT A;  2UZ5 A;  4ZPT R;  3NTP A;  3B9D A;  1ZCN A;  2XP6 A;  2LKN A;  3UI4 A;  2KO7 A;  3CZ8 A;  1Q1C A;  4P8X A;  4QT3 A;  4ODQ A;  1JNS A;  1W26 A;  2MLZ A;  3VAW A;  3KAC A;  2RUR A;  4W9P A;  3PR9 A;  3B8S A;  3TCZ A;  2MF9 A;  1E9L A;  1TCO C;  1KT0 A;  2XPB A;  2DG3 A;  1LQ0 A;  2WK2 A;  3UI5 A;  1ZBC A;  3ARR A;  4MNJ A;  1GRJ A;  3TDB A;  3WQV A;  1W9U A;  3ARP A;  2PN0 A;  1NWR A;  2XP8 A;  1FKB A;  3CHC A;  4IT4 A;  4KR0 B;  4ODO A;  4DRK A;  2WLY A;  3ARO A;  5HWC A;  1FFQ A;  2O9O A;  2F23 A;  4JYS A;  5GPR A;  5DF0 A;  1Y0O A;  3WL1 A;  4W5U A;  3CGM A;  4L3N A;  4MPK A;  4LAV A;  3WD1 A;  1ROT A;  4N19 A;  4DRI A;  1R9H A;  3WIJ A;  1EYM A;  1FKS A;  3CH9 A;  2PPN A;  4WKA A;  4JFJ A;  4Z2H A;  3AS1 A;  4XAK A;  4P8U A;  4QT2 A;  2MPH A;  1JND A;  3O5K A;  4DZ3 A;  1D7I A;  1RD6 A;  2ZQU A;  3BXW A;  1PIN A;  3ART A;  4MNL A;  3ALF A;  1BL4 A;  4LAW A;  1LG2 A;  4U86 A;  5J6E A;  2ZR6 A;  4QIB A;  3O5M A;  2KR7 A;  1HJX A;  1QZ2 A;  3ARY A;  3NI6 A;  2VN1 A;  4G50 A;  1E44 A;  4DT4 A;  4Z2L A;  3WD4 A; 
#chains in the Genus database with same CATH homology
 2KE0 A;  1J4H A;  3JYJ A;  2PPO A;  1ZB5 A;  4TNS A;  1EIB A;  1EDQ A;  3O5E A;  1H0G A;  3AS0 A;  4DZ2 A;  1A7X A;  1O6I A;  2WLZ A;  1W1T A;  5I98 A;  4DRN A;  3UQI A;  3RM8 A;  5DIV A;  4JFI A;  1BKF A;  3I6C A;  3UQA A;  4QZV B;  3WD2 A;  3NRK A;  4MSP A;  1IX5 A;  4MTV A;  1EHN A;  4Q7N A;  2DG4 A;  4R0X A;  4JFM A;  3ODK A;  1HKJ A;  3CGN A;  3O5I A;  2LPV A;  4S3K A;  4DWS C;  1VF8 A;  2ITK A;  3G6L A;  3CHD A;  3PRA A;  1W1P A;  4TW6 A;  1E6R A;  5GPG A;  3KZ7 A;  3LUO A;  1ZL1 A;  1E6Z A;  1HKI A;  4IPX A;  2VCD A;  1ZK6 A;  1X6N A;  4GGQ A;  2YBU A;  4DIP A;  4W9Q A;  4ZS6 A;  2RUD A;  2A3E A;  1SYT A;  2XP4 A;  4W9O A;  2DPE A;  2DT1 A;  3WKZ A;  1FKT A;  1HKK A;  4J4O A;  2ZQV A;  2F4E A;  2N87 A;  5HUA A;  1F8A B;  3WD0 A;  1D7J A;  5HKG A;  4R5E A;  4ODL A;  3FXY A;  1OGB A;  2RSE A;  4MNK A;  3AS2 A;  1TFV A;  3O5J A;  1NH6 A;  1NWU A;  2PV3 A;  3IK8 A;  3OOB A;  1ROU A;  4TYO A;  4DRM A;  3ARZ A;  4MAV A;  3RGC A;  1FD9 A;  1D7H A;  1LG1 A;  2DSW A;  5B8I C;  2DSV A;  2QF8 A;  1X6L A;  1LL7 A;  1WB0 A;  3B9E A;  2L2S A;  5HW6 A;  1WNO A;  4Z2K A;  3H9R B;  2KFW A;  1FKF A;  2XPA A;  4S3J A;  1CTN A;  4PTM A;  4WKH A;  1E6P A;  2DT3 A;  4FN2 A;  2KI3 A;  2M2A A;  3PRD A;  3ARU A;  1HXV A;  1LJY A;  2PV2 A;  2DSZ A;  4DH0 A;  2PBC A;  3WD3 A;  4ODR A;  3AQU A;  1FKI A;  3ARV A;  2IF4 A;  4DRO A;  4NZC A;  4MNM A;  2DSU A;  3ARX A;  4C02 B;  4TW7 A;  2A3A A;  2M08 A;  4U84 A;  4J4N A;  1HKM A;  1Q6U A;  1JNT A;  2PV1 A;  4NSB A;  3JXV A;  2A3B A;  2Y78 A;  4IT6 A;  4Z2G A;  2RQS A;  2LJ4 A;  4URI A;  1QPF A;  1FJD A;  4DWS A;  5DIU A;  2PI6 A;  1E15 A;  4ITZ A;  4IQC A;  1FKR A;  1FKG A;  2LGO A;  1QPL A;  5GQB A;  4JFK A;  3UQB A;  3RM4 A;  2DT0 A;  3JYM A;  5DEZ A;  3O5P A;  3FAP A;  2G8Z A;  2AOS A;  4GIV A;  3O5F A;  4HAR A;  4DRJ A;  1ITX A;  3G6M A;  1W9V A;  1WAW A;  3CHF A;  5BXJ A;  2MLY A;  2DT2 A;  2FKE A;  1GUV A;  3WH0 A;  1J4R A;  3KAB A;  3UF8 A;  3IKD A;  4ZPW R;  3RFW A;  2A3C A;  1EQ3 A;  1H0I A;  4ODP A;  4ODM A;  3ARW A;  1ZBW A;  4LGX A;  1FKH A;  1NMW A;  4U85 A;  2OLH A;  1NMV A;  3KAD A;  1NWT A;  1Q6I A;  1K9T A;  4WIW A;  4MGV A;  2F2D A;  2M1I A;  2ZR5 A;  1KT1 A;  1D6O A;  4IQ2 A;  2XP9 A;  4O2T A;  1FKK A;  1HJW A;  4Z2I A;  3ARQ A;  1F40 A;  4DWS D;  1FKD A;  1FFR A;  3IHZ A;  3AS3 A;  4BF8 A;  2WM0 A;  3OA5 A;  4ODN A;  4P8W A;  2PPP A;  4TW8 A;  2ESC A;  1FKJ A;  1N1A A;  4ML4 A;  3RME A;  1NWS A;  1U79 A;  5HWB A;  4L72 B;  1ZU8 A;  4P8V A;  1YW5 A;  2XP3 A;  4Q22 A;  1OWQ A;  2O92 A;  3O5G A;  4DRP A;  3UI6 A;  3O5Q A;  5JH8 A;  3KAI A;  1M5Y A;  2ZQT A;  1HJV A;  5HW8 A;  4ZPV R;  2K8I A;  3O5R A;  4WK9 A;  3FY1 A;  3TC5 A;  1LL4 A;  2ZR4 A;  1W1V A;  4DRQ A;  2G41 A;  3O5O A;  3MDY B;  4NNR A;  2Q5A A;  1FAP A;  5HT1 A;  1C9H A;  3EY6 A;  3QOK A;  1OGG A;  5HW7 A;  2AWG A;  2D9F A;  2FDM A;  4TX0 A;  5DO2 A;  5DIT A;  1KFW A;  1T11 A;  3PA7 A;  3KAG A;  1W1Y A;  1UR8 A;  4DWS B;  1LL6 A;  4AY1 A;  2DG9 A;  1P5Q A;  1JNE A;  1GOI A;  3WL0 A;  1SR0 A;  2KGJ A;  3O5L A;  4G2P A;  1UR9 A;  2RUC A;  1W9P A;  2B31 A;  5D75 A;  1L1P A;  1NSG A;  1D2K A;  4KQZ A;  1GPF A;  4LAX A;  5HTG A;  2XP7 A;  3KCE A;  1J6Y A;  1XRV A;  1ZBV A;  2FAP A;  2OFN A;  2RUQ A;  1ZBK A;  4JFL A;  3RM9 A;  2F21 A;  4LAY A;  4WJX A;  4FAP A;  4ODK A;  1PBK A;  1Q6H A;  1YAT A;  3W4R A;  2IUZ A;  3PRB A;  2XP5 A;  3KAF A;  5HBF A;  3KAH A;  3B9A A;  1J4I A;  1XHG A;  3CHE A;  1B6C A;  3O5D A;  4WKF A;  4Z2J A;  3ARS A;  3IKG A;  3B7X A;  2ZQS A;  4HBE A;  1FKL A;  2JZV A;  4DRH A;  2MLX A;  1E6N A;  1JVW A;  4HBO A;  3WQW A;  3GPK A;  2MNT A;  3ALG A;  2YBT A;  2UZ5 A;  4ZPT R;  3NTP A;  3B9D A;  1ZCN A;  2XP6 A;  2LKN A;  3UI4 A;  2KO7 A;  3CZ8 A;  1Q1C A;  4P8X A;  4QT3 A;  4ODQ A;  1JNS A;  1W26 A;  2MLZ A;  3VAW A;  3KAC A;  2RUR A;  4W9P A;  3PR9 A;  3B8S A;  3TCZ A;  2MF9 A;  1E9L A;  1TCO C;  1KT0 A;  2XPB A;  2DG3 A;  1LQ0 A;  2WK2 A;  3UI5 A;  1ZBC A;  3ARR A;  4MNJ A;  3TDB A;  3WQV A;  1W9U A;  3ARP A;  1NWR A;  2XP8 A;  1FKB A;  3CHC A;  4IT4 A;  4KR0 B;  4ODO A;  4DRK A;  2WLY A;  3ARO A;  5HWC A;  1FFQ A;  2O9O A;  4JYS A;  5GPR A;  5DF0 A;  1Y0O A;  3WL1 A;  4W5U A;  3CGM A;  4L3N A;  4MPK A;  4LAV A;  3WD1 A;  1ROT A;  4N19 A;  4DRI A;  1R9H A;  3WIJ A;  1EYM A;  1FKS A;  3CH9 A;  2PPN A;  4WKA A;  4JFJ A;  4Z2H A;  3AS1 A;  4XAK A;  4P8U A;  4QT2 A;  2MPH A;  1JND A;  3O5K A;  4DZ3 A;  1D7I A;  1RD6 A;  2ZQU A;  3BXW A;  1PIN A;  3ART A;  4MNL A;  3ALF A;  1BL4 A;  4LAW A;  1LG2 A;  4U86 A;  5J6E A;  2ZR6 A;  4QIB A;  3O5M A;  2KR7 A;  1HJX A;  1QZ2 A;  3ARY A;  3NI6 A;  2VN1 A;  4G50 A;  4DT4 A;  4Z2L A;  3WD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...