4DWSC

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
539
structure length
526
Chain Sequence
KPTENIPSPILVEDKYTEETYSRPDVNFEDGSQGNLSYTATRVCAPMYNHYVGDKTPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKVQEVWDGWNAQAPSLGLPQIGKGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDDGENYVLLIKELRSALDSRFGYSNREISIACSGVALKKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAGHFISLDTPRTVKQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADSNQETIDMGPLYNPGEIYLKSISEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chi2
publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
molecule tags Sugar binding protein
total genus 184
structure length 526
sequence length 539
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsC01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsC02
1GQIA 3BAJA 1PJ9A 4TTGA 1V03A 3WKZA 1JYVA 4JIEA 1MVYA 1HNYA 2WMFA 1WP6A 1CXFA 4A3HA 4C7DA 3SCRA 3TA9A 3GH7A 3TONA 3W4RA 3UETA 4F9DA 5EB8A 3GBDA 4AD2A 1KGWA 1WZAA 4Z2IA 2E8YA 3PN8A 1JZ6A 1PZ3A 3N15A 1V6WA 1V0NA 3TOPA 4CD5A 1UH4A 2D0FA 4CKQA 1EQCA 4QLKA 4TUFA 5E09A 1ZU8A 1G0CA 4R5EA 1ITXA 2WXDM 2D3NA 5A6AA 1LQ0A 5I23A 1AMYA 1C3FA 1GOOA 3NIYA 4UQ9A 3IAPA 3W82A 3AIBA 3W29A 1PX3A 3PZTA 1R86A 5IDIA 1QBAA 1W9VA 5FL0A 4U2ZA 4WLCA 1NQ6A 3RDKA 3AHVA 3WH7A 3WBEA 1XGZA 4EK7A 1H0GA 4UFJA 1TVNA 1GVIA 5A6JA 3VM5A 2V5DA 4UQCA 4EE9A 3M46A 3WD0A 4MNKA 3SUWA 3QOKA 3VM7A 3W25A 3AISA 1NARA 2ZICA 1UZ1A 4PMZA 1OD0A 3I3BA 4FMVA 3ARXA 4L4PA 4AMCA 3ZT7A 2WNWA 1QHPA 1NP2A 3AHXA 1JL8A 1W9BM 1JGIA 1HKJA 4FLQA 4UZUA 5AY7A 3CZEA 3AI0A 1QI4A 2F8QA 1VB9A 1HKKA 4NSBA 4HZ8A 2YBTA 4QFUA 2DH3A 4PRWA 4E4PA 2JF7A 2VJXA 5DMYA 5DT7A 1K6AA 1EDQA 1G9HA 1UWIA 4DUWA 2NT1A 3PTMA 4UFIA 1BQCA 4OIFA 1CECA 4QLJA 3RM9A 3N18A 1JNEA 1EDTA 2CBIA 2CYGA 1W3LA 4D6DA 3THDA 1H49A 2WVVA 4MB4A 3SCOA 5I0DA 1E6XM 1UR2A 1E43A 2RGLA 1VFMA 1MQQA 2BHUA 1V6XA 3WEMA 1NWUA 2G3IA 4IM4A 4W87A 2JEPA 4U5IA 1UD6A 3ZR5A 4UOJA 1E6PA 2WANA 2YBUA 1WZLA 4CCEA 3VVGA 4ACZA 1XCWA 4H7VA 3CLWA 1ZB5A 1VEMA 2ZUMA 1WE5A 4NZCA 4P7NA 2J74A 2DSVA 2BHYA 4MDPA 1CLXA 1QHZA 1CGUA 4B9ZA 1FH8A 2WZIA 4MNLA 2Z1KA 4LPCA 4GO9A 2B31A 2W67A 4PMRA 4ZXOA 4NF7A 1FP8A 3MANA 4LX4A 4YHGA 5IFPA 1AQMA 1S46A 3A4WA 3K8KA 2YDRA 1HVXA 3WENA 1HP4A 1V6YA 2VUYA 4WK9A 1B3ZA 1HJQA 4M8UA 1U2YA 2D22A 4UFLA 4AZCA 1E0XA 2VURA 2WVVB 2DSUA 2F61A 2WZEA 4JFSA 1UQYA 1HN1A 4GPNA 4Z2KA 1K9DA 3OLIA 3SUVA 3VD4A 3ZJ6A 4AEFA 3WH6A 1JZ2A 3W26A 1QI2A 4NRRA 2VZUA 3CZLA 1QNPA 1RP9A 1CPUA 2VR4A 3QR3A 5A6SA 3BXWA 1OIMA 1V08A 2D20A 3MSDA 3WDIA 1UG6A 4AYSA 4UNIA 4J7RA 1A3HA 1OB0A 5E9AA 3GXDA 2XVNA 2Y24A 3SIMA 1Z32X 1HKIA 2WSKA 5DO8A 3ZM8A 5M03A 1XV8A 1TR1A 2YJQA 3N12A 4JKKA 3B8SA 1VENA 1V0MA 1QNOA 2PF0A 2DSWA 1JAEA 5A6LA 2O9TA 3W53A 1VEPA 1KFWA 1UQZA 1HJWA 5BRPA 5TD4A 3LPOA 2V5CA 1O6IA 3ALFA 1XHGA 1GNXA 1FOBA 1J0JA 4P8VA 5GNYA 2BNJA 2PI6A 3ZO9A 4J3SA 3SUSA 3ZSTA 2W4XA 3VDAA 1E0WA 3BMVA 1QNSA 4AZCB 1XSIA 2OSXA 2VRJA 3WNNA 1HP5A 4PSPA 4BQ2A 7CGTA 2DT2A 3W0KA 5JH8A 3CHEA 1XYFA 4M56A 4CD7A 2WMGA 3ECQA 3L2MA 2NW0A 2PC8A 3OZPA 4AY1A 1JDAA 4W5UA 3J7HA 2WSPA 4MTVA 1UH2A 4EANA 1V0KA 5I79A 1F4AA 2UY2A 2WVUA 4PN2A 4UFKA 3W6MA 3CMGA 2A3AA 3NSXA 2JE8A 5M17A 2YIHA 3K8MA 1ISVA 1FHDA 1CBGA 3SUTA 2EPLX 5JBEA 4ZXLA 4D6GA 4AD4A 3PTKA 3LPFA 1JYWA 3CH9A 2CITA 4IPNB 1CGWA 1MW0A 4PYSA 5A6BA 1CGYA 5HPCA 1UHVA 2FHCA 5CG0A 5CQ1A 2OWWA 4EKJA 4WKAA 3MUAA 3UERA 5EMYA 2WCGA 1MWOA 1LG1A 1E4MM 3EMQA 1NH6A 1US3A 2VVSA 5BXPA 4DUXA 2XVLA 4AD1A 1UWTA 1OIFA 2WMKA 4BA0A 3GH5A 3OZOA 4PMNA 1YQ2A 5ABEA 4CN6A 3SUUA 2Z1SA 4W89A 2X8RA 1ZJBA 1C8XA 1WO2A 4TOQA 2VZTA 1IT0A 2BVTA 4UOQA 1W1VA 4M1RA 3MO4A 1W91A 3WFZA 3NDYA 4W85A 2XPKA 3RILA 1UWUA 4WSKA 4XX6A 3M6DA 4W86A 3ZJ8A 3FW6A 4D1IA 5LA0A 2XFRA 2J4GA 1AQ0A 4P8UA 3VGDA 4E2OA 1LG2A 2Q8XA 5CGMA 1WKYA 4PEEA 3WD3A 2XWEA 4AIOA 4PTVA 3WDRA 4AZHA 2ZUUA 4CN1A 4AEEA 2DSZA 1DTUA 1BYBA 4WIWA 1VJZA 4JCLA 3CGTA 1JXJA 2A3HA 1EA9C 5C71A 4GQRA 1XSKA 2FHFA 3MU7A 4HP5A 2ZUVA 4AD0A 5FOOA 3DYOA 1ODUA 3AZSA 2AOSA 3EDEA 1W2PA 3L2LA 3WD1A 3S6TA 4HA4A 3SCTA 5I2UA 1Y7VA 2ZUSA 1DWJM 4R27A 1EO7A 3AIQA 4BCEA 1BG4A 4MADA 2WWCA 5I78A 3PZVA 1QOXA 3WF1A 4PMUA 3WDPP 4KWUA 2WW5A 1JXKA 1GPFA 2G3JA 1CXHA 3AIWA 1HJUA 5M3WA 4M81A 4D6HA 1H4PA 3RIKA 3MMUA 1W1YA 2J25A 3CUHA 1WDRA 2MANA 3IJ9A 2JF6A 1EGZA 1RP8A 5I3DA 5C70A 4QCEA 4GINA 3MUY1 4LQ1A 3MMWA 1UD3A 3UR8A 1TUXA 4Q22A 4MJ4A 2BXYA 5E6YA 4Z2GA 3MV11 5JUVA 1J0IA 1FFRA 2HISA 1J01A 4GXPA 2VOTA 4FLRA 4GZEA 9CGTA 5E70A 2EPNA 1D7FA 5BCAA 2J77A 2D24A 2Y5EA 3VIMA 1MW2A 4WKFA 1ISWA 4W93A 3T0DA 1SMAA 2WLYA 2OWCA 2YL6A 3IJ7A 1PAMA 1V3HA 4U2YA 1OD8A 2D23A 3EDKA 1C8YA 3VMOA 1EXPA 2D0HA 5M5DA 3T09A 4W8BA 1JYXA 2WPGA 2BS9A 3W37A 2G8ZA 1EHNA 1E1EA 2G3NA 4B3KA 5C8BB 4BZYA 1B3WA 3FN9A 1UH3A 3ARVA 3II1A 3BAKA 4P7LA 3GM8A 3OBAA 1J0ZA 4JHOA 2J7DA 1WNOA 3OB8A 3PZMA 1H5VA 3WNMA 1H11A 4MDOA 3ZSSA 2WMIA 1KR0A 3K8LA 4HOZA 1C93A 4BF7A 4M80A 3CUIA 4OOUA 1GVYA 2BHZA 4HPHA 5HNNA 1LJYA 2PWGA 3VIFA 1XH0A 4CU6A 2E8ZA 4F8XA 1KGUA 2D1ZA 1PIGA 3AYRA 3AJ7A 2FGLA 5FCZA 2EQDA 2GDVA 4XUYA 2V3EA 3N1AA 3DYMA 5DF0A 1EDGA 3M7SA 3BAIA 2W91A 2UY5A 1HJSA 2QF8A 3GXFA 4PTMA 4ZEPA 2WK2A 3AS0A 1FHLA 2C7FA 3VGHA 1KR1A 2J75A 1WB0A 2GK1A 3POHA 5HOSA 5BYWA 1GOMA 2O92A 1B3YA 4PMQA 3CBWA 5A2BA 2BFGA 3WY1A 2YDSA 2WHKA 3THCA 1MQPA 3PBGA 3SCWA 3EMCA 1C90A 1OGBA 4C7FA 1JZ7A 2UY3A 1DWAM 1VBUA 2QLYA 3VGGA 4RE4A 2VVNA 4LGXA 4KH2A 2VC9A 2WC7A 1B31A 4OZOA 3UR7A 4NRSA 3SCVA 2XM2A 1MXGA 4S3JA 3U7VA 1E55A 1D3CA 2VI0A 3WIJA 3WELA 1OINA 1OWQA 5F7UA 1IZKA 1SMDA 2VO5A 2WMIB 3WEZA 1JZ8A 1KWGA 3RCNA 3BAXA 5A2CA 4Y7EA 4ATDA 1HIZA 2GJRA 1BVNP 1SYTA 5D9NA 2JEQA 4U3CA 2BY3A 2V3DA 1W3JA 3WUBA 3GXMA 1BHGA 1AVAA 1B3XA 3OLGA 1X6LA 1WDQA 5JIWA 4DWSA 2CBUA 3TTOA 4E8CA 2WBGA 1MW3A 1SFSA 4X0VA 1OCQA 4JL2A 4PUEA 5FIPA 3CZJA 4JL1A 2GK1B 2CBJA 3PZNA 1OBAA 4X9YA 2FHBA 3KL0A 1HXJA 1WZKA 3A6OA 1FH7A 4J3UA 2WKGA 5BXSA 1Q4NX 5CLWA 4L4OA 4CD8A 4YHEA 2CIPA 1M01A 4J27A 4MNJA 3PZOA 4W7VA 3ARYA 2VQUA 7TAAA 1ZBCA 3D5HA 2XTKA 5HPOA 3WEOA 3VD3A 3UG3A 3D3AA 4TVUA 1JF5A 4PMVA 1YHTA 2EJ1A 1DWGM 1OGSA 4JFUA 4PTWA 3ARUA 2Y4SA 1JYNA 1ISYA 1Q6CA 3ZJKA 2NSXA 2QHAA 4PTXA 3VILA 3FHAA 4GZIA 1SR0A 3DC0A 3ZMRA 2WYSA 3MV01 2DIEA 1UD5A 1XH2A 2C0HA 2WMJA 3VPLA 1NM9A 4GQQA 5BXTA 3VDBA 2RGMA 2CERA 2FGZA 3POCA 1DP0A 4DWSB 1E5JA 3WF0A 1UWSA 3CHCA 3AICA 1XSJA 3WF3A 3AZRA 2DT1A 1V0LA 3W81A 3VDHA 3BH4A 1ESWA 1KXVA 1HL9A 4M24A 5A95A 1O7AA 3SCPA 3L4WA 4IUGA 3F5JA 2BVDA 2FH6A 1VAHA 3IJ8A 3GYCA 3N04A 3VINA 1I75A 1C8QA 2ZXDA 2GSJA 1NP0A 3AXIA 3FAXA 4NI3A 4JKLA 2VMFA 3O6AA 1DWFM 2DIJA 4UCFA 1GOQA 2CHOA 4UQDA 3VNYA 1VFFA 1P6WA 3G6MA 3AFBA 4JCMA 2CKRA 3OG2A 1M7XA 1FH9A 1Q6EA 3UG5A 5BWFA 4ATLA 4MNMA 3GNPA 4CD4A 1GQKA 5A8QA 2CETA 3PZ9A 4H2CA 2GJPA 3BSGA 1LLOA 2EXOA 1DWIM 4JFWA 5I5RA 1E40A 1PEZA 4AZIA 5AC4A 3FNDA 1TG7A 4AD5A 3UCQA 1LL7A 1TCMA 3WSUA 3QHMA 4CU7A 1V3KA 5GNZA 2WKLA 2WLZA 3QGVA 4TX6A 4AIEA 2QMJA 5KEZA 3VNZA 2JALA 1HT6A 1Q6FA 3CPUA 2VRKA 4EAMA 1PPIA 1NWSA 1J12A 4CD6A 1ECEA 1R7OA 5A94A 2XFFA 2EPMX 1UKPA 3K1DA 2E9MA 5D8WA 1CEOA 1E1FA 2E4TA 2VX5A 4HPGA 2CBVA 4U31A 3WFLA 4Q7NA 1C7TA 1CGXA 2CXGA 3NSNA 3PHAA 4JAWA 3WMSA 1UWRA 3BCDA 1E4NA 1OSEA 3N17A 1CNVA 3DYPA 4MJ2A 2EPOA 3BAWA 1UKOA 1H2JA 5I6SA 1K9FA 3KL5A 2YKKA 4BQ4A 3ALGA 3EDJA 2IUZA 2YL8A 1JZ4A 2VZSA 4AD3A 4OUEA 3CMJA 1PX8A 2CHNA 2UY4A 1W3HA 1GONA 1MFUA 3HJEA 5A1AA 4AXNA 1V6VA 2ESCA 3AMKA 4UFMA 2DGAA 2D0GA 1H0IA 1N82A 1BTCA 1CXKA 2WC3A 4M82A 3VIIA 1OT2A 4LXFA 2VZOA 4TTUA 3BCFA 3T2PA 3BC9A 1HF6A 3WDHA 1X1NA 4TVCA 3WDJA 1KQYA 2W63A 3GH4A 1E3XA 1GHRA 2WBKA 3A4XA 3VTRA 4GIAA 2EO7A 4CN4A 4HU8A 1JAKA 2AMGA 5A8OA 2E0PA 4U3AA 4V2XA 1ZBWA 2GUYA 6A3HA 3VD7A 4GI9A 3WNPA 4P7QA 4HA3A 3NJ3A 1GOWA 1D2KA 4AISA 2QPUA 3HMCA 5BROA 4UR9A 1UZ4A 1U33A 4J3WA 4Z2HA 1GUVA 2WVSA 3GNOA 3AOFA 3TTQA 1W1TA 1B1YA 4B9YA 3IAQA 1K9TA 2X0YA 2CESA 1JD9A 4CCDA 3L4YA 3KWXA 1BGGA 2W62A 5ABGA 1TVPA 1TA3A 3W6LA 3K4DA 2ZX7A 3AMDA 1W9PA 1UUQA 1BVZA 1ISZA 5CZKA 1GCYA 4UQEA 2W5FA 2D3LA 1E56A 4PBGA 4DM1A 2CNCA 4W7UA 2IXUA 3WDQA 4YN5A 1E15A 1MW1A 4WJXA 1EIBA 5FD0A 4D6CA 4WSJA 4FLOA 3DHUA 3VGBA 4MB3A 4D1JA 2X2YA 1UWQA 1KGXA 2CCRA 2DDXA 1HVQA 3VX0A 4YPJA 3U5YA 4P7RA 1EQPA 1J10A 5HDRA 4AZ5A 1NOUA 4HOWA 6TAAA 3N11A 4LYPA 3CIVA 3CZKA 3EDFA 3CUFA 4DM2A 4D6JA 1QNRA 4JZ5A 2J79A 2Y2WA 5AC5A 2G4FA 1QBBA 3OGRA 4ACYA 1UYQA 2J7BA 4H8HA 2ZX8A 1BG9A 2WB5A 1JFXA 1G94A 8CGTA 1V02E 1BSIA 4AC1X 3W38A 4TVDA 3MKKA 1J9YA 1WDPA 1Q6DA 4B15A 3DHPA 4XZWA 1QHOA 3QHOA 1H09A 1CIUA 1E72M 1E5NA 3RO8A 4UZSA 1TA3B 1NWTA 4W88A 5LA1A 3B9EA 2BY0A 2ZXAA 4IISA 3F5LA 4JHZA 3NUKA 2V3GA 2V38A 3AROA 2DH2A 5CPQA 4AW7A 1L8NA 5A6BD 4GKLA 5D8ZA 2E40A 4W84A 2DT0A 2AAAA 2YL5A 4HMCA 1UR0A 1VEOA 3QOMA 2Y8VA 2WCAA 2WCSA 3ZJ7A 3W27A 1R7AA 3WH8A 3L4VA 4JKMA 3AIUA 4KGJA 4KGLA 1CXEA 2XG9A 3WQWA 3RM8A 5AYIA 2CKSA 4QDMA 4HZ7A 3NDZA 3LPGA 2WMHA 4XZBA 5CXPA 3FY1A 2XVPA 1WDSA 3WQ4A 2WHJA 2GVYA 5A8NA 1PBGA 2XM1A 2DT3A 3PZGA 1BYDA 3GNRA 3ZQ9A 2JIWA 3BSHA 3VX1A 1ZBKA 3OLDA 1W9DM 3T08A 2DSKA 4UOZA 4AIUA 1V3MA 3PZUA 4RE3A 2BVYA 2UWFA 5DEZA 1PZ2A 1E6RA 2PB1A 4KRUA 3BMWA 1GOKA 1BYCA 1W32A 3BGAA 3ARPA 3ARQA 2NT0A 4CVUA 2OLHA 1UR4A 5ABFA 4AZGA 2A3BA 2ZWZA 4IPLA 2D2OA 2ZUWA 1B30A 3PTQA 3CHDA 4HMDA 5CPSA 4F9JA 1MQRA 1XH1A 1C7SA 3LMYA 1V3JA 3MS8A 5JBDA 1CTNA 3VIJA 4HMEA 1ITCA 3ZIZA 5DT5A 3B9AA 3AXXA 4MAZA 3BAYA 3CO4A 3O2LA 4PMYA 3VUPA 4U33A 4D72A 1BPLB 4AZ6A 3BLPX 2J47A 3WQVA 4OBRA 4HOXA 1UR9A 4A3YA 1KBKA 4MPKA 2VQTA 2OSWA 4OOZA 3T0AA 1UKQA 1V3LA 1WZMA 3PZIA 3AS1A 3G6LA 1M04A 3WNKA 4CCCA 1XYZA 4FLSA 3WNOA 1JD7A 1UA3A 2J7GA 1CZ1A 5A3HA 3ZT5A 2XVKA 1MFVA 4N42A 2EBNA 2O9RA 1HX0A 4KMQA 4J28A 2W92A 5ABFB 3I3EA 1KXQA 3L4UA 5A2AA 1GORA 1W1PA 1M03A 1JNDA 2VR5A 1VF8A 4B16A 1VRXA 4W8LA 3MSGA 5BRQA 3WNLA 3ARRA 3BLKA 1CGVA 3OIHA 1FP9A 4OKDA 1E70M 1ISXA 4PUDA 3U5UA 3VD9A 1J0HA 3FHQA 4MB5A 3AMLA 2YA0A 2OYKA 1C91A 5D4YA 2XIBA 3L4TA 3VD5A 1X6NA 1GJUA 3CZGA 1F4HA 3WD4A 3ARZA 4P8XA 3HU7A 4UQAA 1LF1A 4W8AA 3AIVA 2ZXQA 1I1WA 2WC4A 3WF4A 3OA5A 5CSYA 4PSRA 3A4AA 4PMXA 1WAWA 2YA2A 4FK9A 2VCCA 1ODZA 3F4VA 1EH9A 4V28A 3CZ8A 1US2A 3FAWA 3AS3A 3U7BA 3VKKA 2PBOA 5IHRA 2YL9A 2W66A 4GI8A 2IXVA 4QCFA 1ZS2A 2BY2A 1UD8A 2OSYA 5HXMA 3VO0A 1E6QM 1KWKA 2EPKX 4RL3A 3VIHA 1KBBA 1QW8A 3OGSA 1E4LA 2VRQA 2E3ZA 5D9OA 2C8NA 4OBSA 2E9BA 2VZVA 3IK2A 4QP0A 1PIFA 3WH5A 1TZ7A 1RPKA 4W5ZA 4KRTA 1TFVA 1BFNA 5AYBA 1XCXA 4UQBA 1LL4A 3ARWA 2J7CA 1LWJA 1E73M 1EHAA 2J7EA 3SCUA 4TXEA 3ARTA 2W61A 3AHZA 5A8MA 5GNXA 2HVMA 5I77A 1G1YA 1W3KA 1UD4A 2ZX9A 1CENA 3WQ5A 1VJSA 2X09A 2A3EA 3IANA 5I24A 1G5AA 2CEQA 3VMPA 4MB1A 1E9LA 2EEXA 4GI6A 1OM0A 4N0RA 2XFYA 1QI0A 3N13A 4PMDA 2J8GA 3OLEA 1UKSA 3RMEA 4V27A 5E0CA 2PWDA 2YOCA 3SCSA 3M07A 3UEQA 4URIA 4CUCA 4J3VA 4HZ6A 1BGAA 1OGGA 2WAGA 3TTSA 1B0IA 1JI1A 2E9LA 2DQXA 2ZX5A 3WF2A 1CDGA 5DFAA 3RJXA 2PWFA 3B9DA 2ZX6A 3DECA 2GFTA 1JFHA 3AS2A 2Y8KA 2VX4A 3VIKA 5JIPA 1PX4A 1M53A 3MUIA 3AIRA 2J8FA 5A8PA 3L4XA 4ZFMA 4ACZB 1H3GA 1FA2A 5A6MA 4ZE4A 4J3TA 4D71A 5EFFA 5FKYA 1HJXA 2J78A 4BS0A 4JFTA 3NYDA 5E0FA 1R87A 1V6UA 1QNQA 4H04A 4C7GA 4A4AA 3AHYA 1LL6A 4ZENA 1UR1A 1UR8A 5IHSA 4DWSD 5ECUA 2QV4A 1TMQA 1DEDA 1IZJA 3NSMA 4P8WA 5IFTA 3CHFA 4AZ7A 2BY1A 4LYRA 2ZIDA 3CTTA 2JIEA 2PWEA 4U5KA 3UESA 1E0VA 1EOKA 1E6SM 3N9KA 1H41A 1UA7A 3KZSA 3RM4A 4TX8A 4ZE5A 1IV8A 4P7OA 2VNCA 1R8LA 3RJYA 3UG4A 4CU8A 3W28A 2X1IA 1J11A 1GOIA 4X0NA 3CUGA 1GQLA 5CGTA 1HKMA 4JFVA 3AMCA 3T2QA 5GQBA 1W2VA 1J0YA 5GPRA 1CGTA 4UTFA 2BXZA 3GTNA 1GJWA 1Q6GA 2X05A 2A3CA 3SURA 4OJYA 5D9MA 3RPMA 2VCAA 1W9XA 4M29A 2J7HA 1AQHA 3SCNA 1G01A 4J3XA 4GZJA 2OYMA 3GBEA 3EBVA 1RH9A 5IXEA 4PCSA 1ZBVA 1NOWA 2VL4A 4FF5A 1UOKA 1CLVA 4BQ3A 4MAVA 4LYQA 1B3VA 3L4ZA 2YLAA 1QW9A 3WL0A 2VX7A 1JZ5A 1VFOA 1VIWA 8A3HA 3GZAA 4D6FA 1TE1A 3VIPA 1QPKA 1A47A 2XJ7A 3GXIA 2XYLA 1VFUA 3AMGA 5LA2A 1H1NA 2QPSA 5CLTA 3F5KA 2OWXA 1JDCA 3I3DA 3MMDA 5CPTA 1JIBA 3WL1A 2WHLA 2BV9A 4RE2A 1XD0A 1QI3A 5CSUA 4H8UA 4WKHA 1ZL1A 2WZHA 2J7FA 3VGFA 5EBAA 2G3MA 1HJVA 2CPUA 3PZQA 5E6ZA 3GDBA 1K9EA 3KEHA 4S3KA 2OYLA 3VMNA 4D6EA 3WBAA 4K68A 3K46A 2G41A 4AZBA 3WD2A 3WN6A 2WVTA 1BAGA 1KB3A 2ZWYA 3K4AA 3TP4A 2O9PA 7A3HA 3A47A 3O9NA 3ARSA 1C92A 4BQ5A 1U30A 1NWRA 1HL8A 3VDCA 3CUJA 2F2HA 3VOCA 1KCKA 2VX6A 2WM0A 3OGVA 2XIIA 4HTYA 2XGBA 1CXLA 1XD1A 2V3FA 5A6KA 2WHMA 2YLLA 4AWEA 1GW1A 1DWHM 4HA1A 2J62A 5ABHA 2ZOXA 1W9UA 1JF6A 3AZTA 2XGIA 3E1F1 3JUGA 1B2YA 2QMKA 4QLLA 1WPCA 1J0KA 3NCOA 1WCGA 4CGTA 3T0BA 2O9OA 1J18A 2VCBA 3W24A 1EOMA 3KE0A 2TAAA 2FDMA 4GO8A 3S2CA 2YDQA 4B3LA 4F79A 1R85A 1FFQA 4UFHA 3AHTA 3ZT6A 1I1XA 4ATWA 1GHSA 1CWYA 5CJ5A 1BF2A 1OT1A 1MXDA 1BLIA 5BXRA 2XVGA 1LWHA 2ZXBA 3WUGA 2PBGA 3VGEA 4HU0A 6CGTA 4XV0A 4WF7A 3WMBA 2GJXA 1VBRA 3WH9A 1JG9A 1MYRA 1BYAA 1QVBA 3VIOA 2WWDA 2PWHA 1KQZA 3KL3A 1E71M 2DEPA 4QAWA 1NOFA 1KCLA 1JZ3A 3MUZ1 3WUFA 3AYSA 3TTYA 1UD2A 3ZOAA 4W7WA 1GZJA 1GQJA 5D9PA 3AQUA 1DHKA 4PCTA 4PMOA 2YA1A 2XWDA 1XRVA 2DPEA 1JDDA 5A69A 1CYGA 3WQ8A 3U57A 1XC6A 4Z2LA 1B90A 4ML4A 3AIEA 1QI5A 2XSAA 3A3HA 3APGA 1B9ZA 3QHNA 3ZR6A 1V3IA 3SCQA 3T2OA 1UKTA 2ZE0A 1CXIA 3WMCA 3SEPA 1EO5A 2VT0A 3FXYA 1E6NA 1E6ZA 3AXHA 3VU2A 2XUCA 4XB3A 1KXHA 4D6IA 3VIGA 2ZUNA 4F66A 2VTFA 4DUVA 1L0PA 1ZJAA 2X0HA 5EFDA 3EYPA 3EDDA 5LYRA 2FH8A 4DWSC 1JI2A 2ZUTA 3WQ6A 3HN3A 2JFEX 1E3ZA 2XSBA 4CVWA 1KXTA 1E4IA 2XHYA 4H41A 5FL1A 4E8DA 5JBFA 1V02A 2GJXB 3EMZA 5HBFA 3WUEA 4Z2JA 3LPPA 2GDUA 1RD6A 5KZ6A 4H8VA
chains in the Genus database with same CATH superfamily
4KBXA 1IGWA 1VLIA 3W70A 3BAJA 3WKZA 4JIEA 3TSDA 3UI4A 4A8IA 2WMFA 3W1NA 5F4XA 2XDFA 1CXFA 1K03A 1XQKA 4A3HA 5AFDA 3KAIA 3DFQA 1I2QA 1YXDA 4IFRA 3FK4A 4INFA 3GH7A 1ROUA 1UZDA 1QMLA 3OU8A 2R94A 3ITCA 3M7WA 1DBTA 1XLMA 2ZE3A 1T96A 1PZ3A 3CQ0A 3TOPA 1V0NA 4JY9A 1UH4A 2PDNA 4XSLA 1IWAA 1G0CA 3PWAA 5HNUA 4R5EA 1ITXA 3OOBA 1MMFA 2D3NA 3M5ZA 3PG9A 1XYCA 1KTNA 2NVCA 4I8YA 1SQ7A 4ZGYA 1SO5A 3AALA 3AHVA 3EWCA 1VKFA 1BKSA 2E5CA 1PDYA 4FXJA 4UQCA 4EE9A 1ME9A 3ABXA 3ERPA 4LCQA 4Q4KA 1TR9A 4FP1A 3MHFA 3P93A 4NKCA 1Q1CA 3E49A 1NELA 2RKXA 4Z1BA 3MCMA 1JCJA 1DXFA 1QHPA 3UGVA 1MDRA 1C9DA 1HKJA 4ZR8A 3S5NA 5AY7A 2NSOA 1I4NA 3CZEA 3LQLA 1KA9F 2F8QA 2C19A 4JYSA 1XDJA 4HN4A 2QGYA 4PRWA 2VJXA 2VN1A 2R14A 3DN5A 1EDQA 1G9HA 1UWIA 3E74A 3PTMA 1CECA 2V63A 3RM9A 3QPZA 2R1NA 1W3LA 2PLMA 3R7MA 4D6DA 3QH2A 4XZ9A 3THDA 3P81A 4JTJA 4OTKA 5HW6A 1E6XM 1UR2A 2RDWA 5DY3A 2RGLA 1JCLA 3R89A 3CGNA 4KIEA 1NWUA 4W87A 4U5IA 3ZLGA 2FMOA 2QF7A 4K2SA 1U1HA 3DI0A 3S2JA 3FFSA 5DANA 1AZ1A 3GG1A 3QZEA 3EWXA 1DJYA 3DIPA 3AYTA 4NZCA 3SW6A 2F6XA 2XZ9A 4TIMA 2DSVA 3CUZA 1K6WA 3PFMA 2BHYA 1QHZA 1CGUA 4DBEA 2ON3A 2WZIA 4MNLA 5HANA 4GO9A 2B31A 4A8LA 1R5YA 1OFDA 2Q5AA 3KUMA 1C29A 4ZXOA 4PRRA 3O5KA 5IFPA 2ZFAA 1M5YA 2YXGA 4TW8A 1W5PA 3CU2A 1HVXA 1A7XA 3R8HA 2XPAA 1B3ZA 3DU0A 1DJIA 4M8UA 1U2YA 2VURA 4GJIA 2DSUA 2F61A 3M0HA 4F2BA 4X2RA 3SUVA 4RW3A 3PP7A 5B7ZA 1ECQA 3V5CA 3CZLA 3GR8A 3QYQA 4BF5A 4D8LA 1QNPA 3QR3A 3BXWA 3EIPA 1SU5A 3WDIA 3N2OA 4K8GA 5D2XA 1G67A 3L23A 3QFWA 1A3HA 4JD4A 5E9AA 3MKVA 3UCCA 5DIVA 1TE6A 4TR9A 3SIMA 1EWEA 1OQFA 1Z32X 4F40A 4ODMA 5DO8A 3ZM8A 3NL3A 3O5LA 1NVMA 4JKKA 1L9WA 5IBXA 4KEMA 2BOEX 1JAEA 4HYRA 3H2NA 2O0TA 1VBJA 1RXOB 1V8EA 4O17A 2HQAA 5FSDC 3LY0A 1O6IA 1XHGA 3ELFA 1XIFA 4JTLA 2MPHA 5HTGA 5GNYA 1VC4A 4E2DA 2BNJA 4J3SA 3ZSTA 2W4XA 3VDAA 3IVTA 4BI7A 4GUJA 1R0MA 2J8TA 3E38A 2KGJA 1NEYA 2OSXA 2E6DA 1DE6A 3VZXA 2BSLA 2DT2A 3L2MA 2NW0A 3M0MA 4W5UA 3NI6A 2ZVRA 2DVUA 2JZVA 2ONEA 4QITA 3FA4A 3W6MA 4WD0A 3LYEA 2J66A 2JE8A 3K8MA 2HPMA 4AHOA 1EPXA 1CBGA 5FI8A 1U1JA 5F1VA 3HPXA 3O6YX 2XIOA 1XYBA 2PDLA 3GFXA 1JYWA 5T9CE 2GDQA 1QFEA 5A6BA 3B4YA 5LNSA 4IH3A 3MUAA 3UERA 3L12A 3C3NA 5AHLA 1MWOA 5A6TC 4UTUA 3HQ1A 3UJRA 1NH6A 3ICJA 2ZQUA 2VVSA 3PANA 2XVLA 4NIRA 3LM7A 4IPIA 3S0CA 1UWTA 3GH5A 1A5OC 1YQ2A 3ZR4A 4H7ZA 3A9BA 4JYFA 5C55A 3SUUA 3EXTA 1EUAA 3MBDA 4KKXA 5J5DA 1G6CA 2INEA 2O7SA 4TOQA 3V35A 4LAMA 1IT0A 2C13A 3K13A 4UOQA 1W1VA 3MO4A 3QLDA 1WX0A 1Z69A 2GVJA 3HQOA 3E2QA 3LBOA 3GLCA 3E5PA 2QUMA 4WSKA 4O53A 4W86A 3QJAA 1XRTA 4ZVJA 3WLOA 1O68A 1VIZA 3EB2A 3O6DA 1XLFA 1LG2A 5HT1A 2OZTA 4JTIA 1W8SA 3QGKC 1UB3A 3RAOA 3HBLA 3IV8A 3VOIA 3GKFA 1XP3A 2E25A 2DSZA 2DUZA 4HT3A 1GVEA 4IMAA 4WIWA 3CGTA 1JXJA 1Q6QA 3R13A 3F2CA 5REQB 3MU7A 3GR7A 3U2OA 5IDZA 1NF7A 3TROA 1WXZA 2GGEA 4RZ4A 2ZUVA 3LTYA 3AZSA 1W2PA 3MCOA 3WD1A 5B80A 5I2UA 4K3ZA 5HWBA 4ADSA 1O1ZA 3JW7A 3T4WA 1EO7A 3M5YA 4MADA 1X7IA 1RA5A 4NX0A 5I78A 5HAOA 1SFLA 3S1WA 4O1DA 2EG6A 1OFRA 3W7JA 3R25A 1QK2A 3K1GA 1BXCA 1GGOA 4M81A 4Q8QA 3RIKA 3MMUA 1YLVA 2ZBTA 4BEQA 3CUHA 1XS2A 3KXQA 4IGSA 3IJ9A 3RGCA 1XKYA 5C70A 3UZJA 3SBFA 3MUY1 4KIRA 3MMWA 1GG1A 2C6QA 4GH1A 3GD6A 1UD3A 1TUXA 3TNOA 3PRAA 2PS2A 3C5QA 4DZ3A 4W4QA 2DY3A 1DE5A 4PB4A 1RALA 2VFIA 2HISA 1J01A 3U8GA 2ACQA 3MC5A 4FLRA 2P50A 9CGTA 2EPHA 5E70A 4LVDA 3OOQA 3RUBL 3MHGA 3RR4A 1XYMA 3V16A 3T6CA 2D24A 3F03K 3MA8A 4N9DA 3W88A 2JGYA 2D9FA 1UUMA 4NNCA 1QO5A 3IJ7A 2P3ZA 1OD8A 4AU0A 5EL1A 3G1FA 5M5DA 4W8BA 1JYXA 1Z42A 1GYNA 3F4NA 2WPGA 3W37A 3QC3A 2R1KA 1EHNA 2G3NA 2YFOA 2GQ3A 3GKAA 4LCRA 4UNLA 1J93A 4ONVA 2GGJA 2GVGA 4YJ5A 2IW0A 3EOUA 4BEUA 2V5LA 3PPFA 1UH3A 1H7NA 2AQVA 3ARVA 1U5JA 2VEIA 3GM8A 4LANA 5HULA 1RJRA 4Q4SA 3KZ7A 1H5VA 1XBYA 2Y62A 4Y9NA 4WOQA 4HOZA 2WJFA 1UBSA 2PTZA 2ZA1A 1H7RA 2OGYA 2H90A 3MPGA 4C1LA 5HNNA 1LJYA 1XH0A 4DT4A 4IGHA 1PIGA 1C8VA 2DZWA 3P67A 4FNRA 2FGLA 3DBNA 4XAKA 2EHHA 4IIBA 3TYCA 3S1XA 3LERA 4PEKA 5DF0A 3LU2A 3W7IA 3BAIA 2W91A 2QF8A 4GK8A 4PTMA 4QBXA 3AS0A 3P5YA 3DFOA 1KR1A 1WB0A 5HOSA 5BYWA 1P7TB 3UWYA 1B3YA 4C6EA 4PMQA 4QG6A 3G8EA 2PDXA 2WHKA 2Q71A 3WLNA 4IICA 3NOEA 2NUYA 4DJEA 3E6EA 1XR2A 4JTHA 3ENLA 1DWAM 4DZAA 2BOGX 2QLYA 4UIOA 4LGXA 1B31A 1TQJA 4KERA 4ZQRA 4H6RA 1E55A 2VI0A 3WIJA 3S6DA 1OINA 1FWNA 3TC3A 2WMIB 5E5CA 1EXBA 5FJOA 2HVOA 5K3VA 2ABBA 1A5MC 4HK6A 1HIZA 2CLHA 5FA5A 1BVNP 2V3DA 3GUWA 3F4DA 2O7QA 3WYZA 3WBWA 1BHGA 4CQCA 3OLGA 2PTYA 1PTDA 2HNEA 4DWSA 4TU1A 3TTOA 1SFSA 4PUEA 2C16A 2VEPA 2GK1B 4Q8WA 1DIOA 5D04C 3PZNA 2FJKA 3AXMA 2QJGA 4X9YA 1EYEA 3EPOA 1CW2A 3C86A 1VYRA 2WKGA 4ECLA 5BXSA 5CLWA 4CD8A 3EXSA 1U79A 4G8TA 1IIHA 4J27A 3KTXA 1KRBC 3ARYA 3STEA 5AVNA 5HPOA 1FKJA 4PMVA 2EJ1A 1THFD 1OGSA 4JFUA 1J79A 4C6JA 3ARUA 2Y4SA 4C6CA 4GGHA 4LY8A 3VILA 4ADUA 1VCVA 3FHAA 2HSAA 2G97A 4CQBA 3MV01 3C2EA 1UD5A 3NZGA 1T8XA 1XH2A 2ACRA 3B03A 5BXTA 1TPEA 1F40A 3POCA 5G1TA 4MOZA 4XKYB 4GISA 1I9CB 1XSJA 2XFWA 3AZRA 3BOFA 3CT7A 1C9HA 3W1RA 3W81A 2KZHA 3BH4A 3P3BA 3C3UA 5A95A 3M0XA 1PTAA 3F5JA 3W86A 2FZMA 3RCMA 3GYCA 3N04A 2XP5A 4C6PA 3HQNA 3EPMA 4JKLA 4JTGA 1DWFM 3GNDA 4LC6A 2XU2A 3G6MA 3EX1A 3VAVA 3AFBA 2CKRA 3FYYA 4F48A 4ATLA 4J2PA 1WKFA 4MNMA 2VOMA 4MKNA 5FF2A 1JDEA 4H2CA 3QSTA 4MJZA 1VFSA 4KWOA 4Y8FA 2FPTA 3XIMA 5FEXA 5AN7A 4FZIA 1FD9A 3R8RA 4AD5A 2G37A 3EOLA 1LL7A 2DZAA 3TJ4A 2WKLA 2WLZA 5G1MA 4AIEA 1H7PA 1LBLA 2F4EA 4ITZA 4ZO9A 5DXXA 2UV8G 1HT6A 3FXGA 5H2ZA 3COTA 4EAMA 4JX5A 4RDZA 1J12A 3FJLA 3JRKA 1R7OA 2XFFA 2YYTA 3K1DA 3C8NA 2E9MA 4M6UA 1GVRA 7XIMA 2VX5A 1DXIA 1JCMP 1C7TA 2WKJA 1KW1A 2ZZ5A 3PHAA 2HBVA 5FJPA 2WQPA 4ZOBA 1RBLA 3W2KA 1OSEA 3DYPA 3BAWA 1UKOA 3PNUA 3UR2A 3KL5A 3RPDA 2YKKA 5DCEA 4BQ4A 3ALGA 2IUZA 2JK2A 4AD3A 5DO2A 3B8TA 4PCNA 3VKDA 5A1AA 4AXNA 2DVTA 3AMKA 3GUGA 3DESA 4MWAC 5C9RA 3G1AA 4GGQA 1XX1A 1H0IA 6XIMA 3B9NA 4UR8A 4DLMA 4WDUA 4KFPA 4M82A 3VIIA 2BODX 3URAA 2MLXA 2QDGA 4TTUA 3LGDA 1LBMA 3ONCA 5AOUA 3BCFA 4LB4A 3CEPA 1X1NA 2M08A 1L6YA 4TVCA 1LTDA 1YMYA 1KQYA 2F9RA 6TIMA 4CNUA 3PS7A 1GHRA 4YTQA 4RE0A 2G0WA 3M0IA 4B5TA 4DQWA 3DFSA 4CN4A 1SZEA 1JAKA 4U3AA 4ICNA 1KRCC 4IIHA 1AG1O 4HA3A 4WOZA 4YTTA 1GOWA 1UP0A 1D2KA 5AZ0A 3W1PA 4UR9A 4LBUA 4LS2A 4S1FA 3V0SA 1U33A 4J3WA 3NQ8A 5TBOA 4B9YA 1JD9A 3R4IA 1D6OA 5I02A 1UUQA 4JTUA 3QZ6A 2ZVIA 4YNGA 1HO4A 1TWSA 2LPVA 3N6HA 4WXYA 1TIMA 1EYWA 3R10A 4GHRA 4DM1A 5C7VA 5BOEA 3PF3A 1M7PA 5AHMA 3D46A 3TFXA 5EBUA 1TV2A 3R94A 3TZNA 2I17A 4JFKA 5HK4A 5CG7A 5FEZA 2V9DA 1TPDA 3DHUA 5I00A 1NSJA 1UWQA 1D3HA 4K1GA 4R7WA 3V5FA 3VX0A 2VC7A 1LQAA 1IR1A 5HDRA 4AZ5A 1NF0A 3N11A 3CIVA 4EWJA 3CZKA 3TOYA 2Y2WA 1FHUA 2G4FA 2I7GA 5AC5A 1QBBA 3CQHA 2PDIA 3OGRA 4FAPA 4G56A 2ZX8A 1JFXA 3PRDA 2BOFX 4IFKB 4C1KA 3BJTA 3QKZA 1J5TA 5GJNA 2B7PA 4AC1X 1J9YA 1XGEA 3GDRA 4ZZ9A 1ADOA 2J13A 3WQPA 1CIUA 1E5NA 4XAFA 1Z7AA 3C0SA 3UYIA 1TA3B 3Q37A 4W88A 5LA1A 3B9EA 4DRNA 3LA4A 1LM1A 4TNSA 3NUKA 2ODOA 3N2MA 3U2CA 4GY1A 4B4FA 2PDUA 3OHMB 4ODNA 5CPQA 4AW7A 1L8NA 5D2YA 3IK4A 2E40A 3M9YA 2DT0A 2OJPA 1UR0A 1VEOA 4Q8OA 2GLKA 1K7FA 5IOBA 3RRAA 1R2RA 1RQBA 1SJAA 2RSEA 3UNTA 5DCDA 3AIUA 3TQVA 1TB3A 3WQWA 2XG9A 3E96A 3C2YA 3EOOA 3CV7A 4JX4A 4GC3A 4AVNA 4HZ7A 1SJDA 1K3UA 5CXPA 3FS2A 2WHJA 2GVYA 4NU7A 1Z48A 2XM1A 1A3WA 2Z6IA 2VGBA 3SIZA 3G1SA 3TH6A 3G1VA 2CLMA 5AC6A 3BSHA 4GABA 2BMBA 4KCUA 2P8CA 4IT1A 4GG9A 3ZWSA 1QT1A 4HHPA 3MYPA 4Q8MA 4US6A 4BR1A 3A5VA 4DO4A 4GYKA 1DYSA 2NT0A 2UZ9A 1V6TA 4O1AA 2OLHA 3W1AA 3WK0A 1UR4A 4HU3A 1AD4A 3Q2DA 4LF2A 4IPLA 2ZUWA 1S3TC 1A5UA 3TU9A 3TKFA 1PXGA 1UCWA 1GRJA 3LMYA 1VD6A 1JNSA 2VDIA 1V3JA 2BTMA 3MS8A 1U1UA 5JBDA 1QRQA 3LENA 5HQMA 4HMEA 5DT5A 3B9AA 3I7QA 4PUMA 3ATZA 4IOTA 3BAYA 3S47A 1DHPA 3G8RA 1V4YA 5FSEC 2V81A 3UQIA 4HCHA 4OBRA 2OG9A 1PKNA 4D8AA 4HOXA 1SR9A 1KBKA 2VQTA 1WZMA 3KOFA 1OEPA 4E6MA 1CZ1A 2FB2A 3PAJA 3TC7A 1QPLA 1HX0A 4Z1CA 1FKLA 3JZUA 4EF8A 2W92A 4LV4A 1DJQA 1EB3A 3L4UA 1NMWA 4UTJA 1E51A 1W1PA 1M03A 1JNDA 1VRXA 3EA1A 4W8LA 2Z6JA 5BRQA 3P6LA 3ARRA 4L6DA 3EXRA 1FP9A 4OKDA 1GKQA 3U5UA 2TPSA 1J0HA 3FHQA 3E0VA 3AMLA 2YA0A 4MB5A 3BWWA 3VOJA 2OYKA 5D4YA 2XIBA 3F2BA 3VD5A 1GJUA 4W9PA 4IIEA 2H8ZA 1SFJA 1I2OA 3AIVA 1NJJA 2Y78A 1I1WA 4ZQCA 3TYEA 3WF4A 4NYUA 3VFLA 1FWSA 1X98A 5EA9A 4W9QA 3AYVA 1XLIA 4PMXA 4R9XA 2OMAA 3PWIA 1WQ5A 3M1ZA 1YBQB 3LHYA 3EWDA 1US2A 1A49A 3AS3A 8TIMA 5IHRA 1QDSA 4B5NA 2Z26A 4QCFA 1ZS2A 4FHAA 3MI3A 3G1DA 3VO0A 1DQWA 4J3ZA 2VHLA 1E6QM 2EULA 3UD6A 3W2NA 1NAL1 4RLIA 1E4LA 1MUWA 5D9OA 2C8NA 3LUTA 3AXKA 4GC4A 3FEQA 1J4EA 1PIFA 4ENLA 2C1GA 3M41A 3F4CA 4KRTA 3LCGA 5AYBA 4B5VA 1KM5A 4ZO7A 1EHAA 1HKWA 4GY0A 2J7EA 4TXEA 4ERAA 1H7OA 1R9YA 4JYEA 2J6VA 2H9AB 5KZMA 4PUWA 1EC8A 5PTDA 3C52A 1S5WA 2ZX9A 3WQ5A 1B9BA 3CAWA 5CBIA 5I24A 4O8AA 1YKWA 1XFCA 5T91A 2PU1A 2GL5A 1J6OA 2Q09A 3R8GA 4GI6A 1OM0A 2OCZA 1HFBA 1KKRA 3LRMA 3RLHA 3LMZA 1CX9A 2I5IA 2INZA 1SSDA 2NUXA 4URIA 3UPMA 1ME7A 4V15A 4HZ6A 1BXBA 4F0HA 1SPQA 1MSSA 3IGHX 4C5ZA 1CDGA 4LUSA 4OWGA 2ZX6A 2GFTA 1JFHA 3VIKA 1LT8A 2GQAA 2A3LA 1XLAA 4K7YA 3AIRA 4AX7A 4ZFMA 2I14A 3H7UA 1H3GA 1OADA 4I5RA 5FKYA 3W83A 3WX7A 2E5BA 3W2JA 4QJ1A 4UCGA 3W74A 3H9RB 3IV3A 1UR1A 3TC6A 3TWBA 5IHSA 2QV4A 3XINA 2G3FA 3N4EA 1IZJA 3NSMA 3R12A 3CHFA 4AZ7A 4HGXA 3DERA 2ZIDA 5LXEA 3GR4A 1E6SM 5EGRA 3K4WA 1G4PA 1UA7A 4IF2A 3RM4A 3NQDA 1XG3A 3BCJA 4ES4A 4U28A 2Z1BA 3THQA 4CU8A 4CQDA 4QR6A 1PKLA 3QW3A 4X0NA 3CUGA 2F7FA 1J4IA 4C6OA 1RA0A 2V69A 1HKMA 1WBJA 4JFVA 5C2CA 5KTLA 3ZLFA 3T2QA 2KI3A 1J0YA 1CGTA 3TLLA 1TPFA 4HPXA 4UTFA 2BXZA 4AG0A 1GJWA 2YFNA 4ZPWR 3TTEA 4OJYA 3T8LA 3RPMA 2VCAA 3GW3A 2RDXA 1AQHA 1LRNA 1ICSA 5H8PA 1MXSA 3TYBA 3TYZA 3NQAA 3EBVA 1M7OA 1H63A 5IXEA 1ZBVA 2CHRA 2VL4A 4LYQA 1TCDA 5CC7A 1EC7A 1VFOA 3WLQA 2Z1WA 1S2AA 1TE1A 3VIPA 1AZ2A 3R43A 4JNMA 4WGHA 1VFUA 1UIOA 2FVLA 3F5KA 1EZWA 1PZ0A 3WL1A 3JR2A 3W7EA 1FKDA 1F6PA 3BANA 5F4SA 4Q8UA 1ZL1A 4EF9A 2X1TA 1TRIA 2J7FA 5EBAA 2OTDA 4DH0A 2ZC8A 2XH4A 2OX1A 3O6CA 3PZQA 5JH1A 3PA7A 3IRSA 4S3KA 4M6QA 3IJDA 3GC4A 1F07A 4AZBA 4R7JA 3V36A 2WVTA 1KB3A 3TP4A 1ZCNA 3EX4A 1C92A 2PTXA 4BF8A 2POZA 1FX6A 1GYLA 1U30A 5LIWX 3VDCA 3N2CA 1V7YA 3VOCA 4WJ8A 3M43A 5DMLA 2XIIA 1OCBA 4AF0A 4QE4A 1XLJA 4WY0F 3DC8A 2YLLA 4AWEA 1GW1A 4MLRA 2ZOXA 4PB5A 4QEHA 4X22A 3TJLA 3AZTA 2GOKA 1WPCA 2WSRA 1J0KA 5G4WA 2PWVA 4HNLA 5HW7A 3WLSA 3T0BA 4Z1YA 4QDPA 6REQB 1PIIA 1ALDA 2VCBA 2WJEA 3H54A 4YVPA 3DCPA 3MP4A 1Z8AA 3HG2A 4AQLA 1PCKA 2YDQA 4B3LA 2A21A 5H8UA 4CEXC 1R85A 2XIMA 1FFQA 3FA5A 4F0KA 3A22A 4N2YA 2QYGA 3H2CA 1FRBA 3HFTA 1OT1A 1MXDA 4D8ZA 3M0ZA 1LWHA 3U2EA 1R3VA 4ORMA 3MI6A 3VGEA 3FJ4A 2OR2A 2GJXA 1PVNA 1KNWA 5MKGB 1QVBA 2WWDA 1KQZA 2Z00A 2HS6A 2FYMA 3GSMA 4QJ5B 1BWLA 1PB0A 3MUZ1 3WUFA 3TTYA 3ZOAA 5D9PA 1PBKA 3KBMA 5K9DA 2ZZ2A 3TAKA 4IQDA 1R9ZA 1JCHB 3L7RA 1EX5A 3TCZA 3U57A 1JR1A 1XC6A 2PAJA 4Z2LA 1B90A 2FDSA 4XAYA 5A8GA 2TYSA 3F2DA 3LZ5A 4NP7A 4KW2A 4ML4A 3GDKA 1TV3A 1A5AA 3WJZA 3APGA 1B9ZA 2IPGA 3QHNA 4L64A 3SCQA 3OVGA 2DUXA 3W7CA 3SEPA 4DBUA 3FXYA 4YTSA 1DORA 3FGCB 1KXHA 1UUOA 3KP1A 4TW7A 2XH0A 4D6IA 2ZUNA 3CWNA 1ML1A 1QPRA 4DUVA 1WDDA 1L0PA 1ZJAA 5G4HC 3EYPA 4Q4MA 3TNBA 1PO9A 3NM1A 2ZUTA 3WQ6A 1LQ2A 1X1ZA 5A5WA 4DJFC 4E38A 5LIYX 4CVWA 4MVAA 4G2PA 2XHYA 5FL1A 3F4WA 1XUZA 2PRMA 3HURA 3EA2A 4DPPA 4N9CA 4OBTA 3LPPA 3PNZA 4MKVA 5KZ6A 1SJBA 1GQIA 1SSGA 2ZR4A 4CEUC 2CXEA 4JQ4A 1MVYA 2VGGA 2ZDSA 2DZSA 3VC6A 2ZRZA 4KETA 3DXIA 3SCRA 1W31A 3TA9A 2YBVA 5FJUA 3CPGA 4QX4A 3W4RA 5EB8A 4K1WA 1I2PA 3EA3A 1KGWA 1WZAA 3PN8A 2VC6A 5HQLA 3N15A 4DJDC 3W84A 3S46A 4NJJA 5E09A 4TUFA 1VYPX 2TRSA 3GC2A 1IXPA 9XIMA 3W7QA 2VFGA 1OY0A 2E68A 1LQ0A 5U7SA 1GOOA 2WM1A 4FXRA 1E9ZB 3NIYA 4P2VA 4UQ9A 3IAPA 4FX8A 1EJVC 4FR1A 4GOAA 5IDIA 1O66A 1FWWA 3FJNA 1A5NC 1JPMA 3VE7A 2E09A 3WH7A 4DI9A 4ZPVR 4LAOA 4LFYA 1H0GA 2J9YA 4UFJA 1GVIA 4KT2A 5A6JA 2DG9A 5AYXA 3WD0A 4I3GA 4MNKA 3SUWA 3ME3A 1I8JA 3IUHA 2EF9A 3VM7A 1EF2A 3AISA 3IGUA 1F6KA 4O11A 3ZZ1A 4PMZA 3I3BA 5CZTA 3W1LA 4L4PA 3ABZA 4J2MA 3TIMA 3LV6A 2HK1A 2BASA 3UFYA 2WNWA 3TN3A 3QVQA 1NP2A 1D8CA 3MVTA 4UTWC 3OBEA 2F23A 2FZ8A 3I10A 5IM51 2RUDA 1QI4A 1HKKA 4NSBA 4HZ8A 5LGXA 4RJEA 2ACSA 3N14A 3HV8A 4B92A 1QR7A 4QZVB 3GG0A 2P8BA 1OFQA 3KCOA 1GVSA 2PV2A 4DUWA 2NT1A 1BQCA 4QLJA 3CB8A 1JNEA 2NX1A 4B3ZA 4TO8A 3O15A 3EX3A 1VH7A 4KCTA 3T4CA 5E1QA 3O1NA 3BL3A 3SCOA 2FZDA 4PTDA 1E43A 4M6VA 2NVAA 3APTA 2GJNA 4A8RA 3RGTA 2JEPA 1UD6A 5G2IA 4G6CA 2WANA 1K8CA 1PHWA 4R53A 4CCEA 3VVGA 4ACZA 3GG8A 1FWCC 2CWXA 4H7VA 5CPNA 1ZB5A 1WE5A 2QR6A 4P7NA 2ZYFA 2HEJA 3KHDA 3LG3A 2J74A 4NG3A 4MDPA 4B9ZA 1CLXA 1DQUA 2Z28A 3VNDA 4FALA 1TJ1A 2QJNA 2Z1KA 4K36A 1M9HA 2BB0A 3HOJA 1SJCA 5I3KA 1ZGDA 3WBYA 4ZB0A 4YLWA 4NF7A 4YHGA 1S46A 3A4WA 3K8KA 4NJKA 3AJXA 3MY9A 4O15A 2VUYA 4WK9A 1WUEA 4LC8A 1HJQA 2QCFA 2D22A 1E0XA 2VKZG 2A85A 3KCEA 1UQYA 1HN1A 4GPNA 4AHQA 4Z2KA 1K9DA 4RX0A 3OLIA 3I65A 1QI2A 1KLZA 1EIXA 1NQKA 2PDHA 2VR4A 1OIMA 4P5UA 3BURA 1O5KA 4UNIA 1OB0A 2E77A 4D9PA 3GXDA 4I9MA 3PUGA 4RK8A 5G5IA 1HKIA 3CAKA 5H91A 4ZQNA 2YJQA 3LV5A 1IQ8A 2CZEA 1IT7A 3B8SA 1QNOA 4LV9A 2QJHA 4C6NA 2O9TA 5KITA 3TSBA 1F8MA 1ADSA 3OP2A 4PRTA 1HJWA 5TD4A 1J0JA 3H4WA 2D69A 5JXQA 3T81A 4FO4A 1QASA 1MUCA 3ZO9A 3BMVA 2ACUA 3LB0A 4GXWA 1W1A1 5C7HA 4AZCB 1XSIA 2VRJA 2RJHA 7CGTA 3P60A 2WSQA 3W0KA 1XLBA 5JH8A 4M56A 4CD7A 2PC8A 2YGYA 1JDAA 3J7HA 3KM8A 4MTVA 1UH2A 4G9PA 5I79A 3GHSA 4QSFA 2UY2A 3PY2A 4UFKA 3D3FA 3CC1A 3CAQA 1FUYA 2VGFA 5M17A 4G1KA 3E0WA 3MZNA 3BUVA 3B06A 1A5SA 3SUTA 1KV8A 5JBEA 1RY0A 2PLJA 1O94A 2QUUA 4R85A 3CYJA 3LI0A 3CH9A 3LOTA 5HPCA 4NZ3A 2FHCA 1IEIA 4WKAA 4L72B 1K4HA 5ENLA 4US5A 3S8HA 2WCGA 3SSZA 4DIAA 3LNPA 1PE1A 2XH2A 3WMLA 3BK0A 3HJZA 4ODLA 4S3FA 2FTYA 4O4WA 4O1EA 3URBA 5BXPA 5REQA 4DUXA 4HCDA 8RUCA 1TREA 1M5WA 2Q01A 4AXKA 1ZAHA 3NDOA 3GIYA 4BA0A 1DJNA 4PMNA 2A7PA 5ABEA 3RU6A 3SQSA 4W89A 2X8RA 1DJHA 2HCVA 4PL2A 2R1PA 2VZTA 2BVTA 3HPFA 3JU2A 4R3UA 3PJTA 4MUZA 3NDYA 3NQEA 2HPIA 4NNBA 3M6DA 4YYFA 4IPXA 1QPFA 4AYGA 4D1IA 1IYXA 2VP8A 2OOGA 4L5ZA 2J4GA 4QJ4B 3IKDA 4P8UA 2NV2A 2D2JA 3RO6A 3H12A 2WNQA 1VCFA 2PDWA 1WKYA 4LAZA 3EZ4A 3W07A 1RZMA 3PR9A 3WDRA 3JXVA 3LCLA 3IIVA 4AEEA 4OV4A 1DTUA 2Q6ZA 1BYBA 1HXVA 5ECVA 4JCLA 2Z1XA 5C71A 2NQ9A 4GQRA 3R58A 3G1HA 1CCWB 1ZJIA 3GVVA 1L6GA 3C0QA 4G7FA 4AD0A 4MGGA 4MJMA 3H7RA 3EDEA 1N55A 4IMEA 1L2UA 4S2BA 3L2LA 4WDWA 1FHVA 5J5RA 2PV1A 1Y7VA 1V79A 1TWWA 3AIQA 4CNSA 1BG4A 1MEIA 1YDNA 1QOXA 4PMUA 1POKA 3WDPP 1Y5WA 1EUNA 4N6EA 1JXKA 1GPFA 3AIWA 5M3WA 4D6HA 1H4PA 1W1YA 1U5HA 5I3DA 4QCEA 4GINA 3SN4A 4H6KA 4LQ1A 3V75A 3ITOA 4U10A 2RDUA 4PUNA 2PDCA 7TIMA 4MJ4A 2H3DA 3BDKA 4PUJA 5E6YA 1GVQA 3T0CA 4Z2GA 5JUVA 5EY5A 3W87A 1J0IA 5HMDA 3HGSA 3KDNA 1K8XA 1XYAA 2MNRA 4GXPA 2VOTA 4GZEA 3MTWA 3TC5A 4G50A 3P82A 4MZ1A 1D7FA 5LHFA 1NDYA 1F73A 2Y5EA 1XLEA 3TQPA 1MW2A 4WKFA 1G4SA 2ZCGA 1RK6A 1V3HA 3OTRA 4U2YA 1P7TA 2D23A 3EDKA 1C8YA 1R3YA 1EXPA 4G7EB 3MDWA 1HQTA 4L6HA 3QQ0A 3MKCA 4CQ8A 3GZ3A 1QO2A 5CBBA 3G5EA 3W7RA 4GNJA 3II1A 1J0ZA 5DBTA 3WNMA 3B0YA 4J40A 2WMIA 1KR0A 2HMCA 1C93A 4BF7A 3H7VA 2RQSA 4IG2B 4M80A 1WOAA 1JQVA 3CUIA 4ORIA 3FX4A 4OOUA 3M5VA 4HPHA 3H4GA 2PWGA 3UCDA 2ABAA 3CL7A 4OFCA 2E8ZA 4RNJA 1KGUA 5F2GA 4QNEA 3AYRA 4I9JA 4R88A 3AJ7A 3W23A 4ZMGA 2EQDA 2V3EA 3KFTA 3WLKX 2ATMA 5EMKA 5DITA 2G5WA 1NFBA 3P0WA 1HJSA 3GXFA 1HG3A 4MY1A 3E2SA 1FHLA 1AJZA 1KCXA 4JOMA 4MWAD 2GK1A 3POHA 2O92A 4JY8A 1HUVA 5A2BA 2BFGA 5D05A 3WY1A 3G1YA 4UDMA 1MQPA 3PBGA 3SCWA 1GVOA 3KAGA 1XDLA 3O5MA 1OGBA 3N29A 2R9RA 4AVOA 1B5TA 3GXPA 2UY3A 5CAHA 4RE4A 4XUGA 4OZOA 2X7VA 2J6XA 3SCVA 1MXGA 4S3EA 1D3CA 1DIEA 1EGVA 3WELA 1OWQA 5F7UA 1SMDA 2VO5A 3IEBA 2IKIA 1KM4A 1KWGA 1SW3A 4XZMX 3T40A 4BWLA 1OJXA 5A2CA 3P84A 4A21A 4Y7EA 2QULA 2OGJA 2GJRA 2HBXA 1EJUC 1OVDA 4O18A 4U3CA 4JN7A 1W3JA 1OX6A 3UPBA 4I6VA 3BLEA 1AVAA 1B3XA 1KFEA 4DZHA 5JIWA 3PJUA 3P74A 3A23A 4XKYA 2VELA 4E8CA 2WBGA 1MW3A 4X0VA 1OCQA 1TVLA 2JKPA 2Z25A 4JL1A 1XRSA 2EG8A 4CNOA 5LNRA 1OBAA 1FWEC 4PB3A 2F2DA 1GEQA 1HXJA 1WZKA 4DI8A 4LYKA 3A6OA 2PP1A 3W9ZA 5EMMA 2PGWA 3CUXA 4HK5A 1M01A 1Q3NA 3PZOA 4DO7A 5DBUA 4W7VA 1ZBCA 4HZMA 1EX1A 3N2TA 4Y9PA 2XTKA 1XPGA 3WEOA 4R34A 3UT0A 5I7GA 3FJ6A 3SO7A 1JF5A 3P0XA 2OB3A 4E3TA 5HJLA 4PTWA 1N8FA 2CU0A 3KVLA 1P1MA 3FYPA 2QHAA 3BJFA 4IHCA 4GZIA 1X96A 3DC0A 4FIQA 7ENLA 1WA3A 4DVOA 1EP1A 1NM9A 3VDBA 4RCXA 1OX4B 2HK0A 3I6EA 1E5JA 4MY8A 3AICA 1GZGA 3IWPA 1OYBA 3N73A 1S2UA 5HWNA 1K02A 1ESWA 1HL9A 1O7AA 3L4WA 5B8IC 5H8MA 1VAHA 3LM3A 3IJ8A 4GXMA 3UWZA 1TIWA 2V5JA 1H1ZA 2QCMA 1I75A 4PFMA 4LSBA 1NP0A 3FAXA 4NI3A 3W2MA 3CO8A 1GOQA 2CHOA 4ZA0A 2C1HA 3VNYA 5LZLA 1P6WA 2GUUA 4NUWA 2D73A 3OG2A 1M7XA 1FH9A 3UG5A 4X63A 3W22A 4LW7A 3TW6A 2INFA 3K5XA 5A8QA 2CETA 3S5ZA 2GOUA 3BSGA 1LLOA 2EXOA 4LS0A 1Z6KA 1YE6A 1S3HA 3W2LA 5AC4A 3QC0A 2R6OA 2X41A 1TG7A 1ZK6A 2QCCA 1GW9A 3WSUA 3QHMA 4CU7A 1V3KA 4FNTA 4MYXA 1S38A 3QGVA 4TX6A 2QMJA 5KEZA 1Q65A 5D2TA 3VNZA 3CXOA 4MZYA 3CPUA 5G1YA 1ECEA 1D7JA 2VM8A 1NIUA 2J88A 2E7FA 1UKPA 4LUJA 5BZAA 1JVNA 1R3WA 2QGHA 4GVHA 3OHIA 2EKCA 3WFLA 4ODOA 1TMHA 3INPA 4JAWA 3WMSA 1JULA 3LRKA 3WFAA 3BCDA 4IJRA 1R3TA 1NY1A 4IQJA 2YR1A 5JU6A 2EPOA 3NGJA 1H2JA 2RDTA 3PBMA 3GXTA 3RN6A 5I6SA 1SFTA 5BOOA 2RFGA 3DENA 1FKWA 4TX0A 3PAOA 2B0MA 2VZSA 1ONXA 4S39A 3SECA 1PX8A 2OOFA 3NO3A 3I7SA 3O5JA 4KRZA 3LXCA 5DLCA 4IXXA 3NO5A 4H7CA 3SGZA 5CC3A 1AW5A 4RKAA 2YCIX 2WC3A 2ALDA 1HL2A 5CPLA 1S5TA 2VZOA 1XQLA 1YDOA 3W1XA 3E9AA 1UJPA 4I5UA 1HF6A 3WDHA 3B8UA 1Q8JA 3GH4A 5LNVA 3ZWTA 3NRKA 2WBKA 5G2WA 1TTQA 4XAPA 2QDDA 1TTJA 4GIAA 2AMGA 3I4KA 4FXFA 4V2XA 5F2MA 3ABSA 1VFTA 3AWOA 1UROA 3WNPA 1CI1A 1EQ3A 2MLYA 2POTA 2Z27A 3OQ8A 4MUPA 4AISA 2QPUA 4JTRA 4IFKA 3GTFA 4LT9A 3USBA 5K4ZA 1GUVA 1JUEA 3GTXA 3GNOA 1B1YA 2CESA 3KWXA 1BGGA 4LAKA 4EXAA 3P7YA 1A4MA 3RMJA 3WK3A 2VC5A 1TA3A 3W6LA 3K4DA 1W9PA 5KSWA 1I2NA 1BVZA 4KFOA 4J5NA 3S5SA 1ISZA 1FDYA 1GCYA 3GDLA 4UQEA 2W5FA 1E56A 2FB3A 4PBGA 1UPMB 5KETA 3M0JA 2CNCA 1SM9A 4W7UA 1OK4A 3C56A 1E15A 2ZRXA 1YRRA 4GBUA 3GIPA 3LRLA 1TRDA 2NX9A 2E6FA 3E02A 1GVFA 3QQWA 1XLHA 3VGBA 2FIQA 2X2YA 2XSXA 2KX9A 4P7RA 1EQPA 2B4GA 4HOWA 6TAAA 2A6LA 3FA3A 4UTHA 3C61A 3EDFA 2ALRA 4DM2A 2JKEA 4WVXA 1QNRA 1P0DA 1J2WA 4KF1A 3SSJA 5F2LA 1XIMA 3KLLA 4ACYA 1VBGA 3NTPA 2OFJA 3DX5A 3H4XA 3DFYA 4JFMA 1BSIA 2LGOA 1QAPA 4LVFA 3W38A 3MKKA 2YDAA 2ZRUA 3UF8A 1TELA 2NQ5A 3SM0A 3DHPA 4XZWA 4ZOCA 1H09A 3IRDA 1E72M 3GU2A 1FKKA 3MP5A 1WUFA 4WSHA 4GYFA 2BY0A 2ZXAA 4IISA 3C8FA 2V38A 4O1FA 1FWIC 4UTMA 4QJ3B 4GKLA 3LHTA 4W84A 1EP3A 2YL5A 4QM1A 5CC6A 1RK5A 1H60A 4B5WA 3WH8A 1W8GA 4OGZA 3WJWA 4JKMA 4KGJA 4KGLA 1CXEA 4UMAA 3MO7A 4QDMA 1E1CB 5D75A 3GVGA 3AAMA 4XZBA 4F0LA 2XVPA 2XINA 4I9TA 1WDSA 2AAMA 4GQ0A 1GEHA 1PBGA 3H2MA 1BYDA 3PZGA 3NXFA 3NPUA 3PRBA 4ZTYA 3NVDA 5XIMA 2NXIA 1KRMA 1ZBKA 2Y88A 1FKRA 1PV8A 3H24A 2DSKA 5D2WA 2ZZ1A 3N2BA 1Q5MA 4H8NA 1RCOB 2YB4A 1IXQA 4RE3A 3I4EA 2UWFA 1E6RA 1D8WA 2PB1A 4QQ3A 1AODA 5T8GA 1UPPA 1BYCA 3QN3A 3C2VA 4PGLA 1L8PA 3NPXA 1OCNA 5EKYA 4M3PA 4IFOA 2IPFA 3IUIA 4UTTC 3IARA 3CHDA 2FFIA 3NL5A 4HMDA 1SZNA 1MQRA 1KD0A 4POCA 1OABA 2V67A 2Y7FA 4FX6M 4L1GA 1F5ZA 4LS1A 3UW6A 1D7HA 3VIJA 3GXNA 4O19A 4B5UA 2R24A 1SO3A 2GJLA 3MWCA 4QTGA 3N34A 4PMYA 4U33A 3KLKA 3UNDA 4AZ6A 5H1WA 1Q7ZA 2CLKA 1FCQA 3KBVA 3U2ZA 2J47A 3WQVA 1UR9A 1IXNA 1YBQA 2O55A 4C65A 1V3LA 1AL8A 3PZIA 3AS1A 3G6LA 1M04A 3WNKA 4CCCA 2J7GA 5A3HA 1DXEA 2V30A 1MFVA 3CV2A 4N42A 2O9RA 4PH6A 5XINA 1A0DA 4KMQA 2V68A 2H3BA 1KXQA 5CGQA 4XTIA 2EJAA 5A2AA 3KVKA 1GORA 2DFAA 2VR5A 4LNYA 3DGRA 5JH2A 4BFAA 1CGVA 1HW6A 3OIHA 3IK8A 3H23A 3VD9A 3D6NA 1C91A 1YDYA 3L4TA 1IX5A 2PZNA 3CZGA 2A79A 2H6RA 1F4HA 1H50A 1S1PA 5CEWA 4DJFA 4UQAA 2H9AA 2FQIA 2R1LA 1JDFA 3KDOA 2WC4A 3OA5A 3HA1A 1KM1A 5CSYA 4PSRA 4JQAA 4RXFA 1WAWA 2RHGA 3PVFA 5IBXC 4DLFA 4FK9A 3E0LA 1Y5XA 1ODZA 4IL2A 1EH9A 4V28A 3FAWA 1X8CA 3MUXA 2PBOA 4H9MA 2W6RA 3ITTA 4WGXA 1KWKA 3FAPA 2EPKX 3VIHA 3UWQA 1MEHA 3W7OA 1KBBA 4O13A 1P0BA 4GNKB 1HO1A 2VZVA 4MIMA 1TX0A 3CL6A 1E0TA 1W5OA 1RPKA 4XBJA 3BLIA 5BW6A 1LL4A 3ARWA 4YXGA 4PFHA 1GJPA 1E73M 3S83A 4QHRA 3EEGA 3H2AA 3N6JA 3ARTA 4ODKA 3CB3A 1MZRA 1XC4A 5GNXA 4L9YA 3CHVA 4JNYA 3VC5A 1R2SA 1VJSA 4XG1A 5D2VA 5AC7A 2CEQA 3O7UA 2XGZA 2DQWA 3HZ3A 4YTRA 4QRNA 2ZQTA 3NZ1A 8XIMA 2PUZA 4N0RA 2Z4GA 4M51A 3HIJA 4H9YA 3WLMA 1J4RA 3MCNA 4GKTA 3S1VA 1UKSA 2QXWA 5HR7A 4JFLA 2YOCA 3GDMA 3LX9A 3WK2A 1EF3A 2PN0A 1BGAA 4DAIA 1B0IA 3PC0A 4PA8A 1JI1A 2E9LA 4DB7A 2ZZ3A 2KFWA 4H9TA 3RJXA 2PWFA 2ZRWA 2Y8KA 3AS2A 1DJWA 3MUIA 4DRMA 3L4XA 4HMNA 4ACZB 2PPNA 4ZE4A 3ID7A 3MZ2A 3LD5A 4BS0A 4JFTA 5E0FA 1V6UA 2ZDRA 4H04A 3IKGA 4IQLA 4TQTA 3AHYA 1LL6A 2Y70A 2IKJA 1Q2RA 5ECUA 2QJIA 4H83A 1PS9A 3SFKA 3V7PA 4DJFD 4JIPA 5AVHA 4F0SA 4Q7BA 3TMLA 1DEDA 5MF5A 2BY1A 2VGIA 2NX3A 2B7QA 2PWEA 3VOHA 4HK7A 1KT1A 1FWDC 4ZE5A 1R8LA 3JVAA 3M64A 1D7IA 3NZQA 4E3VA 9RUBA 4JTTA 6XIAA 1XXXA 3ORWA 5CGTA 5I03A 1LOSA 1A0EA 1JQXA 3ZFHA 3LBCA 3DI1A 4IUOA 5D30A 5HMSA 1S2WA 4TMCA 1I2RA 2UZ5A 3SURA 2QEZA 5D9MA 4FOJA 5M1TA 4EXBA 1W9XA 4DJDD 5H6HA 1P0EA 4C6IA 3B7XA 4MF4A 4GZJA 4O10A 3BOXA 4YMZA 2OVLA 4PCSA 4WY0B 2DJLA 3EWUA 1JRBA 4PZVA 1BD0A 4XBSA 3B05A 1QW9A 3WL0A 2VX7A 1XIGA 3DAQA 4RPPA 8A3HA 3UQBA 3ITVA 3RF9A 1S39A 1QPKA 2NV9A 2XJ7A 3UVIA 4RZ5A 3AMGA 5LA2A 5CLTA 1JDCA 3C4UA 4GIEA 4I9AA 6REQA 3MMDA 4UR7A 1D9EA 1O5RA 1QI3A 3UZWA 4XAGA 4WKHA 2QVHA 2WZHA 2SFPA 1TWIA 3T0TA 4JN8A 2G3MA 1HJVA 1A5KC 5FJTA 2GVEA 3KS5A 4NJHA 3QXBA 3G3DA 3KEHA 4AWSA 4HJWA 3K46A 3WN6A 2AQOA 1BAGA 3MT1A 2ZWYA 3H53A 1UC4A 4PC8A 2Y6ZA 1TTIA 1IEXA 4XZHA 3ARSA 3TVAA 4LAXA 1HL8A 4TW6A 4MFDA 3CQJA 5MKGA 3GTIA 3GB6A 3IIXA 3LTSA 3OGVA 2X1SA 2XGBA 1CXLA 2LLEA 2NZLA 2DU2A 2V3FA 1DWHM 4HA1A 2J62A 4ADTA 1EKOA 2QPXA 3KADA 3LGGA 4GYPA 1I0BA 4I6KA 3BV7A 2QCLA 3NCOA 1Q13A 3PSVA 2QJJA 1RHCA 3W7PA 3B8VA 3QY8A 4JBRA 4DEFA 2VEKA 2VFEA 1BRLB 1FKSA 4B2DD 1LLZA 2VYOA 3C2RA 1HZYA 1EOMA 1P6BA 2OZ3A 3FGCA 3BG9A 4DZIA 2I1OA 4ZQPA 4NZ4A 2PPOA 1J5SA 1KBJA 1UMYA 1NSGA 4NY2A 3PSWA 3BOLA 8XIAA 3S6OA 3VCCA 4LRTA 1X6UA 2ZXBA 3WUGA 3NZRA 1ITUA 1E9YB 4QSHA 4YCOA 1CB7B 3T05A 4HU0A 3NQ2A 4WF7A 3GU0A 4DXVA 1VBRA 3QMRA 3WH9A 1JG9A 2BGSA 3KL3A 3SRHA 1X8FA 4GFSA 4QAWA 3CTLA 4DJEC 1GZJA 1GQJA 4H3DA 4PTNA 2B7NA 2CLIA 1DHKA 4PMOA 3UG8A 1XIDA 2C3ZA 1XRVA 2DPEA 5A69A 1CYGA 2FAPA 3IGSA 3G22A 1Q2SA 4MFEA 4FA3A 2VWTA 3A24A 1R47A 3ANYA 4PCPA 3A3HA 4G5DA 2WZTA 1TV4A 4GIRA 1R9HA 3T2OA 3UVAA 2ZE0A 1CXIA 3GQYA 4PL1A 1E6NA 1E6ZA 3VU2A 4XWUA 1EEXA 4O57A 4IT4A 4HSOA 4FOUA 4AMAA 4F66A 1DJXA 4DELA 5KMYA 4IX2A 2X0HA 4AIBA 4KWSA 3U6WA 4U85A 4MWAB 3EDDA 5LYRA 2FH8A 4DWSC 3IJQA 4KS0A 3FSUA 3DKJA 4Y2WA 4Q8TA 1KXTA 1E4IA 3CV1A 4H41A 4A05A 3EX6A 5JBFA 1DIDA 2PGEA 5XIAA 3SY8A 2ZRVA 3R0UA 1PJ9A 1PYMA 4TTGA 1V03A 1JYVA 4M7SA 5C5YA 1HNYA 3SR7A 1V77A 2XP8A 1WP6A 2QQ6A 3BG3A 1KBIA 2VUNA 3TONA 3W7HA 5KZDA 3LI1A 3UETA 4F9DA 5AECA 3MJYA 1EEPA 1A53A 2A2IA 3M0LA 4DZ2A 4Z2IA 1QWGA 3QZAA 4A3QA 3L66A 1V6WA 3XISA 4CD5A 1XBVA 2D0FA 3QRHA 4QLKA 2GQ9A 1OHLA 2FGBA 4ODPA 3RRXA 4HBOA 3UWUA 5A6AA 4IMFA 1AMYA 4Q6JA 1EJSC 3W29A 1R86A 2RAGA 2HE5A 3P2VA 1KRAC 1NQ6A 3WQCA 4LAVA 2OT0A 3EEZA 4LALA 1XGZA 4EK7A 4GFIA 2FZ9A 1ZENA 1TVNA 1ZP3A 4E2VA 4WDTA 4AEOA 2XP9A 4B90A 1C9WA 3DFTA 4I90A 4IQCA 3UXIA 1F3TA 4LAWA 3C0JA 3PFRA 4MG4A 3B3DA 3W25A 3USZA 1ONWA 4K37A 2IQDA 3NQMA 4P61A 1OD0A 4FMVA 4GJ1A 3B0VC 1PWMA 3ARXA 2P53A 1OCJA 3BLOA 4AMCA 4RDVA 3SGUA 4L56A 3SQLA 3ZT7A 1AH3A 2PV3A 1PDZA 5I3IA 1W9BM 5HJXA 1A5LC 4UZUA 2V6AA 3OVPA 3L67A 2BWGA 3AI0A 3GC5A 1PHQA 2YSWA 2NVDA 2YBTA 3P5ZA 4QFUA 2I16A 3W3OA 4Z0JA 3BW2A 3FCPA 3OIXA 4E4PA 4YL2A 5DT7A 1K6AA 5FAJA 4FX7A 9XIAA 4UFIA 1Q8AA 1TPC1 4KWWA 4D2JA 3QF0A 3N18A 2IMRA 2MLZA 2QDEA 3AU6A 4GUHA 1GG0A 2CBIA 1WDWA 2NXHA 4ZOEA 4ZSUA 2A4AA 3C6CA 3HPZA 3BG5A 1H49A 5BMWA 4R7OA 1B6CA 3Q45A 3ZLHA 4MB4A 2XP4A 1Z3NA 1JUKA 3EB4A 3W85A 4I7VA 5HNRA 3WEMA 3V5OA 2G3IA 5SWUA 4UOJA 1FXQA 2ISWA 3RCYA 5MHBA 5K7JA 2V8ZA 2YBUA 4NAFB 3KRZA 2I56A 1W0MA 5CZ0A 5EPDA 4CQ9A 1ZZMA 2F21A 3G77A 2CLPA 1Q63A 4M0XA 5EU9A 1ELSA 3EAUA 1XW8A 1Y8BA 4WHBA 1YTEA 1YNQA 4XISA 1SGJA 4LPCA 1CT5A 3KBWA 2W67A 4BI5A 3HF3A 5HQEA 1F6YA 1KM2A 2GQ8A 1LORA 3MANA 4LX4A 2GWNA 3C2FA 3DFNA 4ZOAA 2GYIA 1AQMA 3MYOA 1IIGA 1MRAA 2PPGA 2YDRA 1HP4A 1V6YA 1F3XA 4QQUA 2RUCA 4AZCA 1UBPC 4LJ3A 2WVVB 2Z2AA 2WZEA 4BKNA 4JFSA 3I6RA 3VD4A 4GZ7A 4O4VA 5U4NA 3WH6A 4NASA 4N4PA 3M0YA 4NRRA 4NX5A 1RP9A 3BLFA 2IQ0A 4GRSA 3PPGA 2J24A 3MSDA 1A5CA 1UG6A 2KE0A 3EWWA 4AYSA 3KW3A 3K30A 2XVNA 3N2XA 1ZSXA 3WJSA 1GK8A 4HSHA 1OFBA 4JX6A 3VZZA 2WSKA 2QW5A 5M03A 1XV8A 1TR1A 3VXGA 4H9ZA 3S4TA 1VENA 3RFWA 1V0MA 2FMNA 2PF0A 1OYAA 2DJXA 5A6LA 3UR5A 1ONEA 5EMUA 1F76A 1KFWA 1LT7A 1JVWA 4FOKA 5BRPA 1XWYA 2V5CA 3ALFA 2I57A 4WJEA 3V1PA 1FOBA 2JQXA 3H2EA 4FXSA 3SUSA 3O5IA 2E6YA 1QNSA 1OFEA 2QUVA 2XP3A 5FF7A 1FCBA 1HP5A 4TYOA 3W73A 4BQ2A 3TN6A 2PTWA 1PUDA 2WMGA 3IJ6A 3DOPA 3OZPA 4AY1A 5HKGA 1DL3A 3GIQA 3IIZA 4EANA 3KAOA 1V0KA 5CJNA 3Q58A 1F7BA 2E6AA 4GD0A 3BW3A 1US0A 4X9SA 3NSXA 1FKBA 3NO1A 2YIHA 4REQB 3QPYA 3TWAA 3SB0A 3LN3A 1FHDA 5HNTA 1EJRC 3LQGA 1W5MA 2CLOA 2EPLX 1W3TA 2CZDA 3N25A 4ZXLA 3CIWA 4WZHA 3TYAA 4XO6A 4D6GA 3MB9A 3BMXA 4HNCA 3LPFA 3UP8A 3W7LA 4IPNB 1CGWA 3W71A 1CGYA 3Q67A 3TV8A 2A7NA 1WV2A 5CG0A 4JQ1A 5CQ1A 1WYIA 1HKVA 1OC5A 4GGBA 3M6YA 5AC8A 1FKTA 1LG1A 3EMQA 4HYWA 5G2HA 1J4HA 4Z17A 3UY7A 3GU1A 1E0UA 1US3A 3RR1A 4EX4A 2IF4A 2P0OA 2RURA 4PUKA 1F8AB 1U22A 4C60A 4EPEC 2Q02A 3NL2A 4C6DA 4GNVA 4Y90A 4G1NA 4CN6A 2Z1SA 1ZJBA 4L9XA 2NWSA 2PA6A 4A6GA 3RX3A 1WXJA 4M1RA 4XKMA 3GVWA 5DQPA 3HG4A 1M68A 1W91A 1TWDA 2R91A 4ZODA 4W85A 1LUCB 1X39A 1B4EA 4QT3A 4XX6A 1S5NA 2X0SA 1A4LA 5LA0A 5I07A 1F2JA 3GFYA 1H1YA 3LLDA 3EX2A 3VGDA 4KFNA 5LIXX 3GHTA 1FDJA 4DRJA 7ODCA 4MY9A 2Q8XA 5CGMA 4PEEA 3TR9A 2XWEA 4AIOA 4PTVA 4AZHA 3APYA 4CN1A 4UC5A 4YCPA 4KCVA 5K4XA 3QLLA 1XFBA 3VNMA 2VEGA 1EA9C 4RZBA 3N3TA 1IR2A 1TJRA 1JGMA 1XSKA 4HN8A 2AMXA 4Y9MA 2FHFA 5HJYA 2DP3A 4HP5A 5HUPA 4FNSA 1IWBA 1ODUA 1XLGA 3DYOA 3M5XA 3TW7A 4C6QA 4HD5A 3S6TA 2ISVA 1FTXA 2ZUSA 1DWJM 4G7EA 4R27A 4BCEA 5C9WA 2WWCA 3PZVA 3S1UA 3UJ2A 4KCWA 1A80A 1CXHA 4LRSA 4NZJA 1GKPA 1HJUA 5DMNA 5CZJA 3SGGA 3WQDA 3S5YA 4HBEA 2J25A 1ZHAA 1EPVA 1WDRA 5LNWA 2JF6A 1EGZA 1RP8A 2PWUA 2CC0A 3ONBA 2GGIA 1ZJHA 4NHVA 4IG2A 3UR8A 2PDQA 2WV8A 4Q22A 1O5QA 2XH7A 3CAVA 4X3ZA 4Z1AA 2ICSA 5D02A 4RUBA 1WOBA 4XZLX 4AVFA 3KS6A 1G7UA 1NMVA 2Y8UA 1R38A 4C02B 5EMLA 2L2SA 3CS2A 3MWAA 2PGRA 3T0DA 1SMAA 3E0IA 3VOFA 2WLYA 3W02A 3L9CA 2YL6A 1Q6HA 3TXVA 3T09A 3I68A 1P1XA 5CJMA 2P3EA 3TQKA 2BS9A 3UF9A 2G8ZA 3WLLA 5I3JA 4B3KA 4EIVA 3R79A 3SN0A 4ML9A 5C8BB 1XGDA 3FN9A 4GE8A 3LLXA 2HXUA 4O50A 1EYMA 3G24A 3BAKA 1O60A 4QE5A 2J7DA 1WNOA 3OB8A 3PZMA 4HYVA 4QS5A 1H11A 4GUIA 4MDOA 3ZSSA 3FKRA 3NQFA 2PEVA 5BMXA 1GVYA 4DNMA 4V1YA 4EACA 3UXKA 4WUIA 1P0KA 4JTAA 3EOEA 5FCZA 4L61A 2GDVA 2WO5A 1G7VA 3N1AA 3DYMA 1ZCOA 4DY1A 4DAFA 1EDGA 3M7SA 3HFYA 4ZEPA 2WK2A 2WPBA 3S5OA 3VGHA 1GOMA 1FKIA 4NNRA 4Q32A 4TX9A 3O5GA 4AH7A 3NR0A 2C14A 5AZ1A 3M0KA 4X61A 5RUBA 3L5LA 1YEYA 1C90A 1VHCA 4I5XA 2ISDA 1VBUA 3E2RA 2VVNA 1W3NA 2VC9A 4O0ZA 2ZR5A 4NRSA 5HW8A 3LEPA 2XM2A 3OODA 4S3JA 1Z9AA 3U7VA 3D0CA 4IT6A 4LU0A 1UZHA 3H8AA 4Z42C 3BAXA 4HARA 1RBAA 3TYDA 1XI3A 2HZGA 5E0KA 4I7WA 3SQMA 3B0PA 3CQIA 3JYJA 1XJBA 2JEQA 2BY3A 1A3XA 2X30A 3BQ6A 4HSNA 3WUBA 1X6LA 1OX4A 1H7WA 2VDGA 2Y0FA 3GU9A 1G4TA 3RLVA 1FWGC 3T42A 3FLUA 4V1XA 3CZJA 1KLYA 4IX0A 1T5AA 4WEVX 1IT8A 3RLGA 3CPRA 4UTTA 3KL0A 2I5QA 4LEFA 4Z0SA 1QOPA 4L4OA 2GUBA 2VFFA 3LZ3A 4YHEA 1XIEA 3H26A 2CZ5A 4GCXA 2CIPA 5HUOA 1IHIA 7TAAA 2OU4A 3G2GA 3D5HA 2PDGA 2F84A 3H55A 1AUSL 4HHMA 4R33A 4XQ6A 3D3AA 2LJ4A 2DZUA 4TVUA 3GY1A 2GGHA 1IF2A 2W79A 1DWGM 3R11A 1FAPA 1ISYA 1Q6CA 3MMTA 3B97A 4ODRA 4PTXA 3KVMA 3WLTA 4NZ1A 3ZMRA 4GLEA 2HS8A 2PRHA 2C0HA 2WMJA 4L7ZA 3VPLA 1KM6A 1H51A 3WO8A 2RGMA 3N9SA 3THAA 5E9XA 2CERA 3WZ0E 3IUDA