1Q6IA

Crystal structure of a truncated form of fkpa from escherichia coli, in complex with immunosuppressant fk506
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
210
Chain Sequence
AFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
publication title Structural and functional studies of FkpA from Escherichia coli, a cis/trans peptidyl-prolyl isomerase with chaperone activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 66
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1q6iA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q6iA02
3KACA 2UZ5A 1R9HA 1ROUA 1QPFA 2DG3A 3UI4A 4JFMA 4DRHA 3NRKA 1P5QA 5GPGA 5HWBA 3O5RA 2ZR5A 3TCZA 4DRKA 3KZ7A 1YATA 4DRNA 1KT0A 4W9OA 5HUAA 2KFWA 1B6CA 2XPAA 3KAIA 4MSPA 1N1AA 3IHZA 3O5DA 3H9RB 4BF8A 3O5GA 3IKGA 4ODMA 1F40A 1D7IA 4ODNA 3KABA 1ZK6A 3O5OA 4JFKA 1FKTA 2PV1A 1FKDA 2M2AA 3NI6A 5HW8A 4IQ2A 2Y78A 3LUOA 1J4RA 5DIUA 2XPBA 2PV3A 1NSGA 4G2PA 4LAVA 1FKRA 2RUCA 4QT3A 2RURA 4ODQA 4C02B 1EQ3A 4DZ3A 1L1PA 3JYJA 3OOBA 2ITKA 1T11A 1C9HA 2JZVA 4DRMA 5DIVA 3CGMA 2XP9A 2LJ4A 1FKKA 3O5LA 1FKSA 2RSEA 1EYMA 2PPNA 5HT1A 5I98A 2ZQUA 2VN1A 1FKLA 1PINA 4ODOA 2XP5A 3RFWA 4FAPA 1FKIA 2ZR4A 3PA7A 4NNRA 4TW7A 4TX0A 3PRBA 2VCDA 1QPLA 4TW6A 3KCEA 3UI5A 2N87A 1QZ2A 3KADA 1FD9A 3B09A 4DRJA 2MPHA 4J4OA 2AWGA 1FKGA 1J6YA 2F2DA 2LPVA 3O5QA 3TC5A 1YW5A 3UI6A 3FAPA 3O5IA 4ODLA 2XP8A 2MNTA 2PPPA 1J4IA 2KR7A 2F21A 3IKDA 5J6EA 4ODRA 2LGOA 3JYMA 4DT4A 2XP4A 1PBKA 2FAPA 5HTGA 1FKBA 1FKHA 1ROTA 2MLYA 3RGCA 5D75A 3VAWA 1W26A 2Q5AA 3KAGA 4ITZA 1FAPA 3UQBA 4TW8A 3I6CA 3O5PA 4W9PA 1BL4A 1A7XA 1J4HA 2M1IA 4TNSA 4DRQA 2KGJA 1ZCNA 2ZQVA 4DZ2A 2RUQA 1NMWA 4QT2A 3UQAA 3KAHA 1JVWA 4TYOA 4LAYA 1HXVA 1D6OA 1TCOC 1BKFA 1D7HA 4ODPA 5BXJA 3WH0A 2DG4A 2MLXA 4LAWA 2LKNA 2IF4A 3NTPA 4GGQA 2PV2A 4QIBA 2KO7A 1F8AB 2XP3A 2XP6A 2DG9A 3O5EA 3O5KA 2XP7A 1Q1CA 4O2TA 1Q6IA 2PBCA 4JFLA 3IK8A 4JFJA 5B8IC 2KE0A 2F4EA 4DROA 2RQSA 1FJDA 4JFIA 4U84A 4DIPA 2KI3A 1JNSA 3GPKA 4J4NA 2PPOA 3B7XA 4W9QA 1KT1A 1FKJA 3O5MA 4JYSA 4N19A 4LAXA 2D9FA 3EY6A 3JXVA 3KAFA 4R0XA 3O5JA 4DH0A 2RUDA 3UF8A 4IPXA 3PRDA 2ZR6A 4MGVA 2FKEA 1Y0OA 2MLZA 3CGNA 1Q6HA 2MF9A 3ODKA 5HW7A 5DITA 1NMVA 2OFNA 4FN2A 1M5YA 4DRPA 3TDBA 4G50A 5HW6A 3MDYB 4IQCA 1FKFA 1U79A 3UQIA 2K8IA 2M08A 4DRIA 5HKGA 1D7JA 2L2SA 4U85A 2ZQSA 3O5FA 4ODKA 1Q6UA 4U86A 5HWCA 4GIVA 1JNTA 2ZQTA
chains in the Genus database with same CATH superfamily
3HKDB 1EN6A 4P8WA 4MTVA 3AG4B 3ARUA 4URIA 3TK1A 1VF7A 2P7TC 3K06A 3ZMUA 2EILC 3CCJV 4PI0A 1NTKH 3IC9A 3OR6C 2P90A 5EBMC 1W59A 4LF7B 3E8FA 4XDLA 1YTFD 2OWOA 2F66C 4ZKIA 1OCOB 4GX2A 3A8TA 3WD0A 1UR9A 5LOVA 5B1AC 1AP6A 2ITKA 1F23A 2ZKOA 4QE7A 3K58A 3CGMA 2XP9A 4I55B 2WK2A 1NTZH 1PINA 1K4DC 1FAFA 3UI5A 1I5YA 1ZSPA 1LQ0A 2QSAA 4PHZA 5KX5B 4PD4F 2HLDG 4UCRA 5KHJA 1OHHG 4PDLA 2D2CB 2PPPA 2KR7A 2QM8A 4D7SA 1BHBA 2WA4A 1PBKA 2B31A 4GZRB 3G80A 2BTQB 4RQFA 3QNEA 3RW0A 1WJZA 1E15A 3K5LA 4TW8A 2YXLA 1PNLA 3I5DA 2M1IA 3JASB 2V4DA 4DUZB 5EZYB 1NMWA 4EEQA 1M4UA 3CCEV 2NLJC 4DV1O 3SPJA 2ZIOA 5JWPA 3ZHUA 4PV1B 4TV9B 3SJAC 4FM2A 2F4VB 2BOCC 4LWSA 4UVAA 4G27B 1M57C 1DGSA 1Q6IA 1KU9A 2C2AA 2YICA 1I7FA 4DIPA 4FM1A 4J4NA 3WL1A 2HEPA 1HKKA 3ARQA 1N34B 3EY6A 2CUGA 3CEIA 1XMQO 3JD4A 5L3BA 1W9UA 1HKIA 5EYPA 3L9DA 4MTFA 1QVFU 1US6A 3AG2B 5KHKA 2LP7A 4KHPB 2BE3A 4DR6O 4HARA 3ARVA 5HKGA 1RM1B 5LA6A 2B1IA 1ZTEA 1W1PA 1H2SB 1TUBA 4RUFA 5EC1C 1NVPD 2PN0A 4X64B 1AR1B 1BMFG 1VIBA 3O5RA 2KKWA 2ILMA 3WFVA 3ML0A 2XPAA 3O5GA 1WAZA 2QWRB 1FPOA 2O57A 4TV8A 4O2BA 1LL6A 4Z2GA 5HBFA 3AQUA 1K4CC 5JCOA 3JCZA 2P22C 1M5IA 2ITDC 4XBFA 2PV3A 3BABA 4MS2A 3A0RA 4B7EA 1FKRA 1H38A 1JFFB 4ZOLA 3JAWA 3JYJA 4LFBB 1T11A 1NZ6A 2Q5ZA 3ZHSA 4B08A 2M7WA 4JAVA 3AS3A 4ODOA 1HNWO 4DV6O 4NNRA 2WLIA 3K0GA 2PY5A 3KCEA 4DWSB 4QNHB 4CH3A 2VQFB 5CMUA 4UVBA 2XOKG 3S3WA 5JCOC 1OCRB 3TETA 2PI6A 3ZJZA 1Q43A 4RO2A 4O4JA 5IWAB 1AI4A 5J6EA 5IY5C 3E8BA 4MVMA 3N2KA 3SPCA 5LMUO 3KAGA 4H44B 3UQBA 1V54C 4DW1A 2QKCA 5K1PA 4MTXA 4DO2A 4CBCA 4TNSA 1IX5A 1P49A 2DOSA 4FMTA 1JVWA 3JAKA 1I0HA 1RPOA 3MDSA 3L71H 2OCCB 2MK3A 3OW2U 3OFNG 4BIZA 3ABLB 3DC6A 4W4KA 4DR5O 1KD1W 3GPKA 1JNSA 4DK0A 3CCVV 2F95B 4W9QA 4JI4O 4ZS6A 3F7VC 2ZR6A 1AJPA 3W7TA 3K57A 1WNSA 3MAQA 3ASNC 2EILB 4JI2O 1PD3A 2E76B 3UQIA 3QG5A 1VQ5V 4I9WA 1B6QA 2PYJA 2UZ5A 3JD3A 4OPHA 4FLVA 3WQWA 4K8ZA 3OM3B 2OT5A 4LF9O 2ZR5A 3KZ7A 4DRKA 4UDMA 5CB4B 5HUAA 3IGAC 5B1AB 3ZHRA 2KFWA 2Q73A 4B3MB 3W4RA 1SZTA 2KG7A 2OIGA 3H9VA 3L70H 3ZS8C 2YBUA 3LSSA 2L6LA 2QTOA 1Z5WA 2UXCO 2WLNA 1K97A 4L8JA 2DSWA 2PV1A 3AK2A 1NT2B 4IQ2A 3M8AA 2FDMA 3K5NA 1NKDA 1GUVA 4FLXA 4JTCB 3N27A 1W9VA 1JCHB 1TUEB 1XHGA 1YEWA 4MNJA 4PA9A 4LF5O 1EYMA 2OTJV 3T1YO 3CPWU 4X66B 1PM9A 2AZ0A 2ZE8A 3OE7G 2ZNIA 5JVDA 1VQ7V 3L72H 4NXNO 1L1FA 3TXSA 2K9PA 4BAYA 4O4LA 1M57B 2XAFA 2ZR2A 4KUMA 3RVYA 3BCCH 3CYOA 4J7ZA 1W26A 2DYSC 4I4TA 3NR7A 1J4HA 4QPJA 3T1HB 1K34A 4FK5C 4IYIA 4AY1A 1KP3A 1M1KW 1BE3H 1GK9A 1W0JG 4OGQB 2A06H 3KAHA 4WKFA 1QQCA 1TCOC 3WH0A 2JRIA 1ZL8B 1LUWA 2ZDIA 1H2NA 1IURA 1Y6XA 3VQXA 4QIBA 2JGDA 3PR9A 1EZVH 3OMAB 3QO5A 2V7QG 5H5NA 1IBLO 5CN0A 1D5NA 3A0HZ 2AZ2A 1FFTB 1NH6A 1AVMA 4MTGA 1YVWA 1B04A 2Q0OC 1SRYA 2CTWA 3ASOC 3IC7A 4TOIA 1YSCA 2EINC 5DEDA 3F5WC 1HJXA 4TQDA 1NMVA 1M5YA 4DRPA 1BQZA 3LSQA 1K7DA 5L3DA 1NR7A 2ZDIC 4DV0O 4EFBA 1Q90D 2XAGA 3D36A 3R66A 1NR1A 4I9QA 4LF4B 1CEZA 5CBFA 1Q6UA 1TUBB 4DR7O 1D2KA 3E2EA 2Y0IA 5KA5A 1QPFA 3UI4A 2Q6AA 3B4SA 4JAUA 1WPBA 4FVMA 2G38A 4WFGA 2N04A 4X88A 2YI9A 1OCCC 4NXMO 1I94B 4DK1A 3GVMA 4TV8B 3D36C 3CWBH 1FKDA 4X1YA 4WF9V 2HP8A 4LF6B 4UCOA 1XNRO 1IDSA 4PDRA 1JA8A 4JV5O 3IAYA 3K0DA 1I5XA 3HKDA 3FAVB 4RAIA 5L3FA 4ODQA 4X62B 5LMNO 5IY5B 3JAWB 1NU1H 2PPNA 5HT1A 3OMNB 1XMOO 4JYYA 1V54B 3OGCC 4I0XA 3PA7A 2OCHA 2WLIB 3E86A 3M7MX 2V1DA 5H6RA 1N4CA 3FAPA 2A9HA 3BA9A 4O4JB 4J7JA 4NZCA 2UUBB 1JMKC 5GONA 4F6EA 4CZZA 1QLNA 4LFBO 1E1RG 1BL4A 1HR0B 4JI6O 4DR1B 2RDCA 4GX0A 5KA6A 1J5EB 5FNVB 3A2FA 3JAKB 3OTOO 3ASNB 1S0VA 4L72B 3H1JH 4IT4A 1K33A 2GTAA 2BOBC 2DT1A 3BAAA 3CCSV 1S77D 5C93A 2BTQA 2GDSA 3WU2Z 4YHHO 3MHHC 4DUYB 1FKJA 3CRCA 5EBWC 1GH6A 3CCLV 1KECA 1P7GA 3WL0A 3BEHA 1ZX3A 1HP8A 1NWSA 4ZIBA 1WB0A 4IHJB 3CD6V 3CHXA 3FKSG 3ZN0A 3U10A 4TV9A 1ZBKA 2K8IA 4DR4O 4HBOA 2DE0X 4B3TB 3OUSA 4GIVA 1WAWA 4ITZA 5FPOA 4LF8B 1R9HA 1ZLZA 4JYAB 4UB8Z 5HWBA 1NS1A 5D5PA 1M56C 4QPKA 4DRNA 1SETA 3BA8A 1N8RW 4UV8A 1W1YA 3FB6C 5DECA 4MNLA 4I7ZB 4P30A 3T4ZA 4DRXA 1RSOA 1FXVA 2UU9O 2XPBA 4H0LB 3W7UA 3JAMN 4P9PA 2FMLA 1OZ0A 5L3EA 1V55C 1X6LA 1H2MA 1FKKA 1HNXB 4TWKA 2GBOA 5KAFZ 2DYSB 1JPXA 4MVSA 4UCVA 2WLZA 2WM0A 3PRBA 1IBKB 4GKKB 4JI3B 4DRJA 5JVDB 2EIJC 1FFRA 1R6NA 5IYDO 2UXDO 2CGOA 2F2DA 1VQNV 1JVMA 4N21A 4YJ3B 2A3AA 3F5TA 4U3FH 2QJ1A 3ABMC 4U7NA 1AP5A 3EFFK 3GWOA 4O4LB 3FY1A 3FD9A 1N33O 4QZVB 4I4TB 3F7YC 2XUMA 4MTOA 1FJGO 1FFXB 3JSLA 2P4VA 2JS5A 4LC1A 4CC6A 3ASOB 2RUQA 2EINB 3PN1A 3RM9A 4MVQA 4ODPA 1EIBA 2LKNA 2IF4A 3HB3B 2F43G 3HKCB 2E74B 2EJRA 3P3PA 1JOYA 2JGDB 2JDIG 1TA8A 4XAKA 3IK8A 1KKDA 5B8IC 1QHTA 1L0LH 2Y4TA 3K9SA 5EK0A 3SJCC 3R65A 2WSSG 2IJKA 1Y74A 3CGNA 4DV7O 1ZL1A 3CJHA 3T1HO 4OX9B 1OCRC 1OCCB 4AILC 1H0IA 4LR3A 1WB7A 2L2SA 4UV9A 4PJ0Z 4HNAB 5HWCA 2G41A 1Q81W 4MVRA 3ZMVA 2DG3A 2QTSA 4Z2IA 4J42A 4AQYO 3T4DA 1XRVA 1HW7A 1JR9A 2EZPA 4J80A 1E6RA 4FZ0A 4WFFA 3K79A 2W6IG 4BWAA 1VQ8V 2UUAB 3CC4V 4HBNA 5E1AC 4MVUA 1M93A 2OCCC 4MPKA 4DR3B 1WP7A 1E79G 4MSWC 2DW4A 3ZBHA 4G2PA 1TVKB 4DV4B 4X65O 2BCCH 3B8NA 2IU0A 4DV2O 4DV5O 1R3KC 4DRMA 3O5LA 1BL8A 5CB4A 5GPRA 5JJJB 2HHHB 3K03A 2ZQUA 1PNMA 4FAPA 1N36O 2WPDG 4I0XB 1MABG 4DR2B 3RYHA 4J4OA 5HFLA 2B5UB 4ZHQA 1ZB5A 2RCVA 5JJEB 3CCRV 4WK9A 1Y67A 2ATKC 4EKWA 4LF6O 2P6JA 1YJ9V 2QGNA 1JCHA 5GONB 5D75A 2DT3A 1THZA 4X62O 3O5PA 1A7XA 2XAQA 2DN9A 3ZHQA 1ZCNA 5LL6Y 5GTHZ 4R7CA 2Q67A 4LNUA 1BSMA 4X8AA 1RP3B 4LFCO 4GLXA 1VQOV 3G6MA 4JI0O 1YI2V 4YY3O 2BSKB 1S3JA 1IZ3A 3EVKA 4KQZA 1G8MA 2RQSA 1JNDA 2QWPB 2R70A 1M56B 4IPXA 1G4YB 4JZ2A 4K0KB 1OCZC 1HR0O 1SQPH 2Y48A 1S5HC 3RWRD 4OXSA 3TDBA 2KB1A 2DPEA 1ZL8A 3RM8A 4KXRA 3BY6A 3OAAG 3RYIA 2F1MA 4DV3O 2VQEO 1E44A 3H1LH 3HPLC 2N05A 1X6NA 3EIPA 1ORQC 3ZMZA 2CK3G 1V55B 4WFBV 4MSPA 3P3NA 4MVOA 1GKFA 3WB1A 4ODMA 4PI2A 2BTOA 3ABKC 1XDCA 1D7IA 4ODNA 4Q7NA 5LGUA 1VQ4V 1XNQB 1F51A 2R9RB 1EM1A 2EIJB 4DRXB 1RSOB 1R6TA 1GN2A 4IL6Z 2JJ1G 1IBMB 5CBGA 3CXHF 4FLUA 1BZKA 2Q69A 4C02B 5B1NA 4JI7O 2ADPA 2UXBB 1KFWA 2ZE6A 3ABMB 1HJVA 3TXQA 4WJXA 4GX5A 4JI5B 2YDEA 4J10A 2LFSA 1FXHA 3U0ZA 3AG7A 5BZBA 4X9QA 3P32A 1NJIW 3UI6A 2WLYA 4B3SO 1WNOA 2ZCEA 2QWNB 1NH2B 1M90W 1H2GA 2CAZC 3FAVA 3JYMA 3CCUV 5HTGA 1FKBA 4LFAB 1PV0A 4FLWA 1FAPA 4W9PA 4NTWA 3AS2A 3UT5A 4CS3A 1Z2GA 2YXYA 2ZM6B 4RQEA 5BXJA 4IIJA 2DG4A 3ARZA 1N0JA 2XP3A 3KCYA 2XP7A 4A5UB 3WKZA 4Z2LA 2F4EA 1S72V 2ODMA 1WN7A 2Y69C 5J2TB 4JI1O 3O5JA 1MZFA 1PL4A 4X1KB 4L3NA 2VS0A 3ODKA 5FNVA 2QEXV 1Y74B 3OD4A 4GKJB 3CJHB 3HKEA 3B2EE 3WD4A 2ZR3A 1FKFA 1EN5A 3QO7A 1W1TA 3UM7A 1SC5B 3ICXA 2LFRA 1JNTA 3G71V 4LAYA 1AROP 4LP8A 1ROUA 5KUMA 2RJZA 5GPGA 3TCZA 3TJTA 2RNBA 3STLC 2DQ0A 3SPIA 3O5DA 1PKXA 5IYZB 4NB5A 4RUEA 2IW5A 2YIAA 3E8HA 3PJSK 4X1IB 1NBMG 4MNMA 1W1VA 4IHJA 1GM9A 1ZU8A 2M2AA 1AI7A 4BR6A 2Z0AA 1X59A 1VQLV 4BW9A 1WA8A 1LL4A 1NSGA 4S3KA 1H0GA 2AHZA 3D8CA 4B3RB 2K1EA 2RSEA 3WD3A 2E5LB 1IXMA 1K8AW 1DK1A 1HNZO 3B9DA 5LXTA 2W0XA 2VWJA 1QPLA 2N87A 4JASA 3KADA 1N32O 2AWGA 3RYHB 2WLKA 3BHPA 2NNUA 4ZHQB 3OR7C 2X6AA 3SYAA 5JQGA 3E35A 3O5IA 4NVPA 4W4LA 3AG1B 3CRMA 1X4TA 1Q5OA 4ODRA 4UCSA 5BMVB 1ROTA 4WBNA 1R73A 3RBZA 2FB5A 3QVNA 3ZIAG 2KGJA 2F23A 5A9GA 1I08A 5GW7A 1GAXA 1XREA 1OCZB 1HXVA 2ZE7A 4LNUB 4LAWA 3MD0A 4YIOA 4DR2O 3NTPA 1KYOF 4GGQA 4JI8B 3JATB 4YJ3A 1F8AB 1IXBA 3O5EA 3H1IH 3ZN1A 4LF7O 3THOA 2JEXA 2QF8A 1FFQA 2WLLB 2A3CA 2Q4PA 1SQGA 1A32A 1XEQA 2LW1A 1FFXA 1RD6A 1YITV 4KL1A 1VQKV 1AI6A 2KQXA 3ABKB 3WD1A 4ZBMA 1VEWA 2EJ7A 3HKCA 1E6ZA 2AXTZ 1JNEA 3ETQA 2DSVA 2XHBA 3RYIB 3KACA 1JQ0A 4E2LA 3NRKA 1QBZA 4GT1A 2AGAA 1W2BU 1ZBWA 3JCUZ 2HVKC 4BF8A 2H3OA 2QM4A 4K0KO 3EXAA 4DUZO 1WLEA 5DO2A 3LUOA 5DIUA 1J4RA 4HNAA 4MT8A 3GWKC 5IJ9B 1O9HA 2F4VO 1EQ3A 1BGYH 4Z2JA 2UUCB 1NWRA 3C3TA 1NWUA 4WKHA 2H94A 5L3CA 5B3SC 1TFVA 1FKIA 2ZR4A 1XL4A 1YF2A 1N34O 5B66Z 3BPZA 2DWDC 4U3JB 4QJFB 3ZMTA 2Q7EA 3FB8C 1GO3F 2E3CA 3SPGA 2KSDA 3FXYA 2GUZA 3ETEA 4Z1VA 4KHPO 4YJ2A 1J4IA 1TVKA 2QM7A 4DT4A 5KMGA 2XP4A 2CH7A 1XILA 5FLXN 2XASA 4X64O 5BXZA 1AJNA 2E75B 5LBQA 4QGPA 2Y69B 5JJNB 2WA3A 3UT5B 1H2KA 3W7SA 2B5UA 2F93B 4IIJB 5FL7G 2PV2A 2XP6A 3J80N 4FLTA 4PDVA 2CE4A 1SKVA 4PTMA 1AR5A 1PP9H 4XDKA 1U97A 5LYJB 1SQBH 5HW7A 3DTUB 2FKEA 2HR3A 1VQMV 2PYLA 1Y0OA 4WKAA 2YXHA 4PELA 2HJDA 3MDYB 3HKEB 2N74A 2ZQMA 3CH9A 2WWWA 3CMAV 2VQFO 1EDQA 1EFRG 2ZQSA 2A3QA 5LHGA 1NH2D 2BSKA 1F7YA 2JIZG 5BR8B 1R3JC 5IWAO 2JJ2G 1KT0A 2Z3YA 4W9OA 1EHNA 1R3IC 1B6CA 3KAIA 4LCUC 3SJQC 4DV1B 2XNDG 3CHDA 5FPRA 4CC5A 2GTSA 3ZCCA 2B9ZA 2R72A 3LDCA 1Y76B 2QWOB 4W5UA 3FYEB 1WA8B 3SYPA 1KUQA 1LL7A 3ZRWA 3O9OA 1SF9A 2Q9LA 1XMQB 1C9HA 2FL4A 2WLMA 5KAIZ 3ZHTA 4TX0A 4TW7A 2ZIMA 5LXTB 1XUQA 3FB7C 4DR6B 1SR0A 4LH7A 2W6JG 3Q4HA 1FKGA 4J9ZB 4BIUA 5JQGB 2ESCA 2XP8A 1XHZA 3HKBA 3GU0A 2YIBA 1AJQA 3S3XA 1VF8A 2A0LA 2PGGA 4WBNB 2Q68A 4JF3A 3OEEG 3L75H 1O6IA 4TYOA 4B3MO 1KB9F 4KR0B 3RMEA 1H2LA 4O2AA 2OTLV 3CHEA 1ZBCA 1ZAUA 2DG9A 3NXSA 3JALB 3AS1A 1HJWA 5B5EZ 2PPOA 3B7XA 1HNWB 4DV6B 3SPHA 1E1QG 2D9FA 4FLZA 5DEZA 4H33A 3RYCB 3AK1A 1Q6HA 1YJNV 4X66O 3CMEV 4ZPWR 4G2KA 1YCIA 1VMGA 3H1HH 3B9EA 4UFZA 4IQCA 4J9YB 5JH7B 1F4NA 3EHBB 1FXKC 1KQSU 4ABMA 4PA6A 3CRRA 2YS8A 2A7WA 1KC8W 5LGNA 4UB6Z 5CBHA 5J2TA 3AK3A 2JEUA 4EB6B 4B7KA 3UO3A 4X1KA 5B1BB 5CA0B 5B3SB 1F40A 5LHHA 2QWQB 1ROPA 4IT6A 3RN4A 2Y78A 1UPGA 3WB0A 4LH6A 1BHAA 1YDXA 3U11A 4ZI7A 4DR5B 1DTOA 1EN4A 3ABTA 4O4IA 3E83A 1KP2A 4JI4B 1WP8A 3OOBA 1BS3A 2AHYA 2IUZA 3W7WA 4F4LA 1VF6A 4TUYB 2XP5A 3H1KH 3FFQA 5IYZA 4JI2B 3CRAA 4WCEV 4X1IA 1IX9A 1V9PA 1FYJA 1FS0G 1YJWV 2DMXA 1YW5A 3K5OA 4ODLA 2GUZB 3OT7A 4LF4O 4UXNA 4G28B 3VBBA 2F21A 4LF9B 4YJ2B 2DYRC 5DN6G 2M6YA 2FAPA 4ZPTR 1FKHA 5KMGB 4JTAB 1VF6C 2CH7B 2ZXWC 1YHQV 2YEVA 2MW2B 2UXCB 3B77A 3G6LA 2IJHA 4Z2KA 1Y4MA 4QT2A 3ZMSA 1MG1A 3X2QC 3OEHG 5K1XA 5B1OA 1QU7A 1RPRA 2P4KA 1I94O 3LNNA 4P9OA 3SYCA 5H2FZ 4O4HA 5IDJA 2YBTA 4JFJA 1EZJA 5BMVA 4LF5B 3K3WA 3T1YB 4GX1A 4P8VA 4UCUA 3M99B 4N19A 2RMKB 2ZE5A 4DH0A 1QNMA 1Z5VA 1E6NA 1GN4A 5DITA 2IBZH 2Q7HA 4PDMA 4NXNB 2OFNA 3OMIB 1L0NH 3FB5C 3QOKA 3K08A 1PL0A 4YXWG 3AG1C 3JATA 5DF0A 4RWUA 1L1PA 3DXRA 1G6UA 2O92A 4IYHA 3SGIA 3T2MA 4R8CA 1GM8A 2WLLA 4JFMA 5ITZA 3DC5A 2X6CA 2AOSA 2UUBO 3D3QA 2DT2A 3KKYA 2EBOA 4Z1MG 4DR1O 4YIPA 1MSWD 1J5EO 3JARA 5HW8A 1CTNA 3CC7V 1H8EG 1IBLB 2X0LA 3B40A 1XQ8A 1FKAO 5IE9A 2Q8VA 1AB3A 3KG2A 2YUAA 2VRZA 2RUCA 5H6QA 1CXZB 3ZRWB 1BQ0A 2RURA 4MW8A 4Q22A 3BRCA 5BR8O 3RM4A 3CRQA 2JZVA 5LHIA 4DUYO 2OLHA 1K5SA 4DV0B 1ZBVA 1QZ2A 2UXXA 3CHCA 3Q4HB 2LGQA 2CTQA 4CH5A 5F2VO 4DR7B 3O5QA 3J81N 2OYQA 1SQXH 1XOUA 3GTYX 1UJWB 3DSQA 5IJ9A 3K5MA 2A79B 3HKBB 4B3TO 3HR0A 2MLYA 2XT9A 3ARXA 2EZOA 4LF8O 3I6CA 2CTPA 4JYAO 2EX3A 1K73W 4NXMB 4CS2A 3OA5A 4P8XA 2JGUA 1OJHA 2ZQVA 3JD2A 4GYCB 1K92A 1QR9A 4U3JA 4P2ZA 2EIKC 1K3EA 1SESA 1D6OA 1XNRB 4X89A 1Q3EA 3MHSC 1IVSA 4PA3A 4JV5B 3L73H 4O2AB 3T1CA 2L35A 1Q86W 1Q1CA 1AILA 4DXWA 2PBCA 5LMNB 3E22A 1MZEA 3BFRA 3ARSA 4C7UA 1FXKB 1XMOB 3D3IA 1GN6A 4JYSA 1S5LZ 4U7OA 3ZRVA 3KAFA 1K5QA 1VQ6V 4MGVA 4Q20A 1HNXO 5E79Z 3CCMV 1HWYA 5KHGA 4G50A 5HW6A 4JPRA 4OPAA 1IBKO 4JYBA 4GKKO 4JI3O 2NN4A 1YZBA 1U79A 4MNKA 3E89A 4ODKA 1RFYA 4J11A 4X20B 1BCCH 1S76D 5EBLC 4JI6B 3UO2A 5LYJA 3ZRXA 4FJCC 4I50B 4N23A 5IJ0A 3QO8A 4FLYA 1SERA 4AI8A 2HFEC 3OTOB 1MNGA 1OGGA 1B06A 4R6ZA 2WAMA 4HBEA 3VOUA 2Y0PA 3NI6A 2X6BA 3WG7C 1MOFA 1NWTA 2ZD9A 4PA7A 4YHHB 4CS4A 1KKCA 4ZI7B 4TSFG 3W7XA 3VQWA 4DZ3A 4O4IB 3RGBA 5J2UB 5DIVA 2DYRB 2LJ4A 3ARPA 1FKSA 5I98A 1COWG 2ZXWB 3ABUA 2P67A 1LNQA 3G4SV 4Q6GA 2QKAA 4DR4B 5JH8A 1J6YA 4FPPA 1K9TA 3X2QB 2HVJC 5EC2C 4OX9O 1Y76A 4KFMA 2IH1C 2MNTA 1WB8A 3OGIB 4LGXA 3IKDA 1PNKA 4D7TA 4IT5A 3JD1A 2PI4A 1R1BA 2UXNA 4FFBB 2YEVB 2FTKA 4I5SA 2UU9B 1BKFA 1LR1A 1D7HA 1P4RA 1SQQH 4QE9A 2UUAO 4O4HB 3O5KA 1HKMA 5A2QN 4WIWA 5CA3A 4DR3O 1JJ2U 2AW9A 2KI3A 5TISZ 1VF5B 3LDDA 4DV4O 4ML4A 4CH6A 2DWEC 3C90A 2W0FC 1B3QA 2RN9A 2X7RB 1GMGA 2DQ3A 2HHHO 2CGNA 3N2GA 2UXDB 3LSUA 4FN2A 3BMBA 1SQFA 3SR2C 4D6TH 3LNMB 3APOA 4H13B 1K9MW 4DRIA 3RT3C 4U85A 3K59A 3JALA 4WFHA 3AEIA 2ZQTA 3B8MA 2GHYA 3DXRB 3RFRA 1N33B 1P5QA 1TAEA 5LOVB 3CP1A 2LQTA 3E8GA 5ITZB 1FJGB 2DSUA 1R3LC 5IT9N 1W9PA 3IJ4A 3IHZA 3H9RB 3RYCA 3ALGA 1T5EA 3IKGA 2RQ6A 1S5JA 2ITCC 2B1GA 2NR5A 5IYCO 1FKTA 1ZK6A 3O5OA 1YIJV 4NYKA 3JARB 2JS3A 5JH7A 4J7KA 1N0NA 4GUNA 4FFKA 2GSMB 3FYIB 1MMMA 1OGBA 1GN3A 2ETNA 4DV7B 4EB6A 2QA4V 2VN1A 4FM0A 1QR8A 3RFWA 3AG3C 5CA0A 4TW6A 4GCZA 2VCDA 3BXWA 1GOIA 3B09A 2FYUH 2H8PC 2WLJA 1P84F 2EIMC 2EIKB 2LPVA 3TC5A 3BVOA 2JVDA 1MA1A 1BT8A 4LWSB 4ASUG 4KP4A 3SJBC 1SA0A 4PA4A 1NI8A 4TQFA 5GTIZ 4AQYB 4K3AA 2LGOA 3RGCA 2EULA 3CS5A 5DM6V 4BIOA 5LP6A 2PI5A 1Q7YW 2Q7GA 4TUYA 1JJOA 5B1BC 4DZ2A 3JYCA 4F6RA 4JZGA 2QR4A 5EYPB 1O9GA 3QTCA 1QLEC 1KMIZ 2QE7G 1YXBA 3G67A 5LA6B 3RYFA 4AHCA 4X65B 3WIJA 1XNQO 1YTFB 4O2TA 5CA1A 4BW5A 2ARHA 2DJVA 1CPYA 4DV2B 4DV5B 2PZSA 3KCXA 3E22B 3GB7C 4U84A 1Y66A 1IBMO 5LP6C 3O5MA 4LAXA 1N36B 1CP9A 2D3OW 2O9OA 3JXVA 2R9IA 2RUDA 2UXBO 3PRDA 3APQA 4JI5O 5C8YA 4O2BB 1W0KG 3ARRA 1WPXA 3QF7A 4JAAA 2M08A 1GPFA 2PTMA 1D7JA 3CB2A 3O5FA 2IM9A 4U86A 3WG7B 1R6KA 2LW7A 4UVCA 5GQBA 2HJFC 1JX9A 4DRHA 2YIBD 3CHFA 4ZOLB 3AROA 3A0BZ 1HKJA 3PRAA 2GV9A 4LFAO 5LGTA 5IJ0B 4UUJC 1PPJH 2CTRA 3ZEDA 3ARWA 3C3SA 1M9NA 1D5AA 4LFCB 3KABA 1XI1A 2HG5C 4LBEC 4MW3A 4E4EA 4YY3B 4JI0B 1H8HG 3B9AA 3G6BA 2ZM6O 1G1XB 3L74H 4DYLA 3AG4C 1VQ9V 2YSUB 3ZX6A 3SDLA 3N2KB 2QDOA 4I55A 4ZPVR 4MAVA 4ICGA 4R5EA 3CE2A 1ENVA 5J9PC 1FKLA 5AG2A 2YI8A 3J7AU 2ZINA 5KHIA 2XAHA 4QIWF 1FD9A 2YC0A 5KX5A 4GKJO 1NQTA 4DV3B 1OCOC 2VQEB 2IU3A 4JYCA 2HKOA 5IYBO 1URFA 2ZNJA 3WB2A 1NVPB 4NKGB 3UCSC 2P5OA 3OUFA 3K9AA 4H37A 1EBOA 3ZHVA 2Q5AA 2XAJA 1DF5A 3JASA 4HAMA 5EZYA 4DWSD 4L87A 2Y4UA 3AS0A 3TGUH 3ARTA 3UQAA 4Z2WA 2ZT9B 2CDYA 4IGGA 2LGWA 2OIEA 4MVZA 2PUSA 2IH3C 3ZRSA 1DF4A 1QCEA 1GRJA 1ZWIC 2KO7A 3SYQA 4JI7B 3STZC 1J95A 1F4MA 1NTMH 2KE0A 1Q82W 1HDJA 4DROA 2IJJA 2P06A 3SYOA 4B3RO 3UQ8A 4R0XA 2LJ2A 1UR8A 2KG7B 2MLZA 4WFEA 3KZIZ 2R9AA 5EIBD 2E5LO 1SZXA 2MF9A 3RVZA 3CC2V 3N2GB 4J41A 1OWQA 4B3SB 5HFMA 1XBLA 4UCTA 1LJYA 1TGOA 1XL6A 3LDEA 5KLVH 2JK5C 2PF4E 2A3EA 1FXKA 3IFXA 4K8XA 4DW0A 1DLBA 3UKMA 1L8DA 1YATA 3DGEA 5KUKA 1XHXA 1Q8IA 1N1AA 2Z5UA 1D2DA 1LG2A 3AG2C 4NSBA 3JD0A 3AG3B 1SQVH 4JFKA 1RM1C 1SS3A 3H01A 4P8UA 4HZ3A 4K35A 2EIMB 1LUVA 4X20A 4NR1A 4LAVA 4JI8O 1JFFA 5KHHA 5LMUB 3ETGA 4QT3A 4JI1B 1VQPV 1U96A 4Z2HA 4I50A 1AR4A 3CX5F 1P7BA 1SYTA 3CZ8A 2DT0A 3OTFA 3VQYA 4DWSA 3CXCU 5D5QA 4FZ1A 2MPHA 2WLHA 4HYOA 2LO1A 1QLEB 3G6EV 2G8ZA 2Q0AA 3VQVA 5L3GA 4JGSA 1SA0B 1E6PA 1GM7A 4NTYA 5J2UA 1QVGU 3VAWA 3P30A 2A3BA 5LP6B 5BY1A 4DWSC 4DRQA 3I56V 1LG1A 2QKSA 4F6RB 4EFEA 1AI5A 1E9LA 2DSZA 2ADQB 2MLXA 3B8SA 4FIPC 2XTAA 3I55V 2VWKA 5H9CA 1VARA 3RYFB 4JFLA 5CA1B 2FKXA 1FJDA 3TCUA 4JFIA 2IJIA 1KBHA 1HNZB 4R50A 3CCQV 1KT1A 3WD2A 1ITXA 4NTXA 4CH4A 1UFIA 3ETDA 3UF8A 4WFAV 2UUCO 3CSXA 4FFBA 3ALFA 1N32B 1GTOA 5EIBC 3WQVA 4S3JA 1VP7A 1ZUQA 3FX7A 3K04A 5C8YB 1OV9A 4X1YB 3JSNA 1MSDA 3LUTB 4XDJA 3ARYA 4JTDB 3O65A 2YIDA 3ABLC 4TT3G
chains in the Genus database with same CATH topology
3KACA 4P8WA 1R9HA 3NRKA 4MTVA 5HWBA 4DRNA 3ARUA 4URIA 1ZBWA 4BF8A 1W1YA 4MNLA 1OGGA 4HBEA 3NI6A 5DO2A 3LUOA 5DIUA 1J4RA 1NWTA 2XPBA 3WD0A 1UR9A 1EQ3A 4DZ3A 4Z2JA 2ITKA 1X6LA 5DIVA 1NWRA 3CGMA 2XP9A 2LJ4A 1FKKA 1NWUA 1FKSA 3ARPA 5I98A 4WKHA 2WK2A 1PINA 1TFVA 1FKIA 2ZR4A 2WLZA 2WM0A 3PRBA 3UI5A 1LQ0A 4DRJA 5JH8A 1FFRA 1J6YA 1K9TA 2F2DA 3FXYA 2A3AA 2MNTA 2PPPA 1J4IA 2KR7A 4LGXA 3IKDA 4DT4A 2XP4A 1PBKA 2B31A 3FY1A 1E15A 4QZVB 4TW8A 2M1IA 2RUQA 1NMWA 3RM9A 1BKFA 1D7HA 4ODPA 1EIBA 2LKNA 2IF4A 2PV2A 2XP6A 3O5KA 1HKMA 1Q6IA 4WIWA 4XAKA 3IK8A 5B8IC 4DIPA 4PTMA 2KI3A 4J4NA 3WL1A 3ARQA 1HKKA 4ML4A 3EY6A 5HW7A 2FKEA 1W9UA 1HKIA 1Y0OA 3CGNA 1ZL1A 4FN2A 4WKAA 3MDYB 4HARA 3ARVA 3CH9A 1H0IA 4DRIA 5HKGA 2L2SA 1EDQA 1W1PA 2ZQSA 4U85A 5HWCA 2G41A 2ZQTA 2DG3A 1P5QA 3O5RA 2DSUA 4Z2IA 1KT0A 1W9PA 4W9OA 1EHNA 1B6CA 1XRVA 2XPAA 3KAIA 3IHZA 3H9RB 3ALGA 3O5GA 3IKGA 3CHDA 1E6RA 1ZK6A 1LL6A 3O5OA 1FKTA 4Z2GA 5HBFA 3AQUA 4MPKA 2PV3A 4W5UA 4G2PA 1FKRA 1LL7A 3JYJA 1T11A 1C9HA 1OGBA 4DRMA 3O5LA 5GPRA 3AS3A 2ZQUA 2VN1A 4ODOA 3RFWA 4FAPA 4NNRA 4TX0A 4TW7A 4TW6A 2VCDA 3BXWA 4DWSB 3KCEA 1GOIA 3B09A 1SR0A 4J4OA 1FKGA 1ZB5A 2LPVA 2PI6A 4WK9A 3TC5A 2ESCA 2XP8A 5J6EA 2LGOA 3RGCA 1VF8A 5D75A 2DT3A 3KAGA 4ITZA 3UQBA 3O5PA 1A7XA 1IX5A 4TNSA 1ZCNA 4DZ2A 1O6IA 1JVWA 4TYOA 4KR0B 3RMEA 3CHEA 3G6MA 1ZBCA 3WIJA 2DG9A 4O2TA 3AS1A 4KQZA 1HJWA 2RQSA 4U84A 1JNSA 3GPKA 2PPOA 3B7XA 1JNDA 4W9QA 3O5MA 4LAXA 2D9FA 2O9OA 3JXVA 4ZS6A 2RUDA 5DEZA 4IPXA 3PRDA 2ZR6A 1Q6HA 4ZPWR 3TDBA 2DPEA 3B9EA 3ARRA 4IQCA 3UQIA 2M08A 1GPFA 3RM8A 1D7JA 3O5FA 4U86A 5GQBA 2UZ5A 4DRHA 3CHFA 3AROA 1X6NA 3WQWA 2ZR5A 1HKJA 3PRAA 4DRKA 3KZ7A 5HUAA 2KFWA 4MSPA 3W4RA 2YBUA 3ARWA 4ODMA 1F40A 1D7IA 4ODNA 4Q7NA 3KABA 4IT6A 2DSWA 2PV1A 4IQ2A 2Y78A 2FDMA 3B9AA 1GUVA 1W9VA 4C02B 1XHGA 3OOBA 2IUZA 1KFWA 4MNJA 1HJVA 4ZPVR 4MAVA 4WJXA 4R5EA 1EYMA 1FKLA 2XP5A 1FD9A 1YW5A 3UI6A 2WLYA 4ODLA 1WNOA 2F21A 3JYMA 2FAPA 4ZPTR 1FKBA 1FKHA 5HTGA 1W26A 2Q5AA 1FAPA 4W9PA 1J4HA 4DWSD 3AS2A 3G6LA 4Z2KA 4AY1A 3AS0A 3ARTA 4QT2A 3UQAA 3KAHA 4WKFA 1TCOC 5BXJA 3WH0A 2DG4A 3ARZA 4QIBA 2KO7A 2XP3A 3PR9A 2YBTA 2XP7A 3WKZA 4JFJA 4Z2LA 2KE0A 2F4EA 4DROA 1NH6A 4P8VA 4N19A 4R0XA 4DH0A 3O5JA 1UR8A 1E6NA 2MLZA 4L3NA 1HJXA 2MF9A 3ODKA 5DITA 1NMVA 2OFNA 1M5YA 4DRPA 1OWQA 3WD4A 3QOKA 1LJYA 1FKFA 1W1TA 5DF0A 1Q6UA 1JNTA 2O92A 1D2KA 4LAYA 1L1PA 1ROUA 1QPFA 2A3EA 4JFMA 3UI4A 5GPGA 3TCZA 1YATA 2AOSA 1N1AA 3O5DA 1LG2A 2DT2A 4NSBA 4MNMA 1W1VA 4JFKA 1ZU8A 1FKDA 2M2AA 5HW8A 1CTNA 4P8UA 1LL4A 1NSGA 4LAVA 4S3KA 1H0GA 4Q22A 2RUCA 4QT3A 2RURA 4ODQA 3RM4A 4Z2HA 2JZVA 2RSEA 1SYTA 2PPNA 5HT1A 3CZ8A 3WD3A 2DT0A 3B9DA 2OLHA 4DWSA 3PA7A 1QPLA 1ZBVA 2N87A 1QZ2A 3KADA 2MPHA 2AWGA 3CHCA 3O5QA 3FAPA 2G8ZA 3O5IA 4ODRA 4NZCA 1E6PA 1ROTA 2MLYA 3ARXA 3VAWA 3I6CA 1BL4A 2A3BA 4DWSC 3OA5A 4P8XA 4DRQA 2KGJA 2ZQVA 1LG1A 1E9LA 2DSZA 1HXVA 1D6OA 2MLXA 3B8SA 4LAWA 3NTPA 4GGQA 4L72B 1F8AB 4IT4A 3O5EA 1Q1CA 2PBCA 4JFLA 2DT1A 2QF8A 1FJDA 1FFQA 2A3CA 3ARSA 4JFIA 1KT1A 1FKJA 4JYSA 3WD2A 1ITXA 3KAFA 3UF8A 4MGVA 1RD6A 3ALFA 3WL0A 3WQVA 1NWSA 4S3JA 1WB0A 4G50A 5HW6A 3WD1A 3ARYA 1U79A 1ZBKA 2K8IA 1E6ZA 1JNEA 4HBOA 4MNKA 4ODKA 4GIVA 1WAWA 2DSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAC A;  2UZ5 A;  1R9H A;  1ROU A;  1QPF A;  2DG3 A;  3UI4 A;  4JFM A;  4DRH A;  3NRK A;  1P5Q A;  5GPG A;  5HWB A;  3O5R A;  2ZR5 A;  3TCZ A;  4DRK A;  3KZ7 A;  1YAT A;  4DRN A;  1KT0 A;  4W9O A;  5HUA A;  2KFW A;  1B6C A;  2XPA A;  3KAI A;  4MSP A;  1N1A A;  3IHZ A;  3O5D A;  3H9R B;  4BF8 A;  3O5G A;  3IKG A;  4ODM A;  1F40 A;  1D7I A;  4ODN A;  3KAB A;  1ZK6 A;  3O5O A;  4JFK A;  1FKT A;  2PV1 A;  1FKD A;  2M2A A;  3NI6 A;  5HW8 A;  4IQ2 A;  2Y78 A;  3LUO A;  1J4R A;  5DIU A;  2XPB A;  2PV3 A;  1NSG A;  4G2P A;  4LAV A;  1FKR A;  2RUC A;  4QT3 A;  2RUR A;  4ODQ A;  4C02 B;  1EQ3 A;  4DZ3 A;  1L1P A;  3JYJ A;  3OOB A;  2ITK A;  1T11 A;  1C9H A;  2JZV A;  4DRM A;  5DIV A;  3CGM A;  2XP9 A;  2LJ4 A;  1FKK A;  3O5L A;  1FKS A;  2RSE A;  1EYM A;  2PPN A;  5HT1 A;  5I98 A;  2ZQU A;  2VN1 A;  1FKL A;  1PIN A;  4ODO A;  2XP5 A;  3RFW A;  4FAP A;  1FKI A;  2ZR4 A;  3PA7 A;  4NNR A;  4TW7 A;  4TX0 A;  3PRB A;  2VCD A;  1QPL A;  4TW6 A;  3KCE A;  3UI5 A;  2N87 A;  1QZ2 A;  3KAD A;  1FD9 A;  3B09 A;  4DRJ A;  2MPH A;  4J4O A;  2AWG A;  1FKG A;  1J6Y A;  2F2D A;  2LPV A;  3O5Q A;  3TC5 A;  1YW5 A;  3UI6 A;  3FAP A;  3O5I A;  4ODL A;  2XP8 A;  2MNT A;  2PPP A;  1J4I A;  2KR7 A;  2F21 A;  3IKD A;  5J6E A;  4ODR A;  2LGO A;  3JYM A;  4DT4 A;  2XP4 A;  1PBK A;  2FAP A;  5HTG A;  1FKB A;  1FKH A;  1ROT A;  2MLY A;  3RGC A;  5D75 A;  3VAW A;  1W26 A;  2Q5A A;  3KAG A;  4ITZ A;  1FAP A;  3UQB A;  4TW8 A;  3I6C A;  3O5P A;  4W9P A;  1BL4 A;  1A7X A;  1J4H A;  2M1I A;  4TNS A;  4DRQ A;  2KGJ A;  1ZCN A;  2ZQV A;  4DZ2 A;  2RUQ A;  1NMW A;  4QT2 A;  3UQA A;  3KAH A;  1JVW A;  4TYO A;  4LAY A;  1HXV A;  1D6O A;  1TCO C;  1BKF A;  1D7H A;  4ODP A;  5BXJ A;  3WH0 A;  2DG4 A;  2MLX A;  4LAW A;  2LKN A;  2IF4 A;  3NTP A;  4GGQ A;  2PV2 A;  4QIB A;  2KO7 A;  1F8A B;  2XP3 A;  2XP6 A;  2DG9 A;  3O5E A;  3O5K A;  2XP7 A;  1Q1C A;  4O2T A;  1Q6I A;  2PBC A;  4JFL A;  3IK8 A;  4JFJ A;  5B8I C;  2KE0 A;  2F4E A;  4DRO A;  2RQS A;  1FJD A;  4JFI A;  4U84 A;  4DIP A;  2KI3 A;  1JNS A;  3GPK A;  4J4N A;  2PPO A;  3B7X A;  4W9Q A;  1KT1 A;  1FKJ A;  3O5M A;  4JYS A;  4N19 A;  4LAX A;  2D9F A;  3EY6 A;  3JXV A;  3KAF A;  4R0X A;  3O5J A;  4DH0 A;  2RUD A;  3UF8 A;  4IPX A;  3PRD A;  2ZR6 A;  4MGV A;  2FKE A;  1Y0O A;  2MLZ A;  3CGN A;  1Q6H A;  2MF9 A;  3ODK A;  5HW7 A;  5DIT A;  1NMV A;  2OFN A;  4FN2 A;  1M5Y A;  4DRP A;  3TDB A;  4G50 A;  5HW6 A;  3MDY B;  4IQC A;  1FKF A;  1U79 A;  3UQI A;  2K8I A;  2M08 A;  4DRI A;  5HKG A;  1D7J A;  2L2S A;  4U85 A;  2ZQS A;  3O5F A;  4ODK A;  1Q6U A;  4U86 A;  5HWC A;  4GIV A;  1JNT A;  2ZQT A; 
#chains in the Genus database with same CATH topology
 3HKD B;  1EN6 A;  4P8W A;  4MTV A;  3AG4 B;  3ARU A;  4URI A;  3TK1 A;  1VF7 A;  2P7T C;  3K06 A;  3ZMU A;  2EIL C;  3CCJ V;  4PI0 A;  1NTK H;  3IC9 A;  3OR6 C;  2P90 A;  5EBM C;  1W59 A;  4LF7 B;  3E8F A;  4XDL A;  1YTF D;  2OWO A;  2F66 C;  4ZKI A;  1OCO B;  4GX2 A;  3A8T A;  3WD0 A;  1UR9 A;  5LOV A;  5B1A C;  1AP6 A;  2ITK A;  1F23 A;  2ZKO A;  4QE7 A;  3K58 A;  3CGM A;  2XP9 A;  4I55 B;  2WK2 A;  1NTZ H;  1PIN A;  1K4D C;  1FAF A;  3UI5 A;  1I5Y A;  1ZSP A;  1LQ0 A;  2QSA A;  4PHZ A;  5KX5 B;  4PD4 F;  2HLD G;  4UCR A;  5KHJ A;  1OHH G;  4PDL A;  2D2C B;  2PPP A;  2KR7 A;  2QM8 A;  4D7S A;  1BHB A;  2WA4 A;  1PBK A;  2B31 A;  4GZR B;  3G80 A;  2BTQ B;  4RQF A;  3QNE A;  3RW0 A;  1WJZ A;  1E15 A;  3K5L A;  4TW8 A;  2YXL A;  1PNL A;  3I5D A;  2M1I A;  3JAS B;  2V4D A;  4DUZ B;  5EZY B;  1NMW A;  4EEQ A;  1M4U A;  3CCE V;  2NLJ C;  4DV1 O;  3SPJ A;  2ZIO A;  5JWP A;  3ZHU A;  4PV1 B;  4TV9 B;  3SJA C;  4FM2 A;  2F4V B;  2BOC C;  4LWS A;  4UVA A;  4G27 B;  1M57 C;  1DGS A;  1Q6I A;  1KU9 A;  2C2A A;  2YIC A;  1I7F A;  4DIP A;  4FM1 A;  4J4N A;  3WL1 A;  2HEP A;  1HKK A;  3ARQ A;  1N34 B;  3EY6 A;  2CUG A;  3CEI A;  1XMQ O;  3JD4 A;  5L3B A;  1W9U A;  1HKI A;  5EYP A;  3L9D A;  4MTF A;  1QVF U;  1US6 A;  3AG2 B;  5KHK A;  2LP7 A;  4KHP B;  2BE3 A;  4DR6 O;  4HAR A;  3ARV A;  5HKG A;  1RM1 B;  5LA6 A;  2B1I A;  1ZTE A;  1W1P A;  1H2S B;  1TUB A;  4RUF A;  5EC1 C;  1NVP D;  2PN0 A;  4X64 B;  1AR1 B;  1BMF G;  1VIB A;  3O5R A;  2KKW A;  2ILM A;  3WFV A;  3ML0 A;  2XPA A;  3O5G A;  1WAZ A;  2QWR B;  1FPO A;  2O57 A;  4TV8 A;  4O2B A;  1LL6 A;  4Z2G A;  5HBF A;  3AQU A;  1K4C C;  5JCO A;  3JCZ A;  2P22 C;  1M5I A;  2ITD C;  4XBF A;  2PV3 A;  3BAB A;  4MS2 A;  3A0R A;  4B7E A;  1FKR A;  1H38 A;  1JFF B;  4ZOL A;  3JAW A;  3JYJ A;  4LFB B;  1T11 A;  1NZ6 A;  2Q5Z A;  3ZHS A;  4B08 A;  2M7W A;  4JAV A;  3AS3 A;  4ODO A;  1HNW O;  4DV6 O;  4NNR A;  2WLI A;  3K0G A;  2PY5 A;  3KCE A;  4DWS B;  4QNH B;  4CH3 A;  2VQF B;  5CMU A;  4UVB A;  2XOK G;  3S3W A;  5JCO C;  1OCR B;  3TET A;  2PI6 A;  3ZJZ A;  1Q43 A;  4RO2 A;  4O4J A;  5IWA B;  1AI4 A;  5J6E A;  5IY5 C;  3E8B A;  4MVM A;  3N2K A;  3SPC A;  5LMU O;  3KAG A;  4H44 B;  3UQB A;  1V54 C;  4DW1 A;  2QKC A;  5K1P A;  4MTX A;  4DO2 A;  4CBC A;  4TNS A;  1IX5 A;  1P49 A;  2DOS A;  4FMT A;  1JVW A;  3JAK A;  1I0H A;  1RPO A;  3MDS A;  3L71 H;  2OCC B;  2MK3 A;  3OW2 U;  3OFN G;  4BIZ A;  3ABL B;  3DC6 A;  4W4K A;  4DR5 O;  1KD1 W;  3GPK A;  1JNS A;  4DK0 A;  3CCV V;  2F95 B;  4W9Q A;  4JI4 O;  4ZS6 A;  3F7V C;  2ZR6 A;  1AJP A;  3W7T A;  3K57 A;  1WNS A;  3MAQ A;  3ASN C;  2EIL B;  4JI2 O;  1PD3 A;  2E76 B;  3UQI A;  3QG5 A;  1VQ5 V;  4I9W A;  1B6Q A;  2PYJ A;  2UZ5 A;  3JD3 A;  4OPH A;  4FLV A;  3WQW A;  4K8Z A;  3OM3 B;  2OT5 A;  4LF9 O;  2ZR5 A;  3KZ7 A;  4DRK A;  4UDM A;  5CB4 B;  5HUA A;  3IGA C;  5B1A B;  3ZHR A;  2KFW A;  2Q73 A;  4B3M B;  3W4R A;  1SZT A;  2KG7 A;  2OIG A;  3H9V A;  3L70 H;  3ZS8 C;  2YBU A;  3LSS A;  2L6L A;  2QTO A;  1Z5W A;  2UXC O;  2WLN A;  1K97 A;  4L8J A;  2DSW A;  2PV1 A;  3AK2 A;  1NT2 B;  4IQ2 A;  3M8A A;  2FDM A;  3K5N A;  1NKD A;  1GUV A;  4FLX A;  4JTC B;  3N27 A;  1W9V A;  1JCH B;  1TUE B;  1XHG A;  1YEW A;  4MNJ A;  4PA9 A;  4LF5 O;  1EYM A;  2OTJ V;  3T1Y O;  3CPW U;  4X66 B;  1PM9 A;  2AZ0 A;  2ZE8 A;  3OE7 G;  2ZNI A;  5JVD A;  1VQ7 V;  3L72 H;  4NXN O;  1L1F A;  3TXS A;  2K9P A;  4BAY A;  4O4L A;  1M57 B;  2XAF A;  2ZR2 A;  4KUM A;  3RVY A;  3BCC H;  3CYO A;  4J7Z A;  1W26 A;  2DYS C;  4I4T A;  3NR7 A;  1J4H A;  4QPJ A;  3T1H B;  1K34 A;  4FK5 C;  4IYI A;  4AY1 A;  1KP3 A;  1M1K W;  1BE3 H;  1GK9 A;  1W0J G;  4OGQ B;  2A06 H;  3KAH A;  4WKF A;  1QQC A;  1TCO C;  3WH0 A;  2JRI A;  1ZL8 B;  1LUW A;  2ZDI A;  1H2N A;  1IUR A;  1Y6X A;  3VQX A;  4QIB A;  2JGD A;  3PR9 A;  1EZV H;  3OMA B;  3QO5 A;  2V7Q G;  5H5N A;  1IBL O;  5CN0 A;  1D5N A;  3A0H Z;  2AZ2 A;  1FFT B;  1NH6 A;  1AVM A;  4MTG A;  1YVW A;  1B04 A;  2Q0O C;  1SRY A;  2CTW A;  3ASO C;  3IC7 A;  4TOI A;  1YSC A;  2EIN C;  5DED A;  3F5W C;  1HJX A;  4TQD A;  1NMV A;  1M5Y A;  4DRP A;  1BQZ A;  3LSQ A;  1K7D A;  5L3D A;  1NR7 A;  2ZDI C;  4DV0 O;  4EFB A;  1Q90 D;  2XAG A;  3D36 A;  3R66 A;  1NR1 A;  4I9Q A;  4LF4 B;  1CEZ A;  5CBF A;  1Q6U A;  1TUB B;  4DR7 O;  1D2K A;  3E2E A;  2Y0I A;  5KA5 A;  1QPF A;  3UI4 A;  2Q6A A;  3B4S A;  4JAU A;  1WPB A;  4FVM A;  2G38 A;  4WFG A;  2N04 A;  4X88 A;  2YI9 A;  1OCC C;  4NXM O;  1I94 B;  4DK1 A;  3GVM A;  4TV8 B;  3D36 C;  3CWB H;  1FKD A;  4X1Y A;  4WF9 V;  2HP8 A;  4LF6 B;  4UCO A;  1XNR O;  1IDS A;  4PDR A;  1JA8 A;  4JV5 O;  3IAY A;  3K0D A;  1I5X A;  3HKD A;  3FAV B;  4RAI A;  5L3F A;  4ODQ A;  4X62 B;  5LMN O;  5IY5 B;  3JAW B;  1NU1 H;  2PPN A;  5HT1 A;  3OMN B;  1XMO O;  4JYY A;  1V54 B;  3OGC C;  4I0X A;  3PA7 A;  2OCH A;  2WLI B;  3E86 A;  3M7M X;  2V1D A;  5H6R A;  1N4C A;  3FAP A;  2A9H A;  3BA9 A;  4O4J B;  4J7J A;  4NZC A;  2UUB B;  1JMK C;  5GON A;  4F6E A;  4CZZ A;  1QLN A;  4LFB O;  1E1R G;  1BL4 A;  1HR0 B;  4JI6 O;  4DR1 B;  2RDC A;  4GX0 A;  5KA6 A;  1J5E B;  5FNV B;  3A2F A;  3JAK B;  3OTO O;  3ASN B;  1S0V A;  4L72 B;  3H1J H;  4IT4 A;  1K33 A;  2GTA A;  2BOB C;  2DT1 A;  3BAA A;  3CCS V;  1S77 D;  5C93 A;  2BTQ A;  2GDS A;  3WU2 Z;  4YHH O;  3MHH C;  4DUY B;  1FKJ A;  3CRC A;  5EBW C;  1GH6 A;  3CCL V;  1KEC A;  1P7G A;  3WL0 A;  3BEH A;  1ZX3 A;  1HP8 A;  1NWS A;  4ZIB A;  1WB0 A;  4IHJ B;  3CD6 V;  3CHX A;  3FKS G;  3ZN0 A;  3U10 A;  4TV9 A;  1ZBK A;  2K8I A;  4DR4 O;  4HBO A;  2DE0 X;  4B3T B;  3OUS A;  4GIV A;  1WAW A;  4ITZ A;  5FPO A;  4LF8 B;  1R9H A;  1ZLZ A;  4JYA B;  4UB8 Z;  5HWB A;  1NS1 A;  5D5P A;  1M56 C;  4QPK A;  4DRN A;  1SET A;  3BA8 A;  1N8R W;  4UV8 A;  1W1Y A;  3FB6 C;  5DEC A;  4MNL A;  4I7Z B;  4P30 A;  3T4Z A;  4DRX A;  1RSO A;  1FXV A;  2UU9 O;  2XPB A;  4H0L B;  3W7U A;  3JAM N;  4P9P A;  2FML A;  1OZ0 A;  5L3E A;  1V55 C;  1X6L A;  1H2M A;  1FKK A;  1HNX B;  4TWK A;  2GBO A;  5KAF Z;  2DYS B;  1JPX A;  4MVS A;  4UCV A;  2WLZ A;  2WM0 A;  3PRB A;  1IBK B;  4GKK B;  4JI3 B;  4DRJ A;  5JVD B;  2EIJ C;  1FFR A;  1R6N A;  5IYD O;  2UXD O;  2CGO A;  2F2D A;  1VQN V;  1JVM A;  4N21 A;  4YJ3 B;  2A3A A;  3F5T A;  4U3F H;  2QJ1 A;  3ABM C;  4U7N A;  1AP5 A;  3EFF K;  3GWO A;  4O4L B;  3FY1 A;  3FD9 A;  1N33 O;  4QZV B;  4I4T B;  3F7Y C;  2XUM A;  4MTO A;  1FJG O;  1FFX B;  3JSL A;  2P4V A;  2JS5 A;  4LC1 A;  4CC6 A;  3ASO B;  2RUQ A;  2EIN B;  3PN1 A;  3RM9 A;  4MVQ A;  4ODP A;  1EIB A;  2LKN A;  2IF4 A;  3HB3 B;  2F43 G;  3HKC B;  2E74 B;  2EJR A;  3P3P A;  1JOY A;  2JGD B;  2JDI G;  1TA8 A;  4XAK A;  3IK8 A;  1KKD A;  5B8I C;  1QHT A;  1L0L H;  2Y4T A;  3K9S A;  5EK0 A;  3SJC C;  3R65 A;  2WSS G;  2IJK A;  1Y74 A;  3CGN A;  4DV7 O;  1ZL1 A;  3CJH A;  3T1H O;  4OX9 B;  1OCR C;  1OCC B;  4AIL C;  1H0I A;  4LR3 A;  1WB7 A;  2L2S A;  4UV9 A;  4PJ0 Z;  4HNA B;  5HWC A;  2G41 A;  1Q81 W;  4MVR A;  3ZMV A;  2DG3 A;  2QTS A;  4Z2I A;  4J42 A;  4AQY O;  3T4D A;  1XRV A;  1HW7 A;  1JR9 A;  2EZP A;  4J80 A;  1E6R A;  4FZ0 A;  4WFF A;  3K79 A;  2W6I G;  4BWA A;  1VQ8 V;  2UUA B;  3CC4 V;  4HBN A;  5E1A C;  4MVU A;  1M93 A;  2OCC C;  4MPK A;  4DR3 B;  1WP7 A;  1E79 G;  4MSW C;  2DW4 A;  3ZBH A;  4G2P A;  1TVK B;  4DV4 B;  4X65 O;  2BCC H;  3B8N A;  2IU0 A;  4DV2 O;  4DV5 O;  1R3K C;  4DRM A;  3O5L A;  1BL8 A;  5CB4 A;  5GPR A;  5JJJ B;  2HHH B;  3K03 A;  2ZQU A;  1PNM A;  4FAP A;  1N36 O;  2WPD G;  4I0X B;  1MAB G;  4DR2 B;  3RYH A;  4J4O A;  5HFL A;  2B5U B;  4ZHQ A;  1ZB5 A;  2RCV A;  5JJE B;  3CCR V;  4WK9 A;  1Y67 A;  2ATK C;  4EKW A;  4LF6 O;  2P6J A;  1YJ9 V;  2QGN A;  1JCH A;  5GON B;  5D75 A;  2DT3 A;  1THZ A;  4X62 O;  3O5P A;  1A7X A;  2XAQ A;  2DN9 A;  3ZHQ A;  1ZCN A;  5LL6 Y;  5GTH Z;  4R7C A;  2Q67 A;  4LNU A;  1BSM A;  4X8A A;  1RP3 B;  4LFC O;  4GLX A;  1VQO V;  3G6M A;  4JI0 O;  1YI2 V;  4YY3 O;  2BSK B;  1S3J A;  1IZ3 A;  3EVK A;  4KQZ A;  1G8M A;  2RQS A;  1JND A;  2QWP B;  2R70 A;  1M56 B;  4IPX A;  1G4Y B;  4JZ2 A;  4K0K B;  1OCZ C;  1HR0 O;  1SQP H;  2Y48 A;  1S5H C;  3RWR D;  4OXS A;  3TDB A;  2KB1 A;  2DPE A;  1ZL8 A;  3RM8 A;  4KXR A;  3BY6 A;  3OAA G;  3RYI A;  2F1M A;  4DV3 O;  2VQE O;  1E44 A;  3H1L H;  3HPL C;  2N05 A;  1X6N A;  3EIP A;  1ORQ C;  3ZMZ A;  2CK3 G;  1V55 B;  4WFB V;  4MSP A;  3P3N A;  4MVO A;  1GKF A;  3WB1 A;  4ODM A;  4PI2 A;  2BTO A;  3ABK C;  1XDC A;  1D7I A;  4ODN A;  4Q7N A;  5LGU A;  1VQ4 V;  1XNQ B;  1F51 A;  2R9R B;  1EM1 A;  2EIJ B;  4DRX B;  1RSO B;  1R6T A;  1GN2 A;  4IL6 Z;  2JJ1 G;  1IBM B;  5CBG A;  3CXH F;  4FLU A;  1BZK A;  2Q69 A;  4C02 B;  5B1N A;  4JI7 O;  2ADP A;  2UXB B;  1KFW A;  2ZE6 A;  3ABM B;  1HJV A;  3TXQ A;  4WJX A;  4GX5 A;  4JI5 B;  2YDE A;  4J10 A;  2LFS A;  1FXH A;  3U0Z A;  3AG7 A;  5BZB A;  4X9Q A;  3P32 A;  1NJI W;  3UI6 A;  2WLY A;  4B3S O;  1WNO A;  2ZCE A;  2QWN B;  1NH2 B;  1M90 W;  1H2G A;  2CAZ C;  3FAV A;  3JYM A;  3CCU V;  5HTG A;  1FKB A;  4LFA B;  1PV0 A;  4FLW A;  1FAP A;  4W9P A;  4NTW A;  3AS2 A;  3UT5 A;  4CS3 A;  1Z2G A;  2YXY A;  2ZM6 B;  4RQE A;  5BXJ A;  4IIJ A;  2DG4 A;  3ARZ A;  1N0J A;  2XP3 A;  3KCY A;  2XP7 A;  4A5U B;  3WKZ A;  4Z2L A;  2F4E A;  1S72 V;  2ODM A;  1WN7 A;  2Y69 C;  5J2T B;  4JI1 O;  3O5J A;  1MZF A;  1PL4 A;  4X1K B;  4L3N A;  2VS0 A;  3ODK A;  5FNV A;  2QEX V;  1Y74 B;  3OD4 A;  4GKJ B;  3CJH B;  3HKE A;  3B2E E;  3WD4 A;  2ZR3 A;  1FKF A;  1EN5 A;  3QO7 A;  1W1T A;  3UM7 A;  1SC5 B;  3ICX A;  2LFR A;  1JNT A;  3G71 V;  4LAY A;  1ARO P;  4LP8 A;  1ROU A;  5KUM A;  2RJZ A;  5GPG A;  3TCZ A;  3TJT A;  2RNB A;  3STL C;  2DQ0 A;  3SPI A;  3O5D A;  1PKX A;  5IYZ B;  4NB5 A;  4RUE A;  2IW5 A;  2YIA A;  3E8H A;  3PJS K;  4X1I B;  1NBM G;  4MNM A;  1W1V A;  4IHJ A;  1GM9 A;  1ZU8 A;  2M2A A;  1AI7 A;  4BR6 A;  2Z0A A;  1X59 A;  1VQL V;  4BW9 A;  1WA8 A;  1LL4 A;  1NSG A;  4S3K A;  1H0G A;  2AHZ A;  3D8C A;  4B3R B;  2K1E A;  2RSE A;  3WD3 A;  2E5L B;  1IXM A;  1K8A W;  1DK1 A;  1HNZ O;  3B9D A;  5LXT A;  2W0X A;  2VWJ A;  1QPL A;  2N87 A;  4JAS A;  3KAD A;  1N32 O;  2AWG A;  3RYH B;  2WLK A;  3BHP A;  2NNU A;  4ZHQ B;  3OR7 C;  2X6A A;  3SYA A;  5JQG A;  3E35 A;  3O5I A;  4NVP A;  4W4L A;  3AG1 B;  3CRM A;  1X4T A;  1Q5O A;  4ODR A;  4UCS A;  5BMV B;  1ROT A;  4WBN A;  1R73 A;  3RBZ A;  2FB5 A;  3QVN A;  3ZIA G;  2KGJ A;  2F23 A;  5A9G A;  1I08 A;  5GW7 A;  1GAX A;  1XRE A;  1OCZ B;  1HXV A;  2ZE7 A;  4LNU B;  4LAW A;  3MD0 A;  4YIO A;  4DR2 O;  3NTP A;  1KYO F;  4GGQ A;  4JI8 B;  3JAT B;  4YJ3 A;  1F8A B;  1IXB A;  3O5E A;  3H1I H;  3ZN1 A;  4LF7 O;  3THO A;  2JEX A;  2QF8 A;  1FFQ A;  2WLL B;  2A3C A;  2Q4P A;  1SQG A;  1A32 A;  1XEQ A;  2LW1 A;  1FFX A;  1RD6 A;  1YIT V;  4KL1 A;  1VQK V;  1AI6 A;  2KQX A;  3ABK B;  3WD1 A;  4ZBM A;  1VEW A;  2EJ7 A;  3HKC A;  1E6Z A;  2AXT Z;  1JNE A;  3ETQ A;  2DSV A;  2XHB A;  3RYI B;  3KAC A;  1JQ0 A;  4E2L A;  3NRK A;  1QBZ A;  4GT1 A;  2AGA A;  1W2B U;  1ZBW A;  3JCU Z;  2HVK C;  4BF8 A;  2H3O A;  2QM4 A;  4K0K O;  3EXA A;  4DUZ O;  1WLE A;  5DO2 A;  3LUO A;  5DIU A;  1J4R A;  4HNA A;  4MT8 A;  3GWK C;  5IJ9 B;  1O9H A;  2F4V O;  1EQ3 A;  1BGY H;  4Z2J A;  2UUC B;  1NWR A;  3C3T A;  1NWU A;  4WKH A;  2H94 A;  5L3C A;  5B3S C;  1TFV A;  1FKI A;  2ZR4 A;  1XL4 A;  1YF2 A;  1N34 O;  5B66 Z;  3BPZ A;  2DWD C;  4U3J B;  4QJF B;  3ZMT A;  2Q7E A;  3FB8 C;  1GO3 F;  2E3C A;  3SPG A;  2KSD A;  3FXY A;  2GUZ A;  3ETE A;  4Z1V A;  4KHP O;  4YJ2 A;  1J4I A;  1TVK A;  2QM7 A;  4DT4 A;  5KMG A;  2XP4 A;  2CH7 A;  1XIL A;  5FLX N;  2XAS A;  4X64 O;  5BXZ A;  1AJN A;  2E75 B;  5LBQ A;  4QGP A;  2Y69 B;  5JJN B;  2WA3 A;  3UT5 B;  1H2K A;  3W7S A;  2B5U A;  2F93 B;  4IIJ B;  5FL7 G;  2PV2 A;  2XP6 A;  3J80 N;  4FLT A;  4PDV A;  2CE4 A;  1SKV A;  4PTM A;  1AR5 A;  1PP9 H;  4XDK A;  1U97 A;  5LYJ B;  1SQB H;  5HW7 A;  3DTU B;  2FKE A;  2HR3 A;  1VQM V;  2PYL A;  1Y0O A;  4WKA A;  2YXH A;  4PEL A;  2HJD A;  3MDY B;  3HKE B;  2N74 A;  2ZQM A;  3CH9 A;  2WWW A;  3CMA V;  2VQF O;  1EDQ A;  1EFR G;  2ZQS A;  2A3Q A;  5LHG A;  1NH2 D;  2BSK A;  1F7Y A;  2JIZ G;  5BR8 B;  1R3J C;  5IWA O;  2JJ2 G;  1KT0 A;  2Z3Y A;  4W9O A;  1EHN A;  1R3I C;  1B6C A;  3KAI A;  4LCU C;  3SJQ C;  4DV1 B;  2XND G;  3CHD A;  5FPR A;  4CC5 A;  2GTS A;  3ZCC A;  2B9Z A;  2R72 A;  3LDC A;  1Y76 B;  2QWO B;  4W5U A;  3FYE B;  1WA8 B;  3SYP A;  1KUQ A;  1LL7 A;  3ZRW A;  3O9O A;  1SF9 A;  2Q9L A;  1XMQ B;  1C9H A;  2FL4 A;  2WLM A;  5KAI Z;  3ZHT A;  4TX0 A;  4TW7 A;  2ZIM A;  5LXT B;  1XUQ A;  3FB7 C;  4DR6 B;  1SR0 A;  4LH7 A;  2W6J G;  3Q4H A;  1FKG A;  4J9Z B;  4BIU A;  5JQG B;  2ESC A;  2XP8 A;  1XHZ A;  3HKB A;  3GU0 A;  2YIB A;  1AJQ A;  3S3X A;  1VF8 A;  2A0L A;  2PGG A;  4WBN B;  2Q68 A;  4JF3 A;  3OEE G;  3L75 H;  1O6I A;  4TYO A;  4B3M O;  1KB9 F;  4KR0 B;  3RME A;  1H2L A;  4O2A A;  2OTL V;  3CHE A;  1ZBC A;  1ZAU A;  2DG9 A;  3NXS A;  3JAL B;  3AS1 A;  1HJW A;  5B5E Z;  2PPO A;  3B7X A;  1HNW B;  4DV6 B;  3SPH A;  1E1Q G;  2D9F A;  4FLZ A;  5DEZ A;  4H33 A;  3RYC B;  3AK1 A;  1Q6H A;  1YJN V;  4X66 O;  3CME V;  4ZPW R;  4G2K A;  1YCI A;  1VMG A;  3H1H H;  3B9E A;  4UFZ A;  4IQC A;  4J9Y B;  5JH7 B;  1F4N A;  3EHB B;  1FXK C;  1KQS U;  4ABM A;  4PA6 A;  3CRR A;  2YS8 A;  2A7W A;  1KC8 W;  5LGN A;  4UB6 Z;  5CBH A;  5J2T A;  3AK3 A;  2JEU A;  4EB6 B;  4B7K A;  3UO3 A;  4X1K A;  5B1B B;  5CA0 B;  5B3S B;  1F40 A;  5LHH A;  2QWQ B;  1ROP A;  4IT6 A;  3RN4 A;  2Y78 A;  1UPG A;  3WB0 A;  4LH6 A;  1BHA A;  1YDX A;  3U11 A;  4ZI7 A;  4DR5 B;  1DTO A;  1EN4 A;  3ABT A;  4O4I A;  3E83 A;  1KP2 A;  4JI4 B;  1WP8 A;  3OOB A;  1BS3 A;  2AHY A;  2IUZ A;  3W7W A;  4F4L A;  1VF6 A;  4TUY B;  2XP5 A;  3H1K H;  3FFQ A;  5IYZ A;  4JI2 B;  3CRA A;  4WCE V;  4X1I A;  1IX9 A;  1V9P A;  1FYJ A;  1FS0 G;  1YJW V;  2DMX A;  1YW5 A;  3K5O A;  4ODL A;  2GUZ B;  3OT7 A;  4LF4 O;  4UXN A;  4G28 B;  3VBB A;  2F21 A;  4LF9 B;  4YJ2 B;  2DYR C;  5DN6 G;  2M6Y A;  2FAP A;  4ZPT R;  1FKH A;  5KMG B;  4JTA B;  1VF6 C;  2CH7 B;  2ZXW C;  1YHQ V;  2YEV A;  2MW2 B;  2UXC B;  3B77 A;  3G6L A;  2IJH A;  4Z2K A;  1Y4M A;  4QT2 A;  3ZMS A;  1MG1 A;  3X2Q C;  3OEH G;  5K1X A;  5B1O A;  1QU7 A;  1RPR A;  2P4K A;  1I94 O;  3LNN A;  4P9O A;  3SYC A;  5H2F Z;  4O4H A;  5IDJ A;  2YBT A;  4JFJ A;  1EZJ A;  5BMV A;  4LF5 B;  3K3W A;  3T1Y B;  4GX1 A;  4P8V A;  4UCU A;  3M99 B;  4N19 A;  2RMK B;  2ZE5 A;  4DH0 A;  1QNM A;  1Z5V A;  1E6N A;  1GN4 A;  5DIT A;  2IBZ H;  2Q7H A;  4PDM A;  4NXN B;  2OFN A;  3OMI B;  1L0N H;  3FB5 C;  3QOK A;  3K08 A;  1PL0 A;  4YXW G;  3AG1 C;  3JAT A;  5DF0 A;  4RWU A;  1L1P A;  3DXR A;  1G6U A;  2O92 A;  4IYH A;  3SGI A;  3T2M A;  4R8C A;  1GM8 A;  2WLL A;  4JFM A;  5ITZ A;  3DC5 A;  2X6C A;  2AOS A;  2UUB O;  3D3Q A;  2DT2 A;  3KKY A;  2EBO A;  4Z1M G;  4DR1 O;  4YIP A;  1MSW D;  1J5E O;  3JAR A;  5HW8 A;  1CTN A;  3CC7 V;  1H8E G;  1IBL B;  2X0L A;  3B40 A;  1XQ8 A;  1FKA O;  5IE9 A;  2Q8V A;  1AB3 A;  3KG2 A;  2YUA A;  2VRZ A;  2RUC A;  5H6Q A;  1CXZ B;  3ZRW B;  1BQ0 A;  2RUR A;  4MW8 A;  4Q22 A;  3BRC A;  5BR8 O;  3RM4 A;  3CRQ A;  2JZV A;  5LHI A;  4DUY O;  2OLH A;  1K5S A;  4DV0 B;  1ZBV A;  1QZ2 A;  2UXX A;  3CHC A;  3Q4H B;  2LGQ A;  2CTQ A;  4CH5 A;  5F2V O;  4DR7 B;  3O5Q A;  3J81 N;  2OYQ A;  1SQX H;  1XOU A;  3GTY X;  1UJW B;  3DSQ A;  5IJ9 A;  3K5M A;  2A79 B;  3HKB B;  4B3T O;  3HR0 A;  2MLY A;  2XT9 A;  3ARX A;  2EZO A;  4LF8 O;  3I6C A;  2CTP A;  4JYA O;  2EX3 A;  1K73 W;  4NXM B;  4CS2 A;  3OA5 A;  4P8X A;  2JGU A;  1OJH A;  2ZQV A;  3JD2 A;  4GYC B;  1K92 A;  1QR9 A;  4U3J A;  4P2Z A;  2EIK C;  1K3E A;  1SES A;  1D6O A;  1XNR B;  4X89 A;  1Q3E A;  3MHS C;  1IVS A;  4PA3 A;  4JV5 B;  3L73 H;  4O2A B;  3T1C A;  2L35 A;  1Q86 W;  1Q1C A;  1AIL A;  4DXW A;  2PBC A;  5LMN B;  3E22 A;  1MZE A;  3BFR A;  3ARS A;  4C7U A;  1FXK B;  1XMO B;  3D3I A;  1GN6 A;  4JYS A;  1S5L Z;  4U7O A;  3ZRV A;  3KAF A;  1K5Q A;  1VQ6 V;  4MGV A;  4Q20 A;  1HNX O;  5E79 Z;  3CCM V;  1HWY A;  5KHG A;  4G50 A;  5HW6 A;  4JPR A;  4OPA A;  1IBK O;  4JYB A;  4GKK O;  4JI3 O;  2NN4 A;  1YZB A;  1U79 A;  4MNK A;  3E89 A;  4ODK A;  1RFY A;  4J11 A;  4X20 B;  1BCC H;  1S76 D;  5EBL C;  4JI6 B;  3UO2 A;  5LYJ A;  3ZRX A;  4FJC C;  4I50 B;  4N23 A;  5IJ0 A;  3QO8 A;  4FLY A;  1SER A;  4AI8 A;  2HFE C;  3OTO B;  1MNG A;  1OGG A;  1B06 A;  4R6Z A;  2WAM A;  4HBE A;  3VOU A;  2Y0P A;  3NI6 A;  2X6B A;  3WG7 C;  1MOF A;  1NWT A;  2ZD9 A;  4PA7 A;  4YHH B;  4CS4 A;  1KKC A;  4ZI7 B;  4TSF G;  3W7X A;  3VQW A;  4DZ3 A;  4O4I B;  3RGB A;  5J2U B;  5DIV A;  2DYR B;  2LJ4 A;  3ARP A;  1FKS A;  5I98 A;  1COW G;  2ZXW B;  3ABU A;  2P67 A;  1LNQ A;  3G4S V;  4Q6G A;  2QKA A;  4DR4 B;  5JH8 A;  1J6Y A;  4FPP A;  1K9T A;  3X2Q B;  2HVJ C;  5EC2 C;  4OX9 O;  1Y76 A;  4KFM A;  2IH1 C;  2MNT A;  1WB8 A;  3OGI B;  4LGX A;  3IKD A;  1PNK A;  4D7T A;  4IT5 A;  3JD1 A;  2PI4 A;  1R1B A;  2UXN A;  4FFB B;  2YEV B;  2FTK A;  4I5S A;  2UU9 B;  1BKF A;  1LR1 A;  1D7H A;  1P4R A;  1SQQ H;  4QE9 A;  2UUA O;  4O4H B;  3O5K A;  1HKM A;  5A2Q N;  4WIW A;  5CA3 A;  4DR3 O;  1JJ2 U;  2AW9 A;  2KI3 A;  5TIS Z;  1VF5 B;  3LDD A;  4DV4 O;  4ML4 A;  4CH6 A;  2DWE C;  3C90 A;  2W0F C;  1B3Q A;  2RN9 A;  2X7R B;  1GMG A;  2DQ3 A;  2HHH O;  2CGN A;  3N2G A;  2UXD B;  3LSU A;  4FN2 A;  3BMB A;  1SQF A;  3SR2 C;  4D6T H;  3LNM B;  3APO A;  4H13 B;  1K9M W;  4DRI A;  3RT3 C;  4U85 A;  3K59 A;  3JAL A;  4WFH A;  3AEI A;  2ZQT A;  3B8M A;  2GHY A;  3DXR B;  3RFR A;  1N33 B;  1P5Q A;  1TAE A;  5LOV B;  3CP1 A;  2LQT A;  3E8G A;  5ITZ B;  1FJG B;  2DSU A;  1R3L C;  5IT9 N;  1W9P A;  3IJ4 A;  3IHZ A;  3H9R B;  3RYC A;  3ALG A;  1T5E A;  3IKG A;  2RQ6 A;  1S5J A;  2ITC C;  2B1G A;  2NR5 A;  5IYC O;  1FKT A;  1ZK6 A;  3O5O A;  1YIJ V;  4NYK A;  3JAR B;  2JS3 A;  5JH7 A;  4J7K A;  1N0N A;  4GUN A;  4FFK A;  2GSM B;  3FYI B;  1MMM A;  1OGB A;  1GN3 A;  2ETN A;  4DV7 B;  4EB6 A;  2QA4 V;  2VN1 A;  4FM0 A;  1QR8 A;  3RFW A;  3AG3 C;  5CA0 A;  4TW6 A;  4GCZ A;  2VCD A;  3BXW A;  1GOI A;  3B09 A;  2FYU H;  2H8P C;  2WLJ A;  1P84 F;  2EIM C;  2EIK B;  2LPV A;  3TC5 A;  3BVO A;  2JVD A;  1MA1 A;  1BT8 A;  4LWS B;  4ASU G;  4KP4 A;  3SJB C;  1SA0 A;  4PA4 A;  1NI8 A;  4TQF A;  5GTI Z;  4AQY B;  4K3A A;  2LGO A;  3RGC A;  2EUL A;  3CS5 A;  5DM6 V;  4BIO A;  5LP6 A;  2PI5 A;  1Q7Y W;  2Q7G A;  4TUY A;  1JJO A;  5B1B C;  4DZ2 A;  3JYC A;  4F6R A;  4JZG A;  2QR4 A;  5EYP B;  1O9G A;  3QTC A;  1QLE C;  1KMI Z;  2QE7 G;  1YXB A;  3G67 A;  5LA6 B;  3RYF A;  4AHC A;  4X65 B;  3WIJ A;  1XNQ O;  1YTF B;  4O2T A;  5CA1 A;  4BW5 A;  2ARH A;  2DJV A;  1CPY A;  4DV2 B;  4DV5 B;  2PZS A;  3KCX A;  3E22 B;  3GB7 C;  4U84 A;  1Y66 A;  1IBM O;  5LP6 C;  3O5M A;  4LAX A;  1N36 B;  1CP9 A;  2D3O W;  2O9O A;  3JXV A;  2R9I A;  2RUD A;  2UXB O;  3PRD A;  3APQ A;  4JI5 O;  5C8Y A;  4O2B B;  1W0K G;  3ARR A;  1WPX A;  3QF7 A;  4JAA A;  2M08 A;  1GPF A;  2PTM A;  1D7J A;  3CB2 A;  3O5F A;  2IM9 A;  4U86 A;  3WG7 B;  1R6K A;  2LW7 A;  4UVC A;  5GQB A;  2HJF C;  1JX9 A;  4DRH A;  2YIB D;  3CHF A;  4ZOL B;  3ARO A;  3A0B Z;  1HKJ A;  3PRA A;  2GV9 A;  4LFA O;  5LGT A;  5IJ0 B;  4UUJ C;  1PPJ H;  2CTR A;  3ZED A;  3ARW A;  3C3S A;  1M9N A;  1D5A A;  4LFC B;  3KAB A;  1XI1 A;  2HG5 C;  4LBE C;  4MW3 A;  4E4E A;  4YY3 B;  4JI0 B;  1H8H G;  3B9A A;  3G6B A;  2ZM6 O;  1G1X B;  3L74 H;  4DYL A;  3AG4 C;  1VQ9 V;  2YSU B;  3ZX6 A;  3SDL A;  3N2K B;  2QDO A;  4I55 A;  4ZPV R;  4MAV A;  4ICG A;  4R5E A;  3CE2 A;  1ENV A;  5J9P C;  1FKL A;  5AG2 A;  2YI8 A;  3J7A U;  2ZIN A;  5KHI A;  2XAH A;  4QIW F;  1FD9 A;  2YC0 A;  5KX5 A;  4GKJ O;  1NQT A;  4DV3 B;  1OCO C;  2VQE B;  2IU3 A;  4JYC A;  2HKO A;  5IYB O;  1URF A;  2ZNJ A;  3WB2 A;  1NVP B;  4NKG B;  3UCS C;  2P5O A;  3OUF A;  3K9A A;  4H37 A;  1EBO A;  3ZHV A;  2Q5A A;  2XAJ A;  1DF5 A;  3JAS A;  4HAM A;  5EZY A;  4DWS D;  4L87 A;  2Y4U A;  3AS0 A;  3TGU H;  3ART A;  3UQA A;  4Z2W A;  2ZT9 B;  2CDY A;  4IGG A;  2LGW A;  2OIE A;  4MVZ A;  2PUS A;  2IH3 C;  3ZRS A;  1DF4 A;  1QCE A;  1GRJ A;  1ZWI C;  2KO7 A;  3SYQ A;  4JI7 B;  3STZ C;  1J95 A;  1F4M A;  1NTM H;  2KE0 A;  1Q82 W;  1HDJ A;  4DRO A;  2IJJ A;  2P06 A;  3SYO A;  4B3R O;  3UQ8 A;  4R0X A;  2LJ2 A;  1UR8 A;  2KG7 B;  2MLZ A;  4WFE A;  3KZI Z;  2R9A A;  5EIB D;  2E5L O;  1SZX A;  2MF9 A;  3RVZ A;  3CC2 V;  3N2G B;  4J41 A;  1OWQ A;  4B3S B;  5HFM A;  1XBL A;  4UCT A;  1LJY A;  1TGO A;  1XL6 A;  3LDE A;  5KLV H;  2JK5 C;  2PF4 E;  2A3E A;  1FXK A;  3IFX A;  4K8X A;  4DW0 A;  1DLB A;  3UKM A;  1L8D A;  1YAT A;  3DGE A;  5KUK A;  1XHX A;  1Q8I A;  1N1A A;  2Z5U A;  1D2D A;  1LG2 A;  3AG2 C;  4NSB A;  3JD0 A;  3AG3 B;  1SQV H;  4JFK A;  1RM1 C;  1SS3 A;  3H01 A;  4P8U A;  4HZ3 A;  4K35 A;  2EIM B;  1LUV A;  4X20 A;  4NR1 A;  4LAV A;  4JI8 O;  1JFF A;  5KHH A;  5LMU B;  3ETG A;  4QT3 A;  4JI1 B;  1VQP V;  1U96 A;  4Z2H A;  4I50 A;  1AR4 A;  3CX5 F;  1P7B A;  1SYT A;  3CZ8 A;  2DT0 A;  3OTF A;  3VQY A;  4DWS A;  3CXC U;  5D5Q A;  4FZ1 A;  2MPH A;  2WLH A;  4HYO A;  2LO1 A;  1QLE B;  3G6E V;  2G8Z A;  2Q0A A;  3VQV A;  5L3G A;  4JGS A;  1SA0 B;  1E6P A;  1GM7 A;  4NTY A;  5J2U A;  1QVG U;  3VAW A;  3P30 A;  2A3B A;  5LP6 B;  5BY1 A;  4DWS C;  4DRQ A;  3I56 V;  1LG1 A;  2QKS A;  4F6R B;  4EFE A;  1AI5 A;  1E9L A;  2DSZ A;  2ADQ B;  2MLX A;  3B8S A;  4FIP C;  2XTA A;  3I55 V;  2VWK A;  5H9C A;  1VAR A;  3RYF B;  4JFL A;  5CA1 B;  2FKX A;  1FJD A;  3TCU A;  4JFI A;  2IJI A;  1KBH A;  1HNZ B;  4R50 A;  3CCQ V;  1KT1 A;  3WD2 A;  1ITX A;  4NTX A;  4CH4 A;  1UFI A;  3ETD A;  3UF8 A;  4WFA V;  2UUC O;  3CSX A;  4FFB A;  3ALF A;  1N32 B;  1GTO A;  5EIB C;  3WQV A;  4S3J A;  1VP7 A;  1ZUQ A;  3FX7 A;  3K04 A;  5C8Y B;  1OV9 A;  4X1Y B;  3JSN A;  1MSD A;  3LUT B;  4XDJ A;  3ARY A;  4JTD B;  3O65 A;  2YID A;  3ABL C;  4TT3 G; 
#chains in the Genus database with same CATH homology
 3KAC A;  4P8W A;  1R9H A;  3NRK A;  4MTV A;  5HWB A;  4DRN A;  3ARU A;  4URI A;  1ZBW A;  4BF8 A;  1W1Y A;  4MNL A;  1OGG A;  4HBE A;  3NI6 A;  5DO2 A;  3LUO A;  5DIU A;  1J4R A;  1NWT A;  2XPB A;  3WD0 A;  1UR9 A;  1EQ3 A;  4DZ3 A;  4Z2J A;  2ITK A;  1X6L A;  5DIV A;  1NWR A;  3CGM A;  2XP9 A;  2LJ4 A;  1FKK A;  1NWU A;  1FKS A;  3ARP A;  5I98 A;  4WKH A;  2WK2 A;  1PIN A;  1TFV A;  1FKI A;  2ZR4 A;  2WLZ A;  2WM0 A;  3PRB A;  3UI5 A;  1LQ0 A;  4DRJ A;  5JH8 A;  1FFR A;  1J6Y A;  1K9T A;  2F2D A;  3FXY A;  2A3A A;  2MNT A;  2PPP A;  1J4I A;  2KR7 A;  4LGX A;  3IKD A;  4DT4 A;  2XP4 A;  1PBK A;  2B31 A;  3FY1 A;  1E15 A;  4QZV B;  4TW8 A;  2M1I A;  2RUQ A;  1NMW A;  3RM9 A;  1BKF A;  1D7H A;  4ODP A;  1EIB A;  2LKN A;  2IF4 A;  2PV2 A;  2XP6 A;  3O5K A;  1HKM A;  1Q6I A;  4WIW A;  4XAK A;  3IK8 A;  5B8I C;  4DIP A;  4PTM A;  2KI3 A;  4J4N A;  3WL1 A;  3ARQ A;  1HKK A;  4ML4 A;  3EY6 A;  5HW7 A;  2FKE A;  1W9U A;  1HKI A;  1Y0O A;  3CGN A;  1ZL1 A;  4FN2 A;  4WKA A;  3MDY B;  4HAR A;  3ARV A;  3CH9 A;  1H0I A;  4DRI A;  5HKG A;  2L2S A;  1EDQ A;  1W1P A;  2ZQS A;  4U85 A;  5HWC A;  2G41 A;  2ZQT A;  2DG3 A;  1P5Q A;  3O5R A;  2DSU A;  4Z2I A;  1KT0 A;  1W9P A;  4W9O A;  1EHN A;  1B6C A;  1XRV A;  2XPA A;  3KAI A;  3IHZ A;  3H9R B;  3ALG A;  3O5G A;  3IKG A;  3CHD A;  1E6R A;  1ZK6 A;  1LL6 A;  3O5O A;  1FKT A;  4Z2G A;  5HBF A;  3AQU A;  4MPK A;  2PV3 A;  4W5U A;  4G2P A;  1FKR A;  1LL7 A;  3JYJ A;  1T11 A;  1C9H A;  1OGB A;  4DRM A;  3O5L A;  5GPR A;  3AS3 A;  2ZQU A;  2VN1 A;  4ODO A;  3RFW A;  4FAP A;  4NNR A;  4TX0 A;  4TW7 A;  4TW6 A;  2VCD A;  3BXW A;  4DWS B;  3KCE A;  1GOI A;  3B09 A;  1SR0 A;  4J4O A;  1FKG A;  1ZB5 A;  2LPV A;  2PI6 A;  4WK9 A;  3TC5 A;  2ESC A;  2XP8 A;  5J6E A;  2LGO A;  3RGC A;  1VF8 A;  5D75 A;  2DT3 A;  3KAG A;  4ITZ A;  3UQB A;  3O5P A;  1A7X A;  1IX5 A;  4TNS A;  1ZCN A;  4DZ2 A;  1O6I A;  1JVW A;  4TYO A;  4KR0 B;  3RME A;  3CHE A;  3G6M A;  1ZBC A;  3WIJ A;  2DG9 A;  4O2T A;  3AS1 A;  4KQZ A;  1HJW A;  2RQS A;  4U84 A;  1JNS A;  3GPK A;  2PPO A;  3B7X A;  1JND A;  4W9Q A;  3O5M A;  4LAX A;  2D9F A;  2O9O A;  3JXV A;  4ZS6 A;  2RUD A;  5DEZ A;  4IPX A;  3PRD A;  2ZR6 A;  1Q6H A;  4ZPW R;  3TDB A;  2DPE A;  3B9E A;  3ARR A;  4IQC A;  3UQI A;  2M08 A;  1GPF A;  3RM8 A;  1D7J A;  3O5F A;  4U86 A;  5GQB A;  2UZ5 A;  4DRH A;  3CHF A;  3ARO A;  1X6N A;  3WQW A;  2ZR5 A;  1HKJ A;  3PRA A;  4DRK A;  3KZ7 A;  5HUA A;  2KFW A;  4MSP A;  3W4R A;  2YBU A;  3ARW A;  4ODM A;  1F40 A;  1D7I A;  4ODN A;  4Q7N A;  3KAB A;  4IT6 A;  2DSW A;  2PV1 A;  4IQ2 A;  2Y78 A;  2FDM A;  3B9A A;  1GUV A;  1W9V A;  4C02 B;  1XHG A;  3OOB A;  2IUZ A;  1KFW A;  4MNJ A;  1HJV A;  4ZPV R;  4MAV A;  4WJX A;  4R5E A;  1EYM A;  1FKL A;  2XP5 A;  1FD9 A;  1YW5 A;  3UI6 A;  2WLY A;  4ODL A;  1WNO A;  2F21 A;  3JYM A;  2FAP A;  4ZPT R;  1FKB A;  1FKH A;  5HTG A;  1W26 A;  2Q5A A;  1FAP A;  4W9P A;  1J4H A;  4DWS D;  3AS2 A;  3G6L A;  4Z2K A;  4AY1 A;  3AS0 A;  3ART A;  4QT2 A;  3UQA A;  3KAH A;  4WKF A;  1TCO C;  5BXJ A;  3WH0 A;  2DG4 A;  3ARZ A;  4QIB A;  2KO7 A;  2XP3 A;  3PR9 A;  2YBT A;  2XP7 A;  3WKZ A;  4JFJ A;  4Z2L A;  2KE0 A;  2F4E A;  4DRO A;  1NH6 A;  4P8V A;  4N19 A;  4R0X A;  4DH0 A;  3O5J A;  1UR8 A;  1E6N A;  2MLZ A;  4L3N A;  1HJX A;  2MF9 A;  3ODK A;  5DIT A;  1NMV A;  2OFN A;  1M5Y A;  4DRP A;  1OWQ A;  3WD4 A;  3QOK A;  1LJY A;  1FKF A;  1W1T A;  5DF0 A;  1Q6U A;  1JNT A;  2O92 A;  1D2K A;  4LAY A;  1L1P A;  1ROU A;  1QPF A;  2A3E A;  4JFM A;  3UI4 A;  5GPG A;  3TCZ A;  1YAT A;  2AOS A;  1N1A A;  3O5D A;  1LG2 A;  2DT2 A;  4NSB A;  4MNM A;  1W1V A;  4JFK A;  1ZU8 A;  1FKD A;  2M2A A;  5HW8 A;  1CTN A;  4P8U A;  1LL4 A;  1NSG A;  4LAV A;  4S3K A;  1H0G A;  4Q22 A;  2RUC A;  4QT3 A;  2RUR A;  4ODQ A;  3RM4 A;  4Z2H A;  2JZV A;  2RSE A;  1SYT A;  2PPN A;  5HT1 A;  3CZ8 A;  3WD3 A;  2DT0 A;  3B9D A;  2OLH A;  4DWS A;  3PA7 A;  1QPL A;  1ZBV A;  2N87 A;  1QZ2 A;  3KAD A;  2MPH A;  2AWG A;  3CHC A;  3O5Q A;  3FAP A;  2G8Z A;  3O5I A;  4ODR A;  4NZC A;  1E6P A;  1ROT A;  2MLY A;  3ARX A;  3VAW A;  3I6C A;  1BL4 A;  2A3B A;  4DWS C;  3OA5 A;  4P8X A;  4DRQ A;  2KGJ A;  2ZQV A;  1LG1 A;  1E9L A;  2DSZ A;  1HXV A;  1D6O A;  2MLX A;  3B8S A;  4LAW A;  3NTP A;  4GGQ A;  4L72 B;  1F8A B;  4IT4 A;  3O5E A;  1Q1C A;  2PBC A;  4JFL A;  2DT1 A;  2QF8 A;  1FJD A;  1FFQ A;  2A3C A;  3ARS A;  4JFI A;  1KT1 A;  1FKJ A;  4JYS A;  3WD2 A;  1ITX A;  3KAF A;  3UF8 A;  4MGV A;  1RD6 A;  3ALF A;  3WL0 A;  3WQV A;  1NWS A;  4S3J A;  1WB0 A;  4G50 A;  5HW6 A;  3WD1 A;  3ARY A;  1U79 A;  1ZBK A;  2K8I A;  1E6Z A;  1JNE A;  4HBO A;  4MNK A;  4ODK A;  4GIV A;  1WAW A;  2DSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...