4DWSC

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
539
structure length
526
Chain Sequence
b'KPTENIPSPILVEDKYTEETYSRPDVNFEDGSQGNLSYTATRVCAPMYNHYVGDKTPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKVQEVWDGWNAQAPSLGLPQIGKGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDDGENYVLLIKELRSALDSRFGYSNREISIACSGVALKKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAGHFISLDTPRTVKQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADSNQETIDMGPLYNPGEIYLKSISEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chi2
publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
molecule tags Sugar binding protein
total genus 184
structure length 526
sequence length 539
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsC01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsC02
4KMQA 2VCAA 4GQQA 5LA1A 5GPRA 2ZUTA 1MWOA 5EFDA 3A4WA 3SUUA 1KQZA 1HVXA 3CZLA 4F79A 3WNMA 1E55A 3VDBA 3K4DA 3ECQA 1UH2A 2CCRA 2V3EA 4JFSA 2D23A 3ZSSA 4LQ1A 3WQWA 1WCGA 1EDGA 4Q22A 3TTSA 4D1IA 2V5DA 3WIJA 3QHNA 3PZIA 1E70M 4ACZB 5C71A 1H49A 2DSUA 2VJXA 3OLGA 1PX8A 3A4XA 3VM5A 1B3YA 3WQ4A 3TONA 1GOIA 1KXHA 2D0FA 1WP6A 1G5AA 5HDRA 2QF8A 3THDA 2V5CA 3AIQA 4R5EA 4PMRA 1DWHM 5EB8A 3S6TA 2WANA 1UD8A 1OGBA 3TOPA 3RJYA 2WPGA 4B3KA 4MADA 2VR5A 4OIFA 1TUXA 1CGYA 3NSNA 5CJ5A 5M3WA 4PRWA 3KEHA 1O6IA 3VIOA 4BQ2A 5D8WA 2GDVA 5JH8A 4UZSA 1MYRA 1KBKA 4U33A 3MMDA 4A3HA 4AIUA 5E70A 1P6WA 1U2YA 2F8QA 1TE1A 3MO4A 1R7AA 3GNRA 1GQIA 3QHMA 1ZS2A 5DO8A 4W84A 1UQZA 2ZUUA 3UG3A 3SUWA 4AD4A 1ITXA 5BYWA 3EDDA 3AHYA 1KGXA 1MW2A 2X8RA 3CO4A 4HA3A 4OBSA 4D6HA 5BROA 2W67A 3AZRA 1V3KA 2PWGA 4TX8A 4AXNA 2BV9A 1XYFA 4GZEA 4LYRA 4TTUA 2JF6A 3PZOA 1UWUA 1JZ4A 2J7FA 4CU6A 1ZJBA 2CBUA 2Z1KA 4UQBA 5A6LA 1OT1A 4QFUA 4PSRA 5CGTA 3WNPA 1CXFA 4PTMA 4H04A 4AEEA 2CESA 4CD6A 1B9ZA 4HPGA 3SCRA 1E40A 2WC3A 2WVVA 3WH5A 1W2VA 1QPKA 2D3NA 2VRJA 3GNOA 1J0YA 3L4ZA 3K8KA 1KWGA 5I0DA 4PTVA 1WZMA 2DIEA 4EANA 3AHZA 4OBRA 1ZL1A 2ZX8A 1NQ6A 2JEPA 4MNJA 1LL7A 5AC4A 1BF2A 3CLWA 2XM2A 1UG6A 3POHA 4LYQA 2FHBA 3ARYA 1XSJA 1JF5A 1B2YA 1E1FA 2FH6A 4UOZA 1U33A 4MJ2A 1B1YA 4ZE4A 3GYCA 4UQAA 1WZKA 5A94A 2UY2A 4WKHA 2XIBA 3N11A 1LG1A 2ESCA 2YL5A 1E56A 1DP0A 3DHUA 5FIPA 2EXOA 4Z2LA 3CHCA 1MW3A 2EQDA 1E4NA 4GKLA 4XZWA 1QI4A 2WCSA 1NARA 3K4AA 1W3KA 2WVUA 4UFJA 5CXPA 3T08A 4B9YA 2CPUA 2VZVA 1D2KA 3CUHA 2HISA 3OB8A 1BYAA 2CHNA 2D0GA 3OLEA 1V6XA 2PB1A 4JFWA 4M1RA 1EOMA 1BYDA 4J3SA 2E40A 1WB0A 1UR0A 1JDDA 3EMCA 4P7NA 3BMWA 1E6SM 2GUYA 1UYQA 2WWDA 4P7RA 2B31A 2F2HA 3QHOA 4JKKA 4D6EA 3MKKA 4W93A 4HOWA 1Q6CA 4W8AA 3PTMA 4CGTA 1QI3A 2WCAA 1UD5A 3OLIA 4PN2A 4PEEA 1R7OA 2PBGA 3W0KA 3WELA 4BZYA 1ZBVA 2MANA 4WKAA 3WNOA 3VIFA 1GOWA 2FHCA 4CD7A 1PIGA 1WZAA 2EPNA 5LA2A 4ATWA 3WBAA 5IHRA 5ABHA 3WNKA 3SCTA 1C90A 3AMKA 1N82A 1E71M 1XH1A 2D3LA 2PWEA 3QR3A 4CD4A 5A3HA 2A3EA 2AOSA 2BVYA 3L4XA 3ZOAA 1W3HA 3WBEA 5A8PA 1XCXA 5GNZA 3BAXA 1CGXA 1CXHA 2AMGA 3BC9A 3RMEA 3G6LA 3LMYA 1PZ2A 3WDHA 4C7GA 3WQVA 1E4LA 4EAMA 2ZX9A 4UCFA 1YQ2A 2WXDM 4ZXLA 4HTYA 1LG2A 1X6NA 3II1A 1JNEA 5DF0A 3N12A 1WZLA 3VIGA 1VF8A 5FL1A 4AIEA 1H11A 5IXEA 5EBAA 2WB5A 4XZBA 3AMCA 1CTNA 3AS1A 4L4PA 4JL1A 3VD9A 1LQ0A 3G6MA 2WMGA 4L4OA 1KQYA 1HN1A 1LWJA 1M04A 1JDAA 3N13A 1BHGA 2YBTA 1U30A 1XRVA 2BHZA 2DSKA 5E0CA 4CUCA 2YBUA 1MXDA 2PBOA 3VTRA 1V3HA 1ISYA 2RGMA 1AQHA 3AI0A 1EDTA 1AMYA 4BCEA 2XM1A 3SCNA 4RE2A 5I3DA 1X6LA 3CHDA 3ZT6A 1QI5A 5IFTA 2D0HA 1HJXA 1HNYA 4DUXA 1J0HA 1MVYA 3DHPA 4M29A 4W7VA 4MB4A 3T0AA 1SR0A 2ZUMA 1FH9A 3WN6A 2G3IA 3U7BA 1CECA 4UR9A 1V02E 4N0RA 2BY2A 3CHEA 3FAWA 5I77A 3VNZA 1KGUA 4AZIA 1LLOA 1KCKA 2QPUA 1W91A 3SUSA 1M7XA 1CIUA 2PWFA 2VZSA 4D6CA 2WNWA 3VPLA 1E0XA 5I5RA 4QCEA 1B3WA 1BFNA 4GI9A 3VIMA 3NDYA 2CIPA 2HVMA 3JUGA 1B30A 1CXIA 1SMDA 3T2OA 1B90A 2VI0A 1HT6A 2GFTA 2WVTA 5C8BB 2VUYA 2IUZA 5A6JA 1KXQA 1FFRA 4E4PA 4AZ5A 3IJ9A 5JIPA 4LPCA 1HKKA 5KZ6A 1QHOA 2VURA 2V3DA 4AY1A 1JG9A 1E72M 2G3NA 3AIVA 4K68A 1XD1A 3T2PA 4E8CA 3T0BA 3PZQA 4V2XA 1J11A 1Q6GA 3WMSA 2Z1SA 3ALFA 3ZR5A 5CSUA 3K8LA 3GH7A 3OA5A 1ISWA 2XG9A 2DSWA 4AZHA 2UWFA 3O9NA 4HMCA 1TR1A 1UR4A 5A2BA 2FHFA 4NRSA 1GNXA 1J9YA 2WYSA 1UUQA 4CU7A 2XIIA 2G41A 4PMQA 3A4AA 3I3DA 5D4YA 2VX5A 1F4HA 4ATDA 2VCCA 3CMJA 2F61A 1VENA 3SIMA 2DEPA 5CSYA 5ABGA 1AVAA 2XVGA 2D20A 3IAPA 3PZUA 1V0KA 9CGTA 3MSGA 1CPUA 4PUEA 3CZEA 4J7RA 1K9DA 1OSEA 5A6KA 2V38A 3WDRA 3W26A 1A3HA 2CERA 1CGUA 1MXGA 4UOJA 4E2OA 7TAAA 2A3BA 2W92A 1W9XA 1CGTA 3VNYA 3HMCA 1UA7A 4AD2A 1G01A 3W82A 4GPNA 3CUGA 5A2AA 2BS9A 4B3LA 3FW6A 4JHOA 4GIAA 3AISA 4DWSA 4HZ6A 1UZ1A 2WK2A 2DT1A 2W4XA 1J0KA 2WZHA 5A95A 1CNVA 1J18A 3MMWA 1FH7A 2EO7A 2QV4A 4AD1A 3VMOA 2Y8VA 3ZT7A 3MUY1 3CPUA 2V3FA 7CGTA 1XV8A 1EOKA 4PTXA 2O9OA 1V6WA 4A3YA 3VINA 1HJUA 4QAWA 3TTOA 1H09A 3DYOA 3WQ8A 2J4GA 3WDPP 1M03A 4CVUA 3ARRA 3PZTA 3CZGA 4ATLA 4YHGA 1WDPA 2OWWA 4FMVA 3OIHA 1QW9A 3UR7A 1US3A 1E43A 2CBIA 1QI0A 4M82A 3GZAA 1C92A 4C7DA 2XFFA 1VB9A 1WE5A 4M8UA 3SCOA 4BA0A 3K8MA 1E3ZA 4W8BA 3WD0A 4B9ZA 1GORA 4TVUA 3CH9A 1BVZA 2YDRA 1W9DM 4PMYA 4PMXA 3WDJA 1HJVA 3VD3A 4D72A 1JZ5A 3VVGA 1KWKA 5ABFA 5F7UA 2ZX5A 3GBDA 3L4UA 4P7OA 1B31A 2JE8A 2EEXA 4MPKA 1EO5A 1BGAA 4UNIA 1RH9A 4Z2KA 5CPTA 5A6BA 1CGWA 1JYWA 3CHFA 2D1ZA 1FFQA 1DWGM 2EPKX 2CEQA 3SEPA 1K9EA 5A6AA 2AAAA 1ZBKA 1CLVA 5ABEA 1XH2A 2E0PA 1CGVA 3M6DA 4D6GA 1HKJA 3AJ7A 5DT7A 1W32A 4B15A 1NOWA 2DT2A 3VGEA 2WMHA 4W5ZA 4ML4A 2GDUA 4RE3A 2O9RA 2XUCA 1I75A 3SCUA 1OGGA 2G3JA 2E9MA 4S3JA 1XYZA 3PZVA 1W9PA 3WD4A 1ISZA 5E9AA 2DT0A 3OZPA 4JCLA 3BAJA 4LGXA 3WQ5A 2YLLA 3BGAA 1MW0A 1OD0A 3L4VA 3ZIZA 3MMUA 2GK1B 2VO5A 7A3HA 2PF0A 3GXIA 5KEZA 3GXMA 4TVDA 2WC7A 4KGLA 2ZUWA 4JFUA 2O9PA 2W5FA 2VCBA 4MNLA 1CWYA 3PBGA 4PTWA 3WF0A 3AIBA 2Y5EA 1M01A 2BY0A 2VC9A 1JYNA 1NP2A 2GVYA 4WF7A 1PX4A 3AIWA 3D5HA 4B16A 4W7UA 1HKMA 2GJRA 4JHZA 4EE9A 1H41A 1WDSA 4KGJA 3THCA 4UQ9A 5BCAA 4LYPA 5I6SA 1E9LA 2DDXA 1XD0A 4ZE5A 2VX7A 2GJPA 2OYLA 3MU7A 2EPLX 5M5DA 3VIIA 5HNNA 6TAAA 1HXJA 5AY7A 1E6XM 1GW1A 1FH8A 3GM8A 4X0NA 2VVNA 1NOUA 1V6VA 4NRRA 1D7FA 8A3HA 3IJ8A 2Y2WA 4KWUA 3TP4A 1HIZA 2BY3A 2QHAA 3FN9A 1V03A 3NSMA 4M80A 2ZICA 2G8ZA 3PN8A 3NJ3A 3RM9A 1UKTA 1BG9A 3WMBA 4IM4A 3AS0A 1OCQA 1VBRA 1EHAA 1QBBA 4U31A 1E6NA 1NP0A 2D2OA 4XUYA 1TA3B 4CN6A 3RPMA 2A3HA 1JZ2A 5CLWA 2X2YA 5JIWA 3L2MA 5EFFA 2XGBA 1HJSA 3ARVA 4HZ7A 1VFOA 3K46A 4OKDA 2WMIA 5A8MA 2GSJA 2E9LA 3AHXA 4WSJA 4MAZA 3EBVA 3S2CA 2XFYA 2WMFA 3ARQA 4U2ZA 5D8ZA 3WDQA 3AZSA 1TFVA 2ZWZA 4AD0A 1GJUA 1BG4A 3EMQA 3WQ6A 2CYGA 1CXKA 2XWDA 4DM2A 4UZUA 1MFUA 1UR9A 3AMGA 1UKQA 4MB5A 4PBGA 1TMQA 1KFWA 1TVPA 1IZJA 5I24A 3AS3A 1CLXA 1J0IA 4HZ8A 3PZ9A 1KBBA 5DFAA 3VIHA 3NDZA 5JUVA 3AHTA 2PC8A 4YN5A 2Y24A 3BLPX 1GVIA 3BSGA 5FKYA 3CUIA 2G3MA 1MW1A 1C8XA 4CVWA 2ZUNA 1JD7A 4UFLA 5FOOA 3BLKA 4U5KA 5LYRA 4EKJA 5HXMA 3ARUA 2JIWA 4P8VA 1EQPA 1E1EA 4ZXOA 3N17A 2C0HA 3MUZ1 3EDJA 3N18A 1ISVA 1K6AA 1NM9A 5D9NA 3KL0A 4GXPA 4UQEA 4JZ5A 1R86A 2GJXB 5CLTA 4D6IA 4WJXA 1BSIA 3U5UA 3AMLA 2VVSA 2E3ZA 2J25A 3W38A 2GK1A 4J27A 1VEPA 1OIFA 3ZJ7A 5M17A 1XSKA 1JAKA 2UY3A 3RDKA 1JYXA 3B8SA 4OUEA 1C93A 1VIWA 2BHYA 2WLYA 1O7AA 1ODZA 1GVYA 1W3JA 2W66A 2V3GA 3U5YA 4AD3A 5I23A 1QNQA 2QMKA 4FLQA 4HOXA 3BCFA 4AYSA 5CQ1A 2O9TA 3QGVA 2J47A 1OT2A 1IV8A 1GOKA 5IHSA 3SCQA 4GQRA 3FAXA 2C7FA 5IDIA 3RM4A 1R87A 3VMPA 4W8LA 4FK9A 2ZIDA 5C70A 4HU8A 1NOFA 3HJEA 1JF6A 4TXEA 3WFZA 5GNXA 4DWSB 3WD2A 2BFGA 2DH2A 4RL3A 4FLRA 4UFHA 2VRQA 3WEZA 4DM1A 2VNCA 2VX4A 1ZU8A 3VDHA 3L2LA 3KZSA 1ZB5A 1R85A 4AMCA 3TTYA 4MAVA 3WL0A 2WCGA 1ZBWA 2YDQA 4MDOA 1V3JA 5FL0A 5E6YA 2ZXAA 4M81A 4N42A 3CZJA 3ZJ6A 3ARSA 2VQUA 2NW0A 3RCNA 4FF5A 4BF7A 4F66A 4OOZA 4HPHA 3WMCA 3F4VA 1ODUA 1VEOA 3L4YA 1JZ3A 1TA3A 4QLJA 1EH9A 3WF1A 1BTCA 1GZJA 1XC6A 4CD5A 3N15A 2JFEX 3UG5A 4QCFA 4U2YA 3RM8A 1QW8A 3TTQA 2E8YA 4WLCA 1GOQA 3F5KA 3MV01 3CMGA 1DEDA 3W28A 5CPQA 1NWTA 4WKFA 1PEZA 2X0HA 2WBKA 3PZNA 8CGTA 2OYMA 2JEQA 4U5IA 2O92A 2A3AA 3ARWA 2XWEA 1F4AA 3KL3A 1JNDA 5AYIA 5ABFB 3AQUA 2YDSA 1V0LA 5JBFA 2NT0A 1OINA 1M53A 2WZIA 3VD5A 5HPOA 3BH4A 3VIKA 2OWXA 2W62A 4LX4A 2CNCA 3OGRA 1NH6A 1GPFA 3MV11 2OLHA 1KGWA 2OSWA 2CKRA 1EDQA 2CHOA 2W61A 3W37A 2DGAA 1GONA 1FHDA 2J77A 3WH9A 2CBVA 4IISA 1CXLA 3BAYA 3U57A 3KE0A 2WKLA 4W85A 3F5LA 4Z2IA 1ZBCA 1S46A 4U3AA 1PIFA 3HN3A 4U3CA 1UWQA 1PPIA 1AQ0A 1H3GA 4W89A 2BY1A 5A8NA 3W6MA 2XSBA 1UKPA 1W9UA 2XVPA 1YHTA 4PMZA 1VFUA 1H0GA 1H5VA 2GJXA 3SCSA 3RILA 3T0DA 3ARTA 4XX6A 4LXFA 1E6RA 4JKLA 4F9JA 3M46A 4W88A 3OBAA 1CBGA 1QHPA 1Y7VA 4KRTA 3CBWA 3WFLA 2WMKA 3UG4A 1E0VA 3NUKA 2J79A 4JL2A 4MNKA 1MQPA 1C91A 2QMJA 3WH6A 3WENA 4H2CA 2J8FA 4KRUA 1WNOA 2XVLA 4AZBA 5FD0A 5A8OA 2YA1A 2YL8A 4MDPA 1UD3A 3WD3A 1EXPA 1LL4A 1UOKA 1QNRA 3IK2A 2J7DA 3FY1A 4PMUA 1TZ7A 1W3LA 1JIBA 4QDMA 2YL6A 3POCA 2PWDA 1H2JA 1Q6FA 1V6UA 2WMJA 2YJQA 1TCMA 3VGBA 2WHLA 3FNDA 4EK7A 3FXYA 1EGZA 5BWFA 1BAGA 1ZJAA 4GI6A 3WL1A 3ZR6A 3AS2A 1Q6EA 3EDKA 3GXDA 4MNMA 3VIPA 4F8XA 2VZTA 1MQRA 1JXKA 1UR2A 1E6PA 1C8YA 1JL8A 4AIOA 4BQ5A 3LPPA 2OSXA 3W25A 1PJ9A 2ZUSA 5BXTA 4NI3A 2J78A 6CGTA 3F5JA 1G9HA 3B9EA 3VGFA 3NSXA 2XHYA 1WDRA 4PUDA 4MB1A 1NWRA 2Y8KA 1AQMA 2JALA 1D3CA 1CENA 1IZKA 1K9TA 5FCZA 3UESA 2VRKA 2UY5A 3UEQA 4PCSA 3VD4A 1GHSA 1J12A 5CG0A 2WMIB 5DMYA 1UR1A 4OOUA 3ARZA 3VDCA 2XTKA 4AISA 2BHUA 1DWJM 2W91A 1GCYA 1PAMA 2XYLA 4Z2JA 4YPJA 2WKGA 3PZMA 2Q8XA 3WH7A 3NYDA 3SUVA 4DWSD 3DC0A 4H7VA 4NSBA 3DYMA 3BXWA 3CUFA 1NWUA 4JKMA 1BPLB 5E09A 1FP8A 2IXUA 2XJ7A 4TTGA 3EYPA 1US2A 5BXRA 1GOOA 2D22A 2VTFA 3MS8A 5BRQA 5I78A 3MUIA 1B3VA 3VIJA 2WM0A 4CKQA 2ZUVA 4P7LA 4R27A 1HVQA 3SUTA 5GNYA 4UFMA 2WZEA 1UD4A 1L8NA 4D71A 3SCWA 1WKYA 3UERA 1WO2A 1DHKA 4IPLA 1SMAA 1E3XA 2WHJA 2DPEA 4PSPA 4UOQA 3WNNA 3QOMA 1PZ3A 2WLZA 1W1TA 1CEOA 4ZEPA 4FLSA 1B0IA 3ALGA 1UKSA 2QLYA 1UKOA 3OGVA 1EA9C 1RPKA 1DTUA 3AFBA 1JXJA 3N9KA 1Q4NX 1VEMA 1OM0A 2A3CA 1H1NA 3VKKA 4J28A 2UY4A 2ZWYA 1E6ZA 2VR4A 2EPOA 4J3UA 2J75A 2XVNA 3W6LA 4D6DA 2DSVA 4UTFA 3LPOA 1WDQA 4JIEA 1JYVA 5M03A 1GQKA 3N04A 1HX0A 2CITA 3CTTA 3OLDA 2CKSA 5A6BD 4D6JA 1JZ8A 1RP8A 4GO9A 1DWFM 3W24A 1V3IA 2J62A 2J7BA 3ZJKA 3BMVA 3AZTA 4H41A 1BLIA 4TX6A 3AHVA 5D9MA 2ZXDA 3ARXA 1JGIA 3IJ7A 4Y7EA 4CCDA 2BVTA 3A6OA 3PTQA 1VFFA 3AOFA 1HF6A 5D9PA 3E1F1 2VZUA 4HMDA 1B3ZA 1DWAM 3PZGA 4QLLA 1VRXA 4URIA 4UQCA 1FP9A 3ZM8A 1JFXA 1BQCA 1UH4A 2DIJA 2VOTA 1GJWA 3AROA 3IAQA 1GQLA 4AZCA 1EO7A 1VJZA 3NCOA 3GTNA 1V3MA 2YIHA 3WNLA 3ZSTA 4UFKA 4PMNA 3IANA 3VX1A 1I1WA 1K9FA 1I1XA 1OIMA 1OWQA 3BSHA 1LF1A 4UQDA 1QNSA 2NT1A 4CD8A 4RE4A 4P7QA 1VAHA 3CZKA 1G94A 3A3HA 4AC1X 2VT0A 3CZ8A 2JIEA 2OSYA 2IXVA 2XVKA 1W2PA 4E8DA 2ZE0A 3J7HA 1OB0A 1V0NA 4CCCA 1G0CA 3PHAA 2D24A 1QOXA 3B9DA 1RD6A 1UH3A 3RIKA 1J0ZA 2CBJA 3AYRA 2OWCA 3VMNA 1QBAA 3LPGA 2XFRA 1BVNP 3ZJ8A 3WEOA 3HU7A 1ITCA 2ZX6A 3WKZA 1NWSA 4H8UA 3M07A 1CDGA 1LWHA 4P8XA 1CYGA 4CN1A 4ZFMA 4YHEA 2WW5A 4W7WA 4Q7NA 4CN4A 5GQBA 4AW7A 4JFVA 3VGGA 4ACZA 2BXYA 5D9OA 5ECUA 2PI6A 1XGZA 4CU8A 3OGSA 3M7SA 3KWXA 2EJ1A 1LJYA 1C7SA 1E73M 3BAKA 3RJXA 3W81A 4PCTA 1W9VA 1IT0A 5I2UA 1J0JA 1GHRA 3W29A 4HOZA 5A6MA 2CETA 3T2QA 5LA0A 3LPFA 3CGTA 3I3BA 1LL6A 4AD5A 5A8QA 3D3AA 4PMDA 3DYPA 2DQXA 1V6YA 5DEZA 5AYBA 1FOBA 3AIUA 2E4TA 2E8ZA 2XGIA 1ISXA 1OGSA 4TUFA 1KR0A 1VFMA 1KXVA 3FHAA 1J10A 4ACYA 3ARPA 1E0WA 1SYTA 4OZOA 3MANA 4S3KA 3AMDA 2NSXA 3AXHA 3SCPA 3BAIA 1JI1A 3CUJA 3L4TA 2DH3A 2YKKA 2WSKA 2VX6A 1UWIA 3OG2A 4M56A 1E6QM 2DT3A 1W1VA 3BCDA 1HP5A 1HJWA 4GZJA 3WUEA 3AXXA 2J7EA 2X09A 3W27A 1X1NA 4MB3A 1ECEA 4V27A 3VOCA 1JD9A 1TG7A 1H0IA 4ZENA 5BRPA 4GI8A 1TVNA 1HL9A 1V02A 4JAWA 1XSIA 4QLKA 1QVBA 1UQYA 3WEMA 4AWEA 1OBAA 2J7CA 2J7GA 5A69A 1UWSA 1HL8A 3AIRA 5CZKA 3WH8A 2XSAA 3ZO9A 4WIWA 3GBEA 2ZX7A 4J3WA 4Z2GA 2CXGA 2WHMA 4GINA 4OJYA 1C3FA 4D6FA 2WSPA 2J7HA 4J3VA 3K1DA 4H8HA 1VJSA 4XV0A 4MTVA 1C7TA 3UETA 1FA2A 5HBFA 1Q6DA 4TVCA 1WPCA 1KB3A 3GH5A 1BGGA 4JCMA 5AC5A 3B9AA 1XHGA 3A47A 3EMZA 3L4WA 2WC4A 1QNOA 1JI2A 1V3LA 1UHVA 3UR8A 2YL9A 1UD2A 3OZOA 4BQ4A 4A4AA 4PMOA 2WWCA 4C7FA 3VM7A 1KCLA 4PYSA 5EMYA 3WSUA 3GNPA 1GUVA 4WK9A 1JDCA 1J01A 2OYKA 2XPKA 2YLAA 4DUWA 1W1YA 3ZQ9A 1V08A 3AICA 3VU2A 4TOQA 4P8UA 1UWTA 3MUAA 4X9YA 4AZGA 1BYCA 3TA9A 4F9DA 1A47A 3APGA 4GO8A 2FGZA 5CGMA 4D1JA 4H8VA 2EBNA 3RO8A 3WF2A 2G4FA 2WAGA 1UR8A 3WY1A 3VX0A 2VQTA 3FHQA 3DECA 1UWRA 2FH8A 1E4IA 3I3EA 1XCWA 4IPNB 1KXTA 4UFIA 5TD4A 1C8QA 3GH4A 4DUVA 3AXIA 2YA2A 1SFSA 1W1PA 1RP9A 1L0PA 3O6AA 4DWSC 2J74A 4AZ7A 3SURA 2WVSA 4W86A 1GQJA 5BXSA 1JAEA 4HMEA 5DT5A 3VD7A 3WF3A 4MJ4A 1QI2A 3MSDA 2ZXBA 2VMFA 4J3TA 2ZOXA 3ZMRA 2WBGA 1DWIM 1QHZA 5E6ZA 1E5NA 5CPSA 3O2LA 2W63A 3WUGA 1UD6A 5I79A 4WSKA 2X05A 1FHLA 4BS0A 2ZXQA 2PWHA 2X1IA 4KH2A 2VL4A 1QNPA 4HP5A 5HOSA 3VGDA 2RGLA 3AYSA 5JBEA 2Y4SA 1CZ1A 4NF7A 3ZT5A 4FLOA 3W53A 4GZIA 1JZ7A 1GOMA 1Z32X 1HP4A 4BQ3A 3WDIA 2DSZA 1B3XA 1E15A 2TAAA 1HJQA 4QP0A 3VO0A 3QOKA 1EHNA 4XB3A 4HU0A 1EQCA 2BXZA 2C8NA 2EPMX 4M24A 1H4PA 3VILA 5A6SA 3GDBA 1WAWA 3GXFA 1JFHA 3WUBA 1PX3A 1UA3A 3BAWA 1W9BM 5HPCA 2YA0A 1ESWA 4V28A 1CXEA 2JF7A 3UCQA 2WHKA 5E0FA 5BXPA 2YOCA 4PMVA 4HA4A 1E5JA 2X0YA 3N1AA 4AZCB 2WVVB 1MFVA 1HKIA 3AIEA 3WD1A 2BNJA 1OD8A 4HA1A 4AEFA 2VZOA 1XH0A 2J8GA 3NIYA 3KL5A 2BVDA 1V0MA 4IUGA 3VDAA 4P8WA 1G1YA 6A3HA 3VGHA 3CIVA 3PTKA 1JZ6A 5IFPA 1VBUA 3WF4A 3T09A 2E9BA 1BYBA 4JFTA 4AZ6A 2FDMA 5JBDA 4Z2HA 3W4RA 1R8LA 1E4MM 4W87A 4CCEA 4W5UA 3SCVA 2FGLA 1MQQA 3EDEA 4X0VA 1KR1A 3U7VA 3EDFA 4NZCA 5A1AA 1PBGA 4J3XA 1UZ4A 3VUPA 1EIBA 5A2CA 2QPSA 3WUFA
chains in the Genus database with same CATH superfamily
4KMQA 5LA1A 4D2JA 5EFDA 3SIZA 3SUUA 7REQA 1ENUA 1SZEA 2V9DA 4F79A 4UC5A 5JH2A 2FB2A 4IHCA 3UJEA 3LYEA 4H01A 1GWJA 1VQTA 3GR4A 3LXAA 5HTGA 3EA1A 4KEZA 2A79A 4GQGA 1WCGA 4FOKA 1R9YA 1EDGA 3UXLA 2VELA 1FKSA 1H49A 4KQZA 1I9CB 3OLGA 4DF2A 3DERA 4JNYA 3FEMA 4IQDA 1G5AA 2VOMA 3BSMA 3QRHA 2XPAA 1JVNA 2PP0A 2R9RA 3TOPA 1NAL1 4TIMA 3WK3A 4MADA 4OIFA 2C79A 6ALDA 2XP9A 2QUUA 3S4TA 4MLRA 5TF0A 3WQFA 4C6FA 3H24A 3L0NA 5LNSA 4KWOA 4DXKA 1H7WA 3UYIA 4BQ2A 1SJDA 3WQDA 2GDVA 5BOEA 4MGVA 4U33A 4A3HA 3QEZA 2OQYA 4Y8EA 3NL6A 2ZRUA 1TQXA 3QHMA 4OBTA 4S23A 3GG8A 1IIHA 3QN3A 4W84A 3NQGA 4RZ6A 3UG3A 4LUSB 4ML9A 4MYAA 1ZENA 3HO8A 4QGCA 4XAGA 4G7EA 3CO4A 4JTTA 5BROA 4ZMGA 2D9FA 2B4GA 3FJ6A 4AXNA 3QV8A 2BV9A 2QULA 4GZEA 4TTUA 3N2BA 3PZOA 1JZ4A 2E1DA 2CBUA 5KETA 5A6LA 5G1MA 2PDPA 1YYAA 3MI6A 3RPDA 3WNPA 4YS1A 2DG9A 4GG9A 4H04A 3SN0A 2CESA 2WJEA 4PTDA 3TDBA 4CD6A 2X1SA 3BZJA 4HPGA 4O10A 1FVPA 4PZVA 2BP1A 2OCZA 2D3NA 1J0YA 3K8KA 1OCJA 3GB6A 1TTIA 1RY8A 2DIEA 4EANA 4OBRA 2ZX8A 3TCEA 2V2HA 4I6KA 4OECA 4E6MA 1BWLA 2XM2A 5HW7A 3WQPA 2ISWA 4W9PA 5XIMA 4Q4MA 1W17A 1XSJA 3Q94A 2WNZA 4UOZA 1B1YA 3GYCA 1WZKA 4GGHA 1TX0A 2FYMA 3GVVA 3H23A 1UROA 4RXGA 5FIPA 3V5OA 2PPGA 1K7XA 1MW3A 1XIBA 1E4NA 1EJXC 2VDGA 3RXZA 1GPWA 1IT7A 4GKLA 1Q8AA 1QI4A 1BL4A 3ISIX 3K4AA 1W3KA 3B04A 4DO7A 4NZ4A 4GHRA 1UP3A 5CPMA 5CXPA 4GJ1A 3T08A 4I7UA 1D2KA 3CUHA 1ZAJA 2VWTA 4ROQA 2I9UA 1KCXA 3UD6A 3IIXA 4PTNA 3DU0A 1WB0A 2H3DA 4HNNA 1JDDA 1P0KA 4XAKA 3EMCA 4R7OA 3BMWA 1KM6A 1K70A 3QHOA 1XIMA 3UPMA 3NQMA 4LUYA 4W8AA 1JUBA 5F2MA 4PCNA 1Q6LA 4KT2A 3W73A 4Z1BA 1R7OA 2C19A 2Z1WA 2D2JA 1ZBVA 1D6OA 3CASA 2F21A 4E8GA 3VIFA 2FHCA 2HE5A 3DBPA 4E2DA 3WBAA 4CNUA 1PL9A 3CV7A 5ABHA 2ZZ3A 1XH1A 1LOLA 2D3LA 4F0LA 3T8LA 1XRFA 1KRCC 1GZGA 3L4XA 1I2RA 5K2ZA 3WBEA 5DY2A 4QR6A 3LHUA 3EKLA 1O1HA 2AMGA 2GGEA 1YXYA 4I9JA 1VBJA 3CC1A 3LMYA 3WDHA 2CU0A 5DLCA 1X6NA 1EEXA 3LDVA 3KABA 4AF0B 3RK8A 4ZPTR 1WZLA 4AIEA 2E09A 2ZZ5A 3PFRA 5EBAA 2XPBA 3HG5A 2WB5A 4XZBA 3VD9A 3G6MA 2WMGA 4IMAA 3SJ3A 3UP8A 1LWJA 3T07A 2XH2A 1U30A 2DSKA 3ID7A 4JR5A 4CUCA 2PBOA 3VTRA 4GFSA 4JTUA 2PURA 2RGMA 1AQHA 4IQJA 3PJUA 3QMTA 2A0NA 4BF9A 2VFHA 1EDTA 3XIMA 4JIIX 1KTNA 1QZ2A 4RE2A 1RHCA 5CBIA 5I3DA 1QOQA 1X6LA 3CHDA 3S9YA 1RLDA 3W86A 2D0HA 1HNYA 1PKMA 4M29A 4MB4A 3T0AA 4F0HA 3NOEA 3GZ3A 4DBEA 2MLXA 3EB4A 4J4KA 2NXGA 4UR9A 1QPOA 3CHEA 1AH4A 4NX5A 5AC7A 4Y90A 3TW6A 1W91A 1M7PA 4DJDC 4XISA 2PWFA 5DANA 1BKFA 2VZSA 7REQB 3ITGA 3BZGA 4XQ6A 1B3WA 3UQIA 3KWSA 2CIPA 5LIKX 1B30A 3V5CA 3BLIA 1DQXA 1S38A 1SMDA 1N7KA 1BKHA 3U48A 3VOFA 1A49A 2VI0A 1KFLA 2VUYA 2YCJA 4XG1A 3P5YA 4E4PA 4AZ5A 3IJ9A 3L21A 3NR0A 4N9DA 2VURA 3AIVA 4F48A 4U4MA 1NFBA 2VWSA 3AWOA 2VEIA 3UXDA 4E8CA 3PRDA 1UBPC 1NY1A 3T0BA 1DJYA 2HVOA 2NVAA 4H9TA 3PUDA 1J11A 4F2BA 3WMSA 3PRBA 1UWAA 3ZR5A 2ICSA 3NTPA 3K8LA 2CZFA 5DN1A 4AZHA 4H9VA 1UR4A 3O16A 1EYEA 2FHFA 2WYSA 4PMQA 1MRAA 2J24A 1BXBA 3BLOA 3LXCA 4ATDA 2FZNA 3QY7A 4JTDA 1BKSA 4MVAA 3SADA 3BJSA 1DXIA 3BLDA 3T78A 2BXVA 2B81A 2DEPA 5CSYA 3S3GA 2PWUA 5KMYA 1UASA 4RDYA 4G7EB 4MZ1A 5EGRA 3BK0A 3TNBA 3MSGA 4Y2WA 3JRKA 3TN3A 1X8FA 4ZOEA 1K9DA 1OSEA 3O0FA 3W1UA 2Y6ZA 5TAOA 4K6AA 4QEHA 2PGEA 3W26A 2CERA 1MXGA 4XZLX 4UOJA 3H6OA 4B90A 1GKQA 2V67A 1F40A 1W9XA 4EP8C 1UA7A 4AD2A 2ZTKA 1IR1A 3CUGA 2BS9A 2FDSA 4GYJA 3V4BA 1FDYA 2ZDSA 4DWSA 4IPJA 1UZ1A 1PCKA 2DT1A 2NV1A 2V2CA 2W4XA 3JYJA 2OFJA 1TYGA 5FJRA 3ELFA 1JCYA 2IPGA 1J18A 2PMQA 3MMWA 3CT2A 3LGGA 4K37A 3VMOA 2Y8VA 6TIMA 3CPUA 2V3FA 4UMCA 2TODA 1EOKA 4YTRA 1KC7A 4J9JA 1V6WA 4A3YA 3VINA 3JW7A 1VC4A 4KQNA 4LNYA 4YLWA 1A53A 3HPZA 4QAWA 3WQ8A 4G56A 9RUBA 2J4GA 2X1RA 3WDPP 1E1CB 5IRPA 3P8IA 3M44A 2OWWA 1RQBA 4I9TA 4EXQA 5EY5A 1RSCA 4WOQA 2DIKA 1HQTA 3W76A 1C92A 4RZ4A 2MUCA 1JUKA 1GG1A 1BRLB 3VZYA 2BODX 1IEXA 3CL8A 3NDOA 4ZO7A 3K8MA 3SECA 1E3ZA 3WD0A 4TVUA 1W9DM 2RUDA 1W5MA 2Z6IA 3FA3A 2J6XA 2NUXA 3VD3A 4GACA 1JZ5A 4WGHA 5ABFA 4L7ZA 4YVVA 3O7UA 4CNOA 3RU6A 3PBMA 4GX8A 4I8YA 4I5RA 4ZR8A 5H8UA 1ZCNA 2EEXA 3SGUA 4MPKA 4K7YA 1EO5A 2QIWA 2OR2A 3ERPA 4Z2KA 1BWVA 4FB7A 1OX4B 1CGWA 4IFKA 3CHFA 4GY1A 2D1ZA 1FFQA 1UB3A 1DWGM 3LRLA 1XM3A 1K9EA 1LOSA 3G1XA 3GTHA 4QSHA 2XIOA 4ZB0A 4D6GA 3L5LA 3AJ7A 3MHFA 3ANYA 4IIFA 3TH6A 4NT0A 1XISA 3BLEA 5I09A 2Q01A 2WMHA 2GDUA 2O9RA 2OEKA 2XUCA 4JTLA 4O1BA 4YWIA 2G3JA 2HCVA 3DBNA 3S9ZA 1ZCOA 1W9PA 3TCSA 4X3ZA 1YNQA 3EPOA 2YLLA 1MW0A 3ZIZA 4HKPA 2VO5A 1TQJA 3B4UA 3PPGA 2W5FA 4LJ3A 3TYZA 3EPMA 4PTWA 2R1LA 3AIBA 2RKXA 2BY0A 3ZLGA 2VC9A 3BO9A 4V33A 4B16A 4W7UA 1HKMA 3CEPA 4XSLA 3TZFA 4JHZA 1GRJA 1O5XA 4DXVA 4UQ9A 4W9TA 1BWKA 3B3DA 3SQMA 3UF9A 4ZE5A 3P84A 1AH3A 3C0SA 4RDWA 2XDFA 3G1DA 3MZ2A 3VIIA 5HNNA 1X39A 3NQ6A 3W7PA 2R91A 4X0NA 3TN6A 1W1IE 1V6VA 3N6HA 4KWUA 3UT0A 3TP4A 3LTYA 3GKFA 1N1AA 5AC8A 1ZLPA 2HTMA 3MUXA 4M80A 2G8ZA 5ABTA 3RM9A 3SSZA 2I14A 4IM4A 4NKCA 1ZJHA 4AG0A 3E0VA 4U31A 3P8JA 2CWNA 1TA3B 4CN6A 3H7VA 2A3HA 1JZ2A 4IT4A 4EOUA 4ODQA 3PBUA 1TREA 4DNMA 3K46A 1XLIA 1KT0A 4JQAA 3QY8A 4FALA 1ZP4A 3O05A 5A8MA 3F2BA 5G2HA 4CCZA 1O94A 4RNJA 3EBVA 2QJMA 3VI2A 4QJ3B 4RKAA 4N4QA 3GIYA 4NNCA 1FUYA 3AZSA 1TFVA 2ZWZA 4AD0A 3EMQA 3GW3A 4ILSA 1TV7A 1CXKA 2GL5A 4W9QA 1T8QA 2QDHA 1IGWA 5E93A 4DM2A 4S3AA 1SJBA 4ODPA 1VLWA 3AMGA 3H21A 1CCWB 1IZJA 3M9YA 4C6DA 2PDNA 1J6OA 4HZ8A 3O5IA 3AHTA 4N19A 3BSGA 4S39A 3PB2A 5FKYA 2G3MA 3HV9A 1R46A 2YW4A 4PUWA 1PHQA 2ZZ7A 1YTEA 4DJFC 2RQSA 2ZQ0A 4U5KA 5LYRA 3KRUA 1E1EA 3A4JA 2C0HA 4AIBA 3N18A 3P60A 4K7VA 5D9NA 4Q6XA 4HYWA 3KL0A 4GXPA 4IZGA 1SU5A 3WLSA 4XVEA 4D6IA 5LHEA 1RBLA 2XIQA 3V3WA 1BSIA 1FJDA 1PKYA 3VZZA 1V7YA 3AMLA 3TJXA 2Y7EA 3W38A 1VEPA 5FA5A 5M17A 1XSKA 3W85A 3DAQA 1JAKA 1JYXA 3CAVA 2OELA 4ICNA 3LGDA 1TCDA 5BOFA 5G1TA 3KTXA 2DZAA 1BEUA 2HV5A 2V3GA 2W66A 4MLJA 4BEUA 3UWVA 4HOXA 1XPGA 2PSNA 2O9TA 1SZNA 4Y9OA 1IV8A 4DWDA 2PDXA 5EMUA 4QDPA 4N6EA 3SCQA 3C86A 5IDIA 1JCNA 1R87A 4Q4SA 1W26A 4N02A 1NFGA 3LZ3A 2ZIDA 2QJGA 3L9CA 2ZVIA 4NG3A 4HU8A 1NOFA 1JULA 3REQA 3MPGA 5D2WA 1JF6A 4MY8A 5I3JA 3BMBA 1YKWA 4DWSB 1NF0A 2C13A 1QPFA 4H8NA 2PFHA 2BFGA 1W8GA 4UFHA 3WEZA 4ERAA 2R1NA 3WMLA 4DM1A 2IS7A 2PD9A 3L2LA 3KZSA 3QPYA 4L72B 4AYGA 3TTYA 2GGGA 1XKJA 3CZJA 3ZJ6A 5AB3A 2VQUA 3RCNA 3GE7A 1VEOA 4UNKA 3WF1A 1NSJA 2Q8LA 1CW2A 3N15A 1XFCA 2JFEX 5H1WA 1H60A 2KO7A 4U2YA 5D33A 1M68A 2RDWA 3URAA 3TTQA 1QW8A 3TE9A 2E8YA 4AEOA 4R9OA 3F5KA 3MV01 3V36A 2ATSA 4H3DA 1EGVA 4O53A 1NWTA 3SQLA 1PEZA 4GVGA 2PS2A 2WBKA 1P1MA 4U5IA 3MBDA 1VGAA 3KL3A 2KE0A 2PCQA 5ABFB 3AQUA 5JBFA 1M53A 5HPOA 4K38A 3VCNA 2G37A 2R8WA 3WJYA 1ITUA 4MKSA 2ISVA 1KGWA 2CKRA 2BB0A 3DFHA 3TC7A 4PRTA 3W37A 1EJUC 1GONA 4IFKB 3VNKA 3BAYA 5CPOA 1PTAA 3U57A 4D9PA 3S1UA 3VAVA 3TJ4A 3FXGA 1J96A 4YL2A 4W85A 4J2MA 1PIFA 2P10A 2W9MA 4U3CA 3PANA 4LAXA 1AQ0A 5CAHA 5A8NA 2PV1A 1RUSA 3NZ1A 4GUHA 1S1RA 3ABOA 3IJDA 1UUOA 3GIPA 3R89A 3TSDA 5CJMA 1FKBA 2GJXA 1UUMA 4LOCA 2DZVA 1GEQA 4F4RA 2FGBA 1E6RA 3M46A 3Q67A 3QXBA 4HSHA 4YYFA 2OGJA 4PUKA 4GUFA 4BHYA 3OBAA 1IXOA 3CBWA 1EZWA 3ZWSA 1UOZA 5DELA 4PUMA 3KOZA 5XINA 4MNKA 4GA8A 3QPEA 2J8FA 1WNOA 3B0XA 1H63A 1UPPA 3M0VA 3CB3A 2YL8A 3UXKA 4HNLA 1E9YB 1UD3A 1R3SA 1OX6A 1LL4A 2QDEA 1UOKA 4DNHA 1EIXA 4MGGA 4B3ZA 3NXFA 1RCOB 5KITA 4PMUA 3FVDA 3RFAA 2W6RA 1HZYA 2PP3A 5CC7A 3PRAA 3KAOA 1HL2A 3FNDA 3NXLA 4HYVA 1E0TA 1BAGA 1K1DA 2NX9A 3GXDA 1UR2A 1E6PA 3MVTA 1C8YA 1A5AA 2OSXA 4QT2A 3R8HA 4NI3A 3HPFA 1U22A 3F5JA 3B9EA 2CLIA 1NWRA 3KAGA 3GFZA 2Y8KA 1ZNNA 4MOZA 1D3CA 3LB0A 1CENA 4UTKA 5FCZA 4LAWA 2VRKA 4RNHA 3M7WA 5K4ZA 5DIUA 1OK4A 4FS9A 2A7NA 3LQGA 2BTMA 1S5MA 3KOWA 4LAOA 1OCBA 4Z2JA 2WKGA 2Q8XA 3WH7A 3NYDA 1L6FA 1PE1A 5D2YA 4XAFA 3WK0A 4YVXA 3UNDA 3MYOA 4H7VA 3JU2A 4KW2A 3PUEA 3WQCA 1EXBA 3KCJA 3DFQA 1NWUA 3NL5A 1IEIA 4JKMA 4Q4RA 3EEGA 1BPLB 2R94A 1VPYA 4F40A 1PINA 1VFTA 4F0MA 4MY9A 2AAMA 1B3VA 4H1ZA 4BKNA 5HNUA 2P50A 2WM0A 4UXDA 3V1PA 4R27A 1HVQA 5EMMA 2PODA 7PTDA 1IYXA 3AAMA 1UD4A 1WKYA 4HIBA 4UTLA 3TYBA 3UVAA 2VD9A 2MLZA 1LT7A 1SMAA 2FTYA 2WHJA 1T41A 4Q7IA 1U5HA 3C2VA 3WNNA 3WX7A 1ONEA 1CEOA 2OLAA 4FLSA 4G8TA 3OGVA 3AFBA 2DJLA 5LNWA 1DPMA 3O6YX 4J28A 1R3TA 4U86A 2EPOA 3HQPA 2FZMA 3LPOA 3PUGA 4KS0A 3CB8A 4JIEA 2W3ZA 4GWEA 2PBCA 5M03A 4IJRA 4L9YA 3OLDA 4D6JA 5I3KA 4Q8WA 2GQ9A 4L9XA 2J9ZA 4LALA 4O8RA 5K9XA 1NTHA 3QFWA 3O5JA 3H8AA 4TX6A 4DRJA 4PCFA 3ARXA 3IJ7A 2ZZ4A 3W7LA 3AOFA 5D9PA 3REQB 2VZUA 4URIA 1JFXA 2VOTA 4AZCA 1EO7A 4CNSA 1D3GA 1V3MA 3UA4A 2ATMA 1OIMA 3H53A 4PC8A 3BSHA 4Q8NA 4XD6A 4RCXA 1SJAA 2NT1A 4KF1A 4RE4A 4P7QA 2XN0A 1VAHA 3W72A 3UG8A 2VT0A 2JIEA 1TMHA 4FPSA 1JCJA 3J7HA 5HWMA 4CCCA 3GHTA 1F05A 2D24A 3DX5A 4WSHA 3RIKA 1J0ZA 2H6RA 4ADSA 2IPWA 2DORA 4S3CA 3LPGA 2XFRA 2VGGA 2R1MA 1VPQA 3LM7A 1RV8A 4J4OA 3M0IA 4R7JA 1ITCA 2ZX6A 3WKZA 3B8TA 2PDYA 1NWSA 1UPMB 5D03A 4H8UA 3M07A 3OU8A 1LWHA 3R8RA 3APYA 3KBMA 3R11A 3LCLA 1JUEA 5AYYA 1XLAA 2V5LA 4Q7NA 2Y5JA 1SFJA 4ACZA 1GG0A 3LBMA 1ICQA 4LW7A 2PI6A 4CU8A 3FJLA 3M7SA 4C6IA 1KLZA 2NQ9A 4FHAA 1C7SA 2AQVA 3RJXA 1LQ2A 3W81A 1Q85A 4PA8A 1DKWA 3T2QA 1IWPA 3CGTA 3LPFA 4AD5A 5A8QA 3D3AA 4PMDA 3DYPA 5L9FA 1NFPA 5DEZA 1JNSA 2O7SA 4I5UA 3N73A 4JQ2A 4KFNA 4V1YA 3H54A 4L6OA 3GDLA 3IVUA 3SI9A 1VFMA 1KXVA 2ZE3A 2F6XA 4H6EA 3N4AA 4FR6A 3IGHX 3OHMB 4S3KA 4NVTA 3L4TA 4HSNA 4HNOA 2EG7A 1GVQA 3OG2A 3CPRA 3TC5A 3LCGA 1ICPA 3EGJA 3WUEA 3W22A 5C6MA 3EX3A 4QIBA 5HW6A 1X1NA 1DJXA 3E0FA 3BGGA 3NTYA 4MB3A 5G5IA 3UW6A 3GQYA 3PBVA 3R0DA 2OOGA 3DCPA 1R5YA 1H0IA 5HR7A 3RGTA 3K13A 3L23A 1V02A 3EWWA 2WPBA 1QVBA 1UQYA 3UXAA 3WEMA 5DRIA 1D7KA 2ZR6A 1KTBA 2NVCA 2J7GA 1Q6OA 2OG9A 1RLCL 3ZO9A 1DQWA 3BW4A 3W74A 2ZX7A 1AJ2A 4J3WA 2FJUB 4FOUA 1EJWC 4DZ5A 2YR1A 4H7CA 1VJSA 3DIPA 4K8GA 4XV0A 4MKNA 3UETA 1I6NA 2QCGA 3OVPA 1PWMA 2VC6A 3GH5A 3PS7A 2FPVA 3QZEA 5AC5A 3KP1A 3VUPA 1TJRA 3EMZA 3QC0A 3W2MA 1V3LA 1UHVA 1VFSA 4DO5A 4AWUA 3U8GA 3IIZA 1H7XA 3CNYA 2ZCGA 4BQ4A 1W3NA 4A4AA 3TN4A 5AFDA 4C7FA 4IFOA 3HPSA 4FAPA 4NIRA 4A29A 3VM7A 1LRNA 4PYSA 5EMYA 1JDCA 2IQTA 1J01A 2OYKA 1FCQA 1TRIA 1W1YA 1ONWA 4AZGA 1XX1A 2P8BA 3APGA 4GO8A 4KFPA 1GGOA 4UMBA 5CGMA 1A5MC 4AX6A 2EBNA 4QG8A 3U4FA 3RO8A 3WF2A 2G4FA 1FWJC 1UR8A 4EWJA 3S5SA 1XRSA 1E4IA 3D46A 1DJIA 5FEZA 2ZDRA 1VPXA 1XCWA 1XLDA 4UFIA 1Z42A 5TD4A 3GH4A 1P5QA 2OU4A 4Z1AA 3AXIA 2YA2A 4HZMA 4RDZA 2VHLA 3K5XA 1B54A 1TTPA 1L0PA 1PS9A 1TMLA 3MWCA 3LCXA 2YCKX 4AZ7A 2WVSA 4ZA0A 3L67A 4AU0A 4IT1A 5K3VA 1UZDA 4WR3A 1I0BA 5DT5A 4Z0SA 2XFWA 2XIMA 1QI2A 1Z69A 4GBUA 3MSDA 4J3TA 3WCZA 3KBVA 5CSSA 3MYPA 3I7QA 2ZOXA 1QHZA 3GU2A 4MJMA 2DP3A 1K6WA 5E6ZA 2WZMA 4QTGA 1E5NA 2GSHA 1XIJA 2W63A 4E3VA 1YX1A 2I7GA 3WUGA 3FSTA 2PUZA 4CEXC 3OODA 3ENLA 4DJDA 5AYZA 4UCGA 2PWHA 1R9ZA 3IK4A 3K4WA 4WY0F 3B03A 2V5KA 3NPXA 1FWFC 1B57A 2HK0A 3UWYA 1E15A 5LSMA 3ZZ1A 5BW6A 2TAAA 2FAPA 3BTNA 4ONVA 1R47A 2PRMA 3TXVA 3GDBA 2M2AA 3K2GA 1WAWA 2VFIA 2DV0A 3KTCA 1UA3A 3C3UA 3K30A 1LYXA 1O12A 1SZRA 2HMCA 5E0FA 2NLIA 4PBFA 4X22A 5HULA 3DI0A 4DPQA 3RRAA 3A5VA 4DVOA 4LAUA 3GPKA 1QU4A 4AZCB 1NDVA 3AIEA 2R82A 2VYOA 2VZOA 2HXUA 1FWGC 3NIYA 3KL5A 1L2QA 2BVDA 1V0MA 2HWGA 4IUGA 2M1IA 3CIVA 3G3DA 3W1RA 4N2YA 3E74A 3C56A 2P8CA 3LI1A 3SFKA 5H6HA 5L6UA 4ODRA 1QW7A 4Z2HA 2QGHA 5I7GA 1R8LA 3DKLA 4W5UA 3KDOA 3H22A 3A22A 3SCVA 3DFPA 3NEHA 3N14A 3EDEA 3O15A 3U7VA 1PBGA 4J3XA 2H9AA 2DZPA 4LYKA 1A5KC 2VCAA 4GQQA 5GPRA 3R8GA 1MWOA 3NFUA 1JCMP 1NMWA 3A4WA 4M7SA 1SZFA 3WNMA 1EQ3A 3VDBA 3ECQA 4IGNA 4ZVJA 2CCRA 2V3EA 4NJHA 5GJMA 2D23A 1W54A 1DV7A 4J1OA 3T0CA 4Q22A 1BTMA 3YPIA 4D1IA 3QHNA 1WAUA 4JFIA 3PZIA 1E70M 1V7AA 4ACZB 1GVOA 2DSUA 2VJXA 2V2DA 3WQ4A 1REQA 4L80A 1WP6A 1TKKA 5HDRA 2QF8A 3THDA 3QV7A 4R5EA 4PMRA 1DWHM 4IXXA 2WANA 3MT1A 4B91A 2BOFX 2V8ZA 4H83A 5AECA 1TPC1 4B3KA 3KFTA 4KCVA 3H4XA 3DHFA 1TUXA 3GXPA 3FS2A 1KNWA 1CGYA 3LHZA 4AHQA 1GVFA 1ZY9A 4PRWA 4WQ6A 3JS3A 3FKKA 2Z26A 4EPEC 1ZPTA 1ONRA 3SB0A 1SFTA 1M41A 5JH8A 2YB1A 5HR6A 4C6QA 2F8QA 4ZTYA 5FJPA 2EGZA 3W7CA 4FSAA 4A8RA 4C90A 1ZGDA 1RR2A 1UQZA 2ZUUA 4S3EA 3W1NA 4IGSA 3SUWA 3P93A 4JTGA 4ZTXA 5HWNA 3EDDA 1K8XA 2BWGA 1MW2A 4RV8A 3S83A 4OBSA 5LNVA 4M51A 4GCXA 4LS1A 2W67A 4DYEA 1V3KA 3UGRA 3DESA 4FNTA 2VFGA 3R10A 1A80A 3VNIA 1FCBA 4MYXA 4B5SA 5HW8A 5CGTA 3KACA 1CXFA 1FWWA 1AW2A 4AEEA 1FY6A 4G2DA 2DW6A 3TFCA 2G5WA 4M6UA 2Q3RA 1N55A 1QPKA 3GC5A 1Y0OA 5KINA 4IG2A 1KWGA 3NPVA 4KR0B 1ZL1A 3BL3A 4NAFA 2CZ5A 1A5UA 3POHA 3W3OA 5CC3A 1Q6QA 2FHBA 1KFCA 3QKEA 3N4EA 1YNYA 3FV9A 1I2QA 4MJ2A 3O1NA 2CZVA 2ONEA 4A8NA 8TIMA 1SSDA 2DVTA 2INEA 3LLDA 3GDRA 3ES7A 3MBFA 2PLKA 2EQDA 3VCRA 3B0UX 1Z48A 3PSVA 3LCIA 4KETA 3UWZA 4YCPA 1A3WA 4HNUA 4GABA 3T42A 2VZVA 3TYUA 5IOBA 3M5ZA 1EP1A 1B4EA 2UBPC 2DG4A 2D0GA 1V6XA 2QDGA 4JFWA 3MZNA 1OC7A 2YXOA 1GTEA 3GC2A 2GGJA 1UR0A 3LN3A 4QISA 4HYRA 2XP8A 2DZBA 4P7NA 1YDNA 1E6SM 1IGSA 2GUYA 4GZ7A 4IJCA 3OJGA 3WO8A 1UYQA 1DYSA 2WWDA 4DBDA 2GWGA 4KWVA 4Q8OA 3MKKA 4GMEA 4W93A 5C2GA 3PTMA 4ZGYA 4CGTA 3TDFA 3OLIA 3DFTA 1EWEA 4LCSA 4PN2A 3JR2A 2MANA 4WKAA 1GOWA 2XGZA 4R34A 1PIGA 3QVQA 4ATWA 4TO8A 3VC5A 1W56A 1N82A 4ZQPA 1E71M 2IMRA 1OFAA 2PWEA 5DIVA 4LB4A 4IP7A 3G24A 2AOSA 4HNTA 2SFPA 1W3HA 3NZPA 3B8WA 4LVBA 4DYKA 3Q4DA 3BAXA 5F2IA 1OF8A 2PAJA 2Z28A 4PMJA 2VGIA 5DF0A 5CBBA 4LSBA 4L1GA 1VF8A 1GQNA 2ZZ6A 3F03K 2A4AA 4DZHA 1LZOA 2NWSA 1U5JA 4JL1A 2PZNA 3FX4A 1LQ0A 2VD8A 1EC9A 2RDTA 2WZTA 1M04A 3GVGA 2OT0A 4E4UA 1A3XA 2YBTA 1V3HA 1S5WA 1V6TA 3HFTA 2NX1A 4HN8A 5DMNA 1GOXA 3MP5A 2YX0A 3NQFA 4BCEA 1XGDA 3TYCA 3INPA 1R3YA 3VKBA 4DXXA 1HJXA 4DUXA 1J0HA 1MVYA 1P1XA 1W1B1 5I3HA 3WN6A 4EIVA 1OVDA 4LY4A 3GXNA 4ZB5A 1CECA 4N0RA 1YTDA 1IT8A 3BJTA 4AXKA 2MPHA 1XRTA 3OBEA 3USBA 1KGUA 1WDDA 2KX9A 2H9AB 2QPUA 1IEVA 4Q32A 3EWDA 2NVDA 1N8IA 4D6CA 3CHVA 4QCEA 4GI9A 2HVMA 1YATA 5CPLA 4JQ3A 3VXGA 4Q3MA 1AL7A 1WXZA 1B90A 3W1XA 3OPSA 4MSSA 1HT6A 1V93A 3RYSA 5JH1A 1SVDA 4J35A 4I5XA 3W7EA 1KXQA 1DHPA 4IMCA 1B5TA 4REQB 5KZ6A 1REQB 4DJFD 1RAKA 4AY1A 1JG9A 1E72M 3IIPA 3T2PA 3KBWA 3M5YA 5LIXX 1DVJA 1W5OA 1PHWA 1DBTA 4IGHA 1BQGA 4IMFA 4S2BA 4XBJA 4V2XA 1ROUA 2Z27A 1NF7A 1Q6GA 5AN7A 1O5QA 3P81A 1Q6RA 2DSWA 3TAKA 4HMCA 3XISA 3MJMA 1GNXA 3UWQA 3N2OA 3HBLA 3O3RA 3IGUA 3I3DA 2VX5A 4ODKA 3UNTA 3W7IA 4DO4A 5LIUX 3RPTA 3EOLA 4RDVA 1PDYA 1TWDA 1S5NA 3KAIA 4A8IA 1HW6A 4S3GA 2NQZA 4WHBA 4S3FA 3SRHA 3FEQA 1O60A 2ZQTA 3E5BA 1YPFA 4GXWA 2B7OA 3CZEA 4J7RA 2DZXA 3C5QA 3WDRA 5D2TA 1H7RA 1ZHAA 4O12A 2OKTA 1S5VA 3ANUA 5I03A 4WOZA 2A3BA 2W92A 2C3ZA 4LWWA 4RV3A 4X9SA 1G01A 1YLVA 2MNTA 3OP2A 3MCNA 4B3LA 1NU5A 4JHOA 4Q6JA 4GIAA 5GJPA 2PDMA 3F7JA 5F1UA 4GKTA 3C6CA 1J79A 2WZHA 3AC0A 1R9XA 3GRIA 3BOXA 1CNVA 1AMKA 2YZRA 2VC5A 1TPDA 3ZFHA 3QTGA 1FH7A 2FZ9A 2QV4A 5PTDA 5AZ0A 4IQLA 2P0IA 4PRRA 4C6PA 4B5NA 1XLMA 4NASA 5DCEA 3TTOA 3DYOA 1YDYA 5CZJA 3IGSA 2Y78A 3RX2A 2NV2A 3PZTA 3CZGA 4YHGA 4FMVA 3OIHA 4MWAA 1E43A 2CBIA 3TN5A 2XINA 1QI0A 3KAFA 1AG1O 4CQ9A 1AJ0A 4C7DA 3IK8A 3M64A 4M8UA 2CLHA 4W8BA 2IQDA 3R25A 2DVUA 3FSUA 4B9ZA 3CGNA 1BVZA 4PMXA 3C2OA 3BQ5A 4FZIA 1DORA 2W0UA 3UZWA 4FO4A 1T5AA 2XN2A 1K8ZA 5F7UA 3NGJA 4IF2A 3IVSA 2YYTA 4P7OA 3Q65A 1XG4A 1B31A 4GK8A 2KAUC 1K03A 3WK1A 4O14A 4IMDA 5CPTA 1A0DA 4H9ZA 3MKCA 4MZYA 1SO5A 3IRSA 3N2MA 1TIWA 6REQB 2CEQA 3SEPA 3M4HA 4ZQOA 8XIAA 1OFBA 1CLVA 5ABEA 3F2CA 2XISA 2HROA 2E0PA 1CGVA 4GLEA 4MUZA 5D30A 4B15A 3DHDA 1AJZA 1RBOB 4H6QA 1DJGA 1I75A 1G4EA 3SCUA 2YGYA 4UWMA 1Q1CA 2VC7A 2E9MA 4GYPC 1XYZA 4GXMA 3GWQA 4TW7A 1KO0A 2O0TA 5E9AA 4H00A 4LEQA 2DT0A 4GVFA 3R43A 4MUPA 3G1VA 3MMUA 1KBJA 3R5EA 1KFJA 3KBNA 5E1QA 3O5RA 1F6YA 5KEZA 4TVDA 4XSMA 4LUJA 1F2JA 2ZUWA 4JFUA 3T05A 1NSGA 1M3UA 4JTSA 4GISA 1W3IA 4EACA 4QBXA 3WF0A 1EX5A 2Y5EA 3T81A 5TQLA 1TPEA 1LP6A 1RJPA 3N2XA 4J40A 3LHTA 3C8FA 2C0AA 1LORA 3VNMA 5BRBA 4EE9A 3IARA 2ACSA 1TV2A 4KGJA 4LYPA 2J27A 3GG7A 1XD0A 2VX7A 2OYLA 1ZJIA 2IF4A 2EPLX 3H7UA 2GDQA 1HXJA 1Q3NA 1CB2A 3IWPA 2ACRA 1EWDA 4DIAA 3LHWA 4UBPC 3IJ8A 3IJLA 5JQ9A 5LIWX 1HIZA 2BY3A 2QHAA 2NX3A 3FN9A 1JPDX 4XD4A 4JBRA 3NJ3A 1UKTA 1BG9A 3VABA 3ZR4A 1RJRA 2F2KA 3CLMA 1XQKA 2ZKMX 5DQPA 1EHAA 4JDBA 3UJSA 3IHZA 2Q02A 3BG3A 3OYXA 4ZCWA 2FVKA 2Z4GA 4WZHA 1TV4A 6ENLA 2PF8A 2X2YA 5DMMA 1OZQA 3EWYA 4NILA 4DB7A 5JIWA 1MI3A 3N6JA 4OKDA 1J6PA 4BI5A 2OQLA 5ENLA 2GSJA 2E9LA 1KD0A 1POJA 4MAZA 5HQEA 3S2CA 2VEMA 1YE4A 2XFYA 4HK7A 1ZP3A 3KCEA 2WMFA 5REQA 1PTDA 4NZJA 3WDQA 1BG4A 1DJHA 3WQ6A 2CYGA 3GNXA 1W31A 3UPWA 4WXYA 1UKQA 1KFWA 3E6EA 2YCIX 3PZ9A 1KBBA 3VIHA 3QQ0A 3NDZA 3EOEA 1RCQA 2PDQA 4O1EA 1GVIA 2VKZG 4I7VA 1W3TA 4C6KA 3PUOA 1C8XA 5JXQA 1JD7A 1PYFA 2RJHA 4K39A 3I6CA 1TTQA 2V81A 3NQ7A 4UFLA 5FOOA 4J4NA 4EKJA 3W7NA 3ARUA 4P8VA 4ZXOA 3N17A 3PK7A 5DITA 4GUGA 4PODA 1WKDA 1NM9A 4FNRA 1LBLA 5JMUA 3KS5A 3EA3A 4LFYA 4UQEA 3WFAA 1EEPA 4WJXA 3STGA 3BVJA 2QCEA 2J25A 2GK1A 4J27A 3UCCA 7ODCA 1OIFA 3OZYA 3ZJ7A 3W7KA 1FHUA 3SRKA 4OUEA 1C93A 1O7AA 2E6YA 1KKRA 1ODZA 2ODOA 3GLCA 1W3JA 3U5YA 2ZZ1A 1QNQA 4IQCA 2QMKA 3HTWA 4HHLA 4HSOA 1ONXA 3HQNA 2JGYA 1SO4A 3QGVA 2I16A 3EEZA 3FAPA 1GOKA 1GZ1A 3L66A 5IHSA 2DUAA 4ODNA 3CQJA 3I68A 3FYOA 3ABXA 1EB3A 4XKYA 3UVIA 1FKDA 3THAA 2OTDA 3HJEA 4L6DA 1KW1A 4TXEA 3R4IA 3KW3A 2DH2A 2HDJA 3JVAA 1PWLA 1K77A 1ZU8A 2X30A 1VCVA 4HBKA 4XK2A 1TV3A 3GYEA 4AMCA 1W5QA 4MAVA 1H51A 5DBTA 5EA9A 5FJIA 2WCGA 2YDQA 1XIEA 5FL0A 1V3JA 3U4AA 3HPXA 4N42A 1RCXB 1EJSC 3ARSA 2NW0A 4FF5A 5HMDA 1ODUA 1JZ3A 3TYEA 3WYZA 3RUBL 1BTCA 4MWAB 4ZQCA 4CD5A 1FTXA 3KBJA 4MKVA 4RXFA 3RM8A 5GVJA 1DEDA 4ZPWR 3P0WA 3A3WA 5CPQA 3W28A 3SDOA 3NQAA 2E5BA 4LT9A 4BY3A 3PZNA 1EA0A 2OYMA 3FYPA 2O92A 3RN6A 1F4AA 1JNDA 1XICA 2DZUA 3IIVA 2YDSA 1TE6A 1OINA 2AL2B 2DZSA 3EWZA 3AWNA 4JTKA 4NAEA 3BH4A 4IP5A 2WSYA 5LXXA 3VIKA 2OWXA 2W62A 1FKIA 1NH6A 2R24A 4KIRA 4I6VA 3BDKA 2PPOA 2OLHA 1UCWA 3QYQA 4LBRA 4C6LA 3WH9A 5T9CE 2CBVA 4IISA 1MRQA 2PCEA 5C9WA 1UMYA 1XYBA 2R6OA 3D6NA 2WJDA 3LXBA 3G1SA 3F5LA 2F7FA 2RHGA 4Z2IA 1S46A 2JKEA 2DW7A 1UWQA 1MUMA 1EZ2A 1KV5A 2GVEA 3W6MA 1UKPA 4HCLA 1W9UA 2XVPA 1EC7A 4UUIA 1YHTA 3NWRA 3TUUA 4O0ZA 3URQA 1EPVA 3QSRA 1H0GA 1H5VA 1IF2A 4JYSA 1VD6A 4JY9A 3MCOA 3RILA 3LERA 4XX6A 4LXFA 3KAHA 4F9JA 4JYEA 4LUTA 3QMSA 3O5FA 4LVFA 1QHPA 4KRTA 1XLHA 3ME3A 4V1XA 5CG7A 2A6NA 2WMKA 4IIEA 2Z29A 1E0VA 4JL2A 1MQPA 3CGMA 4P2VA 1UJPA 2W79A 1IR2A 3WENA 4H2CA 3MI2A 2F6UA 1V77A 3LOTA 4DF0A 2F2DA 4JXCA 5DRCA 4MFEA 1YIXA 1B4KA 3IK2A 4F0SA 3DZ1A 1M1BA 4MJZA 4Q7BA 1W3LA 1FX6A 1JIBA 4DROA 3VNDA 3POCA 3KP0A 2PWDA 2NSOA 3WLTA 1OFQA 3PJTA 1O95A 3NPWA 1H2JA 2P53A 4A8LA 2IKJA 2KGJA 2WMJA 2YJQA 1TCMA 3K1GA 3DFSA 2QT3A 1XLEA 4DF1A 3FXYA 1S3TC 5BWFA 1ZJAA 4GI6A 3WL1A 3ZR6A 2YSWA 4B92A 4JTCA 1AD1A 1LCOA 3NAVA 4MNMA 4XWUA 4F8XA 2VZTA 1XDLA 4BQ5A 2CLPA 3GNDA 1PJ9A 5BXTA 4XAPA 4Q4PA 3OBKA 3G8EA 1G9HA 3GR8A 2Y1HA 4PUDA 3EXSA 4K8EA 1AQMA 2JALA 2DVXA 4PGLA 1IZKA 1K9TA 3MI3A 4FR1A 1FHVA 3VD4A 4CQ8A 1R30A 3V0UA 3Q58A 4HARA 2Q3OA 3W7GA 4OOUA 2XTKA 4FNPA 1FRBA 2EG6A 3WLJA 4QE1A 1B6CA 2XYLA 5LNRA 2QJNA 1NIUA 2TPSA 3PZMA 5REQB 3GDTA 4S1FA 5HJYA 2YCLA 4HPJA 1H62A 4JTRA 4US5D 1HG3A 2G97A 3W1QA 4TMBA 5C0QA 4NSBA 1OFRA 3GX9A 3CUFA 4GQ0A 4YYCA 3B8UA 4RUBA 5B80A 1KM2A 3NQDA 5E09A 4TTGA 3MS8A 3URNA 1FWBC 5HWCA 3QR0A 3IPWA 1Z9AA 2ZR4A 2OODA 5C5YA 1E9IA 4P7LA 3A21A 2BG5A 2FB3A 2FFIA 3GUGA 4FX6M 3U2ZA 3PWIA 3UERA 4IPLA 2H3BA 2XP5A 2DPEA 3W75A 4C60A 4PEKA 3QOMA 3IJQA 1W1TA 4ZEPA 3A23A 1JRCA 1JR1A 3ALGA 2QLYA 1UKOA 1RPKA 5I3IA 3AYTA 4O1FA 1QR7A 5FJOA 1T6MA 3RGCA 1OM0A 4BEQA 1H1NA 4B2DD 4ZODA 2UY4A 2ZWYA 3Q37A 4R3UA 2VR4A 4J3UA 3DH7A 1LUCB 2J75A 2XVNA 4D6DA 4UTFA 1ZCCA 2OZTA 1WDQA 1WOBA 4Q4OA 1BSLA 1EGMA 1XFBA 1XWYA 4O4VA 4IXHA 1HX0A 2CITA 5A6BD 5G4WA 1W1ZA 5FEWA 3B0YA 3HZ3A 4M3PA 3TQPA 3W24A 2PC4A 3ODKA 1V3IA 2J7BA 2ZYFA 3ZJKA 4ENLA 5H8MA 2ALRA 3W87A 3TSBA 1F8IA 2DJXA 1JGIA 2C71A 4Q4KA 4XKYB 4NI8A 2BVTA 3GDMA 1VFFA 4HU3A 1HF6A 3GO2A 1Z41A 2HS6A 5CKSA 4HMDA 1DIDA 1EP3A 5FF0A 1GJWA 1TPWA 3WLKX 3AROA 2Z2BA 1GQLA 3FYYA 3IAQA 1AL8A 3NCOA 4IJBA 3GTNA 3S2JA 2KZHA 3WNLA 3ZSTA 4UFKA 2YFOA 1EP2A 1QT1A 1I1WA 4MFDA 2A2IA 1I1XA 1LF1A 5B7ZA 4H19A 4KESA 4L3NA 2E68A 5HA7A 3WLRA 1IEQA 3CZKA 2X42A 1QJWA 4PL1A 3RG6A 4G50A 3VKAA 2OSYA 1YDVA 2GGHA 2IQ0A 2FMNA 3FDGA 1QOXA 1RD6A 1SGJA 2I56A 2CBJA 4JTQA 3KLLA 3AYRA 1YW5A 1K7FA 1CLKA 1HTIA 3PB0A 3OQEA 2FFCA 4NHVA 4R33A 1CDGA 1WX0A 3SRDA 3G22A 3VOGA 3R0KA 3RO6A 4DY1A 1WUFA 4FIRA 4NAEB 4AY7A 1KKOA 2ZC1A 4O4WA 4DPPA 3C52A 5GQBA 4JFVA 3VGGA 4S3BA 3WJXA 5D9OA 4C6EA 1XGZA 4ICMA 3G5EA 3LD5A 1LJYA 1E73M 1F3XA 3ZVHA 1FBAA 4PCTA 2AMXA 3CWOX 2VGBA 3PPCA 5A6MA 2CETA 2WSQA 4GIYA 1H1ZA 5LA0A 3AXKA 1A5CA 2YB4A 1FWTA 2E8ZA 4R7WA 3FIGA 4TUFA 1KR0A 3ZLHA 1J10A 1O4UA 1E0WA 4CQDA 4GQBA 2GUUA 3DKJA 4OZOA 4RLIA 1TUFA 3F4DA 3ZLFA 1NDWA 4C6MA 2OEMA 3AMDA 1JI1A 4GVHA 3GHSA 2DH3A 1GK8A 3RNDA 4LUTB 2VX6A 1GJPA 2EG8A 3GU1A 1E6QM 1W1VA 4LNCA 1HJWA 4N9BA 3A24A 2J7EA 3W27A 3LTSA 4EPBC 4EWND 3VOCA 2J13A 4C6NA 4QQUA 1TVNA 1Q6IA 5HK4A 1UC4A 3M0ZA 3MWAA 4QLKA 2PTWA 1ML1A 2IKHA 1DIEA 3M0HA 4M6QA 1EFZA 4AWEA 1X38A 1QO5A 1B3OA 2QKFA 1OBAA 5CZKA 3PAJA 5I06A 1J5SA 3V75A 1KFKA 3QYSA 1OJXA 3OQ8A 2CXGA 2WHMA 4OJYA 1R6WA 2WSPA 3E3HA 1MZHA 2J7HA 4J3VA 3F2DA 3K1DA 4NNAA 4I9AA 4XUGA 4X61A 4JICA 4JGDA 2W27A 4PE8A 2ISFA 4TVCA 1TX2A 4LAVA 4JCMA 3TR9A 4DT4A 1XHGA 2KI3A 3CK5A 4MM1A 4TX0A 2WC4A 4C6JA 4B5XA 4YTQA 1JCXA 3BGJA 1DL3A 1SR9A 4LBUA 3U2OA 2B0MA 1XF0A 5KZEA 3G3MA 2NWRA 1GUVA 4C5ZA 3TLQA 2INFA 1FKFA 1V08A 1BYCA 1A47A 4LAYA 4MMWA 2FGZA 4D1JA 4WJ8A 3AUJA 1AD4A 2J8TA 5FJUA 1KRAC 4K2SA 5FEPA 1UMLA 1YBQA 1MSSA 2WAGA 3IV8A 5CAKA 1TRDA 2YCLB 3NL2A 4IIBA 4MG4A 4EAYA 4NL1A 1RZMA 3TTEA 3O63A 5HJLA 3VE7A 2MF9A 4AUBA 3PC0A 1QO2A 3H70A 3R0UA 4Z42C 1RP9A 4JX4A 1V79A 4DWSC 2J74A 3W83A 1TCOC 2C18A 1I0DA 4R85A 3VOJA 1GQJA 1JAEA 1FCUA 3QC3A 3GG0A 1ZFJA 3CMFA 3WF3A 3VD7A 2ZVRA 5LGZA 2Z2AA 2WBGA 1DWIM 4LS0A 5I07A 5CPSA 5BWAA 1AH0A 3C0LA 2PRHA 2FZ8A 4WSKA 3TC6A 1FHLA 4LC6A 2GPTA 3IVTA 3W00A 4CNNA 3HGJA 4AY8A 2QCMA 2RGLA 3AYSA 3PTDA 4Z1YA 3FFSA 1MNZA 5IDZA 2Y4SA 3KHDA 4UTWC 2A5HA 1K8CA 3W53A 2QCLA 4GZIA 3KRZA 1GOMA 1L1PA 1HP4A 2DSZA 1B3XA 4LVGA 3VO0A 4TW8A 3QOKA 1RPXA 4XB3A 3LUOA 3C2YA 4ZPVR 3HGOA 4O0QA 4NQ1A 3GXFA 1PX3A 4WY0A 1XLCA 1VKFA 3ATYA 1HXVA 3BARA 1ESWA 4ORMA 3U2EA 2YXGA 1FWHC 2QVNA 2Y89A 1G7VA 4LS2A 2G96A 1E5JA 2X0YA 3T44A 4FXJA 1T96A 3GTIA 1PKLA 3HQOA 1MFVA 5D75A 1ZRQA 5H2ZA 2UZ5A 1Y65A 4I9MA 1OD8A 1XP3A 4HA1A 1XH0A 2J8GA 3RHGA 4JN8A 3ONCA 1X98A 1VH7A 1VBUA 3H12A 3MUCA 3TCZA 2ZA2A 3SY8A 4ZOCA 5EMLA 3OVRA 4DJED 2FDMA 3I4EA 3R13A 5JBDA 3SFWA 2POZA 3STFA 4KERA 4AMAA 1AODA 1ITQA 2FGLA 4X0VA 1KR1A 3EDFA 5A1AA 1ME7A 3R79A 1U1UA 3SZ8A 2QPSA 1HN1A 5DXYA 3DN5A 5HMSA 2C1IA 4LRSA 4YNGA 4JDYA 1HVXA 3CZLA 3TV8A 1XIHA 3K4DA 3B40A 4MHBA 4ZO6A 4AHPA 3SN4A 1F61A 2CLLA 3L5AA 4FF7A 4HHMA 5LXEA 1F6PA 1SO3A 4JFSA 3MVIA 3ZSSA 4GGQA 3PR9A 2WKJA 4HA0A 4TV5A 3WIJA 4N6FA 2ZBTA 1DXFA 5C71A 1EBGA 2R1PA 1PX8A 3A4XA 3VM5A 1B3YA 4KEMA 3PJWA 1GOIA 1KXHA 2D0FA 3UGVA 3ZVHB 5EMKA 2GQ8A 1R38A 3ANVA 3AIQA 3M43A 3QLLA 4NU7A 4ZQRA 1R3WA 1IE7C 1OGBA 3RJYA 4JTJA 3IJIA 1XIIA 1ZZMA 2B7QA 3NO3A 3N4FA 3CM4A 3HGSA 1D7IA 1MDRA 2XN1A 2X16A 5CJ5A 5M3WA 1X8CA 5I3FA 4IPPA 1O6IA 1HFBA 3Q45A 2K8IA 3EOSA 5D8WA 2BOGX 1KBKA 3MMDA 4AIUA 1P6WA 1U2YA 3A9IA 3MO4A 1R7AA 3NA8A 1GKPA 4JTEA 1D7HA 1S3HA 2ABAA 1Q2RA 2QIIA 5HQLA 3NZGA 1AQFA 1G4PA 2GJNA 5F2GA 3QF0A 3ITCA 4BR1A 2X2GA 1ITXA 3O6CA 1UZHA 2E28A 1KGXA 3AHYA 3M5VA 2I5QA 5A5WA 2X8RA 4O57A 2Z24A 2IW0A 4D6HA 3JZEA 5K7JA 3AZRA 4Z0JA 1Z8AA 2VFFA 3OW1A 3E5PA 4TX8A 4DBUA 2XP7A 1XYFA 2OXNA 3LNPA 2JF6A 4Q4QA 1J8VA 2J7FA 2Z1KA 3FGCA 1OT1A 4QFUA 4PSRA 3NQ8A 3W1TA 2D2HA 2AQWA 3N9SA 1S2AA 3KRBA 2X1UA 2BDQA 4N4PA 5GJNA 1XLBA 2WVVA 1XBVA 5EL1A 3SW6A 2A1YA 3QTPA 1FKGA 5I0DA 4KCUA 3AHZA 1YTKA 2JEPA 1A7XA 3O6DA 5E5CA 3WBYA 1UG6A 1UIOA 1U1HA 1LQAA 3CH0A 4Y9NA 4LYQA 2Y70A 3TC3A 1JF5A 3DEQA 2FH6A 4ZE4A 3GR7A 4XZHA 4WKHA 2XIBA 4M6PA 1LG1A 2ESCA 2INZA 2YL5A 1I8JA 1E56A 3DHUA 1G6CA 4C1LA 2EXOA 4AAJA 1TJ2A 3CHCA 1M5YA 1OABA 1YDOA 3UY7A 4XZWA 3WLHA 2WCSA 3UR2A 3NEVA 3UI5A 1NARA 2Q09A 3BLLA 2WVUA 3S2LA 1D9EA 1V51A 4B9YA 2Z2UA 2CPUA 1H7OA 1P43A 3H4GA 4DLFA 1EUNA 2HISA 3OB8A 3TA6A 1L6SA 1TTJA 3H2OA 1BYAA 2CHNA 3UJ2A 3OLEA 3LUTA 2NXIA 4Z17A 4ODOA 1EOMA 3QBUA 5HT1A 2E40A 2CLKA 4H9XA 4GUIA 1Y5VA 1PSCA 3VFCA 3NZRA 1Y5XA 3W01A 3ICJA 2B31A 4JKKA 3NQEA 4D6EA 3ABSA 1T40A 3G0SA 2DQWA 1Q6CA 4C6CA 1S2VA 5XIAA 6XIMA 1JDFA 2WCAA 1UD5A 1UP0A 1HKVA 4PEEA 1PXGA 5HUPA 3OA3A 2HXTA 3M41A 1FWDC 4HCDA 1R3RA 1GYLA 1VYPX 2ZQVA 3SO7A 3I10A 4CD7A 3GVRA 3UPBA 4NJIA 2QUVA 2EPNA 5J6EA 4R0XA 5IHRA 5I02A 3SCTA 1C90A 3DUGA 5A3HA 1M7OA 1PVNA 4S3DA 2A3EA 2P4VA 4BI6A 5A8PA 1XCXA 5GNZA 4O54A 2RURA 1CXHA 3BC9A 5E9XA 3RMEA 3B0PA 3E2VA 4IQ2A 4NY2A 1PZ2A 1XIDA 1E4LA 2QUTA 2GQAA 3FA4A 2POTA 1TZZA 4UCFA 2WXDM 4RJEA 4BWLC 3II1A 1JNEA 3N12A 4HHPA 3B0VC 3KADA 3OIXA 5FL1A 3CXOA 2E6DA 3AMCA 3AS1A 4L4PA 3TYAA 1KQYA 3I7SA 4Y9MA 1BHGA 1XRVA 2BHZA 2HSAA 3GAKA 3QW4B 5T9BG 1Z7AA 5D37A 4KWWA 4DBWA 1YPXA 4GX9A 3PR2A 7ENLA 2X0SA 1TIMA 3P67A 1AMYA 1SO6A 4L64A 2XM1A 4O1DA 4QITA 3HURA 3CTLA 1P6BA 4ITZA 3SJNA 1QI5A 3HB9A 5C55A 2CLMA 1SW3A 3DHPA 2NXHA 4W7VA 4Y9AA 2WNQA 1L2UA 2E7FA 1F74A 3HOJA 2HBXA 4WVXA 1SR0A 4X2RA 2G3IA 5CCZA 9XIAA 3W9ZA 3U7BA 3P2VA 5E0KA 2E77A 3P5ZA 2PTDA 2LJ4A 3FAWA 2Y0FA 4M6VA 3LEPA 3V35A 1SZGA 1RA5A 4AZIA 1KCKA 3SUSA 4LAMA 3WG6A 1CIUA 3COTA 3N29A 1XI3A 3DG7A 1GYNA 2P76A 3RR1A 2WNWA 3VPLA 4DAFA 3L0KA 5I5RA 3H2CA 3NDYA 1CXIA 4JN6A 1VIZA 4MF4A 3T2OA 1Q7MA 2QCFA 2AL1A 3S46A 2REQA 2GFTA 3HM7A 1K02A 2WVTA 2Q6ZA 4TYOA 2QGYA 1TJPA 1AFSA 3HIJA 1XXXA 3I65A 5FF3A 1HKKA 1QHOA 3C2EA 3W1LA 4K68A 1I2NA 3AALA 4G2PA 4O0KA 3B9NA 3UQAA 2WQPA 3EIPA 3G2GA 1PZ1A 1QK0A 3PZQA 1QFEA 4L5ZA 2Z1SA 3T55A 5CSUA 4DZ3A 3OA5A 4DUOA 2QCHA 2D69A 2XG9A 2UWFA 2C14A 3O9NA 1TR1A 2NLYA 4Q8VA 4H9YA 1UUQA 4CU7A 1LDCA 1Q45A 4JX6A 4TW6A 4DQWA 4NXSA 1KFEA 5C9UA 1F4HA 1LWIA 2OB3A 2QZRA 2VCCA 1P0BA 1Y0EA 4QM1A 3C8NA 4K8HA 5ABGA 4GY7A 1AVAA 3IAPA 1F73A 1V0KA 9CGTA 4AF0A 1QASA 1Q7QA 4ZOAA 2Y61A 1IWBA 2FKEA 1VJIA 2V38A 1FKTA 1WDWA 3U9IA 7TIMA 1CGUA 4QNWA 3MQTA 1MO0A 4WDXA 3DG6A 1CGTA 3VNYA 1RY0A 3TAOA 1TB3A 3LSCA 3W82A 4C65A 3CQIA 4GPNA 1S39A 5D2XA 5A2AA 3MJYA 4GH3A 4RZ5A 3FW6A 1H50A 3AISA 1R2TA 3DFOA 4OV9A 3S8HA 1POKA 4JTHA 4IOTA 4HJFA 4QROA 2EO7A 2OO0A 5HANA 4ERIA 4AD1A 3BQ6A 2E6AA 3ZT7A 3MUY1 7CGTA 2CZDA 1YNPA 2Y62A 2O9OA 4C91A 1T0OA 2PDUA 3TYDA 1H09A 2JKPA 1TR9A 3U2CA 3ABZA 4JIQA 3ARRA 2DUXA 1WDPA 3NVTA 1JRBA 3MP3A 3G0XA 2FTWA 2Z7KA 4M82A 2C1GA 3GZAA 2XFFA 1WE5A 1K7EA 2ISDA 4F0RA 3WQOA 2YDRA 1LLZA 5G2WA 1RD5A 3P14A 1KWKA 3O5DA 2ZX5A 3GBDA 1FKRA 3L4UA 3ZYZA 2Z25A 2V6AA 5I00A 1KM5A 4UNIA 3V1HA 1TWIA 3KVMA 2G4JA 4IH3A 2FTPA 1ICSA 5DX7A 3GU9A 4O1CA 1EC8A 2P5NA 2EPKX 1EF3A 2PDGA 1HGWA 5A6AA 2AAAA 4J3ZA 3BW3A 4HBEA 2RUCA 3ZS4A 1XH2A 4QNEA 3M6DA 3JZUA 1Y8BA 3QQ1A 3LM3A 1QAPA 4LBSA 4FOJA 2PLJA 3KVLA 5DT7A 2Y63A 2DT2A 4RE3A 3W7OA 5CH9A 5HUAA 2O4MA 2PDFA 1OGGA 4K1WA 1G67A 4S3JA 3WLMA 3MDYB 3C2RA 3OZPA 3KZ7A 3BAJA 3GD6A 4LGXA 2F9RA 3WQ5A 1R2RA 4GYKA 1OD0A 1D8CA 3L4VA 4GIVA 4X60A 5EMJA 3GXIA 3IS4A 3GXMA 4DRNA 4KGLA 5HNRA 3GVQA 3DFYA 3STEA 4MNLA 4BK9A 1I2OA 2RH9A 4DRKA 1CWYA 3CUZA 1DOSA 1OFPA 4MIMA 3RAOA 1DTNA 1G69A 3MO7A 1NP2A 1PX4A 3AIWA 3GC4A 4UNLA 2VXNA 4H6KA 2KR7A 1H41A 3BLFA 1WDSA 5HATA 1NJJA 4E0CA 5BCAA 5I6SA 3H4WA 2DDXA 4EPDC 5U4NA 1E0UA 2GJPA 1EUAA 2I1OA 5M5DA 1TO3A 3O5KA 1Q66A 4HPNA 6TAAA 5F1VA 5AY7A 1E6XM 4TMCA 1GW1A 3G18A 1XLKA 3HG2A 1NOUA 3WLPA 1UIPA 1D7FA 2Y2WA 2VCDA 3NRKA 4I7WA 1V03A 2ZICA 4ASTA 1E1CA 4JYDA 2PDBA 3OHIA 1RQHA 1TWWA 3AS0A 4FNQA 5HQMA 1I60A 3GIQA 1VBRA 4PB4A 4JHMA 4LEFA 1M5WA 2D2OA 4XUYA 1BRLA 3I6RA 3RPMA 1KT1A 3I4KA 5CLWA 1XDJA 2G95A 5EFFA 2XGBA 3ARVA 1VS1A 1BF6A 4HZ7A 1VFOA 2WO5A 4CEUC 3N3TA 1ADSA 4ORIA 1NELA 2WMIA 5BU6A 5C9RA 2Y5SA 2QXWA 1YPIA 1EJTC 4AB4A 4WSJA 1DIKA 1RALA 2PDCA 3QSTA 3TK7A