1Q6IA

Crystal structure of a truncated form of fkpa from escherichia coli, in complex with immunosuppressant fk506
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
210
Chain Sequence
AFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
publication title Structural and functional studies of FkpA from Escherichia coli, a cis/trans peptidyl-prolyl isomerase with chaperone activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 66
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1q6iA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q6iA02
5I98A 3WH0A 2RUCA 1YW5A 3NTPA 3FAPA 3I6CA 3KAHA 3GPKA 4JFKA 3O5JA 4JFLA 4BF8A 2PPOA 1NSGA 1TCOC 4IQ2A 4JFJA 3KZ7A 3LUOA 2F4EA 4TW8A 4ODQA 1J4IA 4QT2A 2RUDA 4U84A 2M08A 1BKFA 2JZVA 4DROA 2ZQTA 3O5OA 2XP5A 1KT0A 3KACA 4JYSA 4DRMA 3IHZA 1Q1CA 4LAWA 4TYOA 3O5GA 4N19A 3UI4A 4IPXA 2XP8A 4MSPA 3OOBA 4W9QA 2KO7A 1JVWA 1F8AB 2K8IA 2LKNA 5D75A 2ZR5A 1FKHA 2DG3A 4ODOA 1F40A 4ODPA 1QZ2A 4IQCA 2DG9A 1ZK6A 2MPHA 2LPVA 4DT4A 3B09A 3MDYB 1EYMA 3O5IA 2KGJA 3KADA 3O5DA 4ODNA 4LAVA 2MLZA 3CGNA 5HW7A 3JYJA 1PBKA 5BXJA 4G2PA 4C02B 5DIVA 3VAWA 3UQAA 4TX0A 3TDBA 2L2SA 2F2DA 2MLXA 2Q5AA 3NI6A 4QT3A 4TW7A 4TW6A 2ZQVA 4DRIA 2VCDA 1Q6HA 2IF4A 3B7XA 2ZR6A 1ROUA 1FKKA 1YATA 2LJ4A 2PV3A 2XP7A 2MLYA 3JYMA 5HT1A 5HW8A 1NMWA 1N1AA 1ROTA 4ODKA 5HTGA 1J4HA 1FAPA 5HW6A 3KAIA 1B6CA 2FAPA 4MGVA 4DRPA 3IKGA 2FKEA 3RGCA 1W26A 2VN1A 3O5KA 3JXVA 2KI3A 4DRQA 1J4RA 2KR7A 1Q6IA 2XP4A 4R0XA 1FKDA 2PPNA 1FKBA 3KAGA 3PRBA 5HUAA 3RFWA 3H9RB 4W9OA 3KAFA 4QIBA 2MF9A 2N87A 4DRJA 3UQBA 1FKJA 4J4NA 1FKTA 1NMVA 1QPLA 2RUQA 3O5LA 1T11A 1ZCNA 1QPFA 3UI5A 3KABA 2RSEA 5DITA 4O2TA 2LGOA 2MNTA 1Q6UA 1C9HA 1R9HA 1M5YA 1D7IA 2AWGA 5HWCA 2M1IA 4FAPA 3UQIA 2RQSA 2DG4A 5J6EA 4W9PA 1P5QA 2KE0A 1PINA 2PV2A 3CGMA 4LAYA 4FN2A 5GPGA 4DRKA 2PBCA 4DRNA 2M2AA 3KCEA 3ODKA 4JFMA 4DIPA 4DZ3A 4ODRA 4ODLA 3O5MA 5HKGA 3PA7A 1U79A 3PRDA 2ZQUA 4GGQA 1KT1A 2UZ5A 3O5FA 2F21A 5DIUA 1Y0OA 1HXVA 1EQ3A 4G50A 1A7XA 4J4OA 4LAXA 3NRKA 4GIVA 3IKDA 1BL4A 3EY6A 2XPAA 1FD9A 1FKIA 3O5EA 3UF8A 4ODMA 5B8IC 1J6YA 1FKSA 2ZR4A 1FKGA 3O5PA 4TNSA 1D7HA 2RURA 2KFWA 1JNTA 2OFNA 1FJDA 2XP3A 2Y78A 2ZQSA 4DH0A 2XP9A 2D9FA 1L1PA 4JFIA 3TC5A 5HWBA 2PPPA 1D7JA 2ITKA 3O5QA 1FKLA 2XP6A 3IK8A 1D6OA 4NNRA 4DRHA 4DZ2A 3O5RA 4U85A 2PV1A 2XPBA 4U86A 4ITZA 1FKRA 3UI6A 3TCZA 1FKFA 1JNSA
chains in the Genus database with same CATH superfamily
2GHYA 2A3QA 5IJ0B 4X62O 2RUCA 2WLIA 2IH3C 2YIBA 4I0XB 1R6NA 1NVPD 2UU9O 1FXVA 3K9SA 3CZ8A 2H8PC 2HR3A 4ODQA 2L35A 5E79Z 2F4VO 2EINC 4LF6B 1TGOA 1ZAUA 2Y69B 1B04A 5LP6C 2IUZA 3T1YO 1QCEA 5KAIZ 2FDMA 4JI8B 2ZCEA 3QO8A 2UXCB 1HR0O 1TA8A 1NR1A 2JIZG 4FLUA 1HNZO 1HW7A 1IBLO 2DWEC 4H44B 5KX5B 2DSWA 1EFRG 1LQ0A 3QO7A 5C93A 1XMQB 3UQAA 1SC5B 1B6QA 1KU9A 4LF7O 1M90W 4HYOA 3FFQA 1NT2B 1RPOA 4GX5A 1NI8A 4DV5O 4PV1B 4DRPA 1HKKA 5A9GA 4B3TO 2UUBO 1R73A 4JI2B 4TT3G 5KHJA 3ICXA 4FLZA 1K3EA 1V54B 2VWKA 2RN9A 1TUBA 1H8HG 4LF5O 1FKTA 2Y4TA 1TFVA 1K8AW 2N74A 1SYTA 1PL4A 1JJOA 2QKAA 4D7TA 2RSEA 2LGOA 2YEVA 1R9HA 1H0GA 2M1IA 2IJIA 1I94B 5GPGA 2YBUA 4DRNA 4FN2A 4NB5A 3E22A 4DIPA 3A0BZ 4F4LA 2HVKC 5B3SB 1K33A 2ATKC 2ITCC 3ZHQA 5H9CA 4KQZA 4DV0B 1SERA 4G50A 1A7XA 5EZYB 2UXXA 3CRQA 1CXZB 2XPAA 1UFIA 4HBNA 1FKGA 1HJVA 3CWBH 1JOYA 4TUYB 3UO3A 1GK9A 3ZRXA 3QTCA 3OTOB 2EJ7A 4DV2B 1GO3F 3CCVV 1S76D 5CBFA 1L1FA 4ZS6A 3SR2C 1OV9A 1D5NA 3VQVA 1QNMA 3QOKA 4QIWF 3I6CA 4E4EA 4TV8A 4JFLA 4ZOLA 2IJHA 1WLEA 4DV6B 2XHBA 4IQ2A 4IYIA 1P84F 2YC0A 4NSBA 1V55B 3SDLA 2WLLA 1FPOA 3G6MA 5FPRA 1DLBA 3CRRA 4O2AA 4PHZA 2NN4A 4ZPWR 4QPJA 2FTKA 5BR8O 3I5DA 1XL6A 2ZXWB 1ZSPA 1W9VA 1KQSU 3O5DA 3SPIA 1ITXA 3ABKB 1GAXA 5BXJA 5DIVA 1JPXA 4O4IB 4MNMA 2MLXA 4TW7A 2V4DA 4DRIA 2PUSA 4CH4A 5DF0A 4LP8A 1ROUA 4WBNA 3AK3A 2MK3A 3T1HB 4TQFA 1O9HA 1MZEA 3OGCC 2E3CA 2KG7B 3JSLA 5IJ0A 3AS0A 4P8VA 1XHZA 1FKBA 4I0XA 1O6IA 3ZJZA 3K5LA 2DWDC 2GV9A 4KHPB 2OLHA 2B1IA 3ZS8C 3UI5A 2EIKC 1KKDA 1XRVA 1EN5A 2BTQB 2JVDA 3CCEV 5EK0A 4DW0A 4LH7A 1K73W 1EDQA 3SGIA 2IU0A 2XASA 2UZ5A 1OCOC 5DN6G 2QSAA 4J11A 5KX5A 5LMUO 4ODMA 3T4DA 2KFWA 4WKFA 2ZKOA 3ZEDA 4UCVA 2QM7A 4PI2A 2F43G 1F4MA 1R6TA 2OWOA 2CTRA 3ZRWB 4QE7A 1KUQA 1FKLA 2ZDIA 4LF9O 3UCSC 2PV1A 1N33B 1FXHA 3ZBHA 3BRCA 2QM8A 2EIMC 4F6EA 2PGGA 5CN0A 1FXKB 4OXSA 4DUYB 1CPYA 5JJEB 3AG3C 4YHHO 1OGBA 4DV4O 1VMGA 3SPJA 3ARVA 4YY3O 3THOA 4UFZA 3A2FA 1K34A 2DT2A 3ARYA 4DR5B 1DGSA 4CS3A 3LSUA 1LL4A 4RQFA 4X62B 1FYJA 5CBHA 4TYOA 2HLDG 1PL0A 3HKDB 1NR7A 2IM9A 2UU9B 3TXQA 4Z1VA 1M57C 3GTYX 2FKXA 1E6PA 5K1PA 3Q4HB 1FKHA 3ARPA 1NTMH 3MDYB 3OFNG 3JSNA 2F4VB 3H9VA 3SYQA 5IWAO 3NXSA 4LAVA 3CMAV 1HJXA 3K0DA 5EZYA 3ALFA 3WD0A 1SZXA 4XAKA 1N0JA 3B4SA 3FB5C 4W4LA 4WCEV 3TDBA 2ZNJA 4EFBA 4ZI7B 4TUYA 1D5AA 3JYMA 2RDCA 1AR1B 3CJHB 1Q81W 1KP2A 1QBZA 1HR0B 2FYUH 5JJJB 5EBWC 5DO2A 4EFEA 1HNZB 1NBMG 1GPFA 1FAPA 2QWQB 1IBLB 2G8ZA 1FKAO 4FFKA 3C3SA 3UQ8A 3SYPA 4LC1A 2OTLV 5B1NA 1HNWO 1OZ0A 1ZTEA 2P67A 5DEZA 4UCTA 1N32O 4DV5B 4KFMA 3AS1A 4B3TB 2UUBB 3E8GA 2DSZA 2AWGA 5TISZ 2VQFB 4CBCA 1YI2V 2GTAA 2M2AA 5B1AC 4LF5B 2LW1A 3CRMA 1AR4A 1RM1C 3NR7A 5CBGA 1WN7A 1EQ3A 4UB8Z 1NJIW 1XUQA 4TNSA 3G80A 1Y4MA 4U3JB 4O4IA 2A3CA 1JFFB 4JYCA 4FPPA 4MVMA 1SA0B 2QKCA 2ITKA 3L9DA 1LJYA 3QF7A 3AG1C 5EYPB 1HWYA 1N36O 3CCUV 1E6NA 1SESA 2KG7A 3OTFA 2Q7HA 5LXTB 2Q5ZA 1GOIA 4JTDB 1NQTA 2RUDA 3E2EA 3BCCH 5HBFA 3K5MA 5IYBO 4DRMA 2BTQA 4LFAO 2K8IA 5KA6A 2ZR5A 1VP7A 4RQEA 1VEWA 2LPVA 3G6EV 3I56V 3OEEG 3RM4A 3UO2A 3L74H 3H1JH 4C02B 1JCHB 2CGNA 2PYJA 2L2SA 1M56B 5BR8B 2LJ4A 1EM1A 1PPJH 4NTYA 4XDJA 4YJ2B 5HTGA 3STZC 3ZRWA 3ZMTA 4Q22A 2WLHA 4TWKA 5LA6A 4ABMA 3TETA 5AG2A 4WFAV 1QLNA 1J95A 3ZMUA 2KR7A 4J42A 3ZCCA 2DSVA 1FXKA 2HHHO 3KAGA 3H9RB 4PD4F 1JA8A 2HP8A 3FB8C 1Y6XA 2HEPA 2RQSA 2QWRB 1S77D 5LHGA 3CHCA 3HKDA 4CH6A 2W0XA 3G6BA 3D36A 3Q4HA 2OYQA 3BPZA 4P8XA 3GWKC 1OCRB 1E9LA 1FJGB 4PDLA 3SJAC 1VQOV 3UF8A 1BGYH 4PDMA 2B31A 2ZNIA 2DYSC 4ZI7A 3FYEB 2XP9A 2HG5C 1NKDA 1QLEB 2DQ3A 2PPPA 4D7SA 3CJHA 1VF7A 4OPHA 4Z2KA 1D6OA 2PN0A 2XPBA 2YXLA 1WB0A 4KP4A 3LUOA 3TCZA 3W7SA 1HP8A 2F93B 5KHGA 1YW5A 1HKIA 3CPWU 4BR6A 1BZKA 3APQA 2QDOA 3KZIZ 1IX9A 5J2UB 4OPAA 2F4EA 2P90A 1NTKH 2O57A 1G1XB 1JQ0A 1BKFA 1VF8A 3WD3A 1TVKB 1N0NA 1MABG 1RPRA 3RFRA 4I50B 3CHFA 4EB6B 4DV4B 1SQFA 5KHHA 4YY3B 2CGOA 1AR5A 2QKSA 1VQ5V 4MSWC 4NXNO 2UXNA 1H8EG 2ZT9B 3ABMB 3CEIA 3F5WC 4F6RB 3NI6A 2Y69C 4U3JA 4ML4A 4OGQB 1JFFA 1OCCB 2ZR6A 1FKKA 4X1YB 5JCOC 2XAFA 4FM2A 1SA0A 2A0LA 3ASOB 2Z5UA 3X2QB 4FZ1A 4HAMA 4UXNA 5BXZA 2IBZH 1JJ2U 5EYPA 4I5SA 3ETEA 1J4RA 4GX2A 2HJFC 4JGSA 5LXTA 3PRBA 4Z2IA 4FLVA 3BA9A 2GBOA 2Q7GA 1RSOB 3BVOA 4J4NA 4I4TB 1AILA 5F2VO 3ALGA 2EILB 2ZDIC 1XMOO 3LUTB 1LUVA 4JAUA 3OA5A 1HNWB 1NWUA 1XBLA 4LAYA 2IU3A 3CS5A 1ZUQA 3ETDA 1P7GA 1FFRA 1ZBCA 1N32B 1V54C 4LF8O 2UUAO 4J9YB 4O2BB 4GX1A 5KHKA 1K92A 1Y0OA 3AG4C 4WFHA 3ZHTA 2YXYA 3A8TA 3O5PA 1JCHA 1X6LA 2YIBD 3B8NA 4ZIBA 1DF4A 3TC5A 1ZWIC 4O2AB 4YJ2A 2A79B 3IK8A 5B3SC 2RCVA 4U85A 4MTXA 1K9TA 3UI6A 5JVDB 1K7DA 4X9QA 5D5PA 4DK0A 4Z2WA 3KAHA 2PY5A 1DF5A 3JCUZ 2A9HA 5LYJB 3H1LH 1F4NA 1JR9A 5B5EZ 5KUKA 5HFLA 3CCJV 2ZD9A 2ZQTA 1N36B 4UCRA 4P9OA 4JYSA 1AVMA 4WFFA 4MVOA 1K4DC 4LAWA 3RWRD 3O9OA 4FLWA 4W9QA 3TCUA 1XNRO 1G8MA 2A7WA 2QTOA 2VQEO 1NZ6A 1LG2A 2GSMB 3O5IA 1EN4A 3GU0A 5FNVB 4JI3O 4ODNA 4U7NA 1M4UA 1V55C 4X66O 1Y74B 3OE7G 1SF9A 4LFAB 4GX0A 4L72B 3CH9A 2CE4A 1NU1H 3DTUB 1Q86W 1ZL1A 2OT5A 2ZXWC 5GONB 1SQBH 2VN1A 4DR7O 4DWSB 1GUVA 4DR1O 1ENVA 4MNKA 1GM8A 2UXDB 2IH1C 1BE3H 1CTNA 4MTGA 5GTIZ 1VF6A 1XOUA 4BWAA 4QIBA 5GW7A 5J2UA 1PV0A 4H13B 5DITA 3JYCA 1TVKA 3FXYA 4GKKO 2Q7EA 1P5QA 2KE0A 3P30A 4I50A 4WK9A 4DZ3A 4EB6A 2GDSA 5HFMA 1VQ7V 4JFMA 4ODRA 4U7OA 4A5UB 4WF9V 5BY1A 3ETQA 4WKAA 1B06A 1WNOA 3ZHRA 4R50A 4J7JA 4GIVA 3BAAA 3JAWB 2QE7G 4F6RA 4GT1A 2D9FA 3BA8A 3IAYA 4X1YA 2OCHA 5LOVB 1KFWA 1KB9F 3JALB 2R70A 3CP1A 4PJ0Z 3K9AA 2EBOA 2JK5C 3FAPA 1KECA 4H33A 4GYCB 1S3JA 2P7TC 4DR3O 4JI5O 3J80N 3BABA 4JFJA 1RSOA 4XDKA 1NH2B 4I4TA 4JF3A 4QT2A 3EFFK 1QR9A 1Q1CA 1MOFA 3CC4V 1DTOA 1IZ3A 3FY1A 4N19A 1QVFU 3SJBC 4QNHB 4DUZB 3LNMB 1FFQA 3L70H 3SPGA 2QM4A 1SZTA 4JI7B 3B09A 3GB7C 4O2BA 4O4LA 3JARB 4KXRA 1XHXA 2OCCB 2F66C 2JJ1G 2C2AA 1QR8A 4CC6A 3QNEA 3WIJA 4IPXA 2XP7A 3W7TA 3D36C 4LFCB 2XAHA 3K0GA 1OCZC 4DR6B 1Y66A 3IKGA 5JVDA 4ZKIA 4ICGA 2KI3A 4R8CA 4PDRA 5KLVH 1N34O 4IT4A 4B7KA 3PRAA 5LYJA 3GVMA 4BW9A 3FYIB 2DN9A 1AI4A 4X8AA 2R9AA 3VQXA 2MNTA 1H38A 1WB7A 4UVAA 5FLXN 1VQ6V 1M5YA 4PA3A 5LMNB 2DSUA 3J7AU 3G67A 1LG1A 1YJNV 2ZIMA 1PINA 2PV2A 4WFEA 4FK5C 3ODKA 2V7QG 1GN2A 5L3EA 1OHHG 1MNGA 3CHEA 4O4JA 4JV5O 1IX5A 5FNVA 1K4CC 3MHHC 1FKSA 3K04A 1Y74A 4UDMA 1JNTA 2PTMA 3JD1A 1GH6A 2UUAB 2DJVA 1URFA 2DT0A 4Z2LA 3H1HH 1HKMA 4X20B 1RP3B 5GONA 3RT3C 4IYHA 5C8YB 1W1YA 5DEDA 3IC7A 4DWSA 2O9OA 3ZMSA 3APOA 3ETGA 4JFKA 4FLYA 3JAKB 1H2KA 1XQ8A 5E1AC 3FB6C 4B3MO 2X6CA 4E2LA 1LNQA 2B1GA 4RAIA 2Y0PA 3E35A 2EIJB 3G71V 1UJWB 4UCSA 3O5OA 1PNLA 3IHZA 2WWWA 1UR9A 3RYFB 2DQ0A 4MT8A 1CP9A 5LA6B 3UT5B 4WKHA 4NVPA 4FM1A 4LF4B 2WLYA 2V1DA 5L3DA 2KGJA 4WFBV 4MVSA 3JAWA 2JGDB 3ZMVA 2UXBO 1QVGU 1XNRB 1UPGA 1YITV 2L6LA 4K8ZA 2ZQVA 2Q0OC 4HARA 2AHYA 3W7UA 1IBKO 2MLYA 3CYOA 1YHQV 2QWOB 2JGUA 1AROP 3LDCA 5LOVA 1E1QG 1H2LA 4JI3B 2FAPA 3PR9A 3JALA 3WQWA 4X66B 4QZVB 2CTPA 4PI0A 4JI4O 3CX5F 1YXBA 1Y67A 3RFWA 1N8RW 1M56C 2DW4A 4P8UA 3O5LA 5JQGB 1VQMV 3T1YB 5KA5A 2BE3A 2XAJA 4C7UA 3B40A 3F7VC 4DR1B 2F23A 1ZBWA 2ETNA 4N21A 4FLTA 1Y76B 4ZBMA 4NZCA 3C3TA 1Q3EA 4J80A 3PA7A 3OUSA 4LF7B 1NTZH 4BIOA 1GN4A 2CTQA 2P5OA 3JARA 1U96A 4XBFA 1E15A 3IKDA 4DYLA 2AGAA 1V9PA 2LO1A 1ZBKA 1YIJV 1D7HA 4ZPVR 4DV3O 1VIBA 2RMKB 4I55B 4DV1O 3KKYA 3MAQA 3EIPA 3DC6A 3S3WA 1XREA 1E6RA 3O5RA 1D2KA 1OCRC 4L3NA 5I98A 2ESCA 1F23A 3SPCA 1WP8A 2DYRB 4JI6O 2YBTA 2Q67A 3CRCA 3CXCU 1Z5VA 1WP7A 4OX9O 1QLEC 4G27B 3KG2A 3UKMA 3ZN1A 2JZVA 2BCCH 3RVZA 1KT0A 3HPLC 4JASA 4DR4O 2ZE7A 2E5LO 3UI4A 1H2NA 3EVKA 4JI5B 4KL1A 1R3LC 1XNQO 1O9GA 2DG3A 3CSXA 1VF6C 4MVUA 4UCOA 1I08A 5L3FA 1P4RA 1OCOB 3AG2B 2XT9A 3K59A 5EIBC 1WPBA 1YZBA 4X65O 4TX0A 1YTFD 1NS1A 3B7XA 5J9PC 1UR8A 4FJCC 4X89A 2AXTZ 1E44A 4ODKA 2D3OW 3W7XA 1IURA 3KAIA 4AILC 5CB4B 4J9ZB 2FKEA 4X20A 5H6QA 2YUAA 5C8YA 1EHNA 2OTJV 1I5YA 5JH7B 3CD6V 5LHHA 3ABMC 1PKXA 3JAKA 4W9OA 1QHTA 1W0KG 1QPLA 2RUQA 1OCCC 3PJSK 3W4RA 2FL4A 3ASOC 4HZ3A 1D7IA 2QR4A 5HWCA 4UV9A 4AQYO 4HBOA 1N34B 2WK2A 2NR5A 1W1TA 3RYFA 4K8XA 3CMEV 1EIBA 2AZ0A 3UT5A 3KCEA 2ITDC 2ZINA 4DV7O 1M1KW 1BL8A 4LFBO 4ODLA 5HKGA 1U79A 2F21A 3O65A 2EX3A 3MD0A 4RUFA 3ARQA 5KAFZ 4LH6A 3SJQC 5L3BA 2Q8VA 5LGTA 3WG7B 3BMBA 2EILC 1HDJA 1VQ8V 2JGDA 2RURA 2YSUB 4DW1A 2WAMA 4MW8A 4DH0A 1L0LH 1U97A 2HVJC 2WSSG 1XMQO 4JV5B 4G28B 5B1OA 2P4VA 4MVZA 3RYHB 3OAAG 1JNSA 3OMAB 4MW3A 4GLXA 4IHJB 3TK1A 4JI1O 4PELA 4BF8A 2WA4A 1P7BA 4TW8A 1AI7A 2Z3YA 5JQGA 3U10A 2A3BA 4J7KA 3N27A 3E8FA 3KACA 3RYIB 2Y0IA 4O4HB 4K0KO 5IJ9B 4MPKA 2KO7A 1US6A 4B3MB 1Y76A 5IT9N 2OIGA 5LMUB 4ZPTR 5B1AB 4B08A 1E6ZA 1KMIZ 2VWJA 5HW7A 3CGNA 4B3SO 1PBKA 2WLKA 4GCZA 2JEXA 1BHBA 1F51A 4KUMA 4LF9B 4JAAA 3OMIB 4DV0O 4I55A 3HKCB 3B2EE 1ZBVA 1ROPA 4JYYA 5HW6A 4YHHB 4MGVA 2DE0X 3PN1A 2CDYA 1W26A 1VQLV 4UB6Z 2A06H 3F5TA 1TUEB 1SKVA 2YDEA 2PZSA 4R0XA 4P9PA 1IBKB 3SYAA 3L75H 3QO5A 1EBOA 3HR0A 2WLNA 3ZN0A 3CCRV 4CZZA 1QPFA 3KABA 4O2TA 3DXRB 4X1IB 1YJ9V 2O92A 4JI4B 2JRIA 1GKFA 2PYLA 3WB0A 4W9PA 1SQQH 4DWSC 1R3IC 1NVPB 2CAZC 2X7RB 5BMVB 1Z5WA 5IWAB 4X64O 2M7WA 1W1VA 4J7ZA 2R72A 4JPRA 3CCQV 3OUFA 3W7WA 1S5LZ 4QE9A 3D8CA 5B1BB 3B8SA 4LAXA 3IC9A 1BL4A 1FD9A 4PA9A 2VS0A 1IBMO 2DOSA 1FKIA 5IY5B 1NWTA 1NH6A 4PTMA 1AJNA 2ZM6O 2G41A 2Q4PA 3E86A 3G6LA 4NNRA 2LFSA 3CCLV 5CA0B 4CC5A 3DGEA 5CB4A 3N2GB 4TV9B 4DV3B 4PDVA 4MAVA 1EN6A 3JD0A 5JH7A 4O4LB 4DV1B 1XI1A 3TXSA 2A3AA 5IYDO 1F7YA 1R3KC 4I9WA 5H5NA 3K06A 4L87A 2P4KA 1XL4A 5ITZB 4BAYA 4CH3A 4JI6B 5EBLC 1F8AB 2LKNA 1W9UA 3L72H 4YXWG 1MMMA 2Q68A 1P49A 3ASNB 1B3QA 2XUMA 4I9QA 2YI9A 2E5LB 3P3NA 2W0FC 4G2PA 2WLZA 1ZX3A 4RO2A 3CHXA 3ZMZA 3JASA 1XNQB 1Q6HA 2PV3A 2DYSB 2OIEA 5CMUA 1N1AA 1ROTA 4RWUA 2B9ZA 3BEHA 5B66Z 2K9PA 4NR1A 3RYHA 3B77A 4IGGA 4X65B 2OCCC 4IHJA 3WU2Z 4O4JB 2YICA 2XTAA 1BCCH 1R1BA 2KSDA 4DUYO 2Q0AA 3AK2A 3RYIA 1KKCA 2BTOA 4FAPA 4O4HA 1FAFA 2Q9LA 4UVBA 3ARRA 3LNNA 2ODMA 4JAVA 1WAWA 5IJ9A 3CGMA 4DZ2A 2PBCA 3L71H 4PA7A 4R7CA 3PRDA 2QWPB 2D2CB 1BHAA 1TAEA 3ABKC 4AQYB 1R6KA 2H3OA 2ZE6A 3O5EA 5B8IC 1A32A 2H94A 1IXMA 3MHSC 1NWRA 3IGAC 3RW0A 3T4ZA 4DV7B 4LFBB 2BOBC 3HKCA 1QQCA 4K35A 1YDXA 4TOIA 4EEQA 4DRHA 2HJDA 2HHHB 2ADQB 2LP7A 1ZL8B 1PNKA 3ABTA 3WH0A 3QVNA 2P22C 3RM8A 3NTPA 3WQVA 4U3FH 3O5JA 4ASUG 2E75B 1Z2GA 3L73H 3JD2A 4UV8A 3OW2U 3KZ7A 2PI5A 5L3GA 1J4IA 4LGXA 2Q73A 1WNSA 4U84A 4D6TH 2M08A 5CA1B 2RJZA 3DXRA 4X1IA 1H2GA 3OGIB 4JI1B 4MSPA 2AZ2A 3KCXA 5BMVA 2CTWA 4JYAO 3ABLB 4NKGB 3S3XA 4ODPA 4IQCA 2UUCO 2MPHA 2R9RB 2VQFO 5EC2C 3SYOA 4DRXB 2P06A 5LHIA 2EIJC 3AG4B 1VQKV 4NTXA 1L0NH 1COWG 4K0KB 2DPEA 3M8AA 5D5QA 4J41A 1WAZA 3T1CA 2F2DA 1ZLZA 2PF4E 2VCDA 1Q8IA 1T5EA 1KBHA 3CCMV 3H1IH 3WL1A 1B6CA 4B3SB 1GN6A 5CA0A 3B9DA 1FXKC 3N2GA 3O5KA 4DRQA 4L8JA 1AJQA 3E83A 4TV9A 2Q6AA 3VQYA 2CUGA 2BOCC 3SYCA 2Q69A 1FFXB 1JNEA 2MF9A 2LGQA 2YS8A 1LL6A 2Y48A 5IYZB 1ZCNA 1PM9A 3HB3B 3CCSV 5J2TB 1E79G 1ZB5A 5JH8A 4DR2O 1WJZA 1OGGA 3VOUA 2JS3A 5ITZA 5EC1C 2EZOA 5J6EA 2LQTA 1YSCA 4NXNB 1VQPV 3RVYA 2YXHA 2ZQUA 3P32A 3RYCB 3ML0A 3LSSA 2R9IA 5FPOA 3IJ4A 1Q82W 1SQGA 4DWSD 3K57A 1BQZA 2X0LA 1L8DA 2OFNA 3CC7V 2Y4UA 4X64B 3JCZA 2JJ2G 2Y78A 5LGNA 2A3EA 3C90A 1LR1A 5HWBA 1I5XA 1EZJA 3OEHG 2WA3A 2EINB 1W0JG 4KR0B 4TSFG 1HNXO 4ITZA 1FKRA 4FMTA 4Z2GA 5LP6B 1IBMB 3DSQA 1BQ0A 3WD2A 3GPKA 3R66A 1XMOB 4P8WA 2ZM6B 3ARZA 2CK3G 3ZRVA 1AI5A 3K58A 3ARXA 5LBQA 3K08A 3RMEA 1S5HC 4LF8B 4NXMO 3D3IA 1OWQA 3F7YC 2K1EA 2Z0AA 2EJRA 4WJXA 2DMXA 2DYRC 5H2FZ 1F40A 2EULA 4HNAB 4FLXA 1J5EO 3SJCC 4HBEA 1YVWA 2ZR2A 3VAWA 4LNUB 1VQNV 4GZRB 4UCUA 4PA4A 4EKWA 3VQWA 1FJGO 3FX7A 5HW8A 3OD4A 5HT1A 3H01A 1NMWA 2NNUA 3AQUA 1GRJA 3R65A 1NH2D 1E1RG 5JCOA 4DO2A 2QA4V 1ZL8A 2G38A 1Q5OA 3AG2C 2GUZB 1D2DA 1VARA 3WD4A 1WA8B 4LR3A 3VBBA 1W9PA 2XAGA 1T11A 2FMLA 1RFYA 1YF2A 4CH5A 5CA1A 3HKBB 4Z2HA 2VQEB 3AROA 1CEZA 3B8MA 1KD1W 3HKEB 1THZA 2KQXA 3AK1A 3G4SV 1YJWV 3QG5A 3E89A 1G6UA 4GGQA 1YTFB 1M9NA 4QGPA 2QWNB 1X6NA 4JI0O 2DT3A 3I55V 4DRXA 3JATB 4B7EA 3NRKA 2NLJC 4K3AA 4J4OA 3RM9A 4AY1A 2N04A 1J6YA 4YIOA 1JMKC 3J81N 1FJDA 4QJFB 2ZQSA 2CH7B 1AB3A 4DR7B 4Q20A 1GM7A 2ZE8A 1XHGA 1VQ4V 4QPKA 4IIJB 1HKJA 4Z1MG 1OCZB 1NWSA 1QU7A 2WLMA 4P2ZA 4H37A 4NTWA 4DXWA 5H6RA 3WG7C 4B3RO 4AI8A 2N05A 5KUMA 1W2BU 4IT6A 5GTHZ 2BSKB 1FFXA 4GKKB 1NSGA 1HJWA 2B5UB 5LGUA 4Z2JA 5IYZA 1VF5B 5JWPA 5J2TA 4X1KB 3UM7A 3ARWA 1K5QA 4J10A 2YIDA 2XP8A 1H2SB 3OOBA 2QF8A 2AHZA 2KB1A 4CS4A 3RN4A 3LDDA 2W6IG 2DG9A 3K79A 5KHIA 1ZK6A 4N23A 4DT4A 1EYMA 1K9MW 3RYCA 1W59A 3KADA 2ZR3A 4S3JA 3K5OA 1FS0G 3H1KH 4NYKA 4TW6A 5IYCO 1JNDA 2QJ1A 4JYAB 1WB8A 2RQ6A 1YATA 5EBMC 2UUCB 1I0HA 4W4KA 2EIKB 1SRYA 4DR3B 5LP6A 4JZGA 4IL6Z 3U0ZA 3LSQA 3N2KB 2E74B 2PPNA 1RD6A 2JS5A 2N87A 1GM9A 1WPXA 2ZE5A 1LL7A 3U11A 1Q6UA 1W1PA 3AG7A 1PNMA 2DG4A 1AJPA 4LWSB 1AP5A 1JVMA 1G4YB 1SETA 4P30A 1GTOA 4GKJO 4X88A 3ZX6A 4YIPA 4FIPC 4ZHQB 1S0VA 1ZU8A 3OM3B 3O5MA 5DIUA 4CS2A 4HNAA 1N4CA 2LW7A 4DR2B 1IVSA 4FM0A 3P3PA 2EIMB 4W5UA 2P6JA 3SPHA 2ZR4A 2RNBA 3AG3B 4LNUA 2JEUA 1FFTB 4DK1A 1H0IA 5BZBA 5CA3A 3A0HZ 5DECA 3TGUH 3TJTA 3X2QC 1MG1A 4BW5A 3CC2V 2ADPA 1M93A 3K03A 2F95B 3DC5A 1SS3A 5IDJA 5B1BC 4FFBB 4LF6O 1M57B 1Q43A 2GUZA 4Q7NA 1WA8A 4MNJA 4WFGA 5IY5C 1TCOC 4JI8O 2QTSA 2XNDG 2UXCO 2UXDO 1SR0A 1HNXB 4DROA 1XILA 2HFEC 4UUJC 2JDIG 3JASB 4YJ3B 4WIWA 2F1MA 3HKBA 3WKZA 3O5GA 2VRZA 5DM6V 1GMGA 3HKEA 5D75A 2KKWA 1YEWA 1QZ2A 3OR7C 2YIAA 3EHBB 3FKSG 4FVMA 4R5EA 4NXMB 5KMGB 2WPDG 2MLZA 3JATA 2AW9A 4JI2O 1AI6A 2EZPA 2Q5AA 3BHPA 3OT7A 2PI4A 2CH7A 1ORQC 3FAVB 4MVQA 2MW2B 1J4HA 1X59A 1J5EB 3WL0A 2ARHA 3JAMN 3GWOA 4IIJA 3BFRA 1VQ9V 3WFVA 2PI6A 3ASNC 1Q6IA 2WLIB 1I94O 2YI8A 2XOKG 2XP4A 1FKDA 3B9AA 5HUAA 1DK1A 3KAFA 5LL6Y 1RM1B 2IJJA 1Q90D 4URIA 5GPRA 2BSKA 3T2MA 4MS2A 2B5UA 3A0RA 4PA6A 3EXAA 1C9HA 4X1KA 4LBEC 1MZFA 3UQIA 2ZQMA 3ARSA 5A2QN 3ARTA 4I7ZB 4DRKA 2AOSA 4S3KA 3WB1A 3JD4A 3AG1B 4JYBA 3OTOO 2FB5A 1KT1A 3O5FA 3ARUA 4DV2O 2UXBB 1GN3A 1HXVA 2QGNA 1BMFG 4DUZO 1S5JA 3E8HA 3EY6A 4G2KA 2QEXV 3ZHSA 4JI7O 3MDSA 2XP3A 4XDLA 4DV6O 3K5NA 3O5QA 3FB7C 4JI0B 2XP6A 1SQXH 2LFRA 3KCYA 3BXWA 1FKFA 1PP9H 1LUWA 3LDEA 1H2MA 4LCUC 4LFCO 3RGBA 3N2KA 4DR6O 3OMNB 1TUBB 4AHCA 1IXBA 2M6YA 4FZ0A 2PPOA 1K5SA 3ZHVA 4MTVA 1K97A 2HKOA 4H0LB 2YEVB 1XDCA 3CB2A 2XP5A 1YCIA 2WLJA 4MTOA 4BIZA 1R3JC 5JJNB 3K3WA 4BIUA 4B3RB 3BY6A 4LWSA 4R6ZA 1JX9A 3E22B 1JVWA 1M5IA 5LMNO 4ODOA 2WM0A 3CRAA 4ZHQA 2XAQA 4JTCB 1OJHA 3T1HO 2X6AA 5IE9A 3JYJA 1IDSA 4JZ2A 3CE2A 1BSMA 1BS3A 2ILMA 3STLC 4QT3A 3JD3A 2IF4A 3ABUA 4MNLA 4TQDA 4MVRA 4IT5A 4KHPO 3M7MX 3ABLC 2IJKA 3IFXA 3CHDA 1S72V 3RGCA 1MSWD 2GTSA 3JXVA 1KC8W 4OX9B 4FFBA 1SQPH 4TV8B 4RUEA 4GUNA 4ZOLB 5FL7G 3OR6C 4DRJA 4DR4B 3WD1A 1FKJA 3UQBA 1NMVA 2DT1A 3WB2A 2WLLB 2LJ2A 3AS2A 3ZRSA 4YJ3A 3CXHF 1XEQA 3FD9A 4Q6GA 2ZIOA 2IW5A 1BT8A 1KP3A 1PD3A 5EIBD 1SQVH 2X6BA 2LGWA 2W6JG 1X4TA 4JTAB 2E76B 5GQBA 3AEIA 1Q7YW 5KMGA 1N33O 4LF4O 5K1XA 5L3CA 1KYOF 1MSDA 1EZVH 1MA1A 4GKJB 1AP6A 3E8BA 1I7FA 1L1PA 4JFIA 4WBNB 4UVCA 3ZIAG 3AS3A 4MTFA 3ZHUA 1D7JA 3B9EA 3FAVA 3RBZA 3M99B 4U86A 3D3QA 4DR5O
chains in the Genus database with same CATH topology
4L3NA 5I98A 2ESCA 2RUCA 1YW5A 3WD2A 3GPKA 1HKIA 4P8WA 2YBTA 3ARZA 3CZ8A 2F4EA 4ODQA 3ARXA 1BKFA 1VF8A 2JZVA 3RMEA 3WD3A 1KT0A 1OWQA 3UI4A 2IUZA 3CHFA 4WJXA 2FDMA 2DG3A 1F40A 4HBEA 2DSWA 1LQ0A 3VAWA 3UQAA 4TX0A 3NI6A 4ML4A 3B7XA 2ZR6A 1FKKA 1UR8A 5HW8A 5HT1A 1NMWA 3AQUA 4ODKA 3KAIA 4DRPA 1HKKA 2FKEA 1EHNA 1J4RA 3WD4A 3PRBA 4Z2IA 4W9OA 1W9PA 4J4NA 1FKTA 1QPLA 2RUQA 1TFVA 1T11A 3W4RA 1SYTA 2RSEA 3ALGA 2LGOA 1R9HA 4Z2HA 1D7IA 1H0GA 5HWCA 2M1IA 3AROA 4HBOA 3OA5A 2WK2A 1W1TA 1NWUA 4LAYA 2YBUA 5GPGA 4DRNA 4FN2A 1EIBA 1ZBCA 1FFRA 3KCEA 4DIPA 4ODLA 5HKGA 1U79A 4GGQA 4KQZA 2F21A 1Y0OA 1X6NA 2DT3A 3ARQA 4G50A 1A7XA 4J4OA 3NRKA 4AY1A 3RM9A 2XPAA 1J6YA 3O5PA 1FKGA 1HJVA 2RURA 1X6LA 1FJDA 2ZQSA 4DH0A 3TC5A 3IK8A 1XHGA 4U85A 1K9TA 3UI6A 4ZS6A 1HKJA 1JNSA 1NWSA 3QOKA 3I6CA 3KAHA 4JFLA 4BF8A 4IT6A 1NSGA 4IQ2A 1HJWA 4TW8A 4Z2JA 4NSBA 2ZQTA 2A3BA 3KACA 3ARWA 4JYSA 3G6MA 4LAWA 2XP8A 3OOBA 4MPKA 2KO7A 4W9QA 4ZPWR 2QF8A 4ZPTR 2DG9A 1ZK6A 4DT4A 1E6ZA 1LG2A 1EYMA 3O5IA 1W9VA 3KADA 3O5DA 4ODNA 5HW7A 3CGNA 1ITXA 1PBKA 4S3JA 5BXJA 5DIVA 4MNMA 2MLXA 4TW7A 4TW6A 1JNDA 4DRIA 5DF0A 1ROUA 1YATA 4L72B 1ZBVA 3CH9A 5HW6A 1ZL1A 4MGVA 1W26A 2VN1A 4DWSB 1GUVA 4MNKA 3AS0A 4P8VA 4R0XA 2PPNA 1FKBA 1CTNA 1RD6A 1O6IA 4QIBA 2N87A 2OLHA 1LL7A 1QPFA 3UI5A 3KABA 5DITA 4O2TA 1Q6UA 1W1PA 2O92A 3FXYA 2DG4A 1XRVA 4W9PA 1P5QA 2KE0A 4DWSC 4WK9A 4DZ3A 4JFMA 1W1VA 4ODRA 1EDQA 1ZU8A 3O5MA 5DIUA 2UZ5A 4WKAA 1WNOA 3B8SA 4LAXA 4GIVA 4W5UA 1BL4A 1FD9A 1FKIA 4ODMA 2ZR4A 2KFWA 4WKFA 1NWTA 1NH6A 1H0IA 4PTMA 2D9FA 2G41A 1FKLA 3G6LA 1KFWA 4NNRA 2PV1A 4MAVA 3FAPA 2A3AA 4Q7NA 4MNJA 1OGBA 1TCOC 4JFJA 3ARVA 4QT2A 1SR0A 2DT2A 3ARYA 4DROA 4WIWA 1LL4A 1Q1CA 4TYOA 3WKZA 3FY1A 3O5GA 4N19A 1F8AB 5D75A 2LKNA 1FFQA 1E6PA 1FKHA 3ARPA 1QZ2A 1W9UA 3B09A 3MDYB 4R5EA 4Z2GA 4LAVA 2MLZA 1HJXA 3ALFA 3WD0A 4XAKA 4G2PA 2WLZA 3TDBA 2Q5AA 3WIJA 1Q6HA 4IPXA 3JYMA 2PV3A 2XP7A 5DO2A 1N1AA 1ROTA 1J4HA 1GPFA 3WL0A 1FAPA 2G8ZA 3IKGA 2KI3A 2PI6A 1Q6IA 2XP4A 1FKDA 3B9AA 5HUAA 4IT4A 3KAFA 5DEZA 3PRAA 4URIA 5GPRA 3AS1A 2MNTA 1C9HA 1M5YA 2DSZA 2AWGA 2DSUA 4FAPA 3UQIA 3ARSA 3ARRA 3ARTA 1WAWA 1LG1A 1PINA 2PV2A 3CGMA 4DRKA 4DZ2A 2PBCA 2AOSA 2M2AA 3ODKA 4S3KA 3PRDA 1KT1A 3O5FA 3ARUA 1HXVA 3CHEA 1EQ3A 1IX5A 3EY6A 3O5EA 5B8IC 1FKSA 4TNSA 1NWRA 1JNTA 2A3CA 2XP3A 2ITKA 2DT0A 3O5QA 2XP6A 1LJYA 4Z2LA 4DRHA 1HKMA 3BXWA 1E6NA 1FKFA 1W1YA 3WH0A 4DWSA 3RM8A 3NTPA 3WQVA 2O9OA 4JFKA 3O5JA 4MTVA 2PPOA 1GOIA 3KZ7A 1J4IA 4LGXA 2RUDA 4U84A 5HBFA 2M08A 3O5OA 2XP5A 4DRMA 3IHZA 1UR9A 4MSPA 1JVWA 2K8IA 4WKHA 2ZR5A 4ODOA 2WM0A 4ODPA 2WLYA 4IQCA 2MPHA 2LPVA 3RM4A 2KGJA 3JYJA 2DPEA 4C02B 2L2SA 2F2DA 4QT3A 2ZQVA 2VCDA 2IF4A 4HARA 4MNLA 2LJ4A 2MLYA 5HTGA 4Q22A 3WL1A 1B6CA 2FAPA 3PR9A 3CHDA 3RGCA 3B9DA 3WQWA 4QZVB 3O5KA 3JXVA 4DRQA 2KR7A 2DSVA 3KAGA 3RFWA 3H9RB 4DRJA 2MF9A 1JNEA 3WD1A 1FKJA 4P8UA 3UQBA 1NMVA 1LL6A 3O5LA 2DT1A 1ZCNA 1ZB5A 5JH8A 3AS2A 1OGGA 2RQSA 5J6EA 1ZBWA 3CHCA 4NZCA 3PA7A 2ZQUA 4P8XA 1E9LA 5GQBA 1E15A 3IKDA 3UF8A 4DWSD 1ZBKA 1D7HA 2B31A 4ZPVR 2OFNA 2Y78A 2XP9A 1L1PA 4JFIA 2A3EA 5HWBA 2PPPA 3AS3A 1D7JA 3B9EA 4Z2KA 1D6OA 1E6RA 3O5RA 4KR0B 2XPBA 4U86A 4ITZA 1D2KA 1FKRA 1WB0A 3TCZA 3LUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I98 A;  3WH0 A;  2RUC A;  1YW5 A;  3NTP A;  3FAP A;  3I6C A;  3KAH A;  3GPK A;  4JFK A;  3O5J A;  4JFL A;  4BF8 A;  2PPO A;  1NSG A;  1TCO C;  4IQ2 A;  4JFJ A;  3KZ7 A;  3LUO A;  2F4E A;  4TW8 A;  4ODQ A;  1J4I A;  4QT2 A;  2RUD A;  4U84 A;  2M08 A;  1BKF A;  2JZV A;  4DRO A;  2ZQT A;  3O5O A;  2XP5 A;  1KT0 A;  3KAC A;  4JYS A;  4DRM A;  3IHZ A;  1Q1C A;  4LAW A;  4TYO A;  3O5G A;  4N19 A;  3UI4 A;  4IPX A;  2XP8 A;  4MSP A;  3OOB A;  4W9Q A;  2KO7 A;  1JVW A;  1F8A B;  2K8I A;  2LKN A;  5D75 A;  2ZR5 A;  1FKH A;  2DG3 A;  4ODO A;  1F40 A;  4ODP A;  1QZ2 A;  4IQC A;  2DG9 A;  1ZK6 A;  2MPH A;  2LPV A;  4DT4 A;  3B09 A;  3MDY B;  1EYM A;  3O5I A;  2KGJ A;  3KAD A;  3O5D A;  4ODN A;  4LAV A;  2MLZ A;  3CGN A;  5HW7 A;  3JYJ A;  1PBK A;  5BXJ A;  4G2P A;  4C02 B;  5DIV A;  3VAW A;  3UQA A;  4TX0 A;  3TDB A;  2L2S A;  2F2D A;  2MLX A;  2Q5A A;  3NI6 A;  4QT3 A;  4TW7 A;  4TW6 A;  2ZQV A;  4DRI A;  2VCD A;  1Q6H A;  2IF4 A;  3B7X A;  2ZR6 A;  1ROU A;  1FKK A;  1YAT A;  2LJ4 A;  2PV3 A;  2XP7 A;  2MLY A;  3JYM A;  5HT1 A;  5HW8 A;  1NMW A;  1N1A A;  1ROT A;  4ODK A;  5HTG A;  1J4H A;  1FAP A;  5HW6 A;  3KAI A;  1B6C A;  2FAP A;  4MGV A;  4DRP A;  3IKG A;  2FKE A;  3RGC A;  1W26 A;  2VN1 A;  3O5K A;  3JXV A;  2KI3 A;  4DRQ A;  1J4R A;  2KR7 A;  1Q6I A;  2XP4 A;  4R0X A;  1FKD A;  2PPN A;  1FKB A;  3KAG A;  3PRB A;  5HUA A;  3RFW A;  3H9R B;  4W9O A;  3KAF A;  4QIB A;  2MF9 A;  2N87 A;  4DRJ A;  3UQB A;  1FKJ A;  4J4N A;  1FKT A;  1NMV A;  1QPL A;  2RUQ A;  3O5L A;  1T11 A;  1ZCN A;  1QPF A;  3UI5 A;  3KAB A;  2RSE A;  5DIT A;  4O2T A;  2LGO A;  2MNT A;  1Q6U A;  1C9H A;  1R9H A;  1M5Y A;  1D7I A;  2AWG A;  5HWC A;  2M1I A;  4FAP A;  3UQI A;  2RQS A;  2DG4 A;  5J6E A;  4W9P A;  1P5Q A;  2KE0 A;  1PIN A;  2PV2 A;  3CGM A;  4LAY A;  4FN2 A;  5GPG A;  4DRK A;  2PBC A;  4DRN A;  2M2A A;  3KCE A;  3ODK A;  4JFM A;  4DIP A;  4DZ3 A;  4ODR A;  4ODL A;  3O5M A;  5HKG A;  3PA7 A;  1U79 A;  3PRD A;  2ZQU A;  4GGQ A;  1KT1 A;  2UZ5 A;  3O5F A;  2F21 A;  5DIU A;  1Y0O A;  1HXV A;  1EQ3 A;  4G50 A;  1A7X A;  4J4O A;  4LAX A;  3NRK A;  4GIV A;  3IKD A;  1BL4 A;  3EY6 A;  2XPA A;  1FD9 A;  1FKI A;  3O5E A;  3UF8 A;  4ODM A;  5B8I C;  1J6Y A;  1FKS A;  2ZR4 A;  1FKG A;  3O5P A;  4TNS A;  1D7H A;  2RUR A;  2KFW A;  1JNT A;  2OFN A;  1FJD A;  2XP3 A;  2Y78 A;  2ZQS A;  4DH0 A;  2XP9 A;  2D9F A;  1L1P A;  4JFI A;  3TC5 A;  5HWB A;  2PPP A;  1D7J A;  2ITK A;  3O5Q A;  1FKL A;  2XP6 A;  3IK8 A;  1D6O A;  4NNR A;  4DRH A;  4DZ2 A;  3O5R A;  4U85 A;  2PV1 A;  2XPB A;  4U86 A;  4ITZ A;  1FKR A;  3UI6 A;  3TCZ A;  1FKF A;  1JNS A; 
#chains in the Genus database with same CATH topology
 2GHY A;  2A3Q A;  5IJ0 B;  4X62 O;  2RUC A;  2WLI A;  2IH3 C;  2YIB A;  4I0X B;  1R6N A;  1NVP D;  2UU9 O;  1FXV A;  3K9S A;  3CZ8 A;  2H8P C;  2HR3 A;  4ODQ A;  2L35 A;  5E79 Z;  2F4V O;  2EIN C;  4LF6 B;  1TGO A;  1ZAU A;  2Y69 B;  1B04 A;  5LP6 C;  2IUZ A;  3T1Y O;  1QCE A;  5KAI Z;  2FDM A;  4JI8 B;  2ZCE A;  3QO8 A;  2UXC B;  1HR0 O;  1TA8 A;  1NR1 A;  2JIZ G;  4FLU A;  1HNZ O;  1HW7 A;  1IBL O;  2DWE C;  4H44 B;  5KX5 B;  2DSW A;  1EFR G;  1LQ0 A;  3QO7 A;  5C93 A;  1XMQ B;  3UQA A;  1SC5 B;  1B6Q A;  1KU9 A;  4LF7 O;  1M90 W;  4HYO A;  3FFQ A;  1NT2 B;  1RPO A;  4GX5 A;  1NI8 A;  4DV5 O;  4PV1 B;  4DRP A;  1HKK A;  5A9G A;  4B3T O;  2UUB O;  1R73 A;  4JI2 B;  4TT3 G;  5KHJ A;  3ICX A;  4FLZ A;  1K3E A;  1V54 B;  2VWK A;  2RN9 A;  1TUB A;  1H8H G;  4LF5 O;  1FKT A;  2Y4T A;  1TFV A;  1K8A W;  2N74 A;  1SYT A;  1PL4 A;  1JJO A;  2QKA A;  4D7T A;  2RSE A;  2LGO A;  2YEV A;  1R9H A;  1H0G A;  2M1I A;  2IJI A;  1I94 B;  5GPG A;  2YBU A;  4DRN A;  4FN2 A;  4NB5 A;  3E22 A;  4DIP A;  3A0B Z;  4F4L A;  2HVK C;  5B3S B;  1K33 A;  2ATK C;  2ITC C;  3ZHQ A;  5H9C A;  4KQZ A;  4DV0 B;  1SER A;  4G50 A;  1A7X A;  5EZY B;  2UXX A;  3CRQ A;  1CXZ B;  2XPA A;  1UFI A;  4HBN A;  1FKG A;  1HJV A;  3CWB H;  1JOY A;  4TUY B;  3UO3 A;  1GK9 A;  3ZRX A;  3QTC A;  3OTO B;  2EJ7 A;  4DV2 B;  1GO3 F;  3CCV V;  1S76 D;  5CBF A;  1L1F A;  4ZS6 A;  3SR2 C;  1OV9 A;  1D5N A;  3VQV A;  1QNM A;  3QOK A;  4QIW F;  3I6C A;  4E4E A;  4TV8 A;  4JFL A;  4ZOL A;  2IJH A;  1WLE A;  4DV6 B;  2XHB A;  4IQ2 A;  4IYI A;  1P84 F;  2YC0 A;  4NSB A;  1V55 B;  3SDL A;  2WLL A;  1FPO A;  3G6M A;  5FPR A;  1DLB A;  3CRR A;  4O2A A;  4PHZ A;  2NN4 A;  4ZPW R;  4QPJ A;  2FTK A;  5BR8 O;  3I5D A;  1XL6 A;  2ZXW B;  1ZSP A;  1W9V A;  1KQS U;  3O5D A;  3SPI A;  1ITX A;  3ABK B;  1GAX A;  5BXJ A;  5DIV A;  1JPX A;  4O4I B;  4MNM A;  2MLX A;  4TW7 A;  2V4D A;  4DRI A;  2PUS A;  4CH4 A;  5DF0 A;  4LP8 A;  1ROU A;  4WBN A;  3AK3 A;  2MK3 A;  3T1H B;  4TQF A;  1O9H A;  1MZE A;  3OGC C;  2E3C A;  2KG7 B;  3JSL A;  5IJ0 A;  3AS0 A;  4P8V A;  1XHZ A;  1FKB A;  4I0X A;  1O6I A;  3ZJZ A;  3K5L A;  2DWD C;  2GV9 A;  4KHP B;  2OLH A;  2B1I A;  3ZS8 C;  3UI5 A;  2EIK C;  1KKD A;  1XRV A;  1EN5 A;  2BTQ B;  2JVD A;  3CCE V;  5EK0 A;  4DW0 A;  4LH7 A;  1K73 W;  1EDQ A;  3SGI A;  2IU0 A;  2XAS A;  2UZ5 A;  1OCO C;  5DN6 G;  2QSA A;  4J11 A;  5KX5 A;  5LMU O;  4ODM A;  3T4D A;  2KFW A;  4WKF A;  2ZKO A;  3ZED A;  4UCV A;  2QM7 A;  4PI2 A;  2F43 G;  1F4M A;  1R6T A;  2OWO A;  2CTR A;  3ZRW B;  4QE7 A;  1KUQ A;  1FKL A;  2ZDI A;  4LF9 O;  3UCS C;  2PV1 A;  1N33 B;  1FXH A;  3ZBH A;  3BRC A;  2QM8 A;  2EIM C;  4F6E A;  2PGG A;  5CN0 A;  1FXK B;  4OXS A;  4DUY B;  1CPY A;  5JJE B;  3AG3 C;  4YHH O;  1OGB A;  4DV4 O;  1VMG A;  3SPJ A;  3ARV A;  4YY3 O;  3THO A;  4UFZ A;  3A2F A;  1K34 A;  2DT2 A;  3ARY A;  4DR5 B;  1DGS A;  4CS3 A;  3LSU A;  1LL4 A;  4RQF A;  4X62 B;  1FYJ A;  5CBH A;  4TYO A;  2HLD G;  1PL0 A;  3HKD B;  1NR7 A;  2IM9 A;  2UU9 B;  3TXQ A;  4Z1V A;  1M57 C;  3GTY X;  2FKX A;  1E6P A;  5K1P A;  3Q4H B;  1FKH A;  3ARP A;  1NTM H;  3MDY B;  3OFN G;  3JSN A;  2F4V B;  3H9V A;  3SYQ A;  5IWA O;  3NXS A;  4LAV A;  3CMA V;  1HJX A;  3K0D A;  5EZY A;  3ALF A;  3WD0 A;  1SZX A;  4XAK A;  1N0J A;  3B4S A;  3FB5 C;  4W4L A;  4WCE V;  3TDB A;  2ZNJ A;  4EFB A;  4ZI7 B;  4TUY A;  1D5A A;  3JYM A;  2RDC A;  1AR1 B;  3CJH B;  1Q81 W;  1KP2 A;  1QBZ A;  1HR0 B;  2FYU H;  5JJJ B;  5EBW C;  5DO2 A;  4EFE A;  1HNZ B;  1NBM G;  1GPF A;  1FAP A;  2QWQ B;  1IBL B;  2G8Z A;  1FKA O;  4FFK A;  3C3S A;  3UQ8 A;  3SYP A;  4LC1 A;  2OTL V;  5B1N A;  1HNW O;  1OZ0 A;  1ZTE A;  2P67 A;  5DEZ A;  4UCT A;  1N32 O;  4DV5 B;  4KFM A;  3AS1 A;  4B3T B;  2UUB B;  3E8G A;  2DSZ A;  2AWG A;  5TIS Z;  2VQF B;  4CBC A;  1YI2 V;  2GTA A;  2M2A A;  5B1A C;  4LF5 B;  2LW1 A;  3CRM A;  1AR4 A;  1RM1 C;  3NR7 A;  5CBG A;  1WN7 A;  1EQ3 A;  4UB8 Z;  1NJI W;  1XUQ A;  4TNS A;  3G80 A;  1Y4M A;  4U3J B;  4O4I A;  2A3C A;  1JFF B;  4JYC A;  4FPP A;  4MVM A;  1SA0 B;  2QKC A;  2ITK A;  3L9D A;  1LJY A;  3QF7 A;  3AG1 C;  5EYP B;  1HWY A;  1N36 O;  3CCU V;  1E6N A;  1SES A;  2KG7 A;  3OTF A;  2Q7H A;  5LXT B;  2Q5Z A;  1GOI A;  4JTD B;  1NQT A;  2RUD A;  3E2E A;  3BCC H;  5HBF A;  3K5M A;  5IYB O;  4DRM A;  2BTQ A;  4LFA O;  2K8I A;  5KA6 A;  2ZR5 A;  1VP7 A;  4RQE A;  1VEW A;  2LPV A;  3G6E V;  3I56 V;  3OEE G;  3RM4 A;  3UO2 A;  3L74 H;  3H1J H;  4C02 B;  1JCH B;  2CGN A;  2PYJ A;  2L2S A;  1M56 B;  5BR8 B;  2LJ4 A;  1EM1 A;  1PPJ H;  4NTY A;  4XDJ A;  4YJ2 B;  5HTG A;  3STZ C;  3ZRW A;  3ZMT A;  4Q22 A;  2WLH A;  4TWK A;  5LA6 A;  4ABM A;  3TET A;  5AG2 A;  4WFA V;  1QLN A;  1J95 A;  3ZMU A;  2KR7 A;  4J42 A;  3ZCC A;  2DSV A;  1FXK A;  2HHH O;  3KAG A;  3H9R B;  4PD4 F;  1JA8 A;  2HP8 A;  3FB8 C;  1Y6X A;  2HEP A;  2RQS A;  2QWR B;  1S77 D;  5LHG A;  3CHC A;  3HKD A;  4CH6 A;  2W0X A;  3G6B A;  3D36 A;  3Q4H A;  2OYQ A;  3BPZ A;  4P8X A;  3GWK C;  1OCR B;  1E9L A;  1FJG B;  4PDL A;  3SJA C;  1VQO V;  3UF8 A;  1BGY H;  4PDM A;  2B31 A;  2ZNI A;  2DYS C;  4ZI7 A;  3FYE B;  2XP9 A;  2HG5 C;  1NKD A;  1QLE B;  2DQ3 A;  2PPP A;  4D7S A;  3CJH A;  1VF7 A;  4OPH A;  4Z2K A;  1D6O A;  2PN0 A;  2XPB A;  2YXL A;  1WB0 A;  4KP4 A;  3LUO A;  3TCZ A;  3W7S A;  1HP8 A;  2F93 B;  5KHG A;  1YW5 A;  1HKI A;  3CPW U;  4BR6 A;  1BZK A;  3APQ A;  2QDO A;  3KZI Z;  1IX9 A;  5J2U B;  4OPA A;  2F4E A;  2P90 A;  1NTK H;  2O57 A;  1G1X B;  1JQ0 A;  1BKF A;  1VF8 A;  3WD3 A;  1TVK B;  1N0N A;  1MAB G;  1RPR A;  3RFR A;  4I50 B;  3CHF A;  4EB6 B;  4DV4 B;  1SQF A;  5KHH A;  4YY3 B;  2CGO A;  1AR5 A;  2QKS A;  1VQ5 V;  4MSW C;  4NXN O;  2UXN A;  1H8E G;  2ZT9 B;  3ABM B;  3CEI A;  3F5W C;  4F6R B;  3NI6 A;  2Y69 C;  4U3J A;  4ML4 A;  4OGQ B;  1JFF A;  1OCC B;  2ZR6 A;  1FKK A;  4X1Y B;  5JCO C;  2XAF A;  4FM2 A;  1SA0 A;  2A0L A;  3ASO B;  2Z5U A;  3X2Q B;  4FZ1 A;  4HAM A;  4UXN A;  5BXZ A;  2IBZ H;  1JJ2 U;  5EYP A;  4I5S A;  3ETE A;  1J4R A;  4GX2 A;  2HJF C;  4JGS A;  5LXT A;  3PRB A;  4Z2I A;  4FLV A;  3BA9 A;  2GBO A;  2Q7G A;  1RSO B;  3BVO A;  4J4N A;  4I4T B;  1AIL A;  5F2V O;  3ALG A;  2EIL B;  2ZDI C;  1XMO O;  3LUT B;  1LUV A;  4JAU A;  3OA5 A;  1HNW B;  1NWU A;  1XBL A;  4LAY A;  2IU3 A;  3CS5 A;  1ZUQ A;  3ETD A;  1P7G A;  1FFR A;  1ZBC A;  1N32 B;  1V54 C;  4LF8 O;  2UUA O;  4J9Y B;  4O2B B;  4GX1 A;  5KHK A;  1K92 A;  1Y0O A;  3AG4 C;  4WFH A;  3ZHT A;  2YXY A;  3A8T A;  3O5P A;  1JCH A;  1X6L A;  2YIB D;  3B8N A;  4ZIB A;  1DF4 A;  3TC5 A;  1ZWI C;  4O2A B;  4YJ2 A;  2A79 B;  3IK8 A;  5B3S C;  2RCV A;  4U85 A;  4MTX A;  1K9T A;  3UI6 A;  5JVD B;  1K7D A;  4X9Q A;  5D5P A;  4DK0 A;  4Z2W A;  3KAH A;  2PY5 A;  1DF5 A;  3JCU Z;  2A9H A;  5LYJ B;  3H1L H;  1F4N A;  1JR9 A;  5B5E Z;  5KUK A;  5HFL A;  3CCJ V;  2ZD9 A;  2ZQT A;  1N36 B;  4UCR A;  4P9O A;  4JYS A;  1AVM A;  4WFF A;  4MVO A;  1K4D C;  4LAW A;  3RWR D;  3O9O A;  4FLW A;  4W9Q A;  3TCU A;  1XNR O;  1G8M A;  2A7W A;  2QTO A;  2VQE O;  1NZ6 A;  1LG2 A;  2GSM B;  3O5I A;  1EN4 A;  3GU0 A;  5FNV B;  4JI3 O;  4ODN A;  4U7N A;  1M4U A;  1V55 C;  4X66 O;  1Y74 B;  3OE7 G;  1SF9 A;  4LFA B;  4GX0 A;  4L72 B;  3CH9 A;  2CE4 A;  1NU1 H;  3DTU B;  1Q86 W;  1ZL1 A;  2OT5 A;  2ZXW C;  5GON B;  1SQB H;  2VN1 A;  4DR7 O;  4DWS B;  1GUV A;  4DR1 O;  1ENV A;  4MNK A;  1GM8 A;  2UXD B;  2IH1 C;  1BE3 H;  1CTN A;  4MTG A;  5GTI Z;  1VF6 A;  1XOU A;  4BWA A;  4QIB A;  5GW7 A;  5J2U A;  1PV0 A;  4H13 B;  5DIT A;  3JYC A;  1TVK A;  3FXY A;  4GKK O;  2Q7E A;  1P5Q A;  2KE0 A;  3P30 A;  4I50 A;  4WK9 A;  4DZ3 A;  4EB6 A;  2GDS A;  5HFM A;  1VQ7 V;  4JFM A;  4ODR A;  4U7O A;  4A5U B;  4WF9 V;  5BY1 A;  3ETQ A;  4WKA A;  1B06 A;  1WNO A;  3ZHR A;  4R50 A;  4J7J A;  4GIV A;  3BAA A;  3JAW B;  2QE7 G;  4F6R A;  4GT1 A;  2D9F A;  3BA8 A;  3IAY A;  4X1Y A;  2OCH A;  5LOV B;  1KFW A;  1KB9 F;  3JAL B;  2R70 A;  3CP1 A;  4PJ0 Z;  3K9A A;  2EBO A;  2JK5 C;  3FAP A;  1KEC A;  4H33 A;  4GYC B;  1S3J A;  2P7T C;  4DR3 O;  4JI5 O;  3J80 N;  3BAB A;  4JFJ A;  1RSO A;  4XDK A;  1NH2 B;  4I4T A;  4JF3 A;  4QT2 A;  3EFF K;  1QR9 A;  1Q1C A;  1MOF A;  3CC4 V;  1DTO A;  1IZ3 A;  3FY1 A;  4N19 A;  1QVF U;  3SJB C;  4QNH B;  4DUZ B;  3LNM B;  1FFQ A;  3L70 H;  3SPG A;  2QM4 A;  1SZT A;  4JI7 B;  3B09 A;  3GB7 C;  4O2B A;  4O4L A;  3JAR B;  4KXR A;  1XHX A;  2OCC B;  2F66 C;  2JJ1 G;  2C2A A;  1QR8 A;  4CC6 A;  3QNE A;  3WIJ A;  4IPX A;  2XP7 A;  3W7T A;  3D36 C;  4LFC B;  2XAH A;  3K0G A;  1OCZ C;  4DR6 B;  1Y66 A;  3IKG A;  5JVD A;  4ZKI A;  4ICG A;  2KI3 A;  4R8C A;  4PDR A;  5KLV H;  1N34 O;  4IT4 A;  4B7K A;  3PRA A;  5LYJ A;  3GVM A;  4BW9 A;  3FYI B;  2DN9 A;  1AI4 A;  4X8A A;  2R9A A;  3VQX A;  2MNT A;  1H38 A;  1WB7 A;  4UVA A;  5FLX N;  1VQ6 V;  1M5Y A;  4PA3 A;  5LMN B;  2DSU A;  3J7A U;  3G67 A;  1LG1 A;  1YJN V;  2ZIM A;  1PIN A;  2PV2 A;  4WFE A;  4FK5 C;  3ODK A;  2V7Q G;  1GN2 A;  5L3E A;  1OHH G;  1MNG A;  3CHE A;  4O4J A;  4JV5 O;  1IX5 A;  5FNV A;  1K4C C;  3MHH C;  1FKS A;  3K04 A;  1Y74 A;  4UDM A;  1JNT A;  2PTM A;  3JD1 A;  1GH6 A;  2UUA B;  2DJV A;  1URF A;  2DT0 A;  4Z2L A;  3H1H H;  1HKM A;  4X20 B;  1RP3 B;  5GON A;  3RT3 C;  4IYH A;  5C8Y B;  1W1Y A;  5DED A;  3IC7 A;  4DWS A;  2O9O A;  3ZMS A;  3APO A;  3ETG A;  4JFK A;  4FLY A;  3JAK B;  1H2K A;  1XQ8 A;  5E1A C;  3FB6 C;  4B3M O;  2X6C A;  4E2L A;  1LNQ A;  2B1G A;  4RAI A;  2Y0P A;  3E35 A;  2EIJ B;  3G71 V;  1UJW B;  4UCS A;  3O5O A;  1PNL A;  3IHZ A;  2WWW A;  1UR9 A;  3RYF B;  2DQ0 A;  4MT8 A;  1CP9 A;  5LA6 B;  3UT5 B;  4WKH A;  4NVP A;  4FM1 A;  4LF4 B;  2WLY A;  2V1D A;  5L3D A;  2KGJ A;  4WFB V;  4MVS A;  3JAW A;  2JGD B;  3ZMV A;  2UXB O;  1QVG U;  1XNR B;  1UPG A;  1YIT V;  2L6L A;  4K8Z A;  2ZQV A;  2Q0O C;  4HAR A;  2AHY A;  3W7U A;  1IBK O;  2MLY A;  3CYO A;  1YHQ V;  2QWO B;  2JGU A;  1ARO P;  3LDC A;  5LOV A;  1E1Q G;  1H2L A;  4JI3 B;  2FAP A;  3PR9 A;  3JAL A;  3WQW A;  4X66 B;  4QZV B;  2CTP A;  4PI0 A;  4JI4 O;  3CX5 F;  1YXB A;  1Y67 A;  3RFW A;  1N8R W;  1M56 C;  2DW4 A;  4P8U A;  3O5L A;  5JQG B;  1VQM V;  3T1Y B;  5KA5 A;  2BE3 A;  2XAJ A;  4C7U A;  3B40 A;  3F7V C;  4DR1 B;  2F23 A;  1ZBW A;  2ETN A;  4N21 A;  4FLT A;  1Y76 B;  4ZBM A;  4NZC A;  3C3T A;  1Q3E A;  4J80 A;  3PA7 A;  3OUS A;  4LF7 B;  1NTZ H;  4BIO A;  1GN4 A;  2CTQ A;  2P5O A;  3JAR A;  1U96 A;  4XBF A;  1E15 A;  3IKD A;  4DYL A;  2AGA A;  1V9P A;  2LO1 A;  1ZBK A;  1YIJ V;  1D7H A;  4ZPV R;  4DV3 O;  1VIB A;  2RMK B;  4I55 B;  4DV1 O;  3KKY A;  3MAQ A;  3EIP A;  3DC6 A;  3S3W A;  1XRE A;  1E6R A;  3O5R A;  1D2K A;  1OCR C;  4L3N A;  5I98 A;  2ESC A;  1F23 A;  3SPC A;  1WP8 A;  2DYR B;  4JI6 O;  2YBT A;  2Q67 A;  3CRC A;  3CXC U;  1Z5V A;  1WP7 A;  4OX9 O;  1QLE C;  4G27 B;  3KG2 A;  3UKM A;  3ZN1 A;  2JZV A;  2BCC H;  3RVZ A;  1KT0 A;  3HPL C;  4JAS A;  4DR4 O;  2ZE7 A;  2E5L O;  3UI4 A;  1H2N A;  3EVK A;  4JI5 B;  4KL1 A;  1R3L C;  1XNQ O;  1O9G A;  2DG3 A;  3CSX A;  1VF6 C;  4MVU A;  4UCO A;  1I08 A;  5L3F A;  1P4R A;  1OCO B;  3AG2 B;  2XT9 A;  3K59 A;  5EIB C;  1WPB A;  1YZB A;  4X65 O;  4TX0 A;  1YTF D;  1NS1 A;  3B7X A;  5J9P C;  1UR8 A;  4FJC C;  4X89 A;  2AXT Z;  1E44 A;  4ODK A;  2D3O W;  3W7X A;  1IUR A;  3KAI A;  4AIL C;  5CB4 B;  4J9Z B;  2FKE A;  4X20 A;  5H6Q A;  2YUA A;  5C8Y A;  1EHN A;  2OTJ V;  1I5Y A;  5JH7 B;  3CD6 V;  5LHH A;  3ABM C;  1PKX A;  3JAK A;  4W9O A;  1QHT A;  1W0K G;  1QPL A;  2RUQ A;  1OCC C;  3PJS K;  3W4R A;  2FL4 A;  3ASO C;  4HZ3 A;  1D7I A;  2QR4 A;  5HWC A;  4UV9 A;  4AQY O;  4HBO A;  1N34 B;  2WK2 A;  2NR5 A;  1W1T A;  3RYF A;  4K8X A;  3CME V;  1EIB A;  2AZ0 A;  3UT5 A;  3KCE A;  2ITD C;  2ZIN A;  4DV7 O;  1M1K W;  1BL8 A;  4LFB O;  4ODL A;  5HKG A;  1U79 A;  2F21 A;  3O65 A;  2EX3 A;  3MD0 A;  4RUF A;  3ARQ A;  5KAF Z;  4LH6 A;  3SJQ C;  5L3B A;  2Q8V A;  5LGT A;  3WG7 B;  3BMB A;  2EIL C;  1HDJ A;  1VQ8 V;  2JGD A;  2RUR A;  2YSU B;  4DW1 A;  2WAM A;  4MW8 A;  4DH0 A;  1L0L H;  1U97 A;  2HVJ C;  2WSS G;  1XMQ O;  4JV5 B;  4G28 B;  5B1O A;  2P4V A;  4MVZ A;  3RYH B;  3OAA G;  1JNS A;  3OMA B;  4MW3 A;  4GLX A;  4IHJ B;  3TK1 A;  4JI1 O;  4PEL A;  4BF8 A;  2WA4 A;  1P7B A;  4TW8 A;  1AI7 A;  2Z3Y A;  5JQG A;  3U10 A;  2A3B A;  4J7K A;  3N27 A;  3E8F A;  3KAC A;  3RYI B;  2Y0I A;  4O4H B;  4K0K O;  5IJ9 B;  4MPK A;  2KO7 A;  1US6 A;  4B3M B;  1Y76 A;  5IT9 N;  2OIG A;  5LMU B;  4ZPT R;  5B1A B;  4B08 A;  1E6Z A;  1KMI Z;  2VWJ A;  5HW7 A;  3CGN A;  4B3S O;  1PBK A;  2WLK A;  4GCZ A;  2JEX A;  1BHB A;  1F51 A;  4KUM A;  4LF9 B;  4JAA A;  3OMI B;  4DV0 O;  4I55 A;  3HKC B;  3B2E E;  1ZBV A;  1ROP A;  4JYY A;  5HW6 A;  4YHH B;  4MGV A;  2DE0 X;  3PN1 A;  2CDY A;  1W26 A;  1VQL V;  4UB6 Z;  2A06 H;  3F5T A;  1TUE B;  1SKV A;  2YDE A;  2PZS A;  4R0X A;  4P9P A;  1IBK B;  3SYA A;  3L75 H;  3QO5 A;  1EBO A;  3HR0 A;  2WLN A;  3ZN0 A;  3CCR V;  4CZZ A;  1QPF A;  3KAB A;  4O2T A;  3DXR B;  4X1I B;  1YJ9 V;  2O92 A;  4JI4 B;  2JRI A;  1GKF A;  2PYL A;  3WB0 A;  4W9P A;  1SQQ H;  4DWS C;  1R3I C;  1NVP B;  2CAZ C;  2X7R B;  5BMV B;  1Z5W A;  5IWA B;  4X64 O;  2M7W A;  1W1V A;  4J7Z A;  2R72 A;  4JPR A;  3CCQ V;  3OUF A;  3W7W A;  1S5L Z;  4QE9 A;  3D8C A;  5B1B B;  3B8S A;  4LAX A;  3IC9 A;  1BL4 A;  1FD9 A;  4PA9 A;  2VS0 A;  1IBM O;  2DOS A;  1FKI A;  5IY5 B;  1NWT A;  1NH6 A;  4PTM A;  1AJN A;  2ZM6 O;  2G41 A;  2Q4P A;  3E86 A;  3G6L A;  4NNR A;  2LFS A;  3CCL V;  5CA0 B;  4CC5 A;  3DGE A;  5CB4 A;  3N2G B;  4TV9 B;  4DV3 B;  4PDV A;  4MAV A;  1EN6 A;  3JD0 A;  5JH7 A;  4O4L B;  4DV1 B;  1XI1 A;  3TXS A;  2A3A A;  5IYD O;  1F7Y A;  1R3K C;  4I9W A;  5H5N A;  3K06 A;  4L87 A;  2P4K A;  1XL4 A;  5ITZ B;  4BAY A;  4CH3 A;  4JI6 B;  5EBL C;  1F8A B;  2LKN A;  1W9U A;  3L72 H;  4YXW G;  1MMM A;  2Q68 A;  1P49 A;  3ASN B;  1B3Q A;  2XUM A;  4I9Q A;  2YI9 A;  2E5L B;  3P3N A;  2W0F C;  4G2P A;  2WLZ A;  1ZX3 A;  4RO2 A;  3CHX A;  3ZMZ A;  3JAS A;  1XNQ B;  1Q6H A;  2PV3 A;  2DYS B;  2OIE A;  5CMU A;  1N1A A;  1ROT A;  4RWU A;  2B9Z A;  3BEH A;  5B66 Z;  2K9P A;  4NR1 A;  3RYH A;  3B77 A;  4IGG A;  4X65 B;  2OCC C;  4IHJ A;  3WU2 Z;  4O4J B;  2YIC A;  2XTA A;  1BCC H;  1R1B A;  2KSD A;  4DUY O;  2Q0A A;  3AK2 A;  3RYI A;  1KKC A;  2BTO A;  4FAP A;  4O4H A;  1FAF A;  2Q9L A;  4UVB A;  3ARR A;  3LNN A;  2ODM A;  4JAV A;  1WAW A;  5IJ9 A;  3CGM A;  4DZ2 A;  2PBC A;  3L71 H;  4PA7 A;  4R7C A;  3PRD A;  2QWP B;  2D2C B;  1BHA A;  1TAE A;  3ABK C;  4AQY B;  1R6K A;  2H3O A;  2ZE6 A;  3O5E A;  5B8I C;  1A32 A;  2H94 A;  1IXM A;  3MHS C;  1NWR A;  3IGA C;  3RW0 A;  3T4Z A;  4DV7 B;  4LFB B;  2BOB C;  3HKC A;  1QQC A;  4K35 A;  1YDX A;  4TOI A;  4EEQ A;  4DRH A;  2HJD A;  2HHH B;  2ADQ B;  2LP7 A;  1ZL8 B;  1PNK A;  3ABT A;  3WH0 A;  3QVN A;  2P22 C;  3RM8 A;  3NTP A;  3WQV A;  4U3F H;  3O5J A;  4ASU G;  2E75 B;  1Z2G A;  3L73 H;  3JD2 A;  4UV8 A;  3OW2 U;  3KZ7 A;  2PI5 A;  5L3G A;  1J4I A;  4LGX A;  2Q73 A;  1WNS A;  4U84 A;  4D6T H;  2M08 A;  5CA1 B;  2RJZ A;  3DXR A;  4X1I A;  1H2G A;  3OGI B;  4JI1 B;  4MSP A;  2AZ2 A;  3KCX A;  5BMV A;  2CTW A;  4JYA O;  3ABL B;  4NKG B;  3S3X A;  4ODP A;  4IQC A;  2UUC O;  2MPH A;  2R9R B;  2VQF O;  5EC2 C;  3SYO A;  4DRX B;  2P06 A;  5LHI A;  2EIJ C;  3AG4 B;  1VQK V;  4NTX A;  1L0N H;  1COW G;  4K0K B;  2DPE A;  3M8A A;  5D5Q A;  4J41 A;  1WAZ A;  3T1C A;  2F2D A;  1ZLZ A;  2PF4 E;  2VCD A;  1Q8I A;  1T5E A;  1KBH A;  3CCM V;  3H1I H;  3WL1 A;  1B6C A;  4B3S B;  1GN6 A;  5CA0 A;  3B9D A;  1FXK C;  3N2G A;  3O5K A;  4DRQ A;  4L8J A;  1AJQ A;  3E83 A;  4TV9 A;  2Q6A A;  3VQY A;  2CUG A;  2BOC C;  3SYC A;  2Q69 A;  1FFX B;  1JNE A;  2MF9 A;  2LGQ A;  2YS8 A;  1LL6 A;  2Y48 A;  5IYZ B;  1ZCN A;  1PM9 A;  3HB3 B;  3CCS V;  5J2T B;  1E79 G;  1ZB5 A;  5JH8 A;  4DR2 O;  1WJZ A;  1OGG A;  3VOU A;  2JS3 A;  5ITZ A;  5EC1 C;  2EZO A;  5J6E A;  2LQT A;  1YSC A;  4NXN B;  1VQP V;  3RVY A;  2YXH A;  2ZQU A;  3P32 A;  3RYC B;  3ML0 A;  3LSS A;  2R9I A;  5FPO A;  3IJ4 A;  1Q82 W;  1SQG A;  4DWS D;  3K57 A;  1BQZ A;  2X0L A;  1L8D A;  2OFN A;  3CC7 V;  2Y4U A;  4X64 B;  3JCZ A;  2JJ2 G;  2Y78 A;  5LGN A;  2A3E A;  3C90 A;  1LR1 A;  5HWB A;  1I5X A;  1EZJ A;  3OEH G;  2WA3 A;  2EIN B;  1W0J G;  4KR0 B;  4TSF G;  1HNX O;  4ITZ A;  1FKR A;  4FMT A;  4Z2G A;  5LP6 B;  1IBM B;  3DSQ A;  1BQ0 A;  3WD2 A;  3GPK A;  3R66 A;  1XMO B;  4P8W A;  2ZM6 B;  3ARZ A;  2CK3 G;  3ZRV A;  1AI5 A;  3K58 A;  3ARX A;  5LBQ A;  3K08 A;  3RME A;  1S5H C;  4LF8 B;  4NXM O;  3D3I A;  1OWQ A;  3F7Y C;  2K1E A;  2Z0A A;  2EJR A;  4WJX A;  2DMX A;  2DYR C;  5H2F Z;  1F40 A;  2EUL A;  4HNA B;  4FLX A;  1J5E O;  3SJC C;  4HBE A;  1YVW A;  2ZR2 A;  3VAW A;  4LNU B;  1VQN V;  4GZR B;  4UCU A;  4PA4 A;  4EKW A;  3VQW A;  1FJG O;  3FX7 A;  5HW8 A;  3OD4 A;  5HT1 A;  3H01 A;  1NMW A;  2NNU A;  3AQU A;  1GRJ A;  3R65 A;  1NH2 D;  1E1R G;  5JCO A;  4DO2 A;  2QA4 V;  1ZL8 A;  2G38 A;  1Q5O A;  3AG2 C;  2GUZ B;  1D2D A;  1VAR A;  3WD4 A;  1WA8 B;  4LR3 A;  3VBB A;  1W9P A;  2XAG A;  1T11 A;  2FML A;  1RFY A;  1YF2 A;  4CH5 A;  5CA1 A;  3HKB B;  4Z2H A;  2VQE B;  3ARO A;  1CEZ A;  3B8M A;  1KD1 W;  3HKE B;  1THZ A;  2KQX A;  3AK1 A;  3G4S V;  1YJW V;  3QG5 A;  3E89 A;  1G6U A;  4GGQ A;  1YTF B;  1M9N A;  4QGP A;  2QWN B;  1X6N A;  4JI0 O;  2DT3 A;  3I55 V;  4DRX A;  3JAT B;  4B7E A;  3NRK A;  2NLJ C;  4K3A A;  4J4O A;  3RM9 A;  4AY1 A;  2N04 A;  1J6Y A;  4YIO A;  1JMK C;  3J81 N;  1FJD A;  4QJF B;  2ZQS A;  2CH7 B;  1AB3 A;  4DR7 B;  4Q20 A;  1GM7 A;  2ZE8 A;  1XHG A;  1VQ4 V;  4QPK A;  4IIJ B;  1HKJ A;  4Z1M G;  1OCZ B;  1NWS A;  1QU7 A;  2WLM A;  4P2Z A;  4H37 A;  4NTW A;  4DXW A;  5H6R A;  3WG7 C;  4B3R O;  4AI8 A;  2N05 A;  5KUM A;  1W2B U;  4IT6 A;  5GTH Z;  2BSK B;  1FFX A;  4GKK B;  1NSG A;  1HJW A;  2B5U B;  5LGU A;  4Z2J A;  5IYZ A;  1VF5 B;  5JWP A;  5J2T A;  4X1K B;  3UM7 A;  3ARW A;  1K5Q A;  4J10 A;  2YID A;  2XP8 A;  1H2S B;  3OOB A;  2QF8 A;  2AHZ A;  2KB1 A;  4CS4 A;  3RN4 A;  3LDD A;  2W6I G;  2DG9 A;  3K79 A;  5KHI A;  1ZK6 A;  4N23 A;  4DT4 A;  1EYM A;  1K9M W;  3RYC A;  1W59 A;  3KAD A;  2ZR3 A;  4S3J A;  3K5O A;  1FS0 G;  3H1K H;  4NYK A;  4TW6 A;  5IYC O;  1JND A;  2QJ1 A;  4JYA B;  1WB8 A;  2RQ6 A;  1YAT A;  5EBM C;  2UUC B;  1I0H A;  4W4K A;  2EIK B;  1SRY A;  4DR3 B;  5LP6 A;  4JZG A;  4IL6 Z;  3U0Z A;  3LSQ A;  3N2K B;  2E74 B;  2PPN A;  1RD6 A;  2JS5 A;  2N87 A;  1GM9 A;  1WPX A;  2ZE5 A;  1LL7 A;  3U11 A;  1Q6U A;  1W1P A;  3AG7 A;  1PNM A;  2DG4 A;  1AJP A;  4LWS B;  1AP5 A;  1JVM A;  1G4Y B;  1SET A;  4P30 A;  1GTO A;  4GKJ O;  4X88 A;  3ZX6 A;  4YIP A;  4FIP C;  4ZHQ B;  1S0V A;  1ZU8 A;  3OM3 B;  3O5M A;  5DIU A;  4CS2 A;  4HNA A;  1N4C A;  2LW7 A;  4DR2 B;  1IVS A;  4FM0 A;  3P3P A;  2EIM B;  4W5U A;  2P6J A;  3SPH A;  2ZR4 A;  2RNB A;  3AG3 B;  4LNU A;  2JEU A;  1FFT B;  4DK1 A;  1H0I A;  5BZB A;  5CA3 A;  3A0H Z;  5DEC A;  3TGU H;  3TJT A;  3X2Q C;  1MG1 A;  4BW5 A;  3CC2 V;  2ADP A;  1M93 A;  3K03 A;  2F95 B;  3DC5 A;  1SS3 A;  5IDJ A;  5B1B C;  4FFB B;  4LF6 O;  1M57 B;  1Q43 A;  2GUZ A;  4Q7N A;  1WA8 A;  4MNJ A;  4WFG A;  5IY5 C;  1TCO C;  4JI8 O;  2QTS A;  2XND G;  2UXC O;  2UXD O;  1SR0 A;  1HNX B;  4DRO A;  1XIL A;  2HFE C;  4UUJ C;  2JDI G;  3JAS B;  4YJ3 B;  4WIW A;  2F1M A;  3HKB A;  3WKZ A;  3O5G A;  2VRZ A;  5DM6 V;  1GMG A;  3HKE A;  5D75 A;  2KKW A;  1YEW A;  1QZ2 A;  3OR7 C;  2YIA A;  3EHB B;  3FKS G;  4FVM A;  4R5E A;  4NXM B;  5KMG B;  2WPD G;  2MLZ A;  3JAT A;  2AW9 A;  4JI2 O;  1AI6 A;  2EZP A;  2Q5A A;  3BHP A;  3OT7 A;  2PI4 A;  2CH7 A;  1ORQ C;  3FAV B;  4MVQ A;  2MW2 B;  1J4H A;  1X59 A;  1J5E B;  3WL0 A;  2ARH A;  3JAM N;  3GWO A;  4IIJ A;  3BFR A;  1VQ9 V;  3WFV A;  2PI6 A;  3ASN C;  1Q6I A;  2WLI B;  1I94 O;  2YI8 A;  2XOK G;  2XP4 A;  1FKD A;  3B9A A;  5HUA A;  1DK1 A;  3KAF A;  5LL6 Y;  1RM1 B;  2IJJ A;  1Q90 D;  4URI A;  5GPR A;  2BSK A;  3T2M A;  4MS2 A;  2B5U A;  3A0R A;  4PA6 A;  3EXA A;  1C9H A;  4X1K A;  4LBE C;  1MZF A;  3UQI A;  2ZQM A;  3ARS A;  5A2Q N;  3ART A;  4I7Z B;  4DRK A;  2AOS A;  4S3K A;  3WB1 A;  3JD4 A;  3AG1 B;  4JYB A;  3OTO O;  2FB5 A;  1KT1 A;  3O5F A;  3ARU A;  4DV2 O;  2UXB B;  1GN3 A;  1HXV A;  2QGN A;  1BMF G;  4DUZ O;  1S5J A;  3E8H A;  3EY6 A;  4G2K A;  2QEX V;  3ZHS A;  4JI7 O;  3MDS A;  2XP3 A;  4XDL A;  4DV6 O;  3K5N A;  3O5Q A;  3FB7 C;  4JI0 B;  2XP6 A;  1SQX H;  2LFR A;  3KCY A;  3BXW A;  1FKF A;  1PP9 H;  1LUW A;  3LDE A;  1H2M A;  4LCU C;  4LFC O;  3RGB A;  3N2K A;  4DR6 O;  3OMN B;  1TUB B;  4AHC A;  1IXB A;  2M6Y A;  4FZ0 A;  2PPO A;  1K5S A;  3ZHV A;  4MTV A;  1K97 A;  2HKO A;  4H0L B;  2YEV B;  1XDC A;  3CB2 A;  2XP5 A;  1YCI A;  2WLJ A;  4MTO A;  4BIZ A;  1R3J C;  5JJN B;  3K3W A;  4BIU A;  4B3R B;  3BY6 A;  4LWS A;  4R6Z A;  1JX9 A;  3E22 B;  1JVW A;  1M5I A;  5LMN O;  4ODO A;  2WM0 A;  3CRA A;  4ZHQ A;  2XAQ A;  4JTC B;  1OJH A;  3T1H O;  2X6A A;  5IE9 A;  3JYJ A;  1IDS A;  4JZ2 A;  3CE2 A;  1BSM A;  1BS3 A;  2ILM A;  3STL C;  4QT3 A;  3JD3 A;  2IF4 A;  3ABU A;  4MNL A;  4TQD A;  4MVR A;  4IT5 A;  4KHP O;  3M7M X;  3ABL C;  2IJK A;  3IFX A;  3CHD A;  1S72 V;  3RGC A;  1MSW D;  2GTS A;  3JXV A;  1KC8 W;  4OX9 B;  4FFB A;  1SQP H;  4TV8 B;  4RUE A;  4GUN A;  4ZOL B;  5FL7 G;  3OR6 C;  4DRJ A;  4DR4 B;  3WD1 A;  1FKJ A;  3UQB A;  1NMV A;  2DT1 A;  3WB2 A;  2WLL B;  2LJ2 A;  3AS2 A;  3ZRS A;  4YJ3 A;  3CXH F;  1XEQ A;  3FD9 A;  4Q6G A;  2ZIO A;  2IW5 A;  1BT8 A;  1KP3 A;  1PD3 A;  5EIB D;  1SQV H;  2X6B A;  2LGW A;  2W6J G;  1X4T A;  4JTA B;  2E76 B;  5GQB A;  3AEI A;  1Q7Y W;  5KMG A;  1N33 O;  4LF4 O;  5K1X A;  5L3C A;  1KYO F;  1MSD A;  1EZV H;  1MA1 A;  4GKJ B;  1AP6 A;  3E8B A;  1I7F A;  1L1P A;  4JFI A;  4WBN B;  4UVC A;  3ZIA G;  3AS3 A;  4MTF A;  3ZHU A;  1D7J A;  3B9E A;  3FAV A;  3RBZ A;  3M99 B;  4U86 A;  3D3Q A;  4DR5 O; 
#chains in the Genus database with same CATH homology
 4L3N A;  5I98 A;  2ESC A;  2RUC A;  1YW5 A;  3WD2 A;  3GPK A;  1HKI A;  4P8W A;  2YBT A;  3ARZ A;  3CZ8 A;  2F4E A;  4ODQ A;  3ARX A;  1BKF A;  1VF8 A;  2JZV A;  3RME A;  3WD3 A;  1KT0 A;  1OWQ A;  3UI4 A;  2IUZ A;  3CHF A;  4WJX A;  2FDM A;  2DG3 A;  1F40 A;  4HBE A;  2DSW A;  1LQ0 A;  3VAW A;  3UQA A;  4TX0 A;  3NI6 A;  4ML4 A;  3B7X A;  2ZR6 A;  1FKK A;  1UR8 A;  5HW8 A;  5HT1 A;  1NMW A;  3AQU A;  4ODK A;  3KAI A;  4DRP A;  1HKK A;  2FKE A;  1EHN A;  1J4R A;  3WD4 A;  3PRB A;  4Z2I A;  4W9O A;  1W9P A;  4J4N A;  1FKT A;  1QPL A;  2RUQ A;  1TFV A;  1T11 A;  3W4R A;  1SYT A;  2RSE A;  3ALG A;  2LGO A;  1R9H A;  4Z2H A;  1D7I A;  1H0G A;  5HWC A;  2M1I A;  3ARO A;  4HBO A;  3OA5 A;  2WK2 A;  1W1T A;  1NWU A;  4LAY A;  2YBU A;  5GPG A;  4DRN A;  4FN2 A;  1EIB A;  1ZBC A;  1FFR A;  3KCE A;  4DIP A;  4ODL A;  5HKG A;  1U79 A;  4GGQ A;  4KQZ A;  2F21 A;  1Y0O A;  1X6N A;  2DT3 A;  3ARQ A;  4G50 A;  1A7X A;  4J4O A;  3NRK A;  4AY1 A;  3RM9 A;  2XPA A;  1J6Y A;  3O5P A;  1FKG A;  1HJV A;  2RUR A;  1X6L A;  1FJD A;  2ZQS A;  4DH0 A;  3TC5 A;  3IK8 A;  1XHG A;  4U85 A;  1K9T A;  3UI6 A;  4ZS6 A;  1HKJ A;  1JNS A;  1NWS A;  3QOK A;  3I6C A;  3KAH A;  4JFL A;  4BF8 A;  4IT6 A;  1NSG A;  4IQ2 A;  1HJW A;  4TW8 A;  4Z2J A;  4NSB A;  2ZQT A;  2A3B A;  3KAC A;  3ARW A;  4JYS A;  3G6M A;  4LAW A;  2XP8 A;  3OOB A;  4MPK A;  2KO7 A;  4W9Q A;  4ZPW R;  2QF8 A;  4ZPT R;  2DG9 A;  1ZK6 A;  4DT4 A;  1E6Z A;  1LG2 A;  1EYM A;  3O5I A;  1W9V A;  3KAD A;  3O5D A;  4ODN A;  5HW7 A;  3CGN A;  1ITX A;  1PBK A;  4S3J A;  5BXJ A;  5DIV A;  4MNM A;  2MLX A;  4TW7 A;  4TW6 A;  1JND A;  4DRI A;  5DF0 A;  1ROU A;  1YAT A;  4L72 B;  1ZBV A;  3CH9 A;  5HW6 A;  1ZL1 A;  4MGV A;  1W26 A;  2VN1 A;  4DWS B;  1GUV A;  4MNK A;  3AS0 A;  4P8V A;  4R0X A;  2PPN A;  1FKB A;  1CTN A;  1RD6 A;  1O6I A;  4QIB A;  2N87 A;  2OLH A;  1LL7 A;  1QPF A;  3UI5 A;  3KAB A;  5DIT A;  4O2T A;  1Q6U A;  1W1P A;  2O92 A;  3FXY A;  2DG4 A;  1XRV A;  4W9P A;  1P5Q A;  2KE0 A;  4DWS C;  4WK9 A;  4DZ3 A;  4JFM A;  1W1V A;  4ODR A;  1EDQ A;  1ZU8 A;  3O5M A;  5DIU A;  2UZ5 A;  4WKA A;  1WNO A;  3B8S A;  4LAX A;  4GIV A;  4W5U A;  1BL4 A;  1FD9 A;  1FKI A;  4ODM A;  2ZR4 A;  2KFW A;  4WKF A;  1NWT A;  1NH6 A;  1H0I A;  4PTM A;  2D9F A;  2G41 A;  1FKL A;  3G6L A;  1KFW A;  4NNR A;  2PV1 A;  4MAV A;  3FAP A;  2A3A A;  4Q7N A;  4MNJ A;  1OGB A;  1TCO C;  4JFJ A;  3ARV A;  4QT2 A;  1SR0 A;  2DT2 A;  3ARY A;  4DRO A;  4WIW A;  1LL4 A;  1Q1C A;  4TYO A;  3WKZ A;  3FY1 A;  3O5G A;  4N19 A;  1F8A B;  5D75 A;  2LKN A;  1FFQ A;  1E6P A;  1FKH A;  3ARP A;  1QZ2 A;  1W9U A;  3B09 A;  3MDY B;  4R5E A;  4Z2G A;  4LAV A;  2MLZ A;  1HJX A;  3ALF A;  3WD0 A;  4XAK A;  4G2P A;  2WLZ A;  3TDB A;  2Q5A A;  3WIJ A;  1Q6H A;  4IPX A;  3JYM A;  2PV3 A;  2XP7 A;  5DO2 A;  1N1A A;  1ROT A;  1J4H A;  1GPF A;  3WL0 A;  1FAP A;  2G8Z A;  3IKG A;  2KI3 A;  2PI6 A;  1Q6I A;  2XP4 A;  1FKD A;  3B9A A;  5HUA A;  4IT4 A;  3KAF A;  5DEZ A;  3PRA A;  4URI A;  5GPR A;  3AS1 A;  2MNT A;  1C9H A;  1M5Y A;  2DSZ A;  2AWG A;  2DSU A;  4FAP A;  3UQI A;  3ARS A;  3ARR A;  3ART A;  1WAW A;  1LG1 A;  1PIN A;  2PV2 A;  3CGM A;  4DRK A;  4DZ2 A;  2PBC A;  2AOS A;  2M2A A;  3ODK A;  4S3K A;  3PRD A;  1KT1 A;  3O5F A;  3ARU A;  1HXV A;  3CHE A;  1EQ3 A;  1IX5 A;  3EY6 A;  3O5E A;  5B8I C;  1FKS A;  4TNS A;  1NWR A;  1JNT A;  2A3C A;  2XP3 A;  2ITK A;  2DT0 A;  3O5Q A;  2XP6 A;  1LJY A;  4Z2L A;  4DRH A;  1HKM A;  3BXW A;  1E6N A;  1FKF A;  1W1Y A;  3WH0 A;  4DWS A;  3RM8 A;  3NTP A;  3WQV A;  2O9O A;  4JFK A;  3O5J A;  4MTV A;  2PPO A;  1GOI A;  3KZ7 A;  1J4I A;  4LGX A;  2RUD A;  4U84 A;  5HBF A;  2M08 A;  3O5O A;  2XP5 A;  4DRM A;  3IHZ A;  1UR9 A;  4MSP A;  1JVW A;  2K8I A;  4WKH A;  2ZR5 A;  4ODO A;  2WM0 A;  4ODP A;  2WLY A;  4IQC A;  2MPH A;  2LPV A;  3RM4 A;  2KGJ A;  3JYJ A;  2DPE A;  4C02 B;  2L2S A;  2F2D A;  4QT3 A;  2ZQV A;  2VCD A;  2IF4 A;  4HAR A;  4MNL A;  2LJ4 A;  2MLY A;  5HTG A;  4Q22 A;  3WL1 A;  1B6C A;  2FAP A;  3PR9 A;  3CHD A;  3RGC A;  3B9D A;  3WQW A;  4QZV B;  3O5K A;  3JXV A;  4DRQ A;  2KR7 A;  2DSV A;  3KAG A;  3RFW A;  3H9R B;  4DRJ A;  2MF9 A;  1JNE A;  3WD1 A;  1FKJ A;  4P8U A;  3UQB A;  1NMV A;  1LL6 A;  3O5L A;  2DT1 A;  1ZCN A;  1ZB5 A;  5JH8 A;  3AS2 A;  1OGG A;  2RQS A;  5J6E A;  1ZBW A;  3CHC A;  4NZC A;  3PA7 A;  2ZQU A;  4P8X A;  1E9L A;  5GQB A;  1E15 A;  3IKD A;  3UF8 A;  4DWS D;  1ZBK A;  1D7H A;  2B31 A;  4ZPV R;  2OFN A;  2Y78 A;  2XP9 A;  1L1P A;  4JFI A;  2A3E A;  5HWB A;  2PPP A;  3AS3 A;  1D7J A;  3B9E A;  4Z2K A;  1D6O A;  1E6R A;  3O5R A;  4KR0 B;  2XPB A;  4U86 A;  4ITZ A;  1D2K A;  1FKR A;  1WB0 A;  3TCZ A;  3LUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...