1Q6IA

Crystal structure of a truncated form of fkpa from escherichia coli, in complex with immunosuppressant fk506
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
210
Chain Sequence
AFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of FkpA from Escherichia coli, a cis/trans peptidyl-prolyl isomerase with chaperone activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
total genus 66
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1q6iA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q6iA02
2AWGA 2MF9A 3UI5A 1JNTA 2MLZA 2FKEA 3VAWA 3PA7A 1YW5A 2LGOA 1NMWA 5HWCA 2PV2A 1Q1CA 3FAPA 3IHZA 2Q5AA 4IPXA 4NNRA 3KCEA 4JYSA 4GGQA 2FAPA 2F2DA 4DRPA 1PINA 3CGNA 3IK8A 3O5QA 2F4EA 2RSEA 1FKFA 2DG4A 3KAFA 3O5FA 1TCOC 2RUQA 3O5EA 4ODKA 5DITA 5HT1A 1JNSA 4W9PA 1NMVA 1D7JA 4DRKA 4DRIA 2LJ4A 2XPBA 1D7IA 5B8IC 3B09A 3UI4A 4BF8A 5HW6A 3ODKA 1W26A 2XP9A 4IQCA 1ROTA 1BKFA 2F21A 4FAPA 1KT0A 4J4NA 4DIPA 5I98A 1A7XA 3EY6A 1FKSA 3RGCA 4DROA 3TCZA 2M08A 4JFIA 1J4HA 5DIVA 2MNTA 3KAIA 4TX0A 2N87A 4U85A 2ZQSA 5DIUA 2D9FA 1J6YA 4O2TA 4JFKA 1T11A 3NI6A 2M2AA 2LPVA 3KADA 4ODLA 2ZQUA 1QPLA 2KO7A 2VCDA 3PRDA 4MGVA 3TC5A 3O5PA 2MPHA 1PBKA 4DT4A 1Q6HA 4LAWA 4DH0A 2KR7A 1D7HA 4IQ2A 3O5RA 4DZ2A 4DRNA 5HKGA 3B7XA 3I6CA 1FD9A 2PV3A 4DZ3A 3GPKA 3NRKA 3UF8A 1ZCNA 3WH0A 4JFJA 3O5GA 3O5DA 4LAYA 3NTPA 4ODRA 1QZ2A 2L2SA 1FAPA 1FKTA 1L1PA 2PPPA 2ITKA 1JVWA 1M5YA 1FKIA 2XP6A 2RURA 4LAVA 4TW6A 1FKRA 2PPNA 3H9RB 4R0XA 3O5MA 5BXJA 4TW8A 4DRQA 2PV1A 4W9QA 3O5KA 1FKBA 3KAGA 5HWBA 2XP3A 3O5IA 3PRBA 5HW7A 3JYJA 4TW7A 2IF4A 2XP5A 2ZQVA 3OOBA 4ODQA 4QIBA 3JYMA 4U86A 2OFNA 3UQAA 4N19A 2MLXA 2MLYA 3IKGA 4MSPA 4ODMA 4QT3A 5D75A 4DRJA 4DRHA 1FKJA 2ZR4A 1D6OA 1HXVA 1U79A 3MDYB 3O5LA 2DG9A 1ROUA 4ODNA 5J6EA 1P5QA 1Y0OA 2K8IA 2PPOA 1ZK6A 3O5JA 4ITZA 1F8AB 4QT2A 1FKDA 3UI6A 4G2PA 4C02B 5HUAA 1QPFA 1FKHA 2JZVA 4JFMA 2XP8A 2XP7A 4JFLA 3UQIA 3CGMA 2RUCA 2Y78A 2XP4A 1N1AA 4U84A 1FKLA 1EQ3A 3LUOA 5HTGA 2KI3A 1J4RA 3KABA 3TDBA 4FN2A 2RUDA 3JXVA 2UZ5A 3UQBA 1F40A 1C9HA 3KAHA 4LAXA 2VN1A 2KGJA 4TNSA 4G50A 4ODPA 2ZQTA 2ZR6A 1R9HA 3O5OA 2KFWA 1Q6UA 1EYMA 1FKGA 1KT1A 1YATA 3IKDA 3KZ7A 3KACA 5GPGA 1FJDA 4DRMA 1B6CA 5HW8A 1J4IA 2PBCA 2RQSA 4J4OA 4GIVA 3RFWA 1FKKA 4W9OA 1Q6IA 4ODOA 2KE0A 1BL4A 2M1IA 2DG3A 1NSGA 2ZR5A 2XPAA 4TYOA 2LKNA
chains in the Genus database with same CATH superfamily
2AHZA 1K9MW 2Q7HA 1GM8A 1M4UA 4WCEV 4GZRB 4DV3B 1PINA 2UXDB 3ABMC 1NWRA 1THZA 3ARSA 3ARWA 1EN6A 3L72H 3BA9A 3OTFA 3MHHC 3UI4A 2XP9A 4TV9B 2LGQA 4B3RB 2JIZG 5I98A 1FKSA 3ZEDA 4D7TA 4O2TA 4NYKA 5GONB 2F95B 3LSUA 3SJQC 3QNEA 1KC8W 4UVBA 4X65O 3H1KH 5LHIA 1AP6A 3G67A 1HR0B 3OE7G 4C7UA 1FAPA 1BHBA 3MDSA 4DV4B 1MG1A 3L75H 2HLDG 1FKRA 2QWOB 1H8HG 4X20B 2KB1A 5DF0A 1O9HA 5L3EA 2QJ1A 4DR3O 1QLNA 5HW7A 1CXZB 4JI0B 2QGNA 2OTJV 1TUBA 4BIUA 4QT3A 3G6MA 3T2MA 1NTKH 2DG9A 3CCQV 1J5EO 4NXMO 3WD0A 2PPOA 1ZX3A 1Q81W 5LP6A 4TT3G 3DSQA 1GAXA 2IM9A 2QKAA 3CS5A 3ZBHA 3G6BA 1N34O 1E6ZA 4Z2IA 1MZEA 1OCRB 1M90W 2Z0AA 3ZRWA 3CMEV 1OWQA 2IJJA 1AVMA 1XUQA 5IY5C 3IC7A 2YUAA 1SZTA 2CH7B 4PA6A 1FJDA 3RM4A 5HW8A 3HKEB 4J4OA 4BW9A 2GTAA 1VQKV 2KE0A 3CRCA 3D8CA 4LFCB 3ARXA 3PR9A 3WD1A 1Y76B 3WG7C 1MNGA 2DOSA 3FYIB 4WFFA 2IU0A 3KZIZ 1Q82W 1NMWA 5HWCA 2UUCO 4O4JB 4JYSA 2EIMC 3CGNA 3IK8A 3RFRA 3KAFA 1R3IC 4KR0B 5A9GA 2WLLB 4IQCA 5LHGA 1ROTA 4PI2A 1W0JG 5CA0A 2AZ2A 5DIVA 1IXBA 1R3KC 3E8HA 3O65A 1WP7A 1HJXA 1H2SB 4JI4O 1SERA 3G6EV 4MGVA 2ODMA 3S3XA 2KR7A 1S5JA 4P9PA 3VQYA 1V54C 4CBCA 3ABUA 3BFRA 3K5MA 3AG3B 1FKTA 2ZINA 1H2KA 1AI5A 4JAUA 3T4DA 3UCSC 5B1NA 1R3LC 3VQVA 1FFQA 4ML4A 2ZDIA 3UT5B 2DYRC 3UO3A 3JYCA 1ZWIC 5BR8B 1FFXA 2ZXWB 2Y0IA 3HPLC 5EYPA 2JS3A 3ASOC 2N05A 4DV6O 4NXNB 4ODMA 4DRJA 1NBMG 3FD9A 4OX9O 4UDMA 3B8MA 4BAYA 4I9WA 1Y66A 2YXYA 2UU9B 2PY5A 4GLXA 5KLVH 2EJRA 4C02B 1RSOA 2JDIG 4QGPA 3ETDA 4JI2B 3EIPA 4YJ3A 3F7YC 3LDEA 5DECA 4DR1O 4Q6GA 1LJYA 5L3DA 2JGDB 3WD2A 2X6BA 4I0XA 5DM6V 1KD1W 4MNMA 2VQEB 2M6YA 1N33O 1YATA 5HFLA 3B9DA 1E44A 1H0IA 1SKVA 3AK3A 1B6CA 3SDLA 1AJNA 4PA3A 3CC7V 1U97A 4LF9O 2XPAA 2W0XA 2IJHA 3HKBA 2A9HA 1T5EA 3UT5A 3CRRA 4YIPA 3J7AU 2BTQA 3FAPA 5D5QA 4I55B 4J9YB 5LOVB 4Z1VA 1UJWB 4DR2O 4LCUC 3RBZA 2ZXWC 1N4CA 2ZE6A 2Y69C 3OMIB 4PDRA 4Z2JA 1OZ0A 3RVYA 3H9VA 4JI8O 3EY6A 2YICA 1W9VA 1Q5OA 3H1JH 3JD0A 1N36B 2AW9A 5CMUA 3TJTA 1EIBA 1F7YA 3ZMSA 4DT4A 5GTIZ 5LP6B 2EZOA 4DWSB 1W59A 2H94A 4TUYB 1XMOB 3VQXA 2FMLA 4LC1A 1XRVA 1JJOA 4UCOA 3ZRWB 5IYZA 4PDMA 4RQFA 3PRBA 1AJPA 1AR1B 3FB8C 4DV2O 3OGIB 3ZHQA 2B1IA 4O2BB 1ROUA 2HEPA 1Y0OA 2Y0PA 4W4KA 1K34A 4JFLA 3K79A 3CRMA 1E6RA 1RP3B 2QWPB 2QM7A 4X1YB 3KG2A 1B3QA 2O57A 3K5OA 3K3WA 5EC1C 4FN2A 2UZ5A 1GRJA 1E9LA 3F7VC 3HKCA 2HJDA 5LHHA 4ABMA 3TGUH 3CZ8A 3FAVA 4FLUA 1XEQA 3PJSK 1VQ6V 2RDCA 1IXMA 4MTFA 4MNKA 3IGAC 1OV9A 1VEWA 3K5NA 1YZBA 3K58A 1O9GA 2ZR5A 2EULA 5LL6Y 5CA1A 1Q1CA 4U3JB 1FPOA 1O6IA 3KCEA 3ZHSA 4B3SB 1K33A 4KHPB 1SETA 1XILA 4DRKA 2XT9A 2ZKOA 1YSCA 4JI2O 1EN4A 3MD0A 5GONA 4MT8A 1K92A 3NI6A 3UQ8A 3LDDA 3K03A 2ZQUA 1WPXA 3WB1A 1HNZO 4DUYO 2JK5C 4DH0A 4IQ2A 1H8EG 2LW7A 2ZD9A 1M5IA 3B7XA 1RFYA 5EBLC 2YDEA 2PV3A 3AK1A 4LBEC 3ZHVA 3OW2U 3BHPA 4R50A 5KHKA 3ASNB 2P6JA 2L2SA 2UXDO 5JH7A 2RURA 2PI6A 1XREA 5FNVA 3JATA 3SJAC 4TW8A 2PV1A 4W9QA 1K97A 5EK0A 5B1BC 3FB5C 3D36A 3BAAA 4FFBB 3UKMA 3IKGA 4U3JA 4WIWA 5LXTA 3JALB 1S0VA 2YI8A 4OXSA 3RYHB 2Q8VA 2K8IA 1IX9A 2DYSB 2DQ3A 3QF7A 4WFGA 5HUAA 2EIMB 4JFMA 3THOA 2E5LB 2Y78A 4K8XA 4UCUA 3CE2A 2HR3A 3OD4A 3JXVA 1XBLA 1Q90D 1TUEB 5GPRA 4MTGA 3CRQA 3CCVV 4P2ZA 4HYOA 4CH3A 4KP4A 3SYAA 4JI6O 1NWUA 4KUMA 4WFAV 4K3AA 1XMQB 3OT7A 4LNUA 4ASUG 3RFWA 5CN0A 4X8AA 4U7OA 1VQ8V 1JCHB 2DW4A 4LGXA 3OFNG 3BRCA 4LFCO 5K1PA 1XHXA 2A06H 2AWGA 2MF9A 4KHPO 1S77D 1Q86W 2WLYA 1PNMA 2XAJA 2JS5A 2F43G 4CS3A 1YW5A 2YIAA 2L35A 4UB8Z 3GB7C 4NNRA 5CBFA 1JCHA 2UXXA 3O5QA 1G8MA 3Q4HA 2JGDA 4MVMA 3WL1A 4DK0A 3JARA 5HT1A 2RMKB 4NKGB 4JI8B 2LJ4A 5IYZB 1U96A 3DTUB 2WA4A 4GKJO 3OR6C 2A7WA 2ETNA 2GDSA 1VIBA 5DIUA 4RAIA 2DT2A 4FZ1A 2DT0A 3KADA 2P5OA 1QPLA 1GK9A 3TXQA 2OLHA 2QE7G 2KSDA 2XOKG 3VQWA 4BWAA 4PELA 2ZE5A 2LFRA 4KFMA 1NR1A 1B06A 5EBWC 4LP8A 2VQFO 4JASA 4H0LB 4DV7O 5F2VO 1IBLB 2A3CA 5KA5A 1SQFA 2ITCC 4LAVA 2A79B 2CK3G 4I4TA 2F1MA 1JFFA 4R0XA 2GTSA 3DC6A 4P8VA 1GKFA 4GUNA 1ZBKA 2YIBA 3DXRB 2KKWA 4FZ0A 4WFBV 1P7GA 2ZQVA 1IX5A 3STZC 4QIBA 4U3FH 3WFVA 4DV5O 2Y69B 3WG7B 5D75A 3OM3B 1HP8A 1U79A 4PDVA 4FM2A 3QO5A 3K59A 1SS3A 2Y48A 3A8TA 1G4YB 5AG2A 1E79G 5EIBD 3HKDB 1KMIZ 4DYLA 2RUCA 4CS4A 4F6RB 4H13B 1FKLA 2XP4A 4NTXA 3OMAB 2Q68A 4UUJC 1VF6A 3CCMV 4B3RO 5LP6C 1AR5A 1R73A 1F40A 4LF7B 1K9TA 1PL0A 2KGJA 4J9ZB 2FL4A 1H38A 1N0NA 2ADQB 2ZIOA 3JSNA 1FKGA 3T4ZA 5BY1A 1URFA 3GU0A 3ZMZA 3ZRXA 1FXKC 3F5TA 4FMTA 1EZJA 2EILB 3IHZA 2Q6AA 2LKNA 2X0LA 4X89A 2ZM6B 2DMXA 3DXRA 3AG3C 3C3SA 4O4HB 1ZBWA 3ZIAG 4JI4B 5LOVA 3ARUA 2XNDG 1M9NA 2F2DA 4DRPA 3MAQA 2RSEA 1FFXB 1JJ2U 2RNBA 3P3PA 1TCOC 4B3MO 2Y4UA 1KB9F 1R1BA 3SGIA 1JNSA 1QR8A 1W1TA 4JYYA 3KKYA 1OCRC 2GV9A 3ALGA 3RN4A 1Z5WA 1UFIA 3ABLC 3P30A 4J4NA 1SC5B 3RGBA 2LW1A 2OCHA 4XDKA 4J11A 3JASA 4JYAB 1T11A 4JI7B 4KL1A 4WKAA 1GOIA 4ZBMA 5JJNB 1TA8A 5EYPB 1UR8A 4I50B 2XAGA 2LQTA 3RYFA 2ZR3A 2JJ2G 3RYHA 3ZCCA 2YI9A 1VQ9V 2ARHA 1VF5B 1JVMA 2DJVA 1JVWA 1AJQA 5KUMA 1EHNA 3CCSV 1BQZA 1K5QA 4LF4O 2AHYA 4OPHA 5IJ9B 3O5KA 1N8RW 5GTHZ 4JPRA 1LQ0A 1I7FA 1NJIW 3JYMA 5FLXN 2BSKB 4EB6A 4JI3B 1Y67A 2KG7B 4XDLA 4CH6A 4JZGA 3CX5F 5KHGA 1N34B 3SYCA 3K57A 5H2FZ 1QPFA 2GSMB 3H1HH 1YTFB 4J80A 3G4SV 2WLLA 5B5EZ 1NT2B 1M57C 1XL4A 3I5DA 1W0KG 2L6LA 2P7TC 1NH2B 2KI3A 2FYUH 2ZE8A 1AB3A 4FLWA 3R66A 5IYDO 4MPKA 1KP2A 5LYJB 1ZL1A 4ICGA 2QR4A 4FFKA 5CA3A 2ZM6O 5EZYB 3O9OA 1QR9A 4O4JA 4ZHQB 1KQSU 1R9HA 3K04A 4MTOA 2KFWA 3KZ7A 4MW8A 1Z5VA 4HAMA 3JAKB 4X65B 1KECA 1YIJV 1YCIA 3SJBC 4GIVA 4X66O 3JALA 4DUZB 1L0NH 4X1YA 5B1AB 4ZKIA 2M1IA 2UUBO 2PYJA 2ZIMA 2Q7EA 2DSZA 3AK2A 1ZL8A 3UI5A 4YJ2A 1JNTA 4S3KA 4FK5C 5B1OA 3B40A 3JATB 4DV0B 1FYJA 1W1PA 1DTOA 5L3CA 3ARVA 3JD3A 2DG4A 2AXTZ 2E76B 4MVRA 2PUSA 3CP1A 4MVQA 3N2GA 1JR9A 3HB3B 4P8XA 3OGCC 2ZNIA 4DW1A 2ZT9B 1N32B 4Q20A 4WBNB 3RGCA 3OEHG 4JFIA 1XNRB 1XNRO 2QM4A 2ZQSA 5IJ9A 1VQLV 5DEDA 4K0KB 3QG5A 4PA7A 4L72B 1EZVH 3D3IA 3CJHB 3L9DA 1LNQA 1H2NA 2HJFC 5B66Z 1Z2GA 2HHHB 3W7WA 4UV8A 1F4MA 4R6ZA 2WLIB 4TV9A 2PYLA 4NSBA 2YSUB 1HNXO 2FKXA 1HNXB 2MK3A 2NN4A 4B3SO 4DV4O 2PI4A 3JAWB 4DRQA 2BE3A 1HNWB 1FKBA 3LNMB 4HARA 3QTCA 3GVMA 3O5IA 3JYJA 3TETA 2B9ZA 4ODQA 4U86A 1TUBB 2OFNA 1WA8B 4I55A 2PI5A 4RQEA 1BE3H 3IFXA 5J6EA 4JI1O 1OCZC 3O5JA 4K0KO 1ENVA 3OTOB 1FKHA 1SA0A 4J7KA 4HNAB 1KFWA 4QNHB 3STLC 5LMNB 2Q7GA 2CAZC 3KAHA 4AHCA 5JQGB 4J7JA 2OIEA 2ZR6A 2ATKC 1YJNV 3H01A 2WA3A 4BIZA 4LF9B 3UM7A 4GYCB 4DV3O 1GM9A 1BZKA 3CHXA 4MVOA 1XMQO 5DEZA 5IWAO 1QBZA 4JI6B 1E6PA 3ZMTA 4WBNA 2GBOA 5KX5A 3FB6C 1S76D 3EHBB 4DV5B 4WJXA 1NH6A 2MLZA 4B3TO 2FKEA 1RPRA 4J41A 4LWSA 2A3EA 5FPRA 4IYIA 1Y6XA 3B2EE 1VMGA 2N04A 3E8GA 4X88A 4PD4F 3G80A 3IAYA 4ZIBA 4S3JA 2DYRB 2E5LO 1FKFA 4PA9A 2A3AA 4W9PA 1SESA 2XPBA 1OCCB 4DR6B 3QO7A 2UU9O 5LXTB 4DV1B 1W9PA 3SPGA 5C8YA 1KT0A 4URIA 4NR1A 1KKDA 3SPIA 3HKEA 4O2AB 1BS3A 4X1IB 4MNJA 1QLEC 3E35A 3A0HZ 2MPHA 2W6JG 1RSOB 2DT3A 2CTWA 1I5YA 4Z2KA 2YIDA 2P67A 2UXBO 1ZUQA 4CC6A 1YITV 2PTMA 3IJ4A 4L87A 1MSWD 2WAMA 4CH5A 1FKAO 2AGAA 4FLTA 4LF8B 2DSVA 3U10A 4FLVA 5LYJA 2PPNA 4DO2A 2OTLV 2DSWA 3ARPA 1NKDA 3GTYX 1ORQC 2WSSG 2LFSA 2QKSA 3B9AA 4F4LA 3FXYA 3NR7A 3CYOA 3ICXA 1HXVA 1D5NA 1FXKA 1FKJA 4MS2A 1D6OA 4IL6Z 2EIJB 3DGEA 2Q0AA 3OEEG 5H6QA 1M56B 4BW5A 4GX2A 3OAAG 2A3BA 2IH3C 1IBKB 3OUSA 5BMVA 1VARA 4U84A 3K5LA 2XHBA 2CGNA 2RUDA 1PP9H 1EDQA 4LAXA 4MAVA 3RT3C 1KBHA 3O5OA 3QO8A 1S3JA 3W7SA 2EIKC 2HFEC 3JD1A 1IBMB 1WB8A 4PDLA 3ARRA 2Q73A 1L1FA 1FKKA 4W9OA 4PA4A 2YEVB 1HW7A 1XHGA 2N74A 1RD6A 4DR1B 4ZPVR 2QWQB 4LFAB 4GKJB 2YIBD 5B3SB 3CXHF 4UCTA 1P49A 5JJEB 3ABKB 2DYSC 4LF6O 4Z2HA 3K9SA 4QIWF 3SJCC 1PKXA 2RUQA 2XUMA 1N32O 1YJWV 4TUYA 4HBEA 4DV0O 3U11A 1NTMH 2CH7A 3TXSA 5HFMA 1JA8A 5HW6A 1COWG 1E1QG 3H1IH 1ZAUA 2E75B 3ML0A 2UUAO 3CC4V 4FAPA 1HJWA 2EZPA 3JCZA 2YS8A 2IW5A 4I5SA 1SQGA 5LGTA 4O4HA 4TX0A 4AILC 1YHQV 1LL6A 1X4TA 4DRXA 1ITXA 1AROP 3K9AA 5LA6B 4P8UA 4N23A 2P22C 4DRNA 3CEIA 3WD3A 4HZ3A 4LWSB 2MW2B 3CCEV 1FD9A 2O92A 3UF8A 5JCOC 4BR6A 4CZZA 1EFRG 3K06A 5JCOA 2LP7A 2JRIA 4GKKB 2M7WA 3L73H 2FB5A 4WKFA 4L8JA 4FVMA 3ZRSA 2VQFB 2DT1A 3E2EA 2LGWA 3GWKC 4GT1A 2B31A 3JCUZ 4TV8B 1GPFA 3UQAA 1XNQB 1S5LZ 4FM1A 3E83A 2ZNJA 3E86A 1CEZA 4WKHA 5B3SC 3T1HO 1S72V 1N33B 4UCRA 4G2PA 4DR4B 2WWWA 1SA0B 1SF9A 3RYIB 2KQXA 5GQBA 1UPGA 4NVPA 4G27B 1AR4A 2HVJC 3ABLB 5IE9A 2YBTA 4G50A 3ASNC 5KHHA 4X64O 4L3NA 2QEXV 1P84F 4IHJA 1P4RA 4UFZA 5TISZ 3GWOA 1QCEA 3M8AA 3S3WA 4NXMB 2ZE7A 1SR0A 4EKWA 1K5SA 4W5UA 4QPKA 1QVFU 2EINB 3FX7A 1WJZA 4PJ0Z 4JZ2A 3BA8A 4X1KA 4AY1A 1WB7A 2Y4TA 2AOSA 2X7RB 3AROA 4IGGA 5BMVB 4HBOA 1J95A 2DN9A 1W2BU 4LFBB 1AI4A 1V9PA 1RPOA 3B09A 5FNVB 3AG2B 3ODKA 1TVKB 2ZR2A 2F21A 1XHZA 1FS0G 4FIPC 3ZS8C 5CB4A 2XASA 5J2TA 3B8NA 4K8ZA 1JNDA 1J4HA 5ITZA 2MNTA 2N87A 2D9FA 3BEHA 1WPBA 1YF2A 1N36O 5KUKA 4D6TH 1WAZA 2X6CA 1FXKB 4MVZA 3G71V 5LGUA 1YTFD 2G38A 2CTQA 4Z1MG 4LNUB 2HG5C 3JASB 3H1LH 3GPKA 1H0GA 4ODRA 3HKDA 1GN3A 3ETEA 3J81N 1FKIA 3VBBA 3CC2V 2VWJA 4TW6A 2PZSA 4QE9A 1RM1B 4N21A 4HBNA 1XOUA 5B1AC 3NXSA 2IF4A 1OCCC 2G41A 1KKCA 2JEUA 1BGYH 1QHTA 4NB5A 3CSXA 4MTVA 1ZK6A 4WFEA 1SZXA 3WL0A 1US6A 4R5EA 1BT8A 4MVUA 4WFHA 3LUOA 1J4RA 5LBQA 2QM8A 5ITZB 1LG2A 4JI5O 4B3TB 5IT9N 4CC5A 1QVGU 4AQYB 5KX5B 1EYMA 4ZOLA 4H37A 2CGOA 2ADPA 3AQUA 2ZDIC 4UV9A 2FTKA 1JFFB 1ZBVA 1ZU8A 2R9IA 4CH4A 4PV1B 3TCUA 4UCVA 1N0JA 1OCOB 4FLZA 4JTAB 1OGGA 1AI6A 2FAPA 4FLXA 1XMOO 2R72A 5L3GA 3ZMUA 2HVKC 2V1DA 3T1HB 1FXVA 1EN5A 2Q69A 2IBZH 1ZBCA 2EIJC 5BR8O 3OR7C 3LNNA 5CA1B 2QSAA 2R70A 1J6YA 4EFBA 4LF8O 3CHCA 3L71H 1ZSPA 2V4DA 5J9PC 3CB2A 1QNMA 2Q0OC 3FB7C 4NTWA 1VQ7V 3TC5A 3G6LA 4TQFA 4H33A 3VOUA 3HKCB 2UXNA 4JTCB 3ZRVA 2VQEO 4EEQA 1FFRA 1MZFA 5LMUO 1L0LH 4XDJA 1Y4MA 3E8BA 5K1XA 3ABKC 2PF4E 1NU1H 4X9QA 1UR9A 4JAAA 1LUVA 2ILMA 3AG4C 1BMFG 2QWRB 4X1IA 5HWBA 1K8AW 2BOCC 4TOIA 4G28B 4TW7A 3CJHA 3ARTA 3ZN0A 1GTOA 4JTDB 1OCOC 3N2GB 4LFBO 2C2AA 5L3BA 3KCXA 3PRAA 2LJ2A 5KA6A 3B77A 1NZ6A 4O4IB 5JVDB 4NTYA 2XP8A 3CPWU 3RYCB 1EQ3A 3PN1A 4B7EA 5EC2C 1MABG 1OGBA 3UQBA 3RVZA 1C9HA 3JAMN 2VN1A 4ODPA 2ZQTA 5C93A 1GM7A 2B5UA 4I0XB 1M1KW 3CHEA 3IKDA 2UUBB 4RO2A 5KAFZ 4GX0A 2PGGA 1J4IA 4A5UB 4DWSA 2QA4V 4JI1B 2VS0A 3AS1A 5JH7B 5HBFA 2Q9LA 4LR3A 1VP7A 2DG3A 4DWSC 2K1EA 2CE4A 1JNEA 5IJ0B 1GN2A 3X2QB 1PD3A 4JI0O 3ZMVA 3A0BZ 2WM0A 2JJ1G 3FYEB 1PV0A 1OCZB 3CCJV 4IPXA 4DXWA 3E22B 1IZ3A 3O5FA 1J5EB 1M57B 4EFEA 3P32A 3WIJA 1KUQA 2R9RB 3L74H 4BF8A 3B8SA 4X66B 3U0ZA 4I9QA 4E2LA 1TVKA 4DIPA 5J2UB 1LR1A 4H44B 1EM1A 1WB0A 1D2DA 4GKKO 4ODLA 2IU3A 3CCLV 4DW0A 5DN6G 2ZQMA 2V7QG 3KCYA 1I08A 2NNUA 2YC0A 4QZVB 1NVPB 3AS3A 1FXHA 3I6CA 1NVPD 4OPAA 3NRKA 3WH0A 1Q7YW 1F4NA 3BMBA 2IUZA 1HWYA 3SPCA 1WN7A 2OIGA 1IDSA 4LF6B 2AZ0A 4ZI7A 4U7NA 3KAGA 1NS1A 2WLJA 4YY3O 4YY3B 4N19A 3I56V 4LF7O 3AG2C 2EINC 3J80N 4DRHA 1XNQO 4ODNA 4FPPA 2JZVA 2EBOA 3WQWA 4Z2WA 3QOKA 1N1AA 2VWKA 1PPJH 2IJKA 1X59A 4UCSA 1Y74B 3CCRV 4DR5O 4DV2B 4X20A 2E74B 3E22A 1SQXH 2DQ0A 3JD2A 3OTOO 4LF5O 1DF4A 1E6NA 3R65A 2NLJC 3ZN1A 5GPGA 1G1XB 2X6AA 1FJGB 3CHDA 4DRMA 1I94B 3D36C 4P8WA 4IT6A 1VF7A 5IDJA 1VQPV 2EX3A 3P3NA 4JI3O 3T1YB 5KMGA 2OWOA 4DR7B 1SQVH 4JV5O 1JX9A 1M56C 4D7SA 2Q5AA 4O4LB 2XTAA 3OUFA 3QVNA 4ZS6A 2OCCB 1D7JA 3WB2A 4W4LA 1K3EA 5FPOA 1K73W 1HKJA 3M7MX 4F6RA 1MOFA 4Z2GA 2EJ7A 2IJIA 2CTRA 3ZHRA 2GUZB 4I7ZB 4U85A 3A0RA 2JVDA 1E15A 2IH1C 1WLEA 1H2GA 3APOA 5CBHA 3CXCU 1CTNA 1H2LA 2KO7A 2VCDA 2BOBC 2BTQB 1IBLO 4RUFA 3FFQA 4LH6A 1QQCA 2EILC 2WLMA 4DZ3A 3CHFA 1ZCNA 1Q8IA 3AEIA 3O5DA 2H3OA 4WK9A 2WLKA 2F66C 4B3MB 2PPPA 1ZLZA 2BSKA 4EB6B 3A2FA 2YEVA 3BY6A 5EZYA 1I94O 2VRZA 5BXJA 5EIBC 4YHHO 3JAWA 1YEWA 4IIJA 1S5HC 1SYTA 1NH2D 3FAVB 2XP5A 3OOBA 3D3QA 4JI5B 1GUVA 1M93A 4O4LA 2FDMA 2ZR4A 3CCUV 3O5LA 5IYCO 3OMNB 1PNLA 3JARB 1JPXA 3HKBB 1F8AB 3APQA 2WLZA 4QT2A 3UI6A 1IVSA 4IYHA 4TSFG 2RCVA 1DLBA 1F23A 1HDJA 5HTGA 4TQDA 1KYOF 1FAFA 1LL4A 3Q4HB 4F6EA 3K0GA 4Q7NA 1JMKC 1BHAA 1Q6UA 3AG1C 5FL7G 1WP8A 1IURA 1W1YA 5KHIA 1Y74A 1YXBA 2HKOA 2E3CA 4MNLA 3RM9A 1XDCA 3RYFB 3AG4B 3AG7A 3RWRD 1AILA 4I50A 4P30A 1HKKA 5EBMC 4B7KA 2YXHA 1ZB5A 4LAWA 4DR2B 4R7CA 4IIJB 2CDYA 5CBGA 3VAWA 5KMGB 4UXNA 2WLNA 4GX1A 4B08A 4ZOLB 3WKZA 3K0DA 5A2QN 1P7BA 4MSWC 2W6IG 5DITA 1NMVA 2QF8A 2YXLA 1YJ9V 5B8IC 3EVKA 1W26A 4K35A 3RM8A 1BKFA 4MTXA 1HJVA 1GN4A 1A7XA 1GN6A 1LG1A 2D2CB 3SPJA 3W4RA 3KAIA 3FY1A 4G2KA 3ZHUA 4DWSD 4JFKA 2EIKB 1K4DC 1OJHA 1W1VA 5H6RA 1CPYA 3PRDA 2LO1A 1Q6HA 4DR6O 2QTOA 2Q4PA 1D7HA 1HKMA 1SQQH 5KAIZ 4BIOA 5HKGA 1TGOA 1D2KA 1PM9A 3AS2A 1VQNV 1AP5A 3JD4A 1H2MA 3CH9A 3O5GA 4LAYA 3NTPA 1QZ2A 1NTZH 4UVAA 3RW0A 2HP8A 2XP6A 1Q43A 3ETQA 1R6NA 3WQVA 4OX9B 3BVOA 2WLHA 4ZI7B 4X64B 4JV5B 4YJ2B 1NQTA 2RN9A 3M99B 4X1KB 4JYCA 3X2QC 4E4EA 4PTMA 3ALFA 3UO2A 5BZBA 4DRXB 4PI0A 2Z5UA 5E1AC 4DUZO 4KQZA 1P5QA 4ITZA 5J2TB 1VQ5V 1MMMA 4GCZA 3CGMA 3ABMB 5JQGA 2PN0A 1B6QA 3K08A 4LF5B 2ITDC 2W0FC 5LMNO 2QKCA 4QPJA 4DK1A 1F51A 1HNZB 3ETGA 5J2UA 1V54B 2DSUA 1WA8A 2Z3YA 5IYBO 2BCCH 1B04A 3SPHA 1YI2V 4TWKA 1YDXA 3SYQA 1VF6C 2D3OW 3FKSG 2PBCA 1TAEA 1RM1C 1OHHG 3MHSC 3E8FA 5B1BB 4QJFB 2R9AA 3WB0A 1HR0O 4O4IA 5JVDA 1HNWO 4TYOA 3F5WC 3CRAA 4YHHB 2H8PC 1HKIA 2LGOA 1K7DA 2PV2A 2JGUA 1BQ0A 3RMEA 3ARYA 3SYPA 4GGQA 2HHHO 2F4EA 4ODKA 4R8CA 4O2AA 1SQPH 4DRIA 1D7IA 2UUAB 3WD4A 1AI7A 4FM0A 5C8YB 4JAVA 4PHZA 3TCZA 4DROA 5IY5B 1GO3F 2XAFA 3WU2Z 2M08A 2XAQA 1YVWA 2LPVA 2B1GA 3O5PA 1PBKA 1MA1A 4J7ZA 1XQ8A 1SQBH 1K4CC 4JYBA 1V55B 1A32A 2OT5A 5E79Z 5LMUB 1Y76A 1BSMA 4DUYB 3SR2C 2ITKA 1GH6A 5GW7A 1KP3A 3TK1A 4JF3A 2NR5A 1NI8A 3O5MA 3ZX6A 4JGSA 2JEXA 3CD6V 1ZL8B 4AQYO 2XP3A 4P9OA 3B4SA 2ZCEA 5IJ0A 4QE7A 1WNSA 2CUGA 3CMAV 4ZHQA 2MLXA 4MSPA 4TV8A 3B9EA 1MSDA 3MDYB 3C90A 4XAKA 1XL6A 1TFVA 1FKDA 1QLEB 2QTSA 5BXZA 2F4VO 1IBKO 2OCCC 3HR0A 1JQ0A 3LDCA 2CTPA 4FJCC 4IT5A 4NXNO 4IT4A 3C3TA 2K9PA 4DV6B 4DR7O 2UXBB 4AI8A 1NWSA 3RYCA 2BTOA 1I0HA 3ARQA 2DWDC 3N2KA 1DK1A 1ZTEA 1R6TA 1SRYA 4KXRA 4JI7O 1GMGA 1KU9A 3L70H 1FFTB 2KG7A 2A3QA 4YIOA 1XI1A 1BL4A 2A0LA 1EBOA 1WNOA 2WK2A 2F93B 2XAHA 3LSSA 3ZJZA 5JJJB 4LFAO 1NSGA 3AS0A 4Q22A 1V55C 2Q67A 3CWBH 3ZHTA 3W7TA 1W9UA 5DO2A 3PA7A 2RJZA 5KHJA 4I4TB 4FLYA 3N27A 2UXCB 4J10A 1JOYA 5JH8A 3O5EA 2DWEC 1CP9A 4RUEA 4IHJB 4O2BA 3ASOB 4YJ3B 4YXWG 4X62O 4WF9V 3IC9A 4HNAA 1G6UA 3E89A 2P06A 4UB6Z 1IBMO 2GHYA 4LH7A 3ARZA 1BL8A 3AG1B 2M2AA 4CS2A 1Q3EA 3BABA 4Z2LA 4NZCA 1X6NA 3W7UA 1VQ4V 3OA5A 4DZ2A 1R6KA 3O5RA 2ESCA 1D5AA 4XBFA 1PNKA 4GX5A 2P4VA 4RWUA 4JFJA 2P4KA 1BCCH 2F23A 3EFFK 2QDOA 3T1CA 1L1PA 1L8DA 2WPDG 3EXAA 5IWAB 2DPEA 4FFBA 4LF4B 1M5YA 2WLIA 1WAWA 4ZPWR 3H9RB 3JSLA 2F4VB 5L3FA 2YBUA 2QWNB 3JAKA 2GUZA 5CA0B 2Q5ZA 1DGSA 3N2KB 2P90A 2MLYA 5LGNA 1I5XA 1LL7A 1NWTA 2RQ6A 1PL4A 4UVCA 1VF8A 1ROPA 3SYOA 3ABTA 1QU7A 4JYAO 4DR4O 5H5NA 2XP7A 3UQIA 1R3JC 5D5PA 1DF5A 3BCCH 4J42A 4OGQB 1NR7A 3KABA 4DV7B 3TDBA 3T1YO 5JWPA 2G8ZA 1LUWA 4X62B 2UUCB 4DV1O 3LUTB 4DR5B 3BXWA 5CB4B 4MVSA 4TNSA 3W7XA 5LA6A 4ZPTR 1VQOV 4DR3B 1KT1A 3KACA 1E1RG 1FJGO 3DC5A 2UXCO 2RQSA 2DE0X 3BPZA 3LSQA 5H9CA 1Q6IA 4ODOA 4MW3A 2B5UB 3RYIA 2OYQA 2O9OA 3I55V 1VQMV 1X6LA
chains in the Genus database with same CATH topology
2AWGA 2MF9A 2WLYA 1YW5A 2Q5AA 4NNRA 4Z2HA 1PINA 3O5QA 3WL1A 1NWRA 2RUQA 4ZS6A 5HT1A 3ARSA 4HBEA 3ARWA 1D7JA 2LJ4A 1HKJA 3UI4A 5HW6A 2XP9A 4Z2GA 4FAPA 1HJWA 5I98A 1FKSA 4TX0A 4U85A 5DIUA 1E15A 4O2TA 2DT2A 1LL6A 2DT0A 1CTNA 1ITXA 3KADA 1QPLA 2KO7A 2VCDA 2OLHA 4P8UA 4DRNA 3WD3A 2O92A 4DZ3A 1FD9A 3CHFA 3UF8A 1ZCNA 3O5DA 4WK9A 1FAPA 2PPPA 2A3CA 4LAVA 1FKRA 4R0XA 5BXJA 5DF0A 4P8VA 4WKFA 1ZBKA 2DT1A 1SYTA 5HW7A 2B31A 1IX5A 2XP5A 2ZQVA 3OOBA 4QIBA 1GPFA 3UQAA 1GUVA 5D75A 4QT3A 2FDMA 3G6MA 2ZR4A 1U79A 3O5LA 2DG9A 4WKHA 3WD0A 2PPOA 1F8AB 2WLZA 4QT2A 3UI6A 4G2PA 2RUCA 2XP4A 1FKLA 5GQBA 5HTGA 1E6ZA 4Z2IA 1F40A 1K9TA 1LL4A 1OWQA 2KGJA 2YBTA 4G50A 4Q7NA 1Q6UA 1FKGA 4L3NA 1FJDA 3RM4A 1W1YA 5HW8A 4MNLA 3RM9A 4J4OA 1HKKA 2KE0A 1SR0A 3ARXA 3PR9A 3WD1A 1ZB5A 3IHZA 4LAWA 2LKNA 4W5UA 3VAWA 1NMWA 5HWCA 1ZBWA 4AY1A 3WKZA 3ARUA 2AOSA 4JYSA 2F2DA 3AROA 3CGNA 4DRPA 3IK8A 2RSEA 4HBOA 3KAFA 1TCOC 5DITA 1JNSA 1NMVA 1W1TA 2QF8A 4KR0B 5B8IC 3B09A 3ALGA 3ODKA 1W26A 4IQCA 1ROTA 1BKFA 1HJVA 2F21A 3RM8A 4J4NA 1A7XA 1LG1A 1JNDA 3W4RA 1J4HA 5DIVA 2MNTA 3KAIA 2N87A 3FY1A 2D9FA 4DWSD 1HJXA 1T11A 4JFKA 1W1VA 3PRDA 4MGVA 4WKAA 1GOIA 1Q6HA 2KR7A 1D7HA 1HKMA 1UR8A 5HKGA 1D2KA 3AS2A 3GPKA 1H0GA 3CH9A 3O5GA 4LAYA 3NTPA 4ODRA 1QZ2A 1FKTA 1JVWA 1EHNA 2XP6A 1FKIA 4TW6A 1FFQA 3WQVA 4ML4A 3O5KA 1LQ0A 2IF4A 3JYMA 2G41A 4ODMA 4DRJA 4PTMA 3ALFA 4MTVA 4KQZA 1P5QA 1ZK6A 4ITZA 4C02B 1QPFA 3WL0A 4R5EA 3CGMA 3LUOA 2KI3A 1J4RA 4MPKA 1LG2A 1ZL1A 1LJYA 3WD2A 2DSUA 4MNMA 1R9HA 3KZ7A 1EYMA 2KFWA 1YATA 3B9DA 1H0IA 3AQUA 1B6CA 2PBCA 4GIVA 1ZBVA 1ZU8A 2M1IA 2XPAA 2DSZA 4TYOA 3UI5A 1JNTA 4S3KA 1HKIA 2LGOA 2PV2A 1OGGA 3FAPA 3RMEA 3ARYA 1W1PA 4GGQA 2FAPA 2F4EA 3ARVA 2DG4A 4ODKA 4DRIA 1D7IA 3WD4A 4Z2JA 4P8XA 1ZBCA 3EY6A 3RGCA 4DROA 3TCZA 2M08A 4JFIA 1W9VA 2ZQSA 1J6YA 2LPVA 3CHCA 1EIBA 3TC5A 4L72B 3O5PA 3G6LA 1PBKA 4DT4A 4DWSB 1FFRA 2ITKA 4NSBA 1XRVA 1UR9A 3O5MA 4DRQA 1FKBA 5HWBA 4HARA 2XP3A 3O5IA 3PRBA 3JYJA 4TW7A 4ODQA 4U86A 2OFNA 3ARTA 2MLXA 4MSPA 3B9EA 3MDYB 4XAKA 1ROUA 5J6EA 1Y0OA 3PRAA 3O5JA 1TFVA 1FKDA 1FKHA 2XP8A 4JFLA 1E6RA 1EQ3A 1KFWA 1OGBA 4FN2A 3UQBA 2UZ5A 1E9LA 4IT4A 1C9HA 3KAHA 2VN1A 1NWSA 4ODPA 2ZQTA 2ZR6A 3CHEA 3CZ8A 3ARQA 3IKDA 1J4IA 4MNKA 4DWSA 5DEZA 3AS1A 1E6PA 1BL4A 5HBFA 2DG3A 1WNOA 2WK2A 4DWSC 1NSGA 3AS0A 2ZR5A 1JNEA 4Q22A 4WJXA 1NH6A 1W9UA 2FKEA 2MLZA 5DO2A 2WM0A 3PA7A 2A3EA 1Q1CA 4IPXA 1O6IA 3KCEA 5JH8A 4S3JA 1FKFA 3O5FA 3O5EA 2A3AA 4W9PA 4DRKA 3WIJA 2XPBA 4BF8A 3B8SA 1W9PA 1KT0A 4DIPA 4URIA 1WB0A 3ARZA 4MNJA 3NI6A 2M2AA 4ODLA 2ZQUA 4Z2LA 4NZCA 2MPHA 1X6NA 4DH0A 3OA5A 4IQ2A 2DT3A 3O5RA 4DZ2A 4QZVB 2ESCA 3AS3A 3B7XA 3I6CA 4Z2KA 2PV3A 3NRKA 3WH0A 4JFJA 2IUZA 2L2SA 1L1PA 2DPEA 1M5YA 2RURA 2DSVA 2PI6A 1WAWA 4ZPWR 2PPNA 3H9RB 4TW8A 2DSWA 3ARPA 2PV1A 4W9QA 3KAGA 2YBUA 3B9AA 3FXYA 4N19A 3IKGA 2MLYA 1HXVA 4WIWA 4DRHA 1FKJA 1D6OA 1LL7A 1NWTA 4ODNA 1VF8A 2K8IA 2A3BA 5HUAA 2JZVA 4JFMA 3WQWA 2XP7A 3UQIA 3QOKA 2Y78A 1N1AA 4U84A 3KABA 3TDBA 2G8ZA 2RUDA 3JXVA 1EDQA 3BXWA 4LAXA 4MAVA 4TNSA 4ZPTR 5GPRA 1E6NA 3O5OA 1KT1A 3KACA 5GPGA 3CHDA 4DRMA 1NWUA 2RQSA 3ARRA 3RFWA 1FKKA 4W9OA 1Q6IA 4ODOA 4P8WA 4IT6A 1XHGA 1RD6A 2O9OA 4LGXA 4ZPVR 1X6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWG A;  2MF9 A;  3UI5 A;  1JNT A;  2MLZ A;  2FKE A;  3VAW A;  3PA7 A;  1YW5 A;  2LGO A;  1NMW A;  5HWC A;  2PV2 A;  1Q1C A;  3FAP A;  3IHZ A;  2Q5A A;  4IPX A;  4NNR A;  3KCE A;  4JYS A;  4GGQ A;  2FAP A;  2F2D A;  4DRP A;  1PIN A;  3CGN A;  3IK8 A;  3O5Q A;  2F4E A;  2RSE A;  1FKF A;  2DG4 A;  3KAF A;  3O5F A;  1TCO C;  2RUQ A;  3O5E A;  4ODK A;  5DIT A;  5HT1 A;  1JNS A;  4W9P A;  1NMV A;  1D7J A;  4DRK A;  4DRI A;  2LJ4 A;  2XPB A;  1D7I A;  5B8I C;  3B09 A;  3UI4 A;  4BF8 A;  5HW6 A;  3ODK A;  1W26 A;  2XP9 A;  4IQC A;  1ROT A;  1BKF A;  2F21 A;  4FAP A;  1KT0 A;  4J4N A;  4DIP A;  5I98 A;  1A7X A;  3EY6 A;  1FKS A;  3RGC A;  4DRO A;  3TCZ A;  2M08 A;  4JFI A;  1J4H A;  5DIV A;  2MNT A;  3KAI A;  4TX0 A;  2N87 A;  4U85 A;  2ZQS A;  5DIU A;  2D9F A;  1J6Y A;  4O2T A;  4JFK A;  1T11 A;  3NI6 A;  2M2A A;  2LPV A;  3KAD A;  4ODL A;  2ZQU A;  1QPL A;  2KO7 A;  2VCD A;  3PRD A;  4MGV A;  3TC5 A;  3O5P A;  2MPH A;  1PBK A;  4DT4 A;  1Q6H A;  4LAW A;  4DH0 A;  2KR7 A;  1D7H A;  4IQ2 A;  3O5R A;  4DZ2 A;  4DRN A;  5HKG A;  3B7X A;  3I6C A;  1FD9 A;  2PV3 A;  4DZ3 A;  3GPK A;  3NRK A;  3UF8 A;  1ZCN A;  3WH0 A;  4JFJ A;  3O5G A;  3O5D A;  4LAY A;  3NTP A;  4ODR A;  1QZ2 A;  2L2S A;  1FAP A;  1FKT A;  1L1P A;  2PPP A;  2ITK A;  1JVW A;  1M5Y A;  1FKI A;  2XP6 A;  2RUR A;  4LAV A;  4TW6 A;  1FKR A;  2PPN A;  3H9R B;  4R0X A;  3O5M A;  5BXJ A;  4TW8 A;  4DRQ A;  2PV1 A;  4W9Q A;  3O5K A;  1FKB A;  3KAG A;  5HWB A;  2XP3 A;  3O5I A;  3PRB A;  5HW7 A;  3JYJ A;  4TW7 A;  2IF4 A;  2XP5 A;  2ZQV A;  3OOB A;  4ODQ A;  4QIB A;  3JYM A;  4U86 A;  2OFN A;  3UQA A;  4N19 A;  2MLX A;  2MLY A;  3IKG A;  4MSP A;  4ODM A;  4QT3 A;  5D75 A;  4DRJ A;  4DRH A;  1FKJ A;  2ZR4 A;  1D6O A;  1HXV A;  1U79 A;  3MDY B;  3O5L A;  2DG9 A;  1ROU A;  4ODN A;  5J6E A;  1P5Q A;  1Y0O A;  2K8I A;  2PPO A;  1ZK6 A;  3O5J A;  4ITZ A;  1F8A B;  4QT2 A;  1FKD A;  3UI6 A;  4G2P A;  4C02 B;  5HUA A;  1QPF A;  1FKH A;  2JZV A;  4JFM A;  2XP8 A;  2XP7 A;  4JFL A;  3UQI A;  3CGM A;  2RUC A;  2Y78 A;  2XP4 A;  1N1A A;  4U84 A;  1FKL A;  1EQ3 A;  3LUO A;  5HTG A;  2KI3 A;  1J4R A;  3KAB A;  3TDB A;  4FN2 A;  2RUD A;  3JXV A;  2UZ5 A;  3UQB A;  1F40 A;  1C9H A;  3KAH A;  4LAX A;  2VN1 A;  2KGJ A;  4TNS A;  4G50 A;  4ODP A;  2ZQT A;  2ZR6 A;  1R9H A;  3O5O A;  2KFW A;  1Q6U A;  1EYM A;  1FKG A;  1KT1 A;  1YAT A;  3IKD A;  3KZ7 A;  3KAC A;  5GPG A;  1FJD A;  4DRM A;  1B6C A;  5HW8 A;  1J4I A;  2PBC A;  2RQS A;  4J4O A;  4GIV A;  3RFW A;  1FKK A;  4W9O A;  1Q6I A;  4ODO A;  2KE0 A;  1BL4 A;  2M1I A;  2DG3 A;  1NSG A;  2ZR5 A;  2XPA A;  4TYO A;  2LKN A; 
#chains in the Genus database with same CATH topology
 2AHZ A;  1K9M W;  2Q7H A;  1GM8 A;  1M4U A;  4WCE V;  4GZR B;  4DV3 B;  1PIN A;  2UXD B;  3ABM C;  1NWR A;  1THZ A;  3ARS A;  3ARW A;  1EN6 A;  3L72 H;  3BA9 A;  3OTF A;  3MHH C;  3UI4 A;  2XP9 A;  4TV9 B;  2LGQ A;  4B3R B;  2JIZ G;  5I98 A;  1FKS A;  3ZED A;  4D7T A;  4O2T A;  4NYK A;  5GON B;  2F95 B;  3LSU A;  3SJQ C;  3QNE A;  1KC8 W;  4UVB A;  4X65 O;  3H1K H;  5LHI A;  1AP6 A;  3G67 A;  1HR0 B;  3OE7 G;  4C7U A;  1FAP A;  1BHB A;  3MDS A;  4DV4 B;  1MG1 A;  3L75 H;  2HLD G;  1FKR A;  2QWO B;  1H8H G;  4X20 B;  2KB1 A;  5DF0 A;  1O9H A;  5L3E A;  2QJ1 A;  4DR3 O;  1QLN A;  5HW7 A;  1CXZ B;  4JI0 B;  2QGN A;  2OTJ V;  1TUB A;  4BIU A;  4QT3 A;  3G6M A;  3T2M A;  1NTK H;  2DG9 A;  3CCQ V;  1J5E O;  4NXM O;  3WD0 A;  2PPO A;  1ZX3 A;  1Q81 W;  5LP6 A;  4TT3 G;  3DSQ A;  1GAX A;  2IM9 A;  2QKA A;  3CS5 A;  3ZBH A;  3G6B A;  1N34 O;  1E6Z A;  4Z2I A;  1MZE A;  1OCR B;  1M90 W;  2Z0A A;  3ZRW A;  3CME V;  1OWQ A;  2IJJ A;  1AVM A;  1XUQ A;  5IY5 C;  3IC7 A;  2YUA A;  1SZT A;  2CH7 B;  4PA6 A;  1FJD A;  3RM4 A;  5HW8 A;  3HKE B;  4J4O A;  4BW9 A;  2GTA A;  1VQK V;  2KE0 A;  3CRC A;  3D8C A;  4LFC B;  3ARX A;  3PR9 A;  3WD1 A;  1Y76 B;  3WG7 C;  1MNG A;  2DOS A;  3FYI B;  4WFF A;  2IU0 A;  3KZI Z;  1Q82 W;  1NMW A;  5HWC A;  2UUC O;  4O4J B;  4JYS A;  2EIM C;  3CGN A;  3IK8 A;  3RFR A;  3KAF A;  1R3I C;  4KR0 B;  5A9G A;  2WLL B;  4IQC A;  5LHG A;  1ROT A;  4PI2 A;  1W0J G;  5CA0 A;  2AZ2 A;  5DIV A;  1IXB A;  1R3K C;  3E8H A;  3O65 A;  1WP7 A;  1HJX A;  1H2S B;  4JI4 O;  1SER A;  3G6E V;  4MGV A;  2ODM A;  3S3X A;  2KR7 A;  1S5J A;  4P9P A;  3VQY A;  1V54 C;  4CBC A;  3ABU A;  3BFR A;  3K5M A;  3AG3 B;  1FKT A;  2ZIN A;  1H2K A;  1AI5 A;  4JAU A;  3T4D A;  3UCS C;  5B1N A;  1R3L C;  3VQV A;  1FFQ A;  4ML4 A;  2ZDI A;  3UT5 B;  2DYR C;  3UO3 A;  3JYC A;  1ZWI C;  5BR8 B;  1FFX A;  2ZXW B;  2Y0I A;  3HPL C;  5EYP A;  2JS3 A;  3ASO C;  2N05 A;  4DV6 O;  4NXN B;  4ODM A;  4DRJ A;  1NBM G;  3FD9 A;  4OX9 O;  4UDM A;  3B8M A;  4BAY A;  4I9W A;  1Y66 A;  2YXY A;  2UU9 B;  2PY5 A;  4GLX A;  5KLV H;  2EJR A;  4C02 B;  1RSO A;  2JDI G;  4QGP A;  3ETD A;  4JI2 B;  3EIP A;  4YJ3 A;  3F7Y C;  3LDE A;  5DEC A;  4DR1 O;  4Q6G A;  1LJY A;  5L3D A;  2JGD B;  3WD2 A;  2X6B A;  4I0X A;  5DM6 V;  1KD1 W;  4MNM A;  2VQE B;  2M6Y A;  1N33 O;  1YAT A;  5HFL A;  3B9D A;  1E44 A;  1H0I A;  1SKV A;  3AK3 A;  1B6C A;  3SDL A;  1AJN A;  4PA3 A;  3CC7 V;  1U97 A;  4LF9 O;  2XPA A;  2W0X A;  2IJH A;  3HKB A;  2A9H A;  1T5E A;  3UT5 A;  3CRR A;  4YIP A;  3J7A U;  2BTQ A;  3FAP A;  5D5Q A;  4I55 B;  4J9Y B;  5LOV B;  4Z1V A;  1UJW B;  4DR2 O;  4LCU C;  3RBZ A;  2ZXW C;  1N4C A;  2ZE6 A;  2Y69 C;  3OMI B;  4PDR A;  4Z2J A;  1OZ0 A;  3RVY A;  3H9V A;  4JI8 O;  3EY6 A;  2YIC A;  1W9V A;  1Q5O A;  3H1J H;  3JD0 A;  1N36 B;  2AW9 A;  5CMU A;  3TJT A;  1EIB A;  1F7Y A;  3ZMS A;  4DT4 A;  5GTI Z;  5LP6 B;  2EZO A;  4DWS B;  1W59 A;  2H94 A;  4TUY B;  1XMO B;  3VQX A;  2FML A;  4LC1 A;  1XRV A;  1JJO A;  4UCO A;  3ZRW B;  5IYZ A;  4PDM A;  4RQF A;  3PRB A;  1AJP A;  1AR1 B;  3FB8 C;  4DV2 O;  3OGI B;  3ZHQ A;  2B1I A;  4O2B B;  1ROU A;  2HEP A;  1Y0O A;  2Y0P A;  4W4K A;  1K34 A;  4JFL A;  3K79 A;  3CRM A;  1E6R A;  1RP3 B;  2QWP B;  2QM7 A;  4X1Y B;  3KG2 A;  1B3Q A;  2O57 A;  3K5O A;  3K3W A;  5EC1 C;  4FN2 A;  2UZ5 A;  1GRJ A;  1E9L A;  3F7V C;  3HKC A;  2HJD A;  5LHH A;  4ABM A;  3TGU H;  3CZ8 A;  3FAV A;  4FLU A;  1XEQ A;  3PJS K;  1VQ6 V;  2RDC A;  1IXM A;  4MTF A;  4MNK A;  3IGA C;  1OV9 A;  1VEW A;  3K5N A;  1YZB A;  3K58 A;  1O9G A;  2ZR5 A;  2EUL A;  5LL6 Y;  5CA1 A;  1Q1C A;  4U3J B;  1FPO A;  1O6I A;  3KCE A;  3ZHS A;  4B3S B;  1K33 A;  4KHP B;  1SET A;  1XIL A;  4DRK A;  2XT9 A;  2ZKO A;  1YSC A;  4JI2 O;  1EN4 A;  3MD0 A;  5GON A;  4MT8 A;  1K92 A;  3NI6 A;  3UQ8 A;  3LDD A;  3K03 A;  2ZQU A;  1WPX A;  3WB1 A;  1HNZ O;  4DUY O;  2JK5 C;  4DH0 A;  4IQ2 A;  1H8E G;  2LW7 A;  2ZD9 A;  1M5I A;  3B7X A;  1RFY A;  5EBL C;  2YDE A;  2PV3 A;  3AK1 A;  4LBE C;  3ZHV A;  3OW2 U;  3BHP A;  4R50 A;  5KHK A;  3ASN B;  2P6J A;  2L2S A;  2UXD O;  5JH7 A;  2RUR A;  2PI6 A;  1XRE A;  5FNV A;  3JAT A;  3SJA C;  4TW8 A;  2PV1 A;  4W9Q A;  1K97 A;  5EK0 A;  5B1B C;  3FB5 C;  3D36 A;  3BAA A;  4FFB B;  3UKM A;  3IKG A;  4U3J A;  4WIW A;  5LXT A;  3JAL B;  1S0V A;  2YI8 A;  4OXS A;  3RYH B;  2Q8V A;  2K8I A;  1IX9 A;  2DYS B;  2DQ3 A;  3QF7 A;  4WFG A;  5HUA A;  2EIM B;  4JFM A;  3THO A;  2E5L B;  2Y78 A;  4K8X A;  4UCU A;  3CE2 A;  2HR3 A;  3OD4 A;  3JXV A;  1XBL A;  1Q90 D;  1TUE B;  5GPR A;  4MTG A;  3CRQ A;  3CCV V;  4P2Z A;  4HYO A;  4CH3 A;  4KP4 A;  3SYA A;  4JI6 O;  1NWU A;  4KUM A;  4WFA V;  4K3A A;  1XMQ B;  3OT7 A;  4LNU A;  4ASU G;  3RFW A;  5CN0 A;  4X8A A;  4U7O A;  1VQ8 V;  1JCH B;  2DW4 A;  4LGX A;  3OFN G;  3BRC A;  4LFC O;  5K1P A;  1XHX A;  2A06 H;  2AWG A;  2MF9 A;  4KHP O;  1S77 D;  1Q86 W;  2WLY A;  1PNM A;  2XAJ A;  2JS5 A;  2F43 G;  4CS3 A;  1YW5 A;  2YIA A;  2L35 A;  4UB8 Z;  3GB7 C;  4NNR A;  5CBF A;  1JCH A;  2UXX A;  3O5Q A;  1G8M A;  3Q4H A;  2JGD A;  4MVM A;  3WL1 A;  4DK0 A;  3JAR A;  5HT1 A;  2RMK B;  4NKG B;  4JI8 B;  2LJ4 A;  5IYZ B;  1U96 A;  3DTU B;  2WA4 A;  4GKJ O;  3OR6 C;  2A7W A;  2ETN A;  2GDS A;  1VIB A;  5DIU A;  4RAI A;  2DT2 A;  4FZ1 A;  2DT0 A;  3KAD A;  2P5O A;  1QPL A;  1GK9 A;  3TXQ A;  2OLH A;  2QE7 G;  2KSD A;  2XOK G;  3VQW A;  4BWA A;  4PEL A;  2ZE5 A;  2LFR A;  4KFM A;  1NR1 A;  1B06 A;  5EBW C;  4LP8 A;  2VQF O;  4JAS A;  4H0L B;  4DV7 O;  5F2V O;  1IBL B;  2A3C A;  5KA5 A;  1SQF A;  2ITC C;  4LAV A;  2A79 B;  2CK3 G;  4I4T A;  2F1M A;  1JFF A;  4R0X A;  2GTS A;  3DC6 A;  4P8V A;  1GKF A;  4GUN A;  1ZBK A;  2YIB A;  3DXR B;  2KKW A;  4FZ0 A;  4WFB V;  1P7G A;  2ZQV A;  1IX5 A;  3STZ C;  4QIB A;  4U3F H;  3WFV A;  4DV5 O;  2Y69 B;  3WG7 B;  5D75 A;  3OM3 B;  1HP8 A;  1U79 A;  4PDV A;  4FM2 A;  3QO5 A;  3K59 A;  1SS3 A;  2Y48 A;  3A8T A;  1G4Y B;  5AG2 A;  1E79 G;  5EIB D;  3HKD B;  1KMI Z;  4DYL A;  2RUC A;  4CS4 A;  4F6R B;  4H13 B;  1FKL A;  2XP4 A;  4NTX A;  3OMA B;  2Q68 A;  4UUJ C;  1VF6 A;  3CCM V;  4B3R O;  5LP6 C;  1AR5 A;  1R73 A;  1F40 A;  4LF7 B;  1K9T A;  1PL0 A;  2KGJ A;  4J9Z B;  2FL4 A;  1H38 A;  1N0N A;  2ADQ B;  2ZIO A;  3JSN A;  1FKG A;  3T4Z A;  5BY1 A;  1URF A;  3GU0 A;  3ZMZ A;  3ZRX A;  1FXK C;  3F5T A;  4FMT A;  1EZJ A;  2EIL B;  3IHZ A;  2Q6A A;  2LKN A;  2X0L A;  4X89 A;  2ZM6 B;  2DMX A;  3DXR A;  3AG3 C;  3C3S A;  4O4H B;  1ZBW A;  3ZIA G;  4JI4 B;  5LOV A;  3ARU A;  2XND G;  1M9N A;  2F2D A;  4DRP A;  3MAQ A;  2RSE A;  1FFX B;  1JJ2 U;  2RNB A;  3P3P A;  1TCO C;  4B3M O;  2Y4U A;  1KB9 F;  1R1B A;  3SGI A;  1JNS A;  1QR8 A;  1W1T A;  4JYY A;  3KKY A;  1OCR C;  2GV9 A;  3ALG A;  3RN4 A;  1Z5W A;  1UFI A;  3ABL C;  3P30 A;  4J4N A;  1SC5 B;  3RGB A;  2LW1 A;  2OCH A;  4XDK A;  4J11 A;  3JAS A;  4JYA B;  1T11 A;  4JI7 B;  4KL1 A;  4WKA A;  1GOI A;  4ZBM A;  5JJN B;  1TA8 A;  5EYP B;  1UR8 A;  4I50 B;  2XAG A;  2LQT A;  3RYF A;  2ZR3 A;  2JJ2 G;  3RYH A;  3ZCC A;  2YI9 A;  1VQ9 V;  2ARH A;  1VF5 B;  1JVM A;  2DJV A;  1JVW A;  1AJQ A;  5KUM A;  1EHN A;  3CCS V;  1BQZ A;  1K5Q A;  4LF4 O;  2AHY A;  4OPH A;  5IJ9 B;  3O5K A;  1N8R W;  5GTH Z;  4JPR A;  1LQ0 A;  1I7F A;  1NJI W;  3JYM A;  5FLX N;  2BSK B;  4EB6 A;  4JI3 B;  1Y67 A;  2KG7 B;  4XDL A;  4CH6 A;  4JZG A;  3CX5 F;  5KHG A;  1N34 B;  3SYC A;  3K57 A;  5H2F Z;  1QPF A;  2GSM B;  3H1H H;  1YTF B;  4J80 A;  3G4S V;  2WLL A;  5B5E Z;  1NT2 B;  1M57 C;  1XL4 A;  3I5D A;  1W0K G;  2L6L A;  2P7T C;  1NH2 B;  2KI3 A;  2FYU H;  2ZE8 A;  1AB3 A;  4FLW A;  3R66 A;  5IYD O;  4MPK A;  1KP2 A;  5LYJ B;  1ZL1 A;  4ICG A;  2QR4 A;  4FFK A;  5CA3 A;  2ZM6 O;  5EZY B;  3O9O A;  1QR9 A;  4O4J A;  4ZHQ B;  1KQS U;  1R9H A;  3K04 A;  4MTO A;  2KFW A;  3KZ7 A;  4MW8 A;  1Z5V A;  4HAM A;  3JAK B;  4X65 B;  1KEC A;  1YIJ V;  1YCI A;  3SJB C;  4GIV A;  4X66 O;  3JAL A;  4DUZ B;  1L0N H;  4X1Y A;  5B1A B;  4ZKI A;  2M1I A;  2UUB O;  2PYJ A;  2ZIM A;  2Q7E A;  2DSZ A;  3AK2 A;  1ZL8 A;  3UI5 A;  4YJ2 A;  1JNT A;  4S3K A;  4FK5 C;  5B1O A;  3B40 A;  3JAT B;  4DV0 B;  1FYJ A;  1W1P A;  1DTO A;  5L3C A;  3ARV A;  3JD3 A;  2DG4 A;  2AXT Z;  2E76 B;  4MVR A;  2PUS A;  3CP1 A;  4MVQ A;  3N2G A;  1JR9 A;  3HB3 B;  4P8X A;  3OGC C;  2ZNI A;  4DW1 A;  2ZT9 B;  1N32 B;  4Q20 A;  4WBN B;  3RGC A;  3OEH G;  4JFI A;  1XNR B;  1XNR O;  2QM4 A;  2ZQS A;  5IJ9 A;  1VQL V;  5DED A;  4K0K B;  3QG5 A;  4PA7 A;  4L72 B;  1EZV H;  3D3I A;  3CJH B;  3L9D A;  1LNQ A;  1H2N A;  2HJF C;  5B66 Z;  1Z2G A;  2HHH B;  3W7W A;  4UV8 A;  1F4M A;  4R6Z A;  2WLI B;  4TV9 A;  2PYL A;  4NSB A;  2YSU B;  1HNX O;  2FKX A;  1HNX B;  2MK3 A;  2NN4 A;  4B3S O;  4DV4 O;  2PI4 A;  3JAW B;  4DRQ A;  2BE3 A;  1HNW B;  1FKB A;  3LNM B;  4HAR A;  3QTC A;  3GVM A;  3O5I A;  3JYJ A;  3TET A;  2B9Z A;  4ODQ A;  4U86 A;  1TUB B;  2OFN A;  1WA8 B;  4I55 A;  2PI5 A;  4RQE A;  1BE3 H;  3IFX A;  5J6E A;  4JI1 O;  1OCZ C;  3O5J A;  4K0K O;  1ENV A;  3OTO B;  1FKH A;  1SA0 A;  4J7K A;  4HNA B;  1KFW A;  4QNH B;  3STL C;  5LMN B;  2Q7G A;  2CAZ C;  3KAH A;  4AHC A;  5JQG B;  4J7J A;  2OIE A;  2ZR6 A;  2ATK C;  1YJN V;  3H01 A;  2WA3 A;  4BIZ A;  4LF9 B;  3UM7 A;  4GYC B;  4DV3 O;  1GM9 A;  1BZK A;  3CHX A;  4MVO A;  1XMQ O;  5DEZ A;  5IWA O;  1QBZ A;  4JI6 B;  1E6P A;  3ZMT A;  4WBN A;  2GBO A;  5KX5 A;  3FB6 C;  1S76 D;  3EHB B;  4DV5 B;  4WJX A;  1NH6 A;  2MLZ A;  4B3T O;  2FKE A;  1RPR A;  4J41 A;  4LWS A;  2A3E A;  5FPR A;  4IYI A;  1Y6X A;  3B2E E;  1VMG A;  2N04 A;  3E8G A;  4X88 A;  4PD4 F;  3G80 A;  3IAY A;  4ZIB A;  4S3J A;  2DYR B;  2E5L O;  1FKF A;  4PA9 A;  2A3A A;  4W9P A;  1SES A;  2XPB A;  1OCC B;  4DR6 B;  3QO7 A;  2UU9 O;  5LXT B;  4DV1 B;  1W9P A;  3SPG A;  5C8Y A;  1KT0 A;  4URI A;  4NR1 A;  1KKD A;  3SPI A;  3HKE A;  4O2A B;  1BS3 A;  4X1I B;  4MNJ A;  1QLE C;  3E35 A;  3A0H Z;  2MPH A;  2W6J G;  1RSO B;  2DT3 A;  2CTW A;  1I5Y A;  4Z2K A;  2YID A;  2P67 A;  2UXB O;  1ZUQ A;  4CC6 A;  1YIT V;  2PTM A;  3IJ4 A;  4L87 A;  1MSW D;  2WAM A;  4CH5 A;  1FKA O;  2AGA A;  4FLT A;  4LF8 B;  2DSV A;  3U10 A;  4FLV A;  5LYJ A;  2PPN A;  4DO2 A;  2OTL V;  2DSW A;  3ARP A;  1NKD A;  3GTY X;  1ORQ C;  2WSS G;  2LFS A;  2QKS A;  3B9A A;  4F4L A;  3FXY A;  3NR7 A;  3CYO A;  3ICX A;  1HXV A;  1D5N A;  1FXK A;  1FKJ A;  4MS2 A;  1D6O A;  4IL6 Z;  2EIJ B;  3DGE A;  2Q0A A;  3OEE G;  5H6Q A;  1M56 B;  4BW5 A;  4GX2 A;  3OAA G;  2A3B A;  2IH3 C;  1IBK B;  3OUS A;  5BMV A;  1VAR A;  4U84 A;  3K5L A;  2XHB A;  2CGN A;  2RUD A;  1PP9 H;  1EDQ A;  4LAX A;  4MAV A;  3RT3 C;  1KBH A;  3O5O A;  3QO8 A;  1S3J A;  3W7S A;  2EIK C;  2HFE C;  3JD1 A;  1IBM B;  1WB8 A;  4PDL A;  3ARR A;  2Q73 A;  1L1F A;  1FKK A;  4W9O A;  4PA4 A;  2YEV B;  1HW7 A;  1XHG A;  2N74 A;  1RD6 A;  4DR1 B;  4ZPV R;  2QWQ B;  4LFA B;  4GKJ B;  2YIB D;  5B3S B;  3CXH F;  4UCT A;  1P49 A;  5JJE B;  3ABK B;  2DYS C;  4LF6 O;  4Z2H A;  3K9S A;  4QIW F;  3SJC C;  1PKX A;  2RUQ A;  2XUM A;  1N32 O;  1YJW V;  4TUY A;  4HBE A;  4DV0 O;  3U11 A;  1NTM H;  2CH7 A;  3TXS A;  5HFM A;  1JA8 A;  5HW6 A;  1COW G;  1E1Q G;  3H1I H;  1ZAU A;  2E75 B;  3ML0 A;  2UUA O;  3CC4 V;  4FAP A;  1HJW A;  2EZP A;  3JCZ A;  2YS8 A;  2IW5 A;  4I5S A;  1SQG A;  5LGT A;  4O4H A;  4TX0 A;  4AIL C;  1YHQ V;  1LL6 A;  1X4T A;  4DRX A;  1ITX A;  1ARO P;  3K9A A;  5LA6 B;  4P8U A;  4N23 A;  2P22 C;  4DRN A;  3CEI A;  3WD3 A;  4HZ3 A;  4LWS B;  2MW2 B;  3CCE V;  1FD9 A;  2O92 A;  3UF8 A;  5JCO C;  4BR6 A;  4CZZ A;  1EFR G;  3K06 A;  5JCO A;  2LP7 A;  2JRI A;  4GKK B;  2M7W A;  3L73 H;  2FB5 A;  4WKF A;  4L8J A;  4FVM A;  3ZRS A;  2VQF B;  2DT1 A;  3E2E A;  2LGW A;  3GWK C;  4GT1 A;  2B31 A;  3JCU Z;  4TV8 B;  1GPF A;  3UQA A;  1XNQ B;  1S5L Z;  4FM1 A;  3E83 A;  2ZNJ A;  3E86 A;  1CEZ A;  4WKH A;  5B3S C;  3T1H O;  1S72 V;  1N33 B;  4UCR A;  4G2P A;  4DR4 B;  2WWW A;  1SA0 B;  1SF9 A;  3RYI B;  2KQX A;  5GQB A;  1UPG A;  4NVP A;  4G27 B;  1AR4 A;  2HVJ C;  3ABL B;  5IE9 A;  2YBT A;  4G50 A;  3ASN C;  5KHH A;  4X64 O;  4L3N A;  2QEX V;  1P84 F;  4IHJ A;  1P4R A;  4UFZ A;  5TIS Z;  3GWO A;  1QCE A;  3M8A A;  3S3W A;  4NXM B;  2ZE7 A;  1SR0 A;  4EKW A;  1K5S A;  4W5U A;  4QPK A;  1QVF U;  2EIN B;  3FX7 A;  1WJZ A;  4PJ0 Z;  4JZ2 A;  3BA8 A;  4X1K A;  4AY1 A;  1WB7 A;  2Y4T A;  2AOS A;  2X7R B;  3ARO A;  4IGG A;  5BMV B;  4HBO A;  1J95 A;  2DN9 A;  1W2B U;  4LFB B;  1AI4 A;  1V9P A;  1RPO A;  3B09 A;  5FNV B;  3AG2 B;  3ODK A;  1TVK B;  2ZR2 A;  2F21 A;  1XHZ A;  1FS0 G;  4FIP C;  3ZS8 C;  5CB4 A;  2XAS A;  5J2T A;  3B8N A;  4K8Z A;  1JND A;  1J4H A;  5ITZ A;  2MNT A;  2N87 A;  2D9F A;  3BEH A;  1WPB A;  1YF2 A;  1N36 O;  5KUK A;  4D6T H;  1WAZ A;  2X6C A;  1FXK B;  4MVZ A;  3G71 V;  5LGU A;  1YTF D;  2G38 A;  2CTQ A;  4Z1M G;  4LNU B;  2HG5 C;  3JAS B;  3H1L H;  3GPK A;  1H0G A;  4ODR A;  3HKD A;  1GN3 A;  3ETE A;  3J81 N;  1FKI A;  3VBB A;  3CC2 V;  2VWJ A;  4TW6 A;  2PZS A;  4QE9 A;  1RM1 B;  4N21 A;  4HBN A;  1XOU A;  5B1A C;  3NXS A;  2IF4 A;  1OCC C;  2G41 A;  1KKC A;  2JEU A;  1BGY H;  1QHT A;  4NB5 A;  3CSX A;  4MTV A;  1ZK6 A;  4WFE A;  1SZX A;  3WL0 A;  1US6 A;  4R5E A;  1BT8 A;  4MVU A;  4WFH A;  3LUO A;  1J4R A;  5LBQ A;  2QM8 A;  5ITZ B;  1LG2 A;  4JI5 O;  4B3T B;  5IT9 N;  4CC5 A;  1QVG U;  4AQY B;  5KX5 B;  1EYM A;  4ZOL A;  4H37 A;  2CGO A;  2ADP A;  3AQU A;  2ZDI C;  4UV9 A;  2FTK A;  1JFF B;  1ZBV A;  1ZU8 A;  2R9I A;  4CH4 A;  4PV1 B;  3TCU A;  4UCV A;  1N0J A;  1OCO B;  4FLZ A;  4JTA B;  1OGG A;  1AI6 A;  2FAP A;  4FLX A;  1XMO O;  2R72 A;  5L3G A;  3ZMU A;  2HVK C;  2V1D A;  3T1H B;  1FXV A;  1EN5 A;  2Q69 A;  2IBZ H;  1ZBC A;  2EIJ C;  5BR8 O;  3OR7 C;  3LNN A;  5CA1 B;  2QSA A;  2R70 A;  1J6Y A;  4EFB A;  4LF8 O;  3CHC A;  3L71 H;  1ZSP A;  2V4D A;  5J9P C;  3CB2 A;  1QNM A;  2Q0O C;  3FB7 C;  4NTW A;  1VQ7 V;  3TC5 A;  3G6L A;  4TQF A;  4H33 A;  3VOU A;  3HKC B;  2UXN A;  4JTC B;  3ZRV A;  2VQE O;  4EEQ A;  1FFR A;  1MZF A;  5LMU O;  1L0L H;  4XDJ A;  1Y4M A;  3E8B A;  5K1X A;  3ABK C;  2PF4 E;  1NU1 H;  4X9Q A;  1UR9 A;  4JAA A;  1LUV A;  2ILM A;  3AG4 C;  1BMF G;  2QWR B;  4X1I A;  5HWB A;  1K8A W;  2BOC C;  4TOI A;  4G28 B;  4TW7 A;  3CJH A;  3ART A;  3ZN0 A;  1GTO A;  4JTD B;  1OCO C;  3N2G B;  4LFB O;  2C2A A;  5L3B A;  3KCX A;  3PRA A;  2LJ2 A;  5KA6 A;  3B77 A;  1NZ6 A;  4O4I B;  5JVD B;  4NTY A;  2XP8 A;  3CPW U;  3RYC B;  1EQ3 A;  3PN1 A;  4B7E A;  5EC2 C;  1MAB G;  1OGB A;  3UQB A;  3RVZ A;  1C9H A;  3JAM N;  2VN1 A;  4ODP A;  2ZQT A;  5C93 A;  1GM7 A;  2B5U A;  4I0X B;  1M1K W;  3CHE A;  3IKD A;  2UUB B;  4RO2 A;  5KAF Z;  4GX0 A;  2PGG A;  1J4I A;  4A5U B;  4DWS A;  2QA4 V;  4JI1 B;  2VS0 A;  3AS1 A;  5JH7 B;  5HBF A;  2Q9L A;  4LR3 A;  1VP7 A;  2DG3 A;  4DWS C;  2K1E A;  2CE4 A;  1JNE A;  5IJ0 B;  1GN2 A;  3X2Q B;  1PD3 A;  4JI0 O;  3ZMV A;  3A0B Z;  2WM0 A;  2JJ1 G;  3FYE B;  1PV0 A;  1OCZ B;  3CCJ V;  4IPX A;  4DXW A;  3E22 B;  1IZ3 A;  3O5F A;  1J5E B;  1M57 B;  4EFE A;  3P32 A;  3WIJ A;  1KUQ A;  2R9R B;  3L74 H;  4BF8 A;  3B8S A;  4X66 B;  3U0Z A;  4I9Q A;  4E2L A;  1TVK A;  4DIP A;  5J2U B;  1LR1 A;  4H44 B;  1EM1 A;  1WB0 A;  1D2D A;  4GKK O;  4ODL A;  2IU3 A;  3CCL V;  4DW0 A;  5DN6 G;  2ZQM A;  2V7Q G;  3KCY A;  1I08 A;  2NNU A;  2YC0 A;  4QZV B;  1NVP B;  3AS3 A;  1FXH A;  3I6C A;  1NVP D;  4OPA A;  3NRK A;  3WH0 A;  1Q7Y W;  1F4N A;  3BMB A;  2IUZ A;  1HWY A;  3SPC A;  1WN7 A;  2OIG A;  1IDS A;  4LF6 B;  2AZ0 A;  4ZI7 A;  4U7N A;  3KAG A;  1NS1 A;  2WLJ A;  4YY3 O;  4YY3 B;  4N19 A;  3I56 V;  4LF7 O;  3AG2 C;  2EIN C;  3J80 N;  4DRH A;  1XNQ O;  4ODN A;  4FPP A;  2JZV A;  2EBO A;  3WQW A;  4Z2W A;  3QOK A;  1N1A A;  2VWK A;  1PPJ H;  2IJK A;  1X59 A;  4UCS A;  1Y74 B;  3CCR V;  4DR5 O;  4DV2 B;  4X20 A;  2E74 B;  3E22 A;  1SQX H;  2DQ0 A;  3JD2 A;  3OTO O;  4LF5 O;  1DF4 A;  1E6N A;  3R65 A;  2NLJ C;  3ZN1 A;  5GPG A;  1G1X B;  2X6A A;  1FJG B;  3CHD A;  4DRM A;  1I94 B;  3D36 C;  4P8W A;  4IT6 A;  1VF7 A;  5IDJ A;  1VQP V;  2EX3 A;  3P3N A;  4JI3 O;  3T1Y B;  5KMG A;  2OWO A;  4DR7 B;  1SQV H;  4JV5 O;  1JX9 A;  1M56 C;  4D7S A;  2Q5A A;  4O4L B;  2XTA A;  3OUF A;  3QVN A;  4ZS6 A;  2OCC B;  1D7J A;  3WB2 A;  4W4L A;  1K3E A;  5FPO A;  1K73 W;  1HKJ A;  3M7M X;  4F6R A;  1MOF A;  4Z2G A;  2EJ7 A;  2IJI A;  2CTR A;  3ZHR A;  2GUZ B;  4I7Z B;  4U85 A;  3A0R A;  2JVD A;  1E15 A;  2IH1 C;  1WLE A;  1H2G A;  3APO A;  5CBH A;  3CXC U;  1CTN A;  1H2L A;  2KO7 A;  2VCD A;  2BOB C;  2BTQ B;  1IBL O;  4RUF A;  3FFQ A;  4LH6 A;  1QQC A;  2EIL C;  2WLM A;  4DZ3 A;  3CHF A;  1ZCN A;  1Q8I A;  3AEI A;  3O5D A;  2H3O A;  4WK9 A;  2WLK A;  2F66 C;  4B3M B;  2PPP A;  1ZLZ A;  2BSK A;  4EB6 B;  3A2F A;  2YEV A;  3BY6 A;  5EZY A;  1I94 O;  2VRZ A;  5BXJ A;  5EIB C;  4YHH O;  3JAW A;  1YEW A;  4IIJ A;  1S5H C;  1SYT A;  1NH2 D;  3FAV B;  2XP5 A;  3OOB A;  3D3Q A;  4JI5 B;  1GUV A;  1M93 A;  4O4L A;  2FDM A;  2ZR4 A;  3CCU V;  3O5L A;  5IYC O;  3OMN B;  1PNL A;  3JAR B;  1JPX A;  3HKB B;  1F8A B;  3APQ A;  2WLZ A;  4QT2 A;  3UI6 A;  1IVS A;  4IYH A;  4TSF G;  2RCV A;  1DLB A;  1F23 A;  1HDJ A;  5HTG A;  4TQD A;  1KYO F;  1FAF A;  1LL4 A;  3Q4H B;  4F6E A;  3K0G A;  4Q7N A;  1JMK C;  1BHA A;  1Q6U A;  3AG1 C;  5FL7 G;  1WP8 A;  1IUR A;  1W1Y A;  5KHI A;  1Y74 A;  1YXB A;  2HKO A;  2E3C A;  4MNL A;  3RM9 A;  1XDC A;  3RYF B;  3AG4 B;  3AG7 A;  3RWR D;  1AIL A;  4I50 A;  4P30 A;  1HKK A;  5EBM C;  4B7K A;  2YXH A;  1ZB5 A;  4LAW A;  4DR2 B;  4R7C A;  4IIJ B;  2CDY A;  5CBG A;  3VAW A;  5KMG B;  4UXN A;  2WLN A;  4GX1 A;  4B08 A;  4ZOL B;  3WKZ A;  3K0D A;  5A2Q N;  1P7B A;  4MSW C;  2W6I G;  5DIT A;  1NMV A;  2QF8 A;  2YXL A;  1YJ9 V;  5B8I C;  3EVK A;  1W26 A;  4K35 A;  3RM8 A;  1BKF A;  4MTX A;  1HJV A;  1GN4 A;  1A7X A;  1GN6 A;  1LG1 A;  2D2C B;  3SPJ A;  3W4R A;  3KAI A;  3FY1 A;  4G2K A;  3ZHU A;  4DWS D;  4JFK A;  2EIK B;  1K4D C;  1OJH A;  1W1V A;  5H6R A;  1CPY A;  3PRD A;  2LO1 A;  1Q6H A;  4DR6 O;  2QTO A;  2Q4P A;  1D7H A;  1HKM A;  1SQQ H;  5KAI Z;  4BIO A;  5HKG A;  1TGO A;  1D2K A;  1PM9 A;  3AS2 A;  1VQN V;  1AP5 A;  3JD4 A;  1H2M A;  3CH9 A;  3O5G A;  4LAY A;  3NTP A;  1QZ2 A;  1NTZ H;  4UVA A;  3RW0 A;  2HP8 A;  2XP6 A;  1Q43 A;  3ETQ A;  1R6N A;  3WQV A;  4OX9 B;  3BVO A;  2WLH A;  4ZI7 B;  4X64 B;  4JV5 B;  4YJ2 B;  1NQT A;  2RN9 A;  3M99 B;  4X1K B;  4JYC A;  3X2Q C;  4E4E A;  4PTM A;  3ALF A;  3UO2 A;  5BZB A;  4DRX B;  4PI0 A;  2Z5U A;  5E1A C;  4DUZ O;  4KQZ A;  1P5Q A;  4ITZ A;  5J2T B;  1VQ5 V;  1MMM A;  4GCZ A;  3CGM A;  3ABM B;  5JQG A;  2PN0 A;  1B6Q A;  3K08 A;  4LF5 B;  2ITD C;  2W0F C;  5LMN O;  2QKC A;  4QPJ A;  4DK1 A;  1F51 A;  1HNZ B;  3ETG A;  5J2U A;  1V54 B;  2DSU A;  1WA8 A;  2Z3Y A;  5IYB O;  2BCC H;  1B04 A;  3SPH A;  1YI2 V;  4TWK A;  1YDX A;  3SYQ A;  1VF6 C;  2D3O W;  3FKS G;  2PBC A;  1TAE A;  1RM1 C;  1OHH G;  3MHS C;  3E8F A;  5B1B B;  4QJF B;  2R9A A;  3WB0 A;  1HR0 O;  4O4I A;  5JVD A;  1HNW O;  4TYO A;  3F5W C;  3CRA A;  4YHH B;  2H8P C;  1HKI A;  2LGO A;  1K7D A;  2PV2 A;  2JGU A;  1BQ0 A;  3RME A;  3ARY A;  3SYP A;  4GGQ A;  2HHH O;  2F4E A;  4ODK A;  4R8C A;  4O2A A;  1SQP H;  4DRI A;  1D7I A;  2UUA B;  3WD4 A;  1AI7 A;  4FM0 A;  5C8Y B;  4JAV A;  4PHZ A;  3TCZ A;  4DRO A;  5IY5 B;  1GO3 F;  2XAF A;  3WU2 Z;  2M08 A;  2XAQ A;  1YVW A;  2LPV A;  2B1G A;  3O5P A;  1PBK A;  1MA1 A;  4J7Z A;  1XQ8 A;  1SQB H;  1K4C C;  4JYB A;  1V55 B;  1A32 A;  2OT5 A;  5E79 Z;  5LMU B;  1Y76 A;  1BSM A;  4DUY B;  3SR2 C;  2ITK A;  1GH6 A;  5GW7 A;  1KP3 A;  3TK1 A;  4JF3 A;  2NR5 A;  1NI8 A;  3O5M A;  3ZX6 A;  4JGS A;  2JEX A;  3CD6 V;  1ZL8 B;  4AQY O;  2XP3 A;  4P9O A;  3B4S A;  2ZCE A;  5IJ0 A;  4QE7 A;  1WNS A;  2CUG A;  3CMA V;  4ZHQ A;  2MLX A;  4MSP A;  4TV8 A;  3B9E A;  1MSD A;  3MDY B;  3C90 A;  4XAK A;  1XL6 A;  1TFV A;  1FKD A;  1QLE B;  2QTS A;  5BXZ A;  2F4V O;  1IBK O;  2OCC C;  3HR0 A;  1JQ0 A;  3LDC A;  2CTP A;  4FJC C;  4IT5 A;  4NXN O;  4IT4 A;  3C3T A;  2K9P A;  4DV6 B;  4DR7 O;  2UXB B;  4AI8 A;  1NWS A;  3RYC A;  2BTO A;  1I0H A;  3ARQ A;  2DWD C;  3N2K A;  1DK1 A;  1ZTE A;  1R6T A;  1SRY A;  4KXR A;  4JI7 O;  1GMG A;  1KU9 A;  3L70 H;  1FFT B;  2KG7 A;  2A3Q A;  4YIO A;  1XI1 A;  1BL4 A;  2A0L A;  1EBO A;  1WNO A;  2WK2 A;  2F93 B;  2XAH A;  3LSS A;  3ZJZ A;  5JJJ B;  4LFA O;  1NSG A;  3AS0 A;  4Q22 A;  1V55 C;  2Q67 A;  3CWB H;  3ZHT A;  3W7T A;  1W9U A;  5DO2 A;  3PA7 A;  2RJZ A;  5KHJ A;  4I4T B;  4FLY A;  3N27 A;  2UXC B;  4J10 A;  1JOY A;  5JH8 A;  3O5E A;  2DWE C;  1CP9 A;  4RUE A;  4IHJ B;  4O2B A;  3ASO B;  4YJ3 B;  4YXW G;  4X62 O;  4WF9 V;  3IC9 A;  4HNA A;  1G6U A;  3E89 A;  2P06 A;  4UB6 Z;  1IBM O;  2GHY A;  4LH7 A;  3ARZ A;  1BL8 A;  3AG1 B;  2M2A A;  4CS2 A;  1Q3E A;  3BAB A;  4Z2L A;  4NZC A;  1X6N A;  3W7U A;  1VQ4 V;  3OA5 A;  4DZ2 A;  1R6K A;  3O5R A;  2ESC A;  1D5A A;  4XBF A;  1PNK A;  4GX5 A;  2P4V A;  4RWU A;  4JFJ A;  2P4K A;  1BCC H;  2F23 A;  3EFF K;  2QDO A;  3T1C A;  1L1P A;  1L8D A;  2WPD G;  3EXA A;  5IWA B;  2DPE A;  4FFB A;  4LF4 B;  1M5Y A;  2WLI A;  1WAW A;  4ZPW R;  3H9R B;  3JSL A;  2F4V B;  5L3F A;  2YBU A;  2QWN B;  3JAK A;  2GUZ A;  5CA0 B;  2Q5Z A;  1DGS A;  3N2K B;  2P90 A;  2MLY A;  5LGN A;  1I5X A;  1LL7 A;  1NWT A;  2RQ6 A;  1PL4 A;  4UVC A;  1VF8 A;  1ROP A;  3SYO A;  3ABT A;  1QU7 A;  4JYA O;  4DR4 O;  5H5N A;  2XP7 A;  3UQI A;  1R3J C;  5D5P A;  1DF5 A;  3BCC H;  4J42 A;  4OGQ B;  1NR7 A;  3KAB A;  4DV7 B;  3TDB A;  3T1Y O;  5JWP A;  2G8Z A;  1LUW A;  4X62 B;  2UUC B;  4DV1 O;  3LUT B;  4DR5 B;  3BXW A;  5CB4 B;  4MVS A;  4TNS A;  3W7X A;  5LA6 A;  4ZPT R;  1VQO V;  4DR3 B;  1KT1 A;  3KAC A;  1E1R G;  1FJG O;  3DC5 A;  2UXC O;  2RQS A;  2DE0 X;  3BPZ A;  3LSQ A;  5H9C A;  1Q6I A;  4ODO A;  4MW3 A;  2B5U B;  3RYI A;  2OYQ A;  2O9O A;  3I55 V;  1VQM V;  1X6L A; 
#chains in the Genus database with same CATH homology
 2AWG A;  2MF9 A;  2WLY A;  1YW5 A;  2Q5A A;  4NNR A;  4Z2H A;  1PIN A;  3O5Q A;  3WL1 A;  1NWR A;  2RUQ A;  4ZS6 A;  5HT1 A;  3ARS A;  4HBE A;  3ARW A;  1D7J A;  2LJ4 A;  1HKJ A;  3UI4 A;  5HW6 A;  2XP9 A;  4Z2G A;  4FAP A;  1HJW A;  5I98 A;  1FKS A;  4TX0 A;  4U85 A;  5DIU A;  1E15 A;  4O2T A;  2DT2 A;  1LL6 A;  2DT0 A;  1CTN A;  1ITX A;  3KAD A;  1QPL A;  2KO7 A;  2VCD A;  2OLH A;  4P8U A;  4DRN A;  3WD3 A;  2O92 A;  4DZ3 A;  1FD9 A;  3CHF A;  3UF8 A;  1ZCN A;  3O5D A;  4WK9 A;  1FAP A;  2PPP A;  2A3C A;  4LAV A;  1FKR A;  4R0X A;  5BXJ A;  5DF0 A;  4P8V A;  4WKF A;  1ZBK A;  2DT1 A;  1SYT A;  5HW7 A;  2B31 A;  1IX5 A;  2XP5 A;  2ZQV A;  3OOB A;  4QIB A;  1GPF A;  3UQA A;  1GUV A;  5D75 A;  4QT3 A;  2FDM A;  3G6M A;  2ZR4 A;  1U79 A;  3O5L A;  2DG9 A;  4WKH A;  3WD0 A;  2PPO A;  1F8A B;  2WLZ A;  4QT2 A;  3UI6 A;  4G2P A;  2RUC A;  2XP4 A;  1FKL A;  5GQB A;  5HTG A;  1E6Z A;  4Z2I A;  1F40 A;  1K9T A;  1LL4 A;  1OWQ A;  2KGJ A;  2YBT A;  4G50 A;  4Q7N A;  1Q6U A;  1FKG A;  4L3N A;  1FJD A;  3RM4 A;  1W1Y A;  5HW8 A;  4MNL A;  3RM9 A;  4J4O A;  1HKK A;  2KE0 A;  1SR0 A;  3ARX A;  3PR9 A;  3WD1 A;  1ZB5 A;  3IHZ A;  4LAW A;  2LKN A;  4W5U A;  3VAW A;  1NMW A;  5HWC A;  1ZBW A;  4AY1 A;  3WKZ A;  3ARU A;  2AOS A;  4JYS A;  2F2D A;  3ARO A;  3CGN A;  4DRP A;  3IK8 A;  2RSE A;  4HBO A;  3KAF A;  1TCO C;  5DIT A;  1JNS A;  1NMV A;  1W1T A;  2QF8 A;  4KR0 B;  5B8I C;  3B09 A;  3ALG A;  3ODK A;  1W26 A;  4IQC A;  1ROT A;  1BKF A;  1HJV A;  2F21 A;  3RM8 A;  4J4N A;  1A7X A;  1LG1 A;  1JND A;  3W4R A;  1J4H A;  5DIV A;  2MNT A;  3KAI A;  2N87 A;  3FY1 A;  2D9F A;  4DWS D;  1HJX A;  1T11 A;  4JFK A;  1W1V A;  3PRD A;  4MGV A;  4WKA A;  1GOI A;  1Q6H A;  2KR7 A;  1D7H A;  1HKM A;  1UR8 A;  5HKG A;  1D2K A;  3AS2 A;  3GPK A;  1H0G A;  3CH9 A;  3O5G A;  4LAY A;  3NTP A;  4ODR A;  1QZ2 A;  1FKT A;  1JVW A;  1EHN A;  2XP6 A;  1FKI A;  4TW6 A;  1FFQ A;  3WQV A;  4ML4 A;  3O5K A;  1LQ0 A;  2IF4 A;  3JYM A;  2G41 A;  4ODM A;  4DRJ A;  4PTM A;  3ALF A;  4MTV A;  4KQZ A;  1P5Q A;  1ZK6 A;  4ITZ A;  4C02 B;  1QPF A;  3WL0 A;  4R5E A;  3CGM A;  3LUO A;  2KI3 A;  1J4R A;  4MPK A;  1LG2 A;  1ZL1 A;  1LJY A;  3WD2 A;  2DSU A;  4MNM A;  1R9H A;  3KZ7 A;  1EYM A;  2KFW A;  1YAT A;  3B9D A;  1H0I A;  3AQU A;  1B6C A;  2PBC A;  4GIV A;  1ZBV A;  1ZU8 A;  2M1I A;  2XPA A;  2DSZ A;  4TYO A;  3UI5 A;  1JNT A;  4S3K A;  1HKI A;  2LGO A;  2PV2 A;  1OGG A;  3FAP A;  3RME A;  3ARY A;  1W1P A;  4GGQ A;  2FAP A;  2F4E A;  3ARV A;  2DG4 A;  4ODK A;  4DRI A;  1D7I A;  3WD4 A;  4Z2J A;  4P8X A;  1ZBC A;  3EY6 A;  3RGC A;  4DRO A;  3TCZ A;  2M08 A;  4JFI A;  1W9V A;  2ZQS A;  1J6Y A;  2LPV A;  3CHC A;  1EIB A;  3TC5 A;  4L72 B;  3O5P A;  3G6L A;  1PBK A;  4DT4 A;  4DWS B;  1FFR A;  2ITK A;  4NSB A;  1XRV A;  1UR9 A;  3O5M A;  4DRQ A;  1FKB A;  5HWB A;  4HAR A;  2XP3 A;  3O5I A;  3PRB A;  3JYJ A;  4TW7 A;  4ODQ A;  4U86 A;  2OFN A;  3ART A;  2MLX A;  4MSP A;  3B9E A;  3MDY B;  4XAK A;  1ROU A;  5J6E A;  1Y0O A;  3PRA A;  3O5J A;  1TFV A;  1FKD A;  1FKH A;  2XP8 A;  4JFL A;  1E6R A;  1EQ3 A;  1KFW A;  1OGB A;  4FN2 A;  3UQB A;  2UZ5 A;  1E9L A;  4IT4 A;  1C9H A;  3KAH A;  2VN1 A;  1NWS A;  4ODP A;  2ZQT A;  2ZR6 A;  3CHE A;  3CZ8 A;  3ARQ A;  3IKD A;  1J4I A;  4MNK A;  4DWS A;  5DEZ A;  3AS1 A;  1E6P A;  1BL4 A;  5HBF A;  2DG3 A;  1WNO A;  2WK2 A;  4DWS C;  1NSG A;  3AS0 A;  2ZR5 A;  1JNE A;  4Q22 A;  4WJX A;  1NH6 A;  1W9U A;  2FKE A;  2MLZ A;  5DO2 A;  2WM0 A;  3PA7 A;  2A3E A;  1Q1C A;  4IPX A;  1O6I A;  3KCE A;  5JH8 A;  4S3J A;  1FKF A;  3O5F A;  3O5E A;  2A3A A;  4W9P A;  4DRK A;  3WIJ A;  2XPB A;  4BF8 A;  3B8S A;  1W9P A;  1KT0 A;  4DIP A;  4URI A;  1WB0 A;  3ARZ A;  4MNJ A;  3NI6 A;  2M2A A;  4ODL A;  2ZQU A;  4Z2L A;  4NZC A;  2MPH A;  1X6N A;  4DH0 A;  3OA5 A;  4IQ2 A;  2DT3 A;  3O5R A;  4DZ2 A;  4QZV B;  2ESC A;  3AS3 A;  3B7X A;  3I6C A;  4Z2K A;  2PV3 A;  3NRK A;  3WH0 A;  4JFJ A;  2IUZ A;  2L2S A;  1L1P A;  2DPE A;  1M5Y A;  2RUR A;  2DSV A;  2PI6 A;  1WAW A;  4ZPW R;  2PPN A;  3H9R B;  4TW8 A;  2DSW A;  3ARP A;  2PV1 A;  4W9Q A;  3KAG A;  2YBU A;  3B9A A;  3FXY A;  4N19 A;  3IKG A;  2MLY A;  1HXV A;  4WIW A;  4DRH A;  1FKJ A;  1D6O A;  1LL7 A;  1NWT A;  4ODN A;  1VF8 A;  2K8I A;  2A3B A;  5HUA A;  2JZV A;  4JFM A;  3WQW A;  2XP7 A;  3UQI A;  3QOK A;  2Y78 A;  1N1A A;  4U84 A;  3KAB A;  3TDB A;  2G8Z A;  2RUD A;  3JXV A;  1EDQ A;  3BXW A;  4LAX A;  4MAV A;  4TNS A;  4ZPT R;  5GPR A;  1E6N A;  3O5O A;  1KT1 A;  3KAC A;  5GPG A;  3CHD A;  4DRM A;  1NWU A;  2RQS A;  3ARR A;  3RFW A;  1FKK A;  4W9O A;  1Q6I A;  4ODO A;  4P8W A;  4IT6 A;  1XHG A;  1RD6 A;  2O9O A;  4LGX A;  4ZPV R;  1X6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...