4DWSC

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
539
structure length
526
Chain Sequence
KPTENIPSPILVEDKYTEETYSRPDVNFEDGSQGNLSYTATRVCAPMYNHYVGDKTPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKVQEVWDGWNAQAPSLGLPQIGKGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDDGENYVLLIKELRSALDSRFGYSNREISIACSGVALKKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAGHFISLDTPRTVKQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADSNQETIDMGPLYNPGEIYLKSISEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chi2
publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
molecule tags Sugar binding protein
total genus 184
structure length 526
sequence length 539
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsC01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsC02
1ISZA 4EAMA 1Q4NX 1I1WA 3KL5A 3WUGA 2CHOA 4B9YA 5BXSA 1HKKA 2CKRA 4NZCA 2DT1A 3VDBA 4H2CA 3VGFA 1Z32X 4HZ8A 2UY5A 1WZKA 1C8QA 4RE3A 3VTRA 1CXFA 1W3LA 4F66A 1ZJBA 1W9UA 1GVYA 1OCQA 3W6LA 5BYWA 3OLIA 1B3WA 4A3YA 3ZJ8A 1E6PA 1UZ1A 2WVUA 2CERA 1GHRA 1OGSA 2PBOA 1HJWA 5BXRA 2VCCA 3VIMA 1M03A 9CGTA 1ITCA 3CUJA 4FLRA 1QBAA 1K9EA 2ZXAA 2CETA 1BQCA 3FAXA 5D4YA 3SCVA 4QP0A 2ZX9A 4UQBA 2XWDA 1S46A 3KWXA 2WLYA 1VEMA 1H4PA 3ARUA 1GPFA 3IK2A 1M7XA 1SYTA 3U57A 4J3XA 2G3IA 3NDZA 4CN4A 1QPKA 1US2A 3J7HA 4KGJA 5A2AA 1X6LA 3GH7A 1MW1A 1GOMA 2F2HA 1C8YA 4P8XA 2AMGA 2EBNA 3BXWA 1GJWA 3PZUA 1MQRA 2WKGA 1HX0A 3VD9A 1LQ0A 5A6BA 2VNCA 3CHDA 4HA3A 3O2LA 1V0LA 5D8ZA 2XWEA 5E6YA 1OGGA 2G4FA 5FL1A 2VURA 2X1IA 1EO7A 1UYQA 1J0IA 3UCQA 1H41A 4JKMA 1V6UA 5A6JA 2GJRA 4LX4A 1JF5A 1QNPA 4AMCA 1E0VA 4PMZA 4U5KA 1CTNA 1U30A 5C71A 1UR8A 3A3HA 4MAVA 1CGWA 4RE2A 2BXZA 2WCGA 4UOJA 2WC3A 2D23A 2V5DA 2W67A 1VENA 1UA7A 2CBUA 3WL1A 5I23A 1VEPA 1KCLA 3QOKA 4D6FA 3EYPA 3RDKA 1AQHA 2D0FA 1GCYA 4H41A 4PMDA 3ARQA 1B0IA 2G41A 1GQKA 1MYRA 3PZVA 2VZUA 1VEOA 3MS8A 4JKLA 1BVNP 4OKDA 4GO8A 5A3HA 3RPMA 4H04A 1KR0A 4MADA 1C91A 1XCXA 3VDHA 2DSZA 4J7RA 1PBGA 2XG9A 4W87A 5I3DA 2NT0A 3BAKA 5HXMA 5BCAA 2F8QA 3OZPA 3ZT6A 4Z2GA 1JZ5A 2FDMA 4C7FA 4WIWA 4OOUA 3ARRA 3SCQA 1Q6GA 1UZ4A 4AZ6A 1BYCA 3KE0A 4M81A 4U2ZA 4PMXA 2V3GA 3WQ4A 3AS3A 1LWHA 4MB1A 1NOFA 1MVYA 2FHBA 2ZUWA 4HA4A 5DT5A 1B3ZA 2WK2A 1BFNA 3DYPA 3OLDA 2WW5A 3EBVA 4WK9A 1EIBA 2QPSA 1UD6A 3HU7A 1US3A 4UFMA 3WDQA 3MMUA 1UD8A 5GNZA 4UZSA 2FH8A 2BXYA 2XVGA 2XM2A 2UY2A 3U5YA 3A4WA 1KGXA 1DWAM 4MDOA 2D1ZA 1RD6A 1M53A 4W84A 1FP9A 4W8AA 4PUEA 1GORA 4HU8A 3VINA 4D71A 2WB5A 1UUQA 3GH4A 3PZOA 4F9JA 2CIPA 2JF6A 2IXVA 3MMWA 1G94A 4BS0A 2VOTA 2NW0A 3ZR6A 1I75A 4X0NA 1WDSA 1UWUA 2E9LA 2VCAA 1W1PA 1OIFA 3WEMA 5AC4A 4PBGA 1GUVA 1CGUA 4AEEA 4GPNA 1UR4A 1OBAA 2ESCA 2WLZA 1WO2A 1CYGA 2ZXBA 5GNXA 1E56A 3AHTA 4PMNA 5CPTA 3BAJA 1W3JA 3ZR5A 4CUCA 2G3JA 1EO5A 4IUGA 3BLKA 3AS2A 1E6QM 1CGVA 3ZQ9A 1H5VA 3WY1A 4W89A 3AIVA 3NJ3A 3F5KA 4CD4A 1KBBA 2XFFA 4AD2A 1DWJM 1QNQA 4PSRA 3KL3A 1RP9A 1VAHA 2CXGA 1EQCA 2NT1A 1JAKA 2DH3A 2E3ZA 4GQRA 1JG9A 3PHAA 4HZ6A 4IPLA 5KEZA 3CLWA 4W88A 3AMCA 2WAGA 4AIUA 3RCNA 1CBGA 3K8KA 3AYSA 3VIFA 3QGVA 4J3SA 3CUHA 1FH7A 3W82A 1Y7VA 4PMUA 1KGUA 3N17A 4H8HA 3B9EA 2BHUA 1V3JA 2IXUA 1A47A 3BAXA 1UHVA 1GZJA 3AICA 4AYSA 3LPPA 1JF6A 3OA5A 5CGTA 1BGAA 1DWHM 5IHRA 4NSBA 1VF8A 1JI1A 1NWTA 4PRWA 5AC5A 1BF2A 3VIKA 2XGBA 4D1JA 3RJXA 3W0KA 1UR0A 4X0VA 2J78A 5DT7A 2WANA 5HNNA 1JYVA 4W85A 1QNSA 3N9KA 3WH8A 1E6NA 1XC6A 1JI2A 1HF6A 1E71M 1ZJAA 1CGYA 5E0CA 1G1YA 2EXOA 5JBFA 4WF7A 2WCAA 3FW6A 4LQ1A 4AZGA 3MSDA 3WEOA 3WL0A 3L2MA 2E9BA 2BS9A 2BY1A 2FGZA 5FIPA 3SCUA 1LLOA 3NSXA 5A94A 4LGXA 2V5CA 1HL9A 1B3YA 1E73M 3EDEA 5CG0A 3ALGA 4CN1A 3NSMA 4LYRA 3AHYA 3BMWA 5FKYA 3WDIA 1C93A 3W29A 4IPNB 1H11A 1G5AA 3OLGA 1YQ2A 1JD9A 2E8YA 5A2CA 4LPCA 1KB3A 1E4LA 5HPCA 2WHJA 2C8NA 1B30A 1XH2A 1EDTA 2PC8A 1MFVA 1BLIA 1ZS2A 3WIJA 2DPEA 1FP8A 3VX1A 4PYSA 3SCRA 3AJ7A 7CGTA 3QOMA 3W27A 1ISYA 3WQVA 2WXDM 3AHZA 1E0WA 1QBBA 4YHEA 2X8RA 1R85A 4F8XA 3ZIZA 2D22A 3SCNA 1DWGM 1K9DA 3ZJKA 3VGEA 2GFTA 3VIPA 1EOKA 1KR1A 1OGBA 4N42A 2VJXA 4JKKA 2CBJA 1UKSA 3PZ9A 1V3KA 2ZOXA 4X9YA 3RM9A 4JZ5A 2VCBA 3PZTA 5JIWA 2XHYA 1HKJA 2DGAA 4GI9A 1OD0A 1D3CA 1U33A 4HU0A 3WFLA 1J01A 3OGRA 1E1EA 4LYQA 3AMDA 1HP4A 4CD7A 3IJ9A 2WC7A 1QI0A 2WZHA 4NRRA 4DUWA 4CCCA 2JIWA 2BHYA 4AY1A 4M8UA 2VUYA 2BY3A 3IJ8A 5CQ1A 2FHFA 3WH5A 3L4YA 2E8ZA 3S2CA 2DT2A 1IZKA 3VD7A 4UFKA 3BSHA 2VL4A 2NSXA 1W9BM 3BAYA 1DWIM 5I0DA 4XZBA 1JAEA 1FHLA 4RL3A 2Y8VA 5AYIA 3SCOA 1WAWA 4GKLA 3MU7A 1WDRA 3K8MA 1HIZA 4ZFMA 1V0NA 2XVPA 4MDPA 1Q6DA 4TVDA 1J0ZA 4HA1A 4WJXA 4WKFA 1ITXA 1E3ZA 3AIRA 2UY4A 2VX7A 1JFHA 1W9DM 1NP2A 4CD5A 2ZWZA 6A3HA 4D6GA 1KFWA 3E1F1 3FNDA 2EPOA 3WQWA 1HN1A 2OSWA 2X0YA 1TVNA 1X6NA 4GO9A 1B9ZA 4W8BA 3WF1A 2GVYA 2VZSA 3WF4A 2TAAA 4FLQA 3BGAA 1Q6FA 2E40A 1TE1A 3MO4A 2VO5A 1QI5A 2DH2A 3MV01 1XRVA 4J3WA 5LA1A 5A8NA 2AAAA 8A3HA 1OT2A 3OGVA 3SURA 2W5FA 3W38A 3CZ8A 2J7EA 5EBAA 5FCZA 1UD4A 1ESWA 1L8NA 1WCGA 5D9OA 4KRTA 2D24A 5FOOA 1TCMA 3VDAA 2D20A 3UERA 2XYLA 4QLKA 3FAWA 1KXTA 3AI0A 3VM5A 4JCMA 3DHUA 3B9DA 1VRXA 3DYOA 4XZWA 3T0AA 2G3MA 3ARVA 3L4XA 4H8VA 3WMCA 3MUAA 4P7RA 1H2JA 4PN2A 1YHTA 3WNNA 3K4AA 1B3XA 2QHAA 4CVUA 1EA9C 4ZE4A 1E6RA 1W3KA 1JZ8A 2CESA 5LA2A 4MAZA 3M7SA 2VR4A 4GIAA 1RP8A 1GQIA 2UWFA 5A8QA 1H09A 3GM8A 1UR2A 1WZLA 4MTVA 5HDRA 3CHEA 4E2OA 3AMLA 1UQYA 4OUEA 3WNOA 1BYBA 4TTUA 1E6XM 2QMJA 3IANA 3WNLA 5A8MA 2WHKA 1ZL1A 5F7UA 1BAGA 1N82A 4LXFA 1MQPA 1PIFA 3VO0A 1J0KA 3OBAA 2W4XA 4AIEA 3CUGA 4TXEA 3K4DA 1KWKA 4HPHA 2O9OA 1EHNA 3ZO9A 1CGXA 2J75A 4DWSA 1GW1A 2O9PA 4PMVA 4QLJA 4FF5A 1UH3A 2BVDA 4DWSC 3OLEA 4QCEA 1CPUA 1GNXA 4Q22A 2JFEX 1R8LA 1V3HA 4HMEA 4AIOA 1WB0A 5FD0A 1WDPA 3F5LA 1H3GA 1NOWA 3AIBA 1W1YA 4UR9A 3WUFA 1TMQA 1CXHA 3SUWA 4PTVA 2YKKA 3BC9A 2W62A 4MNJA 5DEZA 4W8LA 1GOWA 2OSYA 4AZIA 3HJEA 3RIKA 1UD5A 3UG4A 1E5JA 1HJQA 4AD5A 3L4UA 3M07A 2ZX6A 3L4TA 3W24A 2E9MA 5ABGA 3DYMA 5D8WA 1PEZA 4EE9A 2Y4SA 3CHCA 1HVQA 3K46A 3A4AA 1M04A 3ARTA 1G0CA 4CCDA 1E40A 1LF1A 4KMQA 3L2LA 1ZBKA 4XUYA 3VD5A 5DF0A 1SMAA 3WEZA 3SUTA 1W91A 1DTUA 3SUSA 1V6YA 2JE8A 4QCFA 2ZUTA 2X2YA 2QPUA 3I3DA 3OZOA 2A3AA 3WBEA 4PTWA 4PUDA 4JCLA 4W93A 1BTCA 3WMBA 4M1RA 2E4TA 1XGZA 4H8UA 3W26A 3CPUA 1UWTA 1XYFA 3WN6A 4Q7NA 1KXVA 1X1NA 4BCEA 4MJ2A 1Q6CA 4MNMA 1UA3A 3BMVA 4FLSA 4U31A 1HL8A 5CLTA 2MANA 1D2KA 3TTSA 4BF7A 2GDVA 4WLCA 3MV11 3RM8A 4UNIA 4AZ7A 3ZM8A 3VNZA 3EMCA 3I3BA 1O7AA 3LMYA 3BAIA 4P7OA 4CGTA 3WH6A 3CZJA 2OYMA 2J7FA 3ZJ6A 5I78A 1HJUA 3GBEA 3WQ6A 1WZAA 3WF3A 1UD2A 4AZBA 4UQEA 2YL9A 1VB9A 2DIJA 2D0GA 4B15A 3ARSA 4M24A 1B2YA 2WCSA 1LWJA 1XH0A 4MJ4A 2XJ7A 3VD3A 3T2OA 3D5HA 3N11A 1K9TA 1QI2A 1E3XA 4PMQA 3RMEA 4YPJA 3AIEA 3RM4A 5C70A 2BY0A 4UFHA 3BH4A 1E5NA 2HVMA 4JFSA 4Z2KA 5IFTA 2DT3A 4H7VA 5JH8A 3WUEA 3SUUA 1GOQA 1KQYA 1DHKA 3VU2A 1UWSA 4JHOA 1DP0A 4BQ4A 2YL5A 5DO8A 4ATWA 2CPUA 1ECEA 3SEPA 3WMSA 2YDRA 2QV4A 1HKIA 1SFSA 3F4VA 3MUY1 2ZX5A 3ZT7A 2WSPA 2ZIDA 4J28A 3ZSTA 4BQ2A 3OB8A 5GNYA 1AQMA 1GVIA 1CXLA 4TX8A 1JXKA 4J3VA 2AOSA 3CMJA 1OT1A 1V3MA 1CXKA 1NARA 4WSKA 2DSKA 2CBVA 2YL6A 3N13A 2WNWA 4JAWA 2DQXA 3WUBA 4E8CA 4QAWA 5IXEA 2ZE0A 1BHGA 3M6DA 4PTXA 4UOQA 4Y7EA 2PI6A 1H0IA 5M03A 1E6ZA 4AISA 4OIFA 3VIGA 3NIYA 1E70M 3TTYA 3AYRA 3MUZ1 2JIEA 2D0HA 2DSWA 4DUXA 4TVUA 4JL1A 3W37A 3DHPA 2DSUA 3T08A 4GZJA 1E4IA 1WP6A 4HOXA 5C8BB 1D7FA 4D6EA 3FY1A 1JDCA 4CD6A 5LA0A 4CVWA 2V3EA 5ABEA 4NF7A 4YHGA 4AEFA 4JFWA 1WE5A 1V0MA 3I3EA 3MSGA 2EPKX 2CCRA 3W4RA 4J27A 4ZXLA 1R86A 2X05A 5DMYA 2BHZA 2VZVA 7TAAA 1O6IA 2Y24A 1E0XA 1UKTA 1CEOA 3L4WA 1VBUA 2JEQA 2WVVB 1HVXA 4ATLA 3AIWA 2FHCA 3ZT5A 1NQ6A 4V28A 1LL7A 2WZEA 4TVCA 4DUVA 3VGDA 4CCEA 2V3DA 2PWEA 2DT0A 1QI4A 5DFAA 1JYXA 5CZKA 3MKKA 1SR0A 1ZB5A 3SUVA 2YLAA 1MXDA 4B3LA 5CLWA 2VVNA 3T2QA 4KRUA 4MB4A 1OINA 4ACZA 3GNOA 4HOZA 2VQTA 2WHMA 2J7CA 4OBSA 1NH6A 5CXPA 4DWSB 1HP5A 3WKZA 4DM1A 5CPSA 1HKMA 5I24A 4WSJA 1MW0A 1UWQA 3RJYA 1ODZA 5ECUA 2G3NA 4N0RA 3PZNA 5JBDA 1H49A 3WENA 2WMKA 5I6SA 1UQZA 1VIWA 1JFXA 3SCTA 3AQUA 4UCFA 2XSAA 3WH9A 2CITA 4ML4A 2E0PA 3UR8A 1GJUA 3SCPA 2PWFA 3AHXA 3G6MA 2A3HA 1CNVA 4F79A 3RILA 4UTFA 1QHOA 2GK1B 3TA9A 3OGSA 1XD0A 1V02A 1CDGA 4ZXOA 2CKSA 4HOWA 5A6BD 4UQ9A 5E6ZA 3CUIA 2ZUNA 5GPRA 2OWCA 2J8GA 2O9TA 3PZMA 2GJXA 3VVGA 1ISWA 3NYDA 1JZ4A 1PZ2A 5A6LA 1V08A 3WFZA 3N15A 2EPLX 2XM1A 2CBIA 5BWFA 2VT0A 2YIHA 2WMFA 2W92A 4MNKA 2D2OA 1E4NA 1ZU8A 2VRQA 2YBTA 5LYRA 1EXPA 2XFRA 1JIBA 3AMGA 3WELA 1C92A 1GOOA 4UFIA 1ZBCA 3UG3A 4BZYA 1VFUA 1C8XA 1V0KA 4JFUA 1W1VA 1V03A 3ARZA 2VQUA 3GH5A 1EDQA 1ISVA 1UH4A 4GZIA 1W9VA 1CXEA 4QDMA 1W32A 1UWIA 4OOZA 3WDPP 3EDDA 4F9DA 5EFDA 2J25A 3GXFA 2XIIA 2HISA 1E43A 3WD1A 3AS1A 3AROA 2YLLA 1BSIA 1J12A 4S3JA 2OSXA 5BXTA 3ZJ7A 1HT6A 4RE4A 4E4PA 3BCDA 4JHZA 5M17A 1BG9A 2GSJA 2F61A 3AMKA 1AMYA 4U2YA 4XV0A 4WKHA 5M3WA 3PZGA 3WNPA 5I77A 2GDUA 3AOFA 3QHOA 5A6SA 3ZSSA 5EB8A 4AD0A 1OD8A 3RO8A 1QOXA 3SIMA 4CD8A 2YL8A 4EANA 2VC9A 4IM4A 2JALA 1UG6A 2J4GA 2DEPA 2CNCA 1RH9A 1BYAA 1HJVA 1CENA 1QW8A 2Z1SA 3GNPA 4D6JA 1LL4A 2QLYA 1XD1A 5BRPA 3L4VA 1MWOA 2WM0A 1K6AA 1R7AA 2EPMX 4GZEA 3B8SA 4OBRA 1UH2A 2WVSA 2QF8A 1MXGA 3CHFA 3U7VA 4P7LA 2VR5A 4D6HA 1TA3A 1E15A 1JDAA 4V27A 3VM7A 2BNJA 6CGTA 4LYPA 1UKOA 2V3FA 4C7GA 4K68A 4HMCA 2PBGA 1WNOA 2ZXQA 3N04A 4W7VA 2WVVA 1EDGA 1P6WA 4ZEPA 1E6SM 3GDBA 4HMDA 5ABFB 4BA0A 3TTOA 5KZ6A 4TOQA 3EMZA 2ZUSA 4NRSA 3EDJA 3VUPA 4CU8A 2BY2A 3PTMA 4UQAA 1TUXA 1R7OA 4R27A 2PWGA 3AXXA 3CGTA 3PZQA 1IZJA 5E09A 1AVAA 1W1TA 1V6WA 3CZLA 4HP5A 2VVSA 1J10A 1NP0A 1V6XA 5A69A 4Z2JA 3WD3A 1JGIA 1EQPA 4GI6A 4ACYA 5E9AA 1J9YA 5AY7A 4CKQA 3KL0A 4CU6A 4A4AA 4ATDA 1OSEA 4AZHA 1QHZA 3T0BA 4U3AA 3II1A 2BVTA 3VMNA 1M01A 3DC0A 5FL0A 3CBWA 2D3NA 3PZIA 1QHPA 1TR1A 3TP4A 5I5RA 3PTQA 5BXPA 3VGBA 3SCWA 2C0HA 2GK1A 3VMOA 5I79A 1F4AA 1B31A 1KCKA 3WSUA 4CN6A 1KBKA 5HOSA 1VJSA 4CU7A 2EEXA 3UR7A 3VGHA 4W86A 2XVNA 1TZ7A 3WF2A 3NUKA 1WZMA 1ODUA 1NWRA 3EMQA 4B3KA 3WNMA 1FHDA 1CIUA 1QI3A 4URIA 3VIOA 1BVZA 3HN3A 5A1AA 3VILA 4IISA 1W3HA 3PN8A 1VFFA 1QW9A 4GXPA 4P7NA 4QLLA 5IFPA 4HZ7A 4JL2A 1HXJA 1J0YA 3A47A 4MB5A 3VNYA 2WWDA 1E55A 1FH9A 1MW2A 6TAAA 2VI0A 1XSKA 1BPLB 4AZCA 2YJQA 4E8DA 3VOCA 3AXIA 3W6MA 3WD0A 1C90A 1J0JA 2WMHA 3W25A 1BYDA 4ACZB 2CYGA 1UR1A 2J47A 1UD3A 5GQBA 5JIPA 2XPKA 1JZ6A 4B16A 1B3VA 2WYSA 3TOPA 5CSYA 1MQQA 4TUFA 4UQDA 1JD7A 2YA2A 1BG4A 2GJPA 4D1IA 3UG5A 3CH9A 1WPCA 4W5ZA 2OWXA 2Y8KA 1XYZA 4PMYA 4U5IA 1LG1A 3WH7A 1PAMA 2XUCA 1QVBA 4AC1X 4D6IA 2Y2WA 5D9NA 1PX8A 1PX3A 1RPKA 2YDSA 4W7WA 4UQCA 3POCA 2YBUA 3VIJA 1QNRA 2EO7A 2WPGA 1PPIA 2B31A 2OWWA 4UZUA 4TTGA 2EJ1A 3THCA 1OWQA 1E4MM 5JUVA 1E9LA 1GQJA 4L4OA 4P8UA 1NM9A 1AQ0A 3EDFA 4S3KA 1TVPA 3ECQA 3CO4A 5I2UA 2G8ZA 2FGLA 1OIMA 3M46A 4PMRA 1JNDA 4EKJA 4PCSA 1FOBA 4BQ3A 2GJXB 4W7UA 2YDQA 4PMOA 2PWDA 2XFYA 1J18A 3T0DA 2OYLA 3BAWA 1E72M 3THDA 1W9XA 3PTKA 3W53A 3IAPA 2J7DA 1L0PA 3WD4A 3NDYA 5A6MA 2XTKA 2VRJA 5A8PA 4JFVA 1R87A 3BSGA 3O6AA 4PSPA 1JZ2A 4MB3A 2UY3A 4D6CA 3BLPX 3VX0A 1GOIA 2X0HA 1VFOA 4HTYA 1V02E 2YA0A 3QHNA 3CUFA 3QR3A 1SMDA 3MANA 1GQLA 4AW7A 3AIQA 5BROA 1K9FA 1JNEA 4J3UA 4OJYA 5ABFA 3ARYA 3K8LA 4P7QA 3U7BA 1FH8A 1BGGA 1VFMA 3AXHA 1W2VA 2J7HA 1EH9A 3FHAA 3VGGA 1V6VA 4FLOA 1UR9A 1NWSA 1DWFM 3UEQA 2W66A 1U2YA 3N1AA 1JZ3A 1A3HA 3ARXA 2IUZA 3EDKA 1CECA 1KGWA 4D72A 2A3CA 1ZBVA 2DDXA 3G6LA 4Z2LA 1CWYA 3UETA 1TFVA 3WQ5A 1C7TA 3N12A 5A2BA 1HJXA 3NCOA 8CGTA 2RGLA 2CEQA 4UFJA 2VMFA 3AZSA 3OIHA 1XHGA 1PIGA 2VZOA 1JYWA 1MFUA 1JYNA 1XSIA 1KXHA 1GOKA 1F4HA 3TONA 3AISA 1UKPA 1EHAA 2VX5A 5E0FA 3CZKA 3CZGA 4AZ5A 2J77A 3KEHA 3PBGA 1FA2A 3GXDA 2O92A 2WMIB 1ISXA 4XB3A 5A8OA 1KXQA 2BVYA 3GZAA 3K1DA 3S6TA 2ZUVA 1G01A 3GYCA 4U33A 4MPKA 4DM2A 2ZICA 2V38A 2WMJA 5CPQA 1J0HA 4AXNA 2A3EA 2EPNA 1ZBWA 5AYBA 1TA3B 1J11A 1W2PA 3MUIA 4M56A 3W28A 2FH6A 2ZX7A 1Q6EA 3QHMA 3CIVA 1GONA 1UWRA 2X09A 5TD4A 3MMDA 1DEDA 4KGLA 1PX4A 4M82A 3CMGA 4UFLA 2VTFA 3AFBA 3N18A 3DECA 3VKKA 3POHA 4XX6A 3GNRA 3ALFA 5A6KA 2WC4A 1FFRA 3AIUA 2WVTA 2J8FA 3AHVA 4PEEA 4AWEA 3GTNA 1JZ7A 2W61A 1QNOA 3ZMRA 2WHLA 1GHSA 4NI3A 4U3CA 4J3TA 1XH1A 3AZRA 4WKAA 2DSVA 1NOUA 4YN5A 3WNKA 3GXMA 4L4PA 2J74A 1C3FA 4QFUA 1LJYA 1E1FA 3WDRA 5CJ5A 2ZX8A 1HJSA 1TG7A 3FHQA 3ARPA 1CXIA 2YA1A 4M80A 3VDCA 3UESA 3JUGA 5BRQA 3LPGA 4PTMA 1H1NA 2WZIA 1WKYA 2WBKA 3CZEA 3D3AA 2PF0A 3VPLA 5A6AA 2C7FA 2VX4A 2WMGA 3CTTA 4BQ5A 1MW3A 1CLVA 1EGZA 2DIEA 2YOCA 2XVKA 2O9RA 5JBEA 2WBGA 1W9PA 3IAQA 4GI8A 1WDQA 1FFQA 4TX6A 1JXJA 1UOKA 5M5DA 2VZTA 2Z1KA 4OZOA 1UKQA 3U5UA 1IV8A 4D6DA 3AZTA 1VJZA 4B9ZA 2GUYA 3F5JA 3VD4A 2OLHA 2Q8XA 2XIBA 4A3HA 4AD4A 2ZXDA 4Z2IA 4JFTA 4M29A 2VRKA 1JDDA 2BFGA 4GINA 1XSJA 4DWSD 2BV9A 3LPOA 4P8VA 3OG2A 4KH2A 2D3LA 1I1XA 1OM0A 2OYKA 5E70A 4V2XA 1EOMA 4EK7A 2ZUUA 4FMVA 3VMPA 5A95A 3VIHA 3WDJA 3T09A 2RGMA 1LG2A 3O9NA 3VIIA 2XGIA 3WBAA 5IDIA 4P8WA 3ZOAA 3FN9A 1CGTA 1HNYA 2CHNA 2WKLA 2PB1A 4W5UA 4AZCB 5IHSA 5D9MA 3WF0A 5HBFA 5CGMA 3SCSA 2VX6A 4C7DA 1CZ1A 1B90A 5ABHA 2XSBA 3A6OA 3WQ8A 4HPGA 2EQDA 3NSNA 3GBDA 2ZWYA 5CSUA 2WSKA 3ARWA 2ZUMA 3BCFA 5EFFA 3AS0A 2J7GA 1PZ3A 1KWGA 2J79A 2A3BA 3HMCA 1IT0A 3GXIA 2J62A 2PWHA 3APGA 1CLXA 3WD2A 1C7SA 1KQZA 4GQQA 3W81A 3KZSA 2QMKA 4KWUA 5D9PA 5HPOA 1V3IA 1H0GA 2W63A 1B1YA 2W91A 2JF7A 3A4XA 3IJ7A 4UOZA 1XV8A 4ZENA 4MNLA 4FK9A 1OB0A 7A3HA 3B9AA 1JL8A 1XCWA 4AD3A 1LL6A 3LPFA 4ZE5A 1G9HA 1PJ9A 2XVLA 3T2PA 5EMYA 1V3LA 1VBRA 4AD1A 3L4ZA 2WMIA 1NWUA 3FXYA 2J7BA 3WDHA 4PCTA 3TTQA 4R5EA 4JIEA 2WWCA 4Z2HA 2Y5EA 2JEPA
chains in the Genus database with same CATH superfamily
1NSGA 1I1WA 3MBFA 3UZWA 1HKKA 1PCWA 3URAA 1H7OA 2DT1A 3KTSA 4H2CA 1U22A 3EWCA 3ZWTA 1G4EA 2JK2A 3VZZA 2UY5A 2Y0FA 1C8QA 1T8QA 5I3HA 3R25A 5FJTA 1ZJBA 5HWCA 1UJQA 2GPTA 1GVYA 4NZ3A 3WLJA 1FX6A 3W6LA 1JDEA 3E0LA 3EX3A 4US5D 4XZ9A 4C1NA 3EB3A 2HS6A 2AQOA 4OTKA 4W4QA 2WVUA 2FFCA 1FJDA 4DBSA 1GHRA 5GJNA 1OGSA 1W8SA 1HJWA 5M2FX 4K2SA 5BXRA 2VCCA 1QBAA 4WQ6A 1BQCA 2WO5A 3SCVA 3T7VA 3R8GA 3KWXA 2I57A 4HJWA 1TV3A 1SYTA 4YVXA 5FI8A 2PD5A 3EWXA 4CN4A 2KAUC 5D2WA 3GH7A 3P62A 5ABTA 4C6MA 3C3UA 1IT7A 5FEXA 3GC4A 1LQ0A 2VNCA 3S5SA 2BGNE 3W1XA 9RUBA 2EG8A 3UJRA 1V0LA 3GO2A 2QJGA 3SB0A 2VURA 1A5LC 2NQZA 2XIQA 1PHQA 4JKMA 3P80A 2XDFA 4G50A 1JF5A 1F6YA 1QNPA 3GU0A 1BVWA 5C71A 1JRBA 3S2MA 3A3HA 3LNPA 2WCGA 3H12A 3H2MA 3NPXA 1UA7A 3LCIA 3HQPA 3QGKC 2BGSA 3KX6A 4D6FA 4LT9A 3EYPA 1X7FA 3O16A 2RH9A 2D0FA 1EA0A 3CHVA 3NL3A 4H41A 4XAGA 1R46A 4PMDA 3CUZA 3O5OA 3FVDA 3VOHA 2X1UA 2ACUA 1DJYA 1VEOA 2DZSA 5H2ZA 3HOJA 4H04A 3UI6A 1XXXA 4MADA 2C16A 1C91A 1DJNA 4QIBA 1RQEA 3ABZA 1OG6A 3NZ1A 2DSZA 4JNMA 2XG9A 1TE6A 4W87A 4DJFA 5I3DA 3PULA 3IRSA 2PAJA 2ZCGA 3UA3A 2NT0A 4CEUC 2F8QA 2PDXA 4OU1A 4R7JA 2J8TA 1JZ5A 2FDMA 3IGSA 4RXFA 3NZGA 4WIWA 3OPSA 3EXTA 3SCQA 4EPBC 4U10A 5JH2A 4AZ6A 1OF6A 1VIZA 1OC6A 3DC8A 3O5EA 1RD5A 4M81A 4UTMA 4PMXA 4DZ3A 3GC5A 1BSLA 4MB1A 4PCPA 4KETA 1BRLB 3NQ8A 4LY4A 2ITKA 2PD9A 3N2CA 4DNMA 1EP3A 3DYPA 4XD6A 2QPSA 1Q13A 4UFMA 1QT1A 1TZZA 4UZSA 3ABXA 1RQBA 1Y65A 1BEUA 5FAJA 5CBBA 1TR9A 3U5YA 2IKJA 3PJTA 2V0TA 3NL2A 4XIMA 2B7QA 1R3YA 3DOPA 4U86A 4PUEA 3NXFA 1XIIA 5XIMA 3R58A 1SSGA 3QMRA 2CIPA 4J2PA 3MMWA 4BF9A 5CPNA 4Y9AA 4AB4A 4WDXA 2NW0A 4X0NA 4DLFA 2CLMA 5CBIA 1WDSA 3CL6A 2E9LA 3SM0A 3NL5A 3EEGA 2VCAA 4Y8FA 1GUVA 2Q71A 5HATA 3MKCA 4GPNA 1R3WA 2ATMA 3QKZA 1CYGA 4N6EA 2GQAA 3AHTA 5AB3A 4O8AA 2XN2A 1W3JA 5I02A 4YXGA 4NNAA 5T8GA 4CUCA 1QOQA 4JDBA 3M44A 3RRXA 4GBDA 1ZP4A 3AS2A 4AQLA 1CGVA 3N3TA 3ZQ9A 3WY1A 3VNDA 1N7KA 4BJHA 4A2SA 2FZBA 1SR9A 3LN3A 4IGNA 4LAVA 4FAPA 4CD4A 1KBBA 4JYEA 1RLDA 2E1WA 3ES8A 1KFCA 4LUSB 3M41A 2CXGA 3RRAA 3HQOA 2QPXA 4MWAB 3QZ6A 2NT1A 2OB3A 3DFSA 2E3ZA 3C0LA 4GQRA 1JG9A 5J6EA 4QSFA 3TDBA 4W88A 3QR1A 5T26A 1FTXA 4OV9A 2J6VA 4PA8A 4H01A 4GVIA 1Y7VA 1KGUA 3B9EA 2ZZ3A 4TX9A 2RUSA 4DBUA 2OFJA 3G77A 3KUMA 4AYSA 3LPPA 1BGAA 4NSBA 4BEQA 2QUUA 3TJ4A 5AC5A 4PTDA 8XIAA 3VIKA 2XGBA 1BXBA 2NLYA 2QJMA 3BJSA 4D1JA 5CPMA 2J78A 5DT7A 3T42A 5HNNA 1QNSA 4CNPA 1O5XA 1HO4A 4JFMA 1XX1A 4G7EB 1DIEA 1HF6A 3U2CA 3L5MA 4XBKA 3ZXWA 5C9UA 4WF7A 4HD5A 2ACQA 5FJRA 3MSDA 3OZMA 1WQ5A 4Y2WA 3PBVA 5PTDA 5FIPA 1U1JA 3NSXA 5A94A 3BURA 4RE0A 3TN4A 1HL9A 4JQ2A 1B3YA 1E73M 5CG0A 1WUEA 5HWMA 3G8EA 1Z89A 2R1NA 2AWGA 3BMWA 3WDIA 3FVMA 4EACA 4HT3A 3KVLA 3OLGA 3B0UX 3CMFA 4DRKA 5A2CA 3UZJA 1ZENA 2B7NA 1YPXA 4X63A 5HPCA 3CUXA 3NO1A 1XH2A 1BLIA 4PRTA 4LUJA 4CNSA 2DPEA 3AYVA 1P1XA 1PB0A 3VI2A 1FKGA 3SCRA 1VHCA 3KBSA 3A21A 4DJEA 2E6AA 2QQ6A 2WXDM 3AHZA 2DIKA 3R7MA 4OT7A 4F8XA 3S1UA 1AMKA 2DJLA 3SCNA 1DWGM 3VGEA 2WZTA 1HG3A 4LCSA 4N42A 3CPGA 4JKKA 2WSYA 1R2RA 2CBJA 4B5UA 2AKMA 3O5JA 1V3KA 4LVDA 3USBA 4EIVA 1Q2RA 4NG3A 2DUXA 4JZ5A 1FKTA 1RXOB 3SADA 3TJXA 2QCFA 3L66A 5DX7A 1OD0A 3QZEA 1NU5A 3FYYA 1T11A 1XR2A 1RSCA 2WC7A 1J8VA 2Z26A 4Z1BA 4S38A 2WZHA 3T0TA 2DG3A 2F21A 4K1WA 2JIWA 2XP6A 2BHYA 4B4HA 3R0DA 4O10A 4LCRA 3VCCA 2DJXA 5CQ1A 3T9PA 2FHFA 3L4YA 4JQ1A 2HVOA 1YMYA 4K39A 1PTGA 2FZ9A 4O4WA 3IVUA 2DT2A 3P14A 4Q8TA 3M5ZA 4UFKA 2JKEA 1DWIM 2Y7FA 2Y62A 4XZBA 4JFLA 4XZIA 1YW1A 2YXOA 4ICNA 4MPQA 3USZA 2DV0A 5DMLA 2GGHA 1PKNA 5AYIA 2PEVA 4N6FA 2X0SA 1T5AA 4ICMA 4DBEA 3SCOA 3G8RA 4NYYA 3MU7A 1FXPA 3R1ZA 1AL8A 2M1IA 4IT6A 2MUCA 4ZFMA 1GVSA 4MDPA 2POZA 1KTBA 3UWZA 1QAPA 4N4PA 1QPFA 4JTCA 5F2GA 1E3ZA 3G1FA 3MKVA 4MWAC 4PUKA 3UCCA 1DE5A 4LBUA 2NWSA 4CD5A 2VN1A 3R8HA 1HGWA 3WJXA 4OE7A 1JQVA 4FXSA 1KFWA 3E1F1 4GCAA 5AECA 3WQWA 2QDGA 1EEPA 1QWKA 4IMAA 3L67A 2PV1A 1O5KA 1EEXA 3BGAA 1UIOA 3V36A 2E40A 4IX0A 5BZAA 3MO4A 1QI5A 4K7VA 4QX4A 2C6QA 5A8NA 3CWNA 1GTEA 3R2GA 1ROUA 3W38A 4O18A 1UIPA 5FCZA 5F1UA 1UD4A 2HK0A 3MHGA 3GYEA 1RCOB 2MNRA 1TCMA 1W0MA 3UJFA 3VDAA 1QDSA 1AG1O 1KM5A 4JCMA 4XTIA 3LOTA 1PS9A 4MM1A 4XZWA 1Q6UA 2G3MA 3JYMA 1M5WA 3WNNA 4RLIA 4DO5A 1B3XA 4CVUA 3QTGA 2PRMA 2GVGA 4MAZA 4MY8A 5FF0A 5LXEA 2OX1A 2VR4A 4GIAA 1XUZA 6PTDA 5E9XA 1H09A 3HQNA 5LIKX 5BMWA 4IXHA 1GK8A 4E2OA 2CLFA 3W84A 4DHGA 4H6QA 4OUEA 3WNOA 2QGYA 4IIBA 2I17A 5AYYA 2HSAA 3IANA 4KQZA 5A8MA 4IMEA 3HIJA 1BAGA 3NGFA 1TWZA 3AWOA 1W3NA 4UC5A 4AIEA 1UR3M 1QPNA 4XISA 4HPHA 4TR9A 5EKYA 1FKSA 5KTLA 3CQIA 1XIDA 1W31A 4DWSC 1P0NA 3PVFA 3KCJA 4QCEA 5GPGA 2P0OA 4QE1A 1NJJA 3LCXA 3T78A 4WZHA 3M1ZA 1GNXA 1KRMA 3Q67A 4HMEA 2R6OA 3AU2A 4AIOA 1WB0A 3F5LA 1H3GA 2RJHA 3AIBA 3Q45A 3JW7A 4PFHA 3EOSA 5AHLA 4G7FA 1X97A 1YW5A 5K9XA 4PTVA 1RQHA 5DMMA 4ZSTA 1FKDA 5DEZA 3FIGA 3OYZA 1UD5A 3GKAA 1XPYA 1XGEA 4AD5A 2ZRXA 3TXVA 3M07A 2ZX6A 2AL2A 1BTMA 1OYCA 8XIMA 3CHCA 1HVQA 2JGQA 1H1ZA 4LVGA 4RK8A 1G0CA 3LSBA 5F4XA 1ZBKA 3RNDA 4NX0A 1SMAA 2J9ZA 3F1QA 4JYFA 1P0BA 2WV8A 2Y89A 3U6WA 2JE8A 1WUFA 2ZUTA 2X2YA 1EB3A 3I3DA 1E9IA 3WBEA 4PTWA 1QTWA 1KM3A 4PUDA 5IBXC 3QQWA 5F4WA 2P3ZA 2E4TA 4PUUA 3CPUA 3QF0A 4CNUA 1XYFA 1PYMA 3CV7A 4BCEA 8RUCA 4MJ2A 1ONWA 1UA3A 1XLBA 2ONEA 1HL8A 1E51A 3TTSA 3RM8A 2F7FA 1TV4A 1XLAA 3EMCA 3I3BA 1O7AA 2QAFA 4P7OA 2J7FA 4Y6GA 1XDMA 3NQFA 4Y9NA 1XQKA 2PDIA 1UD2A 4FX7A 4JN8A 1B2YA 2EJAA 1XH0A 2FPTA 4MJ4A 1F2JA 4H6EA 2XN1A 4C6KA 3N11A 1K9TA 1QI2A 4ZB2A 4PMQA 1YX1A 4IQJA 5C70A 2BY0A 4GIVA 3BH4A 2HVMA 2PU0A 4Z2KA 2ALDA 5HW8A 3SI9A 3BWWA 1GOQA 2E25A 1TRIA 2V9DA 3PY2A 3MDYB 4ZO8A 2CPUA 4XWUA 1ECEA 2XP4A 2QV4A 1IWAA 4O57A 2O4MA 1MEIA 2GGEA 2ZIDA 3ZSTA 4LBSA 4Q8MA 4B2DA 2PU1A 2AOSA 1A5KC 1OT1A 4S3BA 3LK6A 1CXKA 1NARA 5GJMA 2FVKA 4D8AA 1UPPA 4WSKA 2PTDA 2QJHA 4G1NA 2DZXA 2EG6A 2YDAA 5JH1A 3N2BA 3WUBA 2F2DA 3O5RA 5I98A 2Z7GA 2PURA 5IXEA 3EWYA 1KM1A 4HK6A 3M6DA 3WLRA 4GLEA 2VFIA 4UOQA 2QT3A 4K38A 4ALDA 3W85A 4GFSA 2PI6A 4I90A 1H0IA 4S3FA 4F2UA 4M7SA 3G1SA 4DXVA 2Q6ZA 2VD8A 1E70M 7XIMA 3MUZ1 2D0HA 3PAJA 4BI7A 1FWTA 4DUXA 3R43A 4R7OA 3T08A 4DVOA 4ODOA 1ZPTA 5EYWA 2ASHA 1ZUAX 3B03A 4D6EA 3I65A 1JDCA 2DY3A 4QJ1A 5LA0A 1XF0A 1ONRA 2FJKA 4CVWA 5ABEA 4NF7A 4YHGA 4AEFA 2ZC1A 1WE5A 2ZBTA 3UWUA 3I68A 4J27A 4LVBA 1R86A 3DEQA 3DIPA 3IHZA 2O55A 1O6IA 2GVLA 1TPFA 1UKTA 4QGCA 1O94A 3OBKA 2PPPA 3VFLA 1QU4A 4MKSA 1EGMA 2HZGA 3TQKA 5D03A 2FHCA 3WBWA 1NQ6A 2XP7A 2XFWA 1NVMA 3NQBA 3M0XA 4RNIA 1DXIA 1P7TB 3CTLA 3N19B 2DT0A 5DFAA 4LNCA 5D2TA 4FNQA 3CAVA 5CZKA 3ZZ1A 3MKKA 4IG2A 1ZB5A 4AFYA 4E3TA 3UW6A 1AJ0A 4PFMA 1FWIC 4KRUA 5B80A 3SZ8A 4WCJA 2QCDA 3GNOA 1VLIA 1X98A 2PWVA 4NZ4A 1ZALA 1R3TA 4A21A 4ZS6A 3B7XA 3RJYA 5B7ZA 4L6OA 2QS8A 1P43A 1TB3A 2CLHA 5JBDA 1H49A 3WENA 2WMKA 4RNFA 1UQZA 1JFXA 4M19A 3EX6A 4GXWA 1KO0A 4ML4A 3SCPA 3P0XA 3CGNA 4IQCA 4O0QA 3SN1A 1B54A 1JULA 4B5WA 3GAYA 4F79A 3GR4A 2YB1A 1Z3NA 3EA3A 1B3OA 1RBLA 2REQA 3OGSA 1XD0A 1EYMA 3BLFA 1GKQA 2H3BA 1CDGA 4HOWA 3E02A 3CUIA 1BKHA 4A05A 2J8GA 2O9TA 1JNTA 1RJQA 1JZ4A 3UA4A 5A6LA 2HE5A 2LLEA 2EPLX 3BZGA 2XM1A 5FJUA 1DJQA 4ZL1A 1LT7A 4Q4RA 2YIHA 2ISWA 2W92A 2E6DA 3BLEA 4GH1A 2D2OA 4V1XA 3JYJA 2VRQA 4E38A 4NKCA 2XFRA 1C92A 1ZBCA 1VFUA 1I45A 3UJEA 5KITA 4ADUA 1Q63A 4Q8WA 4JFUA 3V7PA 3ABOA 1GKRA 3ARZA 3L0GA 3TK7A 4PC8A 1CXEA 4QDMA 2DFAA 1X6UA 5EFDA 5CSSA 1E43A 4GKTA 3WD1A 2PDJA 1E0UA 2ZA2A 2HTMA 3AROA 4S3JA 1XLLA 4NAFA 3LV5A 5T91A 2OSXA 1A80A 4TIMA 1HT6A 5M17A 1BG9A 1FQ0A 4WD0A 3QLDA 1Q7MA 2F61A 3AMKA 3HFYA 3Q58A 2V68A 4QXIA 1YKWA 3K5XA 1QRQA 3THQA 3ZSSA 1S3TC 1DQWA 2Z6IA 3RO8A 4CD8A 2HMCA 4EANA 3C56A 2IKIA 2QUTA 2PPOA 1UG6A 4DZ5A 4IGSA 3M0JA 2BWGA 1RH9A 2HV5A 4GY1A 1HJVA 1G6CA 1QW8A 4K36A 1Q66A 3LHWA 1PWLA 3O5IA 2NVAA 3M0ZA 3SGUA 3CWOX 4YVVA 3LD5A 4A22A 3KVMA 4B5NA 3AUJA 3G24A 3LG3A 3QW4B 4C5YA 3AO0A 2BVWA 4UNKA 2WVSA 3W2KA 2QF8A 1DQUA 1F8IA 3U7VA 2J9XA 5AHNA 3S2NA 4D6HA 4V27A 3VM7A 3UZZA 3WK1A 2BNJA 4LYPA 1UKOA 1WXJA 5C2CA 4B5XA 1JUKA 4XZMX 1WNOA 3UU0A 2ZXQA 1U1UA 1EDGA 1B57A 2Q3OA 3LGEA 3LTPA 2VENA 4BA0A 4AF0A 3TTOA 5KZ6A 2C1HA 4TOQA 2ZUSA 1OZMA 1Q1CA 2QAPA 3ODKA 3SRFA 1R7OA 3FS2A 1PZ1A 2PWGA 4RW5A 3MTWA 3VZYA 5F1VA 1M6JA 3QPYA 1T0OA 3O0KA 3BV7A 1HKVA 2NUYA 1VP5A 4KWWA 2GWGA 3S2JA 1J10A 1NP0A 3W76A 3TN3A 5LNWA 3W9ZA 5BMXA 3MB9A 4H7ZA 2HQAA 1PIIA 1H61A 4GI6A 4EPDC 4S3GA 4ACYA 4GGHA 4CKQA 1Z69A 4L9YA 3PC0A 4AZHA 4JEQA 3G0XA 3T0BA 1Z42A 2BVTA 1L2UA 3L21A 3NZRA 4C1KA 4QDPA 3V4BA 4GIRA 5ENLA 3TP4A 1EGVA 3PTQA 3F2CA 5BXPA 3HFTA 2DW7A 1SM9A 4A29A 3VMOA 3QGAC 1B31A 1OJXA 4KPLA 3FYPA 5MKGA 2EEXA 4PB5A 4JTFA 3REQA 2XVNA 1OX5A 1UZHA 3WF2A 1IWPA 3SFWA 3NUKA 1WZMA 1NWRA 3BG5A 3EMQA 1YXYA 4B3KA 4LF2A 3M0MA 3PRDA 2P1FA 1Z8AA 4URIA 1FWGC 3K13A 4IISA 3PN8A 1DJWA 4JGDA 4GXPA 1H50A 3B9NA 4JL2A 1HXJA 1J0YA 1XLDA 2CU0A 3EOUA 2WWDA 1E55A 3TYUA 1FH9A 4KCWA 2BG5A 1HFBA 6TAAA 1V5XA 1XSKA 4O0ZA 3V75A 3W6MA 2GUUA 1TZ9A 3P81A 1J0JA 2FB2A 5C2XA 1BWKA 3JXVA 1JNSA 1QFEA 5GQBA 5JIPA 5HW7A 5HWJA 1JZ6A 4PZVA 2GOKA 5CSYA 3RLVA 3UG5A 4A8NA 1CW2A 2K8IA 4U5IA 2WQDA 1S1PA 4Z17A 4UQCA 1IF2A 5H6HA 4ORIA 4L4MA 4FALA 2CZVA 6ALDA 1FWSA 1XL9A 1ADOA 1W5NA 3UQBA 5CKSA 1UP3A 1SW7A 3UXIA 5JUVA 4L4OA 1LDCA 2REQB 3C2FA 5CC7A 1EX5A 3TW6A 4S3KA 1TVPA 2G8ZA 1GVQA 4PMRA 5AHFA 2N87A 4H6RA 1EKOA 4BQ3A 2FDSA 4M7TA 1TO3A 3SY8A 2H90A 4ITZA 1OCNA 3K2GA 3KOZA 1AD1A 1W9XA 4MMWA 3KZ7A 4O17A 3SJNA 3BSGA 1TWSA 1REQB 4KRZA 4PL2A 4R3UA 1BWLA 3VX0A 1MUCA 7REQA 1W56A 1VFOA 4NJHA 4XBSA 3P93A 5F4SA 1RZMA 1PYFA 1GQLA 4M51A 1VCGA 2PWUA 5DRIA 1J6OA 2W79A 4MZ1A 4N2YA 4OJYA 3E12A 2GWNA 3GHUA 1XRTA 4JR5A 1FH8A 3N6HA 4QJ5B 5U4NA 4WOZA 1W2VA 3FHAA 2XP3A 4FLOA 1NWSA 3HPXA 4YIWA 5BOOA 2W66A 1A3HA 4ZGYA 2A3CA 1J4RA 1ZBVA 4CQ9A 2VDGA 3KRSA 4YU1A 5AZ1A 3GTIA 4I8DA 3UWVA 4H00A 2ZQVA 1KM4A 1HJXA 1P48A 3UJSA 2ABBA 2QF7A 3DGBA 2FMNA 3AZSA 1XHGA 2QCGA 1PIGA 3E2SA 2FAPA 3FGCA 5CH9A 3LX9A 3TZFA 4MWAE 1D3GA 2VYOA 1UKPA 2VX5A 1XUUA 1JPDX 2H8ZA 1YNPA 3PBGA 2J77A 3KEHA 1X38A 4V33A 4XSLA 2BVYA 3GZAA 3SSJA 4MWAD 4HN8A 1O5RA 2ZUVA 1G01A 2V6AA 1R47A 3W75A 3DHFA 1RA5A 3UFYA 3W88A 4L1WA 1OC5A 1J0HA 2NUXA 4WHBA 2H9AA 3BCJA 4O12A 3STEA 2EPNA 5A8GA 1ZBWA 2YCJA 3T4CA 1W2PA 3W28A 2FH6A 1GVFA 1Q6EA 3QHMA 3IIVA 2OODA 3GRIA 1UP2A 1MRAA 3PFMA 4KGLA 1TX2A 2OKOA 4XAPA 3V5OA 2RDUA 1A53A 2VTFA 4GISA 2ON3A 3DECA 5EMMA 4HHHA 2BMBA 3POHA 3GNRA 1GKPA 4MIMA 1JCYA 3AHVA 4X22A 5HA7A 1JZ7A 4HBKA 3HMJG 1GHSA 5LNSA 3PBYA 2DSVA 3TFCA 4FAMA 1YDNA 5E5CA 1W26A 4YN5A 1ZCNA 3AC0A 4L4PA 2J74A 1SW0A 5CJ5A 2ZZ1A 1A5UA 1SU5A 1SZEA 1TG7A 3R5EA 4C6DA 2OJPA 3VDCA 2QXWA 1PWMA 3UESA 3VKAA 2EAWA 3C3NA 1FKHA 3Q2DA 2OXNA 2Y7EA 3TZNA 5A6AA 4I9TA 2C7FA 1DIOA 3CH0A 3H2FA 1GYNA 1MW3A 1CLVA 1EGZA 2DIEA 2YOCA 5D30A 3SRHA 3HV8A 1W9PA 3IAQA 3WQFA 4GI8A 2FFIA 1SFJA 1WDQA 1B4EA 4E2BA 2V2CA 2PCQA 2O0TA 2WJZA 4Z0SA 1UKQA 1H7RA 4FSAA 4EXQA 1F07A 3WBXA 3F5JA 2Q8XA 4A3HA 5MKGB 1J96A 3REQB 4CEXC 1JDDA 1KBJA 1D7IA 3C52A 3MP5A 4DWSD 2C18A 4P8VA 4KH2A 1I1XA 2OYKA 3NRKA 3UZ5A 2IPFA 3UD6A 4L6HA 1UPMB 4GZ7A 2XPAA 5EY5A 3T8QA 1PL9A 3ANYA 4LVAA 3O9NA 3ONCA 4HQVA 5IDIA 3SY1A 1T7LA 4FA3A 2CHNA 5D9MA 3WF0A 5HBFA 3SCSA 1PTAA 4C7DA 3H22A 1V79A 3WQ8A 2EQDA 2SFPA 2HE8A 5EFFA 3IIOA 3AS0A 2J79A 5U7SA 1OYBA 4DEFA 3CXOA 1ENUA 4LAOA 3QH2A 1KLZA 4TU1A 4Z42C 4IHCA 2J62A 2PWHA 3ITLA 3OZYA 4ROQA 3H6OA 3WD2A 4S3AA 4IXXA 4KWUA 4L61A 4DZHA 1V3IA 1H0GA 2W63A 1WA3A 3M0VA 3A4XA 3QV9A 4UOZA 1XV8A 2C15A 3B9AA 1XCWA 3M0HA 3FOKA 3GG7A 3HPFA 1EJSC 4ZE5A 3ABQA 4RR4A 2XVLA 1VBRA 3GTHA 1ROTA 4AD1A 3CYJA 2VC7A 1PINA 3FXYA 1R30A 3W7CA 3EOLA 2Y5EA 4AX6A 5D2XA 1ALDA 4ZTXA 4O13A 3OHMB 3KABA 3WUGA 4RNHA 4B9YA 5BXSA 1FRBA 1ADDA 4IT1A 4KFPA 3PSVA 1MSSA 1UMYA 3S1WA 2X40A 3TW7A 1Z32X 4HZ8A 3QBUA 1WZKA 2B4GA 4RE3A 4C65A 2GQ8A 1PKYA 1W3LA 4F66A 1XM3A 3NG3A 3ATZA 3OQEA 5BYWA 3TWBA 2ZYFA 4A3YA 1A5NC 3KADA 4TMCA 1FDJA 1I0DA 4XIAA 3K1GA 3WQCA 1R6WA 1VBGA 1M03A 3SQLA 3CUJA 1K9EA 3FAXA 4GUGA 3C5QA 2WLYA 3KBVA 3PFRA 3TV8A 3TCSA 2FMOA 1DQXA 2DP3A 3O5QA 4C6PA 1V8EA 3A5FA 2G3IA 2PDHA 3NDZA 4QAIA 5IRPA 2Y8UA 3E2QA 2BB0A 1US2A 4LU0A 4HSNA 2F2HA 2AMGA 4E5TA 1GJWA 1MQRA 6REQB 1HX0A 1XCFA 5A6BA 1KCXA 3V5CA 5KMYA 3PG8A 3PRAA 3O2LA 5D8ZA 5E6YA 5HMDA 1MZRA 1V7YA 1Z41A 2X1IA 4MF4A 1EO7A 2QCMA 1J0IA 1RV8A 3PJUA 3A64A 1V6UA 4ZPWR 5A6JA 2GJRA 4LX4A 1GYLA 3HG5A 4FNPA 4PMZA 4U5KA 4DELA 1U30A 4FB7A 4GCXA 5CPLA 4MAVA 1CGWA 1OADA 4RE2A 1M5YA 1XIMA 1FHUA 3UY8A 4UOJA 1YRRA 4LSBA 3WL1A 5I23A 4CQBA 2PDWA 1EF3A 4I9MA 2E28A 4NNRA 3N3MA 3W7KA 4NZFA 3IKDA 1UCWA 3Q65A 4LAKA 1SPQA 1IYXA 1B0IA 4EPKA 3R0KA 3MS8A 2DQWA 1KC7A 4JNZA 1BVNP 4HNVA 4B5SA 4UTKA 1YDOA 1JR1A 5LIWX 4C02B 4C1LA 2X7WA 4ZQRA 1PO9A 4MSPA 3W6YA 1TVLA 1EPXA 3PB0A 1NY1A 3WQDA 1S5VA 2GVJA 3C2OA 2PLCA 2RSEA 3BAKA 5HXMA 5HINA 3EWWA 3OZPA 4Z2GA 4JIRA 3MUCA 1L6SA 3ARRA 4DPQA 4U2ZA 1TWDA 2PDLA 3WQ4A 1C8VA 3ITTA 1XP3A 1MVYA 2VFHA 3NQCA 1GZGA 2FTWA 3ZFHA 1W1ZA 1SJDA 1M3UA 4HMNA 4A8RA 2W9MA 1W5OA 2WW5A 1LRNA 1F05A 1RA0A 4ODRA 3HU7A 2FVMA 3WDQA 3P5ZA 3U3HA 5EBUA 2QZRA 2OO0A 3S5OA 5GNZA 3HPZA 2FH8A 3AJXA 3OQ8A 4G6CA 4F0KA 1VCVA 2XM2A 2J66A 3A4WA 4U4MA 1KGXA 4I6VA 1SZRA 1M53A 4ILSA 4FEZA 4IIHA 1M1BA 5GJPA 3CB8A 3VINA 3WLSA 1EF2A 4IGMA 4F9JA 2JF6A 3OTRA 2G37A 3DG7A 4ZODA 2GDQA 4NILA 2VHLA 3VNMA 1KTNA 2VOTA 4DWDA 1J2BA 3ZR6A 4J4OA 2EULA 2TPSA 5AC4A 4PBGA 1CGUA 1MNSA 3PRBA 1P4CA 5I09A 1IEVA 5LHEA 2WLZA 1EUNA 2ZXBA 4MKNA 4ML9A 4S3DA 3CJPA 4JX6A 4PMNA 4JOMA 3SRDA 5CPTA 2Q09A 3ZR5A 1UBPC 3E0VA 4HNLA 1VFHA 4X3ZA 3PAOA 4IUGA 4M1BA 1E6QM 3CC1A 1W1B1 4KIRA 4F0MA 3F5KA 2XFFA 4AD2A 2PTXA 3C4UA 4PSRA 1VAHA 2ZRUA 3O0FA 4NZ1A 3MYOA 1EQCA 4TW8A 3WO8A 2G97A 1JAKA 3GXNA 1S2WA 4JTUA 3B8DA 3E38A 3PHAA 3F03K 5EMJA 4ZTYA 1UJPA 4IPLA 1A0DA 3ITGA 3AMCA 4DPPA 1FHVA 3RCNA 1TYGA 1P5QA 1AZ2A 3TMLA 1OYAA 2BHUA 4ZQMA 1O4UA 4XTDA 4JX4A 2RURA 5J5RA 3AICA 4NIRA 5CGTA 2PDBA 1DWHM 4Q8QA 4IJCA 2QJNA 3GU1A 4YNGA 3W1LA 1R5YA 2JKAA 1FKFA 3TH6A 3RJXA 3DN5A 4WGXA 2WANA 4NP7A 4W85A 3NL6A 3WH8A 1E6NA 2QUVA 5LHFA 3WJYA 1NDVA 4RCXA 4RDWA 5EA9A 5E0CA 3VK5A 4A3RA 2EXOA 1F6KA 4NAEA 1L6YA 4LQ1A 1RUSA 3WEOA 3WL0A 3L2MA 2E9BA 4GY7A 3TOYA 4TO8A 3SCUA 3LBMA 4UTUA 1XLMA 3FJNA 3W73A 3EDEA 1VKFA 3ALGA 4CN1A 1FKBA 3GW3A 5C7VA 1I2QA 3AHYA 3IV3A 4IPNB 1H11A 1G5AA 2E5BA 4AVNA 1ZNNA 1JD9A 2E8YA 3PNUA 1R9YA 1KB3A 2R24A 1E4LA 4A3UA 2WHJA 4H9VA 3GVGA 1GEQA 1GG1A 4HK5A 4GK8A 3GE7A 3PWIA 4K8HA 1FWBC 4L1XA 4UTJA 7CGTA 4HCHA 1HKWA 4ZZ9A 3W27A 4QROA 3KLKA 1H1YA 1QBBA 4J4KA 2NX3A 1C9WA 5AN7A 3W7RA 3ZIZA 1U5HA 4H9YA 4H9MA 2GFTA 3UVIA 1OFAA 1EOKA 3TQ0A 4WOQA 1FCUA 3FAPA 3KRZA 2ZOXA 1FWFC 4X9YA 4S1FA 3RM9A 2VCBA 1FKKA 2ZC8A 5JIWA 1GJPA 2XHYA 3TLQA 2DVUA 2DGAA 4HKPA 5HQLA 1D3CA 1U33A 4HU0A 3V0UA 4DRSA 1E1EA 4CQCA 3AMDA 4CD7A 5CJNA 4C6CA 2NX9A 1QI0A 1HZYA 2J24A 1NEYA 4DUWA 4CCCA 3W1AA 2VUYA 4MOZA 1TJ1A 2BY3A 5C0QA 4KERA 3WH5A 3KVJA 1VFLA 4Y9PA 2FZMA 1OHLA 2TODA 1IZKA 3VD7A 1VQTA 3BAYA 2V5BA 5LNUA 5HUAA 1FHLA 1KV8A 3QV8A 3PA7A 3MUXA 4RL3A 2Z00A 3S5YA 4O50A 1ICQA 1WAWA 2E1DA 3MHUA 2XVPA 3OEXA 4TVDA 3TUUA 1LUCA 4GGQA 4RPPA 1ITXA 1QOPA 2UY4A 3CL7A 5H8MA 1W9DM 5K7JA 2MF9A 1ZFJA 1OX4B 3OVGA 3W7QA 3CV1A 3SSZA 3MP4A 3LLFA 2X0YA 1YNYA 3N4FA 1JCMP 4EWJA 4GO9A 4W8BA 1RCQA 1EIXA 4LB4A 2P8CA 1I2OA 2QIIA 2TAAA 2VZSA 1VS1A 1Q6FA 1NF0A 4R53A 4LBRA 3MV01 1T6MA 4XK2A 5IOBA 3NA8A 1NDYA 1Q45A 1KFEA 5LA1A 5H8PA 2V69A 1WBJA 2OEKA 4Q6XA 3OGVA 1RK5A 4Q6JA 2IQ0A 2J7EA 1XW8A 1J93A 3LI0A 5EBAA 3W1QA 1ESWA 3UVAA 1L8NA 4UWMA 2D24A 3NQDA 4IH3A 4DQWA 5AYZA 4LANA 4QG9A 4L5ZA 3DYOA 5CBJA 3OVRA 3QV7A 3ARVA 3WMCA 5EU9A 2YXXA 1GVOA 1H2JA 4UTWA 1YHTA 4IP7A 1DORA 1E1CA 2CESA 3B0PA 1K7EA 4GX8A 5A8QA 1XYLA 3S9YA 1R9HA 3GM8A 3E2VA 1WZLA 4S3CA 3AMLA 4NZ5A 1UQYA 3P74A 4S3EA 2QMJA 3KHDA 3WNLA 2J13A 3LZ3A 2A3LA 4LXFA 2IPWA 2BGQA 3OBAA 3NZQA 2HNEA 2WOQA 4TXEA 3GFXA 3UWWA 4PODA 4BFAA 1EHNA 2J75A 2O9PA 1UH3A 2BVDA 3I7SA 1IWBA 4ZO6A 4JXCA 3L12A 4NT0A 1VPYA 4DRJA 1E0TA 1I2NA 1V3HA 3GTYX 1PKLA 3L0KA 4I9JA 5FD0A 1NOWA 2OEJA 3DGRA 1W1YA 4UR9A 1IGWA 5AC7A 2DORA 3B8WA 2QJJA 3A13A 2YX0A 4G8TA 1SJAA 2MLZA 4MNJA 4PUJA 3LRLA 4W8LA 3S47A 3HJEA 3KS6A 4IPIA 4O11A 3RIKA 3PG9A 2WJEA 4UTHA 1E5JA 2ZR5A 1GEHA 4O15A 2VGBA 1VFSA 4HB7A 3ICJA 3L4UA 2XP5A 3QY6A 3KOXA 3L4TA 1WV2A 4QIUA 1LZOA 4MZ8A 3BANA 2YZRA 1ICPA 3V1HA 3KLLA 5D8WA 4DRMA 1W1A1 2Y4SA 2XP8A 3C0SA 1EZ2A 1B9BA 1DJHA 3APTA 4CCDA 4DRHA 3C8FA 2E77A 3RYSA 3BOXA 3SUTA 1W91A 3AXKA 3UG8A 4JTSA 1V6YA 1S5NA 4MLJA 1SO5A 4JCLA 4M1RA 1XGZA 4IQ2A 3B8IA 1UWTA 4OGZA 3WLLA 2JZVA 4G2PA 4Q7NA 2Q3RA 2BDQA 1KXVA 1Q6CA 4U31A 1D2KA 4BF7A 2GDVA 4WLCA 4EXBA 4KR0B 2WKJA 3QXBA 3VNZA 4CGTA 5C55A 4Z08A 3TSBA 1HJUA 3WQ6A 1WZAA 4H9TA 3WF3A 4Q3MA 4UQEA 1VB9A 2D0GA 1Q2SA 4J1OA 4N7QA 2IS7A 2WCSA 3L5AA 1WAUA 2Z1VA 1XIEA 5DCDA 1OCJA 4US5A 3QW3A 3BG9A 1E3XA 3AIEA 3RM4A 3IUHA 4RDZA 2D9FA 1E5NA 2INZA 3UNDA 4JFSA 3V3WA 4BF5A 4XSMA 3EEZA 4H7VA 3LBCA 4XO7A 3SUUA 3RAOA 2QV5A 1KQYA 3B0VC 2C0AA 2P5NA 3T6CA 5C2GA 2GSHA 5DO8A 3V0TA 1ME9A 5G4EA 3TIMA 3BW2A 3WMSA 2CWNA 4JTDA 3GFZA 2DUAA 1KLYA 3F4VA 1VBHA 3MUY1 1AH3A 2WSPA 2E6YA 5AHIA 3OB8A 1JXKA 3W2MA 2PDFA 4IJBA 3CMJA 4GYKA 4GYPC 4KCUA 1GRJA 3DFNA 3KFTA 4Q8PA 1JCHB 2CBVA 4ZCWA 2WNWA 3LY0A 4JAWA 2DQXA 4E8CA 4Q8NA 1H7PA 1T96A 2ZE0A 4H9ZA 1Z44A 1XLHA 5JXQA 4R88A 3EX1A 4Y7EA 1L6FA 5M03A 1E6ZA 1TQXA 4AISA 3CIXA 1H7NA 2J9YA 4IL2A 5H1WA 4EP8C 2ZRZA 3TTYA 3AYRA 2I5QA 5HANA 3FJ6A 5HAOA 4DZAA 3W37A 3ELFA 3N9RA 4N4QA 3RGCA 4GZJA 2FPVA 2OT0A 1WP6A 2ATSA 3VNKA 3GC2A 1PDZA 2YZ5A 1EZWA 2OFNA 3NOYA 1LBMA 1D7FA 7ENLA 3R12A 4ZB5A 5G1TA 3O6CA 1RBOB 2F4EA 3FSUA 3GDRA 2V3EA 4JFWA 3P3BA 1AW2A 4B91A 1V0MA 3MSGA 2CCRA 3W4RA 4KFOA 3W1UA 1OZQA 5DMYA 2BZNA 2HWGA 5L6UA 2Y24A 1E0XA 4DAIA 4F3HA 4IFKB 5REQA 1CEOA 4Z1CA 1OFOA 3L23A 2PDUA 1N8FA 4NYUA 2BSLA 3AIWA 3E5PA 5DIUA 4M6QA 4V28A 1LL7A 3STFA 3PWGA 4J5NA 3YPIA 4UTLA 1JPKA 2I1OA 3TYEA 1JYXA 2BBFA 4B5TA 3VAVA 4D8ZA 2F2KA 4E2VA 2AGKA 1XGDA 2YLAA 1MXDA 2OVLA 2CZ5A 4B3LA 5CLWA 2VVNA 3T2QA 2G95A 2YPIA 4DZ2A 3W74A 4HOZA 2VQTA 4OBSA 1NH6A 3HF3A 1GW9A 5CXPA 4HZMA 2BOFX 4QTGA 2ZA3A 4DM1A 4WSJA 3FLUA 1FD9A 2X7VA 1UWQA 2G3NA 4N0RA 3PZNA 4IMDA 5I6SA 3KTXA 1VIWA 4HNNA 1KRBC 2A7NA 3AQUA 3Q37A 4LEQA 2E0PA 4QE5A 3AHXA 2D2JA 3G6MA 4DNHA 3EX2A 2CXEA 5CGQA 4GNJA 1G69A 4UTFA 1QHOA 2IPGA 2XINA 2NQHA 3MVIA 2GK1B 3TA9A 3DFTA 2RUQA 3CWHA 2WM1A 3NTYA 4H4IA 4ZXOA 5DBUA 4FPSA 2CKSA 4RJEA 1W8GA 3KBNA 2ZUNA 3PZMA 1ISWA 3WX7A 3MWCA 2CBIA 5BWFA 1OFBA 1FWWA 3GU2A 3QN3A 1E4NA 3S1GA 5RUBA 1VD6A 2XIMA 2NSOA 1ZU8A 3QYQA 1JIBA 2VEFA 3AMGA 1GOOA 3UG3A 5EMUA 1C8XA 2HS8A 2VQUA 1JVWA 3KAOA 1EDQA 1ISVA 1W9VA 3UF8A 3LV6A 3WDPP 2POTA 3EDDA 5HUOA 3C0JA 3B0YA 2XIIA 3CLMA 3ZVHB 3R89A 1O60A 2YLLA 1BSIA 1YADA 2VEMA 4AHOA 2OGJA 4QDWA 3RPTA 3BCDA 1M7JA 3W7HA 2O7QA 1Q5MA 2P8BA 1ZCCA 3VC6A 4DJDA 2Y5JA 1XS2A 3MI2A 1AMYA 3AYTA 2PUZA 2PP1A 2XIJA 3H7RA 2ZZ6A 4N9BA 5I77A 2GDUA 5A6SA 1D7JA 3RGTA 3QJAA 4REQA 5EB8A 4AD0A 1ZQ5A 1LYXA 3OU8A 4QR6A 1AL7A 3CYVA 2DEPA 4E4FA 2CNCA 1RAKA 3SRKA 1FWHC 2OZ8A 1XC4A 3GPKA 1XD1A 2HNHA 5BRPA 2I5IA 3L4VA 1MWOA 4MY1A 3LMZA 2WM0A 2V5LA 3IJLA 4R85A 4ODNA 1R7AA 2EPMX 4HCLA 5XINA 4JTRA 1V6TA 3N6JA 4ODPA 1FKIA 2A21A 2X42A 3NZPA 4GD0A 4FO4A 2OGYA 2RFGA 1EC8A 5MF5A 5TIMA 1YIXA 2HPIA 4UMBA 4H9XA 4C7GA 4K68A 2PC4A 3LXAA 2WVVA 1P0KA 2QUNA 3S9IA 4OECA 5ABFB 3O5FA 1MZHA 1SW3A 4NRSA 3EDJA 4DO6A 3LA4A 4UQAA 3L0NA 1TUXA 2VCDA 2QUMA 3T1GA 1IEQA 1ME7A 3C8NA 3AXXA 1FKRA 5LIXX 1FAPA 1GQNA 1IR2A 3PZQA 3GNNA 4QG6A 2YCLA 4YTRA 4LB3A 1IZJA 5E09A 3VOFA 2R8WA 3EY6A 1L2QA 1HXVA 3VOGA 2ZR6A 1SO4A 2YFOA 1NIUA 2BTMA 2ICSA 5AY7A 3R8RA 4A4AA 4ATDA 4RDYA 1DIKA 1DXEA 2PDGA 4YCOA 1QHZA 4AG0A 4BK9A 3VMNA 3DC0A 2ZFAA 3NPWA 1AW1A 1F74A 5C6MA 4LUYA 4FOJA 3TN6A 5I5RA 1X39A 1Z7AA 5CC5A 4TW6A 2A5HA 4MFDA 3M0YA 1F4AA 1IR1A 3GTXA 1VJSA 3UR7A 2IPJA 3HO8A 1GYMA 3VGHA 3FA3A 4W86A 4EF8A 4FNRA 1X1OA 3WNMA 2KI3A 2DZBA 1QI3A 5BU6A 1BVZA 2BX7A 4AX7A 5A1AA 3VILA 1R9XA 3G18A 2VFFA 5AOUA 1W3HA 1VFFA 1GWJA 2PGEA 1BF6A 3IS4A 3L5LA 4HZ7A 4N9EA 4FX6M 2ISFA 2VR2A 4MB5A 1VH7A 1KBIA 1H63A 3UPBA 5F2IA 2DUZA 1BPLB 4YYFA 4A3QA 4E8DA 1YBQA 4J4NA 1C90A 3WK3A 3DFPA 4I3GA 2Q5AA 1EWEA 1UR1A 3CL8A 3I10A 2ZQUA 3LRMA 3UQIA 3CQKA 3LCWA 4W9OA 4IIGA 8TIMA 3PNZA 2ZQ0A 2WYSA 2RQSA 1MQQA 4UQDA 3GHRA 1JD7A 2GJPA 3UPWA 3TCZA 1KBLA 2V30A 2OWXA 2Y8KA 3PB2A 4E3VA 2XH7A 1LG1A 1D7KA 2XUCA 1QVBA 5D04C 4GUFA 2Y2WA 4W7WA 2YDSA 1UOZA 3POCA 4ZMGA 3WLTA 1O1HA 4RZBA 1DYSA 2P10A 2B31A 4ERAA 4UZUA 4DXKA 3M4HA 2EJ1A 2VEIA 1E4MM 1GQJA 4P8UA 1NM9A 2V5KA 1AQ0A 1F3WA 4HYRA 3EDFA 3LI1A 4DF1A 1ZAIA 3ECQA 5I2UA 1K7XA 5HWNA 2CC0A 3ANVA 4PCSA 3B4YA 1QWGA 3VYLA 1LBFA 4PMOA 2PWDA 3T0DA 1XIHA 2ZZ2A 3IKGA 3BAWA 3F4WA 4KCVA 5A8PA 1FWEC 3JRKA 4PSPA 4MKVA 2UY3A 3RMJA 1N8WA 2X0HA 1S2CA 2YA0A 4Q7IA 3VNJA 1LOSA 3CUFA 2L2SA 4AW7A 3NQ7A 5BROA 2C1GA 2YXGA 3PPFA 4J3UA 3MVTA 4ZR8A 2YGYA 2R82A 1BGGA 3RX3A 2PBCA 1EH9A 1C9HA 3Q4DA 5HJLA 3UXKA 2QDDA 3N25A 5D02A 1HW6A 3MA8A 1NF7A 2DVXA 3UEQA 3N1AA 3ARXA 2W0UA 3S2LA 3E49A 1QCWA 1TPVA 4JTAA 4D72A 2HEJA 3MT1A 3HGOA 2DDXA 2Z0IA 3G6LA 3W1RA 4Z2LA 1CWYA 3UETA 1R3QA 1C7TA 3E0WA 4YWIA 4L1GA 5A2BA 8CGTA 1MMFA 2CEQA 1S39A 3OIHA 2X1TA 2VZOA 1ZAHA 4ADTA 4QEEA 4IP4A 3AISA 4K7YA 1UW9A 4IIDA 1GVRA 2Q8LA 5E0FA 1OQFA 3CZGA 4R7WA 4QSHA 4ZVJA 1Q6HA 4XB3A 3A3WA 1KXQA 3MY9A 4O4VA 3K1DA 3MC5A 1Z48A 1MUWA 1BWVA 3VCNA 4U33A 4MPKA 3E2RA 4GJJA 4GOAA 1UZDA 4N9CA 2VC6A 4AXNA 3HV9A 2OZTA 1OFPA 4DRNA 4QS5A 3MUIA 4M56A 2ZX7A 3CIVA 4NXSA 5TD4A 3AWNA 1PX4A 4M82A 2XU2A 4UFLA 3AFBA 1T99A 4RZ4A 3NO3A 3STCA 4C1NB 3A12A 5A6KA 2WVTA 4PEEA 4AWEA 1XI3A 4YJ5A 4BWLC 2A0NA 5C54A 2W61A 3ZMRA 1K8XA 4U3CA 1XH1A 4HHMA 3AZRA 4XAZA 3BW3A 2FPYA 3WNKA 3GXMA 4S39A 4QFUA 2E5DA 1E1FA 3NEVA 1TJPA 3WDRA 3FHQA 4O1DA 3S6OA 1CXIA 1F3EA 1XJBA 3H24A 3GDMA 4AY8A 1XIBA 5HR6A 4PTMA 3MSRA 3WJWA 1WKYA 1IE7C 1W54A 1A5BA 1W17A 2VX4A 1VR6A 3CTTA 2YCEA 3W22A 2V8ZA 2XVKA 1DXFA 4QQ3A 5JBEA 4O2TA 1W5MA 1FFQA 3MMTA 3WCZA 1UOKA 1RLCL 1RY0A 3O15A 4TX0A 3U5UA 3UBPC 3W23A 1RPXA 4GXMA 3VD4A 2OLHA 1WOAA 2ZR4A 3NNTA 2Y5SA 3DI1A 2P3EA 5EMLA 5FEZA 2VRKA 5I7GA 3RHGA 1AUSL 4GINA 3LPOA 3BICA 4O1CA 3OG2A 1KRAC 4XUGA 4V2XA 1K02A 1EJTC 1DHPA 4HSOA 1XRSA 2ZUUA 4PRRA 4NZJA 3VMPA 1XYBA 3VIHA 3L68A 2ZRYA 1CLKA 2RKXA 1LG2A 4QT2A 2XGIA 2JQXA 3HG2A 3MYPA 1U5JA 3F4DA 2P4VA 4JQ3A 4P8WA 2X41A 4Q4SA 4FR1A 1CGTA 1HNYA 1LP6A 5HNUA 4LS0A 1AK5A 3EGJA 3FA5A 1EJXC 2V67A 2VX6A 4OUIA 5ABHA 4IF2A 2XSBA 2I9EA 2C91A 3WJZA 2PLJA 4HPGA 3OOQA 4FX8A 1O66A 2VEKA 4HA0A 5I3IA 2ZWYA 4XVEA 1H5YA 3GHSA 2DZAA 3MDUA 3O5KA 1KWGA 3G0UA 2A3BA 1K7FA 3HMCA 4GUJA 4V15A 4X60A 1ZK6A 1ZAJA 3W87A 4MFEA 3U48A 4FXRA 4AWUA 3A23A 1W1IE 5E1QA 1XYAA 1C7SA 4GQQA 1R2SA 1X96A 5HPOA 3RXZA 4GI4A 2W91A 1SFTA 3QEZA 1D8CA 2JF7A 4QNEA 3ITYA 2UZ5A 4ZENA 3TNBA 3QPZA 5JU6A 1DBTA 2QJIA 4AVOA 3V5FA 1LL6A 3LPFA 3LCHA 1PDYA 2BLEA 4IIEA 1PJ9A 5KSWA 4QS6A 3T2PA 1V3LA 4C60A 4R9OA 5HWBA 2WMIA 3ZS4A 1NWUA 4MY9A 1TSIA 2G4JA 5G2HA 2PN0A 3TTQA 4JIEA 4N9DA 2JEPA 4EAMA 3KBWA 3KL5A 4AH7A 3O5GA 4FNUA 3U4FA 2E67A 2G5WA 3CPRA 3I6CA 4NZCA 3VDBA 1DJIA 2C79A 1AD4A 3VNLA 1AW5A 3H55A 3VTRA 3MCMA 1Y0EA 1CXFA 3PS7A 4MZYA 4IPPA 2NVCA 3CGMA 1W6TA 2YCIX 1B3WA 5LGXA 3A9BA 4HYWA 4TV6A 1AODA 3PPHA 3PPGA 3GDTA 3W7IA 3EIPA 1UMLA 1ITCA 3IIZA 2CETA 3APYA 5I3FA 4RPQA 4HHLA 1BQGA 2XWDA 4UQBA 2VXNA 1VEMA 4M0XA 1TPB1 3ARUA 1GPFA 3IK2A 1M7XA 2PV2A 3U57A 4J3XA 4I5RA 3G3DA 3C61A 3MJYA 4Q32A 2IMRA 1G4PA 4ZOEA 3J7HA 2DZTA 2PTWA 5A2AA 2ZRWA 1DVJA 3LXBA 3KW3A 1GOMA 4P8XA 3W83A 3CB3A 2EBNA 1L1PA 5DQPA 3C6CA 3CHDA 1IX5A 4DF2A 1KFKA 3WJSA 2J27A 3AU6A 2XWEA 4JICA 1OGGA 5FL1A 4ZPVR 3BJTA 1R38A 7TIMA 4FNTA 1TPH1 4KEZA 3OBEA 3KAIA 5HMFA 4AY7A 4C6JA 3UZXA 3R6IA 4JTJA 1UR8A 2BXZA 3N29A 3SIZA 1GVEA 2D23A 1X8CA 2W67A 3BOFA 1VENA 2CBUA 1KCLA 3QOKA 5E93A 3RDKA 4GHRA 1AQHA 2DZUA 2G3FA 4GUIA 4NU7A 1YE4A 1TWIA 4A8LA 1QK0A 3LHTA 3ARQA 1GQKA 2VC5A 3H4WA 4C6EA 2VZUA 3U2EA 2XIOA 3XIMA 1VBJA 2J88A 4DRQA 2PLMA 4IT4A 1OY0A 4GX9A 5A3HA 4TNSA 4B4FA 3OG3A 1KR0A 5BOEA 3DDMA 1IXQA 2RAGA 1XCXA 3EA2A 3LS9A 5CJMA 3VDHA 4J7RA 3GXPA 2VDIA 4HBOA 1PTDA 4DJFC 5BCAA 1WDDA 3ZT6A 3FDGA 4C7FA 4OOUA 1J4IA 1Q6GA 2BOGX 1UZ4A 1BYCA 3KE0A 1LOQA 3W7GA 1FBAA 3AS3A 1IEWA 1VPQA 1NOFA 4HA4A 5DT5A 1JRCA 1O5QA 4ASTA 4LRSA 1E9ZB 4KT2A 2I56A 2ZQSA 1F76A 1S5MA 1UD6A 1US3A 2NX1A 4J2MA 3MMUA 3TN5A 3TYBA 4HVXA 5LZLA 3BVJA 1UD8A 3EXSA 4CCZA 3LENA 2ZVIA 2OKTA 2BXYA 2CZEA 3NDOA 2UY2A 3ITXA 3MCNA 4FN2A 4NUWA 5FJJA 2I7GA 2HBXA 2V63A 1RD6A 4W84A 3SQMA 4HU8A 1GORA 1XLGA 5HW6A 1QUMA 2WB5A 1ZJHA 3P7YA 1WDWA 1UUQA 3GH4A 1RALA 2IXVA 5EGRA 1G94A 4DZIA 2B7OA 1NTHA 5H8UA 1TCOC 4NHVA 3W2LA 4YYCA 2KR7A 1UWUA 3IJIA 5D32A 1DOSA 1OIFA 3ISIX 3RPDA 1ZP3A 2ALRA 4XZLX 5D2VA 3IIPA 2PDKA 4EF9A 3URBA 3S3GA 1UR4A 4AHPA 1OBAA 2ESCA 1J6YA 2VM8A 1XISA 4JPGA 4GQBA 2O56A 3VA8A 1E56A 3GQYA 3H2EA 1Q7QA 2FIQA 3BJFA 3BAJA 2ZZ4A 1EO5A 4C6QA 3LU2A 1H5VA 3NM1A 4ZQOA 1ZJIA 4L9XA 3E74A 3GDKA 3VFCA 3L2IA 4IZGA 3DZ1A 5C7HA 1DWJM 1QNQA 4EVZA 3MO7A 2DH3A 3W86A 5EL1A 2NXHA 1KKOA 4HZ6A 4GY0A 4XZHA 5KEZA 3CLWA 2I9UA 1CBGA 3K8KA 3AYSA 2IQDA 3GVVA 3QGVA 4C6IA 3WQEA 2ZVRA 3CUHA 1FH7A 1WBHA 2Z28A 3W82A 4KKXA 3N17A 4H8HA 3TA6A 1V3JA 2EPHA 1W5QA 2QR6A 3EAUA 3BAXA 1UHVA 3GB6A 1JF6A 2OOFA 5DELA 5IHRA 1VF8A 3S1XA 5FESA 4PRWA 3H2CA 2OCZA 1O95A 1BF2A 5EMKA 3W0KA 2FLIA 3BTNA 3TNOA 1JYVA 1IEIA 3N9KA 2Z1BA 2BP1A 1XC6A 3LHYA 4GQGA 4HNCA 1JI2A 4Q8OA 1E71M 1ZJAA 1FVPA 5DXYA 1G1YA 3UCDA 3G1XA 2KX9A 4YTSA 4KEUA 2WCAA 3FW6A 4K8EA 1A3XA 4DAFA 5LKYA 1R3SA 2BS9A 4K37A 3SO7A 1LLOA 1U5VA 5K4ZA 2ZADA 3DFOA 5TAOA 3A24A 4L7ZA 2F84A 2V5CA 3GVQA 3OODA 1O1ZA 3W29A 3PJXA 3TVAA 3WBYA 2Q8ZA 2CHRA 3W3OA 1WOBA 3TYZA 4JY8A 1FXQA 1EDTA 2PC8A 5CAKA 2CWXA 3WIJA 4TMBA 4PYSA 3AJ7A 3WLPA 3WH0A 3WQVA 1TELA 1TQJA 4DJEC 4YHEA 1EFZA 2F6UA 1PVNA 2AAMA 1K9DA 3LEPA 3R0UA 3ZJKA 4QE4A 1US0A 3HBLA 3N6QA 4FI4A 3O3RA 1KR1A 3H2NA 4LC6A 2INFA 3BLDA 3PWAA 5CCZA 3CNYA 5KZMA 4JY9A 1Y5WA 3VE9A 4Q33A 5E0KA 2CLOA 2CW6A 3WLOA 3PZTA 4IFRA 4IL0A 4O0KA 1HKJA 5BRBA 3LBOA 2AKZA 2EKGA 1XIFA 3WLNA 1CT5A 1FWDC 3WFLA 1J01A 1Q3NA 4JNYA 1TKKA 2FZ8A 4LYQA 2VWSA 3CK5A 3LNMA 3NPVA 2AL2B 1HP4A 4GE8A 4NRRA 5G5IA 5GVJA 4ENLA 2FVLA 3W1NA 5SWUA 3VABA 2RDTA 4O1AA 2LKNA 3TYDA 5ECVA 3QKEA 2QW5A 4LS1A 5I0DA 4U84A 1MNZA 1QNVA 2NQLA 3TTEA 2FGBA 1XICA 2Y8VA 4WY0F 1UC5A 3TEVA 4Z1YA 4GKLA 5D05A 5C9WA 3NAVA 3KVKA 3K8MA 1HIZA 4LUSA 5KZEA 2MLXA 3ABSA 1J0ZA 2HCVA 4YWSA 4WJXA 1JUEA 4E0CA 4MWAA 4AEOA 4WKFA 2JGYA 2FZNA 3AIRA 2VX7A 3TC7A 1NP2A 4UR8A 3DFHA 4KFNA 4FZIA 3P8JA 2ZWZA 4D6GA 2EPOA 2VWTA 2OSWA 3ID7A 3D47A 3RU8X 1HUVA 1B9ZA 1ZHAA 3NQ6A 4K6AA 3WF4A 3PUDA 4FLQA 2UBPC 1KA9F 2NVDA 1TE1A 1K77A 2VO5A 3MCOA 3PSWA 1J4EA 2F38A 5D2YA 2AAAA 3DI0A 4H6KA 1J2WA 3OYXA 4HPJA 5DANA 3TQVA 1NMWA 4TYOA 3U2ZA 3EKZA 2Z2BA 4X61A 1YTKA 5D9OA 3NXLA 1L9WA 2QDEA 4PL1A 5FOOA 2D20A 3FJ4A 2XYLA 4PR4A 5KZDA 4LS2A 3FAWA 1KXTA 1FCBA 2RDWA 3AI0A 3GG8A 2PRHA 3DHUA 4G7EA 3VM5A 4L72B 3B9DA 3H8AA 3CQHA 2GJNA 2ZTJA 3T0AA 5HULA 4H8VA 3MUAA 4P7RA 1KM6A 1SJCA 4PN2A 5HNRA 4JTEA 4POCA 1EA9C 3BLLA 1E6RA 4ZE4A 1W3KA 3OOBA 4WR3A 1AA1B 1PBKA 1RP8A 4WX2A 1GQIA 2ZRVA 2UWFA 1J79A 3CO8A 4MJMA 1XFCA 1EC9A 3ENLA 5HJYA 1BXNA 1B4KA 4JIQA 2OG9A 3CHEA 1PKMA 1BYBA 4TTUA 1E6XM 5B7YA 3UXAA 2VD9A 5F7UA 3NI6A 1MQPA 3BW4A 4ROPA 3W7NA 2W4XA 3IUIA 3CUGA 1XDLA 3QFEA 3K4DA 4KEVA 1KWKA 3VKDA 2O9OA 4IFOA 4DWSA 4PMVA 4QLJA 4FF5A 2XH2A 1MDRA 2PZ0A 2QEZA 5XIAA 4KWSA 1CPUA 2PDQA 1X1ZA 4LOCA 1WDPA 5CSRA 2LJ4A 4E2DA 3EB2A 3RR1A 3WUFA 1TMQA 4MYXA 4GVHA 2VOMA 1CXHA 3SUWA 3KRUA 2YKKA 3BC9A 3GNDA 4LYKA 5D33A 2OSYA 2NV2A 4AZIA 4O53A 3TROA 4ECLA 5FF3A 4I7VA 2PPGA 4LAYA 4NI8A 1NAL1 3I6TA 1FCVA 3DKLA 1RHCA 4US6A 3O5MA 2HJPA 4ZFCA 3DYMA 3FSTA 4EE9A 4AWTA 4YL2A 1XYMA 3K46A 1K8YA 3N4EA 2B5UB 1M04A 3A4AA 3GIQA