4DWSC

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
539
structure length
526
Chain Sequence
KPTENIPSPILVEDKYTEETYSRPDVNFEDGSQGNLSYTATRVCAPMYNHYVGDKTPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKVQEVWDGWNAQAPSLGLPQIGKGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDDGENYVLLIKELRSALDSRFGYSNREISIACSGVALKKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAGHFISLDTPRTVKQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADSNQETIDMGPLYNPGEIYLKSISEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
molecule tags Sugar binding protein
molecule keywords Chi2
total genus 184
structure length 526
sequence length 539
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsC01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsC02
4LXFA 1TE1A 3AIBA 5A6LA 3NDYA 1KFWA 4WSKA 4B3KA 1E6SM 1JF5A 3BAXA 4H8UA 4BQ3A 5CXPA 4CD4A 2W66A 3IANA 1UR4A 1H49A 4D6DA 1R7AA 1W2PA 4JHZA 2D0HA 3MO4A 2BXZA 4HOWA 2WLZA 3BAJA 1WDRA 2Y8VA 3JUGA 2J7EA 1NM9A 3S2CA 2WSKA 1HT6A 3RIKA 4MPKA 4AXNA 1IV8A 5JH8A 3VVGA 4AWEA 4KWUA 4GO9A 2OWCA 3W28A 4D6IA 4AEFA 2BVTA 1RD6A 1PX3A 3AIVA 4UOZA 2BVDA 4FLQA 5EMYA 4WKFA 3ZT5A 1B9ZA 1EHAA 3TA9A 1HKMA 4BCEA 1JZ2A 1G9HA 1S46A 3GH4A 3GBDA 2WAGA 1QHZA 2WANA 4MNMA 1MW3A 1CENA 3UEQA 4ACZA 3AS1A 1V0NA 3GNPA 4AZCB 2XFFA 3U7BA 2ZOXA 4W5UA 2X0YA 3ZMRA 1PBGA 1J0YA 1H41A 5ABEA 3WUFA 1W3JA 2DSWA 2QMJA 2A3CA 2VZTA 3S6TA 1V3MA 3VNZA 3GM8A 4MDOA 3VGHA 3E1F1 3LPPA 4J7RA 4UOJA 1GONA 2C7FA 2WBGA 1UOKA 5AYBA 2DIEA 1LG2A 1F4HA 5ABHA 3RILA 4W86A 3MV01 2WVVB 5I0DA 3VM5A 3AIWA 5IHRA 3WH5A 1H0GA 4AD0A 5A6AA 5BRQA 1J10A 2E9LA 1UWIA 3O6AA 3CZ8A 4M80A 1G5AA 2AMGA 3CZKA 3BGAA 1GVYA 4DWSC 4HTYA 4JFUA 1OT1A 4P8XA 2ESCA 3DC0A 1JYNA 4W8LA 1QI2A 2XM2A 4D6GA 2BV9A 1SR0A 4W84A 2W91A 3CUJA 1X6NA 3FHQA 4L4PA 2CPUA 3ARTA 1K9DA 1VIWA 2WZHA 2WYSA 1E4MM 1E4LA 1W2VA 2RGLA 1MXGA 3PTMA 4CCCA 3WF2A 1AQMA 1PX4A 3CMGA 1RH9A 3VD9A 3AMLA 4D6FA 1ODUA 2G41A 1R87A 2YDRA 1V3HA 3VD3A 4EAMA 4B3LA 1LG1A 4F9DA 1KR1A 1GHRA 4NF7A 4FK9A 1J0HA 3WKZA 3L4WA 3SUTA 1J0KA 2WHLA 3K4AA 1B3ZA 1UD5A 4PCSA 4MB4A 4JCLA 2D0GA 3LPOA 4PTVA 1ZBKA 5A3HA 5A6MA 1W9VA 2FHBA 1BPLB 2GK1B 2WVUA 3T2QA 3ZJKA 3EDJA 1UD6A 2EJ1A 2C8NA 1BLIA 4KRUA 3WNPA 2VR5A 2WW5A 3KZSA 3W26A 3WFZA 2ZX7A 3BMWA 3NUKA 1EOMA 1VAHA 2W61A 4JKMA 1E6RA 4PMUA 1BFNA 1YHTA 3AHYA 2ZICA 1KGWA 5A1AA 2YL5A 1BG4A 5AY7A 3IJ9A 3QR3A 3FXYA 2DSZA 2WHMA 3RCNA 2PBOA 1W3KA 3WMBA 6TAAA 3WEOA 5FL1A 3OG2A 4ZE5A 2VQUA 1WB0A 1QHOA 4GINA 4AZHA 5A6KA 3VGBA 3AMGA 3OLIA 5I23A 4CD5A 5ABGA 5A95A 1DEDA 3T0DA 1VFFA 4P7OA 2VZSA 4UQCA 1FFRA 3ZR5A 1FOBA 1UKSA 1J0JA 3BSHA 3WFLA 1UR9A 4LQ1A 4P8VA 4URIA 4PMZA 1HJWA 3VIFA 4IUGA 4MNKA 1C7SA 3GTNA 5FIPA 1B30A 4C7FA 4LX4A 4M81A 4J3TA 1PEZA 3L4UA 2DSKA 3VGFA 4DM2A 2VNCA 2JFEX 4M24A 2CXGA 3WQ6A 4F79A 2DPEA 3L2MA 4JL1A 1Q6DA 2ZUSA 1HL8A 5M5DA 2O9TA 3RO8A 4X0NA 3AHTA 3AIEA 2WNWA 5E09A 3QHOA 1VEPA 2DIJA 3MUY1 5JBDA 3WIJA 3MS8A 2WWCA 4GIAA 4PTWA 3WUEA 4J3WA 2HISA 3THDA 1HNYA 1UD2A 4AZ6A 5I77A 4AD5A 1XSIA 2EPMX 3CHEA 6A3HA 4PMRA 1LWHA 3A47A 3M7SA 2GDUA 1V6XA 4WIWA 3AMCA 3PZGA 2D23A 2BHZA 5EB8A 1FA2A 3WEZA 5CZKA 1BF2A 1BG9A 1A47A 1GOMA 4LGXA 3VIMA 3TONA 3VGGA 1MWOA 1CNVA 4S3KA 1EQCA 3FN9A 2VCCA 3W6LA 4ATDA 4WKHA 3AYRA 5GQBA 1DWJM 1W9BM 2WLYA 4W7WA 3DHPA 2UY3A 5M17A 1R85A 2G3JA 5D8ZA 1MW0A 1EDQA 3PZOA 1ZBCA 2CIPA 4Z2LA 1C7TA 4A3YA 1KXVA 3WH7A 4A3HA 3WD0A 1KR0A 3WBEA 1EDTA 1EIBA 2GJXA 3WY1A 1E9LA 1DHKA 1JZ6A 3GXIA 4MADA 2DGAA 3AMKA 2PWDA 3ZJ8A 1H5VA 5E6YA 3VIPA 1M01A 5C70A 2GUYA 4M29A 2XHYA 1TZ7A 2WMGA 1BYDA 4NZCA 1HVXA 1CPUA 3AZSA 1HJXA 3ZO9A 3MMWA 5CLWA 1KBKA 2E8YA 5TD4A 3ARRA 2JIEA 2J8FA 2A3HA 3CHDA 3NSXA 1BTCA 4TTUA 3SCPA 4HU8A 2WMIA 1QI3A 1UQYA 1SYTA 3RM9A 1TMQA 1JYXA 4CKQA 4M1RA 2E9BA 3T0AA 3TP4A 2W92A 1OM0A 1JAKA 1C8XA 3SCWA 3VPLA 3UCQA 1K9FA 5FKYA 2DEPA 2J7FA 1UWTA 2VX4A 3ZIZA 4ATWA 3WD1A 1CZ1A 1WDPA 3I3EA 1QPKA 3CUGA 4OZOA 3F5LA 2WZIA 1BYBA 4V2XA 3N1AA 4EK7A 5D9PA 3B9DA 1ZU8A 3PZMA 1SMDA 1E5JA 3BC9A 4AD1A 1FH7A 3K8LA 3CPUA 1FHDA 4BQ4A 2VZUA 5IFTA 4Z2IA 4ML4A 1FP8A 3PTQA 4GXPA 1XH1A 3WN6A 4AISA 1B31A 1OD8A 5DT5A 2CYGA 1E73M 1GJWA 1OWQA 2Y8KA 2CBUA 5AYIA 2VX6A 3RPMA 3ARXA 3WNMA 1HJQA 3TTYA 1OD0A 1HL9A 2CCRA 1C91A 1XH2A 2DT2A 2CHOA 4DWSB 5BYWA 5HDRA 2RGMA 3ARSA 1G1YA 3RMEA 2UY2A 5CSYA 2VR4A 3F5KA 3VIKA 2XGBA 1DWHM 5GNZA 4PUDA 1MFUA 3MSDA 2VCAA 2FHFA 2WCSA 3IK2A 3MUAA 5CG0A 1CTNA 5I5RA 1X1NA 2EXOA 4XZBA 3W4RA 2D24A 3N11A 1HN1A 4YPJA 1ZS2A 4P7RA 3AOFA 2WC7A 3CUIA 3AFBA 3SCVA 3ZJ7A 1MYRA 2CKRA 1KWGA 2XSAA 9CGTA 4Y7EA 1QHPA 1JD7A 4D72A 3AZRA 2DSVA 1D3CA 3VM7A 4TVCA 1VFUA 1GOWA 4CVUA 1TA3B 1UUQA 3DYMA 4IM4A 2BHUA 2NW0A 4F66A 3VINA 2OYLA 1D7FA 2YBUA 1H3GA 1UKOA 3AS3A 1E4IA 5AC5A 3OZPA 1JF6A 4OOZA 1I75A 3HU7A 2E0PA 2G3NA 1KCKA 3ECQA 5A6SA 1XD1A 4N0RA 3VX1A 4CD6A 3WEMA 3UERA 3PZQA 1DWGM 2JIWA 4RE3A 2ZX6A 3VX0A 1W9PA 3MMDA 3CBWA 2YOCA 3OZOA 5JIPA 2W67A 4KGLA 4ZE4A 2YA2A 1G01A 1BGAA 1E0VA 1EH9A 1HJUA 3AIUA 4Z2JA 4E2OA 4CN6A 2XVNA 3ARPA 4GZJA 2IUZA 2CERA 5I79A 3GDBA 1HJVA 2XIIA 4HPHA 1PJ9A 1TG7A 3WDRA 3AI0A 3SCQA 2DSUA 2J4GA 3FAXA 1M04A 3WQ4A 2QV4A 3LMYA 3PTKA 3PZVA 3UESA 4QP0A 3N12A 2XUCA 1NWRA 5LA0A 5EFDA 2WKGA 4AZBA 2A3EA 2GDVA 2FGZA 3L4XA 1TVPA 3BCFA 1Y7VA 3BAKA 1W32A 1QI4A 4P7QA 4QLLA 4AEEA 3WNOA 3WL1A 1NWTA 3I3BA 2AAAA 5HOSA 2E3ZA 5I24A 1H11A 1E6XM 1W1PA 1ECEA 1H09A 1JL8A 4UFJA 2G4FA 4YHGA 3AICA 1DP0A 1CDGA 5BCAA 1UH2A 5A8PA 1E1FA 1OIMA 4BQ5A 1B3XA 4IPNB 1JNEA 1RP8A 1JZ4A 5GNXA 3RM4A 3AMDA 4JFVA 4CD8A 4BA0A 2J7CA 1H4PA 2VX7A 5GNYA 1K9EA 2EEXA 3OGVA 1SMAA 1EQPA 2XGIA 4WKAA 2FHCA 8CGTA 1ITCA 4NI3A 1V6YA 3K8MA 2WC4A 3VMNA 2QHAA 2ZXQA 1VRXA 4UOQA 3KL3A 2J25A 2YLLA 4HPGA 3WD4A 4HZ7A 5KEZA 3WD3A 4FLRA 2OSWA 3VD5A 1AVAA 3ALFA 1GCYA 3TTSA 4Q22A 1E0XA 4HA1A 4JFWA 2MANA 1R8LA 2B31A 1CXEA 1UA7A 2V38A 4ACZB 3OIHA 4CN1A 3W25A 5DF0A 3B9AA 1J0IA 1E4NA 4CD7A 2WK2A 1PX8A 1RPKA 4DWSD 3MUZ1 3W0KA 3O9NA 3MSGA 5FL0A 2WVVA 1W3HA 3N18A 1MVYA 1Q4NX 2XFRA 1IZJA 2O92A 3RJXA 1I1WA 1Q6FA 4HMCA 1KQZA 5BXTA 4D6HA 2V3FA 1AQ0A 2D3LA 1LWJA 1GQJA 3VIHA 1WNOA 3OLGA 5FCZA 4MB5A 3ARWA 4HMEA 1ZJBA 2PWHA 4GI8A 3PHAA 4EANA 1CXLA 2OSYA 4U5KA 2JEQA 3CZEA 4E8DA 4CGTA 3WH8A 4MTVA 3PBGA 5HPCA 1J01A 2XG9A 1V0LA 1LJYA 1OGSA 1P6WA 5BROA 4KGJA 3BMVA 3HJEA 4RE4A 2BY0A 4UFHA 1QOXA 3DHUA 4CCEA 1M03A 1XV8A 2IXUA 1M7XA 2VRJA 5A69A 2JALA 1V03A 1NOFA 4QFUA 5ABFA 1QNRA 1QNSA 2GJXB 3AHZA 3WDPP 3VD7A 4W5ZA 1E3XA 3DYOA 2ZX9A 5HNNA 3W38A 1R7OA 3I3DA 1E40A 3WMSA 4P7LA 2JEPA 3GH5A 3BAIA 3W37A 1UKTA 3K4DA 3U5YA 2CBJA 3CLWA 4CU8A 2XSBA 3ZSTA 1G94A 1KQYA 2EPNA 3QOKA 3N15A 5DMYA 1U2YA 2EPLX 1WKYA 1X6LA 4D6JA 3ZT6A 3AJ7A 1E5NA 2OLHA 3A4XA 1JDAA 1EXPA 5JIWA 4ATLA 2JF6A 1BYCA 4HU0A 1LLOA 2FH6A 2HVMA 3OGSA 2VT0A 5A6BA 3ARQA 2WMFA 2ZWZA 4PMXA 2QF8A 1JDCA 1UWUA 4Z2GA 2WVSA 1EO7A 3PZTA 1B3VA 1NWSA 4UFMA 5C71A 1UWRA 1W1TA 4QCFA 1KXTA 1HXJA 1JNDA 1PZ3A 4UZUA 2QMKA 2EO7A 3BH4A 4ZFMA 3VMPA 3AYSA 2XFYA 2PBGA 4E8CA 3QHMA 3T08A 1YQ2A 3ARVA 1HX0A 3CZGA 1HKIA 1GQKA 1GOQA 4NSBA 2AOSA 1JI2A 1MQQA 1XHGA 1NQ6A 4WJXA 1VEMA 1CYGA 3U7VA 2GK1A 2Q8XA 2VTFA 3NCOA 4A4AA 1QW8A 3IAQA 3AS0A 3FY1A 1NARA 2J7GA 1CXKA 3W29A 1RP9A 1CGXA 4V27A 4TTGA 2F61A 3KL5A 4EE9A 3ZJ6A 3NDZA 1DWAM 4YHEA 1VJSA 5GPRA 3CHCA 4DM1A 1CEOA 2ZX5A 5CGMA 4MNJA 1GVIA 2D20A 4GKLA 4W7VA 3VMOA 4PRWA 5KZ6A 3UR8A 3SUVA 3THCA 2VC9A 3CZJA 1R86A 4PMOA 4WK9A 1ISYA 1V08A 2YA1A 3GXDA 1JIBA 1GHSA 2ZUUA 4AYSA 8A3HA 5ECUA 2WHKA 1B90A 4PMVA 1FH8A 1V0KA 2BFGA 2FGLA 4B16A 2WMIB 4WSJA 3SIMA 1QBBA 2WCAA 1VB9A 3PZIA 3QGVA 5E70A 4FMVA 1FHLA 2PWFA 4U2ZA 3GXMA 2TAAA 2ZUNA 5A2AA 4QDMA 4AMCA 3G6MA 3VU2A 1E6NA 3AQUA 5CPQA 1CGUA 5DEZA 4GQRA 3L4VA 1WZMA 5E0CA 4ZXLA 4PMYA 2PI6A 2CETA 1BYAA 2YKKA 3MKKA 2NSXA 3LPGA 3VDAA 1ESWA 1H2JA 1QBAA 2J62A 3T09A 4JKKA 1OBAA 1GJUA 2G3MA 1UD3A 4J3VA 1GNXA 1JGIA 1HJSA 4H41A 4J28A 2XWDA 3UR7A 1E71M 2D0FA 2ZUMA 3J7HA 1XRVA 2WWDA 2ZXBA 1VF8A 1JZ5A 4R27A 1LL7A 2XTKA 1UD4A 4KRTA 3MANA 3WQ5A 1E3ZA 1JYWA 4AIOA 3AIRA 5F7UA 4TVUA 1C90A 1CGWA 2WZEA 3IAPA 3RDKA 1E56A 2Y4SA 2V3GA 4QAWA 2YBTA 3BAWA 4HMDA 3WNLA 2V3DA 2WKLA 3U5UA 3AS2A 2PB1A 3DYPA 1LL4A 3EBVA 4TX8A 3ARYA 4NRRA 5D8WA 2YL9A 2XIBA 1E6QM 4W8AA 2XVGA 1VFMA 2W5FA 2VURA 3PZ9A 4W85A 1JXJA 4D1JA 4HZ8A 1FFQA 5IXEA 3SUWA 1KGXA 1HP4A 2CBVA 2VQTA 4MAZA 3PZUA 4Q7NA 1VENA 4JIEA 1K9TA 2BY2A 2Z1KA 3KL0A 3WUBA 1D2KA 5HBFA 3A4AA 2W63A 3M6DA 1QW9A 3BSGA 1MFVA 3D3AA 4J3XA 1ZBVA 1NH6A 2YLAA 4CVWA 3D5HA 4AD3A 4H8VA 1TCMA 3NIYA 5LA2A 2DH3A 4GI9A 2ZXAA 5BXRA 2WMJA 3AISA 3U57A 2X8RA 2J7BA 2OYKA 4HZ6A 2Z1SA 1UR2A 3VGDA 1B3YA 4P7NA 4W87A 5DT7A 2FH8A 7TAAA 1HVQA 3APGA 2VI0A 3CGTA 3SCRA 2VL4A 4GO8A 1F4AA 1BVZA 1OINA 3EDKA 2YIHA 1XSKA 1UD8A 4UTFA 1UYQA 3GNRA 4W88A 1CXFA 2OSXA 1US2A 5A6JA 5JBFA 4PMNA 3WENA 1GQIA 1BAGA 3VDCA 1KXHA 4OOUA 2Y5EA 4PCTA 2YDQA 1JD9A 1NOUA 4J3UA 1VBUA 2QLYA 5A2BA 1C93A 2OYMA 1TUXA 2WCGA 4CN4A 1UWQA 3K1DA 3L4YA 2Y2WA 1OT2A 4DUVA 2EBNA 1ITXA 1JFHA 3WDHA 3FHAA 3SCOA 4WF7A 3GYCA 3SUSA 3II1A 3K8KA 3BLKA 4MB3A 1MQRA 1GQLA 4TUFA 3VIGA 1UWSA 2VRKA 4FF5A 2G8ZA 5IFPA 3EYPA 3GNOA 1C3FA 4H8HA 4U2YA 2CESA 1UH3A 4OKDA 1L0PA 4MAVA 5A8QA 3UETA 5BWFA 4M82A 1XGZA 1VEOA 1MQPA 1ISXA 1EGZA 2W4XA 4W7UA 4H04A 1UKQA 1JZ7A 3HMCA 3OA5A 2XPKA 3NYDA 2VUYA 3GZAA 1JI1A 4HOZA 4J3SA 2YA0A 1V3KA 2OWXA 3B9EA 2NT1A 1ISVA 4PSPA 1CXHA 3T0BA 1IZKA 4GZEA 3VIJA 4PTXA 1W9UA 1UZ4A 2X0HA 4MJ2A 3W24A 2UY5A 1GPFA 1JG9A 4KH2A 4LPCA 4J27A 5CGTA 1WDQA 2D1ZA 2J74A 3OBAA 1JAEA 3ZSSA 3EMCA 4JFTA 2DH2A 2PWGA 2VZOA 3ARUA 4UQBA 1CLVA 2ZIDA 3OGRA 4X9YA 1ZB5A 4MNLA 1MW2A 3N17A 4W8BA 1OB0A 1TR1A 4JHOA 4PEEA 1Q6EA 1O6IA 2VMFA 1DWFM 2WB5A 1KWKA 4L4OA 2DQXA 4UNIA 5LA1A 1V3JA 2GJRA 1E70M 4EKJA 3NJ3A 3VILA 1IT0A 5FD0A 4M56A 4D1IA 1V0MA 3GBEA 3IJ8A 1I1XA 4PYSA 2X2YA 3ARZA 2QPSA 4B9ZA 5BXSA 2V5DA 1QNOA 2ZE0A 1E55A 4H2CA 2V3EA 1ISWA 4GQQA 1TA3A 1OIFA 3SCSA 5ABFB 3WDQA 5E6ZA 3NSMA 1V6VA 3KE0A 4AD4A 4MDPA 1V3IA 4OBSA 2XYLA 3AHVA 1VJZA 2C0HA 1QI0A 2VVSA 4AZGA 4JKLA 3WELA 1JZ3A 3CH9A 1V02E 3WF3A 4ZXOA 4HP5A 2WSPA 2JE8A 3GXFA 5IHSA 2O9OA 3BAYA 3WNKA 1GOIA 3UG5A 5I6SA 3BLPX 3ZOAA 2E8ZA 3PZNA 4OUEA 4YN5A 4D6CA 4HOXA 4CU7A 3CMJA 5M03A 4UZSA 1JYVA 1C92A 4C7DA 1XYZA 1US3A 5CQ1A 2GJPA 2DT1A 3K46A 4K68A 4U3CA 2YL8A 4AZCA 1CGYA 4B9YA 2O9RA 4TVDA 3EMZA 2FDMA 1E1EA 2VJXA 4CUCA 2DDXA 3FNDA 4RL3A 4V28A 4LYPA 1UQZA 3WQWA 3TOPA 1WZAA 3CZLA 1EHNA 3QOMA 4E4PA 1U30A 3WD2A 2XVKA 1BHGA 5D9MA 2BS9A 1K6AA 1XCWA 3SURA 1GOOA 2VCBA 1QI5A 3OB8A 2NT0A 4JFSA 2OWWA 4D71A 1PZ2A 2Y24A 4ZEPA 1JFXA 3POHA 3UG4A 6CGTA 3VUPA 1E0WA 2J7DA 1A3HA 4UFKA 1PPIA 1E72M 3UG3A 2ZWYA 1KGUA 3DECA 3GH7A 5AC4A 4BF7A 3ALGA 4UCFA 5M3WA 2V5CA 4UQ9A 1UG6A 3POCA 3WQ8A 2J7HA 3ZQ9A 4PMQA 2VX5A 2J47A 4PN2A 5D9OA 4PUEA 3BCDA 1B3WA 1XCXA 1BVNP 2WBKA 3WDIA 1WP6A 3QHNA 3FAWA 3A3HA 3ZT7A 4DWSA 2WMKA 1XYFA 4U33A 2J75A 1KCLA 3MMUA 1CGVA 1WPCA 3NSNA 4F9JA 5DO8A 1WAWA 4WLCA 4DUXA 1Z32X 2IXVA 1LF1A 3O2LA 2X05A 3WH9A 1WCGA 2WHJA 7CGTA 2VRQA 3WQVA 4TOQA 1B2YA 2GFTA 3WSUA 5LYRA 2EQDA 7A3HA 2X1IA 3CHFA 1CECA 1MXDA 1Q6GA 1Q6CA 2QPUA 2WXDM 4JAWA 1PAMA 2GVYA 2YJQA 3KEHA 4XX6A 3A6OA 1BSIA 5A6BD 2EPOA 4W93A 3WF1A 5D4YA 1V3LA 3KWXA 2PC8A 1H0IA 1MW1A 5DFAA 5E0FA 1UH4A 3VDBA 1N82A 2WVTA 1CWYA 4PMDA 1B1YA 3CO4A 1PIGA 3W53A 2ZXDA 2W62A 5A8OA 1JDDA 4LYQA 1WZKA 1OGGA 4CCDA 1HIZA 1M53A 2J8GA 4HA3A 4FLSA 4AD2A 1KB3A 2D3NA 5EFFA 4U31A 5E9AA 1LL6A 1V6WA 3SCNA 4F8XA 3VO0A 3AIQA 4QLKA 4PBGA 4XUYA 2BHYA 4UFLA 1B0IA 3WF0A 3MUIA 1WZLA 4XB3A 2EPKX 2UWFA 3WUGA 3PN8A 3T2PA 4AIEA 4BZYA 3FW6A 2WMHA 4P8WA 3M46A 5I78A 1C8QA 1TFVA 1E6PA 1XC6A 1CBGA 3MU7A 1NP0A 3EDFA 3TTQA 1WO2A 3AZTA 1QNPA 1G0CA 1BGGA 5I3DA 4JCMA 2XWEA 4QCEA 3F5JA 2BY3A 2PF0A 3CUFA 4PSRA 2XVLA 4M8UA 4KMQA 4PTMA 1HF6A 4B15A 3AXIA 2UY4A 3HN3A 3CUHA 4RE2A 5BRPA 2J77A 5HPOA 1QVBA 1W9XA 1W1YA 1HP5A 2WM0A 4AIUA 3N04A 2BXYA 3VOCA 2VOTA 3SEPA 1EOKA 1OGBA 1FH9A 4S3JA 4FLOA 1UA3A 2WC3A 4AZIA 1EA9C 3VIIA 1AQHA 5HXMA 5FOOA 5I2UA 3RJYA 3N13A 4GPNA 2F8QA 3WH6A 3ZR6A 4OIFA 1J18A 1JXKA 4UQDA 4JL2A 1HKJA 5C8BB 1QNQA 2CHNA 4UR9A 4D6EA 1ZJAA 4AC1X 4BS0A 4OBRA 1GZJA 5BXPA 4N42A 3BXWA 1UKPA 1CGTA 2PWEA 5CPTA 1UR0A 3W27A 3EDDA 3SCUA 2YL6A 1GW1A 1L8NA 1ISZA 4BQ2A 3ZM8A 2VO5A 1UR1A 3VTRA 1XD0A 1EO5A 3WDJA 2X09A 1GORA 4GZIA 1XSJA 4OJYA 4U5IA 1DTUA 3CIVA 3SUUA 1H1NA 3W81A 1VFOA 3SCTA 1O7AA 5EBAA 3AHXA 1ODZA 5CJ5A 4U3AA 3W6MA 4HA4A 3WBAA 4W89A 3WF4A 2DT3A 1V6UA 3LPFA 3L4TA 2E4TA 2CNCA 1NP2A 3EDEA 4LYRA 4R5EA 2CITA 4X0VA 2D2OA 2BNJA 1J12A 4UQAA 2DT0A 1GUVA 2CBIA 2J78A 1HKKA 4MB1A 4C7GA 1W3LA 2F2HA 1CLXA 5A2CA 5JBEA 1AMYA 2YDSA 3EMQA 2VVNA 3M07A 1GOKA 1NOWA 1DWIM 2E40A 4MJ4A 1KXQA 2ZX8A 5IDIA 3W82A 1FP9A 5A8NA 1E15A 3MV11 3L2LA 1ZBWA 1OSEA 1SFSA 5JUVA 5A8MA 2JF7A 4NRSA 1UZ1A 3F4VA 3VDHA 2E9MA 4ACYA 1U33A 1C8YA 3TTOA 3WL0A 1W91A 1V02A 4XV0A 5CPSA 3VGEA 2ZUTA 1W1VA 4AY1A 2O9PA 1VBRA 1TVNA 2J79A 3RM8A 1XH0A 4UQEA 3CTTA 4IISA 3AXXA 1JZ8A 4IPLA 4JZ5A 2ZUWA 1UR8A 2XM1A 1WE5A 2BY1A 2WPGA 5CSUA 4AZ5A 4TX6A 1E43A 4CU6A 3N9KA 1BQCA 3IJ7A 4Z2KA 4AW7A 1W9DM 2A3BA 1KBBA 3T2OA 1E6ZA 4XZWA 3OLDA 3VKKA 3WNNA 1J9YA 2XJ7A 1CIUA 2G3IA 1ZL1A 2VZVA 2XVPA 4QLJA 1NWUA 4H7VA 2BVYA 2D22A 3VNYA 3G6LA 2GSJA 1UHVA 3AROA 3VD4A 2A3AA 1CXIA 1WDSA 2CEQA 4UFIA 4Z2HA 1J0ZA 2ZUVA 5A94A 4P8UA 4GI6A 3AXHA 4TXEA 3OLEA 1J11A 4DUWA 5D9NA 4AZ7A 3L4ZA 1EDGA 2CKSA 4ZENA 1OCQA 1PIFA 5CLTA 3A4WA 3VIOA 1LQ0A 3B8SA 3WMCA
chains in the Genus database with same CATH superfamily
1Z48A 1VFSA 1KFWA 3C0JA 3NDYA 4L9YA 4B3KA 1N8IA 3BAXA 1IWBA 5CXPA 2QUMA 3SY1A 4CD4A 5C54A 4H6KA 4QE4A 4U86A 1D6OA 5AHIA 1R7AA 4JHZA 3MO4A 4L65A 2ABBA 2BXZA 4DLFA 5PTDA 3P6LA 1RZMA 2WLZA 3BAJA 3JUGA 2ISSA 2WSKA 3URQA 2P0OA 3GVWA 1LDCA 4KWUA 3W28A 1DJZA 4AEFA 2J13A 2X41A 2QZRA 4O1FA 4WKFA 4XSLA 3ID7A 1F5ZA 3TA9A 1Y5VA 3H23A 1JCJA 3G1HA 3GBDA 3NL2A 2WAGA 1QHZA 2WANA 1MW3A 1M7JA 1CENA 2PLJA 3AS1A 2ADAA 3C56A 3ZMRA 4FO4A 4PFHA 1PBGA 1H41A 1MZRA 1W3JA 2DSWA 2QMJA 2A3CA 2VZTA 3S6TA 1V3MA 3CO8A 4AU0A 3F2DA 4NILA 3VGHA 4N9EA 3LPPA 3MQTA 2QAFA 4UOJA 2Y7DA 5AYBA 4BKNA 3P8JA 1FWFC 4RR4A 3RILA 4W86A 5FF4A 1TJ0A 5CJMA 3AIWA 5IHRA 4DNMA 4XZNX 1UWIA 3TA6A 4W9OA 5FAGA 4FEZA 4YIWA 4P61A 4BR1A 1XLMA 5FJOA 1GVYA 1EYWA 4P8XA 3DC0A 1E0UA 1JYNA 2XM2A 4RPPA 1L6FA 3GDMA 4L4PA 1XF0A 2YCIX 3ARTA 4O8RA 2WZHA 4F40A 4JTGA 1S38A 5HQMA 1MXGA 5C55A 4CCCA 3PG9A 3EIPA 3N2MA 2PCQA 3DBPA 3VD9A 4LAMA 1QWKA 1R87A 3L5MA 4V15A 3N6QA 1LG1A 3BOFA 5D37A 3FIGA 1FHUA 4GCAA 4NF7A 3MBDA 2PLCA 2QYGA 3CAQA 3SUTA 3R12A 3NL3A 4DJDC 1R38A 4LH8A 1B3ZA 2DIKA 4IX2A 1UD5A 4PCSA 4JCLA 4GG9A 1EJSC 3O0FA 2ICSA 3DKJA 3M0VA 1ZAHA 4HHLA 5A6MA 2GK1B 4EPKA 4LAKA 2PAJA 4MY9A 3EDJA 2VWSA 4QS5A 4DRJA 4KRUA 2DZPA 5EYWA 1RLDA 4ASTA 3T0TA 2WW5A 4IJRA 5EGRA 1Q1CA 2W61A 3WYZA 4R3UA 4JKMA 4MGVA 1BFNA 6TIMA 1KGWA 3AC0A 3VCRA 5BOEA 4C6DA 4E8GA 1BG4A 2YB1A 5DY2A 3I7QA 1I2QA 2WHMA 2YCLB 3M5XA 2PTYA 4HIBA 4GC3A 4YU1A 1W3KA 2XP8A 3BW2A 3WEOA 4BEQA 1XPGA 3U48A 4GH1A 1QHOA 1MSSA 3TCZA 5A6KA 1F3XA 4CD5A 1VLWA 1QMLA 1DEDA 3T0DA 1VFFA 3LUOA 4E2BA 1OK4A 4ECLA 3OZYA 1FKDA 1FFRA 1P7TB 1UKSA 1J0JA 4ZO6A 4A22A 3WFLA 2R1LA 1RK6A 2OT1A 3UVIA 2G3FA 2YDAA 2OTDA 2VELA 3V5FA 4DPQA 3U3HA 1C7SA 4RDYA 1T96A 2CW6A 2HNHA 5HNRA 4AUBA 4OVXA 2BLEA 1VJIA 4DM2A 3M0LA 4JYEA 2Y5JA 1XLAA 3G1YA 4JL1A 1VHNA 2WSYA 1LM1A 1OX5A 3GIPA 3W2LA 3AHTA 3UA4A 2WNWA 3ANVA 4CEXC 4YTQA 3UZ5A 2WWCA 4AB4A 2RJGA 5BZAA 3W1AA 4J3WA 2HISA 2FMOA 3VNDA 1NTHA 3RX4A 4OGZA 3S83A 3A47A 3M7SA 4IT6A 2PPGA 3PS7A 1V6XA 1A0CA 1YPIA 2D23A 2BHZA 5CAKA 2P0IA 4R34A 1TV4A 3FLUA 5CZKA 1BF2A 3L7RA 1GOMA 1QDSA 3VIMA 3TONA 5CC6A 3W71A 1DQUA 4I9AA 3P67A 1EQCA 1KW1A 5HQEA 1O1HA 3AYRA 2ZR4A 2TYSA 4O12A 5GQBA 4KFOA 1DIEA 2ZZ2A 4XAFA 5AHLA 1DWJM 2Q71A 5TAOA 1PZ0A 1W9BM 3KOWA 3HB9A 1BXNA 3ZZ1A 4NYYA 2UY3A 1FBAA 2Y7EA 2LPVA 1EDQA 5AZ1A 3JR2A 1FWIC 3TFXA 1C7TA 1WX0A 2F4EA 2I5IA 3WBEA 3K30A 1EDTA 3R43A 3GXIA 4MADA 3V36A 1UBSA 1NY1A 4WEVX 2POZA 4GGHA 4Y9OA 3ZXWA 1WDWA 2OOGA 3TR2A 3VIPA 5C70A 2XHYA 2WMGA 1TPC1 1FTXA 1OADA 1SFJA 3W7KA 1HJXA 4QS6A 1JRCA 1KBKA 2E8YA 3OVPA 3ARRA 1LWIA 1I6NA 1YEYA 1VCFA 3CHDA 5DO2A 4TTUA 1YTKA 5HUAA 3W76A 3GU1A 3OJGA 1SYTA 1JYXA 3GVRA 3EA2A 1TJPA 3P0WA 2IPGA 3T0AA 4AIBA 3DU0A 2NUXA 4Q4OA 1FWCC 1VKFA 2GQAA 3LQLA 4FXJA 2VX4A 3S1WA 1SSDA 3ZIZA 3EKZA 3O6CA 3WD1A 3ELFA 4KS0A 1WDPA 3CXOA 3CUGA 4OZOA 2WZIA 1BYBA 1EC8A 3LXBA 5DLCA 5KZDA 1I2NA 2P88A 4Z1CA 1E5JA 4JN7A 4AD1A 2I9EA 3RCYA 1HGWA 4CQCA 3GS6A 3T40A 1R3WA 3B03A 2TPSA 1XCFA 1JUKA 1XIHA 3O5JA 4ML4A 4ZMGA 1FP8A 2BZNA 1XH1A 4FALA 2GPTA 4AISA 1MMFA 3MWAA 3CV6A 5EMKA 1EC9A 1TB3A 3KP0A 5J04A 3M43A 1GJWA 4PCPA 2WQDA 4EACA 2I5GA 3NO3A 1NJJA 1KM3A 1JCTA 2WNNA 4MG4A 1OD0A 3ERPA 4IUOA 1C91A 1XH2A 1UROA 4O14A 4DWSB 4C90A 3ARSA 5CSYA 2QUTA 2KX9A 3F5KA 3NQ8A 4NZ3A 4KERA 2OO6A 2XGBA 1DWHM 3PANA 3MSDA 2GJNA 1CTNA 4RZBA 4HZMA 3NQVA 3N11A 1NDZA 1VH7A 3HM7A 3EPNA 3G18A 3ZVHA 3GRIA 2WC7A 3SCVA 1UP2A 1MYRA 1KWGA 2QJGA 1YRRA 3STEA 1JD7A 4D72A 1TPVA 4DLMA 5HULA 4WVXA 1TA3B 4IM4A 4WQ6A 1XBXA 2YBUA 1UKOA 5M2FX 2PUZA 1P0EA 5BRBA 2ZYFA 4POCA 3WLIA 2NLIA 3PC0A 1I75A 3HU7A 2X1RA 3GWQA 4F0RA 1DWGM 5DN1A 4QSHA 2PDJA 2JIWA 4TU1A 4RE3A 4YJ5A 3VX0A 3MMDA 3CBWA 3OZOA 3W88A 4US5A 1OABA 5FF0A 3WQPA 2DW7A 3M9YA 1W1IE 1G01A 4FS9A 1E0VA 1W1ZA 3F4DA 4KCTA 3F1QA 5EY5A 2ZQSA 1FKSA 1GWJA 1UUMA 2XVNA 3ARPA 2IUZA 1W5PA 5F4XA 3HV8A 4M6PA 3S1XA 4GLEA 1BXCA 4LALA 3BLOA 5AHEA 4ROQA 3RN6A 2AKZA 2FFCA 4DXVA 4WOZA 5I3FA 1LT8A 3N12A 3OA3A 1NWRA 1K77A 2A3EA 2QCFA 4M0XA 1IXPA 1GTHA 4K8EA 4JIRA 1SJAA 3WL1A 2XP4A 2AAAA 2E3ZA 3W1NA 2PCEA 1IYXA 2H8XA 3QY8A 5I24A 4Q8QA 4UFJA 4YHGA 3GHTA 1YDNA 4ZOAA 3W1QA 1XLCA 3VZXA 4YMZA 3LHZA 3QGKC 1JNEA 2NVAA 3F2CA 4DBSA 2MNRA 2NX3A 4WY0B 3A4JA 4M7SA 2NZLA 3OVRA 3NGJA 4JFVA 1KFJA 4HSOA 3C61A 4JTSA 4C65A 3EX2A 5GNYA 4LSBA 1K9EA 1EQPA 4IPJA 3VMNA 4IIGA 1GVQA 1NVMA 3S3GA 3SGUA 4H83A 3BW3A 8TIMA 3WD4A 1EFZA 3WD3A 2OSWA 3ABSA 3VD5A 4BEUA 1AVAA 3HQ1A 3WZ0E 4ODKA 3W86A 4QTGA 3UQNA 4AF0B 1TWWA 5FEWA 1R8LA 3VNMA 4CEUC 1TMHA 5FEPA 3HJZA 3OIHA 3WLNA 4CN1A 2O7QA 5DF0A 3RLVA 2QPXA 1XS2A 3MSGA 4S3BA 4UTHA 3HG5A 5IM51 3H9RB 1W3HA 2VDGA 2O92A 4JNZA 4GGBA 3UBPC 4ZQRA 3HO8A 4E38A 2A6LA 4QEEA 4D6HA 1AQ0A 1JDEA 1GQJA 3OLGA 1P5BA 1KM0A 5LIUX 3RG6A 4MB5A 3UVAA 3VKJA 3GVVA 4PTNA 2JEQA 4CGTA 4XAPA 4MTVA 5F1UA 1J01A 2XG9A 1XINA 1P6WA 5BROA 3UQAA 4OV4A 4RE4A 1W5MA 4UFHA 1QOXA 4QQ3A 1LQAA 3W73A 3H26A 1MDLA 1A53A 3SY5A 2JALA 3OQEA 1V03A 1U1UA 1PBKA 3MHGA 5ABFA 3VD7A 2W27A 3SN4A 4A05A 1WBJA 1E40A 4P7LA 5AYZA 3GKFA 3WJSA 1IXNA 3W83A 1RR2A 4NJJA 3W37A 1K1DA 2C6QA 4NHVA 4NZ5A 4C6OA 3OU8A 3P14A 4S3EA 3QOKA 1PKNA 9XIAA 1U2YA 1A4LA 2QIWA 1E5NA 1BL4A 1LLOA 1VP5A 1LQ2A 3CQ0A 3OGSA 3RX2A 5LIWX 1PE1A 3FSTA 4RLIA 4C6CA 2B5UB 3ARQA 2WMFA 1GPWA 2ZWZA 1JDCA 1X38A 2B7NA 2GSHA 1B3VA 1KV5A 4UFMA 4MWAB 1BWKA 5C71A 1NFGA 2BG5A 4U4MA 1JNDA 1W17A 3R0KA 4UTUA 4QJ3B 3T7VA 4ZODA 3IK8A 2R94A 1J4RA 5AC8A 2OKTA 4BF9A 3W74A 3APYA 3T08A 1YQ2A 4DRMA 3ARVA 1J5TA 3CZGA 3MYPA 1HKIA 2CLEA 5GPGA 1JI2A 1TPUA 2O4MA 4WJXA 4MWAD 1C9WA 3GZ3A 4NXSA 1J79A 3U7VA 2Q8XA 3FGCA 1JULA 1QW8A 2EKGA 4ADUA 3AS0A 1NARA 1CXKA 3BLIA 3LY0A 3HPFA 3GDKA 3PPFA 2PLMA 3UI4A 2HZGA 3KL5A 4KBXA 3ZJ6A 1DWAM 4PODA 1CEOA 2ALDA 4W7VA 3VMOA 3EPOA 4HTBA 2VN1A 1FCBA 1V6TA 3SUVA 3THCA 2VC9A 1R6WA 1ISYA 4JDBA 1JIBA 4Q6JA 4NNCA 3KAFA 3UCDA 2YXOA 3UP8A 1F05A 4IICA 1W3IA 1DVJA 3MZNA 3MO7A 4DBEA 5E70A 4LV9A 3EEZA 5A2AA 4AMCA 3G6MA 3VU2A 1WAUA 3DHFA 2IS7A 3C0SA 1TTJA 3L4VA 3LV6A 1WZMA 3TU9A 5G1MA 4HYWA 4NAFA 4D8LA 4PMYA 1PDYA 2DZAA 4N9CA 5A5WA 3UYCA 2C71A 4JS3A 1KFKA 5DX7A 3LPGA 2I1OA 2ISVA 3T09A 4JKKA 4J3VA 4ES4A 1IQ8A 4LEFA 2I57A 4NJHA 1J8VA 1ONXA 2XWDA 1M9HA 1E71M 2ZUMA 1UJQA 3MDYB 4JQ3A 2GGIA 4XVDA 1DIOA 1UD4A 3MANA 2VEPA 2OQHA 2GGEA 4Q8MA 4RE0A 1C90A 1CGWA 3RDKA 1Q6OA 4I7WA 1E56A 3BE7A 2Y4SA 1YNYA 2YBTA 1J6PA 3E2SA 1VPXA 4DZ5A 1TRDA 2PB1A 3H4GA 3MP4A 3DYPA 1EGVA 2Z6JA 1T5AA 3BOXA 3N19B 1XRTA 4TIMA 5C7VA 2ZZ5A 1OZQA 4K2SA 2RHGA 1VFMA 2W5FA 4DI8A 5DIVA 3BG5A 3O0KA 2VURA 3PZ9A 4ZB2A 4HZ8A 4PBFA 4WHBA 3SUWA 1Q66A 2H8ZA 3O63A 3NFUA 2VQTA 1EA0A 4N02A 3HFYA 1Z44A 4US5D 3KL0A 2Z1KA 2RDWA 1AK5A 2OPJA 3BSGA 4X61A 3APTA 3RPTA 3IGXA 3KBWA 4H2HA 2C13A 1MXSA 3A9BA 3W02A 1TTQA 2OELA 3D5HA 4CLMA 5JMUA 4O18A 3KHJA 2WMJA 1P6BA 3AISA 3EWUA 4HVXA 2JGQA 4AMAA 1TWDA 3VGDA 4PGLA 1QK0A 4W87A 4GABA 1IEXA 1HVQA 2VI0A 1FQ0A 3CGTA 3ZS4A 2VL4A 2A85A 3UZYA 3OIXA 3ES8A 2OLAA 3VK5A 1OINA 1NELA 4UTFA 1RQBA 1TIWA 4K39A 1V51A 2ZA1A 4PMNA 4ZO9A 3H70A 4DAFA 4QM1A 3OYZA 4OOUA 2REQA 4H00A 3ITTA 3ITCA 2YDQA 1PZ1A 4C6MA 5HW6A 4J3UA 2QLYA 4EXQA 4M7TA 2WOQA 4NJIA 1EGMA 4KIEA 3PWAA 2WCGA 3A3WA 4WDUA 4UNLA 3OOBA 2Y2WA 1OT2A 3OVQA 3MI2A 1PSCA 2BBFA 3TE9A 1OVDA 3STGA 3GYCA 3G2GA 3PWGA 2Q02A 4MB3A 3C8NA 1GQLA 4TUFA 2DG4A 3VIGA 4QNWA 2VRKA 4HPNA 1FDJA 2XP7A 1IEWA 2G8ZA 3EYPA 3QV7A 2ZA2A 5BOFA 1SW0A 2I5QA 4HSHA 3PBVA 3OVGA 3H8AA 4U2YA 3KTXA 4AHQA 5A8QA 3EOOA 2AAMA 3A21A 2E6AA 1GVSA 4UMCA 2WSRA 1L6SA 3PULA 5DXXA 4REQB 4LAWA 1O5KA 3CWHA 3PFMA 3O5LA 1EGZA 1MRQA 1Q6QA 1Q8AA 1HZYA 3HMCA 3NYDA 2TSYA 1FX6A 4G8TA 3B8TA 3H12A 5HA7A 1Y5WA 4J3SA 2QCEA 3BO9A 2MLZA 1ISVA 4BF5A 4C6IA 2J66A 1XDJA 1IZKA 4GZEA 3VIJA 1VIZA 3B4UA 4KWVA 2CZDA 4MJ2A 4ZQPA 5DRIA 3W24A 2UY5A 5GJPA 1RK5A 5DMMA 5AC6A 4S3AA 2NXIA 5D03A 1GYNA 3W7MA 2OU4A 1JAEA 3KVLA 4QNEA 3ZSSA 2DZXA 4L56A 1GEQA 3W2MA 3G24A 3FGCB 2ZIDA 1JUBA 3M5YA 4JD4A 3VKAA 4DBDA 1ZB5A 3N17A 1TPFA 3G1RA 3NRKA 1GYLA 4WXZA 1FHVA 2OMAA 3BOLA 4JHOA 3FA5A 3NL6A 5AHMA 3UJSA 1DWFM 1MDRA 1T40A 2YX0A 5LA1A 1U1HA 4LY4A 2XH4A 2D2JA 4ZTYA 3MUXA 1IT0A 2IPFA 4X22A 5FD0A 2NQLA 1RBOB 2W6RA 4NP7A 1V0MA 3IJ8A 2NV1A 4GVIA 4S23A 5BXSA 3B9NA 3NZGA 3W70A 3LCFA 1IEQA 3FAPA 2V3EA 2CZ5A 1J4HA 2P3EA 3B97A 4WXYA 1V3IA 1AJ2A 1WKFA 3NAVA 1EJRC 1GT8A 1VZWA 4XAZA 2C0HA 3UF9A 3O5EA 4NT0A 1QI0A 1FRBA 1TJ2A 1FXPA 3SJNA 3DCPA 2KR7A 2QDHA 2JE8A 4BF8A 5IHSA 2O9OA 3BAYA 3WNKA 1TUFA 3DN5A 3C2EA 2Z7KA 3BLPX 3ZOAA 4W9PA 4GYPA 4YN5A 5M03A 2EG8A 3OG3A 4M6UA 1ZLPA 1U5HA 2XPBA 2I56A 2V69A 3LTPA 2YL8A 4AZCA 1CGYA 2Y7FA 2FDMA 2NLYA 1P0DA 4CUCA 2DDXA 4V28A 3UXKA 4FXRA 3BQ6A 3CNYA 3TOPA 2WO5A 3USZA 4KWWA 3QRHA 2FB2A 4D2JA 1BHGA 5D9MA 3D6NA 4C1NA 3EB4A 3LERA 2VCBA 1RD5A 2OWWA 3G22A 2RJHA 3KFTA 6XIAA 3PRAA 4FAMA 5GJNA 1KRCC 1JFXA 3UG4A 3VAVA 2E67A 4PZVA 3VUPA 1E0WA 1A3HA 1FKGA 1SVDA 1NF0A 3W7HA 3IJLA 4UFKA 1E72M 1D8CA 4JN8A 3GH7A 4BF7A 5M3WA 4UCFA 3R8GA 3YPIA 4AAJA 5J8LA 3TYBA 3ITYA 3POCA 3U0HA 3ZQ9A 5D9OA 4PUEA 3BCDA 2H3DA 1K8YA 3HGJA 3WDIA 3QYSA 2QVNA 4YCPA 1F9CA 3R0DA 1UWAA 2VDIA 1XYFA 4GY0A 4F9JA 4IMCA 2IKJA 1QASA 1WAWA 1YDYA 4DUXA 1BWVA 5AN7A 4KEZA 3M0IA 1WA3A 3TCEA 2HVNA 2PS2A 1JNSA 2VEMA 1F8MA 1EXBA 2EQDA 4TNSA 3W7GA 2X1IA 1SFLA 1CECA 1Q6CA 4PR4A 3RO6A 3PAOA 2VEGA 2YPIA 2WXDM 4JAWA 5I3KA 2KI3A 5A6BD 4W93A 3WF1A 2FLIA 4XUGA 1V3LA 5SWUA 3BV4A 3THQA 3GB6A 4TV5A 3VOJA 4LAXA 1MW1A 3HA1A 1A0DA 1UIOA 3VDBA 5HW7A 2WVTA 1GJPA 3CO4A 2ATMA 2HBXA 3KX6A 1R46A 2W62A 4Z08A 2QDDA 3FYPA 1JDDA 1TV7A 4ZCWA 2F9RA 2YCKX 1ZP3A 4FPSA 4HA3A 3K5XA 3MTWA 3VC5A 2D3NA 4JYFA 2NQJA 1RV8A 5E9AA 1LL6A 4F8XA 5FAJA 4PBGA 1MEWA 4XUYA 4K6AA 1B0IA 1XLIA 5CAHA 3C86A 3MUIA 2E5DA 2Q3OA 3MVTA 4A8NA 3CLMA 5IOBA 2CLPA 4LUTB 1PS9A 3O5KA 3A3XA 4BZYA 4S38A 1RJPA 4JGDA 1RXOB 4ERAA 2YB4A 1XC6A 4HNCA 4MLRA 5GJMA 2MNTA 1HG3A 2TODA 3TTQA 1TYGA 2GQ8A 4QG9A 3F5JA 2PF0A 4EXAA 1ZJHA 2QGHA 3IGUA 2V2HA 1E1CA 4ZFCA 2HJPA 2M08A 4IZGA 4AVFA 1AUSL 2GZXA 2ZADA 2ZDRA 2J77A 5HPOA 1S5TA 1W9XA 3IIVA 1LRQA 1OFEA 1FCUA 4NAEA 4QJ4B 3M7WA 4DIPA 4MZ1A 1LOQA 1EOKA 4I6VA 4AZIA 2E77A 3CMFA 4G7EA 2F8QA 1TWIA 4DRNA 1X7FA 3ZR6A 4ODMA 3QQWA 3QTGA 4JL2A 3VE7A 2CHNA 1LUCB 1ZJAA 4TR9A 4XO7A 1S2WA 1UUOA 1FDYA 3LENA 2PWEA 3PNZA 1UR0A 3W27A 5CJNA 3EDDA 3DDMA 3IUIA 5D32A 5I03A 4Y90A 3TC6A 1Z42A 1ISZA 1NSJA 2I9UA 3VABA 1XD0A 3WDJA 3TN3A 3FYOA 4OJYA 3LLXA 3O7UA 1XIBA 1ODZA 4YVVA 3SFWA 3NM3A 3WLKX 2DT3A 4I9TA 5E93A 2Q09A 1IGSA 3DOPA 3H4XA 4HCHA 3EDEA 1I2PA 2D2OA 5LXXA 3HGSA 2O55A 2ZE3A 4JQ4A 4JIPA 2G50A 3E0IA 2DT0A 1CT5A 4GHRA 3ME3A 1HKKA 4C7GA 5AHFA 5CC3A 4ODRA 3LBCA 3O3RA 3RFWA 4LUJA 2VVNA 2HCVA 2DG3A 2PV3A 3V75A 1RCXB 1FP9A 3UCCA 5A8NA 2XFWA 1KO0A 1SFSA 3W7CA 4PCNA 3REQA 3E02A 1DXIA 2RUCA 4IMFA 1O1ZA 1K70A 4XV0A 3VGEA 3STCA 2W79A 1S3HA 1FKTA 2O9PA 1VBRA 4NX5A 3TQVA 4UQEA 3CTTA 4JIHA 4IISA 4Y9AA 3QZEA 4RCXA 4H9TA 2BY1A 2WPGA 1FKXA 4S1FA 1IIHA 3DFQA 3UXIA 4IP4A 2QKFA 5KETA 3M44A 4ODNA 4QIUA 5AYYA 1OX4A 4AW7A 2A3BA 4Q32A 3OLDA 1XIMA 1X6UA 1DYSA 3CEPA 1W54A 2G3IA 4H01A 4QLJA 1NWUA 5LNSA 2PV2A 2D22A 2PPPA 1POKA 2GSJA 4LV4A 3T4WA 4ILSA 3AROA 4OQVA 1Y0EA 3R4IA 1CXIA 3LYEA 2VGIA 4ALDA 1WYIA 4Q8OA 4WOQA 3WLSA 5D9NA 4AZ7A 4J4NA 2ODOA 3QMSA 1EDGA 5KMYA 1XYAA 2ZQVA 3A4WA 3N2TA 1LQ0A 3B8SA 4IL2A 1TE1A 4WSKA 1E6SM 1JF5A 4BQ3A 4MYXA 1O5QA 3IANA 1UR4A 4D6DA 3PJTA 2FVMA 2OB3A 4YTSA 4KQZA 2Y8VA 4DXKA 4L64A 1NM9A 3S2CA 1HT6A 4MPKA 2QNEA 1IV8A 4GI4A 1JPHA 1EJXC 4DZHA 3O5FA 2CC0A 4GO9A 4KRZA 3XIMA 4R33A 1PX3A 2F2DA 1KM2A 4INFA 5LNRA 3NQFA 3G8RA 4BCEA 1JZ2A 1G9HA 1NIUA 3GH4A 1DJNA 1I45A 2Z1BA 3ZWTA 3Q45A 3GK0A 1XBVA 3IS4A 3GNPA 4AZCB 2XFFA 5RUBA 1J0YA 1IX5A 1Y8BA 2QCNA 5ABEA 3WUFA 1H7PA 2MUCA 2BDQA 2VGGA 3OBEA 3H7UA 3STFA 3LNPA 3E1F1 5LKYA 2DIEA 5CKSA 5ABHA 1AJ0A 2XH7A 3VM5A 4XAKA 4DB7A 4FXSA 1XQLA 2ZZ1A 3GY1A 4FIRA 3MHFA 3O6AA 3N4FA 1JQVA 4V1XA 3CZ8A 4M80A 2C1GA 4F0LA 4L3NA 2QEZA 3QPZA 1S5WA 1BRLB 4N4PA 4JFUA 2QCGA 1TELA 2ESCA 3W1PA 3SW6A 4UTMA 4FR1A 4W8LA 1QI2A 2ZDSA 3QXBA 3H22A 4RDVA 1OFAA 1OJXA 3QV8A 2B4GA 3FHQA 4DNHA 1SFTA 1K9DA 1VIWA 1QXLA 2A6NA 2UZ9A 2RGLA 1IE7C 3TUUA 5I09A 1EUAA 3WF2A 1AQMA 3BLFA 3SN1A 1PX4A 4L9ZA 4FZIA 4N6FA 3AMLA 2E68A 2I17A 1V3HA 4M6VA 3C0QA 1Z8AA 4EAMA 4MWAA 4F9DA 3PUGA 5F1VA 4QAIA 1GHRA 1FWTA 4O1EA 2PDYA 1GG1A 3ABQA 3H24A 3MWCA 3DIPA 1OFDA 3WCZA 3A23A 3FOKA 1TKKA 3TW9A 1Q7MA 1TWZA 2Z26A 2V5BA 3LLFA 1GYMA 5LGXA 2R1PA 4BI7A 5G2WA 2D0GA 3LPOA 3KVJA 1NFPA 2GSEA 3TAOA 1F8AB 1UD6A 2EJ1A 2YYTA 4ZBCA 5D33A 2C8NA 1BLIA 3EX1A 1L2QA 1LCOA 2OCZA 4Y9MA 3P84A 3WH0A 3WFZA 2ZX7A 5I98A 4MHBA 4GIRA 1A5UA 1Q65A 1E6RA 2DVTA 2ZICA 1Q6RA 2YL5A 2C15A 1PUDA 3IJ9A 3QR3A 1GZ1A 3RCNA 3R2GA 4DAIA 2PDUA 1RA5A 4XTIA 1KT0A 3WMBA 5C9WA 5FL1A 1VFLA 3S6DA 1F3WA 2CZEA 1SW7A 2LLEA 1OFRA 4MKNA 3KHDA 4IQCA 3OLIA 1OC7A 4L9XA 2FIQA 1ZGDA 2Y61A 3B8WA 4ZB5A 1FOBA 3W7OA 4MZ8A 4P8VA 4URIA 1CB2A 3ENLA 3N9SA 3PTDA 3FDGA 4L6HA 1UMYA 1O94A 3HQPA 1H7NA 4IUGA 3W84A 4XBSA 5FF2A 3GTNA 5FIPA 4XAYA 3WQGA 1POJA 2PWVA 3O8AA 2EGZA 1EJVC 1QTWA 4LX4A 4WDTA 3S6OA 1A3WA 4M81A 5DCDA 4IMGA 3R7MA 1ME7A 1I0DA 2JFEX 7REQA 5LNVA 2Z6IA 4C1LA 3WQ6A 2VUNA 1HL8A 3PJXA 1Q6UA 1FDZA 2FDSA 3QHOA 4K38A 5E09A 2OEJA 5T91A 3MUY1 1M7OA 5JBDA 3TW7A 3WIJA 3MS8A 3THDA 3CYVA 1R9YA 3CPRA 2ZC1A 3M4HA 5I77A 2XIOA 2IKHA 2EPMX 1R9HA 4MMWA 6A3HA 5AHNA 1SJBA 5AC7A 5HT1A 2GDUA 3V4BA 2VKZG 2V5KA 3S9ZA 1RBAA 2Z2UA 3R94A 3O16A 4DX3A 1FWAC 3W7JA 3H4WA 2Z27A 1BG9A 4LGXA 1H7RA 1PCWA 3S5SA 1XR2A 4S3KA 4I3GA 2VCCA 4B5WA 3WLTA 5BMWA 4G2DA 4XIAA 4HB7A 4GXMA 2ON3A 2WLYA 1P1XA 3FFSA 5M17A 4IWWA 1JPMA 1AQFA 4AVNA 3DERA 1JNTA 1KXVA 1LBLA 4Y9PA 1R3RA 1HUVA 3GNDA 4E6MA 3WD0A 1KR0A 3S5ZA 5KZMA 3XISA 1EIBA 1DQWA 3BCJA 1E9LA 1DHKA 3NQCA 1MI3A 5LGZA 2PWDA 5G2IA 5E6YA 1M01A 3EAUA 4M29A 1TZ7A 3E9AA 1BYDA 1FCVA 1HVXA 3HBLA 1CPUA 3JW7A 1U79A 1IGWA 3SQSA 5CLWA 1R3TA 1HL2A 4WZHA 2G37A 2A3HA 4UR8A 3DFTA 3SCPA 3GC4A 5LNUA 4HU8A 1QI3A 1TMQA 4H8NA 4M1RA 6ALDA 2E9BA 3TP4A 1OM0A 1C8XA 3VPLA 1W8GA 1K9FA 4B5XA 5CZSA 2J7FA 1EZWA 3GHRA 1UWTA 3FKRA 1S2UA 3WBXA 4ATWA 1QPKA 3BMBA 3RYSA 3F5LA 1Q2RA 3VCNA 2ONEA 5FSEC 1P5QA 1SMDA 1YTDA 4JTCA 4I5UA 3B8DA 2VZUA 4IG2A 4Z2IA 4NJGA 4BWLC 3AALA 3PTQA 3HF3A 3WN6A 3LGDA 4LEQA 1OZMA 4HARA 3QM3A 4X60A 2ZRVA 2AL1A 3H6OA 3C5QA 2C19A 2F23A 3B7XA 2VX6A 3KBVA 2JZVA 1D7IA 1KRAC 1HL9A 3UY8A 4DN1A 1BVWA 2DT2A 3S2JA 2QJIA 2PRLA 5HDRA 3ZLHA 3RMEA 1VD6A 1XIDA 1YPXA 2VR4A 3UZJA 4GYJA 2V2CA 3VIKA 1FJDA 2V81A 3JZEA 4PUDA 1MFUA 2WCSA 3IK2A 5CPMA 3S9IA 5I3JA 3QLDA 4NY2A 5CG0A 2R82A 5CZ0A 1OCNA 3NQ2A 1RLCL 1X1NA 4XZBA 4GCXA 2PLKA 2D24A 4GQGA 4QISA 2F84A 3S5NA 1LZOA 5AECA 9CGTA 1QHPA 2XIQA 3KLKA 4HNLA 2DSVA 1D3CA 4C6EA 4TVCA 1VFUA 1GOWA 4LRTA 4CVUA 1UUQA 3DYMA 2HSAA 3O6YX 2BHUA 4C91A 1VQTA 4W4QA 4QE1A 3UR5A 3VINA 1D7FA 3NEVA 1H3GA 4C02B 1TE6A 5K9XA 4DYKA 3LGEA 4OOZA 1JF6A 1W26A 2G3NA 2P4VA 2PRMA 3SIZA 4N0RA 3VX1A 1SJDA 3UERA 2RDTA 1A5LC 1W9PA 4H9MA 3MBFA 3H7VA 4GUJA 4ZE4A 3AYVA 5HAOA 3GU9A 1BKSA 4GOAA 3DBNA 1EH9A 1F6PA 1YMYA 3IACA 4Z2JA 2P5NA 4E2OA 1ICSA 4ZQCA 2QJNA 4DO5A 3W7IA 1SUXA 5I79A 3CHVA 5I07A 4HPHA 2A7NA 1TO3A 3LMZA 2FPYA 4PA8A 4CNOA 4GMEA 1H51A 2VWTA 3SCQA 3VCCA 1F2JA 2DSUA 2J4GA 3FAXA 4A29A 4XBJA 2QV4A 3LMYA 3PTKA 3ORWA 2IPJA 3FCPA 4QP0A 1XGEA 4FA3A 3G0UA 2M1IA 3L4XA 1TVPA 1W32A 4QLLA 4LJ3A 4ZGYA 5KZEA 4LBSA 3TW6A 1E6XM 1W1PA 1ECEA 1H09A 1JL8A 2G4FA 4ZOEA 1CDGA 5BCAA 5I00A 4GIEA 4UTWC 1PYFA 2Z4GA 3VKCA 1RPXA 4MWAC 3SAZA 3TQKA 2PU1A 3TKFA 3OQ8A 1TCOC 3W7QA 1MEIA 4CQDA 1JVWA 2PDPA 3RM4A 3AMDA 4CD8A 1BXBA 2BASA 3R0UA 1QZ2A 3NM1A 1HFBA 4N2YA 1TWSA 4JPGA 1SMAA 2FHCA 8CGTA 3K8MA 1DXEA 3JXVA 2ZXQA 3GAKA 4JTIA 3EWDA 1M68A 1FKBA 1SU5A 4DJEC 4FLRA 4AF0A 2NX1A 2BGSA 3ALFA 4HK7A 3UWQA 1GCYA 4Q22A 1G67A 1DE6A 4J9JA 4HA1A 1X97A 4JFWA 2MANA 2XSXA 1UA7A 3TQPA 4ACZB 1ZCNA 1A5KC 4EOUA 3B9AA 1J0IA 3GHSA 3LXAA 5HJLA 4KF1A 1PX8A 4XZMX 4NJKA 1TTPA 1D8WA 3N18A 1U22A 3TJLA 3W2JA 2XFRA 1YLVA 1IZCA 1I1WA 1Q6FA 3LBOA 1QO5A 5BXTA 2J6VA 2VEIA 2V3FA 4Z42C 3VIHA 3H53A 3TX9A 4YTRA 4O0QA 5HWBA 1SM9A 1TREA 3ARWA 1ZJBA 2E5BA 3PHAA 4EANA 2GDQA 2OSYA 2HK1A 3DUGA 4MWAE 1O66A 2RUDA 4Y8EA 2D2GA 3CZEA 4G56A 4NAEB 5L6UA 3WH8A 2NXGA 4LF2A 2GJLA 1OGSA 5F2MA 4LY8A 3BMVA 4KGJA 8XIMA 3HJEA 1ML1A 3WK0A 4DI9A 1US0A 3L23A 1M03A 2IXUA 3M5VA 2VRJA 4LF1A 3PBWA 2ACUA 3HPZA 4OUIA 3EOEA 1WKDA 4QFUA 1I2OA 3NA8A 3IKDA 4ZB0A 1E3XA 5HNNA 3W38A 4AFYA 4HHPA 2JEPA 3BAIA 3UD6A 1TX2A 2CBJA 4AY7A 3ZSTA 3GYEA 3DH7A 2VFEA 3N15A 5DMYA 2EPLX 4IQEA 3V0UA 4TX9A 2BP1A 4NXKA 3A4XA 4C6LA 2OODA 1BYCA 4HU0A 4PB5A 4RNFA 2FKPA 3SRDA 2MF9A 1EKOA 5CC7A 4REQA 4KEUA 4YVXA 3T44A 4PMXA 1UWUA 3THAA 1DTNA 2XDFA 2RDUA 3GIYA 1EWDA 1H62A 1RA0A 4MPQA 1W1TA 4PB4A 4QCFA 1KXTA 1TVLA 1KFLA 1HKVA 4JBRA 2QMKA 3UPBA 3L9CA 1VBGA 1ONRA 3AYSA 3OZMA 4E8CA 1FWDC 1EBHA 3CWNA 1EP1A 1HX0A 3EOUA 5BU6A 1GQKA 1GOQA 2XISA 3LRKA 4LBRA 1XHGA 2YSWA 2VTFA 5BWAA 4A4AA 2F6XA 3LTSA 3C2VA 4JYDA 4NUWA 2QVHA 2J7GA 3BW4A 1RP9A 4TTGA 1XUUA 1PVNA 1ZK6A 4UTLA 2QQ6A 3ATYA 2AQOA 3TYZA 2AL2B 1SZFA 2PN0A 2XN0A 3IRDA 1K3UA 4HPXA 2D20A 5KZ6A 4CCZA 3GR7A 4ZA0A 3H2AA 3CZJA 3T07A 1R86A 4JFKA 4F0HA 5REQB 3GHUA 1Z89A 4GY1A 3UNDA 4HCDA 2WHKA 1IEIA 1B90A 4MJZA 3H2FA 1FH8A 3LB0A 3KOFA 2P3ZA 3S4TA 1XG4A 2FGLA 4B16A 1I4NA 1QFEA 3SIMA 1VB9A 2O0TA 1VCVA 2E25A 4AVOA 4FMVA 3LNMA 4HBOA 2C18A 3A24A 4RKAA 1S1RA 2ZUNA 1B4KA 5C0QA 2J9ZA 3AQUA 5CPQA 4GA8A 3HG3A 4B2DD 1QNVA 3SI9A 5H8MA 1LYXA 3PSVA 4ZXLA 2CETA 2CXEA 2YKKA 1R0MA 4JEQA 3B40A 1JCYA 3B3DA 3LK6A 4JIQA 1OBAA 3W6YA 3IIXA 4MFEA 1HJSA 3U4FA 5LHEA 3GTHA 4HNTA 1XRVA 3NPXA 3TJXA 5H91A 1E9YB 3HGOA 1W6TA 1IF2A 3NNTA 4KRTA 2ZVRA 1JYWA 7ODCA 4AIOA 3AIRA 1F8IA 4L6DA 2RDXA 2V3GA 5LIYX 3BLDA 1VPQA 4O10A 3QC0A 3OODA 4M6QA 3U5UA 1BD0A 5J5RA 5FJPA 2FGBA 1K03A 4KIRA 4A2SA 1XLFA 1CI1A 3ARYA 4IIBA 4NRRA 3V18A 1CB7B 1YDVA 5H8UA 3RU6A 2J9YA 2XIBA 2ZZ7A 3FSUA 2E6DA 1GK8A 5HJYA 3INPA 3SRHA 2HK0A 4IMDA 4GNKB 4UWMA 4O4VA 4W85A 1JXJA 5IXEA 1FFQA 1YX1A 1R47A 3W75A 1KGXA 4HMNA 4DRQA 2FZ8A 1HP4A 2WZMA 3EX3A 2FVLA 4Q4PA 1ROTA 3B0YA 4MAZA 1OC5A 3PZUA 4Q8WA 1ZQ5A 5HBFA 1MNSA 5KITA 1QW9A 1MFVA 3NQEA 2VGFA 2CU0A 3Q4DA 1ZBVA 2VFFA 3DESA 3PM6A 3SO7A 1DL3A 2YLAA 1R3QA 3C3NA 3UWWA 2XP6A 5C9UA 5JH2A 4AD3A 3ZVIA 4H8VA 2HE8A 2ZXAA 1J2WA 3EWZA 4RZ5A 3TWBA 2X8RA 2IQTA 2J7BA 3VE9A 2OYKA 4HZ6A 2Z1SA 3AO0A 1UR2A 4ZPVR 4I90A 4G50A 5DT7A 3WLQA 2FH8A 7TAAA 5D2XA 3APGA 3R6IA 1NDVA 1EX1A 1JEZA 1BVZA 3SDOA 4ZSTA 3EDKA 1UD8A 2LGOA 3G0SA 3MY9A 4QZVB 3U2EA 4W88A 3CQKA 2QCLA 5D2TA 3E49A 3IV8A 3QY7A 5JBFA 2XZ7A 1GQIA 4QE5A 1A50A 5T8GA 2C1IA 1MUCA 4QGCA 3EA1A 3CT2A 4JFJA 4PCTA 4QITA 4IQ2A 1XBZA 4PULA 1NOUA 1GQNA 3QW4B 1VBUA 3M16A 3RFAA 1SZNA 4R9OA 1O12A 5AB3A 1TUXA 1BKFA 1DKWA 4IH3A 3QPEA 3PNUA 4DUVA 2EBNA 1QWGA 4UTWA 3WDHA 4ZQOA 1N8FA 3SM0A 3BLKA 4LVGA 4Q8PA 4XISA 5DELA 4AX7A 3UGVA 3W9ZA 1VBHA 4UTIA 3E38A 3GNOA 1C3FA 2D2HA 1JCXA 2CESA 3KRSA 3TFCA 1L0PA 5FI8A 3UETA 3ATZA 2PURA 7XIMA 3IVTA 3WJXA 4JY8A 3CUXA 3N2CA 2V63A 2VC7A 4W7UA 1XRSA 1M3UA 1JZ7A 1YADA 3WLHA 1T6MA 2FYMA 2VUYA 1YE6A 3CK5A 3WQDA 4HOZA 2OXNA 3W7NA 1V3KA 1UASA 2OWXA 2NT1A 2ZRUA 4RZ6A 1G7UA 3T0BA 4PTXA 3CASA 1W9UA 3H55A 1K6WA 4JHMA 2X0HA 4WGXA 3O5QA 1JG9A 4HYVA 4FOUA 2DY3A 3GIQA 5CGTA 1WDQA 3KCLA 2ZZ4A 3JU2A 2J74A 3OBAA 4N4QA 3RXZA 4JOMA 3EMCA 4JFTA 2PWGA 1Z7AA 3PJWA 2WV8A 2INFA 4UQBA 2QXWA 3WK2A 2Y1HA 4MNLA 1K8CA 4JTFA 1OB0A 5CBBA 4B92A 4X9SA 3W85A 5IDZA 3W87A 3S2NA 1Q6EA 4WRHA 2WB5A 3L0NA 1Z3NA 1E70M 3MCMA 1XX1A 3E0LA 3N34A 3VILA 2QUNA 3CGMA 2YXGA 4RNIA 4RZ4A 1P0BA 4DRIA 1TV8A 4GD0A 3CV1A 1I1XA 3LCHA 5K7JA 3E3HA 4JTKA 4LC8A 1KCZA 2WJFA 1SZGA 4B9ZA 1QNOA 1E55A 4H2CA 3K13A 3P80A 1ISWA 1Y0OA 1TA3A 2BODX 3CPGA 5ABFB 5E6ZA 1FVPA 3NSMA 3KE0A 2KAUC 5HUOA 5A6TC 4AD4A 2XYLA 4A3UA 3IGHX 3PG8A 4B2DA 2AWGA 2WM1A 3SSJA 1VFTA 4Y2WA 5C2CA 5D09A 4DF0A 3FVMA 3CH9A 3KACA 2FAPA 4GQBA 4MIMA 4HP5A 2WSPA 1GVOA 2OT0A 3N2BA 4TW7A 2A7RA 1CLKA 3A12A 4OUEA 3R8HA 3UW6A 4CU7A 4HGXA 2P53A 1SGJA 3HTWA 2DZVA 1C92A 2CZVA 3RX3A 1ZP4A 1US3A 5EMLA 3KTCA 2RUQA 4K68A 3BANA 1LRNA 3PVFA 1VCGA 2E1WA 3E2RA 4TVDA 2VJXA 3ZR4A 2CFFA 1LLWA 3CZLA 3QOMA 3WD2A 1FKIA 1RVKA 1HTIA 3WMLA 1D9EA 2IQ0A 1S5MA 5D05A 3L65A 3SURA 1GOOA 3OB8A 4KCWA 1PZ2A 4D71A 1EEPA 4Z1AA 6CGTA 3P60A 4J1OA 1TIMA 3SRKA 1QPFA 2ZWYA 1KGUA 5AC4A 3B8VA 3R11A 1R30A 1N2VA 1YXDA 2V5CA 2PDQA 4UQ9A 2D9FA 3L66A 2ZKMX 4I8DA 1F7BA 4LANA 1XCXA 2FB3A 3G1DA 5F4SA 3VOGA 2J88A 3GC5A 1WP6A 4FHAA 3TLLA 1UJPA 3A3HA 3U9IA 1P7TA 2QDGA 1UMLA 4DWSA 4H9ZA 3IV3A 1LOLA 3EOLA 2J75A 3LA4A 2CHRA 4B91A 1XFCA 1CGVA 1WPCA 2OZ3A 1OFOA 5KTLA 3W1TA 1ZAJA 1JCHB 4WLCA 4DEFA 3BLLA 3WH9A 3PR2A 2X05A 3T1GA 2I16A 3UJEA 7REQB 4TOQA 3WQVA 1B2YA 4A8IA 3HV9A 3VFCA 3WSUA 2FPVA 7A3HA 1ZENA 4JFLA 3CHFA 3ZLGA 1Q6GA 4DXXA 4H19A 3DZ1A 2YJQA 1M5WA 3A6OA 3NQDA 3HPSA 4ZR8A 3KWXA 3OHIA 1H0IA 3OW1A 1KM4A 5D75A 2BB0A 1HKWA 1CWYA 1ITUA 1PIGA 3B06A 3W53A 5C2XA 3OEXA 5A8OA 1HIZA 2DZSA 3WK1A 1H7WA 1GTEA 1L2UA 5FF3A 4AD2A 4UR7A 5EFFA 3JVAA 4U31A 2V2DA 3SCNA 3W00A 3AIQA 2FZDA 3IUDA 4G9PA 4WCJA 2BHYA 2BOFX 1OQFA 4GBUA 1QK2A 2D73A 1WZLA 4I7VA 1R2TA 3DFNA 2UWFA 4ERGA 3T2PA 4IIEA 1QPLA 4O57A 2J27A 2C0AA 5I7GA 2Z1XA 3M46A 4B4FA 2QT3A 3KRBA 3OO2A 3EDFA 3UZZA 4A8RA 3R58A 2G4JA 1TX0A 4QCEA 2XWEA 1KM5A 2XVLA 3QV6A 3MSRA 1KBLA 1H1YA 3HN3A 1TJ1A 4GVFA 5BRPA 1DE5A 1Z69A 2Y5SA 4HJFA 1SPQA 3TDFA 3N04A 2QV5A 2VOTA 4F0SA 5T9BG 1OGBA 1J2BA 1GVRA 1Q85A 3ABZA 1AQHA 3W01A 5I2UA 3RJYA 3N13A 3FA4A 4GPNA 2HV5A 4DROA 2EG6A 3WH6A 1RJQA 4C60A 4H1ZA 1QU4A 3BV7A 4UQDA 3CAWA 4GRSA 2LJ4A 3GG8A 4D6EA 4TW8A 4IQJA 5M1TA 1VYSX 2WNZA 3G5EA 2Y62A 4J3ZA 1L8NA 1EP2A 2KE0A 2VO5A 1UR1A 3VTRA 4DRKA 4Q33A 1EEXA 3UQIA 2X09A 3WLRA 4RV8A 1DTUA 3SCTA 3AHXA 4RNHA 4NYUA 4FNTA 4GACA 4GUFA 3EKGA 5CJ5A 3RHGA 1HXVA 3FKKA 4QG6A 4HA4A 3WBAA 3CAVA 2QCMA 4AH7A 3LPFA 2CLKA 2JBMA 4MUPA 4XG1A 1JCLA 1A49A 3URNA 1FWWA 4BI5A 3E2QA 3LCGA 4U28A 3W2KA 4X0VA 2A79A 4CQ9A 5F2GA 1J12A 4WR3A 2CWNA 2FPTA 4I9MA 1GUVA 1HW6A 1JPIA 2KFWA 4GFSA 2ZZ3A 4MB1A 4HHHA 4O8AA 4PUWA 2PMQA 1SO3A 1PKMA 3M07A 2V5LA 3O5RA 1GOKA 1XFBA 1NOWA 4MLJA 2ZX8A 3W82A 4EPEC 1ZBWA 5JUVA 5HR7A 5A8MA 5CCZA 4LBUA 2HWGA 2JF7A 3DFOA 4P2VA 4WX2A 4O17A 3SB0A 2E9MA 1U33A 3NQMA 3GTXA 4X63A 1DPMA 2PF8A 1XLJA 5CPSA 1PIIA 3TXVA 1W1VA 4AY1A 5HW8A 4QG8A 3IIZA 3GR8A 4X3ZA 3RR4A 1XH0A 4D9PA 3WQCA 3AXXA 4IPLA 3AJXA 3RGCA 1WE5A 1M5YA 1A5CA 2A1YA 3EWXA 5CSUA 3NZQA 3T42A 4AZ5A 3VFLA 4LAOA 3TXZA 2VM8A 4Z2KA 3LCWA 4L4MA 4R9XA 2QAPA 3T2OA 4XZWA 3AUJA 1CIUA 4M19A 3B0UX 3O15A 3GFXA 1SQ7A 2VZVA 1M1BA 2I14A 2XZ9A 3FEQA 4A21A 1AL7A 4DBUA 1XLKA 2BVYA 4B90A 2VCDA 4AHOA 3VNYA 4E4UA 3C3UA 2PDXA 2NWSA 3WQFA 2XIMA 3O5DA 3VD4A 3WLPA 2PEVA 4O1CA 3S5YA 3U4AA 2ITKA 4Z2HA 1YBQB 1J0ZA 2ZUVA 4P8UA 5C9RA 1JPDX 4LS0A 2Y0FA 4DUWA 1IHIA 3HFTA 3W1LA 3KAIA 3BQ5A 4JX4A 3L4ZA 4ODLA 3R8RA 2CKSA 3ZYZA 3TZFA 4G2PA 3P62A 2V68A 2A0NA 5G4WA 4LXFA 4LNYA 3KS6A 5G5IA 3AIBA 5A6LA 4OBTA 2UZ5A 2EKCA 2INZA 1QCWA 2W66A 1GKPA 1H49A 3M5ZA 1W2PA 3GX9A 6REQA 3QQ0A 4HOWA 1UPMB 2FJKA 3AXMA 3LXCA 2J7EA 1OG0A 4MSSA 3CU2A 4KR0B 3RIKA 4JN6A 4AXNA 1SZRA 5JH8A 3VVGA 4AWEA 4D6IA 2BVTA 3AIVA 3URBA 3MMTA 4UOZA 5EMYA 4HD5A 3ZT5A 1OC6A 4P5UA 1F74A 1B9ZA 1EHAA 1ME8A 3SQLA 2QW5A 4G5DA 2PGWA 3KVKA 2ZRXA 5CGQA 2YYUA 4LVBA 3UEQA 3O5GA 1V0NA 3FK4A 2ZOXA 4TW6A 2X0YA 3WBWA 3T55A 3OPSA 4E2VA 3HOJA 3VNZA 3H2NA 3I7SA 4D8ZA 4DRSA 3NOYA 4MDOA 4J7RA 1KKRA 1TZZA 1UOKA 3JRKA 3QR1A 5CPNA 1WKEA 3M0HA 1LG2A 1F4HA 3A5FA 1F61A 3MV01 2WVVB 4UNKA 3WH5A 4CQAA 3GDTA 5BRQA 3MW7A 1J10A 1VBJA 4LVDA 1TQJA 2DUAA 4DJFA 1G5AA 4Q4QA 3LSCA 2AMGA 2P10A 3LM3A 4ERIA 3CZKA 3BGAA 4HTYA 4WD0A 2OX4A 1T7LA 7TIMA 2EULA 4AC7C 1F40A 3Q65A 4HK5A 4QBXA 4D6GA 3GG7A 2BV9A 4ZQMA 4W84A 2W91A 3CUJA 4GK8A 4GUHA 2CPUA 2QJMA 5DMLA 2WYSA 1E4MM 2J9XA 3MJYA 2E7FA 1E4LA 1W2VA 3PTMA 3NEHA 1TPB1 2E5CA 3CMGA 1JDFA 4V33A 4D6FA 3FDKA 2G41A 3M6YA 1JCNA 3M0ZA 4KESA 2KO7A 2Z00A 1DJQA 1FKHA 3JS3A 4FK9A 1J0HA 3QJAA 3NTYA 4ZVJA 3L4WA 3TH6A 3PSWA 5G1YA 3RU8X 1J0KA 4N9BA 1JVNA 5HUPA 3BLEA 2WJDA 4H6EA 4J35A 1Z6KA 3M41A 3BZGA 5A3HA 1NDYA 4PTVA 1ZBKA 1YW5A 4QDWA 2FHBA 2R1NA 3BJSA 2WVUA 3UT0A 2D69A 3ZVHB 2R1MA 3OBKA 3T8QA 3WNPA 2VR5A 5BXJA 3KZSA 4S3CA 2PDKA 3BMWA 1XJBA 3NUKA 3RLUA 3C0LA 1EOMA 1VAHA 4ZO8A 2E1DA 3GC2A 3AHYA 1YHTA 1YXCA 4C6KA 5A1AA 3NI6A 3FXYA 2DSZA 4EP8C 4FNPA 3UYIA 2PBOA 1R2RA 3PY2A 6TAAA 1R9ZA 2JKAA 1T41A 3SJ3A 4DPPA 2XP3A 4LU0A 3VI2A 4ML9A 2FMNA 4ZE5A 1WB0A 1PXGA 4AZHA 1T0OA 3BJFA 2ZR6A 2PDMA 5A95A 3TC7A 4MVAA 2HRWA 1L1PA 4P7OA 2VZSA 2Q3RA 2CLMA 3RCMA 4CNSA 2PSNA 3ZR5A 1TSIA 4LAUA 1PTDA 1NF7A 1VYRA 4XAGA 3O5MA 1UR9A 2MLYA 3VOFA 1L6WA 3VIFA 2INEA 4NL1A 3BUVA 3UA3A 3BGJA 4R7OA 2VP8A 4BWLA 4J3TA 3SGGA 4JQ1A 4DIAA 4GUGA 2DSKA 4YYCA 3VGFA 3RITA 4DYEA 2VNCA 4M24A 4A3QA 1PTAA 2CXGA 4KCVA 1MEHA 5C6MA 3W7RA 2DPEA 2NQ9A 1G7VA 1T8XA 3TV8A 5HWCA 1Q6DA 3V7PA 4I8YA 2O9TA 3RO8A 3DGRA 4X0NA 3AIEA 2DIJA 4DJFD 1UP3A 4EWND 4DELA 4GJJA 4GIAA 2SFPA 1J4IA 1HNYA 1UD2A 4DZAA 4AD5A 3ITOA 1XSIA 3CHEA 4XVEA 3QTPA 4PMRA 4ORMA 1LWHA 4HU3A 4O53A 4XQ6A 3BURA 3LV5A 3LG3A 1YYAA 4YL2A 5T26A 1JR1A 3WEZA 1FA2A 3SBFA 3PUOA 4JY9A 2OQLA 5HWNA 4WGHA 3AYTA 1A47A 1HQTA 1ONEA 1R9XA 3VNLA 4PRRA 2NUWA 1CNVA 2DJXA 3FN9A 4Z0SA 5DBTA 4FR6A 3W6LA 4ATDA 3V16A 4FX8A 4DQWA 3GFYA 1J6OA 1TV2A 3KDOA 3TDBA 3DHPA 1R85A 3U2OA 1W37A 1TV3A 3CL7A 3PZOA 1ZBCA 3LI0A 5FESA 3KTSA 4LUTA 4Z2LA 4OWGA 3KBSA 2GGJA 5EBUA 2HS8A 4A3YA 2VYOA 1XDLA 2ZQTA 3KXQA 5DRCA 4JFMA 3WH7A 1QJWA 4O0KA 4AQLA 5DANA 2ISWA 2GJXA 1DIKA 2DGAA 4O11A 2PWUA 3AMKA 2BVWA 4KCUA 2GLKA 4LB4A 2DORA 3GVGA 2GUYA 4R7WA 1C9HA 3GW0A 3TN5A 3R79A 4AX6A 3ZO9A 3MMWA 4IOTA 1S3TC 4ICMA 2J8FA 2A2IA 3NR0A 1BTCA 3PB2A 5LIKX 2WMIA 1UQYA 3W7LA 4PTDA 4A8LA 1JAKA 3V5OA 3SCWA 3N73A 3O6DA 1XWYA 3UCQA 1TR9A 2G5WA 5FKYA 2DEPA 1QW7A 3NG3A 1XLHA 3IIOA 4GXWA 1P0NA 2RFGA 3TCSA 3I3EA 1OYBA 3QZAA 1V7YA 4V2XA 3MP3A 4EK7A 1Q6HA 4DVOA 1KNWA 1O95A 2AKMA 2JQXA 4PUJA 3LHUA 1R3SA 3GXTA 3BC9A 2AQWA 4R85A 4IPIA 3K8LA 3CPUA 3S1GA 1FHDA 3FYYA 3VKDA 5IFTA 1IT7A 3PF3A 4Z17A 3PA7A 2QDEA 1G69A 1OD8A 3CL8A 3W23A 4PRTA 5C5YA 5DT5A 3UI6A 1ZY9A 3MKVA 3C2OA 3LZ5A 1OWQA 2Y8KA 3GU0A 3W07A 3IEBA 4ZOBA 2PD9A 1AH3A 3RPMA 3ARXA 1YE4A 1HJQA 3TTYA 1A80A 2CHOA 3BK0A 4XSMA 1ROUA 3QSTA 5BYWA 2RGMA 1G1YA 3NQAA 1XDMA 2VCAA 1QRQA 2OR2A 3MUAA 1EJUC 5G1TA 2B7PA 1TPEA 3TROA 2DV0A 4H9VA 2EXOA 3E0WA 5EMUA 3PWIA 3GPKA 3CUIA 3SECA 3AFBA 3ZJ7A 3TR9A 1GKRA 2XSAA 4FNSA 3AZRA 2FZNA 3VM7A 3SADA 1XLEA 3KDNA 4HKPA 4IHCA 4H6RA 4LAZA 4PB3A 1L6YA 1H5YA 1L8PA 3ISIX 1F3TA 2WJZA 1LT7A 5AC5A 4QJ1A 4H9YA 4B5NA 2V5JA 3OZPA 4A6GA 5CSRA 1KCKA 3AAMA 1W5NA 1W8SA 3H54A 3PZQA 4JTEA 2ZX6A 3KRZA 3WJWA 1XYMA 4O15A 1TQXA 4KGLA 2MLXA 1V7AA 2YA2A 9XIMA 2B7OA 1DV7A 5HKGA 4MZYA 4LWWA 2RAGA 1YW1A 3CV7A 1KTCA 3Q94A 4CN6A 4KW2A 2CERA 3GDBA 1CW2A 3EWYA 1PJ9A 2W3ZA 1S2CA 2ZR5A 3A64A 1O5RA 5DQPA 5LHFA 2HE5A 3RF9A 5TIMA 1M04A 3WQ4A 4M1BA 4BFAA 1XI3A 3UESA 2XUCA 5LA0A 5EFDA 2WKGA 4AZBA 2FGZA 3ES7A 1WDDA 4KETA 3BCFA 1Y7VA 3LN3A 1QI4A 3WNOA 1ZHAA 3I3BA 3MCOA 1GZGA 3I10A 5CZJA 3V1PA 2ZRYA 2DP3A 4JR5A 2F6KA 3AICA 1DP0A 2GGHA 1E1FA 3PPCA 1B3XA 4IPNB 1RP8A 1JZ4A 2Y63A 3VOHA 1E44A 4BA0A 4DJDD 1XRFA 1H4PA 3B0PA 3THUA 1Q2SA 1VR6A 3OGVA 1S39A 1AZ1A 1QATA 4WKAA 3JYJA 4NI3A 1V6YA 2Z0IA 2WC4A 3KBNA 2QHAA 5DY3A 2R24A 3WLOA 1RHCA 2J25A 2YLLA 3NO5A 4HPGA 4NVTA 4IP7A 5KEZA 3MHUA 3TTSA 1IEVA 3RR1A 3TN4A 6ENLA 4ZPTR 4NZ4A 1CXEA 1UC4A 4FXFA 2BTMA 2Z1VA 1DJWA 2PODA 1KFEA 4CD7A 2WK2A 3MUZ1 1RPKA 4LYKA 1C9DA 4WY0A 4NZJA 3S9YA 5FL0A 1IWPA 4QR6A 1XIFA 4ICNA 4GZ7A 2C3ZA 4IGSA 2HPIA 3MI6A 1Q8JA 4G1NA 3QMRA 4S2CA 1PWMA 4MY1A 2Y78A 2QGYA 3DG3A 5HINA 5G2HA 3FJ6A 1V4YA 2PWHA 2K8IA 3KCJA 2P50A 3TAKA 4E8DA 3WJZA 3Q67A 4PUUA 1PKYA 1B6CA 1PB0A 1V0LA 2BY0A 3H2C