1Q6IA

Crystal structure of a truncated form of fkpa from escherichia coli, in complex with immunosuppressant fk506
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
210
Chain Sequence
AFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
publication title Structural and functional studies of FkpA from Escherichia coli, a cis/trans peptidyl-prolyl isomerase with chaperone activity.
pubmed doi rcsb
source organism Escherichia coli
total genus 66
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1q6iA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q6iA02
4W9PA 1R9HA 4DRHA 3EY6A 3PRBA 4MGVA 1D7JA 4ODNA 1NMWA 4IQ2A 3KAGA 1YATA 1FAPA 3O5JA 3FAPA 4ODRA 1FKSA 2KE0A 3TCZA 5HW6A 1F8AB 1FKJA 2MLYA 4J4NA 5HUAA 2RUQA 5I98A 2LJ4A 1FKHA 5DIVA 2Y78A 2MNTA 2DG4A 4O2TA 2IF4A 4N19A 3KABA 4FAPA 5J6EA 2MF9A 4ODOA 3TC5A 4DROA 2PV3A 2JZVA 2KI3A 2Q5AA 2ITKA 2XP8A 1Q6IA 3CGNA 2PPPA 4ODMA 4FN2A 4GIVA 4DRKA 5HKGA 2PV1A 4G2PA 2FKEA 1FKLA 1A7XA 1C9HA 3JYJA 2XP9A 4JFJA 4U84A 2ZR5A 5DITA 3B09A 2XPBA 4GGQA 5HT1A 3O5FA 5HW7A 1HXVA 1FKBA 2UZ5A 1P5QA 2PV2A 3TDBA 4DRNA 4DRJA 2MLZA 2F4EA 4LAYA 3NI6A 2AWGA 4DRIA 1F40A 4TYOA 1NSGA 4DZ3A 5HTGA 1JVWA 3CGMA 3KAFA 2PPNA 1BKFA 2XP6A 3KZ7A 4R0XA 5GPGA 1QPFA 1M5YA 5DIUA 2M2AA 5BXJA 1FKTA 1L1PA 2XP4A 4C02B 3UQAA 3O5OA 1FKGA 2RURA 3PA7A 1JNTA 1T11A 1J4IA 1D7HA 2VN1A 3KAHA 4IQCA 4W9OA 1KT1A 3RFWA 5HWBA 4U86A 1U79A 4QIBA 4DZ2A 4TX0A 1FD9A 1Q6HA 3UI6A 2ZQUA 3PRDA 3GPKA 3KADA 5HWCA 3O5QA 1BL4A 3LUOA 2RUCA 3NTPA 1KT0A 4ITZA 3ODKA 4JFKA 4QT2A 2PBCA 1PBKA 3O5GA 3IKGA 4LAVA 4BF8A 3UQBA 2XP3A 1TCOC 3VAWA 2OFNA 4J4OA 3O5MA 2D9FA 3O5EA 3IK8A 2ZR6A 2LGOA 4JYSA 1FKRA 1B6CA 3RGCA 3KCEA 2VCDA 2ZQTA 2L2SA 4DT4A 5HW8A 1N1AA 4JFMA 3O5PA 4NNRA 4TNSA 1FKFA 2ZQSA 1Q1CA 3MDYB 1Y0OA 2KO7A 1JNSA 1D6OA 2XP7A 1QPLA 3H9RB 3IKDA 1Q6UA 1YW5A 1FKDA 1W26A 4TW8A 1EQ3A 3O5DA 3UQIA 1J4RA 3WH0A 2DG9A 1ROTA 2XP5A 2FAPA 1QZ2A 2LPVA 2F21A 3O5RA 2K8IA 5D75A 4JFLA 4ODQA 2DG3A 2ZQVA 3JXVA 4ODLA 4TW7A 4DRQA 3UI5A 2M1IA 2M08A 2PPOA 2MLXA 3B7XA 3O5KA 3UI4A 1J4HA 2KFWA 2KR7A 1PINA 2RSEA 3O5IA 4DIPA 4W9QA 1ZK6A 4DRMA 1ROUA 4IPXA 4G50A 4TW6A 4LAWA 3KACA 4DH0A 1J6YA 5B8IC 2ZR4A 1FJDA 1EYMA 1FKIA 2RUDA 4U85A 1D7IA 1ZCNA 4LAXA 2F2DA 3KAIA 1FKKA 3IHZA 3UF8A 4JFIA 4DRPA 1NMVA 2LKNA 2N87A 4ODPA 3O5LA 2KGJA 2MPHA 2RQSA 2XPAA 3NRKA 3OOBA 4MSPA 3JYMA 4ODKA 4QT3A 3I6CA
chains in the Genus database with same CATH superfamily
5J2TA 3HKDA 4DRHA 3PRBA 4MGVA 2A06H 4B7EA 2YSUB 3DTUB 5B1AB 2EINC 3O5JA 3JASA 3BFRA 2A3EA 3RVYA 3N27A 5JWPA 1AR1B 4O4JB 3ARQA 4RQFA 3KABA 4FAPA 4UCTA 2GV9A 3E8HA 4TQDA 2CTPA 2HG5C 3EFFK 2F4VO 3E83A 5KX5A 1K4DC 3CCMV 1C9HA 2YIDA 3TXSA 1P5QA 1HNWB 3TDBA 2Q67A 1KMIZ 1YSCA 5KHGA 4JI0B 4PTMA 3K57A 3MHHC 2A3CA 2PPNA 2K9PA 5LP6C 2GUZB 3T1HO 2UXCB 3ABUA 2X6CA 4ASUG 1XNRO 4X89A 2ZINA 1H0GA 3T4DA 4WKFA 4FLUA 2QEXV 4U86A 4YIPA 3EIPA 3AEIA 3CHEA 2ZXWB 3GPKA 4AILC 1MZEA 2C2AA 2RUCA 1CTNA 3RT3C 1KP3A 3R65A 4DV2O 2PBCA 1WN7A 4C7UA 5LMNB 1K7DA 5IYCO 1V55C 3FAVB 1JR9A 4PJ0Z 4MNLA 2VCDA 1V54B 2LQTA 5LXTB 1PL0A 3ARUA 1K8AW 1JNSA 3G67A 5KA6A 1W9VA 5B3SC 3B77A 3OMNB 2G8ZA 4LBEC 3O5DA 4CH3A 3FD9A 1QZ2A 5LA6A 5CBFA 3HKCA 4FMTA 2ZQVA 1HNXO 1ZSPA 3RM9A 4X65O 4ZIBA 3OD4A 1NBMG 4O4LB 5JQGB 1UPGA 2CAZC 2UUBB 4LAWA 1DTOA 4LCUC 1SYTA 1R6NA 4ODPA 1OGGA 4LNUA 2OYQA 3OE7G 2DT1A 2QTSA 1GM9A 3I55V 2JRIA 2UUAO 1B04A 3ASOC 4FLYA 3CRRA 1Q43A 5B1NA 3IFXA 2Y48A 2H3OA 5F2VO 4PDVA 3KZIZ 3UT5B 4Z1MG 5JJEB 4J4NA 2NN4A 1NWUA 4H0LB 2DSVA 3KCXA 1AP5A 1W0JG 3JARB 3K5OA 1IBLB 4RUEA 4CH4A 1P49A 3WIJA 4ICGA 2OLHA 3OMAB 3GU0A 1D2KA 2ZR5A 2R70A 3O5FA 1JMKC 4JI3O 4X62O 4Z2WA 1I0HA 4DV7O 4DRIA 5LMUB 5AG2A 5BXZA 2ZDIA 2IU0A 2DPEA 2HJFC 5KAFZ 2DWDC 1K73W 3GWKC 4LWSA 3RFWA 4Q20A 1YIJV 2VQEO 2VRZA 3ZHTA 2XUMA 5J2TB 2R9IA 2ZR3A 5H5NA 1IBMB 5IWAB 3IKGA 4ZI7A 2RJZA 2YIAA 3JASB 2UU9O 1GH6A 2JGDB 1N33O 5BR8B 1AVMA 2L2SA 4O4HA 2R9RB 4JI4B 3ZMZA 1OCRC 1D6OA 4FZ0A 1CEZA 2QM4A 4MVUA 2ZT9B 4LF7O 4NKGB 3HKEB 4DW0A 1Q90D 1JFFA 5C93A 2F93B 1N36O 1R73A 3JALA 4HAMA 3BXWA 2YXLA 2VQFO 4OX9O 1VQNV 1GAXA 2KR7A 3ARXA 3ZS8C 4W9QA 1IBKB 3QOKA 3J7AU 4LFAB 4J41A 4MW8A 1D7IA 3KAIA 2PN0A 3CRAA 4DRPA 5LL6Y 5EYPB 4YIOA 4FM1A 5IJ0A 2RDCA 1EZVH 5TISZ 2AHZA 3ARPA 2PUSA 4NXMO 1D7JA 1Y76B 4WKAA 2GDSA 4MW3A 2IJKA 5KUMA 4I9QA 5DM6V 4U7OA 3GVMA 4N19A 4UXNA 1Z2GA 5J6EA 4O2AA 5LOVA 5HKGA 4F6EA 2QSAA 5HBFA 2QA4V 1ITXA 1SZTA 1M93A 3ZHQA 4MTGA 4DRJA 1H8HG 1H2GA 3JD1A 1IDSA 5GPGA 1JCHA 1OWQA 2AZ0A 1E6RA 4JI6B 4PI2A 4DK0A 4R7CA 4DR7O 5HFMA 1T11A 3ZHUA 4QIBA 4K35A 3WL1A 2DYSC 3IAYA 1F7YA 3MD0A 3PRDA 2EBOA 3JD3A 3AG3C 1BL4A 3AG2C 1KT0A 4E4EA 4GZRB 1H2KA 3BCCH 3W7XA 4QNHB 2ZDIC 4XDLA 3LNMB 2A3QA 1SS3A 3ABLC 2E74B 5E1AC 4CC5A 3E22B 1FKFA 4B3RB 3HPLC 2YXYA 1WB0A 4GX5A 1P7GA 2GSMB 2L6LA 1WA8B 2RQ6A 3AG7A 1YW5A 1AJQA 1TUEB 2F66C 2HVJC 1E44A 3CWBH 2YEVB 4Q7NA 3SYAA 1NH2D 4I55A 1SF9A 1EM1A 1YEWA 4CS2A 2ZCEA 1FKIA 1D2DA 3JCUZ 1QVFU 5ITZA 1XDCA 2B31A 3OM3B 2KGJA 1LUWA 1SQXH 2JGUA 4QJFB 3Q4HB 3M8AA 4WF9V 3SYOA 2LJ2A 5IYZA 1YTFD 2F43G 2DWEC 2JJ2G 2LGQA 5CA1A 1NR1A 1ZWIC 1Q5OA 3JCZA 1Y74A 3OTOO 1VQPV 4O4HB 1N0JA 2MLYA 3DGEA 5HUAA 3R66A 4DR4O 4I50A 4X66O 2JZVA 2Q5AA 4KP4A 3BAAA 2OTJV 4MTXA 3JALB 3B4SA 2ZE5A 2UZ5A 3OA5A 2OCCB 4X1IA 4DR6O 1AB3A 2H94A 3FB6C 3PN1A 2AXTZ 1QLEB 1F40A 1RM1C 5HTGA 1MOFA 4BR6A 1K9MW 2XP6A 3CMEV 1HJXA 3LSQA 3CXHF 2H8PC 4DV5O 4YY3O 4UVAA 1I5YA 2YC0A 1N8RW 1ZL8A 2Q0OC 2XP4A 3UQAA 1H8EG 1BT8A 1OZ0A 1FKGA 1OGBA 4P2ZA 3ETEA 2E76B 4MTVA 3AS1A 5KAIZ 3ZN1A 5IJ0B 4BW5A 3RBZA 1LQ0A 4NZCA 3SGIA 1IXMA 5HWCA 4X64O 4EFEA 3S3WA 1UFIA 4DV4O 3O5GA 5KHKA 2XAFA 1EBOA 3UQBA 2YUAA 1FAFA 1US6A 2KG7B 5CB4A 5DEDA 5CA0B 2IM9A 2XHBA 2DOSA 1FKRA 3RYIA 3IJ4A 4OGQB 2DE0X 5HW8A 1IURA 2QWOB 4TNSA 4O2AB 2WLIA 1Y0OA 4X1KA 3E2EA 4K0KO 1NWTA 1M56C 1URFA 3TGUH 1VQ7V 1FXKA 1DF4A 2FAPA 2K8IA 2DG3A 3M7MX 5BMVA 1SETA 4TW7A 4DRQA 3O5KA 5DO2A 1JX9A 2UUCO 2P6JA 1O9HA 1FFXB 4TW6A 4ZOLA 1LL6A 1COWG 3WD4A 4JFIA 4K8XA 4UDMA 2CE4A 1Y67A 3CRQA 2Z0AA 2EIJC 5GONA 4LFBB 4QT3A 3CJHA 4CZZA 1TVKA 1SA0A 2DT0A 5CMUA 3ABMC 3B8SA 3KAGA 2GHYA 2QWQB 4LF4B 1FAPA 5BZBA 1NZ6A 4PI0A 3CYOA 3ZMTA 4WFFA 3VQWA 2MNTA 4P9OA 4O2TA 2WLLB 5JH7A 2WLHA 1HW7A 3GB7C 3K9AA 1OCZC 2N74A 1BSMA 3QTCA 2PI5A 2L35A 1LG1A 4G2PA 3DC6A 4R6ZA 1A7XA 3KG2A 4HYOA 5HT1A 4UCUA 5BY1A 3APQA 3K79A 5J2UB 5IT9N 2Q68A 4LAYA 4URIA 3CS5A 2V4DA 1XMOB 3CGMA 2XTAA 4IHJA 5EBMC 4P8UA 3CRMA 1FKTA 3N2GB 5E79Z 1NVPD 2LW7A 4Z2HA 2P90A 4KXRA 1PL4A 1RPOA 4TQFA 5EBLC 2Z3YA 5KMGA 5GQBA 4LAVA 2OT5A 4FLWA 1RPRA 1HNZB 4IYIA 2ITCC 4JAUA 4FIPC 1W1PA 4JI0O 3KCEA 1Y66A 5C8YB 1SQQH 1ORQC 1MA1A 1B06A 2Q7GA 5IE9A 2UXBB 4KQZA 4NTXA 1I5XA 4FVMA 2Q0AA 1HJVA 2Y0PA 1Q82W 5GPRA 3CXCU 3ARYA 2RMKB 3JSLA 4Z1VA 3WH0A 3CCLV 3CC4V 4IYHA 4CC6A 4I4TA 1N32O 3JXVA 3UI5A 2DN9A 5GTIZ 2EULA 2Y69C 3QF7A 1PINA 3G80A 3CRCA 5FNVA 4JV5B 1YVWA 4J10A 3FFQA 4LGXA 1CPYA 3KCYA 1NTKH 1ZCNA 4LAXA 1S77D 2EIKB 3IHZA 1PNKA 1FXKC 3CMAV 2E5LB 4EEQA 3A0BZ 1OJHA 2P22C 3T1YB 1M57C 3SPJA 1AILA 2AOSA 5HW6A 2DSWA 2XT9A 3WD2A 2CK3G 3S3XA 1M90W 2RUQA 2CTRA 1AI6A 4UFZA 5GTHZ 1GM8A 4DK1A 2DT2A 3CCVV 2UUBO 2P67A 3H9VA 3ZIAG 2P7TC 2QGNA 1WPXA 4U84A 3CHDA 3HR0A 4WK9A 1FS0G 1S5HC 1Q86W 2HHHO 4S3JA 3FB5C 1XILA 2BSKA 5CBGA 4JI1B 2AWGA 2UXNA 2ARHA 3ZJZA 3ASNB 3JAKB 3IC7A 4GX2A 4ZOLB 4KR0B 5BXJA 4Q22A 3AK3A 5KHHA 1E15A 3RWRD 3K06A 1Y6XA 1EHNA 2IUZA 3AS0A 4ZPVR 1IX5A 1KFWA 3ZN0A 1YHQV 2EIMC 2ZQMA 1IBLO 4MPKA 1O6IA 2XASA 4LH6A 4L72B 2LFSA 3RYFB 1X59A 3OEEG 4WBNA 4GKKB 2Q69A 3ALGA 1PNLA 1JOYA 1X6LA 1WAZA 4JZ2A 2EINB 4H33A 5LMUO 1LR1A 3JYCA 3U10A 2Y0IA 1FXHA 3DC5A 3JSNA 4FFKA 1TUBB 1Q3EA 5FPRA 4WJXA 2QTOA 4DUYB 1EQ3A 4FFBB 4JF3A 2PGGA 3L70H 3A2FA 3VQXA 2LPVA 4TV8A 1X6NA 5D75A 4TWKA 2PF4E 1IBMO 1Q8IA 3CEIA 4ZKIA 4YHHB 5IWAO 1XHGA 2MLXA 4IHJB 4MVSA 2KFWA 2WLNA 2PI4A 1THZA 4P30A 1U96A 4DR5B 4PDMA 1J6YA 5LP6B 5BR8O 1H0IA 1LJYA 3ZMSA 2RUDA 4UB6Z 3CCRV 2FTKA 2F2DA 1KP2A 1KC8W 4JI4O 1W1TA 1IX9A 4MVRA 4UCRA 3MHSC 5EIBC 1HKIA 5LGNA 4H37A 1R3JC 4MVZA 1YATA 2DQ0A 5KUKA 4B3SO 2P5OA 1MABG 1V55B 4JYCA 2BTQA 3ABTA 4LFCB 1IBKO 2G41A 3OEHG 2B1IA 1ENVA 5IJ9B 1FFQA 3CCQV 3H1HH 4LFAO 4I0XA 4TT3G 1NJIW 1OCOC 4OPAA 3CGNA 2B9ZA 4GIVA 4XBFA 2QR4A 5B3SB 2X7RB 1UR8A 2QKSA 4GGQA 4I4TB 2MW2B 1VARA 5LYJB 2MK3A 3CB2A 4KL1A 3K3WA 1K3EA 4D6TH 4R5EA 3CHCA 3BPZA 2JEUA 5HWBA 4KUMA 2BE3A 4EKWA 1L8DA 3CX5F 3KADA 1Y4MA 3RYCA 1SZXA 2ZKOA 3P3NA 3B9EA 4P9PA 3N2KA 1WP8A 3VAWA 2ZNIA 5EZYA 3ASOB 3O5MA 2D9FA 3O5EA 2ZR6A 3CH9A 4BW9A 2ZQTA 4DT4A 2ESCA 3ZHSA 2F4VB 1CP9A 4IIJA 3H01A 4DR3O 2D2CB 4JI6O 4EB6A 3LDCA 4J80A 4X1YB 1R3IC 1LG2A 1M9NA 1J4RA 3HKDB 2CTQA 3OW2U 4LF6B 1PD3A 2BSKB 2F21A 2KB1A 4JFLA 4O4IA 3T1HB 3ARWA 2YIBD 5H6QA 1XNRB 3UI4A 3VBBA 2JIZG 2K1EA 4DIPA 1SQGA 4G50A 2ATKC 4LP8A 4Z2LA 2ILMA 2HLDG 4DUZB 4FLZA 3K59A 2Q9LA 1FXVA 4B3RO 3FB7C 5KX5B 2XPAA 2O57A 3SYCA 1QR8A 1DK1A 4JI2B 3OMIB 3K03A 4ZPTR 1LUVA 3I6CA 3ETGA 3K0DA 4JGSA 4WBNB 4PA4A 1R9HA 5FLXN 4MNJA 2Q7EA 2ZE7A 3FAPA 2E3CA 4DWSD 2QKAA 4W4LA 4CS4A 2BTOA 3BA9A 3B9AA 3OGCC 1K9TA 4K3AA 4IGGA 4IT4A 3ZHVA 1WAWA 4QPJA 2MF9A 3TXQA 4JASA 3JAWA 2ADPA 3OGIB 4MNMA 3QO5A 1Q6IA 1GN4A 1W59A 3SJCC 1OCRB 3SPGA 4DRMA 1PNMA 3NXSA 2XPBA 2FMLA 2WAMA 1ZX3A 3K5LA 2JJ1G 2MLZA 1R3KC 3ZBHA 4R8CA 4TYOA 2YI8A 4PA3A 3L72H 4P8XA 1XMQO 4TUYA 2WLMA 3EXAA 1VF5B 3O65A 1W2BU 4DRXA 3O5OA 3DXRA 3B9DA 3CHFA 2HP8A 3P32A 3AS2A 3WB0A 3AK1A 1JJ2U 2ZQUA 1QVGU 4LR3A 4B08A 3LUOA 1D5NA 5EC1C 5DF0A 5LA6B 3HKCB 3IGAC 2IH1C 1HP8A 4TV9A 2OFNA 1DLBA 4P8VA 5JVDA 3UCSC 1VMGA 3P30A 3UQ8A 4AHCA 2WA3A 4FPPA 2HR3A 2N04A 5H6RA 4QIWF 4LNUB 2M6YA 4JI3B 1BE3H 1WJZA 1SERA 2Z5UA 2B5UA 4DV7B 1WLEA 2X0LA 4ZHQA 2XAHA 1B6QA 4CH6A 3NR7A 3VOUA 3HKBA 3RYHA 5D5PA 3OR6C 2RSEA 4UCSA 1PKXA 1ZK6A 3KKYA 1AI4A 1BHBA 1RP3B 4LF9B 2Y4TA 1OCCC 2YXHA 1QLNA 3H1KH 1S5LZ 4X8AA 3JD2A 4Z2KA 3OOBA 1QHTA 2DYSB 1TFVA 1XL6A 3AG3B 3AG2B 1L1FA 4B3MO 3L74H 5EZYB 3CZ8A 1N33B 1NMWA 3RN4A 4IL6Z 4AQYB 1EZJA 3WFVA 1HWYA 2IJJA 1EN5A 1FKJA 3FX7A 3LDDA 4I5SA 1F51A 4Q6GA 5L3FA 3ABLB 4L87A 3TJTA 1ZBWA 4LWSB 1QNMA 3W7WA 2XP8A 1W1YA 2UXXA 3WG7C 1SQFA 1R1BA 2VQFB 5HW7A 1BMFG 4ZI7B 1K33A 4LFBO 3M99B 3BHPA 3THOA 1YZBA 5A9GA 3WQWA 1BKFA 4LF4O 4MVQA 3QG5A 4DR1O 1MZFA 3X2QC 4JI7B 4DV1O 3PA7A 3ICXA 1J4IA 2VN1A 4W9OA 3BABA 2JDIG 2VWKA 1W1VA 4X20A 2QWNB 4HNAA 1XOUA 1R6KA 4W4KA 1WB7A 4NXMB 2IH3C 5EK0A 1FFTB 3DSQA 1JFFB 3ZMVA 2ITDC 3ARRA 3AROA 2HKOA 4PD4F 4J7KA 4GYCB 2OWOA 1T5EA 4LF5B 4AI8A 3L9DA 4DV0O 4UV9A 5LHIA 3W7SA 2A9HA 2Q6AA 1XMOO 4JAVA 4GCZA 2WLYA 3JAWB 2KO7A 2ZE8A 4WCEV 1SRYA 4OPHA 3IKDA 4DO2A 1XL4A 2BOBC 3F7VC 1VEWA 4TOIA 5DECA 1H2NA 3HB3B 3D3IA 2PPOA 2LW1A 1YF2A 3ALFA 4XDJA 1MSDA 1HNZO 3RFRA 1RM1B 1KBHA 2OCHA 2NNUA 3ZRXA 5HFLA 2CH7A 1FJDA 3DXRB 1JA8A 3EHBB 1MMMA 5LOVB 1RD6A 1RSOA 2Q4PA 1NWSA 4U7NA 3T4ZA 2UXBO 2CTWA 3CCSV 2MPHA 3O5LA 4MSPA 2Q8VA 1NU1H 4MVMA 5IYDO 3D8CA 5FPOA 4FJCC 1XHZA 1BQZA 3AG1C 4ODRA 2KE0A 1SQPH 4XDKA 2EJ7A 1JCHB 4S3KA 4YJ2A 1HKKA 2LO1A 1TGOA 2HVKC 2LJ4A 5I98A 1QCEA 3E35A 3OTFA 4J7JA 1VQKV 4U3JA 3TC5A 1EFRG 2ITKA 1KYOF 1I08A 3BY6A 4NXNB 3ZRWA 1VQ9V 1GPFA 3U0ZA 1M56B 3HKBB 1K5QA 4WKHA 2AW9A 4JPRA 1ZLZA 1AJPA 3AG4C 3AK2A 2F4EA 4CBCA 4JTCB 5B1BC 3T1YO 2AZ2A 4B3TB 4R0XA 4PA9A 3KZ7A 3CC7V 4DW1A 1CXZB 1XEQA 2IJHA 1E1QG 4O4JA 4DR2B 2EX3A 3KAHA 1F4NA 4DZ2A 2D3OW 4FLXA 1OV9A 1TAEA 4PDLA 2YBTA 4LF8B 3F7YC 2EIJB 1ZTEA 4ITZA 1YI2V 4QT2A 4U3FH 2DT3A 3OTOB 5IYBO 2QDOA 4YXWG 2ZIOA 3AG4B 4DR4B 3QO8A 4I55B 3ZRSA 3ABMB 4J42A 2DQ3A 4BAYA 4JI1O 4PHZA 1R6TA 2RN9A 5K1PA 1ZBVA 2GUZA 4JI5B 2FYUH 3P3PA 3T2MA 3UM7A 2PYLA 1NTZH 1VQ6V 4Z2JA 5ITZB 1AROP 1FJGB 1NKDA 1OCZB 1QPLA 3FB8C 1DF5A 1GKFA 4KHPB 5KA5A 5IYZB 5J9PC 1JPXA 1BL8A 1JVMA 5CA1B 2QKCA 1O9GA 4HBEA 4A5UB 4YY3B 1Y74B 4BWAA 1HNWO 3FAVA 3SDLA 3ZHRA 4IT6A 5JJNB 1ROUA 3K58A 4ABMA 1I7FA 1VQ5V 5LXTA 4I50B 2UXCO 2DW4A 4ODKA 4FK5C 1UR9A 4DUYO 3FYEB 4X1IB 3EY6A 4JYAB 1XRVA 4NYKA 2QE7G 3LNNA 4NSBA 2UXDB 4DV3B 5LMNO 4YHHO 1BQ0A 4O4LA 3PRAA 1ZL8B 1QBZA 2EILC 4FM0A 2W0FC 2QJ1A 4DROA 4ODOA 4GKJB 1WPBA 4ZBMA 1XQ8A 1I94B 2PV3A 2DMXA 2FKEA 3JYJA 5L3BA 2XP9A 1P84F 3CHXA 4DRNA 1EIBA 3CPWU 2UUCB 3E86A 1EN4A 1NI8A 2EJRA 4JYYA 5CB4B 4DZ3A 2OIGA 5L3EA 4JTDB 3RYIB 1EN6A 2VS0A 1VQOV 2Y69B 2QWRB 3ABKC 3UT5A 1QPFA 4DXWA 1BCCH 3WB2A 3D3QA 2QM8A 2WLIB 1L1PA 2IJIA 5K1XA 1XNQB 4X1KB 1XBLA 3JARA 4IQCA 4LFCO 1BZKA 3C3TA 2V1DA 2NR5A 3I56V 1JNDA 3UI6A 3K5MA 1FXKB 3IC9A 1ZBKA 1YJNV 3FY1A 1XI1A 2ZIMA 5B1AC 5BMVB 3SYQA 3RGBA 2LGWA 4G28B 1M57B 4YJ2B 1YITV 1D5AA 3IK8A 4JYSA 3JAMN 4BIUA 5L3GA 4G2KA 4JFMA 3O5PA 4LC1A 1B3QA 1KD1W 4O2BA 2DJVA 1J5EB 3CD6V 3SJAC 3MAQA 2JK5C 1L0LH 2NLJC 3JATA 3A0RA 3H9RB 5GONB 2EZPA 3CJHB 2HEPA 3WB1A 1N34B 4Z2IA 1TVKB 1SA0B 5D5QA 1KECA 3ARSA 3O5IA 5JJJB 4DV6B 1NH2B 2JGDA 2PY5A 4UCVA 1NS1A 1NH6A 1ZU8A 5JH7B 4DH0A 2ZD9A 4U85A 3OFNG 1XREA 2ZXWC 1XUQA 1VP7A 1GN3A 2W0XA 2FKXA 1YDXA 3NRKA 4R50A 1FFRA 3ZRVA 2EIMB 2A79B 3HKEA 1VQ8V 1NTMH 3FKSG 5B66Z 3I5DA 3TCUA 4X88A 1YTFB 4LF6O 1X4TA 4ZS6A 5IY5C 1ROPA 4B7KA 1MNGA 4X9QA 1RFYA 3TCZA 3LSSA 1V54C 1F8AB 2ADQB 4JI8B 3G4SV 2Y78A 1KQSU 1IZ3A 1PV0A 4NR1A 5KHIA 3H1IH 4UUJC 2RNBA 4DUZO 1SQBH 3G6MA 5EYPA 4FN2A 4MTOA 1ZL1A 4JTAB 3UF8A 1N32B 1JQ0A 5DITA 1SR0A 2X6BA 4HARA 1HXVA 5KMGB 4JI2O 4MVOA 4NVPA 4MAVA 3BMBA 2WLKA 1NSGA 1YJ9V 1Y76A 3L71H 5IY5B 1P4RA 3B8MA 1Q7YW 4WFGA 2QM7A 2ZE6A 4BIOA 4C02B 4UVCA 1IVSA 1DGSA 1KT1A 3F5TA 1TA8A 4H13B 4TX0A 3BVOA 5JCOA 1GTOA 4HBNA 4TSFG 3NTPA 1E9LA 2XAGA 1QR9A 1G8MA 1JNEA 2ZM6B 2Q7HA 4RO2A 5FNVB 2LGOA 1AR5A 1B6CA 1K5SA 3RGCA 3W7TA 1AI5A 3OUFA 1E6PA 1HDJA 3TETA 3OAAG 1GN6A 4UCOA 3CCJV 3MDYB 2EZOA 2HHHB 1HR0B 3GTYX 2XP7A 1Q6UA 1OCOB 4QE7A 4UVBA 2DG9A 2XP5A 5B1OA 5KLVH 4ODQA 4ODLA 3ZCCA 2M08A 4J9YB 1G4YB 1H2MA 1K92A 5LHHA 3E22A 5B8IC 2ZR4A 2B1GA 1VQLV 4PDRA 1NMVA 1GN2A 3FXYA 4Z2GA 3K9SA 2RQSA 1QU7A 3CP1A 1WA8A 2A3BA 5DN6G 3ARVA 5A2QN 2GTAA 1VF7A 1GM7A 1J95A 4MTFA 2ODMA 2YEVA 2Q73A 1S0VA 3TK1A 1PP9H 1KKCA 4KFMA 3WD3A 4QE9A 2X6AA 3CCUV 1VF6A 3E89A 5B5EZ 4O2BB 2W6JG 2IF4A 2VWJA 1S72V 3B8NA 4FZ1A 4LF9O 3JATB 3U11A 4RUFA 1L0NH 2KI3A 4DRKA 3A8TA 4DV2B 3L73H 4JFJA 3Q4HA 4WFBV 2WPDG 2YICA 2G38A 2PV2A 2A3AA 4MNKA 2IW5A 3BEHA 4L8JA 1ZB5A 3NI6A 1E6ZA 2YS8A 3OUSA 2XAJA 4AQYO 3AS3A 5DIUA 3D36A 1U97A 2N05A 1H38A 4MS2A 3RMEA 1S76D 1YXBA 3UKMA 2E75B 1NVPB 3APOA 4W5UA 3F5WC 3JD4A 4CS3A 4PA6A 1KKDA 1EDQA 4TV8B 1HNXB 4B3SB 4JFKA 1PBKA 4X65B 4BF8A 2CGOA 3RM4A 2XP3A 4YJ3A 3ML0A 3CSXA 2WWWA 2AHYA 4H44B 1AR4A 3QO7A 4UV8A 1N1AA 4NNRA 4E2LA 5JCOC 2O92A 3QVNA 4JI7O 3STZC 4TW8A 5FL7G 1FKDA 1W26A 2UUAB 1HKMA 3K08A 1GUVA 3O5RA 3LUTB 3ZMUA 1PM9A 5L3DA 3G6EV 3B7XA 5LGTA 2KG7A 4EFBA 4GLXA 1J4HA 2F1MA 5CA0A 4NTYA 2KSDA 2PTMA 3H1LH 4LF5O 3PR9A 2BTQB 2CDYA 1W9UA 4JYBA 1A32A 3VQVA 3STLC 4I0XB 3B2EE 3WD0A 2XNDG 1YJWV 4F6RA 4X62B 3G6LA 2CGNA 1SKVA 2PI6A 2KQXA 3PJSK 3WKZA 4IQ2A 1K34A 2WLZA 4DR3B 2P4KA 3UO3A 1FFXA 2CUGA 3QNEA 5DIVA 1JJOA 2DG4A 4D7TA 2VQEB 4OXSA 4FLTA 2HJDA 3W7UA 4PV1B 1M1KW 4ODMA 2PV1A 1R3LC 3RYCB 1MG1A 1M5IA 2JS3A 1FKBA 3JD0A 2UU9B 3N2KB 3WQVA 2F23A 3SJQC 1PPJH 1VF6C 1GMGA 1JVWA 3KAFA 3VQYA 3SPHA 4HZ3A 2YIBA 5CN0A 2PZSA 4IIJB 2WLLA 1W0KG 4EB6B 1OCCB 4WFAV 2AGAA 4LF7B 1V9PA 1Q6HA 4RQEA 4RWUA 1N36B 1BHAA 4ZPWR 4OX9B 4NXNO 3OR7C 4BIZA 3ODKA 1F4MA 2XOKG 4O4IB 5J2UA 3BRCA 3ARZA 1TCOC 1H2LA 1E79G 3ETDA 2XAQA 1AP6A 3WL0A 3D36C 4QGPA 1SC5B 4B3TO 4PA7A 3WU2Z 4DWSA 3H1JH 2ZQSA 3L75H 3N2GA 4MSWC 3E8FA 4DR2O 4CH5A 4I7ZB 3SR2C 4WIWA 1N4CA 2OCCC 1ROTA 3WG7B 5KHJA 2OIEA 5CA3A 2F95B 1QLEC 4FLVA 4J9ZB 4J7ZA 4LF8O 1XMQB 3RM8A 3EVKA 4IPXA 5C8YA 4G27B 3KACA 4RAIA 2GTSA 5H2FZ 3X2QB 4JI5O 1VF8A 2JS5A 2LKNA 1FJGO 4N23A 3JYMA 4W9PA 4YJ3B 1VIBA 4KHPO 1E1RG 2W6IG 4NB5A 4AY1A 1FKSA 3K5NA 4DR7B 4TUYB 1FKHA 4DRXB 2R9AA 4I9WA 4GUNA 4XAKA 5H9CA 1BS3A 1GRJA 2P06A 4PELA 5LGUA 5EIBD 1NWRA 3B09A 1H2SB 3ZX6A 1HJWA 1WNOA 4TV9B 2A0LA 2DSZA 4QPKA 5JVDB 1IXBA 3G6BA 4JYAO 3MDSA 1M5YA 2YI9A 1GO3F 2UXDO 4DV3O 1BGYH 4JV5O 1OHHG 1U79A 4QZVB 1FD9A 4F6RB 3RVZA 4GKJO 3OT7A 1I94O 4B3MB 2B5UB 3O5QA 4NTWA 3B40A 4ZHQB 1VQMV 3G71V 2RCVA 2DSUA 2E5LO 2DYRC 1KB9F 3LSUA 2GBOA 3K04A 3RYHB 4J4OA 2ZR2A 3AG1B 4JZGA 4P8WA 3JAKA 4IT5A 2LFRA 1K4CC 2WK2A 3SJBC 1XNQO 3C3SA 1GK9A 1LL7A 4GX1A 1XHXA 2JEXA 2YDEA 1YCIA 5JH8A 2BCCH 3RYFA 1M4UA 1NR7A 2DYRB 4DR1B 2M1IA 5EC2C 2JVDA 4DWSC 4DV1B 5B1BB 2FB5A 3FYIB 2M7WA 1QQCA 3T1CA 4X66B 1LL4A 3J81N 3O9OA 1W9PA 3UO2A 1E6NA 1F23A 1FKKA 2N87A 2O9OA 1TUBA 1J5EO 3GWOA 3CCEV 1S5JA 4FFBA 1WB8A 4DR6B 3ZEDA 5LHGA 5GW7A 2Q5ZA 4DV0B 2WA4A 4ODNA 1N34O 2ZNJA 1NT2B 4MT8A 4DV5B 5EBWC 3CE2A 3C90A 4GKKO 5LBQA 4DWSB 1S3JA 4F4LA 2KKWA 4DV6O 2BOCC 5LP6A 4X20B 4HNAB 2WLJA 4X64B 2PPPA 3CC2V 2HFEC 1FKLA 4DV4B 3ARTA 4ML4A 2QWPB 1KU9A 2YBUA 3SYPA 3AQUA 1Z5VA 1VQ4V 1SESA 2P4VA 4LH7A 1NQTA 4WFEA 1G1XB 2WSSG 4GT1A 4GX0A 1FPOA 4UB8Z 4WFHA 2A7WA 1GOIA 1P7BA 5JQGA 2M2AA 3E8BA 2FL4A 1HKJA 2EIKC 2LP7A 2PYJA 2R72A 4JI8O 1JNTA 4K0KB 1D7HA 2RURA 5IJ9A 3E8GA 4DR5O 5CBHA 2V7QG 1SQVH 3SPIA 4L3NA 3SPCA 3BA8A 1ZUQA 5IDJA 1KUQA 1ZAUA 5LYJA 1Z5WA 4DYLA 1N0NA 1WP7A 1LNQA 1AI7A 4HBOA 2CH7B 2Y4UA 2WM0A 3ETQA 1AJNA 1Q1CA 1G6UA 2EILB 2OTLV 5DEZA 1RSOB 3WD1A 2FDMA 1Q81W 3UQIA 3LDEA 1ZBCA 3J80N 4JAAA 3A0HZ 3ASNC 4N21A 2QF8A 1MSWD 4D7SA 1FYJA 2ZM6O 2IU3A 3K0GA 5L3CA 4J11A 3W4RA 3ABKB 1EYMA 1UJWB 4U3JB 1FKAO 3RW0A 4K8ZA 2ETNA 2IBZH 1K97A 3ZRWB 4X1YA 4FM2A 1WNSA 1HR0O
chains in the Genus database with same CATH topology
3ARVA 4DRHA 3PRBA 2DT0A 4MGVA 3CZ8A 1NMWA 3B8SA 3KAGA 1FAPA 3O5JA 3WD3A 1FKJA 2A3EA 2MNTA 3ARQA 1ZBWA 4O2TA 2IF4A 3KABA 4FAPA 2KI3A 2XP8A 1W1YA 4DRKA 1LG1A 4G2PA 1A7XA 1C9HA 4JFJA 5HW7A 5HT1A 1P5QA 2PV2A 2A3AA 3TDBA 4MNKA 4LAYA 1ZB5A 4URIA 3NI6A 1E6ZA 4PTMA 2A3CA 3CGMA 2PPNA 1BKFA 3WQWA 4P8UA 3AS3A 5DIUA 1FKTA 3PA7A 1H0GA 1J4IA 2VN1A 4W9OA 4WKFA 1W1VA 3RMEA 4Z2HA 4U86A 3CHEA 4W5UA 3GPKA 1EDQA 2RUCA 1CTNA 4JFKA 2PBCA 5GQBA 1PBKA 4LAVA 4BF8A 3ARRA 3RM4A 3AROA 2XP3A 1W1PA 3KCEA 4MNLA 2VCDA 1N1AA 4NNRA 2WLYA 4KQZA 3ARUA 2O92A 2KO7A 1HJVA 1JNSA 1W9VA 5GPRA 3ARYA 3IKDA 4TW8A 1FKDA 1W26A 2G8ZA 3O5DA 1HKMA 3WH0A 1QZ2A 1GUVA 3O5RA 2ZQVA 3JXVA 3UI5A 3RM9A 3B7XA 2PPOA 1J4HA 3ALFA 1PINA 3PR9A 4LAWA 4LGXA 1W9UA 1FJDA 1ZCNA 1SYTA 4LAXA 1RD6A 3IHZA 1NWSA 4ODPA 1OGGA 3O5LA 2MPHA 4MSPA 3WD0A 2DT1A 3G6LA 2PI6A 3WKZA 4IQ2A 2AOSA 2WLZA 4ODRA 2KE0A 5HW6A 2DSWA 4S3KA 3WD2A 1HKKA 4J4NA 1NWUA 2RUQA 2DSVA 2LJ4A 5DIVA 5I98A 2DT2A 2DG4A 3TC5A 3WIJA 2ITKA 4ODMA 2OLHA 2PV1A 1D2KA 4U84A 3CHDA 1GPFA 4WK9A 2ZR5A 3O5FA 1FKBA 4S3JA 4WKHA 3WQVA 2F4EA 2AWGA 4DRIA 1JVWA 4R0XA 3KAFA 3KZ7A 2DPEA 4KR0B 5BXJA 4Q22A 3AS0A 3RFWA 1E15A 4ZPVR 1EHNA 2IUZA 3KAHA 1IX5A 1KFWA 4DZ2A 1Q6HA 4MPKA 1O6IA 4ZPWR 2YBTA 4L72B 4ITZA 3ODKA 4QT2A 2DT3A 3IKGA 3ARZA 1TCOC 3ALGA 1X6LA 3WL0A 1ZBVA 2L2SA 4Z2JA 4DWSA 2ZQSA 1D6OA 4WJXA 1QPLA 1EQ3A 4WIWA 1ROTA 2LPVA 1X6NA 3BXWA 5D75A 4HBEA 1XHGA 2MLXA 3RM8A 2KR7A 2KFWA 3ARXA 4W9QA 4IT6A 3QOKA 1ROUA 4IPXA 3KACA 1J6YA 1H0IA 1LJYA 2RUDA 1D7IA 2F2DA 1VF8A 3KAIA 4DRPA 1W1TA 2LKNA 3JYMA 4ODKA 1UR9A 1HKIA 4W9PA 3ARPA 3EY6A 1D7JA 1XRVA 1YATA 4NSBA 4AY1A 1FKSA 4WKAA 3PRAA 1FKHA 2G41A 4N19A 4XAKA 5J6EA 4DROA 1FFQA 4ODOA 2PV3A 3CGNA 5HKGA 4GIVA 5HBFA 3JYJA 1ITXA 2FKEA 2XP9A 1NWRA 3B09A 1UR8A 4GGQA 1HJWA 4DRNA 1EIBA 1WNOA 4DRJA 2DSZA 4DZ3A 5GPGA 1QPFA 1M5YA 1OWQA 1E6RA 1L1PA 4R5EA 3CHCA 1T11A 5HWBA 4IQCA 1U79A 4QIBA 3WL1A 4QZVB 1FD9A 1JNDA 3UI6A 3PRDA 3KADA 3O5QA 1ZBKA 1BL4A 1KT0A 3FY1A 2DSUA 3B9EA 3VAWA 4J4OA 3O5MA 2D9FA 3O5EA 4P8WA 3IK8A 2ZR6A 4JYSA 3CH9A 2ZQTA 4DT4A 2ESCA 4JFMA 2WK2A 3O5PA 1FKFA 1WB0A 1LL7A 1LG2A 3H9RB 1YW5A 1J4RA 4Z2IA 2F21A 5JH8A 4JFLA 4Q7NA 3ARSA 3ARWA 2M1IA 3UI4A 4DWSC 3O5IA 4DIPA 4G50A 1NH6A 1ZU8A 4DH0A 1LL4A 1W9PA 4Z2LA 1FKIA 4U85A 1E6NA 1FKKA 2B31A 2N87A 2O9OA 2KGJA 2XPAA 3NRKA 1FFRA 4ZPTR 3I6CA 1R9HA 4ODNA 4MNJA 4ZS6A 3FAPA 3TCZA 4DWSD 1F8AB 2MLYA 4DWSB 5HUAA 3B9AA 2Y78A 1K9TA 4IT4A 1WAWA 2MF9A 4MNMA 2JZVA 2Q5AA 1Q6IA 2PPPA 4FN2A 3G6MA 1ZL1A 3UF8A 1FKLA 5DITA 3ARTA 4DRMA 1SR0A 2XPBA 4HARA 1HXVA 4ML4A 2UZ5A 3OA5A 4MAVA 2MLZA 2YBUA 3AQUA 1F40A 4TYOA 1NSGA 5HTGA 2XP6A 1HJXA 4P8XA 1GOIA 2M2AA 2XP4A 1HKJA 4C02B 3O5OA 1FKGA 2RURA 1OGBA 1JNTA 3UQAA 1D7HA 1KT1A 3B9DA 4MTVA 3AS1A 3CHFA 3AS2A 4TX0A 2ZQUA 1LQ0A 4NZCA 5HWCA 3LUOA 3NTPA 4L3NA 5DF0A 1E9LA 3O5GA 1JNEA 3UQBA 2OFNA 4P8VA 2LGOA 1FKRA 1B6CA 3RGCA 4HBOA 5HW8A 2WM0A 1E6PA 4TNSA 1Q1CA 3MDYB 1Y0OA 5DEZA 3WD1A 2FDMA 1NWTA 2XP7A 1Q6UA 3UQIA 2DG9A 2XP5A 1ZBCA 2FAPA 2K8IA 4ODQA 2DG3A 4ODLA 4TW7A 4DRQA 2QF8A 3O5KA 2M08A 5DO2A 2RSEA 1ZK6A 4TW6A 3W4RA 1LL6A 5B8IC 2ZR4A 1EYMA 3WD4A 4JFIA 1NMVA 3FXYA 4Z2KA 4Z2GA 2RQSA 3OOBA 2A3BA 1TFVA 4QT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9P A;  1R9H A;  4DRH A;  3EY6 A;  3PRB A;  4MGV A;  1D7J A;  4ODN A;  1NMW A;  4IQ2 A;  3KAG A;  1YAT A;  1FAP A;  3O5J A;  3FAP A;  4ODR A;  1FKS A;  2KE0 A;  3TCZ A;  5HW6 A;  1F8A B;  1FKJ A;  2MLY A;  4J4N A;  5HUA A;  2RUQ A;  5I98 A;  2LJ4 A;  1FKH A;  5DIV A;  2Y78 A;  2MNT A;  2DG4 A;  4O2T A;  2IF4 A;  4N19 A;  3KAB A;  4FAP A;  5J6E A;  2MF9 A;  4ODO A;  3TC5 A;  4DRO A;  2PV3 A;  2JZV A;  2KI3 A;  2Q5A A;  2ITK A;  2XP8 A;  1Q6I A;  3CGN A;  2PPP A;  4ODM A;  4FN2 A;  4GIV A;  4DRK A;  5HKG A;  2PV1 A;  4G2P A;  2FKE A;  1FKL A;  1A7X A;  1C9H A;  3JYJ A;  2XP9 A;  4JFJ A;  4U84 A;  2ZR5 A;  5DIT A;  3B09 A;  2XPB A;  4GGQ A;  5HT1 A;  3O5F A;  5HW7 A;  1HXV A;  1FKB A;  2UZ5 A;  1P5Q A;  2PV2 A;  3TDB A;  4DRN A;  4DRJ A;  2MLZ A;  2F4E A;  4LAY A;  3NI6 A;  2AWG A;  4DRI A;  1F40 A;  4TYO A;  1NSG A;  4DZ3 A;  5HTG A;  1JVW A;  3CGM A;  3KAF A;  2PPN A;  1BKF A;  2XP6 A;  3KZ7 A;  4R0X A;  5GPG A;  1QPF A;  1M5Y A;  5DIU A;  2M2A A;  5BXJ A;  1FKT A;  1L1P A;  2XP4 A;  4C02 B;  3UQA A;  3O5O A;  1FKG A;  2RUR A;  3PA7 A;  1JNT A;  1T11 A;  1J4I A;  1D7H A;  2VN1 A;  3KAH A;  4IQC A;  4W9O A;  1KT1 A;  3RFW A;  5HWB A;  4U86 A;  1U79 A;  4QIB A;  4DZ2 A;  4TX0 A;  1FD9 A;  1Q6H A;  3UI6 A;  2ZQU A;  3PRD A;  3GPK A;  3KAD A;  5HWC A;  3O5Q A;  1BL4 A;  3LUO A;  2RUC A;  3NTP A;  1KT0 A;  4ITZ A;  3ODK A;  4JFK A;  4QT2 A;  2PBC A;  1PBK A;  3O5G A;  3IKG A;  4LAV A;  4BF8 A;  3UQB A;  2XP3 A;  1TCO C;  3VAW A;  2OFN A;  4J4O A;  3O5M A;  2D9F A;  3O5E A;  3IK8 A;  2ZR6 A;  2LGO A;  4JYS A;  1FKR A;  1B6C A;  3RGC A;  3KCE A;  2VCD A;  2ZQT A;  2L2S A;  4DT4 A;  5HW8 A;  1N1A A;  4JFM A;  3O5P A;  4NNR A;  4TNS A;  1FKF A;  2ZQS A;  1Q1C A;  3MDY B;  1Y0O A;  2KO7 A;  1JNS A;  1D6O A;  2XP7 A;  1QPL A;  3H9R B;  3IKD A;  1Q6U A;  1YW5 A;  1FKD A;  1W26 A;  4TW8 A;  1EQ3 A;  3O5D A;  3UQI A;  1J4R A;  3WH0 A;  2DG9 A;  1ROT A;  2XP5 A;  2FAP A;  1QZ2 A;  2LPV A;  2F21 A;  3O5R A;  2K8I A;  5D75 A;  4JFL A;  4ODQ A;  2DG3 A;  2ZQV A;  3JXV A;  4ODL A;  4TW7 A;  4DRQ A;  3UI5 A;  2M1I A;  2M08 A;  2PPO A;  2MLX A;  3B7X A;  3O5K A;  3UI4 A;  1J4H A;  2KFW A;  2KR7 A;  1PIN A;  2RSE A;  3O5I A;  4DIP A;  4W9Q A;  1ZK6 A;  4DRM A;  1ROU A;  4IPX A;  4G50 A;  4TW6 A;  4LAW A;  3KAC A;  4DH0 A;  1J6Y A;  5B8I C;  2ZR4 A;  1FJD A;  1EYM A;  1FKI A;  2RUD A;  4U85 A;  1D7I A;  1ZCN A;  4LAX A;  2F2D A;  3KAI A;  1FKK A;  3IHZ A;  3UF8 A;  4JFI A;  4DRP A;  1NMV A;  2LKN A;  2N87 A;  4ODP A;  3O5L A;  2KGJ A;  2MPH A;  2RQS A;  2XPA A;  3NRK A;  3OOB A;  4MSP A;  3JYM A;  4ODK A;  4QT3 A;  3I6C A; 
#chains in the Genus database with same CATH topology
 5J2T A;  3HKD A;  4DRH A;  3PRB A;  4MGV A;  2A06 H;  4B7E A;  2YSU B;  3DTU B;  5B1A B;  2EIN C;  3O5J A;  3JAS A;  3BFR A;  2A3E A;  3RVY A;  3N27 A;  5JWP A;  1AR1 B;  4O4J B;  3ARQ A;  4RQF A;  3KAB A;  4FAP A;  4UCT A;  2GV9 A;  3E8H A;  4TQD A;  2CTP A;  2HG5 C;  3EFF K;  2F4V O;  3E83 A;  5KX5 A;  1K4D C;  3CCM V;  1C9H A;  2YID A;  3TXS A;  1P5Q A;  1HNW B;  3TDB A;  2Q67 A;  1KMI Z;  1YSC A;  5KHG A;  4JI0 B;  4PTM A;  3K57 A;  3MHH C;  2A3C A;  2PPN A;  2K9P A;  5LP6 C;  2GUZ B;  3T1H O;  2UXC B;  3ABU A;  2X6C A;  4ASU G;  1XNR O;  4X89 A;  2ZIN A;  1H0G A;  3T4D A;  4WKF A;  4FLU A;  2QEX V;  4U86 A;  4YIP A;  3EIP A;  3AEI A;  3CHE A;  2ZXW B;  3GPK A;  4AIL C;  1MZE A;  2C2A A;  2RUC A;  1CTN A;  3RT3 C;  1KP3 A;  3R65 A;  4DV2 O;  2PBC A;  1WN7 A;  4C7U A;  5LMN B;  1K7D A;  5IYC O;  1V55 C;  3FAV B;  1JR9 A;  4PJ0 Z;  4MNL A;  2VCD A;  1V54 B;  2LQT A;  5LXT B;  1PL0 A;  3ARU A;  1K8A W;  1JNS A;  3G67 A;  5KA6 A;  1W9V A;  5B3S C;  3B77 A;  3OMN B;  2G8Z A;  4LBE C;  3O5D A;  4CH3 A;  3FD9 A;  1QZ2 A;  5LA6 A;  5CBF A;  3HKC A;  4FMT A;  2ZQV A;  1HNX O;  1ZSP A;  3RM9 A;  4X65 O;  4ZIB A;  3OD4 A;  1NBM G;  4O4L B;  5JQG B;  1UPG A;  2CAZ C;  2UUB B;  4LAW A;  1DTO A;  4LCU C;  1SYT A;  1R6N A;  4ODP A;  1OGG A;  4LNU A;  2OYQ A;  3OE7 G;  2DT1 A;  2QTS A;  1GM9 A;  3I55 V;  2JRI A;  2UUA O;  1B04 A;  3ASO C;  4FLY A;  3CRR A;  1Q43 A;  5B1N A;  3IFX A;  2Y48 A;  2H3O A;  5F2V O;  4PDV A;  3KZI Z;  3UT5 B;  4Z1M G;  5JJE B;  4J4N A;  2NN4 A;  1NWU A;  4H0L B;  2DSV A;  3KCX A;  1AP5 A;  1W0J G;  3JAR B;  3K5O A;  1IBL B;  4RUE A;  4CH4 A;  1P49 A;  3WIJ A;  4ICG A;  2OLH A;  3OMA B;  3GU0 A;  1D2K A;  2ZR5 A;  2R70 A;  3O5F A;  1JMK C;  4JI3 O;  4X62 O;  4Z2W A;  1I0H A;  4DV7 O;  4DRI A;  5LMU B;  5AG2 A;  5BXZ A;  2ZDI A;  2IU0 A;  2DPE A;  2HJF C;  5KAF Z;  2DWD C;  1K73 W;  3GWK C;  4LWS A;  3RFW A;  4Q20 A;  1YIJ V;  2VQE O;  2VRZ A;  3ZHT A;  2XUM A;  5J2T B;  2R9I A;  2ZR3 A;  5H5N A;  1IBM B;  5IWA B;  3IKG A;  4ZI7 A;  2RJZ A;  2YIA A;  3JAS B;  2UU9 O;  1GH6 A;  2JGD B;  1N33 O;  5BR8 B;  1AVM A;  2L2S A;  4O4H A;  2R9R B;  4JI4 B;  3ZMZ A;  1OCR C;  1D6O A;  4FZ0 A;  1CEZ A;  2QM4 A;  4MVU A;  2ZT9 B;  4LF7 O;  4NKG B;  3HKE B;  4DW0 A;  1Q90 D;  1JFF A;  5C93 A;  2F93 B;  1N36 O;  1R73 A;  3JAL A;  4HAM A;  3BXW A;  2YXL A;  2VQF O;  4OX9 O;  1VQN V;  1GAX A;  2KR7 A;  3ARX A;  3ZS8 C;  4W9Q A;  1IBK B;  3QOK A;  3J7A U;  4LFA B;  4J41 A;  4MW8 A;  1D7I A;  3KAI A;  2PN0 A;  3CRA A;  4DRP A;  5LL6 Y;  5EYP B;  4YIO A;  4FM1 A;  5IJ0 A;  2RDC A;  1EZV H;  5TIS Z;  2AHZ A;  3ARP A;  2PUS A;  4NXM O;  1D7J A;  1Y76 B;  4WKA A;  2GDS A;  4MW3 A;  2IJK A;  5KUM A;  4I9Q A;  5DM6 V;  4U7O A;  3GVM A;  4N19 A;  4UXN A;  1Z2G A;  5J6E A;  4O2A A;  5LOV A;  5HKG A;  4F6E A;  2QSA A;  5HBF A;  2QA4 V;  1ITX A;  1SZT A;  1M93 A;  3ZHQ A;  4MTG A;  4DRJ A;  1H8H G;  1H2G A;  3JD1 A;  1IDS A;  5GPG A;  1JCH A;  1OWQ A;  2AZ0 A;  1E6R A;  4JI6 B;  4PI2 A;  4DK0 A;  4R7C A;  4DR7 O;  5HFM A;  1T11 A;  3ZHU A;  4QIB A;  4K35 A;  3WL1 A;  2DYS C;  3IAY A;  1F7Y A;  3MD0 A;  3PRD A;  2EBO A;  3JD3 A;  3AG3 C;  1BL4 A;  3AG2 C;  1KT0 A;  4E4E A;  4GZR B;  1H2K A;  3BCC H;  3W7X A;  4QNH B;  2ZDI C;  4XDL A;  3LNM B;  2A3Q A;  1SS3 A;  3ABL C;  2E74 B;  5E1A C;  4CC5 A;  3E22 B;  1FKF A;  4B3R B;  3HPL C;  2YXY A;  1WB0 A;  4GX5 A;  1P7G A;  2GSM B;  2L6L A;  1WA8 B;  2RQ6 A;  3AG7 A;  1YW5 A;  1AJQ A;  1TUE B;  2F66 C;  2HVJ C;  1E44 A;  3CWB H;  2YEV B;  4Q7N A;  3SYA A;  1NH2 D;  4I55 A;  1SF9 A;  1EM1 A;  1YEW A;  4CS2 A;  2ZCE A;  1FKI A;  1D2D A;  3JCU Z;  1QVF U;  5ITZ A;  1XDC A;  2B31 A;  3OM3 B;  2KGJ A;  1LUW A;  1SQX H;  2JGU A;  4QJF B;  3Q4H B;  3M8A A;  4WF9 V;  3SYO A;  2LJ2 A;  5IYZ A;  1YTF D;  2F43 G;  2DWE C;  2JJ2 G;  2LGQ A;  5CA1 A;  1NR1 A;  1ZWI C;  1Q5O A;  3JCZ A;  1Y74 A;  3OTO O;  1VQP V;  4O4H B;  1N0J A;  2MLY A;  3DGE A;  5HUA A;  3R66 A;  4DR4 O;  4I50 A;  4X66 O;  2JZV A;  2Q5A A;  4KP4 A;  3BAA A;  2OTJ V;  4MTX A;  3JAL B;  3B4S A;  2ZE5 A;  2UZ5 A;  3OA5 A;  2OCC B;  4X1I A;  4DR6 O;  1AB3 A;  2H94 A;  3FB6 C;  3PN1 A;  2AXT Z;  1QLE B;  1F40 A;  1RM1 C;  5HTG A;  1MOF A;  4BR6 A;  1K9M W;  2XP6 A;  3CME V;  1HJX A;  3LSQ A;  3CXH F;  2H8P C;  4DV5 O;  4YY3 O;  4UVA A;  1I5Y A;  2YC0 A;  1N8R W;  1ZL8 A;  2Q0O C;  2XP4 A;  3UQA A;  1H8E G;  1BT8 A;  1OZ0 A;  1FKG A;  1OGB A;  4P2Z A;  3ETE A;  2E76 B;  4MTV A;  3AS1 A;  5KAI Z;  3ZN1 A;  5IJ0 B;  4BW5 A;  3RBZ A;  1LQ0 A;  4NZC A;  3SGI A;  1IXM A;  5HWC A;  4X64 O;  4EFE A;  3S3W A;  1UFI A;  4DV4 O;  3O5G A;  5KHK A;  2XAF A;  1EBO A;  3UQB A;  2YUA A;  1FAF A;  1US6 A;  2KG7 B;  5CB4 A;  5DED A;  5CA0 B;  2IM9 A;  2XHB A;  2DOS A;  1FKR A;  3RYI A;  3IJ4 A;  4OGQ B;  2DE0 X;  5HW8 A;  1IUR A;  2QWO B;  4TNS A;  4O2A B;  2WLI A;  1Y0O A;  4X1K A;  3E2E A;  4K0K O;  1NWT A;  1M56 C;  1URF A;  3TGU H;  1VQ7 V;  1FXK A;  1DF4 A;  2FAP A;  2K8I A;  2DG3 A;  3M7M X;  5BMV A;  1SET A;  4TW7 A;  4DRQ A;  3O5K A;  5DO2 A;  1JX9 A;  2UUC O;  2P6J A;  1O9H A;  1FFX B;  4TW6 A;  4ZOL A;  1LL6 A;  1COW G;  3WD4 A;  4JFI A;  4K8X A;  4UDM A;  2CE4 A;  1Y67 A;  3CRQ A;  2Z0A A;  2EIJ C;  5GON A;  4LFB B;  4QT3 A;  3CJH A;  4CZZ A;  1TVK A;  1SA0 A;  2DT0 A;  5CMU A;  3ABM C;  3B8S A;  3KAG A;  2GHY A;  2QWQ B;  4LF4 B;  1FAP A;  5BZB A;  1NZ6 A;  4PI0 A;  3CYO A;  3ZMT A;  4WFF A;  3VQW A;  2MNT A;  4P9O A;  4O2T A;  2WLL B;  5JH7 A;  2WLH A;  1HW7 A;  3GB7 C;  3K9A A;  1OCZ C;  2N74 A;  1BSM A;  3QTC A;  2PI5 A;  2L35 A;  1LG1 A;  4G2P A;  3DC6 A;  4R6Z A;  1A7X A;  3KG2 A;  4HYO A;  5HT1 A;  4UCU A;  5BY1 A;  3APQ A;  3K79 A;  5J2U B;  5IT9 N;  2Q68 A;  4LAY A;  4URI A;  3CS5 A;  2V4D A;  1XMO B;  3CGM A;  2XTA A;  4IHJ A;  5EBM C;  4P8U A;  3CRM A;  1FKT A;  3N2G B;  5E79 Z;  1NVP D;  2LW7 A;  4Z2H A;  2P90 A;  4KXR A;  1PL4 A;  1RPO A;  4TQF A;  5EBL C;  2Z3Y A;  5KMG A;  5GQB A;  4LAV A;  2OT5 A;  4FLW A;  1RPR A;  1HNZ B;  4IYI A;  2ITC C;  4JAU A;  4FIP C;  1W1P A;  4JI0 O;  3KCE A;  1Y66 A;  5C8Y B;  1SQQ H;  1ORQ C;  1MA1 A;  1B06 A;  2Q7G A;  5IE9 A;  2UXB B;  4KQZ A;  4NTX A;  1I5X A;  4FVM A;  2Q0A A;  1HJV A;  2Y0P A;  1Q82 W;  5GPR A;  3CXC U;  3ARY A;  2RMK B;  3JSL A;  4Z1V A;  3WH0 A;  3CCL V;  3CC4 V;  4IYH A;  4CC6 A;  4I4T A;  1N32 O;  3JXV A;  3UI5 A;  2DN9 A;  5GTI Z;  2EUL A;  2Y69 C;  3QF7 A;  1PIN A;  3G80 A;  3CRC A;  5FNV A;  4JV5 B;  1YVW A;  4J10 A;  3FFQ A;  4LGX A;  1CPY A;  3KCY A;  1NTK H;  1ZCN A;  4LAX A;  1S77 D;  2EIK B;  3IHZ A;  1PNK A;  1FXK C;  3CMA V;  2E5L B;  4EEQ A;  3A0B Z;  1OJH A;  2P22 C;  3T1Y B;  1M57 C;  3SPJ A;  1AIL A;  2AOS A;  5HW6 A;  2DSW A;  2XT9 A;  3WD2 A;  2CK3 G;  3S3X A;  1M90 W;  2RUQ A;  2CTR A;  1AI6 A;  4UFZ A;  5GTH Z;  1GM8 A;  4DK1 A;  2DT2 A;  3CCV V;  2UUB O;  2P67 A;  3H9V A;  3ZIA G;  2P7T C;  2QGN A;  1WPX A;  4U84 A;  3CHD A;  3HR0 A;  4WK9 A;  1FS0 G;  1S5H C;  1Q86 W;  2HHH O;  4S3J A;  3FB5 C;  1XIL A;  2BSK A;  5CBG A;  4JI1 B;  2AWG A;  2UXN A;  2ARH A;  3ZJZ A;  3ASN B;  3JAK B;  3IC7 A;  4GX2 A;  4ZOL B;  4KR0 B;  5BXJ A;  4Q22 A;  3AK3 A;  5KHH A;  1E15 A;  3RWR D;  3K06 A;  1Y6X A;  1EHN A;  2IUZ A;  3AS0 A;  4ZPV R;  1IX5 A;  1KFW A;  3ZN0 A;  1YHQ V;  2EIM C;  2ZQM A;  1IBL O;  4MPK A;  1O6I A;  2XAS A;  4LH6 A;  4L72 B;  2LFS A;  3RYF B;  1X59 A;  3OEE G;  4WBN A;  4GKK B;  2Q69 A;  3ALG A;  1PNL A;  1JOY A;  1X6L A;  1WAZ A;  4JZ2 A;  2EIN B;  4H33 A;  5LMU O;  1LR1 A;  3JYC A;  3U10 A;  2Y0I A;  1FXH A;  3DC5 A;  3JSN A;  4FFK A;  1TUB B;  1Q3E A;  5FPR A;  4WJX A;  2QTO A;  4DUY B;  1EQ3 A;  4FFB B;  4JF3 A;  2PGG A;  3L70 H;  3A2F A;  3VQX A;  2LPV A;  4TV8 A;  1X6N A;  5D75 A;  4TWK A;  2PF4 E;  1IBM O;  1Q8I A;  3CEI A;  4ZKI A;  4YHH B;  5IWA O;  1XHG A;  2MLX A;  4IHJ B;  4MVS A;  2KFW A;  2WLN A;  2PI4 A;  1THZ A;  4P30 A;  1U96 A;  4DR5 B;  4PDM A;  1J6Y A;  5LP6 B;  5BR8 O;  1H0I A;  1LJY A;  3ZMS A;  2RUD A;  4UB6 Z;  3CCR V;  2FTK A;  2F2D A;  1KP2 A;  1KC8 W;  4JI4 O;  1W1T A;  1IX9 A;  4MVR A;  4UCR A;  3MHS C;  5EIB C;  1HKI A;  5LGN A;  4H37 A;  1R3J C;  4MVZ A;  1YAT A;  2DQ0 A;  5KUK A;  4B3S O;  2P5O A;  1MAB G;  1V55 B;  4JYC A;  2BTQ A;  3ABT A;  4LFC B;  1IBK O;  2G41 A;  3OEH G;  2B1I A;  1ENV A;  5IJ9 B;  1FFQ A;  3CCQ V;  3H1H H;  4LFA O;  4I0X A;  4TT3 G;  1NJI W;  1OCO C;  4OPA A;  3CGN A;  2B9Z A;  4GIV A;  4XBF A;  2QR4 A;  5B3S B;  2X7R B;  1UR8 A;  2QKS A;  4GGQ A;  4I4T B;  2MW2 B;  1VAR A;  5LYJ B;  2MK3 A;  3CB2 A;  4KL1 A;  3K3W A;  1K3E A;  4D6T H;  4R5E A;  3CHC A;  3BPZ A;  2JEU A;  5HWB A;  4KUM A;  2BE3 A;  4EKW A;  1L8D A;  3CX5 F;  3KAD A;  1Y4M A;  3RYC A;  1SZX A;  2ZKO A;  3P3N A;  3B9E A;  4P9P A;  3N2K A;  1WP8 A;  3VAW A;  2ZNI A;  5EZY A;  3ASO B;  3O5M A;  2D9F A;  3O5E A;  2ZR6 A;  3CH9 A;  4BW9 A;  2ZQT A;  4DT4 A;  2ESC A;  3ZHS A;  2F4V B;  1CP9 A;  4IIJ A;  3H01 A;  4DR3 O;  2D2C B;  4JI6 O;  4EB6 A;  3LDC A;  4J80 A;  4X1Y B;  1R3I C;  1LG2 A;  1M9N A;  1J4R A;  3HKD B;  2CTQ A;  3OW2 U;  4LF6 B;  1PD3 A;  2BSK B;  2F21 A;  2KB1 A;  4JFL A;  4O4I A;  3T1H B;  3ARW A;  2YIB D;  5H6Q A;  1XNR B;  3UI4 A;  3VBB A;  2JIZ G;  2K1E A;  4DIP A;  1SQG A;  4G50 A;  2ATK C;  4LP8 A;  4Z2L A;  2ILM A;  2HLD G;  4DUZ B;  4FLZ A;  3K59 A;  2Q9L A;  1FXV A;  4B3R O;  3FB7 C;  5KX5 B;  2XPA A;  2O57 A;  3SYC A;  1QR8 A;  1DK1 A;  4JI2 B;  3OMI B;  3K03 A;  4ZPT R;  1LUV A;  3I6C A;  3ETG A;  3K0D A;  4JGS A;  4WBN B;  4PA4 A;  1R9H A;  5FLX N;  4MNJ A;  2Q7E A;  2ZE7 A;  3FAP A;  2E3C A;  4DWS D;  2QKA A;  4W4L A;  4CS4 A;  2BTO A;  3BA9 A;  3B9A A;  3OGC C;  1K9T A;  4K3A A;  4IGG A;  4IT4 A;  3ZHV A;  1WAW A;  4QPJ A;  2MF9 A;  3TXQ A;  4JAS A;  3JAW A;  2ADP A;  3OGI B;  4MNM A;  3QO5 A;  1Q6I A;  1GN4 A;  1W59 A;  3SJC C;  1OCR B;  3SPG A;  4DRM A;  1PNM A;  3NXS A;  2XPB A;  2FML A;  2WAM A;  1ZX3 A;  3K5L A;  2JJ1 G;  2MLZ A;  1R3K C;  3ZBH A;  4R8C A;  4TYO A;  2YI8 A;  4PA3 A;  3L72 H;  4P8X A;  1XMQ O;  4TUY A;  2WLM A;  3EXA A;  1VF5 B;  3O65 A;  1W2B U;  4DRX A;  3O5O A;  3DXR A;  3B9D A;  3CHF A;  2HP8 A;  3P32 A;  3AS2 A;  3WB0 A;  3AK1 A;  1JJ2 U;  2ZQU A;  1QVG U;  4LR3 A;  4B08 A;  3LUO A;  1D5N A;  5EC1 C;  5DF0 A;  5LA6 B;  3HKC B;  3IGA C;  2IH1 C;  1HP8 A;  4TV9 A;  2OFN A;  1DLB A;  4P8V A;  5JVD A;  3UCS C;  1VMG A;  3P30 A;  3UQ8 A;  4AHC A;  2WA3 A;  4FPP A;  2HR3 A;  2N04 A;  5H6R A;  4QIW F;  4LNU B;  2M6Y A;  4JI3 B;  1BE3 H;  1WJZ A;  1SER A;  2Z5U A;  2B5U A;  4DV7 B;  1WLE A;  2X0L A;  4ZHQ A;  2XAH A;  1B6Q A;  4CH6 A;  3NR7 A;  3VOU A;  3HKB A;  3RYH A;  5D5P A;  3OR6 C;  2RSE A;  4UCS A;  1PKX A;  1ZK6 A;  3KKY A;  1AI4 A;  1BHB A;  1RP3 B;  4LF9 B;  2Y4T A;  1OCC C;  2YXH A;  1QLN A;  3H1K H;  1S5L Z;  4X8A A;  3JD2 A;  4Z2K A;  3OOB A;  1QHT A;  2DYS B;  1TFV A;  1XL6 A;  3AG3 B;  3AG2 B;  1L1F A;  4B3M O;  3L74 H;  5EZY B;  3CZ8 A;  1N33 B;  1NMW A;  3RN4 A;  4IL6 Z;  4AQY B;  1EZJ A;  3WFV A;  1HWY A;  2IJJ A;  1EN5 A;  1FKJ A;  3FX7 A;  3LDD A;  4I5S A;  1F51 A;  4Q6G A;  5L3F A;  3ABL B;  4L87 A;  3TJT A;  1ZBW A;  4LWS B;  1QNM A;  3W7W A;  2XP8 A;  1W1Y A;  2UXX A;  3WG7 C;  1SQF A;  1R1B A;  2VQF B;  5HW7 A;  1BMF G;  4ZI7 B;  1K33 A;  4LFB O;  3M99 B;  3BHP A;  3THO A;  1YZB A;  5A9G A;  3WQW A;  1BKF A;  4LF4 O;  4MVQ A;  3QG5 A;  4DR1 O;  1MZF A;  3X2Q C;  4JI7 B;  4DV1 O;  3PA7 A;  3ICX A;  1J4I A;  2VN1 A;  4W9O A;  3BAB A;  2JDI G;  2VWK A;  1W1V A;  4X20 A;  2QWN B;  4HNA A;  1XOU A;  1R6K A;  4W4K A;  1WB7 A;  4NXM B;  2IH3 C;  5EK0 A;  1FFT B;  3DSQ A;  1JFF B;  3ZMV A;  2ITD C;  3ARR A;  3ARO A;  2HKO A;  4PD4 F;  4J7K A;  4GYC B;  2OWO A;  1T5E A;  4LF5 B;  4AI8 A;  3L9D A;  4DV0 O;  4UV9 A;  5LHI A;  3W7S A;  2A9H A;  2Q6A A;  1XMO O;  4JAV A;  4GCZ A;  2WLY A;  3JAW B;  2KO7 A;  2ZE8 A;  4WCE V;  1SRY A;  4OPH A;  3IKD A;  4DO2 A;  1XL4 A;  2BOB C;  3F7V C;  1VEW A;  4TOI A;  5DEC A;  1H2N A;  3HB3 B;  3D3I A;  2PPO A;  2LW1 A;  1YF2 A;  3ALF A;  4XDJ A;  1MSD A;  1HNZ O;  3RFR A;  1RM1 B;  1KBH A;  2OCH A;  2NNU A;  3ZRX A;  5HFL A;  2CH7 A;  1FJD A;  3DXR B;  1JA8 A;  3EHB B;  1MMM A;  5LOV B;  1RD6 A;  1RSO A;  2Q4P A;  1NWS A;  4U7N A;  3T4Z A;  2UXB O;  2CTW A;  3CCS V;  2MPH A;  3O5L A;  4MSP A;  2Q8V A;  1NU1 H;  4MVM A;  5IYD O;  3D8C A;  5FPO A;  4FJC C;  1XHZ A;  1BQZ A;  3AG1 C;  4ODR A;  2KE0 A;  1SQP H;  4XDK A;  2EJ7 A;  1JCH B;  4S3K A;  4YJ2 A;  1HKK A;  2LO1 A;  1TGO A;  2HVK C;  2LJ4 A;  5I98 A;  1QCE A;  3E35 A;  3OTF A;  4J7J A;  1VQK V;  4U3J A;  3TC5 A;  1EFR G;  2ITK A;  1KYO F;  1I08 A;  3BY6 A;  4NXN B;  3ZRW A;  1VQ9 V;  1GPF A;  3U0Z A;  1M56 B;  3HKB B;  1K5Q A;  4WKH A;  2AW9 A;  4JPR A;  1ZLZ A;  1AJP A;  3AG4 C;  3AK2 A;  2F4E A;  4CBC A;  4JTC B;  5B1B C;  3T1Y O;  2AZ2 A;  4B3T B;  4R0X A;  4PA9 A;  3KZ7 A;  3CC7 V;  4DW1 A;  1CXZ B;  1XEQ A;  2IJH A;  1E1Q G;  4O4J A;  4DR2 B;  2EX3 A;  3KAH A;  1F4N A;  4DZ2 A;  2D3O W;  4FLX A;  1OV9 A;  1TAE A;  4PDL A;  2YBT A;  4LF8 B;  3F7Y C;  2EIJ B;  1ZTE A;  4ITZ A;  1YI2 V;  4QT2 A;  4U3F H;  2DT3 A;  3OTO B;  5IYB O;  2QDO A;  4YXW G;  2ZIO A;  3AG4 B;  4DR4 B;  3QO8 A;  4I55 B;  3ZRS A;  3ABM B;  4J42 A;  2DQ3 A;  4BAY A;  4JI1 O;  4PHZ A;  1R6T A;  2RN9 A;  5K1P A;  1ZBV A;  2GUZ A;  4JI5 B;  2FYU H;  3P3P A;  3T2M A;  3UM7 A;  2PYL A;  1NTZ H;  1VQ6 V;  4Z2J A;  5ITZ B;  1ARO P;  1FJG B;  1NKD A;  1OCZ B;  1QPL A;  3FB8 C;  1DF5 A;  1GKF A;  4KHP B;  5KA5 A;  5IYZ B;  5J9P C;  1JPX A;  1BL8 A;  1JVM A;  5CA1 B;  2QKC A;  1O9G A;  4HBE A;  4A5U B;  4YY3 B;  1Y74 B;  4BWA A;  1HNW O;  3FAV A;  3SDL A;  3ZHR A;  4IT6 A;  5JJN B;  1ROU A;  3K58 A;  4ABM A;  1I7F A;  1VQ5 V;  5LXT A;  4I50 B;  2UXC O;  2DW4 A;  4ODK A;  4FK5 C;  1UR9 A;  4DUY O;  3FYE B;  4X1I B;  3EY6 A;  4JYA B;  1XRV A;  4NYK A;  2QE7 G;  3LNN A;  4NSB A;  2UXD B;  4DV3 B;  5LMN O;  4YHH O;  1BQ0 A;  4O4L A;  3PRA A;  1ZL8 B;  1QBZ A;  2EIL C;  4FM0 A;  2W0F C;  2QJ1 A;  4DRO A;  4ODO A;  4GKJ B;  1WPB A;  4ZBM A;  1XQ8 A;  1I94 B;  2PV3 A;  2DMX A;  2FKE A;  3JYJ A;  5L3B A;  2XP9 A;  1P84 F;  3CHX A;  4DRN A;  1EIB A;  3CPW U;  2UUC B;  3E86 A;  1EN4 A;  1NI8 A;  2EJR A;  4JYY A;  5CB4 B;  4DZ3 A;  2OIG A;  5L3E A;  4JTD B;  3RYI B;  1EN6 A;  2VS0 A;  1VQO V;  2Y69 B;  2QWR B;  3ABK C;  3UT5 A;  1QPF A;  4DXW A;  1BCC H;  3WB2 A;  3D3Q A;  2QM8 A;  2WLI B;  1L1P A;  2IJI A;  5K1X A;  1XNQ B;  4X1K B;  1XBL A;  3JAR A;  4IQC A;  4LFC O;  1BZK A;  3C3T A;  2V1D A;  2NR5 A;  3I56 V;  1JND A;  3UI6 A;  3K5M A;  1FXK B;  3IC9 A;  1ZBK A;  1YJN V;  3FY1 A;  1XI1 A;  2ZIM A;  5B1A C;  5BMV B;  3SYQ A;  3RGB A;  2LGW A;  4G28 B;  1M57 B;  4YJ2 B;  1YIT V;  1D5A A;  3IK8 A;  4JYS A;  3JAM N;  4BIU A;  5L3G A;  4G2K A;  4JFM A;  3O5P A;  4LC1 A;  1B3Q A;  1KD1 W;  4O2B A;  2DJV A;  1J5E B;  3CD6 V;  3SJA C;  3MAQ A;  2JK5 C;  1L0L H;  2NLJ C;  3JAT A;  3A0R A;  3H9R B;  5GON B;  2EZP A;  3CJH B;  2HEP A;  3WB1 A;  1N34 B;  4Z2I A;  1TVK B;  1SA0 B;  5D5Q A;  1KEC A;  3ARS A;  3O5I A;  5JJJ B;  4DV6 B;  1NH2 B;  2JGD A;  2PY5 A;  4UCV A;  1NS1 A;  1NH6 A;  1ZU8 A;  5JH7 B;  4DH0 A;  2ZD9 A;  4U85 A;  3OFN G;  1XRE A;  2ZXW C;  1XUQ A;  1VP7 A;  1GN3 A;  2W0X A;  2FKX A;  1YDX A;  3NRK A;  4R50 A;  1FFR A;  3ZRV A;  2EIM B;  2A79 B;  3HKE A;  1VQ8 V;  1NTM H;  3FKS G;  5B66 Z;  3I5D A;  3TCU A;  4X88 A;  1YTF B;  4LF6 O;  1X4T A;  4ZS6 A;  5IY5 C;  1ROP A;  4B7K A;  1MNG A;  4X9Q A;  1RFY A;  3TCZ A;  3LSS A;  1V54 C;  1F8A B;  2ADQ B;  4JI8 B;  3G4S V;  2Y78 A;  1KQS U;  1IZ3 A;  1PV0 A;  4NR1 A;  5KHI A;  3H1I H;  4UUJ C;  2RNB A;  4DUZ O;  1SQB H;  3G6M A;  5EYP A;  4FN2 A;  4MTO A;  1ZL1 A;  4JTA B;  3UF8 A;  1N32 B;  1JQ0 A;  5DIT A;  1SR0 A;  2X6B A;  4HAR A;  1HXV A;  5KMG B;  4JI2 O;  4MVO A;  4NVP A;  4MAV A;  3BMB A;  2WLK A;  1NSG A;  1YJ9 V;  1Y76 A;  3L71 H;  5IY5 B;  1P4R A;  3B8M A;  1Q7Y W;  4WFG A;  2QM7 A;  2ZE6 A;  4BIO A;  4C02 B;  4UVC A;  1IVS A;  1DGS A;  1KT1 A;  3F5T A;  1TA8 A;  4H13 B;  4TX0 A;  3BVO A;  5JCO A;  1GTO A;  4HBN A;  4TSF G;  3NTP A;  1E9L A;  2XAG A;  1QR9 A;  1G8M A;  1JNE A;  2ZM6 B;  2Q7H A;  4RO2 A;  5FNV B;  2LGO A;  1AR5 A;  1B6C A;  1K5S A;  3RGC A;  3W7T A;  1AI5 A;  3OUF A;  1E6P A;  1HDJ A;  3TET A;  3OAA G;  1GN6 A;  4UCO A;  3CCJ V;  3MDY B;  2EZO A;  2HHH B;  1HR0 B;  3GTY X;  2XP7 A;  1Q6U A;  1OCO B;  4QE7 A;  4UVB A;  2DG9 A;  2XP5 A;  5B1O A;  5KLV H;  4ODQ A;  4ODL A;  3ZCC A;  2M08 A;  4J9Y B;  1G4Y B;  1H2M A;  1K92 A;  5LHH A;  3E22 A;  5B8I C;  2ZR4 A;  2B1G A;  1VQL V;  4PDR A;  1NMV A;  1GN2 A;  3FXY A;  4Z2G A;  3K9S A;  2RQS A;  1QU7 A;  3CP1 A;  1WA8 A;  2A3B A;  5DN6 G;  3ARV A;  5A2Q N;  2GTA A;  1VF7 A;  1GM7 A;  1J95 A;  4MTF A;  2ODM A;  2YEV A;  2Q73 A;  1S0V A;  3TK1 A;  1PP9 H;  1KKC A;  4KFM A;  3WD3 A;  4QE9 A;  2X6A A;  3CCU V;  1VF6 A;  3E89 A;  5B5E Z;  4O2B B;  2W6J G;  2IF4 A;  2VWJ A;  1S72 V;  3B8N A;  4FZ1 A;  4LF9 O;  3JAT B;  3U11 A;  4RUF A;  1L0N H;  2KI3 A;  4DRK A;  3A8T A;  4DV2 B;  3L73 H;  4JFJ A;  3Q4H A;  4WFB V;  2WPD G;  2YIC A;  2G38 A;  2PV2 A;  2A3A A;  4MNK A;  2IW5 A;  3BEH A;  4L8J A;  1ZB5 A;  3NI6 A;  1E6Z A;  2YS8 A;  3OUS A;  2XAJ A;  4AQY O;  3AS3 A;  5DIU A;  3D36 A;  1U97 A;  2N05 A;  1H38 A;  4MS2 A;  3RME A;  1S76 D;  1YXB A;  3UKM A;  2E75 B;  1NVP B;  3APO A;  4W5U A;  3F5W C;  3JD4 A;  4CS3 A;  4PA6 A;  1KKD A;  1EDQ A;  4TV8 B;  1HNX B;  4B3S B;  4JFK A;  1PBK A;  4X65 B;  4BF8 A;  2CGO A;  3RM4 A;  2XP3 A;  4YJ3 A;  3ML0 A;  3CSX A;  2WWW A;  2AHY A;  4H44 B;  1AR4 A;  3QO7 A;  4UV8 A;  1N1A A;  4NNR A;  4E2L A;  5JCO C;  2O92 A;  3QVN A;  4JI7 O;  3STZ C;  4TW8 A;  5FL7 G;  1FKD A;  1W26 A;  2UUA B;  1HKM A;  3K08 A;  1GUV A;  3O5R A;  3LUT B;  3ZMU A;  1PM9 A;  5L3D A;  3G6E V;  3B7X A;  5LGT A;  2KG7 A;  4EFB A;  4GLX A;  1J4H A;  2F1M A;  5CA0 A;  4NTY A;  2KSD A;  2PTM A;  3H1L H;  4LF5 O;  3PR9 A;  2BTQ B;  2CDY A;  1W9U A;  4JYB A;  1A32 A;  3VQV A;  3STL C;  4I0X B;  3B2E E;  3WD0 A;  2XND G;  1YJW V;  4F6R A;  4X62 B;  3G6L A;  2CGN A;  1SKV A;  2PI6 A;  2KQX A;  3PJS K;  3WKZ A;  4IQ2 A;  1K34 A;  2WLZ A;  4DR3 B;  2P4K A;  3UO3 A;  1FFX A;  2CUG A;  3QNE A;  5DIV A;  1JJO A;  2DG4 A;  4D7T A;  2VQE B;  4OXS A;  4FLT A;  2HJD A;  3W7U A;  4PV1 B;  1M1K W;  4ODM A;  2PV1 A;  1R3L C;  3RYC B;  1MG1 A;  1M5I A;  2JS3 A;  1FKB A;  3JD0 A;  2UU9 B;  3N2K B;  3WQV A;  2F23 A;  3SJQ C;  1PPJ H;  1VF6 C;  1GMG A;  1JVW A;  3KAF A;  3VQY A;  3SPH A;  4HZ3 A;  2YIB A;  5CN0 A;  2PZS A;  4IIJ B;  2WLL A;  1W0K G;  4EB6 B;  1OCC B;  4WFA V;  2AGA A;  4LF7 B;  1V9P A;  1Q6H A;  4RQE A;  4RWU A;  1N36 B;  1BHA A;  4ZPW R;  4OX9 B;  4NXN O;  3OR7 C;  4BIZ A;  3ODK A;  1F4M A;  2XOK G;  4O4I B;  5J2U A;  3BRC A;  3ARZ A;  1TCO C;  1H2L A;  1E79 G;  3ETD A;  2XAQ A;  1AP6 A;  3WL0 A;  3D36 C;  4QGP A;  1SC5 B;  4B3T O;  4PA7 A;  3WU2 Z;  4DWS A;  3H1J H;  2ZQS A;  3L75 H;  3N2G A;  4MSW C;  3E8F A;  4DR2 O;  4CH5 A;  4I7Z B;  3SR2 C;  4WIW A;  1N4C A;  2OCC C;  1ROT A;  3WG7 B;  5KHJ A;  2OIE A;  5CA3 A;  2F95 B;  1QLE C;  4FLV A;  4J9Z B;  4J7Z A;  4LF8 O;  1XMQ B;  3RM8 A;  3EVK A;  4IPX A;  5C8Y A;  4G27 B;  3KAC A;  4RAI A;  2GTS A;  5H2F Z;  3X2Q B;  4JI5 O;  1VF8 A;  2JS5 A;  2LKN A;  1FJG O;  4N23 A;  3JYM A;  4W9P A;  4YJ3 B;  1VIB A;  4KHP O;  1E1R G;  2W6I G;  4NB5 A;  4AY1 A;  1FKS A;  3K5N A;  4DR7 B;  4TUY B;  1FKH A;  4DRX B;  2R9A A;  4I9W A;  4GUN A;  4XAK A;  5H9C A;  1BS3 A;  1GRJ A;  2P06 A;  4PEL A;  5LGU A;  5EIB D;  1NWR A;  3B09 A;  1H2S B;  3ZX6 A;  1HJW A;  1WNO A;  4TV9 B;  2A0L A;  2DSZ A;  4QPK A;  5JVD B;  1IXB A;  3G6B A;  4JYA O;  3MDS A;  1M5Y A;  2YI9 A;  1GO3 F;  2UXD O;  4DV3 O;  1BGY H;  4JV5 O;  1OHH G;  1U79 A;  4QZV B;  1FD9 A;  4F6R B;  3RVZ A;  4GKJ O;  3OT7 A;  1I94 O;  4B3M B;  2B5U B;  3O5Q A;  4NTW A;  3B40 A;  4ZHQ B;  1VQM V;  3G71 V;  2RCV A;  2DSU A;  2E5L O;  2DYR C;  1KB9 F;  3LSU A;  2GBO A;  3K04 A;  3RYH B;  4J4O A;  2ZR2 A;  3AG1 B;  4JZG A;  4P8W A;  3JAK A;  4IT5 A;  2LFR A;  1K4C C;  2WK2 A;  3SJB C;  1XNQ O;  3C3S A;  1GK9 A;  1LL7 A;  4GX1 A;  1XHX A;  2JEX A;  2YDE A;  1YCI A;  5JH8 A;  2BCC H;  3RYF A;  1M4U A;  1NR7 A;  2DYR B;  4DR1 B;  2M1I A;  5EC2 C;  2JVD A;  4DWS C;  4DV1 B;  5B1B B;  2FB5 A;  3FYI B;  2M7W A;  1QQC A;  3T1C A;  4X66 B;  1LL4 A;  3J81 N;  3O9O A;  1W9P A;  3UO2 A;  1E6N A;  1F23 A;  1FKK A;  2N87 A;  2O9O A;  1TUB A;  1J5E O;  3GWO A;  3CCE V;  1S5J A;  4FFB A;  1WB8 A;  4DR6 B;  3ZED A;  5LHG A;  5GW7 A;  2Q5Z A;  4DV0 B;  2WA4 A;  4ODN A;  1N34 O;  2ZNJ A;  1NT2 B;  4MT8 A;  4DV5 B;  5EBW C;  3CE2 A;  3C90 A;  4GKK O;  5LBQ A;  4DWS B;  1S3J A;  4F4L A;  2KKW A;  4DV6 O;  2BOC C;  5LP6 A;  4X20 B;  4HNA B;  2WLJ A;  4X64 B;  2PPP A;  3CC2 V;  2HFE C;  1FKL A;  4DV4 B;  3ART A;  4ML4 A;  2QWP B;  1KU9 A;  2YBU A;  3SYP A;  3AQU A;  1Z5V A;  1VQ4 V;  1SES A;  2P4V A;  4LH7 A;  1NQT A;  4WFE A;  1G1X B;  2WSS G;  4GT1 A;  4GX0 A;  1FPO A;  4UB8 Z;  4WFH A;  2A7W A;  1GOI A;  1P7B A;  5JQG A;  2M2A A;  3E8B A;  2FL4 A;  1HKJ A;  2EIK C;  2LP7 A;  2PYJ A;  2R72 A;  4JI8 O;  1JNT A;  4K0K B;  1D7H A;  2RUR A;  5IJ9 A;  3E8G A;  4DR5 O;  5CBH A;  2V7Q G;  1SQV H;  3SPI A;  4L3N A;  3SPC A;  3BA8 A;  1ZUQ A;  5IDJ A;  1KUQ A;  1ZAU A;  5LYJ A;  1Z5W A;  4DYL A;  1N0N A;  1WP7 A;  1LNQ A;  1AI7 A;  4HBO A;  2CH7 B;  2Y4U A;  2WM0 A;  3ETQ A;  1AJN A;  1Q1C A;  1G6U A;  2EIL B;  2OTL V;  5DEZ A;  1RSO B;  3WD1 A;  2FDM A;  1Q81 W;  3UQI A;  3LDE A;  1ZBC A;  3J80 N;  4JAA A;  3A0H Z;  3ASN C;  4N21 A;  2QF8 A;  1MSW D;  4D7S A;  1FYJ A;  2ZM6 O;  2IU3 A;  3K0G A;  5L3C A;  4J11 A;  3W4R A;  3ABK B;  1EYM A;  1UJW B;  4U3J B;  1FKA O;  3RW0 A;  4K8Z A;  2ETN A;  2IBZ H;  1K97 A;  3ZRW B;  4X1Y A;  4FM2 A;  1WNS A;  1HR0 O; 
#chains in the Genus database with same CATH homology
 3ARV A;  4DRH A;  3PRB A;  2DT0 A;  4MGV A;  3CZ8 A;  1NMW A;  3B8S A;  3KAG A;  1FAP A;  3O5J A;  3WD3 A;  1FKJ A;  2A3E A;  2MNT A;  3ARQ A;  1ZBW A;  4O2T A;  2IF4 A;  3KAB A;  4FAP A;  2KI3 A;  2XP8 A;  1W1Y A;  4DRK A;  1LG1 A;  4G2P A;  1A7X A;  1C9H A;  4JFJ A;  5HW7 A;  5HT1 A;  1P5Q A;  2PV2 A;  2A3A A;  3TDB A;  4MNK A;  4LAY A;  1ZB5 A;  4URI A;  3NI6 A;  1E6Z A;  4PTM A;  2A3C A;  3CGM A;  2PPN A;  1BKF A;  3WQW A;  4P8U A;  3AS3 A;  5DIU A;  1FKT A;  3PA7 A;  1H0G A;  1J4I A;  2VN1 A;  4W9O A;  4WKF A;  1W1V A;  3RME A;  4Z2H A;  4U86 A;  3CHE A;  4W5U A;  3GPK A;  1EDQ A;  2RUC A;  1CTN A;  4JFK A;  2PBC A;  5GQB A;  1PBK A;  4LAV A;  4BF8 A;  3ARR A;  3RM4 A;  3ARO A;  2XP3 A;  1W1P A;  3KCE A;  4MNL A;  2VCD A;  1N1A A;  4NNR A;  2WLY A;  4KQZ A;  3ARU A;  2O92 A;  2KO7 A;  1HJV A;  1JNS A;  1W9V A;  5GPR A;  3ARY A;  3IKD A;  4TW8 A;  1FKD A;  1W26 A;  2G8Z A;  3O5D A;  1HKM A;  3WH0 A;  1QZ2 A;  1GUV A;  3O5R A;  2ZQV A;  3JXV A;  3UI5 A;  3RM9 A;  3B7X A;  2PPO A;  1J4H A;  3ALF A;  1PIN A;  3PR9 A;  4LAW A;  4LGX A;  1W9U A;  1FJD A;  1ZCN A;  1SYT A;  4LAX A;  1RD6 A;  3IHZ A;  1NWS A;  4ODP A;  1OGG A;  3O5L A;  2MPH A;  4MSP A;  3WD0 A;  2DT1 A;  3G6L A;  2PI6 A;  3WKZ A;  4IQ2 A;  2AOS A;  2WLZ A;  4ODR A;  2KE0 A;  5HW6 A;  2DSW A;  4S3K A;  3WD2 A;  1HKK A;  4J4N A;  1NWU A;  2RUQ A;  2DSV A;  2LJ4 A;  5DIV A;  5I98 A;  2DT2 A;  2DG4 A;  3TC5 A;  3WIJ A;  2ITK A;  4ODM A;  2OLH A;  2PV1 A;  1D2K A;  4U84 A;  3CHD A;  1GPF A;  4WK9 A;  2ZR5 A;  3O5F A;  1FKB A;  4S3J A;  4WKH A;  3WQV A;  2F4E A;  2AWG A;  4DRI A;  1JVW A;  4R0X A;  3KAF A;  3KZ7 A;  2DPE A;  4KR0 B;  5BXJ A;  4Q22 A;  3AS0 A;  3RFW A;  1E15 A;  4ZPV R;  1EHN A;  2IUZ A;  3KAH A;  1IX5 A;  1KFW A;  4DZ2 A;  1Q6H A;  4MPK A;  1O6I A;  4ZPW R;  2YBT A;  4L72 B;  4ITZ A;  3ODK A;  4QT2 A;  2DT3 A;  3IKG A;  3ARZ A;  1TCO C;  3ALG A;  1X6L A;  3WL0 A;  1ZBV A;  2L2S A;  4Z2J A;  4DWS A;  2ZQS A;  1D6O A;  4WJX A;  1QPL A;  1EQ3 A;  4WIW A;  1ROT A;  2LPV A;  1X6N A;  3BXW A;  5D75 A;  4HBE A;  1XHG A;  2MLX A;  3RM8 A;  2KR7 A;  2KFW A;  3ARX A;  4W9Q A;  4IT6 A;  3QOK A;  1ROU A;  4IPX A;  3KAC A;  1J6Y A;  1H0I A;  1LJY A;  2RUD A;  1D7I A;  2F2D A;  1VF8 A;  3KAI A;  4DRP A;  1W1T A;  2LKN A;  3JYM A;  4ODK A;  1UR9 A;  1HKI A;  4W9P A;  3ARP A;  3EY6 A;  1D7J A;  1XRV A;  1YAT A;  4NSB A;  4AY1 A;  1FKS A;  4WKA A;  3PRA A;  1FKH A;  2G41 A;  4N19 A;  4XAK A;  5J6E A;  4DRO A;  1FFQ A;  4ODO A;  2PV3 A;  3CGN A;  5HKG A;  4GIV A;  5HBF A;  3JYJ A;  1ITX A;  2FKE A;  2XP9 A;  1NWR A;  3B09 A;  1UR8 A;  4GGQ A;  1HJW A;  4DRN A;  1EIB A;  1WNO A;  4DRJ A;  2DSZ A;  4DZ3 A;  5GPG A;  1QPF A;  1M5Y A;  1OWQ A;  1E6R A;  1L1P A;  4R5E A;  3CHC A;  1T11 A;  5HWB A;  4IQC A;  1U79 A;  4QIB A;  3WL1 A;  4QZV B;  1FD9 A;  1JND A;  3UI6 A;  3PRD A;  3KAD A;  3O5Q A;  1ZBK A;  1BL4 A;  1KT0 A;  3FY1 A;  2DSU A;  3B9E A;  3VAW A;  4J4O A;  3O5M A;  2D9F A;  3O5E A;  4P8W A;  3IK8 A;  2ZR6 A;  4JYS A;  3CH9 A;  2ZQT A;  4DT4 A;  2ESC A;  4JFM A;  2WK2 A;  3O5P A;  1FKF A;  1WB0 A;  1LL7 A;  1LG2 A;  3H9R B;  1YW5 A;  1J4R A;  4Z2I A;  2F21 A;  5JH8 A;  4JFL A;  4Q7N A;  3ARS A;  3ARW A;  2M1I A;  3UI4 A;  4DWS C;  3O5I A;  4DIP A;  4G50 A;  1NH6 A;  1ZU8 A;  4DH0 A;  1LL4 A;  1W9P A;  4Z2L A;  1FKI A;  4U85 A;  1E6N A;  1FKK A;  2B31 A;  2N87 A;  2O9O A;  2KGJ A;  2XPA A;  3NRK A;  1FFR A;  4ZPT R;  3I6C A;  1R9H A;  4ODN A;  4MNJ A;  4ZS6 A;  3FAP A;  3TCZ A;  4DWS D;  1F8A B;  2MLY A;  4DWS B;  5HUA A;  3B9A A;  2Y78 A;  1K9T A;  4IT4 A;  1WAW A;  2MF9 A;  4MNM A;  2JZV A;  2Q5A A;  1Q6I A;  2PPP A;  4FN2 A;  3G6M A;  1ZL1 A;  3UF8 A;  1FKL A;  5DIT A;  3ART A;  4DRM A;  1SR0 A;  2XPB A;  4HAR A;  1HXV A;  4ML4 A;  2UZ5 A;  3OA5 A;  4MAV A;  2MLZ A;  2YBU A;  3AQU A;  1F40 A;  4TYO A;  1NSG A;  5HTG A;  2XP6 A;  1HJX A;  4P8X A;  1GOI A;  2M2A A;  2XP4 A;  1HKJ A;  4C02 B;  3O5O A;  1FKG A;  2RUR A;  1OGB A;  1JNT A;  3UQA A;  1D7H A;  1KT1 A;  3B9D A;  4MTV A;  3AS1 A;  3CHF A;  3AS2 A;  4TX0 A;  2ZQU A;  1LQ0 A;  4NZC A;  5HWC A;  3LUO A;  3NTP A;  4L3N A;  5DF0 A;  1E9L A;  3O5G A;  1JNE A;  3UQB A;  2OFN A;  4P8V A;  2LGO A;  1FKR A;  1B6C A;  3RGC A;  4HBO A;  5HW8 A;  2WM0 A;  1E6P A;  4TNS A;  1Q1C A;  3MDY B;  1Y0O A;  5DEZ A;  3WD1 A;  2FDM A;  1NWT A;  2XP7 A;  1Q6U A;  3UQI A;  2DG9 A;  2XP5 A;  1ZBC A;  2FAP A;  2K8I A;  4ODQ A;  2DG3 A;  4ODL A;  4TW7 A;  4DRQ A;  2QF8 A;  3O5K A;  2M08 A;  5DO2 A;  2RSE A;  1ZK6 A;  4TW6 A;  3W4R A;  1LL6 A;  5B8I C;  2ZR4 A;  1EYM A;  3WD4 A;  4JFI A;  1NMV A;  3FXY A;  4Z2K A;  4Z2G A;  2RQS A;  3OOB A;  2A3B A;  1TFV A;  4QT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...