1Q6IA

Crystal structure of a truncated form of fkpa from escherichia coli, in complex with immunosuppressant fk506
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
210
Chain Sequence
b'AFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
publication title Structural and functional studies of FkpA from Escherichia coli, a cis/trans peptidyl-prolyl isomerase with chaperone activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 66
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1q6iA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q6iA02
2IF4A 3IK8A 2XP6A 4GGQA 4LAYA 3OOBA 4MSPA 3B7XA 3O5GA 4ODRA 1ROTA 1FKBA 4DRJA 5HTGA 1FKGA 3O5JA 4QT3A 4U84A 1QZ2A 3KADA 4TW8A 4DH0A 4FAPA 2KFWA 1NMVA 4IQ2A 1NMWA 2KR7A 2XP3A 1JVWA 2RUQA 3KACA 2LJ4A 3PRDA 4LAXA 4MGVA 3O5RA 4G50A 4QIBA 1B6CA 2Q5AA 3TC5A 2ZR4A 4LAWA 2PPNA 2PV2A 2UZ5A 1D7HA 4J4OA 4N19A 1BKFA 4GIVA 2KO7A 4G2PA 3IKDA 1Q6IA 1FKSA 2KI3A 4ITZA 2MPHA 1FKTA 2MLYA 3RGCA 1M5YA 1J4IA 1J4HA 1EYMA 4W9QA 1QPFA 2AWGA 1J4RA 2LPVA 4FN2A 1D6OA 1FKLA 3TCZA 1YATA 4TYOA 2XP4A 3UQIA 4DRKA 2PPOA 2MNTA 4DT4A 1Q6HA 5HWBA 2ZR6A 4R0XA 2KE0A 4ODNA 5GPGA 2XP8A 3O5LA 3NI6A 2Y78A 4QT2A 4J4NA 3JYMA 2XPAA 5B8IC 1JNTA 2KGJA 2RSEA 3I6CA 5D75A 2RUDA 3FAPA 3O5DA 2RUCA 3O5KA 3PA7A 4ODPA 4C02B 2MLZA 4DRMA 1F8AB 3KCEA 3O5IA 4IQCA 3UI4A 4DZ2A 1EQ3A 3JYJA 3O5OA 5BXJA 4TW6A 3IHZA 4ODOA 5DITA 4DRPA 1PINA 1FAPA 3O5MA 4W9OA 1A7XA 1FKDA 1FKKA 2L2SA 3KABA 3UF8A 2XP9A 5HUAA 2F2DA 1ZCNA 1D7JA 2RQSA 3LUOA 3PRBA 1FJDA 1KT1A 2PV3A 2F4EA 5HW8A 3GPKA 2N87A 1L1PA 1ZK6A 1TCOC 3ODKA 5DIUA 4JFIA 1Y0OA 1Q1CA 3NRKA 3TDBA 2PBCA 1FKHA 2M1IA 4JFJA 5I98A 4TX0A 3VAWA 2FKEA 2ZQSA 5HWCA 2XP5A 2D9FA 1F40A 4JFKA 2MF9A 3KAIA 3MDYB 2M08A 2PV1A 4ODKA 3KAGA 2ZQTA 2LKNA 1J6YA 3IKGA 4JFLA 5HW7A 1Q6UA 1U79A 1C9HA 1N1AA 1BL4A 1P5QA 3KAHA 4JYSA 4ODMA 4W9PA 3RFWA 4BF8A 2OFNA 2F21A 1KT0A 3B09A 2LGOA 3H9RB 5DIVA 5HW6A 2ITKA 4U85A 5HT1A 3O5QA 4DRIA 4NNRA 4JFMA 1JNSA 4DRNA 4DRQA 2ZQVA 4LAVA 2XP7A 1R9HA 2DG4A 2JZVA 2RURA 2XPBA 1FKJA 2ZR5A 2DG3A 3O5EA 2PPPA 1T11A 1D7IA 2MLXA 1QPLA 3NTPA 3UQBA 2FAPA 4IPXA 1PBKA 2ZQUA 3UI6A 3JXVA 4TNSA 3O5FA 4ODQA 5HKGA 3EY6A 3KAFA 3CGMA 1ROUA 1YW5A 3WH0A 3UQAA 1FD9A 3CGNA 2VN1A 1FKRA 3O5PA 3UI5A 4DIPA 1NSGA 4ODLA 4TW7A 4DRHA 2M2AA 2K8IA 4DZ3A 1W26A 1FKFA 4U86A 2VCDA 2DG9A 3KZ7A 1HXVA 5J6EA 1FKIA 4O2TA 4DROA
chains in the Genus database with same CATH superfamily
3KCXA 3ZN1A 1YTFB 4MSPA 3O5GA 1JCHA 1FKGA 2DT1A 3WB1A 5DEZA 1MABG 2Q68A 3ABKB 4P8UA 3CSXA 4DV2O 2P5OA 4MW3A 3IKDA 3OTOB 3D36A 3PR9A 2MPHA 1J5EB 1HNXO 1NVPD 4JTCB 1QPFA 1HJXA 4MTXA 3WD3A 1WNSA 1HW7A 4O2BA 3TCZA 5L3DA 4TYOA 3JSNA 1RM1C 1NQTA 5K1XA 5J2TA 5K1PA 1YVWA 4B7EA 2RSEA 3JD4A 4DR6O 5GONB 4ODOA 5KLVH 2OIGA 3RMEA 3G6BA 3G71V 1IBKB 1AJPA 4P9PA 1KT1A 1O9GA 5KAFZ 1ZK6A 4WFFA 5DIUA 1SERA 2A06H 3WB2A 4TX0A 1SS3A 4PI0A 4JI4O 1W0KG 4HNAA 1EN6A 4LFCB 4UFZA 3IKGA 2YXHA 4LF5B 1M56C 3ML0A 3CHCA 3DC6A 3CHFA 2LGOA 1HNWB 3LDEA 4D7TA 3MD0A 4Q7NA 1N32B 1G4YB 3APQA 2ZR5A 4DV0O 4QNHB 1R3IC 3K08A 1DK1A 3JATA 4I0XA 1AR5A 4JGSA 1W2BU 2P90A 2QM4A 3JALB 4NB5A 2VN1A 4GYCB 4XAKA 5IYBO 2P7TC 5BR8B 1JR9A 4O2AA 3KKYA 4DO2A 4LNUA 4JYYA 3KZ7A 4DV4B 2OCCC 3CD6V 1FKIA 5C8YB 4NYKA 1GRJA 2B31A 2JS3A 5LBQA 4JV5O 3WFVA 5IJ9A 1NH2B 4FAPA 4HYOA 4FK5C 5GW7A 5IYDO 3JASA 3WKZA 2P22C 1JVWA 4H37A 4LAXA 2IH1C 1VF5B 1PP9H 2R9AA 2KG7B 2B5UB 2GDSA 3RM9A 4OX9O 4QE7A 1YDXA 5KX5B 4X1IA 1E9LA 2OT5A 3JARA 1IBMO 3CJHB 1D6OA 1WP7A 4IIJB 1YATA 4LFAB 3VQYA 4Z2IA 3ZS8C 5EIBC 2YIBD 3EVKA 4Z1MG 1JJOA 1HKJA 1OWQA 4FVMA 1LL7A 3ZHQA 2FTKA 4J80A 2KGJA 4NXNB 1MNGA 1RM1B 3VBBA 5IYZB 1XI1A 1N4CA 1F8AB 3AS1A 3TETA 2AZ2A 5HUAA 1MSDA 5FPRA 1GTOA 1XHXA 1R6TA 1PPJH 1UJWB 3OE7G 4FFBB 1FJDA 4X20A 2VWKA 1SQVH 5GTIZ 1YHQV 5ITZA 2HHHB 2EJ7A 3NRKA 1GK9A 2GBOA 1WB7A 1D2DA 4JFJA 4R7CA 3GB7C 2OCHA 4WFBV 3CCJV 1ZB5A 1HKIA 1SQQH 4DV3B 3KAIA 5EZYB 1MZFA 2IU0A 3BCCH 1RSOB 4LF8B 1GAXA 4JFLA 1Z5VA 3KAHA 2UUBO 1IBLB 4MVUA 1AI7A 2Q0OC 2F1MA 2Q9LA 4YJ3B 3HKCB 3HKBB 1M56B 5HT1A 3WD4A 3ARZA 1RFYA 2XP7A 2RURA 1FKJA 2PPPA 4I4TA 3JD0A 4FLVA 4GKJO 5JVDA 4Z2KA 4PA9A 5KA6A 2O9OA 1ROUA 3RM8A 2EIKC 1E6RA 4O4HA 4ZOLB 4ZI7A 4J7JA 1GN6A 2CGNA 2ILMA 4DWSA 1W0JG 2OLHA 2QWQB 4TUYA 1I5XA 4OPHA 4WBNA 4LWSA 3BAAA 4WJXA 4S3KA 4DV5O 1F7YA 4DW0A 1XUQA 2OCCB 5DEDA 4PA3A 1KU9A 4FLTA 3A0BZ 3EXAA 1NMVA 2FDMA 4MNLA 2BSKB 3LDCA 3RFRA 4LAWA 3ZRWB 2PPNA 3JSLA 4LBEC 4WFEA 4J41A 2QDOA 4ZKIA 4BW5A 1FKSA 1AILA 4DR2O 4IHJB 4F6RB 5IWAB 5BMVB 2LPVA 2Z5UA 1HNZB 3E8HA 4DT4A 3UKMA 4B3SO 3CRQA 1OCCC 2QKAA 5CA0B 5D5PA 4D6TH 4DUZB 4PI2A 4JI5B 2RUDA 1K73W 4BAYA 1E79G 4BWAA 1ZL8A 1F4NA 4OPAA 1ITXA 2UXCO 3O5OA 5BXJA 1R6KA 1FAPA 4ZHQA 4X66B 2EULA 2M6YA 3FYEB 2QM7A 1FS0G 2HJDA 3RYIA 1VQLV 2QM8A 5I98A 2Q0AA 2FKEA 4X1YB 5JH7A 2PV1A 3SYPA 2LKNA 1QLNA 1XEQA 3APOA 1RPRA 2ZD9A 3JD3A 1AJQA 2DQ0A 3GU0A 1B3QA 4JFMA 1K8AW 2JIZG 5LHHA 1FXVA 3ARWA 3ARSA 3T1HB 1FYJA 5CBGA 2DYSC 1X59A 5GPRA 4LF6O 2E76B 3WH0A 4B08A 2JEXA 2W6JG 4JYAB 3BA8A 4RUEA 3O5PA 3UI5A 4YJ2A 1JOYA 4DV7B 2ZE7A 1D5AA 1PV0A 1FJGB 4NKGB 3WG7B 1FKFA 1N34B 1JMKC 5H6RA 3G6EV 2VQEB 5D5QA 4JI6B 4DV6O 5GONA 3B7XA 4X9QA 4TW8A 3CS5A 4R5EA 5IJ0B 3JCUZ 3KACA 1I94O 1B6CA 2CTPA 4H0LB 3K0DA 1WJZA 1ZBWA 5AG2A 5EYPA 1X4TA 5LXTA 5CA1A 2YC0A 3CYOA 3RGCA 2DOSA 3F5WC 1M5YA 2AWGA 2JJ2G 1J4RA 1XL6A 2EILB 2QR4A 5L3GA 4X65O 1IVSA 4JI0B 1Q5OA 1HDJA 4WFHA 5TISZ 5HWBA 4DUYB 5DECA 4HBEA 2EBOA 2DT3A 3C90A 5DN6G 1NJIW 2NR5A 4IYIA 3H1JH 1OCCB 2OTJV 5LMNO 3ABLC 4PD4F 1GN2A 3CCQV 4K8ZA 2JGUA 1B6QA 1EN4A 3JATB 1FXKA 4OXSA 2LGWA 4MW8A 3TDBA 5DM6V 5HWCA 4ZPVR 2NN4A 2QF8A 5C8YA 1ZL1A 1K9TA 4J42A 3CCVV 1Y74B 4LNUB 1N1AA 4W9PA 2AOSA 2F21A 1OCZB 4MVZA 2E5LO 5BY1A 2B5UA 2PYLA 3OEEG 3H1KH 4B3TB 2JK5C 3JASB 3K03A 2IBZH 4IGGA 1EIBA 1XILA 4P2ZA 1AR1B 3NTPA 4WIWA 3CJHA 3ALFA 3ZHTA 4IIJA 5HKGA 4H33A 2Q67A 4F6EA 1ZWIC 3CGNA 2DQ3A 2PN0A 1WLEA 3ZJZA 4WFGA 3RVZA 2YDEA 1KYOF 3K9AA 2ITCC 1PL0A 1FFTB 1B04A 3QVNA 4JI2B 2A3CA 1CPYA 4IL6Z 5IYZA 2DW4A 4DROA 1Q43A 3IK8A 4LAYA 3OOBA 3WQVA 3FXYA 1K4CC 1P84F 2E3CA 2ZM6O 4AILC 1Q7YW 5HTGA 1W1PA 4U84A 5GQBA 4FFBA 2EX3A 3UO3A 4UB8Z 1NWTA 2PUSA 4MTGA 1NT2B 2IJKA 2ZR4A 2H94A 4TV8B 3CP1A 4TQFA 4AI8A 1EFRG 2UZ5A 4HBOA 1V55C 2ADQB 2QWOB 4RQEA 3LSUA 3FAVB 5J9PC 2QKCA 1YSCA 4LF9B 2KKWA 1HJVA 3E83A 3L74H 3UT5B 4YJ3A 1Q6HA 3TXQA 3SPHA 3W7SA 3LUTB 3ICXA 4ZIBA 4LGXA 5BXZA 3PA7A 2IUZA 1OHHG 1ZBCA 2IU3A 3GVMA 1EQ3A 1UR8A 2A3AA 4GX5A 4DR3O 1FKKA 3ABLB 1HR0O 4I4TB 1CXZB 2RQSA 3MDSA 1OCRC 1CEZA 2PV3A 4UDMA 1ZU8A 1XHGA 1XNRB 3T4ZA 4ZOLA 1QU7A 1K3EA 5EBMC 3K5NA 2EIMC 2D9FA 1TUEB 2MF9A 4DR5O 1SESA 2A7WA 5LOVA 1WA8B 3AG3C 3IJ4A 4MVSA 1XMOB 2WWWA 4WBNB 1DTOA 4FM2A 2BSKA 1W9UA 1KT0A 5HW6A 3CPWU 1F23A 3FB7C 3ZRSA 3U0ZA 4ZBMA 2B1GA 2PZSA 3ZRWA 1YCIA 1QHTA 2QJ1A 4IHJA 4F6RA 2LJ2A 1J95A 5BMVA 3T1YB 1KMIZ 1VARA 3RN4A 3BFRA 4WFAV 2PF4E 4YY3O 4HZ3A 1NWRA 1JJ2U 1VQPV 1LUWA 1AI4A 5CA0A 1M1KW 4TW7A 4DV2B 4WK9A 1W26A 3WB0A 3FY1A 1TA8A 2WLHA 5CA3A 1I0HA 5H6QA 3I55V 1O9HA 2VS0A 4GGQA 1HNXB 4JYCA 4DWSD 1NR7A 3STLC 4U7OA 2GTSA 5JWPA 5H5NA 5HFMA 3M7MX 2WPDG 2XP3A 5IY5C 3TC5A 4QGPA 2UU9O 1EZJA 3SDLA 4ZHQB 2B9ZA 4X1YA 3QO7A 4GIVA 1FFQA 1FKTA 1BCCH 4DR6B 1ZX3A 2CE4A 4GX1A 1L8DA 1P7BA 1V55B 2HLDG 5JCOC 3JD2A 1FFXA 5JH7B 2XP4A 4DRKA 2XP8A 1PD3A 1WAWA 2RMKB 2XPAA 3E35A 5LMUO 2P06A 3K3WA 1VQMV 2XNDG 1SA0A 4K3AA 4JI4B 2E75B 3CZ8A 2BOCC 2BCCH 2XP9A 5FPOA 2LGQA 2EINC 2XOKG 3X2QB 2Y0IA 3ZRXA 1N0JA 2UUAO 1VQKV 5KMGB 1OCRB 1K92A 2PBCA 4PDMA 3EFFK 3B2EE 2LFSA 3ZEDA 4AQYO 4J9YB 4LP8A 4YJ2B 2FL4A 4DV0B 2ZDIC 4PDRA 3BMBA 4X89A 4HBNA 4WKHA 4I50A 2HR3A 1SQPH 4R6ZA 5IJ0A 1YTFD 2Q7HA 2YI8A 2X6AA 3A0HZ 4IT4A 5A9GA 3KG2A 2ZE6A 1YIJV 2X7RB 1KP2A 1KBHA 2CUGA 1F4MA 4KHPO 3TJTA 2DN9A 2DG3A 2ZINA 2Q7GA 3OUFA 4Z2WA 2OWOA 3O5FA 1TVKA 3FB6C 5EYPB 1FAFA 5LXTB 5CA1B 3CCMV 2QGNA 4JV5B 3G6LA 4BR6A 2DT2A 1NTKH 4ODLA 1BSMA 3CXCU 4CBCA 3ABUA 5EC2C 1K9MW 3UQ8A 2K8IA 4NXMO 2FB5A 4OX9B 1LJYA 5IDJA 4KFMA 1ROTA 4DRJA 1IBMB 3CCLV 1K4DC 2WLYA 3AG1C 1N36O 2Q5AA 3H1HH 3P30A 1R3KC 3ETQA 3CMEV 1MMMA 3QF7A 4ICGA 1VP7A 4LF7O 1Q81W 2MW2B 3ZBHA 3ARVA 1FXKB 2HP8A 2GHYA 4G2KA 3L75H 5IY5B 1J4HA 3G80A 1Y74A 5JQGA 1VF7A 3K79A 3RYHB 1FKLA 4KUMA 3HKEB 4X8AA 4DYLA 1XRVA 3Q4HB 4B7KA 2QE7G 2XAQA 4R50A 1Y6XA 3OM3B 3JYMA 1HKMA 2ZT9B 4MTFA 2OYQA 3AS0A 2BOBC 1IBKO 1VEWA 5DITA 1PINA 1YITV 3LSQA 3UF8A 2FKXA 2UUBB 3ARUA 1ZCNA 2XAFA 4JAVA 3K5LA 3ZCCA 3GPKA 2JS5A 1GM9A 3ODKA 4TWKA 2V7QG 2EINB 1LG2A 1FKHA 1UPGA 4JTAB 5L3CA 4I5SA 4GX2A 1W1YA 3OMIB 3IC7A 3RGBA 3F7VC 3ZHUA 4CS2A 4GT1A 1BS3A 4HARA 3CRRA 4J10A 4NZCA 2AHZA 4DK1A 1YXBA 1H2NA 1YJNV 4BF8A 1ZTEA 4CC5A 2ESCA 3ZN0A 3NXSA 5H9CA 2PYJA 5DIVA 4B3RO 4TV8A 4NR1A 1OGGA 2Q8VA 3T2MA 3SPIA 1NH2D 2WK2A 2JZVA 2F66C 1OGBA 2BE3A 1AROP 4EKWA 3CHDA 3FAVA 4UCVA 1PBKA 2ZQUA 4DV5B 1XDCA 5BR8O 1W9PA 5B1AC 3UT5A 3KAFA 3WD0A 4DRXB 4X64O 3SPCA 3EIPA 1FKRA 3WQWA 5KA5A 1EZVH 1H2MA 4DRHA 4DR7O 2L35A 2IH3C 1QVFU 1VMGA 2D3OW 2HG5C 3LNMB 2CTWA 2DMXA 2DT0A 4UXNA 2JGDB 1KKCA 4DR2B 1Q8IA 4KP4A 2IF4A 1S5JA 2LFRA 4CH5A 4MVRA 2XAGA 4GX0A 2PI5A 3W7XA 1BQ0A 4W4KA 1NMWA 3B8MA 4JAUA 4U85A 2A9HA 4B3SB 3JAKB 3OAAG 4UCOA 3I56V 2OTLV 1BT8A 1IXMA 2N05A 3AG1B 3SYOA 4EFEA 1IX9A 1NKDA 4N19A 2HVKC 1LQ0A 5LHIA 1WB8A 1EYMA 1D2KA 1WA8A 4PDVA 2UXCB 1R6NA 1WNOA 1WPXA 3JAMN 1H8HG 3E22B 2A3BA 2DSVA 1AB3A 1KQSU 2Q73A 4ZPTR 2CTRA 5B5EZ 4MS2A 3DXRB 2WA3A 5LOVB 2DSZA 4O4JB 4WF9V 3NI6A 4ZS6A 3EHBB 1Q82W 3ZMZA 4UVBA 1VQOV 2PY5A 2X6BA 4L72B 4RO2A 4FLUA 3ETDA 4CC6A 1A32A 4YHHO 1NBMG 3D3QA 1VF8A 2B1IA 3G6MA 4R8CA 3C3SA 3CWBH 3CCSV 2VQFO 2PI6A 3AK2A 3HPLC 4DV3O 1Q90D 1TCOC 4EB6A 4IT6A 2QEXV 2Q5ZA 1F51A 2Q4PA 2ZQSA 4CH4A 3RWRD 1HP8A 1GN4A 2QSAA 1BMFG 1HWYA 2EIJC 2W0FC 4MAVA 5JJNB 3DTUB 3K9SA 4K35A 1CP9A 1QQCA 2CGOA 3ASOC 2ZNIA 1WN7A 3SYAA 4F4LA 5BZBA 3O5EA 3OEHG 3O65A 1H8EG 3AS2A 2WLJA 1TFVA 3IFXA 1VQ5V 3UI6A 4DV6B 3E89A 3W4RA 3QNEA 5HBFA 4JI1O 5JJJB 3FB5C 1XL4A 2EZPA 3E8FA 2ZIOA 5B1AB 4DIPA 1I94B 1FFRA 5LA6B 1FFXB 3CRMA 5L3BA 4L8JA 5J6EA 2XTAA 5EIBD 1H2KA 1COWG 5IYCO 4KQZA 4ODRA 1I08A 3ZRVA 4X65B 1SA0B 3MAQA 1QLEC 4MVOA 1QBZA 1EM1A 4IQ2A 1NS1A 1K97A 3W7WA 2RUQA 2K9PA 3AROA 4LR3A 5KMGA 2Z3YA 2QWRB 4K0KO 3N2GB 4G2PA 4RAIA 1Y76B 5LMNB 1DLBA 1J4IA 1NZ6A 2AGAA 2A3QA 2EIKB 3QO8A 4JZ2A 3FB8C 3HKDB 1LL6A 1GM7A 3B9EA 2HKOA 1GH6A 3ZHVA 3BVOA 4B3MO 1SC5B 4N21A 4R0XA 4I50B 1IDSA 1NU1H 2H8PC 2RQ6A 3UCSC 4QT2A 3CC7V 3I6CA 4E4EA 1M93A 3O5KA 2IJHA 3L9DA 3L72H 5LHGA 2MLZA 3H1LH 3KCEA 2WLNA 2RN9A 4FMTA 2F4VB 2PGGA 3AK3A 1FPOA 4I9QA 1SQBH 1NR1A 1TVKB 3B8NA 2E5LB 1ENVA 2Q6AA 2AXTZ 3STZC 2F95B 4MT8A 1LL4A 5DO2A 4PJ0Z 1O6IA 3HR0A 5HW7A 1Q6UA 3B4SA 3ARTA 2N04A 1AI6A 2BTQA 2FYUH 3ARPA 3D3IA 2YIDA 3WU2Z 2QWPB 4PTMA 2W6IG 3ZMSA 2ETNA 4WKFA 3CHEA 1R9HA 1JFFA 3ALGA 3J80N 1M90W 5B1NA 2XAJA 1Z2GA 2ARHA 3ETGA 2F23A 1E6NA 4JYAO 1IXBA 3RYHA 4ODQA 1RD6A 2ZM6B 4FM0A 3HKEA 3EY6A 1W59A 4MVQA 3OT7A 5LP6C 5JCOA 4L87A 5JQGB 3Q4HA 1EHNA 2WM0A 1YJWV 1XNQO 2AHYA 1ZLZA 1M4UA 1UFIA 4Z2GA 4LF4O 2H3OA 4U86A 4FJCC 2RDCA 3O5JA 4QT3A 4E2LA 1N33O 1QZ2A 2KFWA 4QJFB 1XREA 1QLEB 3W7UA 5HFLA 2DYSB 5F2VO 2Y4UA 1EBOA 1BHAA 1URFA 2KI3A 3CRCA 2MLYA 3N2KB 1NWSA 3B77A 3IGAC 3OMAB 1S72V 3E8GA 1X6NA 5LYJB 4DR3B 5FNVB 2ZDIA 2HEPA 4H44B 4TSFG 1HR0B 1SRYA 2PPOA 2MNTA 3D8CA 1NI8A 3CCUV 1S0VA 3ABMC 2EZOA 1IURA 2PTMA 5D75A 2WLZA 1JVMA 4C02B 3I5DA 5CBFA 3HB3B 4NSBA 3LSSA 4DR5B 1VQ9V 3SJAC 2Z0AA 5KHKA 1FKDA 3O5MA 2D2CB 1I7FA 2CH7B 4DRXA 1LG1A 3O9OA 1L1PA 4CZZA 1GPFA 4N23A 1V54C 1BL8A 4LC1A 2JGDA 2ZE8A 1PNLA 1K5QA 4J11A 5J2UB 3T4DA 4UCRA 1ZAUA 4DR4O 5LGNA 4JYSA 4YXWG 4EFBA 3H9RB 2CDYA 4BIZA 3L73H 3JAKA 4YY3B 2KSDA 1ZBKA 5FL7G 1NTZH 1Q86W 3GWOA 2JVDA 1BQZA 1T11A 3RT3C 4DV1O 4TNSA 3E22A 1JA8A 2CTQA 1VQ4V 2ODMA 3CGMA 3DXRA 2XASA 2LW7A 5KUMA 1AP5A 4O4JA 2UU9B 4QPJA 5LP6B 4JI7O 4X88A 2RNBA 3FD9A 1BHBA 4DZ3A 1RP3B 3K57A 3OUSA 3GWKC 2A79B 4LFBO 4O2TA 1FKBA 3KCYA 4G28B 3SPGA 2KR7A 4ASUG 4UCUA 4MGVA 1PNMA 1THZA 4DR1O 4MTVA 1E6PA 3TGUH 5LMUB 4JI3O 2Y0PA 4DW1A 4LH7A 3CE2A 3BXWA 4QIWF 5KHIA 4EB6B 1NWUA 1LUVA 3CXHF 1KFWA 3ZMTA 3G67A 2KQXA 4Z1VA 3O5LA 2UUAB 4JYBA 5B8IC 2CK3G 3GTYX 2O92A 2V4DA 4ODPA 1RPOA 4AQYB 4TOIA 5H2FZ 3JYJA 4J9ZB 2ZKOA 4PA6A 4NVPA 3PRBA 3RVYA 1ROPA 4O4IB 2ZR3A 1OV9A 1XMQO 1K33A 5HW8A 2N87A 5LA6A 1XHZA 3DSQA 4AHCA 3OR6C 1MA1A 4FLZA 1NVPB 5EBLC 3L71H 2YICA 3F7YC 4NTYA 1JNEA 2RCVA 4KHPB 1E44A 2Q7EA 1G6UA 4MTOA 1V54B 1F40A 2E74B 3ARRA 2VWJA 4ODKA 4P9OA 4GCZA 1KC8W 1J6YA 3A2FA 3VOUA 5LGTA 4MPKA 4C7UA 2UUCO 2OFNA 1XOUA 1CTNA 3JCZA 4QPKA 2JRIA 1WPBA 3P3PA 4FZ1A 4IT5A 4NNRA 1JNSA 2ZQVA 3N2GA 1JQ0A 1PL4A 2WLIA 1NH6A 1Y76A 4NXMB 3K5OA 2FAPA 2XHBA 1BZKA 2NLJC 3JAWA 4RUFA 4PV1B 4GKKO 4IPXA 3HKDA 5EC1C 5EK0A 1M9NA 2ZE5A 3ZMUA 4GLXA 2UXBO 4P8VA 2EIMB 1E1QG 1N36B 1I5YA 2M2AA 5DF0A 3JYCA 3G4SV 4LF7B 3AG3B 1BE3H 1HJWA 1PM9A 2R72A 3H01A 4P8WA 4MNKA 2PI4A 4O4LA 4X62O 4JI8O 3AK1A 2ZCEA 4AY1A 2YEVB 3PRDA 3IAYA 4BIUA 2UXDO 3O5RA 3M99B 4FPPA 1TUBB 1D7HA 2CAZC 3OMNB 1LNQA 1V9PA 2G38A 4DXWA 1X6LA 3RYCA 2JEUA 5LGUA 3CCRV 3MHSC 3FX7A 4W5UA 3QTCA 2KB1A 4FIPC 3U10A 2KE0A 2Y78A 2BTQB 1YF2A 3OTOO 1ORQC 1EN5A 2DYRC 1XQ8A 1J5EO 3K0GA 5FLXN 4MVMA 1P49A 1JFFB 1S5LZ 2ZIMA 1A7XA 4W9OA 2F2DA 1DGSA 1G1XB 4XDKA 5E1AC 4S3JA 2N74A 4B3RB 4JF3A 4YIPA 1KUQA 3E2EA 3VAWA 2Y4TA 3R65A 4LCUC 3RW0A 3DC5A 1WAZA 4Q6GA 3CCEV 2R9RB 1C9HA 2GTAA 3VQXA 4PA4A 4U3JB 2VRZA 3SJBC 4CS3A 1JNDA 2WLLB 1SR0A 2ITKA 4X64B 3ARQA 5B1BC 1VQ6V 2WA4A 4DR7B 1ZBVA 1WP8A 2XPBA 3C3TA 4FM1A 2GV9A 3N2KA 2P4KA 5KHHA 4LFCO 4UUJC 1GM8A 3JXVA 4LF5O 5GTHZ 1K7DA 5LYJA 5FNVA 4XDJA 2GSMB 4CH6A 1AJNA 4GKJB 2ADPA 1HNWO 1SETA 1S5HC 1KP3A 4X1KA 2DE0X 1GOIA 3J7AU 1NSGA 2ITDC 4I7ZB 3S3WA 1N32O 3AG4C 2YI9A 3CH9A 1MZEA 3TCUA 3THOA 4I55A 1ZUQA 2FMLA 2XP6A 4UVAA 4Q22A 3SR2C 3VQWA 1S77D 2CH7A 3SYQA 3SYCA 5LL6Y 2YBTA 1Y67A 1E6ZA 3PJSK 4QIBA 3AG2C 3BRCA 3SGIA 2PV2A 2LW1A 1VF6C 1SQGA 2IM9A 4DV4O 3DGEA 2GUZA 4YHHB 5J2UA 4W9QA 1YZBA 5A2QN 5KHGA 2VQFB 3OGCC 2ZR6A 4NTXA 1QNMA 3CRAA 4UCTA 3SJQC 3FAPA 1H2LA 1D5NA 3ETEA 3CC2V 3RYFB 2G8ZA 4IQCA 1NTMH 1GMGA 3R66A 2DYRB 1JX9A 1KD1W 3B40A 4LFAO 2HVJC 2X6CA 1D7JA 2ZXWC 4GZRB 3K59A 5IT9N 1OZ0A 2IJIA 4JFIA 5CB4A 1Q1CA 5LP6A 3D36C 4NXNO 4MNMA 2XP5A 1LR1A 3N27A 2XUMA 3MDYB 1IZ3A 3J81N 5CBHA 1Q3EA 1DF5A 1U79A 3RFWA 3WG7C 2L6LA 1UR9A 4U7NA 3FFQA 3AG7A 1L1FA 2HHHO 4JI1B 1AVMA 1FXHA 4DRNA 3L70H 4DRQA 4LAVA 1GUVA 4TV9A 5B1BB 1QCEA 1SZXA 4LF8O 3P3NA 1L0LH 1IBLO 3OGIB 3UQAA 5E79Z 2EILC 4J7ZA 4LF6B 3VQVA 1K34A 1Z5WA 3CHXA 2HFEC 4K0KB 2VCDA 2ATKC 3CEIA 1YEWA 3BABA 4PELA 3AG4B 3TK1A 4ML4A 3KADA 4O4IA 3WL1A 3ARYA 4D7SA 4B3MB 3ASNC 4BIOA 4XBFA 3SPJA 4G50A 2WAMA 3K5MA 1SKVA 1H2SB 3AS3A 3AG2B 2KO7A 1Q6IA 4QE9A 3RBZA 5JJEB 4FLXA 1GO3F 2P67A 1WB0A 1VQNV 1R3JC 4IYHA 2YUAA 4UVCA 3QOKA 1TGOA 4ODNA 2EJRA 1L0NH 1FKAO 2DWEC 4LH6A 2UXXA 4TT3G 1OCZC 4NTWA 2RJZA 4DRMA 5IWAO 4DZ2A 3ZMVA 4TW6A 1KKDA 2WLIB 4JPRA 1HNZO 1JCHB 1KB9F 4JZGA 1PNKA 2WLKA 5KUKA 1DF4A 4H13B 2DJVA 4QZVB 1W9VA 3JAWB 3OTFA 2G41A 1EDQA 3BY6A 1Y0OA 1M5IA 2ZXWB 4DUZO 4XDLA 3B9AA 4JI5O 1YI2V 2M1IA 3OFNG 2YSUB 2WLMA 3T1CA 4FLYA 5EBWC 2P4VA 4JTDB 1YJ9V 3P32A 1OCOC 4X66O 1P5QA 2F43G 4O2BB 2YEVA 3K04A 1H2GA 4O4LB 3H9VA 1R1BA 4DRIA 3UO2A 1XNQB 4FZ0A 1TUBA 4Z2HA 2LO1A 5J2TB 3ZHRA 4LF4B 3WIJA 4MNJA 2A3EA 4JAAA 1QPLA 3UQBA 3FKSG 3KZIZ 3B8SA 1H0GA 1Y66A 2Y48A 2HJFC 1MSWD 3WD2A 1M57C 1N33B 4K8XA 5JH8A 4PHZA 3RYCB 1AR4A 4Z2LA 4TQDA 2EIJB 1MOFA 3NR7A 2AZ0A 3T1HO 3BHPA 1HXVA 1AI5A 5CMUA 4BW9A 3E8BA 4HAMA 2ZNJA 3ASOB 4HNAB 4W4LA 1R73A 4UCSA 3SJCC 1B06A 4KL1A 3TXSA 1XBLA 1G8MA 2NNUA 4P8XA 4DV7O 1FJGO 3ASNB 2R70A 4J4OA 1N34O 3JALA 2VQEO 3A0RA 4JI6O 2YIBA 1GN3A 2LP7A 2LQTA 4ABMA 2YS8A 3WL0A 4OGQB 4I0XB 4Z2JA 1K5SA 4A5UB 2O57A 4U3JA 3IC9A 3M8AA 2WLLA 3K58A 2XT9A 1US6A 1AP6A 5GPGA 2QWNB 4DWSC 1SF9A 2C2AA 3ZHSA 4J4NA 4O2AB 1H0IA 3U11A 3O5DA 2A0LA 3ABTA 4KXRA 3W7TA 2RUCA 2F4VO 3AQUA 1GKFA 1N8RW 3CB2A 4WCEV 4FLWA 3O5IA 3RM4A 4JI0O 3UI4A 4UV9A 1Y4MA 3BA9A 2KG7A 3S3XA 4DR4B 3QO5A 5IJ9B 1N0NA 2QTSA 4DUYO 1QVGU 1QR8A 2JJ1G 3CX5F 2R9IA 5KX5A 2YIAA 1T5EA 3OR7C 1OJHA 4PA7A 4X1KB 4WKAA 1JPXA 1ZSPA 2ZQTA 4X1IB 4PDLA 4DV1B 3JARB 3A8TA 4L3NA 4EEQA 4ODMA 4FFKA 4I55B 1H38A 1E15A 3QG5A 1OCOB 3PRAA 3O5QA 1S3JA 3WD1A 4JI7B 1U96A 1D7IA 4P30A 2DPEA 1TAEA 4LFBB 2MLXA 3B9DA 2Y69C 3F5TA 2QTOA 2DSWA 2GUZB 1YW5A 1P4RA 3E86A 2QA4V 1FD9A 5L3EA 5B3SC 4X20B 5EZYA 5ITZB 1M57B 4B3TO 1RSOA 4DR1B 3UM7A 2DSUA 2DG9A 1R3LC 4JI3B 3RYFA 2V1DA 3CMAV 2AW9A 3HKCA 3HKBA 3LDDA 1E1RG 3ABKC 4URIA 4G27B 4DH0A 2ZQMA 2BTOA 2LJ4A 4JI2O 1P7GA 1SZTA 1PKXA 2YXLA 2IW5A 1BKFA 3X2QC 2UXNA 3K06A 4ITZA 2QKSA 3PN1A 5CB4B 3OW2U 5JVDB 4FN2A 1U97A 1SQFA 2WSSG 3UQIA 1MG1A 1QR9A 1S76D 1XMQB 3ARXA 4O4HB 5C93A 2XAHA 2YBUA 4ZI7B 5KHJA 3H1IH 4I9WA 1JNTA 2YXYA 4DWSB 4UB6Z 4TUYB 4LWSB 2K1EA 3ZX6A 3IHZA 4DRPA 4LF9O 2L2SA 3KABA 4TV9B 2W0XA 2ZR2A 4YIOA 4U3FH 1HKKA 2UUCB 3LUOA 1VQ7V 2F4EA 1VIBA 4CH3A 2JDIG 3CC4V 3AEIA 4KR0B 4ZPWR 1SYTA 2P6JA 4JFKA 2M08A 3KAGA 1W1VA 4GKKB 3OA5A 3ABMB 2F93B 4RQFA 5CN0A 1BL4A 1BGYH 4Q20A 2DWDC 3JD1A 2Q69A 1XNRO 3B09A 3ZIAG 2UXBB 3LNNA 5B1OA 4DK0A 4UV8A 5B66Z 2DG4A 2X0LA 3BPZA 1W1TA 4MSWC 5L3FA 1ZL8B 2MK3A 1VF6A 1KECA 4J7KA 5KAIZ 4X62B 1XMOO 1FXKC 1SQXH 4JI8B 2IJJA 3MHHC 1IX5A 3OD4A 2Y69B 3BEHA 4RWUA 3FYIB 5IE9A 2UXDB 4JASA 2OIEA 3RYIB 4GUNA 5B3SB 2M7WA 4CS4A 1VQ8V 3T1YO
chains in the Genus database with same CATH topology
3IK8A 2XP6A 4LAYA 4MSPA 3OOBA 3O5GA 3WQVA 3FXYA 4KQZA 4ODRA 4Q22A 5HTGA 1FKGA 1W1PA 2DT1A 5DEZA 4U84A 5GQBA 4IQ2A 2YBTA 1NWTA 2RUQA 1E6ZA 3AROA 4QIBA 4P8UA 2ZR4A 2PV2A 4HBOA 2UZ5A 4G2PA 3IKDA 3PR9A 2MPHA 1J4IA 4W9QA 1QPFA 1HJXA 3WD3A 1LL6A 3TCZA 1HJVA 3B9EA 4TYOA 1Q6HA 2ZR6A 4R0XA 4QT2A 3I6CA 4LGXA 2RSEA 3FAPA 3O5KA 2IUZA 3PA7A 2MLZA 1ZBCA 2G8ZA 3KCEA 4IQCA 1EQ3A 4ODOA 1UR8A 2A3AA 3RMEA 1FKKA 1D7JA 2RQSA 1KT1A 2PV3A 1ZU8A 1XHGA 1ZK6A 5DIUA 4JFIA 1Q1CA 4TX0A 4MNMA 2XP5A 2D9FA 2MF9A 3MDYB 1LL4A 5DO2A 3IKGA 1O6IA 5HW7A 1Q6UA 1U79A 3ARTA 3RFWA 1UR9A 3ARPA 3CHCA 1W9UA 1KT0A 2LGOA 3CHFA 5HW6A 4PTMA 4DRNA 4DRQA 4WKFA 4LAVA 3CHEA 1R9HA 4Q7NA 3ALGA 2ZR5A 1GUVA 1E6NA 4ODQA 1RD6A 3EY6A 3UQAA 2VN1A 4XAKA 1EHNA 1NWRA 2WM0A 4TW7A 4Z2GA 4WK9A 1W26A 4U86A 2VCDA 3KZ7A 3FY1A 1FKIA 4GGQA 2B31A 4ML4A 3O5JA 4DWSD 4QT3A 1QZ2A 3KADA 4FAPA 2KFWA 3WL1A 3ARYA 3WKZA 2XP3A 1JVWA 4LAXA 4G50A 3TC5A 3AS3A 3RM9A 4GIVA 2KO7A 1Q6IA 1FFQA 2KI3A 1FKTA 2MLYA 1E9LA 1NWSA 1WB0A 1D6OA 1X6NA 1YATA 2XP4A 4DRKA 4Z2IA 2PPOA 2MNTA 3QOKA 4ODNA 1HKJA 1OWQA 2XP8A 1LL7A 1WAWA 2XPAA 2KGJA 5D75A 2WLZA 4C02B 4DRMA 4NSBA 1F8AB 4DZ2A 3AS1A 4TW6A 3CZ8A 3O5MA 5HUAA 1FKDA 2XP9A 4QZVB 1FJDA 1W9VA 1LG1A 2G41A 1L1PA 1EDQA 1GPFA 1Y0OA 3NRKA 3B9AA 2PBCA 2M1IA 4JFJA 1ZB5A 1HKIA 3KAIA 4JFLA 4WKHA 1P5QA 3KAHA 4JYSA 3H9RB 4IT4A 5HT1A 3WD4A 3ARZA 4DRIA 1ZBKA 4Z2HA 2XP7A 2RURA 1FKJA 2DG3A 3WIJA 4MNJA 2PPPA 1T11A 2A3EA 1QPLA 4Z2KA 3UQBA 3B8SA 4TNSA 1H0GA 3O5FA 2O9OA 3WD2A 3CGMA 1ROUA 3RM8A 3G6LA 5JH8A 4Z2LA 2DT2A 1E6RA 4ODLA 4DWSA 2K8IA 4DZ3A 2OLHA 1HXVA 4WJXA 1LJYA 4O2TA 4S3KA 1ROTA 1FKBA 4DRJA 2WLYA 1NMVA 2FDMA 4MNLA 2KR7A 4MGVA 4P8XA 2Q5AA 4LAWA 4MTVA 2PPNA 1E6PA 4J4OA 3ARVA 1FKSA 3BXWA 1J4HA 3WL0A 2LPVA 1NWUA 4Z2JA 1FKLA 1KFWA 4DT4A 1XRVA 5GPGA 4DWSC 3O5LA 4J4NA 3JYMA 5B8IC 1HKMA 1H0IA 2RUDA 3O5DA 3AQUA 2O92A 2RUCA 3AS0A 4ODPA 1ITXA 3O5IA 3UI4A 3RM4A 3JYJA 3O5OA 5BXJA 5DITA 1PINA 1FAPA 3UF8A 3ARUA 1ZCNA 3PRBA 5HW8A 3GPKA 2N87A 3ODKA 1LG2A 1FKHA 5I98A 1JNEA 2FKEA 1F40A 2PV1A 3ARRA 4ODKA 4WKAA 1W1YA 2ZQTA 2LKNA 1J6YA 4HARA 4L3NA 4NZCA 4ODMA 4MPKA 4BF8A 2OFNA 1E15A 2ESCA 5DIVA 1CTNA 3PRAA 3O5QA 4NNRA 4JFMA 1OGGA 1JNSA 2ZQVA 3WD1A 2WK2A 2JZVA 1NH6A 1OGBA 3ARWA 3ARSA 1D7IA 2DPEA 2MLXA 3CHDA 2FAPA 4IPXA 1PBKA 2ZQUA 3B9DA 5GPRA 1W9PA 2DSWA 3KAFA 3WD0A 3WH0A 1YW5A 1FD9A 4P8VA 1FKRA 3O5PA 3WQWA 3UI5A 4DRHA 2M2AA 5DF0A 2DT0A 1FKFA 2DSUA 1HJWA 2DG9A 2IF4A 4P8WA 4MNKA 3B7XA 4URIA 4TW8A 4DH0A 4AY1A 4R5EA 1NMWA 3KACA 3PRDA 4U85A 2LJ4A 3O5RA 1B6CA 1ZBWA 1D7HA 4N19A 1BKFA 1LQ0A 4ITZA 1X6LA 1M5YA 3RGCA 1EYMA 1D2KA 2AWGA 1J4RA 1WNOA 4FN2A 2A3BA 4W5UA 2DSVA 3UQIA 4ZPTR 5HWBA 2KE0A 3ARXA 4HBEA 2DSZA 2DT3A 3NI6A 2Y78A 2YBUA 4ZS6A 1JNTA 4DWSB 4L72B 1VF8A 3G6MA 3IHZA 4DRPA 4W9OA 1A7XA 2L2SA 3KABA 2PI6A 2F2DA 1HKKA 3LUOA 2F4EA 1TCOC 4S3JA 3TDBA 4ZPWR 4IT6A 4KR0B 3VAWA 1SYTA 2ZQSA 4ZPVR 5HWCA 2QF8A 1ZL1A 4JFKA 2M08A 1K9TA 3KAGA 1W1VA 3OA5A 1C9HA 1N1AA 1BL4A 4MAVA 4W9PA 2AOSA 2F21A 1JNDA 3B09A 1SR0A 2ITKA 3ARQA 1ZBVA 2DG4A 2XPBA 3O5EA 1EIBA 1W1TA 3NTPA 3AS2A 4WIWA 1TFVA 3ALFA 3JXVA 3UI6A 3W4RA 5HKGA 5HBFA 1IX5A 3CGNA 1GOIA 4DIPA 1NSGA 1FFRA 2A3CA 3CH9A 5J6EA 4DROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IF4 A;  3IK8 A;  2XP6 A;  4GGQ A;  4LAY A;  3OOB A;  4MSP A;  3B7X A;  3O5G A;  4ODR A;  1ROT A;  1FKB A;  4DRJ A;  5HTG A;  1FKG A;  3O5J A;  4QT3 A;  4U84 A;  1QZ2 A;  3KAD A;  4TW8 A;  4DH0 A;  4FAP A;  2KFW A;  1NMV A;  4IQ2 A;  1NMW A;  2KR7 A;  2XP3 A;  1JVW A;  2RUQ A;  3KAC A;  2LJ4 A;  3PRD A;  4LAX A;  4MGV A;  3O5R A;  4G50 A;  4QIB A;  1B6C A;  2Q5A A;  3TC5 A;  2ZR4 A;  4LAW A;  2PPN A;  2PV2 A;  2UZ5 A;  1D7H A;  4J4O A;  4N19 A;  1BKF A;  4GIV A;  2KO7 A;  4G2P A;  3IKD A;  1Q6I A;  1FKS A;  2KI3 A;  4ITZ A;  2MPH A;  1FKT A;  2MLY A;  3RGC A;  1M5Y A;  1J4I A;  1J4H A;  1EYM A;  4W9Q A;  1QPF A;  2AWG A;  1J4R A;  2LPV A;  4FN2 A;  1D6O A;  1FKL A;  3TCZ A;  1YAT A;  4TYO A;  2XP4 A;  3UQI A;  4DRK A;  2PPO A;  2MNT A;  4DT4 A;  1Q6H A;  5HWB A;  2ZR6 A;  4R0X A;  2KE0 A;  4ODN A;  5GPG A;  2XP8 A;  3O5L A;  3NI6 A;  2Y78 A;  4QT2 A;  4J4N A;  3JYM A;  2XPA A;  5B8I C;  1JNT A;  2KGJ A;  2RSE A;  3I6C A;  5D75 A;  2RUD A;  3FAP A;  3O5D A;  2RUC A;  3O5K A;  3PA7 A;  4ODP A;  4C02 B;  2MLZ A;  4DRM A;  1F8A B;  3KCE A;  3O5I A;  4IQC A;  3UI4 A;  4DZ2 A;  1EQ3 A;  3JYJ A;  3O5O A;  5BXJ A;  4TW6 A;  3IHZ A;  4ODO A;  5DIT A;  4DRP A;  1PIN A;  1FAP A;  3O5M A;  4W9O A;  1A7X A;  1FKD A;  1FKK A;  2L2S A;  3KAB A;  3UF8 A;  2XP9 A;  5HUA A;  2F2D A;  1ZCN A;  1D7J A;  2RQS A;  3LUO A;  3PRB A;  1FJD A;  1KT1 A;  2PV3 A;  2F4E A;  5HW8 A;  3GPK A;  2N87 A;  1L1P A;  1ZK6 A;  1TCO C;  3ODK A;  5DIU A;  4JFI A;  1Y0O A;  1Q1C A;  3NRK A;  3TDB A;  2PBC A;  1FKH A;  2M1I A;  4JFJ A;  5I98 A;  4TX0 A;  3VAW A;  2FKE A;  2ZQS A;  5HWC A;  2XP5 A;  2D9F A;  1F40 A;  4JFK A;  2MF9 A;  3KAI A;  3MDY B;  2M08 A;  2PV1 A;  4ODK A;  3KAG A;  2ZQT A;  2LKN A;  1J6Y A;  3IKG A;  4JFL A;  5HW7 A;  1Q6U A;  1U79 A;  1C9H A;  1N1A A;  1BL4 A;  1P5Q A;  3KAH A;  4JYS A;  4ODM A;  4W9P A;  3RFW A;  4BF8 A;  2OFN A;  2F21 A;  1KT0 A;  3B09 A;  2LGO A;  3H9R B;  5DIV A;  5HW6 A;  2ITK A;  4U85 A;  5HT1 A;  3O5Q A;  4DRI A;  4NNR A;  4JFM A;  1JNS A;  4DRN A;  4DRQ A;  2ZQV A;  4LAV A;  2XP7 A;  1R9H A;  2DG4 A;  2JZV A;  2RUR A;  2XPB A;  1FKJ A;  2ZR5 A;  2DG3 A;  3O5E A;  2PPP A;  1T11 A;  1D7I A;  2MLX A;  1QPL A;  3NTP A;  3UQB A;  2FAP A;  4IPX A;  1PBK A;  2ZQU A;  3UI6 A;  3JXV A;  4TNS A;  3O5F A;  4ODQ A;  5HKG A;  3EY6 A;  3KAF A;  3CGM A;  1ROU A;  1YW5 A;  3WH0 A;  3UQA A;  1FD9 A;  3CGN A;  2VN1 A;  1FKR A;  3O5P A;  3UI5 A;  4DIP A;  1NSG A;  4ODL A;  4TW7 A;  4DRH A;  2M2A A;  2K8I A;  4DZ3 A;  1W26 A;  1FKF A;  4U86 A;  2VCD A;  2DG9 A;  3KZ7 A;  1HXV A;  5J6E A;  1FKI A;  4O2T A;  4DRO A; 
#chains in the Genus database with same CATH topology
 3KCX A;  3ZN1 A;  1YTF B;  4MSP A;  3O5G A;  1JCH A;  1FKG A;  2DT1 A;  3WB1 A;  5DEZ A;  1MAB G;  2Q68 A;  3ABK B;  4P8U A;  3CSX A;  4DV2 O;  2P5O A;  4MW3 A;  3IKD A;  3OTO B;  3D36 A;  3PR9 A;  2MPH A;  1J5E B;  1HNX O;  1NVP D;  4JTC B;  1QPF A;  1HJX A;  4MTX A;  3WD3 A;  1WNS A;  1HW7 A;  4O2B A;  3TCZ A;  5L3D A;  4TYO A;  3JSN A;  1RM1 C;  1NQT A;  5K1X A;  5J2T A;  5K1P A;  1YVW A;  4B7E A;  2RSE A;  3JD4 A;  4DR6 O;  5GON B;  4ODO A;  5KLV H;  2OIG A;  3RME A;  3G6B A;  3G71 V;  1IBK B;  1AJP A;  4P9P A;  1KT1 A;  1O9G A;  5KAF Z;  1ZK6 A;  4WFF A;  5DIU A;  1SER A;  2A06 H;  3WB2 A;  4TX0 A;  1SS3 A;  4PI0 A;  4JI4 O;  1W0K G;  4HNA A;  1EN6 A;  4LFC B;  4UFZ A;  3IKG A;  2YXH A;  4LF5 B;  1M56 C;  3ML0 A;  3CHC A;  3DC6 A;  3CHF A;  2LGO A;  1HNW B;  3LDE A;  4D7T A;  3MD0 A;  4Q7N A;  1N32 B;  1G4Y B;  3APQ A;  2ZR5 A;  4DV0 O;  4QNH B;  1R3I C;  3K08 A;  1DK1 A;  3JAT A;  4I0X A;  1AR5 A;  4JGS A;  1W2B U;  2P90 A;  2QM4 A;  3JAL B;  4NB5 A;  2VN1 A;  4GYC B;  4XAK A;  5IYB O;  2P7T C;  5BR8 B;  1JR9 A;  4O2A A;  3KKY A;  4DO2 A;  4LNU A;  4JYY A;  3KZ7 A;  4DV4 B;  2OCC C;  3CD6 V;  1FKI A;  5C8Y B;  4NYK A;  1GRJ A;  2B31 A;  2JS3 A;  5LBQ A;  4JV5 O;  3WFV A;  5IJ9 A;  1NH2 B;  4FAP A;  4HYO A;  4FK5 C;  5GW7 A;  5IYD O;  3JAS A;  3WKZ A;  2P22 C;  1JVW A;  4H37 A;  4LAX A;  2IH1 C;  1VF5 B;  1PP9 H;  2R9A A;  2KG7 B;  2B5U B;  2GDS A;  3RM9 A;  4OX9 O;  4QE7 A;  1YDX A;  5KX5 B;  4X1I A;  1E9L A;  2OT5 A;  3JAR A;  1IBM O;  3CJH B;  1D6O A;  1WP7 A;  4IIJ B;  1YAT A;  4LFA B;  3VQY A;  4Z2I A;  3ZS8 C;  5EIB C;  2YIB D;  3EVK A;  4Z1M G;  1JJO A;  1HKJ A;  1OWQ A;  4FVM A;  1LL7 A;  3ZHQ A;  2FTK A;  4J80 A;  2KGJ A;  4NXN B;  1MNG A;  1RM1 B;  3VBB A;  5IYZ B;  1XI1 A;  1N4C A;  1F8A B;  3AS1 A;  3TET A;  2AZ2 A;  5HUA A;  1MSD A;  5FPR A;  1GTO A;  1XHX A;  1R6T A;  1PPJ H;  1UJW B;  3OE7 G;  4FFB B;  1FJD A;  4X20 A;  2VWK A;  1SQV H;  5GTI Z;  1YHQ V;  5ITZ A;  2HHH B;  2EJ7 A;  3NRK A;  1GK9 A;  2GBO A;  1WB7 A;  1D2D A;  4JFJ A;  4R7C A;  3GB7 C;  2OCH A;  4WFB V;  3CCJ V;  1ZB5 A;  1HKI A;  1SQQ H;  4DV3 B;  3KAI A;  5EZY B;  1MZF A;  2IU0 A;  3BCC H;  1RSO B;  4LF8 B;  1GAX A;  4JFL A;  1Z5V A;  3KAH A;  2UUB O;  1IBL B;  4MVU A;  1AI7 A;  2Q0O C;  2F1M A;  2Q9L A;  4YJ3 B;  3HKC B;  3HKB B;  1M56 B;  5HT1 A;  3WD4 A;  3ARZ A;  1RFY A;  2XP7 A;  2RUR A;  1FKJ A;  2PPP A;  4I4T A;  3JD0 A;  4FLV A;  4GKJ O;  5JVD A;  4Z2K A;  4PA9 A;  5KA6 A;  2O9O A;  1ROU A;  3RM8 A;  2EIK C;  1E6R A;  4O4H A;  4ZOL B;  4ZI7 A;  4J7J A;  1GN6 A;  2CGN A;  2ILM A;  4DWS A;  1W0J G;  2OLH A;  2QWQ B;  4TUY A;  1I5X A;  4OPH A;  4WBN A;  4LWS A;  3BAA A;  4WJX A;  4S3K A;  4DV5 O;  1F7Y A;  4DW0 A;  1XUQ A;  2OCC B;  5DED A;  4PA3 A;  1KU9 A;  4FLT A;  3A0B Z;  3EXA A;  1NMV A;  2FDM A;  4MNL A;  2BSK B;  3LDC A;  3RFR A;  4LAW A;  3ZRW B;  2PPN A;  3JSL A;  4LBE C;  4WFE A;  4J41 A;  2QDO A;  4ZKI A;  4BW5 A;  1FKS A;  1AIL A;  4DR2 O;  4IHJ B;  4F6R B;  5IWA B;  5BMV B;  2LPV A;  2Z5U A;  1HNZ B;  3E8H A;  4DT4 A;  3UKM A;  4B3S O;  3CRQ A;  1OCC C;  2QKA A;  5CA0 B;  5D5P A;  4D6T H;  4DUZ B;  4PI2 A;  4JI5 B;  2RUD A;  1K73 W;  4BAY A;  1E79 G;  4BWA A;  1ZL8 A;  1F4N A;  4OPA A;  1ITX A;  2UXC O;  3O5O A;  5BXJ A;  1R6K A;  1FAP A;  4ZHQ A;  4X66 B;  2EUL A;  2M6Y A;  3FYE B;  2QM7 A;  1FS0 G;  2HJD A;  3RYI A;  1VQL V;  2QM8 A;  5I98 A;  2Q0A A;  2FKE A;  4X1Y B;  5JH7 A;  2PV1 A;  3SYP A;  2LKN A;  1QLN A;  1XEQ A;  3APO A;  1RPR A;  2ZD9 A;  3JD3 A;  1AJQ A;  2DQ0 A;  3GU0 A;  1B3Q A;  4JFM A;  1K8A W;  2JIZ G;  5LHH A;  1FXV A;  3ARW A;  3ARS A;  3T1H B;  1FYJ A;  5CBG A;  2DYS C;  1X59 A;  5GPR A;  4LF6 O;  2E76 B;  3WH0 A;  4B08 A;  2JEX A;  2W6J G;  4JYA B;  3BA8 A;  4RUE A;  3O5P A;  3UI5 A;  4YJ2 A;  1JOY A;  4DV7 B;  2ZE7 A;  1D5A A;  1PV0 A;  1FJG B;  4NKG B;  3WG7 B;  1FKF A;  1N34 B;  1JMK C;  5H6R A;  3G6E V;  2VQE B;  5D5Q A;  4JI6 B;  4DV6 O;  5GON A;  3B7X A;  4X9Q A;  4TW8 A;  3CS5 A;  4R5E A;  5IJ0 B;  3JCU Z;  3KAC A;  1I94 O;  1B6C A;  2CTP A;  4H0L B;  3K0D A;  1WJZ A;  1ZBW A;  5AG2 A;  5EYP A;  1X4T A;  5LXT A;  5CA1 A;  2YC0 A;  3CYO A;  3RGC A;  2DOS A;  3F5W C;  1M5Y A;  2AWG A;  2JJ2 G;  1J4R A;  1XL6 A;  2EIL B;  2QR4 A;  5L3G A;  4X65 O;  1IVS A;  4JI0 B;  1Q5O A;  1HDJ A;  4WFH A;  5TIS Z;  5HWB A;  4DUY B;  5DEC A;  4HBE A;  2EBO A;  2DT3 A;  3C90 A;  5DN6 G;  1NJI W;  2NR5 A;  4IYI A;  3H1J H;  1OCC B;  2OTJ V;  5LMN O;  3ABL C;  4PD4 F;  1GN2 A;  3CCQ V;  4K8Z A;  2JGU A;  1B6Q A;  1EN4 A;  3JAT B;  1FXK A;  4OXS A;  2LGW A;  4MW8 A;  3TDB A;  5DM6 V;  5HWC A;  4ZPV R;  2NN4 A;  2QF8 A;  5C8Y A;  1ZL1 A;  1K9T A;  4J42 A;  3CCV V;  1Y74 B;  4LNU B;  1N1A A;  4W9P A;  2AOS A;  2F21 A;  1OCZ B;  4MVZ A;  2E5L O;  5BY1 A;  2B5U A;  2PYL A;  3OEE G;  3H1K H;  4B3T B;  2JK5 C;  3JAS B;  3K03 A;  2IBZ H;  4IGG A;  1EIB A;  1XIL A;  4P2Z A;  1AR1 B;  3NTP A;  4WIW A;  3CJH A;  3ALF A;  3ZHT A;  4IIJ A;  5HKG A;  4H33 A;  2Q67 A;  4F6E A;  1ZWI C;  3CGN A;  2DQ3 A;  2PN0 A;  1WLE A;  3ZJZ A;  4WFG A;  3RVZ A;  2YDE A;  1KYO F;  3K9A A;  2ITC C;  1PL0 A;  1FFT B;  1B04 A;  3QVN A;  4JI2 B;  2A3C A;  1CPY A;  4IL6 Z;  5IYZ A;  2DW4 A;  4DRO A;  1Q43 A;  3IK8 A;  4LAY A;  3OOB A;  3WQV A;  3FXY A;  1K4C C;  1P84 F;  2E3C A;  2ZM6 O;  4AIL C;  1Q7Y W;  5HTG A;  1W1P A;  4U84 A;  5GQB A;  4FFB A;  2EX3 A;  3UO3 A;  4UB8 Z;  1NWT A;  2PUS A;  4MTG A;  1NT2 B;  2IJK A;  2ZR4 A;  2H94 A;  4TV8 B;  3CP1 A;  4TQF A;  4AI8 A;  1EFR G;  2UZ5 A;  4HBO A;  1V55 C;  2ADQ B;  2QWO B;  4RQE A;  3LSU A;  3FAV B;  5J9P C;  2QKC A;  1YSC A;  4LF9 B;  2KKW A;  1HJV A;  3E83 A;  3L74 H;  3UT5 B;  4YJ3 A;  1Q6H A;  3TXQ A;  3SPH A;  3W7S A;  3LUT B;  3ICX A;  4ZIB A;  4LGX A;  5BXZ A;  3PA7 A;  2IUZ A;  1OHH G;  1ZBC A;  2IU3 A;  3GVM A;  1EQ3 A;  1UR8 A;  2A3A A;  4GX5 A;  4DR3 O;  1FKK A;  3ABL B;  1HR0 O;  4I4T B;  1CXZ B;  2RQS A;  3MDS A;  1OCR C;  1CEZ A;  2PV3 A;  4UDM A;  1ZU8 A;  1XHG A;  1XNR B;  3T4Z A;  4ZOL A;  1QU7 A;  1K3E A;  5EBM C;  3K5N A;  2EIM C;  2D9F A;  1TUE B;  2MF9 A;  4DR5 O;  1SES A;  2A7W A;  5LOV A;  1WA8 B;  3AG3 C;  3IJ4 A;  4MVS A;  1XMO B;  2WWW A;  4WBN B;  1DTO A;  4FM2 A;  2BSK A;  1W9U A;  1KT0 A;  5HW6 A;  3CPW U;  1F23 A;  3FB7 C;  3ZRS A;  3U0Z A;  4ZBM A;  2B1G A;  2PZS A;  3ZRW A;  1YCI A;  1QHT A;  2QJ1 A;  4IHJ A;  4F6R A;  2LJ2 A;  1J95 A;  5BMV A;  3T1Y B;  1KMI Z;  1VAR A;  3RN4 A;  3BFR A;  4WFA V;  2PF4 E;  4YY3 O;  4HZ3 A;  1NWR A;  1JJ2 U;  1VQP V;  1LUW A;  1AI4 A;  5CA0 A;  1M1K W;  4TW7 A;  4DV2 B;  4WK9 A;  1W26 A;  3WB0 A;  3FY1 A;  1TA8 A;  2WLH A;  5CA3 A;  1I0H A;  5H6Q A;  3I55 V;  1O9H A;  2VS0 A;  4GGQ A;  1HNX B;  4JYC A;  4DWS D;  1NR7 A;  3STL C;  4U7O A;  2GTS A;  5JWP A;  5H5N A;  5HFM A;  3M7M X;  2WPD G;  2XP3 A;  5IY5 C;  3TC5 A;  4QGP A;  2UU9 O;  1EZJ A;  3SDL A;  4ZHQ B;  2B9Z A;  4X1Y A;  3QO7 A;  4GIV A;  1FFQ A;  1FKT A;  1BCC H;  4DR6 B;  1ZX3 A;  2CE4 A;  4GX1 A;  1L8D A;  1P7B A;  1V55 B;  2HLD G;  5JCO C;  3JD2 A;  1FFX A;  5JH7 B;  2XP4 A;  4DRK A;  2XP8 A;  1PD3 A;  1WAW A;  2RMK B;  2XPA A;  3E35 A;  5LMU O;  2P06 A;  3K3W A;  1VQM V;  2XND G;  1SA0 A;  4K3A A;  4JI4 B;  2E75 B;  3CZ8 A;  2BOC C;  2BCC H;  2XP9 A;  5FPO A;  2LGQ A;  2EIN C;  2XOK G;  3X2Q B;  2Y0I A;  3ZRX A;  1N0J A;  2UUA O;  1VQK V;  5KMG B;  1OCR B;  1K92 A;  2PBC A;  4PDM A;  3EFF K;  3B2E E;  2LFS A;  3ZED A;  4AQY O;  4J9Y B;  4LP8 A;  4YJ2 B;  2FL4 A;  4DV0 B;  2ZDI C;  4PDR A;  3BMB A;  4X89 A;  4HBN A;  4WKH A;  4I50 A;  2HR3 A;  1SQP H;  4R6Z A;  5IJ0 A;  1YTF D;  2Q7H A;  2YI8 A;  2X6A A;  3A0H Z;  4IT4 A;  5A9G A;  3KG2 A;  2ZE6 A;  1YIJ V;  2X7R B;  1KP2 A;  1KBH A;  2CUG A;  1F4M A;  4KHP O;  3TJT A;  2DN9 A;  2DG3 A;  2ZIN A;  2Q7G A;  3OUF A;  4Z2W A;  2OWO A;  3O5F A;  1TVK A;  3FB6 C;  5EYP B;  1FAF A;  5LXT B;  5CA1 B;  3CCM V;  2QGN A;  4JV5 B;  3G6L A;  4BR6 A;  2DT2 A;  1NTK H;  4ODL A;  1BSM A;  3CXC U;  4CBC A;  3ABU A;  5EC2 C;  1K9M W;  3UQ8 A;  2K8I A;  4NXM O;  2FB5 A;  4OX9 B;  1LJY A;  5IDJ A;  4KFM A;  1ROT A;  4DRJ A;  1IBM B;  3CCL V;  1K4D C;  2WLY A;  3AG1 C;  1N36 O;  2Q5A A;  3H1H H;  3P30 A;  1R3K C;  3ETQ A;  3CME V;  1MMM A;  3QF7 A;  4ICG A;  1VP7 A;  4LF7 O;  1Q81 W;  2MW2 B;  3ZBH A;  3ARV A;  1FXK B;  2HP8 A;  2GHY A;  4G2K A;  3L75 H;  5IY5 B;  1J4H A;  3G80 A;  1Y74 A;  5JQG A;  1VF7 A;  3K79 A;  3RYH B;  1FKL A;  4KUM A;  3HKE B;  4X8A A;  4DYL A;  1XRV A;  3Q4H B;  4B7K A;  2QE7 G;  2XAQ A;  4R50 A;  1Y6X A;  3OM3 B;  3JYM A;  1HKM A;  2ZT9 B;  4MTF A;  2OYQ A;  3AS0 A;  2BOB C;  1IBK O;  1VEW A;  5DIT A;  1PIN A;  1YIT V;  3LSQ A;  3UF8 A;  2FKX A;  2UUB B;  3ARU A;  1ZCN A;  2XAF A;  4JAV A;  3K5L A;  3ZCC A;  3GPK A;  2JS5 A;  1GM9 A;  3ODK A;  4TWK A;  2V7Q G;  2EIN B;  1LG2 A;  1FKH A;  1UPG A;  4JTA B;  5L3C A;  4I5S A;  4GX2 A;  1W1Y A;  3OMI B;  3IC7 A;  3RGB A;  3F7V C;  3ZHU A;  4CS2 A;  4GT1 A;  1BS3 A;  4HAR A;  3CRR A;  4J10 A;  4NZC A;  2AHZ A;  4DK1 A;  1YXB A;  1H2N A;  1YJN V;  4BF8 A;  1ZTE A;  4CC5 A;  2ESC A;  3ZN0 A;  3NXS A;  5H9C A;  2PYJ A;  5DIV A;  4B3R O;  4TV8 A;  4NR1 A;  1OGG A;  2Q8V A;  3T2M A;  3SPI A;  1NH2 D;  2WK2 A;  2JZV A;  2F66 C;  1OGB A;  2BE3 A;  1ARO P;  4EKW A;  3CHD A;  3FAV A;  4UCV A;  1PBK A;  2ZQU A;  4DV5 B;  1XDC A;  5BR8 O;  1W9P A;  5B1A C;  3UT5 A;  3KAF A;  3WD0 A;  4DRX B;  4X64 O;  3SPC A;  3EIP A;  1FKR A;  3WQW A;  5KA5 A;  1EZV H;  1H2M A;  4DRH A;  4DR7 O;  2L35 A;  2IH3 C;  1QVF U;  1VMG A;  2D3O W;  2HG5 C;  3LNM B;  2CTW A;  2DMX A;  2DT0 A;  4UXN A;  2JGD B;  1KKC A;  4DR2 B;  1Q8I A;  4KP4 A;  2IF4 A;  1S5J A;  2LFR A;  4CH5 A;  4MVR A;  2XAG A;  4GX0 A;  2PI5 A;  3W7X A;  1BQ0 A;  4W4K A;  1NMW A;  3B8M A;  4JAU A;  4U85 A;  2A9H A;  4B3S B;  3JAK B;  3OAA G;  4UCO A;  3I56 V;  2OTL V;  1BT8 A;  1IXM A;  2N05 A;  3AG1 B;  3SYO A;  4EFE A;  1IX9 A;  1NKD A;  4N19 A;  2HVK C;  1LQ0 A;  5LHI A;  1WB8 A;  1EYM A;  1D2K A;  1WA8 A;  4PDV A;  2UXC B;  1R6N A;  1WNO A;  1WPX A;  3JAM N;  1H8H G;  3E22 B;  2A3B A;  2DSV A;  1AB3 A;  1KQS U;  2Q73 A;  4ZPT R;  2CTR A;  5B5E Z;  4MS2 A;  3DXR B;  2WA3 A;  5LOV B;  2DSZ A;  4O4J B;  4WF9 V;  3NI6 A;  4ZS6 A;  3EHB B;  1Q82 W;  3ZMZ A;  4UVB A;  1VQO V;  2PY5 A;  2X6B A;  4L72 B;  4RO2 A;  4FLU A;  3ETD A;  4CC6 A;  1A32 A;  4YHH O;  1NBM G;  3D3Q A;  1VF8 A;  2B1I A;  3G6M A;  4R8C A;  3C3S A;  3CWB H;  3CCS V;  2VQF O;  2PI6 A;  3AK2 A;  3HPL C;  4DV3 O;  1Q90 D;  1TCO C;  4EB6 A;  4IT6 A;  2QEX V;  2Q5Z A;  1F51 A;  2Q4P A;  2ZQS A;  4CH4 A;  3RWR D;  1HP8 A;  1GN4 A;  2QSA A;  1BMF G;  1HWY A;  2EIJ C;  2W0F C;  4MAV A;  5JJN B;  3DTU B;  3K9S A;  4K35 A;  1CP9 A;  1QQC A;  2CGO A;  3ASO C;  2ZNI A;  1WN7 A;  3SYA A;  4F4L A;  5BZB A;  3O5E A;  3OEH G;  3O65 A;  1H8E G;  3AS2 A;  2WLJ A;  1TFV A;  3IFX A;  1VQ5 V;  3UI6 A;  4DV6 B;  3E89 A;  3W4R A;  3QNE A;  5HBF A;  4JI1 O;  5JJJ B;  3FB5 C;  1XL4 A;  2EZP A;  3E8F A;  2ZIO A;  5B1A B;  4DIP A;  1I94 B;  1FFR A;  5LA6 B;  1FFX B;  3CRM A;  5L3B A;  4L8J A;  5J6E A;  2XTA A;  5EIB D;  1H2K A;  1COW G;  5IYC O;  4KQZ A;  4ODR A;  1I08 A;  3ZRV A;  4X65 B;  1SA0 B;  3MAQ A;  1QLE C;  4MVO A;  1QBZ A;  1EM1 A;  4IQ2 A;  1NS1 A;  1K97 A;  3W7W A;  2RUQ A;  2K9P A;  3ARO A;  4LR3 A;  5KMG A;  2Z3Y A;  2QWR B;  4K0K O;  3N2G B;  4G2P A;  4RAI A;  1Y76 B;  5LMN B;  1DLB A;  1J4I A;  1NZ6 A;  2AGA A;  2A3Q A;  2EIK B;  3QO8 A;  4JZ2 A;  3FB8 C;  3HKD B;  1LL6 A;  1GM7 A;  3B9E A;  2HKO A;  1GH6 A;  3ZHV A;  3BVO A;  4B3M O;  1SC5 B;  4N21 A;  4R0X A;  4I50 B;  1IDS A;  1NU1 H;  2H8P C;  2RQ6 A;  3UCS C;  4QT2 A;  3CC7 V;  3I6C A;  4E4E A;  1M93 A;  3O5K A;  2IJH A;  3L9D A;  3L72 H;  5LHG A;  2MLZ A;  3H1L H;  3KCE A;  2WLN A;  2RN9 A;  4FMT A;  2F4V B;  2PGG A;  3AK3 A;  1FPO A;  4I9Q A;  1SQB H;  1NR1 A;  1TVK B;  3B8N A;  2E5L B;  1ENV A;  2Q6A A;  2AXT Z;  3STZ C;  2F95 B;  4MT8 A;  1LL4 A;  5DO2 A;  4PJ0 Z;  1O6I A;  3HR0 A;  5HW7 A;  1Q6U A;  3B4S A;  3ART A;  2N04 A;  1AI6 A;  2BTQ A;  2FYU H;  3ARP A;  3D3I A;  2YID A;  3WU2 Z;  2QWP B;  4PTM A;  2W6I G;  3ZMS A;  2ETN A;  4WKF A;  3CHE A;  1R9H A;  1JFF A;  3ALG A;  3J80 N;  1M90 W;  5B1N A;  2XAJ A;  1Z2G A;  2ARH A;  3ETG A;  2F23 A;  1E6N A;  4JYA O;  1IXB A;  3RYH A;  4ODQ A;  1RD6 A;  2ZM6 B;  4FM0 A;  3HKE A;  3EY6 A;  1W59 A;  4MVQ A;  3OT7 A;  5LP6 C;  5JCO A;  4L87 A;  5JQG B;  3Q4H A;  1EHN A;  2WM0 A;  1YJW V;  1XNQ O;  2AHY A;  1ZLZ A;  1M4U A;  1UFI A;  4Z2G A;  4LF4 O;  2H3O A;  4U86 A;  4FJC C;  2RDC A;  3O5J A;  4QT3 A;  4E2L A;  1N33 O;  1QZ2 A;  2KFW A;  4QJF B;  1XRE A;  1QLE B;  3W7U A;  5HFL A;  2DYS B;  5F2V O;  2Y4U A;  1EBO A;  1BHA A;  1URF A;  2KI3 A;  3CRC A;  2MLY A;  3N2K B;  1NWS A;  3B77 A;  3IGA C;  3OMA B;  1S72 V;  3E8G A;  1X6N A;  5LYJ B;  4DR3 B;  5FNV B;  2ZDI A;  2HEP A;  4H44 B;  4TSF G;  1HR0 B;  1SRY A;  2PPO A;  2MNT A;  3D8C A;  1NI8 A;  3CCU V;  1S0V A;  3ABM C;  2EZO A;  1IUR A;  2PTM A;  5D75 A;  2WLZ A;  1JVM A;  4C02 B;  3I5D A;  5CBF A;  3HB3 B;  4NSB A;  3LSS A;  4DR5 B;  1VQ9 V;  3SJA C;  2Z0A A;  5KHK A;  1FKD A;  3O5M A;  2D2C B;  1I7F A;  2CH7 B;  4DRX A;  1LG1 A;  3O9O A;  1L1P A;  4CZZ A;  1GPF A;  4N23 A;  1V54 C;  1BL8 A;  4LC1 A;  2JGD A;  2ZE8 A;  1PNL A;  1K5Q A;  4J11 A;  5J2U B;  3T4D A;  4UCR A;  1ZAU A;  4DR4 O;  5LGN A;  4JYS A;  4YXW G;  4EFB A;  3H9R B;  2CDY A;  4BIZ A;  3L73 H;  3JAK A;  4YY3 B;  2KSD A;  1ZBK A;  5FL7 G;  1NTZ H;  1Q86 W;  3GWO A;  2JVD A;  1BQZ A;  1T11 A;  3RT3 C;  4DV1 O;  4TNS A;  3E22 A;  1JA8 A;  2CTQ A;  1VQ4 V;  2ODM A;  3CGM A;  3DXR A;  2XAS A;  2LW7 A;  5KUM A;  1AP5 A;  4O4J A;  2UU9 B;  4QPJ A;  5LP6 B;  4JI7 O;  4X88 A;  2RNB A;  3FD9 A;  1BHB A;  4DZ3 A;  1RP3 B;  3K57 A;  3OUS A;  3GWK C;  2A79 B;  4LFB O;  4O2T A;  1FKB A;  3KCY A;  4G28 B;  3SPG A;  2KR7 A;  4ASU G;  4UCU A;  4MGV A;  1PNM A;  1THZ A;  4DR1 O;  4MTV A;  1E6P A;  3TGU H;  5LMU B;  4JI3 O;  2Y0P A;  4DW1 A;  4LH7 A;  3CE2 A;  3BXW A;  4QIW F;  5KHI A;  4EB6 B;  1NWU A;  1LUV A;  3CXH F;  1KFW A;  3ZMT A;  3G67 A;  2KQX A;  4Z1V A;  3O5L A;  2UUA B;  4JYB A;  5B8I C;  2CK3 G;  3GTY X;  2O92 A;  2V4D A;  4ODP A;  1RPO A;  4AQY B;  4TOI A;  5H2F Z;  3JYJ A;  4J9Z B;  2ZKO A;  4PA6 A;  4NVP A;  3PRB A;  3RVY A;  1ROP A;  4O4I B;  2ZR3 A;  1OV9 A;  1XMQ O;  1K33 A;  5HW8 A;  2N87 A;  5LA6 A;  1XHZ A;  3DSQ A;  4AHC A;  3OR6 C;  1MA1 A;  4FLZ A;  1NVP B;  5EBL C;  3L71 H;  2YIC A;  3F7Y C;  4NTY A;  1JNE A;  2RCV A;  4KHP B;  1E44 A;  2Q7E A;  1G6U A;  4MTO A;  1V54 B;  1F40 A;  2E74 B;  3ARR A;  2VWJ A;  4ODK A;  4P9O A;  4GCZ A;  1KC8 W;  1J6Y A;  3A2F A;  3VOU A;  5LGT A;  4MPK A;  4C7U A;  2UUC O;  2OFN A;  1XOU A;  1CTN A;  3JCZ A;  4QPK A;  2JRI A;  1WPB A;  3P3P A;  4FZ1 A;  4IT5 A;  4NNR A;  1JNS A;  2ZQV A;  3N2G A;  1JQ0 A;  1PL4 A;  2WLI A;  1NH6 A;  1Y76 A;  4NXM B;  3K5O A;  2FAP A;  2XHB A;  1BZK A;  2NLJ C;  3JAW A;  4RUF A;  4PV1 B;  4GKK O;  4IPX A;  3HKD A;  5EC1 C;  5EK0 A;  1M9N A;  2ZE5 A;  3ZMU A;  4GLX A;  2UXB O;  4P8V A;  2EIM B;  1E1Q G;  1N36 B;  1I5Y A;  2M2A A;  5DF0 A;  3JYC A;  3G4S V;  4LF7 B;  3AG3 B;  1BE3 H;  1HJW A;  1PM9 A;  2R72 A;  3H01 A;  4P8W A;  4MNK A;  2PI4 A;  4O4L A;  4X62 O;  4JI8 O;  3AK1 A;  2ZCE A;  4AY1 A;  2YEV B;  3PRD A;  3IAY A;  4BIU A;  2UXD O;  3O5R A;  3M99 B;  4FPP A;  1TUB B;  1D7H A;  2CAZ C;  3OMN B;  1LNQ A;  1V9P A;  2G38 A;  4DXW A;  1X6L A;  3RYC A;  2JEU A;  5LGU A;  3CCR V;  3MHS C;  3FX7 A;  4W5U A;  3QTC A;  2KB1 A;  4FIP C;  3U10 A;  2KE0 A;  2Y78 A;  2BTQ B;  1YF2 A;  3OTO O;  1ORQ C;  1EN5 A;  2DYR C;  1XQ8 A;  1J5E O;  3K0G A;  5FLX N;  4MVM A;  1P49 A;  1JFF B;  1S5L Z;  2ZIM A;  1A7X A;  4W9O A;  2F2D A;  1DGS A;  1G1X B;  4XDK A;  5E1A C;  4S3J A;  2N74 A;  4B3R B;  4JF3 A;  4YIP A;  1KUQ A;  3E2E A;  3VAW A;  2Y4T A;  3R65 A;  4LCU C;  3RW0 A;  3DC5 A;  1WAZ A;  4Q6G A;  3CCE V;  2R9R B;  1C9H A;  2GTA A;  3VQX A;  4PA4 A;  4U3J B;  2VRZ A;  3SJB C;  4CS3 A;  1JND A;  2WLL B;  1SR0 A;  2ITK A;  4X64 B;  3ARQ A;  5B1B C;  1VQ6 V;  2WA4 A;  4DR7 B;  1ZBV A;  1WP8 A;  2XPB A;  3C3T A;  4FM1 A;  2GV9 A;  3N2K A;  2P4K A;  5KHH A;  4LFC O;  4UUJ C;  1GM8 A;  3JXV A;  4LF5 O;  5GTH Z;  1K7D A;  5LYJ A;  5FNV A;  4XDJ A;  2GSM B;  4CH6 A;  1AJN A;  4GKJ B;  2ADP A;  1HNW O;  1SET A;  1S5H C;  1KP3 A;  4X1K A;  2DE0 X;  1GOI A;  3J7A U;  1NSG A;  2ITD C;  4I7Z B;  3S3W A;  1N32 O;  3AG4 C;  2YI9 A;  3CH9 A;  1MZE A;  3TCU A;  3THO A;  4I55 A;  1ZUQ A;  2FML A;  2XP6 A;  4UVA A;  4Q22 A;  3SR2 C;  3VQW A;  1S77 D;  2CH7 A;  3SYQ A;  3SYC A;  5LL6 Y;  2YBT A;  1Y67 A;  1E6Z A;  3PJS K;  4QIB A;  3AG2 C;  3BRC A;  3SGI A;  2PV2 A;  2LW1 A;  1VF6 C;  1SQG A;  2IM9 A;  4DV4 O;  3DGE A;  2GUZ A;  4YHH B;  5J2U A;  4W9Q A;  1YZB A;  5A2Q N;  5KHG A;  2VQF B;  3OGC C;  2ZR6 A;  4NTX A;  1QNM A;  3CRA A;  4UCT A;  3SJQ C;  3FAP A;  1H2L A;  1D5N A;  3ETE A;  3CC2 V;  3RYF B;  2G8Z A;  4IQC A;  1NTM H;  1GMG A;  3R66 A;  2DYR B;  1JX9 A;  1KD1 W;  3B40 A;  4LFA O;  2HVJ C;  2X6C A;  1D7J A;  2ZXW C;  4GZR B;  3K59 A;  5IT9 N;  1OZ0 A;  2IJI A;  4JFI A;  5CB4 A;  1Q1C A;  5LP6 A;  3D36 C;  4NXN O;  4MNM A;  2XP5 A;  1LR1 A;  3N27 A;  2XUM A;  3MDY B;  1IZ3 A;  3J81 N;  5CBH A;  1Q3E A;  1DF5 A;  1U79 A;  3RFW A;  3WG7 C;  2L6L A;  1UR9 A;  4U7N A;  3FFQ A;  3AG7 A;  1L1F A;  2HHH O;  4JI1 B;  1AVM A;  1FXH A;  4DRN A;  3L70 H;  4DRQ A;  4LAV A;  1GUV A;  4TV9 A;  5B1B B;  1QCE A;  1SZX A;  4LF8 O;  3P3N A;  1L0L H;  1IBL O;  3OGI B;  3UQA A;  5E79 Z;  2EIL C;  4J7Z A;  4LF6 B;  3VQV A;  1K34 A;  1Z5W A;  3CHX A;  2HFE C;  4K0K B;  2VCD A;  2ATK C;  3CEI A;  1YEW A;  3BAB A;  4PEL A;  3AG4 B;  3TK1 A;  4ML4 A;  3KAD A;  4O4I A;  3WL1 A;  3ARY A;  4D7S A;  4B3M B;  3ASN C;  4BIO A;  4XBF A;  3SPJ A;  4G50 A;  2WAM A;  3K5M A;  1SKV A;  1H2S B;  3AS3 A;  3AG2 B;  2KO7 A;  1Q6I A;  4QE9 A;  3RBZ A;  5JJE B;  4FLX A;  1GO3 F;  2P67 A;  1WB0 A;  1VQN V;  1R3J C;  4IYH A;  2YUA A;  4UVC A;  3QOK A;  1TGO A;  4ODN A;  2EJR A;  1L0N H;  1FKA O;  2DWE C;  4LH6 A;  2UXX A;  4TT3 G;  1OCZ C;  4NTW A;  2RJZ A;  4DRM A;  5IWA O;  4DZ2 A;  3ZMV A;  4TW6 A;  1KKD A;  2WLI B;  4JPR A;  1HNZ O;  1JCH B;  1KB9 F;  4JZG A;  1PNK A;  2WLK A;  5KUK A;  1DF4 A;  4H13 B;  2DJV A;  4QZV B;  1W9V A;  3JAW B;  3OTF A;  2G41 A;  1EDQ A;  3BY6 A;  1Y0O A;  1M5I A;  2ZXW B;  4DUZ O;  4XDL A;  3B9A A;  4JI5 O;  1YI2 V;  2M1I A;  3OFN G;  2YSU B;  2WLM A;  3T1C A;  4FLY A;  5EBW C;  2P4V A;  4JTD B;  1YJ9 V;  3P32 A;  1OCO C;  4X66 O;  1P5Q A;  2F43 G;  4O2B B;  2YEV A;  3K04 A;  1H2G A;  4O4L B;  3H9V A;  1R1B A;  4DRI A;  3UO2 A;  1XNQ B;  4FZ0 A;  1TUB A;  4Z2H A;  2LO1 A;  5J2T B;  3ZHR A;  4LF4 B;  3WIJ A;  4MNJ A;  2A3E A;  4JAA A;  1QPL A;  3UQB A;  3FKS G;  3KZI Z;  3B8S A;  1H0G A;  1Y66 A;  2Y48 A;  2HJF C;  1MSW D;  3WD2 A;  1M57 C;  1N33 B;  4K8X A;  5JH8 A;  4PHZ A;  3RYC B;  1AR4 A;  4Z2L A;  4TQD A;  2EIJ B;  1MOF A;  3NR7 A;  2AZ0 A;  3T1H O;  3BHP A;  1HXV A;  1AI5 A;  5CMU A;  4BW9 A;  3E8B A;  4HAM A;  2ZNJ A;  3ASO B;  4HNA B;  4W4L A;  1R73 A;  4UCS A;  3SJC C;  1B06 A;  4KL1 A;  3TXS A;  1XBL A;  1G8M A;  2NNU A;  4P8X A;  4DV7 O;  1FJG O;  3ASN B;  2R70 A;  4J4O A;  1N34 O;  3JAL A;  2VQE O;  3A0R A;  4JI6 O;  2YIB A;  1GN3 A;  2LP7 A;  2LQT A;  4ABM A;  2YS8 A;  3WL0 A;  4OGQ B;  4I0X B;  4Z2J A;  1K5S A;  4A5U B;  2O57 A;  4U3J A;  3IC9 A;  3M8A A;  2WLL A;  3K58 A;  2XT9 A;  1US6 A;  1AP6 A;  5GPG A;  2QWN B;  4DWS C;  1SF9 A;  2C2A A;  3ZHS A;  4J4N A;  4O2A B;  1H0I A;  3U11 A;  3O5D A;  2A0L A;  3ABT A;  4KXR A;  3W7T A;  2RUC A;  2F4V O;  3AQU A;  1GKF A;  1N8R W;  3CB2 A;  4WCE V;  4FLW A;  3O5I A;  3RM4 A;  4JI0 O;  3UI4 A;  4UV9 A;  1Y4M A;  3BA9 A;  2KG7 A;  3S3X A;  4DR4 B;  3QO5 A;  5IJ9 B;  1N0N A;  2QTS A;  4DUY O;  1QVG U;  1QR8 A;  2JJ1 G;  3CX5 F;  2R9I A;  5KX5 A;  2YIA A;  1T5E A;  3OR7 C;  1OJH A;  4PA7 A;  4X1K B;  4WKA A;  1JPX A;  1ZSP A;  2ZQT A;  4X1I B;  4PDL A;  4DV1 B;  3JAR B;  3A8T A;  4L3N A;  4EEQ A;  4ODM A;  4FFK A;  4I55 B;  1H38 A;  1E15 A;  3QG5 A;  1OCO B;  3PRA A;  3O5Q A;  1S3J A;  3WD1 A;  4JI7 B;  1U96 A;  1D7I A;  4P30 A;  2DPE A;  1TAE A;  4LFB B;  2MLX A;  3B9D A;  2Y69 C;  3F5T A;  2QTO A;  2DSW A;  2GUZ B;  1YW5 A;  1P4R A;  3E86 A;  2QA4 V;  1FD9 A;  5L3E A;  5B3S C;  4X20 B;  5EZY A;  5ITZ B;  1M57 B;  4B3T O;  1RSO A;  4DR1 B;  3UM7 A;  2DSU A;  2DG9 A;  1R3L C;  4JI3 B;  3RYF A;  2V1D A;  3CMA V;  2AW9 A;  3HKC A;  3HKB A;  3LDD A;  1E1R G;  3ABK C;  4URI A;  4G27 B;  4DH0 A;  2ZQM A;  2BTO A;  2LJ4 A;  4JI2 O;  1P7G A;  1SZT A;  1PKX A;  2YXL A;  2IW5 A;  1BKF A;  3X2Q C;  2UXN A;  3K06 A;  4ITZ A;  2QKS A;  3PN1 A;  5CB4 B;  3OW2 U;  5JVD B;  4FN2 A;  1U97 A;  1SQF A;  2WSS G;  3UQI A;  1MG1 A;  1QR9 A;  1S76 D;  1XMQ B;  3ARX A;  4O4H B;  5C93 A;  2XAH A;  2YBU A;  4ZI7 B;  5KHJ A;  3H1I H;  4I9W A;  1JNT A;  2YXY A;  4DWS B;  4UB6 Z;  4TUY B;  4LWS B;  2K1E A;  3ZX6 A;  3IHZ A;  4DRP A;  4LF9 O;  2L2S A;  3KAB A;  4TV9 B;  2W0X A;  2ZR2 A;  4YIO A;  4U3F H;  1HKK A;  2UUC B;  3LUO A;  1VQ7 V;  2F4E A;  1VIB A;  4CH3 A;  2JDI G;  3CC4 V;  3AEI A;  4KR0 B;  4ZPW R;  1SYT A;  2P6J A;  4JFK A;  2M08 A;  3KAG A;  1W1V A;  4GKK B;  3OA5 A;  3ABM B;  2F93 B;  4RQF A;  5CN0 A;  1BL4 A;  1BGY H;  4Q20 A;  2DWD C;  3JD1 A;  2Q69 A;  1XNR O;  3B09 A;  3ZIA G;  2UXB B;  3LNN A;  5B1O A;  4DK0 A;  4UV8 A;  5B66 Z;  2DG4 A;  2X0L A;  3BPZ A;  1W1T A;  4MSW C;  5L3F A;  1ZL8 B;  2MK3 A;  1VF6 A;  1KEC A;  4J7K A;  5KAI Z;  4X62 B;  1XMO O;  1FXK C;  1SQX H;  4JI8 B;  2IJJ A;  3MHH C;  1IX5 A;  3OD4 A;  2Y69 B;  3BEH A;  4RWU A;  3FYI B;  5IE9 A;  2UXD B;  4JAS A;  2OIE A;  3RYI B;  4GUN A;  5B3S B;  2M7W A;  4CS4 A;  1VQ8 V;  3T1Y O; 
#chains in the Genus database with same CATH homology
 3IK8 A;  2XP6 A;  4LAY A;  4MSP A;  3OOB A;  3O5G A;  3WQV A;  3FXY A;  4KQZ A;  4ODR A;  4Q22 A;  5HTG A;  1FKG A;  1W1P A;  2DT1 A;  5DEZ A;  4U84 A;  5GQB A;  4IQ2 A;  2YBT A;  1NWT A;  2RUQ A;  1E6Z A;  3ARO A;  4QIB A;  4P8U A;  2ZR4 A;  2PV2 A;  4HBO A;  2UZ5 A;  4G2P A;  3IKD A;  3PR9 A;  2MPH A;  1J4I A;  4W9Q A;  1QPF A;  1HJX A;  3WD3 A;  1LL6 A;  3TCZ A;  1HJV A;  3B9E A;  4TYO A;  1Q6H A;  2ZR6 A;  4R0X A;  4QT2 A;  3I6C A;  4LGX A;  2RSE A;  3FAP A;  3O5K A;  2IUZ A;  3PA7 A;  2MLZ A;  1ZBC A;  2G8Z A;  3KCE A;  4IQC A;  1EQ3 A;  4ODO A;  1UR8 A;  2A3A A;  3RME A;  1FKK A;  1D7J A;  2RQS A;  1KT1 A;  2PV3 A;  1ZU8 A;  1XHG A;  1ZK6 A;  5DIU A;  4JFI A;  1Q1C A;  4TX0 A;  4MNM A;  2XP5 A;  2D9F A;  2MF9 A;  3MDY B;  1LL4 A;  5DO2 A;  3IKG A;  1O6I A;  5HW7 A;  1Q6U A;  1U79 A;  3ART A;  3RFW A;  1UR9 A;  3ARP A;  3CHC A;  1W9U A;  1KT0 A;  2LGO A;  3CHF A;  5HW6 A;  4PTM A;  4DRN A;  4DRQ A;  4WKF A;  4LAV A;  3CHE A;  1R9H A;  4Q7N A;  3ALG A;  2ZR5 A;  1GUV A;  1E6N A;  4ODQ A;  1RD6 A;  3EY6 A;  3UQA A;  2VN1 A;  4XAK A;  1EHN A;  1NWR A;  2WM0 A;  4TW7 A;  4Z2G A;  4WK9 A;  1W26 A;  4U86 A;  2VCD A;  3KZ7 A;  3FY1 A;  1FKI A;  4GGQ A;  2B31 A;  4ML4 A;  3O5J A;  4DWS D;  4QT3 A;  1QZ2 A;  3KAD A;  4FAP A;  2KFW A;  3WL1 A;  3ARY A;  3WKZ A;  2XP3 A;  1JVW A;  4LAX A;  4G50 A;  3TC5 A;  3AS3 A;  3RM9 A;  4GIV A;  2KO7 A;  1Q6I A;  1FFQ A;  2KI3 A;  1FKT A;  2MLY A;  1E9L A;  1NWS A;  1WB0 A;  1D6O A;  1X6N A;  1YAT A;  2XP4 A;  4DRK A;  4Z2I A;  2PPO A;  2MNT A;  3QOK A;  4ODN A;  1HKJ A;  1OWQ A;  2XP8 A;  1LL7 A;  1WAW A;  2XPA A;  2KGJ A;  5D75 A;  2WLZ A;  4C02 B;  4DRM A;  4NSB A;  1F8A B;  4DZ2 A;  3AS1 A;  4TW6 A;  3CZ8 A;  3O5M A;  5HUA A;  1FKD A;  2XP9 A;  4QZV B;  1FJD A;  1W9V A;  1LG1 A;  2G41 A;  1L1P A;  1EDQ A;  1GPF A;  1Y0O A;  3NRK A;  3B9A A;  2PBC A;  2M1I A;  4JFJ A;  1ZB5 A;  1HKI A;  3KAI A;  4JFL A;  4WKH A;  1P5Q A;  3KAH A;  4JYS A;  3H9R B;  4IT4 A;  5HT1 A;  3WD4 A;  3ARZ A;  4DRI A;  1ZBK A;  4Z2H A;  2XP7 A;  2RUR A;  1FKJ A;  2DG3 A;  3WIJ A;  4MNJ A;  2PPP A;  1T11 A;  2A3E A;  1QPL A;  4Z2K A;  3UQB A;  3B8S A;  4TNS A;  1H0G A;  3O5F A;  2O9O A;  3WD2 A;  3CGM A;  1ROU A;  3RM8 A;  3G6L A;  5JH8 A;  4Z2L A;  2DT2 A;  1E6R A;  4ODL A;  4DWS A;  2K8I A;  4DZ3 A;  2OLH A;  1HXV A;  4WJX A;  1LJY A;  4O2T A;  4S3K A;  1ROT A;  1FKB A;  4DRJ A;  2WLY A;  1NMV A;  2FDM A;  4MNL A;  2KR7 A;  4MGV A;  4P8X A;  2Q5A A;  4LAW A;  4MTV A;  2PPN A;  1E6P A;  4J4O A;  3ARV A;  1FKS A;  3BXW A;  1J4H A;  3WL0 A;  2LPV A;  1NWU A;  4Z2J A;  1FKL A;  1KFW A;  4DT4 A;  1XRV A;  5GPG A;  4DWS C;  3O5L A;  4J4N A;  3JYM A;  5B8I C;  1HKM A;  1H0I A;  2RUD A;  3O5D A;  3AQU A;  2O92 A;  2RUC A;  3AS0 A;  4ODP A;  1ITX A;  3O5I A;  3UI4 A;  3RM4 A;  3JYJ A;  3O5O A;  5BXJ A;  5DIT A;  1PIN A;  1FAP A;  3UF8 A;  3ARU A;  1ZCN A;  3PRB A;  5HW8 A;  3GPK A;  2N87 A;  3ODK A;  1LG2 A;  1FKH A;  5I98 A;  1JNE A;  2FKE A;  1F40 A;  2PV1 A;  3ARR A;  4ODK A;  4WKA A;  1W1Y A;  2ZQT A;  2LKN A;  1J6Y A;  4HAR A;  4L3N A;  4NZC A;  4ODM A;  4MPK A;  4BF8 A;  2OFN A;  1E15 A;  2ESC A;  5DIV A;  1CTN A;  3PRA A;  3O5Q A;  4NNR A;  4JFM A;  1OGG A;  1JNS A;  2ZQV A;  3WD1 A;  2WK2 A;  2JZV A;  1NH6 A;  1OGB A;  3ARW A;  3ARS A;  1D7I A;  2DPE A;  2MLX A;  3CHD A;  2FAP A;  4IPX A;  1PBK A;  2ZQU A;  3B9D A;  5GPR A;  1W9P A;  2DSW A;  3KAF A;  3WD0 A;  3WH0 A;  1YW5 A;  1FD9 A;  4P8V A;  1FKR A;  3O5P A;  3WQW A;  3UI5 A;  4DRH A;  2M2A A;  5DF0 A;  2DT0 A;  1FKF A;  2DSU A;  1HJW A;  2DG9 A;  2IF4 A;  4P8W A;  4MNK A;  3B7X A;  4URI A;  4TW8 A;  4DH0 A;  4AY1 A;  4R5E A;  1NMW A;  3KAC A;  3PRD A;  4U85 A;  2LJ4 A;  3O5R A;  1B6C A;  1ZBW A;  1D7H A;  4N19 A;  1BKF A;  1LQ0 A;  4ITZ A;  1X6L A;  1M5Y A;  3RGC A;  1EYM A;  1D2K A;  2AWG A;  1J4R A;  1WNO A;  4FN2 A;  2A3B A;  4W5U A;  2DSV A;  3UQI A;  4ZPT R;  5HWB A;  2KE0 A;  3ARX A;  4HBE A;  2DSZ A;  2DT3 A;  3NI6 A;  2Y78 A;  2YBU A;  4ZS6 A;  1JNT A;  4DWS B;  4L72 B;  1VF8 A;  3G6M A;  3IHZ A;  4DRP A;  4W9O A;  1A7X A;  2L2S A;  3KAB A;  2PI6 A;  2F2D A;  1HKK A;  3LUO A;  2F4E A;  1TCO C;  4S3J A;  3TDB A;  4ZPW R;  4IT6 A;  4KR0 B;  3VAW A;  1SYT A;  2ZQS A;  4ZPV R;  5HWC A;  2QF8 A;  1ZL1 A;  4JFK A;  2M08 A;  1K9T A;  3KAG A;  1W1V A;  3OA5 A;  1C9H A;  1N1A A;  1BL4 A;  4MAV A;  4W9P A;  2AOS A;  2F21 A;  1JND A;  3B09 A;  1SR0 A;  2ITK A;  3ARQ A;  1ZBV A;  2DG4 A;  2XPB A;  3O5E A;  1EIB A;  1W1T A;  3NTP A;  3AS2 A;  4WIW A;  1TFV A;  3ALF A;  3JXV A;  3UI6 A;  3W4R A;  5HKG A;  5HBF A;  1IX5 A;  3CGN A;  1GOI A;  4DIP A;  1NSG A;  1FFR A;  2A3C A;  3CH9 A;  5J6E A;  4DRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...