1Q6IA

Crystal structure of a truncated form of fkpa from escherichia coli, in complex with immunosuppressant fk506
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
210
Chain Sequence
AFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of FkpA from Escherichia coli, a cis/trans peptidyl-prolyl isomerase with chaperone activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
total genus 66
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1q6iA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q6iA02
4DRJA 2DG4A 1EYMA 2MLZA 2ZR5A 3NTPA 5HW7A 3KAIA 3TDBA 1P5QA 4W9QA 1Q1CA 2DG3A 1U79A 2PPNA 4LAVA 3O5OA 1D7IA 1YW5A 4QIBA 2ZQSA 3TC5A 3I6CA 4W9PA 4BF8A 3NI6A 2OFNA 4DRKA 1FKRA 1R9HA 1NMVA 3PA7A 4ODRA 1D6OA 3JYJA 4TX0A 1FAPA 3TCZA 3UQIA 2VCDA 2MPHA 3UI6A 2RURA 4ODOA 3JYMA 5I98A 2MLXA 1D7JA 1QZ2A 2L2SA 4IPXA 3RFWA 1JNTA 4R0XA 1YATA 4U86A 4TW6A 2XP7A 3H9RB 2KR7A 1J6YA 1W26A 3KAHA 1PBKA 5HWCA 2KGJA 4LAYA 1EQ3A 2RUDA 1F40A 2LJ4A 3KACA 2UZ5A 1FKBA 5DITA 3O5IA 3JXVA 4N19A 3O5EA 1D7HA 4JFMA 4JYSA 5HW6A 2PV1A 2FAPA 4NNRA 4QT2A 3O5DA 2AWGA 1Q6UA 3B09A 1ZK6A 1A7XA 1BL4A 2M08A 2ZQTA 4DRHA 2PBCA 4ITZA 4MSPA 4ODLA 1FKTA 3UQBA 4TW8A 1FD9A 1T11A 1NSGA 3ODKA 4DRQA 2PV2A 2MNTA 3KAGA 3IKGA 3UF8A 4DT4A 5J6EA 1Y0OA 4ODQA 1PINA 2K8IA 4JFLA 5DIVA 3O5LA 3KAFA 3WH0A 4DRIA 3UQAA 3CGNA 2M1IA 1FKKA 3B7XA 1FKIA 4J4OA 2XPAA 3KADA 2D9FA 1FKSA 1C9HA 4ODKA 3LUOA 2Q5AA 3O5FA 1Q6HA 4ODNA 4DRNA 2JZVA 2F4EA 2M2AA 3IHZA 1KT0A 4TYOA 4ODPA 2MLYA 4C02B 2PV3A 1JVWA 2ZR4A 4G2PA 1BKFA 2ITKA 2LKNA 4MGVA 3MDYB 3KCEA 4JFIA 2ZQVA 1J4RA 1FKHA 1FKDA 3PRDA 1FKLA 3EY6A 4TW7A 5HKGA 4DRPA 1L1PA 3UI5A 5D75A 2IF4A 2XP6A 3O5KA 4DZ2A 3KABA 3GPKA 2KO7A 2RSEA 1J4IA 1FKGA 2XP3A 3O5JA 4TNSA 1Q6IA 1FKJA 4DZ3A 5HUAA 1ROUA 1M5YA 1TCOC 4O2TA 3NRKA 3PRBA 1NMWA 4JFJA 1N1AA 1F8AB 4IQ2A 2DG9A 4U85A 2RUQA 2XP8A 4DH0A 1FJDA 4GIVA 4IQCA 4FAPA 2F2DA 4FN2A 4U84A 2RUCA 4J4NA 4LAWA 5HWBA 2XP4A 2XP5A 2XPBA 1JNSA 1B6CA 2LPVA 1J4HA 4DIPA 4JFKA 3IKDA 4DRMA 1FKFA 2PPOA 4DROA 1HXVA 5HW8A 2KFWA 3VAWA 4LAXA 3O5RA 3O5GA 5DIUA 1QPLA 2KI3A 3IK8A 2VN1A 3OOBA 2XP9A 5B8IC 2ZR6A 1QPFA 2KE0A 5BXJA 2RQSA 2PPPA 1KT1A 4GGQA 1ROTA 2MF9A 1ZCNA 3O5PA 2FKEA 4G50A 5GPGA 4ODMA 4W9OA 3KZ7A 2N87A 2ZQUA 3CGMA 3O5QA 4QT3A 5HT1A 3RGCA 3UI4A 2F21A 2Y78A 5HTGA 3O5MA 2LGOA 3FAPA
chains in the Genus database with same CATH superfamily
3QO7A 3T1YB 4MSWC 1K9MW 1JMKC 2XUMA 5BY1A 3W7UA 4CBCA 3EVKA 3MD0A 3KG2A 4EFBA 1RSOA 2HLDG 2XT9A 3ARYA 4TX0A 2VCDA 3UI6A 1ENVA 2WLZA 1XDCA 4GLXA 5JJNB 3RYCB 5IYZA 4GX5A 1YATA 2EJ7A 3CCLV 4OXSA 1E6ZA 5DM6V 2OCCB 3BA8A 3CC4V 1SC5B 5LGTA 2FMLA 1YI2V 1TUBB 2EJRA 4MW8A 1XI1A 2DE0X 1I08A 3O5EA 2QM4A 2OWOA 3K9AA 4X88A 5KA6A 1BL4A 3JD2A 4J11A 2OLHA 4I0XB 3UF8A 2UUCO 4PA6A 4P8UA 4JFLA 3GTYX 1FAFA 1XMQO 3QNEA 5IT9N 3B9DA 4MPKA 3W7WA 4G2PA 1OCZC 2CUGA 4J7ZA 3UT5A 1IBKB 2QKAA 4LFAB 4BIZA 5JJJB 1W9UA 2DQ0A 4DUYB 1Y76B 2W0XA 3KABA 1QR8A 4JI8B 4E2LA 3ABTA 1YZBA 4UCUA 1PPJH 4GX0A 3AS3A 4QZVB 3CHEA 4FLWA 1NH6A 4TOIA 1EIBA 2Q7GA 3CZ8A 3EXAA 3JALA 4OX9O 2HJFC 1X6NA 4TQDA 4I4TA 4MVMA 1XUQA 2UUAO 3OA5A 1RPOA 2UXCB 1K73W 3O5RA 3CCUV 5CBGA 4WF9V 2KE0A 3H9VA 2CTPA 3LDCA 1M5IA 4Z2WA 4HAMA 1WPXA 1ZCNA 1I94B 5IJ9B 2YBUA 5FPRA 3RW0A 3LDEA 2AZ0A 3ABMC 4UCVA 5HFMA 3ZMVA 2ZDIA 1XHZA 1VEWA 1YDXA 2JGDA 5DECA 2YBTA 3OMNB 4LFBB 3VOUA 1YJNV 4GUNA 3TC5A 1K8AW 3B9AA 3J7AU 2OFNA 4AQYO 2X7RB 3PA7A 4I9QA 5J2UB 1XHGA 5EIBD 3M99B 1HNXB 1H8EG 4K3AA 5JCOA 1ZB5A 4R6ZA 2YEVB 2LFRA 3S3WA 1JCHB 5DN6G 3ETGA 1GN3A 5IY5C 2ZKOA 2DYSC 1SQXH 4CH5A 3CC2V 5LOVB 3O5DA 3MDSA 2QM8A 2W6JG 2WPDG 2PBCA 1MZEA 3L71H 4Z2GA 2H8PC 4TWKA 1Q7YW 2R9AA 2MNTA 4HBOA 3AQUA 5DIVA 4XDLA 1QBZA 1W1YA 3W4RA 1Z5WA 1JR9A 2XAHA 4ZS6A 1KECA 4ODNA 2GV9A 5LA6A 1S77D 4AHCA 1T5EA 3TJTA 3E8HA 5KHIA 1VQ9V 3WD0A 4MVRA 1IVSA 1MSWD 3WL0A 1VF7A 3ICXA 1HW7A 1S5LZ 3RM4A 5K1XA 3HR0A 2AOSA 1RM1B 1TCOC 5KHJA 1NWTA 2OIGA 5CA0A 1F8AB 2ZT9B 3C3SA 2ARHA 4QIWF 5LMNB 2X0LA 3S3XA 1TUBA 4B3SO 5GTHZ 4DR5O 3FD9A 2PI6A 1UR8A 3UKMA 5GTIZ 1JFFA 4X89A 5CMUA 1Q90D 3VAWA 4BR6A 1BL8A 2JVDA 2BTQA 1NWSA 1LQ0A 2DT1A 3IFXA 2HVJC 1F51A 1XILA 3ZEDA 2F4VO 5BMVA 4URIA 2Y78A 4LF5O 1RPRA 4FZ0A 4DRJA 4UCTA 2WLHA 3ETQA 2DOSA 1H8HG 3N2GA 2PPNA 3CMAV 2DMXA 3ZIAG 3AK3A 1DTOA 3CE2A 2Y0PA 2P67A 2F93B 2UXBO 1AROP 2EILB 2LJ4A 1SR0A 2R9IA 3BABA 5J2UA 2WLIB 3K5LA 1VQPV 3RT3C 1N8RW 1WAWA 1BSMA 2A3EA 2DQ3A 3F5WC 3QTCA 1COWG 1AI4A 2WAMA 2ZXWB 1ZK6A 3JSLA 1JNDA 4XDJA 2XAJA 1R1BA 1FKTA 3WG7C 2IM9A 1N33B 3RYFA 1GPFA 4JGSA 4EB6A 3IKGA 2P06A 3J80N 4WFGA 3UQAA 3CGNA 4P8XA 5EC2C 1SZTA 2IU3A 3CCEV 3KADA 2YIBA 3DXRA 1M56C 4WFFA 4DV1O 3SPJA 4TV8A 2QM7A 1OCRC 3ZBHA 1JOYA 2LKNA 1FKLA 5BMVB 4J41A 3DXRB 1TA8A 1IXBA 4PI2A 4XAKA 2D2CB 3K59A 3O5JA 1QR9A 4KXRA 4H44B 3DC5A 3NRKA 4U7NA 3I5DA 2DW4A 1LNQA 2XP8A 2ITDC 4GIVA 4IQCA 4LFBO 1NJIW 1P4RA 4DV4B 2BTOA 3UT5B 2R72A 2H94A 2JEUA 4X1IA 4JTCB 4B7KA 2GBOA 2V7QG 3B2EE 5CA0B 1BS3A 1QPFA 4GCZA 2WLIA 2ZE5A 3OTOO 3FX7A 3G71V 4B3SB 4DR4B 4JI3B 3RFRA 5HTGA 4YIPA 1W0JG 3EFFK 5K1PA 3DTUB 3PRAA 4HYOA 4QPKA 3KZIZ 1SQFA 1K4CC 2F1MA 1DLBA 4QIBA 2ZQSA 1ZAUA 3L74H 3HKBB 3NI6A 3K06A 2Q4PA 1LL7A 1X4TA 3E83A 4H0LB 3K5MA 1VQ6V 1NMVA 4DV3B 5D5PA 1AI7A 1SA0B 2Q68A 1VQ7V 4IHJA 2PY5A 3ZN1A 1BT8A 3CP1A 3IAYA 4GT1A 4TW6A 4X8AA 1XQ8A 3OE7G 1CP9A 3JAWB 4HZ3A 3WD2A 3JD4A 1F40A 4Z2HA 1Y74A 3WU2Z 4MVOA 4YHHB 1X59A 2WLLA 1KMIZ 1GN4A 1Q6UA 4JI1B 2C2AA 4BW5A 1L0LH 1E79G 4QE9A 3JCZA 2A3AA 3HKEA 2CGOA 2EINB 1SF9A 5B5EZ 2JEXA 2O9OA 3ARWA 4DT4A 4DRIA 1KKDA 4DR6B 1SS3A 3EHBB 2UU9O 5JVDB 2ESCA 1OV9A 2DJVA 3B4SA 4LF9O 1Q8IA 3ASOC 4DK0A 3ZMUA 1Q6HA 1E6RA 2PGGA 1KT0A 4JYBA 2PV3A 2QWPB 1BKFA 3B77A 2M6YA 1Z5VA 4HNAB 3R66A 2P5OA 3CCVV 1N36O 1XEQA 5KX5A 2ZM6B 1E6PA 3ZMZA 5TISZ 2P90A 2FB5A 2F4VB 2CGNA 4O4JB 1BGYH 1XNRB 2Q9LA 2Q7HA 3BPZA 3BRCA 3RYHA 1R73A 4MVQA 4QPJA 2PYJA 3JALB 2LPVA 1FKFA 3WB1A 5GW7A 4NXMO 4X64B 4DR1B 1SQBH 3UCSC 1B06A 3AS1A 3F5TA 4UB6Z 2ZE7A 1MG1A 3IK8A 1ZL8B 3X2QC 1FFXB 1QLNA 2BSKA 1HNXO 1R3JC 1EDQA 5LP6C 4MNLA 2ZQUA 2ZQMA 5H2FZ 4J9ZB 5GONB 3T1CA 5CA1A 4LF7O 4KQZA 4W9QA 2G8ZA 5C8YA 3L75H 1IXMA 1KUQA 1Q1CA 4X62O 2DG3A 1H2SB 1VF5B 1HJVA 1YSCA 3E86A 1SYTA 4OX9B 3ZS8C 1KB9F 1YTFD 1MA1A 1OGBA 1NVPD 3E22B 3IJ4A 2DPEA 1D7JA 1WB7A 4ZHQB 2EZPA 1UR9A 1OZ0A 5C8YB 3SR2C 2H3OA 3C90A 3LSSA 4DUZO 2YI9A 2UUAB 2B5UB 2KR7A 1VQMV 2CH7B 4JAVA 1H0GA 2FDMA 3OR6C 4JTAB 5DITA 2IW5A 3SYPA 1YITV 2W6IG 1ZWIC 3SPHA 5HW6A 3ZHQA 2IBZH 5BR8O 2AWGA 1PL4A 1A7XA 4KP4A 5IE9A 1HNZO 1ITXA 2P6JA 3J81N 1XBLA 1NSGA 3WD1A 2RJZA 4TV9B 5LMNO 2DSZA 1A32A 1AJNA 4FLXA 2AW9A 1M1KW 1XL4A 2VS0A 3KAFA 1LR1A 2QWNB 3Q4HA 2A3QA 1Q43A 2DWEC 3JYCA 5CA3A 2D9FA 2ZR2A 1R3LC 2R9RB 1SRYA 2GTSA 1XOUA 2HR3A 1TGOA 2LFSA 2WLNA 5J2TA 3SYAA 2UUBB 3RWRD 4DV4O 4IT4A 3MHHC 3OGIB 5EBWC 4ZKIA 4DZ2A 4K8XA 4B3MO 3D36A 1FKJA 3ASOB 4DRXB 5IY5B 4LH6A 4WFHA 1GN2A 4U85A 4NZCA 3IC9A 3O65A 5L3EA 2Y4TA 3LNMB 4IGGA 4CS2A 2RUCA 1ZSPA 4FFKA 1J4HA 3CYOA 3CS5A 2HFEC 1VQ5V 3T1YO 3TXQA 1SZXA 1YHQV 1GUVA 1LL4A 3TETA 3ML0A 1XHXA 5EYPB 4LWSB 2ZR6A 4B3TO 1ROTA 2MF9A 4UFZA 4O2AA 4MAVA 3BVOA 1BE3H 5IYZB 4Q6GA 4CH3A 2JK5C 4JI2O 1H0IA 4NXMB 3RYHB 3NTPA 5H5NA 3N27A 1EN5A 1F23A 1M57C 4JV5B 5EC1C 5EZYB 4YIOA 3RVZA 5FNVA 2FKXA 3UM7A 1QCEA 3OMAB 5EYPA 3AG2B 4IPXA 2A0LA 3SPGA 2XTAA 4LF7B 4FVMA 4FLUA 4U86A 2YEVA 1AR5A 5HWCA 3CHXA 4JYCA 4F4LA 1S76D 3ABLC 5CBFA 4JYSA 4GKJB 2FAPA 1J5EO 2AHYA 2M08A 1I5YA 4JZ2A 3HKCA 4X20B 2P7TC 2Y4UA 1BZKA 4X1KA 2QF8A 5JH7B 4JV5O 4O4IB 1K34A 2ZCEA 5LA6B 2IJJA 3QVNA 4DXWA 4WK9A 3JAKB 2JJ1G 3T2MA 3MAQA 3H1HH 4JI8O 4DV7B 3LNNA 1WA8B 1W9PA 4DWSD 2A06H 2W0FC 3AG1C 3CX5F 4ODPA 2ZR4A 4NKGB 1VF6A 3FYIB 5B1AB 3T1HO 1G6UA 4HBNA 4B08A 2B1GA 3VQVA 2CTWA 4JI4O 4Q22A 3ASNC 4TUYB 4KHPB 5JWPA 1IBLO 2HG5C 2RCVA 3CD6V 1LUVA 5B66Z 3P3PA 3ABMB 2XPBA 3RYFB 4UB8Z 3HPLC 1SERA 2IUZA 3HKDB 2DYRB 1YVWA 1M90W 1M56B 1K5SA 1HWYA 2XP9A 3WD4A 3JSNA 4UUJC 5KUMA 3OEEG 3AG7A 1GM7A 1KQSU 4PHZA 4ZOLA 3CRQA 4QT3A 3WQVA 3LSUA 1WJZA 1EQ3A 3ETEA 1S5HC 3K03A 1U79A 1JJOA 4FM0A 4LAVA 4JTDB 1RFYA 2L6LA 4HARA 3UQIA 2ZNJA 4DR6O 2KQXA 4WFBV 2RURA 3ARPA 2D3OW 5E79Z 2B31A 3ARQA 3L73H 3RFWA 3BHPA 5A9GA 2YC0A 1NR7A 3ZHRA 2E75B 2UZ5A 3G4SV 3OFNG 4I50A 4Z1VA 1K9TA 1D7HA 4Q7NA 1QQCA 4X1YA 4X1YB 4QT2A 2HKOA 3B09A 1VIBA 3SYQA 5FPOA 2ZQTA 5KX5B 4B3MB 3L72H 1JA8A 1ZLZA 5L3DA 4JI0O 2A3CA 4OPHA 3A0BZ 4WFEA 1VQNV 1ZBKA 4K0KO 1AR4A 3E8BA 1GM8A 1N4CA 1D5AA 1M9NA 4DRNA 2Q5AA 4S3JA 1O9GA 2F4EA 2FL4A 4TYOA 1N32O 3NR7A 1FFTB 3G67A 3CJHB 3KCEA 1J4RA 3ZHVA 3AK2A 1YCIA 1RD6A 3HKEB 5H6QA 3D3QA 5JCOC 4IT6A 3SDLA 1J4IA 1FXVA 3JARA 2XOKG 2DG9A 3QO8A 3T1HB 1GH6A 1CTNA 1W9VA 5J2TB 4DV7O 1NI8A 3RBZA 4KL1A 3JAWA 1JNSA 2WK2A 3IKDA 1QVGU 4MNMA 4LF8O 5CBHA 1E15A 4DV1B 4P8VA 5IJ0B 3WKZA 2Q67A 3O5GA 4NB5A 2N74A 3K08A 4ZPWR 5IDJA 3P3NA 2WM0A 3RYIA 3P32A 1IX5A 3CCQV 4W9OA 1O9HA 4LC1A 4RAIA 4WKFA 5HT1A 1JCHA 5EIBC 2LGOA 1NR1A 5B1BC 4E4EA 3TDBA 4GYCB 1N0JA 4YY3O 1U97A 1US6A 2PF4E 1D7IA 3I6CA 4W9PA 2M7WA 2GDSA 1E9LA 2YIBD 3R65A 1G8MA 4MTGA 1QNMA 4O4IA 2HVKC 3BY6A 4JI6B 2V1DA 1J6YA 3WG7B 3H01A 4J7JA 2GSMB 4ICGA 3JCUZ 4QJFB 3X2QB 1PD3A 4JZGA 3JXVA 4RWUA 5LP6B 1BQ0A 2KKWA 3OUSA 5D5QA 2PV1A 1W0KG 3ARTA 3GB7C 3T4DA 3RM9A 1VQ8V 2O92A 5IYBO 4ITZA 1GK9A 1HKMA 2UUBO 4PJ0Z 4X65O 2HEPA 3ODKA 4I4TB 4DR3B 1VP7A 2WA3A 1W59A 3ZRSA 2QSAA 2QWOB 3APQA 2EIMB 1H2GA 1QLEB 2ILMA 4IYIA 4UCOA 3B8MA 1EN4A 3CRRA 4L87A 4MGVA 4JFIA 3U11A 2JGUA 1EZJA 3CWBH 5HBFA 2QGNA 4UV8A 3SJBC 2JIZG 1FKGA 2XNDG 3CXHF 5HUAA 5LP6A 1M5YA 4D7TA 1AB3A 2UUCB 2VQEO 4DV5O 2VWJA 1YJ9V 1OWQA 1NS1A 2F2DA 1S0VA 5HWBA 2A7WA 1N36B 2E76B 3HKCB 4DRMA 4JF3A 3SYCA 5EBLC 3WL1A 2G38A 4UXNA 1KU9A 4LAXA 4DUYO 4ABMA 1MSDA 3FFQA 2ZR3A 1NH2B 4LFAO 5BXJA 4G50A 1MNGA 3BEHA 1ORQC 3P30A 4J10A 3UI4A 3AS0A 4U3JA 3QG5A 1NMWA 1MMMA 1FS0G 4DR2O 3KAIA 2FYUH 1FJGB 3ABKB 1NT2B 4IIJA 2PN0A 4BF8A 2NLJC 1O6IA 1GKFA 1YF2A 1NH2D 2UXXA 1NBMG 5IJ0A 1GAXA 4FZ1A 5KA5A 1H38A 4JYAO 1Y76A 1OCCC 1NKDA 3GWKC 2RQ6A 4LF6O 5LHGA 1D2DA 4GX2A 1OGGA 4P2ZA 1FKBA 2VQFB 3JARB 1AR1B 5LHIA 1PP9H 3SPCA 4DV6B 3RVYA 2E5LB 3AEIA 4YY3B 2ATKC 3BFRA 4K35A 5KAIZ 1HKIA 4O2BA 3FAVA 1QVFU 1VQ4V 2FTKA 4ML4A 1ZUQA 1JX9A 4DO2A 1HNWB 1HP8A 5LYJB 2QTOA 2ZM6O 3B7XA 3CH9A 2JDIG 3FB8C 3ZJZA 1KKCA 4JI7O 1ZBWA 1N0NA 3L70H 4QE7A 3SJAC 4LF6B 3LUOA 2MLYA 1NTZH 1WB8A 1N34O 3CC7V 3VQXA 1FKDA 3EY6A 2BCCH 5JQGB 3CRMA 1NQTA 3AROA 1J5EB 2XP6A 2HHHO 5KLVH 3O5KA 4FFBA 1X6LA 3W7TA 2EIMC 1QLEC 1ROUA 1EBOA 1UPGA 2LGWA 1WPBA 1B04A 2YIAA 4LNUB 2E3CA 1AI5A 2A9HA 5E1AC 2LP7A 3E89A 4NVPA 1IX9A 2ZE8A 1CEZA 1B6CA 4DIPA 4JFKA 1QU7A 4DROA 2EZOA 1JPXA 1GM9A 4UCRA 5GPRA 3D36C 4FK5C 2JS5A 3AG1B 4PI0A 2Q69A 5B8IC 4QGPA 3SPIA 3C3TA 2GTAA 1LUWA 4YJ2B 4DYLA 1FXKB 1NWRA 1EN6A 4FLVA 4EB6B 1BHBA 3ALGA 3ASNB 4N23A 2F21A 5LGNA 3K04A 1EHNA 2DG4A 1EYMA 5B1AC 2G41A 3E22A 4GX1A 1Q82W 3FY1A 2KG7B 4YHHO 3CCJV 1GOIA 1HJXA 5JVDA 3JYJA 1YJWV 3TCZA 1BMFG 4MS2A 1WB0A 3DSQA 4PD4F 2EX3A 3I56V 1EZVH 2UXDO 3AG3B 3U0ZA 1W26A 1F4NA 1R6NA 1KFWA 1PM9A 1MABG 4FLZA 1FFXA 1THZA 3FXYA 4LNUA 2DYRC 3JASB 3EIPA 3N2GB 5L3BA 3JATB 1WP7A 2KSDA 2DSUA 4PDVA 1V54B 1S3JA 4S3KA 1PNLA 4DRHA 1DK1A 5LL6Y 4X66O 2P4KA 2P4VA 1SETA 3K0GA 3UO3A 3KAGA 5J6EA 1NVPB 4IHJB 3M7MX 1YTFB 1E44A 2M1IA 1TFVA 1UFIA 3ZHSA 2YI8A 1XNRO 1ZL1A 1D5NA 2Z5UA 2OT5A 2ITCC 3O5FA 4UDMA 4J42A 4GKKB 5BXZA 1J95A 3LSQA 4PA4A 1JVMA 1Y4MA 4DWSC 2KO7A 4LGXA 2RMKB 2XHBA 3PJSK 4I9WA 4LCUC 3WD3A 4DZ3A 3K3WA 4TT3G 4HBEA 3M8AA 4CS3A 3CCSV 4G28B 2XAGA 3ZX6A 3SGIA 4LAWA 5L3FA 4AQYB 1ZBVA 2A3BA 2GUZA 4JI6O 1JJ2U 3CCMV 1PNMA 5AG2A 2HP8A 3OR7C 2WLLB 1VMGA 3OAAG 4J9YB 1YXBA 4FIPC 2PZSA 4I55A 3LDDA 2YDEA 2QDOA 3Q4HB 4IYHA 4NXNO 2EINC 4DUZB 2K1EA 3FAPA 4WJXA 3SJQC 3BAAA 4R7CA 4MNKA 1TUEB 1VQKV 1XMOB 1YW5A 3W7XA 3ARZA 1FKRA 1AVMA 1OCCB 3MHSC 2ZINA 3K79A 4CH4A 4ODRA 3JD3A 3IC7A 4DV2O 3ARUA 3OT7A 2Q0AA 1D2KA 1L8DA 2EILC 3GVMA 3CJHA 2B5UA 1TAEA 4DR4O 2DT2A 4YXWG 1S72V 2ZXWC 3ZN0A 2WWWA 2KG7A 2YIDA 2F66C 2QA4V 3ALFA 2AGAA 2JGDB 4MTFA 2BE3A 2F23A 2YS8A 2VQEB 3G6LA 3N2KA 4FJCC 5IJ9A 4MTXA 1FXKA 4RUEA 2Z0AA 3CRCA 1G1XB 4ODQA 5B1BB 2RDCA 2ZDIC 3VQWA 4KHPO 1DF4A 1H2LA 1P84F 4J4OA 4O4LA 4LR3A 2XPAA 1K7DA 4I50B 4ODKA 1G4YB 3NXSA 5H9CA 3K5NA 3OMIB 2JZVA 4WFAV 2RN9A 4C02B 1F4MA 1Y66A 4IT5A 4F6RA 4ZPVR 1VQLV 2ITKA 3TK1A 3RN4A 1OHHG 3MDYB 3HB3B 5L3GA 2Q6AA 5HKGA 2YXHA 4DRPA 3G6EV 4LFCB 2RSEA 5KHGA 1HJWA 1TVKB 2UU9B 3JD1A 1N1AA 1WLEA 3E2EA 1Z2GA 3ETDA 4X9QA 4J4NA 3U10A 2Z3YA 4LP8A 3K5OA 4PELA 2PPOA 1W1VA 1HXVA 3E8FA 3E8GA 5HFLA 3IGAC 2KI3A 3CRAA 3OOBA 4W5UA 4ZI7B 4H13B 2RQSA 4BWAA 4I7ZB 4JYAB 4DV6O 1EFRG 1FXHA 3RGCA 3FAVB 3CPWU 1SQQH 3H1LH 4Q20A 3AG4B 2UXBB 2XP5A 1B3QA 5B1NA 4LBEC 3PR9A 2P22C 1IDSA 4WBNB 3GU0A 1LG2A 4RQFA 1R9HA 4NXNB 4NR1A 1IURA 4LF8B 5EZYA 3AG3C 3G6BA 4ODOA 1Q5OA 4J80A 1QZ2A 2PTMA 1I7FA 5A2QN 1JNTA 2XP7A 4YJ3B 1FFRA 1YIJV 2O57A 4JPRA 2LJ2A 1IBMB 1N34B 3KACA 4N19A 5KUKA 1VF6C 3B40A 4JI7B 4O4HB 4N21A 4ZBMA 4NNRA 4WKHA 1AJQA 4UVAA 4JAAA 4B7EA 5JH7A 1NU1H 4JI4B 3I55V 2Q5ZA 2PV2A 4X1KB 4NTYA 5B3SB 1HR0O 1JNEA 4K8ZA 3RGBA 1PINA 1Y0OA 3PN1A 1OCOC 2EIJB 4DR5B 4NYKA 2Q0OC 3ABKC 2YXYA 2WLMA 1W1PA 1FPOA 4CS4A 4RO2A 2M2AA 1K97A 3QF7A 1MZFA 4MNJA 2PYLA 1SQVH 2JJ2G 1FXKC 2ZQVA 1WNOA 2YICA 1M57B 2IF4A 3ZRVA 2L35A 1M4UA 3LUTB 1GMGA 4MW3A 3B8SA 2N05A 1K3EA 4O2TA 2IU0A 3PRBA 1GN6A 3CHCA 4JFJA 4Z2KA 2Q8VA 1M93A 4MT8A 4OGQB 1HDJA 3ZCCA 4RQEA 1XRVA 1KD1W 1IBKO 1ZTEA 3ZRWB 1B6QA 3DC6A 5B1OA 4TV9A 3T4ZA 2IJHA 2EULA 4O2AB 3UO2A 4LF4B 2F43G 2Q7EA 1Q81W 4O4LB 4LWSA 1XNQO 4R8CA 2R70A 3OEHG 3ZMTA 4KFMA 4WKAA 3O5PA 1H2NA 3RMEA 4DV2B 2N87A 1YEWA 4MTOA 2CH7A 1F7YA 1OCRB 4PA7A 4OPAA 4X66B 1K92A 3H1IH 4ZOLB 4DRKA 2XASA 4P9PA 5DF0A 1Q3EA 3VQYA 3BCCH 2LO1A 3B8NA 1V55B 2OYQA 1I0HA 3WFVA 3F7VC 2EIKC 1I5XA 4JI5B 4R0XA 2ZIMA 1XMQB 3H9RB 4MVSA 5GONA 1KBHA 3CB2A 4O2BB 1PBKA 4LAYA 3KKYA 2E74B 1W2BU 4JI2B 2RUDA 3OD4A 3O5IA 4MVUA 4W4KA 1E1RG 1W1TA 4DWSB 2VWKA 4DW0A 1SKVA 4MSPA 1KYOF 1FD9A 1V9PA 4DV0B 4UCSA 4TV8B 3RYIB 1GO3F 3AK1A 4EKWA 5CB4B 3OW2U 3WH0A 1H2KA 1ZBCA 1FKKA 2IH1C 3FB6C 1FKIA 1FKSA 4DW1A 2LW1A 5GQBA 1R3KC 2ADPA 2DN9A 2Q73A 3WIJA 4DV5B 1RP3B 1P49A 1PNKA 5LGUA 1JVWA 2PUSA 2E5LO 1IZ3A 2BOCC 5KMGA 4HNAA 4LH7A 4TW7A 3SJCC 2DSWA 1HNWO 5LBQA 3UQ8A 4X64O 4F6EA 1WNSA 1V54C 3GPKA 4X20A 4R50A 4Z1MG 2HJDA 4ASUG 5CN0A 2RUQA 1AILA 4EFEA 1FJDA 1ZX3A 4W4LA 4FAPA 1E6NA 4B3RO 2NNUA 4PTMA 1XMOO 5HW8A 2KFWA 4DR2B 1NTMH 4WCEV 4D6TH 3CHFA 1N32B 1ZL8A 4GKKO 3THOA 1PV0A 4CC5A 2QKSA 2PPPA 2HHHB 4GGQA 5FNVB 2PI5A 2FKEA 1MOFA 2OCHA 1IBMO 2QE7G 1Y74B 2DT0A 4FM2A 2ADQB 2AZ2A 3H1KH 1S5JA 4YJ3A 2X6AA 5J9PC 2MLZA 5HW7A 2ZR5A 1XREA 1P5QA 3CSXA 2QTSA 3TCUA 2JS3A 5LXTB 1RSOB 2QWQB 3JAMN 1HNZB 4XBFA 2DSVA 2MW2B 3AG2C 5L3CA 5BR8B 4O4JA 4H33A 1OCZB 3JYMA 2MLXA 4L3NA 4KR0B 1EM1A 2X6CA 4L8JA 5KAFZ 2ZD9A 2KGJA 1BQZA 3L9DA 4FPPA 4P9OA 4U7OA 3A0RA 3K58A 4ZI7A 3A0HZ 3ABUA 3ABLB 2EIKB 4DRXA 2YUAA 1JQ0A 5B3SC 4ODLA 4BW9A 5DEZA 1T11A 4DRQA 5C93A 4CZZA 4X1IB 2WSSG 4AILC 4NTWA 1LL6A 3APOA 2ZE6A 1AP5A 4GZRB 1LG1A 4EEQA 1H2MA 1C9HA 5H6RA 2GHYA 2IH3C 1R3IC 1Y6XA 3IHZA 1CPYA 4JAUA 2NN4A 1P7BA 3G80A 5CB4A 1ROPA 2N04A 4P8WA 3KCXA 4WIWA 2X6BA 1FKHA 3FYEB 2VRZA 3PRDA 4B3TB 2PI4A 3TGUH 5D75A 4MTVA 4BIOA 1U96A 3QOKA 1DF5A 3JATA 4MVZA 3JASA 2AXTZ 4DV0O 3AS2A 4NSBA 4PDLA 4K0KB 4DWSA 4X65B 1XNQB 4LF9B 3K57A 2YXLA 4FFBB 4PA3A 3STLC 4FN2A 4U84A 3N2KB 4UVCA 4TSFG 1WA8A 2B1IA 2OTLV 4ZHQA 3JAKA 2LQTA 5DEDA 1QPLA 2VN1A 1HKJA 4DK1A 2A79B 1KT1A 3FKSG 4DR7O 4FLTA 5JH8A 1XL6A 1QHTA 3O5QA 3ZRXA 3D8CA 4JI5O 4RUFA 4JYYA 5CA1B 5IYCO 1KP3A 5JJEB 3O5OA 4D7SA 4B3RB 2CTRA 4DR1O 4GKJO 1V55C 4ZIBA 4CC6A 4IL6Z 4XDKA 1URFA 1D6OA 1SESA 1FAPA 2LW7A 1VQOV 2MPHA 4KUMA 4JI3O 5I98A 4I5SA 3B9EA 1UJWB 2RNBA 1KP2A 2CK3G 2UXCO 3ARVA 1HR0B 2WLYA 1FYJA 4AY1A 5FL7G 5ITZB 3ZRWA 2ODMA 2CAZC 1GTOA 1NZ6A 2OCCC 3CEIA 1I94O 4JFMA 2Y69C 1P7GA 4I55B 5LXTA 4BAYA 3ARXA 1LJYA 4PDMA 1R6KA 2IJKA 5ITZA 5BZBA 2GUZB 1RM1C 2WA4A 3GWOA 3O9OA 2OIEA 2ZIOA 3AG4C 4ZPTR 3ZMSA 2DT3A 2AHZA 2CE4A 3KCYA 4L72B 1WP8A 5LYJA 1WN7A 5LHHA 4C7UA 2VQFO 4I0XA 1WAZA 4PA9A 1L1FA 4BIUA 2B9ZA 2XAQA 2V4DA 2QJ1A 3WQWA 1L1PA 3UI5A 4G27B 3CHDA 3OTOB 3OGCC 1ZU8A 1Y67A 2UXNA 4LF5B 5IYDO 2XP3A 1K4DC 4TQFA 2MK3A 3OTFA 4DR3O 3RM8A 4O4HA 3HKDA 2ETNA 1K33A 5KMGB 1AP6A 4UV9A 1HKKA 1E1QG 1NTKH 1OCOB 2EIJC 3RYCA 2YSUB 3WB0A 4UVBA 1FKAO 3K0DA 4H37A 3FB7C 1SA0A 2BTQB 5LOVA 4Z2LA 4FM1A 3K9SA 4IIJB 3ZHTA 3HKBA 4G2KA 5GPGA 1VARA 4CH6A 2NR5A 4WBNA 3CMEV 1JFFB 1DGSA 4U3JB 3FB5C 3O5MA 3H1JH 1BCCH 2ZNIA 1AJPA 1OJHA 1GRJA 4DR7B 4A5UB 4PV1B 2K9PA 3DGEA 4AI8A 3G6MA 4JI1O 2L2SA 4Z2JA 3OM3B 1KC8W 3JD0A 4LF4O 4JI0B 3ZHUA 3KAHA 1PL0A 1FJGO 3STZC 3W7SA 2F95B 3CCRV 5DO2A 4PDRA 4FMTA 1K5QA 2DYSB 1PKXA 1TVKA 4J7KA 5IWAB 3BA9A 3QO5A 2QWRB 1L0NH 2IJIA 5EBMC 3UQBA 1SQPH 2KB1A 3WB2A 4TW8A 3VBBA 1AI6A 2BSKB 1BHAA 2K8IA 3E35A 3O5LA 3CXCU 3BMBA 2Y69B 3OUFA 4F6RB 4JASA 4LFCO 5KHKA 2UXDB 2XAFA 2WLJA 1FFQA 5FLXN 4TUYA 2QKCA 5IWAO 1NWUA 2Y0IA 2JRIA 5JQGA 3ARSA 3F7YC 1N33O 5LMUB 4U3FH 2LGQA 2WLKA 4TNSA 1Q6IA 1R6TA 3ARRA 4Z2IA 3BXWA 5F2VO 5KHHA 4IQ2A 2EBOA 2QR4A 4DH0A 1CXZB 2CTQA 4X62B 4DV3O 4P30A 2XP4A 2OTJV 3A8TA 2DWDC 2QEXV 2BOBC 5LMUO 1VF8A 3TXSA 3D3IA 3A2FA 4YJ2A 5DIUA 1IBLB 1SQGA 5EK0A 2CDYA 4QNHB 4NTXA 4R5EA 1Q86W 4ODMA 3SYOA 3KZ7A 3CGMA 2Y48A 4FLYA
chains in the Genus database with same CATH topology
3KAIA 4KQZA 4W9QA 2G8ZA 1Q1CA 2DG3A 1HJVA 4BF8A 1O6IA 4DRKA 1SYTA 5DF0A 1OGBA 3ARYA 4TX0A 2VCDA 3UI6A 2WLZA 2DPEA 1D7JA 1UR9A 4R0XA 1YATA 3H9RB 2KR7A 1E6ZA 1H0GA 1OGGA 1PBKA 2FDMA 4LAYA 2RUDA 5DITA 1FKBA 3O5IA 3O5EA 5HW6A 1W1TA 2AWGA 4DWSB 1A7XA 1BL4A 1ITXA 2OLHA 4MSPA 1HKIA 1FD9A 1NSGA 3WD1A 2DSZA 3UF8A 4P8UA 4ML4A 4JFLA 3WH0A 3KAFA 1ZBCA 1FKKA 3B7XA 3CH9A 1FKIA 2D9FA 1FKSA 1ZBWA 3LUOA 5GQBA 3B9DA 4MPKA 2MLYA 3WIJA 1JVWA 4G2PA 4IT4A 1FKDA 4TW7A 3EY6A 1W9UA 2DSWA 3AROA 2XP6A 3O5KA 4DZ2A 3KABA 3GPKA 1X6LA 1FKJA 1ROUA 3AS3A 4QZVB 3CHEA 4U85A 1NH6A 1EIBA 3CZ8A 2RUQA 4NZCA 1FJDA 4FAPA 1E6NA 1X6NA 2RUCA 1B6CA 4DIPA 1J4HA 4PTMA 4JFKA 4DROA 5GPRA 5HW8A 2KFWA 3OA5A 1LL4A 1GUVA 3O5RA 3CHFA 5B8IC 2ZR6A 2KE0A 2PPPA 4GGQA 1NWRA 1ROTA 2MF9A 1ZCNA 2FKEA 2YBUA 3ALGA 2DT0A 4MAVA 2F21A 1EHNA 2DG4A 1EYMA 2MLZA 1H0IA 2ZR5A 3NTPA 5HW7A 1P5QA 2G41A 2YBTA 3FY1A 3TC5A 3B9AA 2DSVA 2OFNA 3PA7A 1GOIA 1HJXA 3JYJA 3TCZA 1XHGA 1WB0A 3JYMA 2MLXA 4IPXA 4L3NA 4KR0B 1ZB5A 4U86A 1W26A 5HWCA 1KFWA 2KGJA 3FXYA 4JYSA 2FAPA 3O5DA 2DSUA 4S3KA 2M08A 4DRHA 2PBCA 4ODLA 5DEZA 4Z2GA 1T11A 4DRQA 2QF8A 2MNTA 3KAGA 4HBOA 3AQUA 5J6EA 5DIVA 1LL6A 1W1YA 3W4RA 4WK9A 2M1IA 1TFVA 1LG1A 1ZL1A 1W9PA 4DWSD 1C9HA 4ZS6A 3O5FA 4ODNA 3IHZA 4ODPA 2ZR4A 3WD0A 4P8WA 4WIWA 3WL0A 1FKHA 3PRDA 4Q22A 5D75A 4MTVA 4DWSC 3QOKA 2KO7A 4LGXA 3RM4A 2AOSA 3WD3A 4DZ3A 3AS2A 1TCOC 4HBEA 4NSBA 1NWTA 4DWSA 1F8AB 4FN2A 4U84A 2PI6A 4LAWA 1UR8A 2XPBA 1ZBVA 2A3BA 2IUZA 3VAWA 1QPLA 2VN1A 2XP9A 1NWSA 3WD4A 1HKJA 1LQ0A 2DT1A 1KT1A 5JH8A 4URIA 3O5QA 4QT3A 3WQVA 2Y78A 3FAPA 4DRJA 1EQ3A 4WJXA 4MNKA 1U79A 2PPNA 4LAVA 3O5OA 1YW5A 3ARZA 1FKRA 4HARA 4ODRA 1D6OA 3UQIA 1FAPA 2MPHA 2RURA 3ARPA 3ARUA 5I98A 2B31A 3ARQA 3RFWA 3B9EA 1D2KA 3ARVA 2WLYA 4AY1A 2LJ4A 1SR0A 2DT2A 2UZ5A 1WAWA 1K9TA 1D7HA 2A3EA 4JFMA 4Q7NA 4QT2A 3ARXA 1LJYA 3B09A 1ZK6A 1JNDA 2ZQTA 3ALFA 1FKTA 3G6LA 1GPFA 3IKGA 2A3CA 4ODQA 4ZPTR 2DT3A 3UQAA 3CGNA 4P8XA 1ZBKA 4L72B 4J4OA 2XPAA 3KADA 4ODKA 4DRNA 2Q5AA 4S3JA 2JZVA 2F4EA 4TYOA 4C02B 4ZPVR 2ITKA 2LKNA 3MDYB 3KCEA 1J4RA 1FKLA 3WQWA 5HKGA 4DRPA 1L1PA 1RD6A 3CHDA 3UI5A 1ZU8A 2RSEA 4IT6A 1J4IA 4XAKA 2XP3A 1HJWA 3O5JA 3RM8A 3NRKA 1N1AA 2DG9A 2XP8A 4GIVA 4IQCA 1CTNA 1HKKA 1W9VA 4J4NA 1JNSA 2WK2A 3IKDA 4MNMA 2PPOA 1W1VA 1E15A 1HXVA 4P8VA 3WKZA 3O5GA 2KI3A 3OOBA 4W5UA 4Z2LA 1QPFA 4ZPWR 2RQSA 2WM0A 1IX5A 5GPGA 4W9OA 4WKFA 3RGCA 5HT1A 5HTGA 3O5MA 2LGOA 2XP5A 3PRAA 3TDBA 3PR9A 1D7IA 4QIBA 2ZQSA 3I6CA 4W9PA 1E9LA 3NI6A 1LG2A 1R9HA 1LL7A 1NMVA 4ODOA 3G6MA 1QZ2A 2L2SA 4Z2JA 1JNTA 4TW6A 2XP7A 1J6YA 3KAHA 1FFRA 3WD2A 1F40A 3KACA 4Z2HA 3JXVA 5DO2A 4N19A 2PV1A 4NNRA 4WKHA 3ARTA 1Q6UA 3RM9A 2O92A 4ITZA 1HKMA 3UQBA 2A3AA 4TW8A 3ODKA 2O9OA 2PV2A 3ARWA 4DT4A 1JNEA 1Y0OA 4DRIA 1PINA 2K8IA 3O5LA 2ESCA 1FFQA 1W1PA 1Q6HA 1E6RA 2M2AA 1KT0A 4MNJA 2PV3A 1NWUA 1BKFA 4MGVA 3ARSA 4JFIA 2ZQVA 1WNOA 2IF4A 5HBFA 1E6PA 1FKGA 4TNSA 1Q6IA 5HUAA 3B8SA 1M5YA 3ARRA 4O2TA 3BXWA 4Z2IA 3PRBA 3CHCA 4JFJA 4Z2KA 4IQ2A 1XRVA 4DH0A 1OWQA 2F2DA 5HWBA 2XP4A 2LPVA 4DRMA 3WL1A 1FKFA 1VF8A 4LAXA 3AS1A 5DIUA 3IK8A 5BXJA 4WKAA 3O5PA 4G50A 4R5EA 1EDQA 4MNLA 4ODMA 3RMEA 3KZ7A 2N87A 2ZQUA 3CGMA 3UI4A 3AS0A 1NMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRJ A;  2DG4 A;  1EYM A;  2MLZ A;  2ZR5 A;  3NTP A;  5HW7 A;  3KAI A;  3TDB A;  1P5Q A;  4W9Q A;  1Q1C A;  2DG3 A;  1U79 A;  2PPN A;  4LAV A;  3O5O A;  1D7I A;  1YW5 A;  4QIB A;  2ZQS A;  3TC5 A;  3I6C A;  4W9P A;  4BF8 A;  3NI6 A;  2OFN A;  4DRK A;  1FKR A;  1R9H A;  1NMV A;  3PA7 A;  4ODR A;  1D6O A;  3JYJ A;  4TX0 A;  1FAP A;  3TCZ A;  3UQI A;  2VCD A;  2MPH A;  3UI6 A;  2RUR A;  4ODO A;  3JYM A;  5I98 A;  2MLX A;  1D7J A;  1QZ2 A;  2L2S A;  4IPX A;  3RFW A;  1JNT A;  4R0X A;  1YAT A;  4U86 A;  4TW6 A;  2XP7 A;  3H9R B;  2KR7 A;  1J6Y A;  1W26 A;  3KAH A;  1PBK A;  5HWC A;  2KGJ A;  4LAY A;  1EQ3 A;  2RUD A;  1F40 A;  2LJ4 A;  3KAC A;  2UZ5 A;  1FKB A;  5DIT A;  3O5I A;  3JXV A;  4N19 A;  3O5E A;  1D7H A;  4JFM A;  4JYS A;  5HW6 A;  2PV1 A;  2FAP A;  4NNR A;  4QT2 A;  3O5D A;  2AWG A;  1Q6U A;  3B09 A;  1ZK6 A;  1A7X A;  1BL4 A;  2M08 A;  2ZQT A;  4DRH A;  2PBC A;  4ITZ A;  4MSP A;  4ODL A;  1FKT A;  3UQB A;  4TW8 A;  1FD9 A;  1T11 A;  1NSG A;  3ODK A;  4DRQ A;  2PV2 A;  2MNT A;  3KAG A;  3IKG A;  3UF8 A;  4DT4 A;  5J6E A;  1Y0O A;  4ODQ A;  1PIN A;  2K8I A;  4JFL A;  5DIV A;  3O5L A;  3KAF A;  3WH0 A;  4DRI A;  3UQA A;  3CGN A;  2M1I A;  1FKK A;  3B7X A;  1FKI A;  4J4O A;  2XPA A;  3KAD A;  2D9F A;  1FKS A;  1C9H A;  4ODK A;  3LUO A;  2Q5A A;  3O5F A;  1Q6H A;  4ODN A;  4DRN A;  2JZV A;  2F4E A;  2M2A A;  3IHZ A;  1KT0 A;  4TYO A;  4ODP A;  2MLY A;  4C02 B;  2PV3 A;  1JVW A;  2ZR4 A;  4G2P A;  1BKF A;  2ITK A;  2LKN A;  4MGV A;  3MDY B;  3KCE A;  4JFI A;  2ZQV A;  1J4R A;  1FKH A;  1FKD A;  3PRD A;  1FKL A;  3EY6 A;  4TW7 A;  5HKG A;  4DRP A;  1L1P A;  3UI5 A;  5D75 A;  2IF4 A;  2XP6 A;  3O5K A;  4DZ2 A;  3KAB A;  3GPK A;  2KO7 A;  2RSE A;  1J4I A;  1FKG A;  2XP3 A;  3O5J A;  4TNS A;  1Q6I A;  1FKJ A;  4DZ3 A;  5HUA A;  1ROU A;  1M5Y A;  1TCO C;  4O2T A;  3NRK A;  3PRB A;  1NMW A;  4JFJ A;  1N1A A;  1F8A B;  4IQ2 A;  2DG9 A;  4U85 A;  2RUQ A;  2XP8 A;  4DH0 A;  1FJD A;  4GIV A;  4IQC A;  4FAP A;  2F2D A;  4FN2 A;  4U84 A;  2RUC A;  4J4N A;  4LAW A;  5HWB A;  2XP4 A;  2XP5 A;  2XPB A;  1JNS A;  1B6C A;  2LPV A;  1J4H A;  4DIP A;  4JFK A;  3IKD A;  4DRM A;  1FKF A;  2PPO A;  4DRO A;  1HXV A;  5HW8 A;  2KFW A;  3VAW A;  4LAX A;  3O5R A;  3O5G A;  5DIU A;  1QPL A;  2KI3 A;  3IK8 A;  2VN1 A;  3OOB A;  2XP9 A;  5B8I C;  2ZR6 A;  1QPF A;  2KE0 A;  5BXJ A;  2RQS A;  2PPP A;  1KT1 A;  4GGQ A;  1ROT A;  2MF9 A;  1ZCN A;  3O5P A;  2FKE A;  4G50 A;  5GPG A;  4ODM A;  4W9O A;  3KZ7 A;  2N87 A;  2ZQU A;  3CGM A;  3O5Q A;  4QT3 A;  5HT1 A;  3RGC A;  3UI4 A;  2F21 A;  2Y78 A;  5HTG A;  3O5M A;  2LGO A;  3FAP A; 
#chains in the Genus database with same CATH topology
 3QO7 A;  3T1Y B;  4MSW C;  1K9M W;  1JMK C;  2XUM A;  5BY1 A;  3W7U A;  4CBC A;  3EVK A;  3MD0 A;  3KG2 A;  4EFB A;  1RSO A;  2HLD G;  2XT9 A;  3ARY A;  4TX0 A;  2VCD A;  3UI6 A;  1ENV A;  2WLZ A;  1XDC A;  4GLX A;  5JJN B;  3RYC B;  5IYZ A;  4GX5 A;  1YAT A;  2EJ7 A;  3CCL V;  4OXS A;  1E6Z A;  5DM6 V;  2OCC B;  3BA8 A;  3CC4 V;  1SC5 B;  5LGT A;  2FML A;  1YI2 V;  1TUB B;  2EJR A;  4MW8 A;  1XI1 A;  2DE0 X;  1I08 A;  3O5E A;  2QM4 A;  2OWO A;  3K9A A;  4X88 A;  5KA6 A;  1BL4 A;  3JD2 A;  4J11 A;  2OLH A;  4I0X B;  3UF8 A;  2UUC O;  4PA6 A;  4P8U A;  4JFL A;  3GTY X;  1FAF A;  1XMQ O;  3QNE A;  5IT9 N;  3B9D A;  4MPK A;  3W7W A;  4G2P A;  1OCZ C;  2CUG A;  4J7Z A;  3UT5 A;  1IBK B;  2QKA A;  4LFA B;  4BIZ A;  5JJJ B;  1W9U A;  2DQ0 A;  4DUY B;  1Y76 B;  2W0X A;  3KAB A;  1QR8 A;  4JI8 B;  4E2L A;  3ABT A;  1YZB A;  4UCU A;  1PPJ H;  4GX0 A;  3AS3 A;  4QZV B;  3CHE A;  4FLW A;  1NH6 A;  4TOI A;  1EIB A;  2Q7G A;  3CZ8 A;  3EXA A;  3JAL A;  4OX9 O;  2HJF C;  1X6N A;  4TQD A;  4I4T A;  4MVM A;  1XUQ A;  2UUA O;  3OA5 A;  1RPO A;  2UXC B;  1K73 W;  3O5R A;  3CCU V;  5CBG A;  4WF9 V;  2KE0 A;  3H9V A;  2CTP A;  3LDC A;  1M5I A;  4Z2W A;  4HAM A;  1WPX A;  1ZCN A;  1I94 B;  5IJ9 B;  2YBU A;  5FPR A;  3RW0 A;  3LDE A;  2AZ0 A;  3ABM C;  4UCV A;  5HFM A;  3ZMV A;  2ZDI A;  1XHZ A;  1VEW A;  1YDX A;  2JGD A;  5DEC A;  2YBT A;  3OMN B;  4LFB B;  3VOU A;  1YJN V;  4GUN A;  3TC5 A;  1K8A W;  3B9A A;  3J7A U;  2OFN A;  4AQY O;  2X7R B;  3PA7 A;  4I9Q A;  5J2U B;  1XHG A;  5EIB D;  3M99 B;  1HNX B;  1H8E G;  4K3A A;  5JCO A;  1ZB5 A;  4R6Z A;  2YEV B;  2LFR A;  3S3W A;  1JCH B;  5DN6 G;  3ETG A;  1GN3 A;  5IY5 C;  2ZKO A;  2DYS C;  1SQX H;  4CH5 A;  3CC2 V;  5LOV B;  3O5D A;  3MDS A;  2QM8 A;  2W6J G;  2WPD G;  2PBC A;  1MZE A;  3L71 H;  4Z2G A;  2H8P C;  4TWK A;  1Q7Y W;  2R9A A;  2MNT A;  4HBO A;  3AQU A;  5DIV A;  4XDL A;  1QBZ A;  1W1Y A;  3W4R A;  1Z5W A;  1JR9 A;  2XAH A;  4ZS6 A;  1KEC A;  4ODN A;  2GV9 A;  5LA6 A;  1S77 D;  4AHC A;  1T5E A;  3TJT A;  3E8H A;  5KHI A;  1VQ9 V;  3WD0 A;  4MVR A;  1IVS A;  1MSW D;  3WL0 A;  1VF7 A;  3ICX A;  1HW7 A;  1S5L Z;  3RM4 A;  5K1X A;  3HR0 A;  2AOS A;  1RM1 B;  1TCO C;  5KHJ A;  1NWT A;  2OIG A;  5CA0 A;  1F8A B;  2ZT9 B;  3C3S A;  2ARH A;  4QIW F;  5LMN B;  2X0L A;  3S3X A;  1TUB A;  4B3S O;  5GTH Z;  4DR5 O;  3FD9 A;  2PI6 A;  1UR8 A;  3UKM A;  5GTI Z;  1JFF A;  4X89 A;  5CMU A;  1Q90 D;  3VAW A;  4BR6 A;  1BL8 A;  2JVD A;  2BTQ A;  1NWS A;  1LQ0 A;  2DT1 A;  3IFX A;  2HVJ C;  1F51 A;  1XIL A;  3ZED A;  2F4V O;  5BMV A;  4URI A;  2Y78 A;  4LF5 O;  1RPR A;  4FZ0 A;  4DRJ A;  4UCT A;  2WLH A;  3ETQ A;  2DOS A;  1H8H G;  3N2G A;  2PPN A;  3CMA V;  2DMX A;  3ZIA G;  3AK3 A;  1DTO A;  3CE2 A;  2Y0P A;  2P67 A;  2F93 B;  2UXB O;  1ARO P;  2EIL B;  2LJ4 A;  1SR0 A;  2R9I A;  3BAB A;  5J2U A;  2WLI B;  3K5L A;  1VQP V;  3RT3 C;  1N8R W;  1WAW A;  1BSM A;  2A3E A;  2DQ3 A;  3F5W C;  3QTC A;  1COW G;  1AI4 A;  2WAM A;  2ZXW B;  1ZK6 A;  3JSL A;  1JND A;  4XDJ A;  2XAJ A;  1R1B A;  1FKT A;  3WG7 C;  2IM9 A;  1N33 B;  3RYF A;  1GPF A;  4JGS A;  4EB6 A;  3IKG A;  2P06 A;  3J80 N;  4WFG A;  3UQA A;  3CGN A;  4P8X A;  5EC2 C;  1SZT A;  2IU3 A;  3CCE V;  3KAD A;  2YIB A;  3DXR A;  1M56 C;  4WFF A;  4DV1 O;  3SPJ A;  4TV8 A;  2QM7 A;  1OCR C;  3ZBH A;  1JOY A;  2LKN A;  1FKL A;  5BMV B;  4J41 A;  3DXR B;  1TA8 A;  1IXB A;  4PI2 A;  4XAK A;  2D2C B;  3K59 A;  3O5J A;  1QR9 A;  4KXR A;  4H44 B;  3DC5 A;  3NRK A;  4U7N A;  3I5D A;  2DW4 A;  1LNQ A;  2XP8 A;  2ITD C;  4GIV A;  4IQC A;  4LFB O;  1NJI W;  1P4R A;  4DV4 B;  2BTO A;  3UT5 B;  2R72 A;  2H94 A;  2JEU A;  4X1I A;  4JTC B;  4B7K A;  2GBO A;  2V7Q G;  3B2E E;  5CA0 B;  1BS3 A;  1QPF A;  4GCZ A;  2WLI A;  2ZE5 A;  3OTO O;  3FX7 A;  3G71 V;  4B3S B;  4DR4 B;  4JI3 B;  3RFR A;  5HTG A;  4YIP A;  1W0J G;  3EFF K;  5K1P A;  3DTU B;  3PRA A;  4HYO A;  4QPK A;  3KZI Z;  1SQF A;  1K4C C;  2F1M A;  1DLB A;  4QIB A;  2ZQS A;  1ZAU A;  3L74 H;  3HKB B;  3NI6 A;  3K06 A;  2Q4P A;  1LL7 A;  1X4T A;  3E83 A;  4H0L B;  3K5M A;  1VQ6 V;  1NMV A;  4DV3 B;  5D5P A;  1AI7 A;  1SA0 B;  2Q68 A;  1VQ7 V;  4IHJ A;  2PY5 A;  3ZN1 A;  1BT8 A;  3CP1 A;  3IAY A;  4GT1 A;  4TW6 A;  4X8A A;  1XQ8 A;  3OE7 G;  1CP9 A;  3JAW B;  4HZ3 A;  3WD2 A;  3JD4 A;  1F40 A;  4Z2H A;  1Y74 A;  3WU2 Z;  4MVO A;  4YHH B;  1X59 A;  2WLL A;  1KMI Z;  1GN4 A;  1Q6U A;  4JI1 B;  2C2A A;  4BW5 A;  1L0L H;  1E79 G;  4QE9 A;  3JCZ A;  2A3A A;  3HKE A;  2CGO A;  2EIN B;  1SF9 A;  5B5E Z;  2JEX A;  2O9O A;  3ARW A;  4DT4 A;  4DRI A;  1KKD A;  4DR6 B;  1SS3 A;  3EHB B;  2UU9 O;  5JVD B;  2ESC A;  1OV9 A;  2DJV A;  3B4S A;  4LF9 O;  1Q8I A;  3ASO C;  4DK0 A;  3ZMU A;  1Q6H A;  1E6R A;  2PGG A;  1KT0 A;  4JYB A;  2PV3 A;  2QWP B;  1BKF A;  3B77 A;  2M6Y A;  1Z5V A;  4HNA B;  3R66 A;  2P5O A;  3CCV V;  1N36 O;  1XEQ A;  5KX5 A;  2ZM6 B;  1E6P A;  3ZMZ A;  5TIS Z;  2P90 A;  2FB5 A;  2F4V B;  2CGN A;  4O4J B;  1BGY H;  1XNR B;  2Q9L A;  2Q7H A;  3BPZ A;  3BRC A;  3RYH A;  1R73 A;  4MVQ A;  4QPJ A;  2PYJ A;  3JAL B;  2LPV A;  1FKF A;  3WB1 A;  5GW7 A;  4NXM O;  4X64 B;  4DR1 B;  1SQB H;  3UCS C;  1B06 A;  3AS1 A;  3F5T A;  4UB6 Z;  2ZE7 A;  1MG1 A;  3IK8 A;  1ZL8 B;  3X2Q C;  1FFX B;  1QLN A;  2BSK A;  1HNX O;  1R3J C;  1EDQ A;  5LP6 C;  4MNL A;  2ZQU A;  2ZQM A;  5H2F Z;  4J9Z B;  5GON B;  3T1C A;  5CA1 A;  4LF7 O;  4KQZ A;  4W9Q A;  2G8Z A;  5C8Y A;  3L75 H;  1IXM A;  1KUQ A;  1Q1C A;  4X62 O;  2DG3 A;  1H2S B;  1VF5 B;  1HJV A;  1YSC A;  3E86 A;  1SYT A;  4OX9 B;  3ZS8 C;  1KB9 F;  1YTF D;  1MA1 A;  1OGB A;  1NVP D;  3E22 B;  3IJ4 A;  2DPE A;  1D7J A;  1WB7 A;  4ZHQ B;  2EZP A;  1UR9 A;  1OZ0 A;  5C8Y B;  3SR2 C;  2H3O A;  3C90 A;  3LSS A;  4DUZ O;  2YI9 A;  2UUA B;  2B5U B;  2KR7 A;  1VQM V;  2CH7 B;  4JAV A;  1H0G A;  2FDM A;  3OR6 C;  4JTA B;  5DIT A;  2IW5 A;  3SYP A;  1YIT V;  2W6I G;  1ZWI C;  3SPH A;  5HW6 A;  3ZHQ A;  2IBZ H;  5BR8 O;  2AWG A;  1PL4 A;  1A7X A;  4KP4 A;  5IE9 A;  1HNZ O;  1ITX A;  2P6J A;  3J81 N;  1XBL A;  1NSG A;  3WD1 A;  2RJZ A;  4TV9 B;  5LMN O;  2DSZ A;  1A32 A;  1AJN A;  4FLX A;  2AW9 A;  1M1K W;  1XL4 A;  2VS0 A;  3KAF A;  1LR1 A;  2QWN B;  3Q4H A;  2A3Q A;  1Q43 A;  2DWE C;  3JYC A;  5CA3 A;  2D9F A;  2ZR2 A;  1R3L C;  2R9R B;  1SRY A;  2GTS A;  1XOU A;  2HR3 A;  1TGO A;  2LFS A;  2WLN A;  5J2T A;  3SYA A;  2UUB B;  3RWR D;  4DV4 O;  4IT4 A;  3MHH C;  3OGI B;  5EBW C;  4ZKI A;  4DZ2 A;  4K8X A;  4B3M O;  3D36 A;  1FKJ A;  3ASO B;  4DRX B;  5IY5 B;  4LH6 A;  4WFH A;  1GN2 A;  4U85 A;  4NZC A;  3IC9 A;  3O65 A;  5L3E A;  2Y4T A;  3LNM B;  4IGG A;  4CS2 A;  2RUC A;  1ZSP A;  4FFK A;  1J4H A;  3CYO A;  3CS5 A;  2HFE C;  1VQ5 V;  3T1Y O;  3TXQ A;  1SZX A;  1YHQ V;  1GUV A;  1LL4 A;  3TET A;  3ML0 A;  1XHX A;  5EYP B;  4LWS B;  2ZR6 A;  4B3T O;  1ROT A;  2MF9 A;  4UFZ A;  4O2A A;  4MAV A;  3BVO A;  1BE3 H;  5IYZ B;  4Q6G A;  4CH3 A;  2JK5 C;  4JI2 O;  1H0I A;  4NXM B;  3RYH B;  3NTP A;  5H5N A;  3N27 A;  1EN5 A;  1F23 A;  1M57 C;  4JV5 B;  5EC1 C;  5EZY B;  4YIO A;  3RVZ A;  5FNV A;  2FKX A;  3UM7 A;  1QCE A;  3OMA B;  5EYP A;  3AG2 B;  4IPX A;  2A0L A;  3SPG A;  2XTA A;  4LF7 B;  4FVM A;  4FLU A;  4U86 A;  2YEV A;  1AR5 A;  5HWC A;  3CHX A;  4JYC A;  4F4L A;  1S76 D;  3ABL C;  5CBF A;  4JYS A;  4GKJ B;  2FAP A;  1J5E O;  2AHY A;  2M08 A;  1I5Y A;  4JZ2 A;  3HKC A;  4X20 B;  2P7T C;  2Y4U A;  1BZK A;  4X1K A;  2QF8 A;  5JH7 B;  4JV5 O;  4O4I B;  1K34 A;  2ZCE A;  5LA6 B;  2IJJ A;  3QVN A;  4DXW A;  4WK9 A;  3JAK B;  2JJ1 G;  3T2M A;  3MAQ A;  3H1H H;  4JI8 O;  4DV7 B;  3LNN A;  1WA8 B;  1W9P A;  4DWS D;  2A06 H;  2W0F C;  3AG1 C;  3CX5 F;  4ODP A;  2ZR4 A;  4NKG B;  1VF6 A;  3FYI B;  5B1A B;  3T1H O;  1G6U A;  4HBN A;  4B08 A;  2B1G A;  3VQV A;  2CTW A;  4JI4 O;  4Q22 A;  3ASN C;  4TUY B;  4KHP B;  5JWP A;  1IBL O;  2HG5 C;  2RCV A;  3CD6 V;  1LUV A;  5B66 Z;  3P3P A;  3ABM B;  2XPB A;  3RYF B;  4UB8 Z;  3HPL C;  1SER A;  2IUZ A;  3HKD B;  2DYR B;  1YVW A;  1M90 W;  1M56 B;  1K5S A;  1HWY A;  2XP9 A;  3WD4 A;  3JSN A;  4UUJ C;  5KUM A;  3OEE G;  3AG7 A;  1GM7 A;  1KQS U;  4PHZ A;  4ZOL A;  3CRQ A;  4QT3 A;  3WQV A;  3LSU A;  1WJZ A;  1EQ3 A;  3ETE A;  1S5H C;  3K03 A;  1U79 A;  1JJO A;  4FM0 A;  4LAV A;  4JTD B;  1RFY A;  2L6L A;  4HAR A;  3UQI A;  2ZNJ A;  4DR6 O;  2KQX A;  4WFB V;  2RUR A;  3ARP A;  2D3O W;  5E79 Z;  2B31 A;  3ARQ A;  3L73 H;  3RFW A;  3BHP A;  5A9G A;  2YC0 A;  1NR7 A;  3ZHR A;  2E75 B;  2UZ5 A;  3G4S V;  3OFN G;  4I50 A;  4Z1V A;  1K9T A;  1D7H A;  4Q7N A;  1QQC A;  4X1Y A;  4X1Y B;  4QT2 A;  2HKO A;  3B09 A;  1VIB A;  3SYQ A;  5FPO A;  2ZQT A;  5KX5 B;  4B3M B;  3L72 H;  1JA8 A;  1ZLZ A;  5L3D A;  4JI0 O;  2A3C A;  4OPH A;  3A0B Z;  4WFE A;  1VQN V;  1ZBK A;  4K0K O;  1AR4 A;  3E8B A;  1GM8 A;  1N4C A;  1D5A A;  1M9N A;  4DRN A;  2Q5A A;  4S3J A;  1O9G A;  2F4E A;  2FL4 A;  4TYO A;  1N32 O;  3NR7 A;  1FFT B;  3G67 A;  3CJH B;  3KCE A;  1J4R A;  3ZHV A;  3AK2 A;  1YCI A;  1RD6 A;  3HKE B;  5H6Q A;  3D3Q A;  5JCO C;  4IT6 A;  3SDL A;  1J4I A;  1FXV A;  3JAR A;  2XOK G;  2DG9 A;  3QO8 A;  3T1H B;  1GH6 A;  1CTN A;  1W9V A;  5J2T B;  4DV7 O;  1NI8 A;  3RBZ A;  4KL1 A;  3JAW A;  1JNS A;  2WK2 A;  3IKD A;  1QVG U;  4MNM A;  4LF8 O;  5CBH A;  1E15 A;  4DV1 B;  4P8V A;  5IJ0 B;  3WKZ A;  2Q67 A;  3O5G A;  4NB5 A;  2N74 A;  3K08 A;  4ZPW R;  5IDJ A;  3P3N A;  2WM0 A;  3RYI A;  3P32 A;  1IX5 A;  3CCQ V;  4W9O A;  1O9H A;  4LC1 A;  4RAI A;  4WKF A;  5HT1 A;  1JCH A;  5EIB C;  2LGO A;  1NR1 A;  5B1B C;  4E4E A;  3TDB A;  4GYC B;  1N0J A;  4YY3 O;  1U97 A;  1US6 A;  2PF4 E;  1D7I A;  3I6C A;  4W9P A;  2M7W A;  2GDS A;  1E9L A;  2YIB D;  3R65 A;  1G8M A;  4MTG A;  1QNM A;  4O4I A;  2HVK C;  3BY6 A;  4JI6 B;  2V1D A;  1J6Y A;  3WG7 B;  3H01 A;  4J7J A;  2GSM B;  4ICG A;  3JCU Z;  4QJF B;  3X2Q B;  1PD3 A;  4JZG A;  3JXV A;  4RWU A;  5LP6 B;  1BQ0 A;  2KKW A;  3OUS A;  5D5Q A;  2PV1 A;  1W0K G;  3ART A;  3GB7 C;  3T4D A;  3RM9 A;  1VQ8 V;  2O92 A;  5IYB O;  4ITZ A;  1GK9 A;  1HKM A;  2UUB O;  4PJ0 Z;  4X65 O;  2HEP A;  3ODK A;  4I4T B;  4DR3 B;  1VP7 A;  2WA3 A;  1W59 A;  3ZRS A;  2QSA A;  2QWO B;  3APQ A;  2EIM B;  1H2G A;  1QLE B;  2ILM A;  4IYI A;  4UCO A;  3B8M A;  1EN4 A;  3CRR A;  4L87 A;  4MGV A;  4JFI A;  3U11 A;  2JGU A;  1EZJ A;  3CWB H;  5HBF A;  2QGN A;  4UV8 A;  3SJB C;  2JIZ G;  1FKG A;  2XND G;  3CXH F;  5HUA A;  5LP6 A;  1M5Y A;  4D7T A;  1AB3 A;  2UUC B;  2VQE O;  4DV5 O;  2VWJ A;  1YJ9 V;  1OWQ A;  1NS1 A;  2F2D A;  1S0V A;  5HWB A;  2A7W A;  1N36 B;  2E76 B;  3HKC B;  4DRM A;  4JF3 A;  3SYC A;  5EBL C;  3WL1 A;  2G38 A;  4UXN A;  1KU9 A;  4LAX A;  4DUY O;  4ABM A;  1MSD A;  3FFQ A;  2ZR3 A;  1NH2 B;  4LFA O;  5BXJ A;  4G50 A;  1MNG A;  3BEH A;  1ORQ C;  3P30 A;  4J10 A;  3UI4 A;  3AS0 A;  4U3J A;  3QG5 A;  1NMW A;  1MMM A;  1FS0 G;  4DR2 O;  3KAI A;  2FYU H;  1FJG B;  3ABK B;  1NT2 B;  4IIJ A;  2PN0 A;  4BF8 A;  2NLJ C;  1O6I A;  1GKF A;  1YF2 A;  1NH2 D;  2UXX A;  1NBM G;  5IJ0 A;  1GAX A;  4FZ1 A;  5KA5 A;  1H38 A;  4JYA O;  1Y76 A;  1OCC C;  1NKD A;  3GWK C;  2RQ6 A;  4LF6 O;  5LHG A;  1D2D A;  4GX2 A;  1OGG A;  4P2Z A;  1FKB A;  2VQF B;  3JAR B;  1AR1 B;  5LHI A;  1PP9 H;  3SPC A;  4DV6 B;  3RVY A;  2E5L B;  3AEI A;  4YY3 B;  2ATK C;  3BFR A;  4K35 A;  5KAI Z;  1HKI A;  4O2B A;  3FAV A;  1QVF U;  1VQ4 V;  2FTK A;  4ML4 A;  1ZUQ A;  1JX9 A;  4DO2 A;  1HNW B;  1HP8 A;  5LYJ B;  2QTO A;  2ZM6 O;  3B7X A;  3CH9 A;  2JDI G;  3FB8 C;  3ZJZ A;  1KKC A;  4JI7 O;  1ZBW A;  1N0N A;  3L70 H;  4QE7 A;  3SJA C;  4LF6 B;  3LUO A;  2MLY A;  1NTZ H;  1WB8 A;  1N34 O;  3CC7 V;  3VQX A;  1FKD A;  3EY6 A;  2BCC H;  5JQG B;  3CRM A;  1NQT A;  3ARO A;  1J5E B;  2XP6 A;  2HHH O;  5KLV H;  3O5K A;  4FFB A;  1X6L A;  3W7T A;  2EIM C;  1QLE C;  1ROU A;  1EBO A;  1UPG A;  2LGW A;  1WPB A;  1B04 A;  2YIA A;  4LNU B;  2E3C A;  1AI5 A;  2A9H A;  5E1A C;  2LP7 A;  3E89 A;  4NVP A;  1IX9 A;  2ZE8 A;  1CEZ A;  1B6C A;  4DIP A;  4JFK A;  1QU7 A;  4DRO A;  2EZO A;  1JPX A;  1GM9 A;  4UCR A;  5GPR A;  3D36 C;  4FK5 C;  2JS5 A;  3AG1 B;  4PI0 A;  2Q69 A;  5B8I C;  4QGP A;  3SPI A;  3C3T A;  2GTA A;  1LUW A;  4YJ2 B;  4DYL A;  1FXK B;  1NWR A;  1EN6 A;  4FLV A;  4EB6 B;  1BHB A;  3ALG A;  3ASN B;  4N23 A;  2F21 A;  5LGN A;  3K04 A;  1EHN A;  2DG4 A;  1EYM A;  5B1A C;  2G41 A;  3E22 A;  4GX1 A;  1Q82 W;  3FY1 A;  2KG7 B;  4YHH O;  3CCJ V;  1GOI A;  1HJX A;  5JVD A;  3JYJ A;  1YJW V;  3TCZ A;  1BMF G;  4MS2 A;  1WB0 A;  3DSQ A;  4PD4 F;  2EX3 A;  3I56 V;  1EZV H;  2UXD O;  3AG3 B;  3U0Z A;  1W26 A;  1F4N A;  1R6N A;  1KFW A;  1PM9 A;  1MAB G;  4FLZ A;  1FFX A;  1THZ A;  3FXY A;  4LNU A;  2DYR C;  3JAS B;  3EIP A;  3N2G B;  5L3B A;  3JAT B;  1WP7 A;  2KSD A;  2DSU A;  4PDV A;  1V54 B;  1S3J A;  4S3K A;  1PNL A;  4DRH A;  1DK1 A;  5LL6 Y;  4X66 O;  2P4K A;  2P4V A;  1SET A;  3K0G A;  3UO3 A;  3KAG A;  5J6E A;  1NVP B;  4IHJ B;  3M7M X;  1YTF B;  1E44 A;  2M1I A;  1TFV A;  1UFI A;  3ZHS A;  2YI8 A;  1XNR O;  1ZL1 A;  1D5N A;  2Z5U A;  2OT5 A;  2ITC C;  3O5F A;  4UDM A;  4J42 A;  4GKK B;  5BXZ A;  1J95 A;  3LSQ A;  4PA4 A;  1JVM A;  1Y4M A;  4DWS C;  2KO7 A;  4LGX A;  2RMK B;  2XHB A;  3PJS K;  4I9W A;  4LCU C;  3WD3 A;  4DZ3 A;  3K3W A;  4TT3 G;  4HBE A;  3M8A A;  4CS3 A;  3CCS V;  4G28 B;  2XAG A;  3ZX6 A;  3SGI A;  4LAW A;  5L3F A;  4AQY B;  1ZBV A;  2A3B A;  2GUZ A;  4JI6 O;  1JJ2 U;  3CCM V;  1PNM A;  5AG2 A;  2HP8 A;  3OR7 C;  2WLL B;  1VMG A;  3OAA G;  4J9Y B;  1YXB A;  4FIP C;  2PZS A;  4I55 A;  3LDD A;  2YDE A;  2QDO A;  3Q4H B;  4IYH A;  4NXN O;  2EIN C;  4DUZ B;  2K1E A;  3FAP A;  4WJX A;  3SJQ C;  3BAA A;  4R7C A;  4MNK A;  1TUE B;  1VQK V;  1XMO B;  1YW5 A;  3W7X A;  3ARZ A;  1FKR A;  1AVM A;  1OCC B;  3MHS C;  2ZIN A;  3K79 A;  4CH4 A;  4ODR A;  3JD3 A;  3IC7 A;  4DV2 O;  3ARU A;  3OT7 A;  2Q0A A;  1D2K A;  1L8D A;  2EIL C;  3GVM A;  3CJH A;  2B5U A;  1TAE A;  4DR4 O;  2DT2 A;  4YXW G;  1S72 V;  2ZXW C;  3ZN0 A;  2WWW A;  2KG7 A;  2YID A;  2F66 C;  2QA4 V;  3ALF A;  2AGA A;  2JGD B;  4MTF A;  2BE3 A;  2F23 A;  2YS8 A;  2VQE B;  3G6L A;  3N2K A;  4FJC C;  5IJ9 A;  4MTX A;  1FXK A;  4RUE A;  2Z0A A;  3CRC A;  1G1X B;  4ODQ A;  5B1B B;  2RDC A;  2ZDI C;  3VQW A;  4KHP O;  1DF4 A;  1H2L A;  1P84 F;  4J4O A;  4O4L A;  4LR3 A;  2XPA A;  1K7D A;  4I50 B;  4ODK A;  1G4Y B;  3NXS A;  5H9C A;  3K5N A;  3OMI B;  2JZV A;  4WFA V;  2RN9 A;  4C02 B;  1F4M A;  1Y66 A;  4IT5 A;  4F6R A;  4ZPV R;  1VQL V;  2ITK A;  3TK1 A;  3RN4 A;  1OHH G;  3MDY B;  3HB3 B;  5L3G A;  2Q6A A;  5HKG A;  2YXH A;  4DRP A;  3G6E V;  4LFC B;  2RSE A;  5KHG A;  1HJW A;  1TVK B;  2UU9 B;  3JD1 A;  1N1A A;  1WLE A;  3E2E A;  1Z2G A;  3ETD A;  4X9Q A;  4J4N A;  3U10 A;  2Z3Y A;  4LP8 A;  3K5O A;  4PEL A;  2PPO A;  1W1V A;  1HXV A;  3E8F A;  3E8G A;  5HFL A;  3IGA C;  2KI3 A;  3CRA A;  3OOB A;  4W5U A;  4ZI7 B;  4H13 B;  2RQS A;  4BWA A;  4I7Z B;  4JYA B;  4DV6 O;  1EFR G;  1FXH A;  3RGC A;  3FAV B;  3CPW U;  1SQQ H;  3H1L H;  4Q20 A;  3AG4 B;  2UXB B;  2XP5 A;  1B3Q A;  5B1N A;  4LBE C;  3PR9 A;  2P22 C;  1IDS A;  4WBN B;  3GU0 A;  1LG2 A;  4RQF A;  1R9H A;  4NXN B;  4NR1 A;  1IUR A;  4LF8 B;  5EZY A;  3AG3 C;  3G6B A;  4ODO A;  1Q5O A;  4J80 A;  1QZ2 A;  2PTM A;  1I7F A;  5A2Q N;  1JNT A;  2XP7 A;  4YJ3 B;  1FFR A;  1YIJ V;  2O57 A;  4JPR A;  2LJ2 A;  1IBM B;  1N34 B;  3KAC A;  4N19 A;  5KUK A;  1VF6 C;  3B40 A;  4JI7 B;  4O4H B;  4N21 A;  4ZBM A;  4NNR A;  4WKH A;  1AJQ A;  4UVA A;  4JAA A;  4B7E A;  5JH7 A;  1NU1 H;  4JI4 B;  3I55 V;  2Q5Z A;  2PV2 A;  4X1K B;  4NTY A;  5B3S B;  1HR0 O;  1JNE A;  4K8Z A;  3RGB A;  1PIN A;  1Y0O A;  3PN1 A;  1OCO C;  2EIJ B;  4DR5 B;  4NYK A;  2Q0O C;  3ABK C;  2YXY A;  2WLM A;  1W1P A;  1FPO A;  4CS4 A;  4RO2 A;  2M2A A;  1K97 A;  3QF7 A;  1MZF A;  4MNJ A;  2PYL A;  1SQV H;  2JJ2 G;  1FXK C;  2ZQV A;  1WNO A;  2YIC A;  1M57 B;  2IF4 A;  3ZRV A;  2L35 A;  1M4U A;  3LUT B;  1GMG A;  4MW3 A;  3B8S A;  2N05 A;  1K3E A;  4O2T A;  2IU0 A;  3PRB A;  1GN6 A;  3CHC A;  4JFJ A;  4Z2K A;  2Q8V A;  1M93 A;  4MT8 A;  4OGQ B;  1HDJ A;  3ZCC A;  4RQE A;  1XRV A;  1KD1 W;  1IBK O;  1ZTE A;  3ZRW B;  1B6Q A;  3DC6 A;  5B1O A;  4TV9 A;  3T4Z A;  2IJH A;  2EUL A;  4O2A B;  3UO2 A;  4LF4 B;  2F43 G;  2Q7E A;  1Q81 W;  4O4L B;  4LWS A;  1XNQ O;  4R8C A;  2R70 A;  3OEH G;  3ZMT A;  4KFM A;  4WKA A;  3O5P A;  1H2N A;  3RME A;  4DV2 B;  2N87 A;  1YEW A;  4MTO A;  2CH7 A;  1F7Y A;  1OCR B;  4PA7 A;  4OPA A;  4X66 B;  1K92 A;  3H1I H;  4ZOL B;  4DRK A;  2XAS A;  4P9P A;  5DF0 A;  1Q3E A;  3VQY A;  3BCC H;  2LO1 A;  3B8N A;  1V55 B;  2OYQ A;  1I0H A;  3WFV A;  3F7V C;  2EIK C;  1I5X A;  4JI5 B;  4R0X A;  2ZIM A;  1XMQ B;  3H9R B;  4MVS A;  5GON A;  1KBH A;  3CB2 A;  4O2B B;  1PBK A;  4LAY A;  3KKY A;  2E74 B;  1W2B U;  4JI2 B;  2RUD A;  3OD4 A;  3O5I A;  4MVU A;  4W4K A;  1E1R G;  1W1T A;  4DWS B;  2VWK A;  4DW0 A;  1SKV A;  4MSP A;  1KYO F;  1FD9 A;  1V9P A;  4DV0 B;  4UCS A;  4TV8 B;  3RYI B;  1GO3 F;  3AK1 A;  4EKW A;  5CB4 B;  3OW2 U;  3WH0 A;  1H2K A;  1ZBC A;  1FKK A;  2IH1 C;  3FB6 C;  1FKI A;  1FKS A;  4DW1 A;  2LW1 A;  5GQB A;  1R3K C;  2ADP A;  2DN9 A;  2Q73 A;  3WIJ A;  4DV5 B;  1RP3 B;  1P49 A;  1PNK A;  5LGU A;  1JVW A;  2PUS A;  2E5L O;  1IZ3 A;  2BOC C;  5KMG A;  4HNA A;  4LH7 A;  4TW7 A;  3SJC C;  2DSW A;  1HNW O;  5LBQ A;  3UQ8 A;  4X64 O;  4F6E A;  1WNS A;  1V54 C;  3GPK A;  4X20 A;  4R50 A;  4Z1M G;  2HJD A;  4ASU G;  5CN0 A;  2RUQ A;  1AIL A;  4EFE A;  1FJD A;  1ZX3 A;  4W4L A;  4FAP A;  1E6N A;  4B3R O;  2NNU A;  4PTM A;  1XMO O;  5HW8 A;  2KFW A;  4DR2 B;  1NTM H;  4WCE V;  4D6T H;  3CHF A;  1N32 B;  1ZL8 A;  4GKK O;  3THO A;  1PV0 A;  4CC5 A;  2QKS A;  2PPP A;  2HHH B;  4GGQ A;  5FNV B;  2PI5 A;  2FKE A;  1MOF A;  2OCH A;  1IBM O;  2QE7 G;  1Y74 B;  2DT0 A;  4FM2 A;  2ADQ B;  2AZ2 A;  3H1K H;  1S5J A;  4YJ3 A;  2X6A A;  5J9P C;  2MLZ A;  5HW7 A;  2ZR5 A;  1XRE A;  1P5Q A;  3CSX A;  2QTS A;  3TCU A;  2JS3 A;  5LXT B;  1RSO B;  2QWQ B;  3JAM N;  1HNZ B;  4XBF A;  2DSV A;  2MW2 B;  3AG2 C;  5L3C A;  5BR8 B;  4O4J A;  4H33 A;  1OCZ B;  3JYM A;  2MLX A;  4L3N A;  4KR0 B;  1EM1 A;  2X6C A;  4L8J A;  5KAF Z;  2ZD9 A;  2KGJ A;  1BQZ A;  3L9D A;  4FPP A;  4P9O A;  4U7O A;  3A0R A;  3K58 A;  4ZI7 A;  3A0H Z;  3ABU A;  3ABL B;  2EIK B;  4DRX A;  2YUA A;  1JQ0 A;  5B3S C;  4ODL A;  4BW9 A;  5DEZ A;  1T11 A;  4DRQ A;  5C93 A;  4CZZ A;  4X1I B;  2WSS G;  4AIL C;  4NTW A;  1LL6 A;  3APO A;  2ZE6 A;  1AP5 A;  4GZR B;  1LG1 A;  4EEQ A;  1H2M A;  1C9H A;  5H6R A;  2GHY A;  2IH3 C;  1R3I C;  1Y6X A;  3IHZ A;  1CPY A;  4JAU A;  2NN4 A;  1P7B A;  3G80 A;  5CB4 A;  1ROP A;  2N04 A;  4P8W A;  3KCX A;  4WIW A;  2X6B A;  1FKH A;  3FYE B;  2VRZ A;  3PRD A;  4B3T B;  2PI4 A;  3TGU H;  5D75 A;  4MTV A;  4BIO A;  1U96 A;  3QOK A;  1DF5 A;  3JAT A;  4MVZ A;  3JAS A;  2AXT Z;  4DV0 O;  3AS2 A;  4NSB A;  4PDL A;  4K0K B;  4DWS A;  4X65 B;  1XNQ B;  4LF9 B;  3K57 A;  2YXL A;  4FFB B;  4PA3 A;  3STL C;  4FN2 A;  4U84 A;  3N2K B;  4UVC A;  4TSF G;  1WA8 A;  2B1I A;  2OTL V;  4ZHQ A;  3JAK A;  2LQT A;  5DED A;  1QPL A;  2VN1 A;  1HKJ A;  4DK1 A;  2A79 B;  1KT1 A;  3FKS G;  4DR7 O;  4FLT A;  5JH8 A;  1XL6 A;  1QHT A;  3O5Q A;  3ZRX A;  3D8C A;  4JI5 O;  4RUF A;  4JYY A;  5CA1 B;  5IYC O;  1KP3 A;  5JJE B;  3O5O A;  4D7S A;  4B3R B;  2CTR A;  4DR1 O;  4GKJ O;  1V55 C;  4ZIB A;  4CC6 A;  4IL6 Z;  4XDK A;  1URF A;  1D6O A;  1SES A;  1FAP A;  2LW7 A;  1VQO V;  2MPH A;  4KUM A;  4JI3 O;  5I98 A;  4I5S A;  3B9E A;  1UJW B;  2RNB A;  1KP2 A;  2CK3 G;  2UXC O;  3ARV A;  1HR0 B;  2WLY A;  1FYJ A;  4AY1 A;  5FL7 G;  5ITZ B;  3ZRW A;  2ODM A;  2CAZ C;  1GTO A;  1NZ6 A;  2OCC C;  3CEI A;  1I94 O;  4JFM A;  2Y69 C;  1P7G A;  4I55 B;  5LXT A;  4BAY A;  3ARX A;  1LJY A;  4PDM A;  1R6K A;  2IJK A;  5ITZ A;  5BZB A;  2GUZ B;  1RM1 C;  2WA4 A;  3GWO A;  3O9O A;  2OIE A;  2ZIO A;  3AG4 C;  4ZPT R;  3ZMS A;  2DT3 A;  2AHZ A;  2CE4 A;  3KCY A;  4L72 B;  1WP8 A;  5LYJ A;  1WN7 A;  5LHH A;  4C7U A;  2VQF O;  4I0X A;  1WAZ A;  4PA9 A;  1L1F A;  4BIU A;  2B9Z A;  2XAQ A;  2V4D A;  2QJ1 A;  3WQW A;  1L1P A;  3UI5 A;  4G27 B;  3CHD A;  3OTO B;  3OGC C;  1ZU8 A;  1Y67 A;  2UXN A;  4LF5 B;  5IYD O;  2XP3 A;  1K4D C;  4TQF A;  2MK3 A;  3OTF A;  4DR3 O;  3RM8 A;  4O4H A;  3HKD A;  2ETN A;  1K33 A;  5KMG B;  1AP6 A;  4UV9 A;  1HKK A;  1E1Q G;  1NTK H;  1OCO B;  2EIJ C;  3RYC A;  2YSU B;  3WB0 A;  4UVB A;  1FKA O;  3K0D A;  4H37 A;  3FB7 C;  1SA0 A;  2BTQ B;  5LOV A;  4Z2L A;  4FM1 A;  3K9S A;  4IIJ B;  3ZHT A;  3HKB A;  4G2K A;  5GPG A;  1VAR A;  4CH6 A;  2NR5 A;  4WBN A;  3CME V;  1JFF B;  1DGS A;  4U3J B;  3FB5 C;  3O5M A;  3H1J H;  1BCC H;  2ZNI A;  1AJP A;  1OJH A;  1GRJ A;  4DR7 B;  4A5U B;  4PV1 B;  2K9P A;  3DGE A;  4AI8 A;  3G6M A;  4JI1 O;  2L2S A;  4Z2J A;  3OM3 B;  1KC8 W;  3JD0 A;  4LF4 O;  4JI0 B;  3ZHU A;  3KAH A;  1PL0 A;  1FJG O;  3STZ C;  3W7S A;  2F95 B;  3CCR V;  5DO2 A;  4PDR A;  4FMT A;  1K5Q A;  2DYS B;  1PKX A;  1TVK A;  4J7K A;  5IWA B;  3BA9 A;  3QO5 A;  2QWR B;  1L0N H;  2IJI A;  5EBM C;  3UQB A;  1SQP H;  2KB1 A;  3WB2 A;  4TW8 A;  3VBB A;  1AI6 A;  2BSK B;  1BHA A;  2K8I A;  3E35 A;  3O5L A;  3CXC U;  3BMB A;  2Y69 B;  3OUF A;  4F6R B;  4JAS A;  4LFC O;  5KHK A;  2UXD B;  2XAF A;  2WLJ A;  1FFQ A;  5FLX N;  4TUY A;  2QKC A;  5IWA O;  1NWU A;  2Y0I A;  2JRI A;  5JQG A;  3ARS A;  3F7Y C;  1N33 O;  5LMU B;  4U3F H;  2LGQ A;  2WLK A;  4TNS A;  1Q6I A;  1R6T A;  3ARR A;  4Z2I A;  3BXW A;  5F2V O;  5KHH A;  4IQ2 A;  2EBO A;  2QR4 A;  4DH0 A;  1CXZ B;  2CTQ A;  4X62 B;  4DV3 O;  4P30 A;  2XP4 A;  2OTJ V;  3A8T A;  2DWD C;  2QEX V;  2BOB C;  5LMU O;  1VF8 A;  3TXS A;  3D3I A;  3A2F A;  4YJ2 A;  5DIU A;  1IBL B;  1SQG A;  5EK0 A;  2CDY A;  4QNH B;  4NTX A;  4R5E A;  1Q86 W;  4ODM A;  3SYO A;  3KZ7 A;  3CGM A;  2Y48 A;  4FLY A; 
#chains in the Genus database with same CATH homology
 3KAI A;  4KQZ A;  4W9Q A;  2G8Z A;  1Q1C A;  2DG3 A;  1HJV A;  4BF8 A;  1O6I A;  4DRK A;  1SYT A;  5DF0 A;  1OGB A;  3ARY A;  4TX0 A;  2VCD A;  3UI6 A;  2WLZ A;  2DPE A;  1D7J A;  1UR9 A;  4R0X A;  1YAT A;  3H9R B;  2KR7 A;  1E6Z A;  1H0G A;  1OGG A;  1PBK A;  2FDM A;  4LAY A;  2RUD A;  5DIT A;  1FKB A;  3O5I A;  3O5E A;  5HW6 A;  1W1T A;  2AWG A;  4DWS B;  1A7X A;  1BL4 A;  1ITX A;  2OLH A;  4MSP A;  1HKI A;  1FD9 A;  1NSG A;  3WD1 A;  2DSZ A;  3UF8 A;  4P8U A;  4ML4 A;  4JFL A;  3WH0 A;  3KAF A;  1ZBC A;  1FKK A;  3B7X A;  3CH9 A;  1FKI A;  2D9F A;  1FKS A;  1ZBW A;  3LUO A;  5GQB A;  3B9D A;  4MPK A;  2MLY A;  3WIJ A;  1JVW A;  4G2P A;  4IT4 A;  1FKD A;  4TW7 A;  3EY6 A;  1W9U A;  2DSW A;  3ARO A;  2XP6 A;  3O5K A;  4DZ2 A;  3KAB A;  3GPK A;  1X6L A;  1FKJ A;  1ROU A;  3AS3 A;  4QZV B;  3CHE A;  4U85 A;  1NH6 A;  1EIB A;  3CZ8 A;  2RUQ A;  4NZC A;  1FJD A;  4FAP A;  1E6N A;  1X6N A;  2RUC A;  1B6C A;  4DIP A;  1J4H A;  4PTM A;  4JFK A;  4DRO A;  5GPR A;  5HW8 A;  2KFW A;  3OA5 A;  1LL4 A;  1GUV A;  3O5R A;  3CHF A;  5B8I C;  2ZR6 A;  2KE0 A;  2PPP A;  4GGQ A;  1NWR A;  1ROT A;  2MF9 A;  1ZCN A;  2FKE A;  2YBU A;  3ALG A;  2DT0 A;  4MAV A;  2F21 A;  1EHN A;  2DG4 A;  1EYM A;  2MLZ A;  1H0I A;  2ZR5 A;  3NTP A;  5HW7 A;  1P5Q A;  2G41 A;  2YBT A;  3FY1 A;  3TC5 A;  3B9A A;  2DSV A;  2OFN A;  3PA7 A;  1GOI A;  1HJX A;  3JYJ A;  3TCZ A;  1XHG A;  1WB0 A;  3JYM A;  2MLX A;  4IPX A;  4L3N A;  4KR0 B;  1ZB5 A;  4U86 A;  1W26 A;  5HWC A;  1KFW A;  2KGJ A;  3FXY A;  4JYS A;  2FAP A;  3O5D A;  2DSU A;  4S3K A;  2M08 A;  4DRH A;  2PBC A;  4ODL A;  5DEZ A;  4Z2G A;  1T11 A;  4DRQ A;  2QF8 A;  2MNT A;  3KAG A;  4HBO A;  3AQU A;  5J6E A;  5DIV A;  1LL6 A;  1W1Y A;  3W4R A;  4WK9 A;  2M1I A;  1TFV A;  1LG1 A;  1ZL1 A;  1W9P A;  4DWS D;  1C9H A;  4ZS6 A;  3O5F A;  4ODN A;  3IHZ A;  4ODP A;  2ZR4 A;  3WD0 A;  4P8W A;  4WIW A;  3WL0 A;  1FKH A;  3PRD A;  4Q22 A;  5D75 A;  4MTV A;  4DWS C;  3QOK A;  2KO7 A;  4LGX A;  3RM4 A;  2AOS A;  3WD3 A;  4DZ3 A;  3AS2 A;  1TCO C;  4HBE A;  4NSB A;  1NWT A;  4DWS A;  1F8A B;  4FN2 A;  4U84 A;  2PI6 A;  4LAW A;  1UR8 A;  2XPB A;  1ZBV A;  2A3B A;  2IUZ A;  3VAW A;  1QPL A;  2VN1 A;  2XP9 A;  1NWS A;  3WD4 A;  1HKJ A;  1LQ0 A;  2DT1 A;  1KT1 A;  5JH8 A;  4URI A;  3O5Q A;  4QT3 A;  3WQV A;  2Y78 A;  3FAP A;  4DRJ A;  1EQ3 A;  4WJX A;  4MNK A;  1U79 A;  2PPN A;  4LAV A;  3O5O A;  1YW5 A;  3ARZ A;  1FKR A;  4HAR A;  4ODR A;  1D6O A;  3UQI A;  1FAP A;  2MPH A;  2RUR A;  3ARP A;  3ARU A;  5I98 A;  2B31 A;  3ARQ A;  3RFW A;  3B9E A;  1D2K A;  3ARV A;  2WLY A;  4AY1 A;  2LJ4 A;  1SR0 A;  2DT2 A;  2UZ5 A;  1WAW A;  1K9T A;  1D7H A;  2A3E A;  4JFM A;  4Q7N A;  4QT2 A;  3ARX A;  1LJY A;  3B09 A;  1ZK6 A;  1JND A;  2ZQT A;  3ALF A;  1FKT A;  3G6L A;  1GPF A;  3IKG A;  2A3C A;  4ODQ A;  4ZPT R;  2DT3 A;  3UQA A;  3CGN A;  4P8X A;  1ZBK A;  4L72 B;  4J4O A;  2XPA A;  3KAD A;  4ODK A;  4DRN A;  2Q5A A;  4S3J A;  2JZV A;  2F4E A;  4TYO A;  4C02 B;  4ZPV R;  2ITK A;  2LKN A;  3MDY B;  3KCE A;  1J4R A;  1FKL A;  3WQW A;  5HKG A;  4DRP A;  1L1P A;  1RD6 A;  3CHD A;  3UI5 A;  1ZU8 A;  2RSE A;  4IT6 A;  1J4I A;  4XAK A;  2XP3 A;  1HJW A;  3O5J A;  3RM8 A;  3NRK A;  1N1A A;  2DG9 A;  2XP8 A;  4GIV A;  4IQC A;  1CTN A;  1HKK A;  1W9V A;  4J4N A;  1JNS A;  2WK2 A;  3IKD A;  4MNM A;  2PPO A;  1W1V A;  1E15 A;  1HXV A;  4P8V A;  3WKZ A;  3O5G A;  2KI3 A;  3OOB A;  4W5U A;  4Z2L A;  1QPF A;  4ZPW R;  2RQS A;  2WM0 A;  1IX5 A;  5GPG A;  4W9O A;  4WKF A;  3RGC A;  5HT1 A;  5HTG A;  3O5M A;  2LGO A;  2XP5 A;  3PRA A;  3TDB A;  3PR9 A;  1D7I A;  4QIB A;  2ZQS A;  3I6C A;  4W9P A;  1E9L A;  3NI6 A;  1LG2 A;  1R9H A;  1LL7 A;  1NMV A;  4ODO A;  3G6M A;  1QZ2 A;  2L2S A;  4Z2J A;  1JNT A;  4TW6 A;  2XP7 A;  1J6Y A;  3KAH A;  1FFR A;  3WD2 A;  1F40 A;  3KAC A;  4Z2H A;  3JXV A;  5DO2 A;  4N19 A;  2PV1 A;  4NNR A;  4WKH A;  3ART A;  1Q6U A;  3RM9 A;  2O92 A;  4ITZ A;  1HKM A;  3UQB A;  2A3A A;  4TW8 A;  3ODK A;  2O9O A;  2PV2 A;  3ARW A;  4DT4 A;  1JNE A;  1Y0O A;  4DRI A;  1PIN A;  2K8I A;  3O5L A;  2ESC A;  1FFQ A;  1W1P A;  1Q6H A;  1E6R A;  2M2A A;  1KT0 A;  4MNJ A;  2PV3 A;  1NWU A;  1BKF A;  4MGV A;  3ARS A;  4JFI A;  2ZQV A;  1WNO A;  2IF4 A;  5HBF A;  1E6P A;  1FKG A;  4TNS A;  1Q6I A;  5HUA A;  3B8S A;  1M5Y A;  3ARR A;  4O2T A;  3BXW A;  4Z2I A;  3PRB A;  3CHC A;  4JFJ A;  4Z2K A;  4IQ2 A;  1XRV A;  4DH0 A;  1OWQ A;  2F2D A;  5HWB A;  2XP4 A;  2LPV A;  4DRM A;  3WL1 A;  1FKF A;  1VF8 A;  4LAX A;  3AS1 A;  5DIU A;  3IK8 A;  5BXJ A;  4WKA A;  3O5P A;  4G50 A;  4R5E A;  1EDQ A;  4MNL A;  4ODM A;  3RME A;  3KZ7 A;  2N87 A;  2ZQU A;  3CGM A;  3UI4 A;  3AS0 A;  1NMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...