4DWSC

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
539
structure length
526
Chain Sequence
KPTENIPSPILVEDKYTEETYSRPDVNFEDGSQGNLSYTATRVCAPMYNHYVGDKTPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKVQEVWDGWNAQAPSLGLPQIGKGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDDGENYVLLIKELRSALDSRFGYSNREISIACSGVALKKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAGHFISLDTPRTVKQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADSNQETIDMGPLYNPGEIYLKSISEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Chi2
publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
total genus 184
structure length 526
sequence length 539
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsC01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsC02
3AQUA 2A3HA 3WEMA 1FFRA 1M04A 5IXEA 2VVNA 2OWWA 2F61A 1CPUA 2XIIA 1QHPA 2OYLA 3OZPA 1C3FA 4BZYA 5A3HA 2HISA 4FLOA 5I78A 1VEOA 2BXYA 1EHNA 2W62A 4HU8A 5CSUA 4W8AA 1E6ZA 2VUYA 2E4TA 4UQCA 3W26A 3WFZA 3WDJA 2BXZA 4W86A 3IJ7A 4W7UA 1WPCA 3TTOA 2ZWZA 1UWRA 3O6AA 3ARYA 1W3LA 1UR4A 4C7DA 3TTQA 1PZ2A 2FHCA 2RGMA 2DQXA 1G01A 1D3CA 5A8MA 2VI0A 3L4XA 1C8XA 2XVGA 4UZUA 5TD4A 3W53A 5D4YA 1X6NA 3MSDA 4L4OA 2WSKA 4AIEA 1EO5A 3BLPX 3L4VA 3RMEA 2XVPA 5A8PA 3FHAA 3WFLA 1XH1A 1UG6A 4UFKA 2W66A 4KRTA 3MUY1 4X9YA 4ACZA 1ZJBA 1QOXA 4HMCA 2OWCA 4PUDA 4E8CA 3CO4A 3MKKA 4WSJA 1ITXA 3AHYA 5E0FA 2WVTA 4D6FA 4JL1A 3CZKA 4H8HA 1JZ7A 5E0CA 2XFFA 2Z1SA 4YN5A 3OB8A 2GK1A 3N17A 2XM2A 4TOQA 5CLWA 1C8QA 1QHZA 3VMPA 4D6HA 3BAKA 1BLIA 1CEOA 3CUGA 4GQRA 3VO0A 1QBBA 2CNCA 4U2YA 1WO2A 2ZUTA 3A6OA 1US2A 4J3VA 3WF0A 1PX8A 3PZMA 4UFIA 4LGXA 4UZSA 1V3LA 1C93A 2OYMA 1HJVA 2EPOA 2DEPA 1UKSA 4W85A 5JBDA 1TZ7A 2IUZA 6CGTA 6A3HA 5CPSA 3W6LA 4UFLA 3LPPA 5EFFA 3T2OA 1E6RA 2YDSA 2Q8XA 5E6YA 3AMGA 5A2CA 1YQ2A 1HVXA 1S46A 4W7WA 5CGMA 4E2OA 3AISA 3GYCA 1H4PA 3UETA 5BXSA 3FNDA 5CQ1A 4AD0A 3LPOA 3II1A 2EJ1A 1B1YA 3N9KA 4M81A 1QI2A 4S3JA 5E09A 4ML4A 1EO7A 3VIGA 4CU6A 4B3LA 3U5UA 1UKTA 2QMKA 2WBGA 1KXVA 4HZ6A 4KGLA 4Q7NA 1B30A 2XJ7A 4GZIA 3TA9A 3UEQA 1V0NA 1PIGA 2PWHA 1W9PA 1B90A 2D1ZA 2V3FA 2J78A 4ZEPA 1QNSA 5JIPA 3CMGA 1GOWA 1AQHA 2QPUA 3BH4A 4OOZA 5HDRA 3LPFA 4HZ7A 4U3AA 3QHMA 3WELA 1IZJA 2D20A 3OGVA 1KFWA 3NYDA 3WH8A 4PCSA 4HPGA 1FA2A 4WLCA 1BSIA 2VQUA 4J27A 4PMNA 3MMWA 3AS1A 1C7TA 2DT0A 3F5LA 1W1TA 1R7AA 2YBTA 4MB4A 1W3HA 2JIEA 4J3XA 1EDGA 3O2LA 4CKQA 3WQ8A 4TX8A 3VIKA 2WBKA 1VAHA 2W67A 5E6ZA 5A6AA 4LX4A 4HOXA 3EBVA 3F5JA 3WBEA 5FIPA 3WF3A 1CXIA 3QHOA 1W1VA 1ZB5A 2D3LA 4W5ZA 1JGIA 3SUWA 1PEZA 3OLEA 3OIHA 2D0HA 2WM0A 4JKLA 2OSYA 3SCSA 3BC9A 3GXIA 1V3JA 1W2PA 3M07A 1A47A 5I2UA 1PZ3A 4AISA 4UCFA 1GONA 1A3HA 5BXRA 1XCXA 3VPLA 2VX4A 1BVZA 3QHNA 4CD6A 3RM9A 1GNXA 1WNOA 1JXKA 1I75A 5I77A 3OG2A 3PZTA 3W0KA 2UWFA 4X0NA 1CECA 4UQDA 4AYSA 3ZSSA 3TTSA 3IAPA 4J3WA 3W4RA 4FLSA 3NCOA 2PWFA 1E15A 3FW6A 2J8GA 4GI8A 2CIPA 5D9MA 1G0CA 1XD1A 4WKAA 1JAEA 4P7LA 5M5DA 4M1RA 4P8UA 1E56A 2UY3A 1OWQA 1BYDA 2WANA 1LL6A 3WENA 1H0GA 2IXUA 2QHAA 2VOTA 4BQ3A 2A3AA 5DT5A 1CGWA 3U57A 1CXKA 3VTRA 3NSNA 1TFVA 1AVAA 1V03A 3I3DA 1QI0A 4W87A 2YDQA 3WL1A 3VD5A 4MADA 1OT1A 3WSUA 3GXDA 3SCNA 1GHRA 1W32A 1WZLA 3RM4A 3CUFA 3VNZA 1BTCA 1LWHA 4J7RA 5IHSA 1I1XA 4UFHA 2VQTA 2FGZA 3KL5A 4JKKA 2J47A 5ABFB 1E6XM 3RJXA 2E3ZA 1X6LA 1CXFA 1UD2A 4DM2A 2CKRA 4IPLA 3RILA 3FXYA 1H11A 1ODZA 2V3EA 4CD5A 3BCDA 3OA5A 3EMCA 3WUGA 2VVSA 1DWAM 2AOSA 4MPKA 4CCEA 1ISWA 4HP5A 2XVNA 2C8NA 4AZ6A 4EE9A 2WCSA 4M24A 2XUCA 2C0HA 4BS0A 4JIEA 1QBAA 1Z32X 3VIFA 1V3MA 3PZNA 4W89A 5JIWA 2X1IA 2WCGA 3AHXA 2WWCA 1ODUA 1VBUA 3AXHA 4V27A 1ISZA 4HZ8A 2CESA 1J12A 2WHKA 4CD7A 5BWFA 1O7AA 2OLHA 4NRSA 3ZJ6A 3QR3A 2PC8A 3WH7A 1QNQA 4IM4A 4PMRA 3AIWA 5EFDA 1H09A 1GOOA 2WMFA 2WVVB 1H5VA 1JZ4A 2GUYA 3K8KA 3MUZ1 5LA0A 2VX7A 3AFBA 1PX4A 1LG2A 1DWIM 2ZUNA 3WUFA 1CIUA 5JH8A 3K46A 4R5EA 5A95A 1KB3A 2ZUUA 3MMUA 3VVGA 5F7UA 4TVCA 2J7FA 3EDEA 3I3EA 4H2CA 1E4NA 3TOPA 2ZX8A 3CIVA 4NSBA 1B3YA 2DT3A 3K8LA 1DTUA 1BGGA 1XYZA 1OD0A 1E71M 1W3JA 2YLLA 3DYOA 3HJEA 3AI0A 4LXFA 4KGJA 4OOUA 2FGLA 2BY1A 3WMBA 3AYSA 1ZBCA 3MANA 5A6BA 2WHJA 4OBSA 1JDAA 3MMDA 1JIBA 1ZS2A 3IJ9A 1V3HA 2ZUMA 3SUVA 1GQJA 1RH9A 4CVUA 2DSVA 1K6AA 2DGAA 2QF8A 1LQ0A 4UFJA 1Y7VA 1OBAA 2XFYA 1E1EA 4Y7EA 2ZWYA 1E3XA 4C7GA 1CXHA 4H41A 2EO7A 2HVMA 3WD2A 1WCGA 1XHGA 1XH0A 3KE0A 1TA3B 1E70M 1MW1A 1C7SA 1E1FA 1HL8A 3BCFA 1UZ1A 4U5KA 3CZ8A 1LF1A 1FH9A 4PCTA 1NWRA 2FH8A 3ZQ9A 1BYAA 2DIEA 3LMYA 1GQLA 4Z2GA 2O9OA 4LQ1A 3LPGA 3ARSA 1JFXA 1NP2A 4OUEA 4RE2A 1TG7A 1UWUA 3UR8A 2OYKA 5ABFA 3ALGA 5KZ6A 4BA0A 1E73M 1GQKA 4MTVA 1QVBA 2WPGA 5FL0A 5I79A 5I6SA 1OGGA 4UOQA 3VOCA 1W9BM 2J77A 2PBOA 1BQCA 4TUFA 1WDQA 4Q22A 3AMKA 4M80A 5CPQA 1NOWA 3T2QA 1GZJA 1E6NA 2PI6A 3WDIA 1KQZA 4JHZA 4ZXLA 4Z2KA 1J0ZA 1JYNA 3PZOA 5D9PA 3SCUA 3A4WA 4HA4A 3N15A 3VIOA 3GH5A 3G6MA 2YIHA 1LWJA 2FHFA 1WZAA 1FP9A 1CXEA 3AJ7A 4AZIA 3OLGA 4B9YA 2WMHA 3EDKA 2BVDA 3VIPA 3WDHA 3PTMA 4PRWA 2ZXDA 4DUXA 3VIJA 4U33A 5I0DA 1EGZA 3AMLA 2YBUA 2WVVA 1E3ZA 2J7BA 3VD4A 4J3TA 1E6SM 3VD7A 2W92A 1KCLA 3OGRA 5D8ZA 3VM5A 1RP9A 4J3SA 2J7CA 1JNEA 1EQPA 2DIJA 3PHAA 4AD1A 1OM0A 4IISA 1DWFM 1P6WA 1NWUA 3ECQA 3PZGA 2VURA 2BHYA 4LYPA 3VD9A 2W63A 1M01A 4D6IA 3ZSTA 3N04A 1UUQA 3WD4A 4M82A 4ATDA 5JBFA 1GOKA 4F9JA 4PYSA 2UY5A 2WVSA 1TR1A 3ARQA 2MANA 1LL7A 3MU7A 1VJSA 3VIHA 2VZUA 4GI9A 4AZHA 5BYWA 1PBGA 5DO8A 3GXFA 4EANA 5AC5A 6TAAA 3AS3A 4MJ2A 1BAGA 1C91A 1BF2A 3A3HA 1G1YA 3SURA 5CJ5A 4AW7A 1K9EA 2WMIB 1Q6FA 3L2MA 3SEPA 4OIFA 4XUYA 2BY3A 2WSPA 4OZOA 4MDPA 3SUUA 2ZIDA 1HKJA 2XSBA 3EDJA 5DMYA 1B3ZA 1GOQA 3IANA 1TA3A 2ZX6A 3AHTA 2EPMX 5ECUA 1R7OA 4AWEA 2E9MA 1HVQA 2O9TA 4U5IA 5AYIA 3AIEA 2AMGA 1JZ2A 3APGA 1NP0A 1MWOA 1C8YA 7TAAA 2JE8A 5JUVA 3T08A 3IAQA 2YA1A 2CITA 3VNYA 4QLKA 4FLQA 1TVPA 4MB5A 1BG4A 4RE3A 5A2AA 3W82A 5DFAA 1JI2A 1U33A 5EB8A 3WH5A 3VINA 4JFUA 1IZKA 2G3NA 2XVKA 1UWTA 2A3BA 1J0HA 3U5YA 1GUVA 2XFRA 3KEHA 3SUSA 3VKKA 1WB0A 3WIJA 1B3VA 3GNRA 1R87A 2A3CA 3PZVA 3MS8A 1ZL1A 4P7OA 3GM8A 4PEEA 4F9DA 3WDPP 4F66A 2CBJA 1IT0A 1XV8A 2BVYA 4AIOA 4P7RA 1HP4A 4JZ5A 1FHDA 3DHUA 5HXMA 2AAAA 2IXVA 3UCQA 2D0FA 2J7GA 3AXIA 4HA3A 3CHCA 3WF4A 1E55A 2WC3A 1U2YA 4MNMA 2DPEA 1EA9C 3IJ8A 1H0IA 1H2JA 2CXGA 4QAWA 1R85A 1SYTA 1ESWA 2C7FA 4PSPA 4CN6A 4QDMA 1QNRA 1CLXA 3O9NA 1ISVA 3AROA 4DWSB 1QW8A 1L8NA 3FY1A 1BGAA 5GNZA 3F5KA 3GH4A 4YHEA 1VBRA 1JNDA 3VX1A 2ZX5A 1HNYA 1B3XA 3K4AA 2E0PA 2VRQA 4TVUA 1K9DA 4KMQA 4QP0A 1LJYA 3CHEA 2XGIA 1JYWA 4URIA 3VUPA 3EMZA 3WD0A 3WNKA 2J7DA 1AQ0A 1JL8A 2J62A 3RCNA 5ABHA 1GORA 1F4AA 1V6XA 2WMJA 5BCAA 4JFTA 2WZEA 3BAXA 2JFEX 2WKGA 3BAWA 3S2CA 2XWDA 2WMIA 4X0VA 1GOMA 3ARTA 4WK9A 1E4LA 4EK7A 2UY4A 2V3GA 3L4WA 1V6YA 1E9LA 3DHPA 1CGYA 5A6MA 2E8YA 4H8UA 1BHGA 3UG5A 2ZICA 2JEQA 3BLKA 2BVTA 4PN2A 1XGZA 1UH3A 4FK9A 4PMOA 3WN6A 1MXDA 2WHLA 1M7XA 3POHA 1DEDA 2QLYA 4QLJA 3WMCA 3M6DA 8A3HA 4ZFMA 4LYRA 4AEEA 3BAYA 3DC0A 4D6EA 1RP8A 4PBGA 4MAVA 2NT0A 1MW2A 1E4MM 3ARXA 1J0IA 2VZVA 3THCA 3KL0A 5A6LA 4DUVA 2E40A 4LYQA 5IFTA 2WVUA 3RO8A 3VGHA 1NWSA 4HPHA 1CXLA 1K9FA 4BCEA 1U30A 5LA2A 3VGEA 1PJ9A 2EBNA 9CGTA 1JXJA 2EQDA 5GQBA 5A8NA 5C70A 1HKKA 2O9PA 4BQ4A 1ITCA 3L2LA 3QOKA 2F2HA 3ARPA 4AD4A 3WY1A 1GJWA 3NSXA 1MQQA 2D22A 3HMCA 1J0KA 1Q6DA 1UA3A 4XX6A 1CDGA 1IV8A 3MUAA 1HT6A 1M03A 3ARVA 1UR0A 2CETA 2J75A 2JEPA 4MAZA 3T09A 3VDCA 2ZUWA 3SCOA 2W61A 3VMNA 2CBVA 2DT2A 1H49A 3T0AA 2BV9A 5GNXA 4WKFA 1KXQA 1KGWA 1EDQA 2VZSA 4R27A 1J0YA 3EDFA 1RPKA 2WKLA 1V6VA 4B16A 1G9HA 5DT7A 4P8VA 8CGTA 4D1IA 2FDMA 1MQPA 2Z1KA 2CBIA 2OSWA 1FP8A 2V5CA 1G94A 4JAWA 5CGTA 3B9AA 1J10A 1V0LA 4BQ2A 2ZE0A 1MFUA 3BAJA 5AC4A 1KQYA 1J9YA 1ISXA 5I3DA 2J7EA 3SCQA 4AEFA 2X0YA 3WKZA 2D24A 3GH7A 4P8WA 2VT0A 3WL0A 1VF8A 4FLRA 2Y24A 3ZJKA 1TE1A 3OLIA 2VX6A 2WHMA 2DDXA 1UR8A 2JALA 3NSMA 4H04A 4LPCA 1QI4A 4GINA 1OSEA 1E5NA 3WNOA 5A6KA 3UG4A 1HL9A 3W28A 1GW1A 1VFFA 2YA0A 5FCZA 2X8RA 3AYRA 2PB1A 2VTFA 1VIWA 3AXXA 4QCFA 3MV11 3ZR6A 1J0JA 1XRVA 2G3IA 5CLTA 1QHOA 2DSKA 5ABEA 2VZTA 1WE5A 1H1NA 3AS2A 2O92A 2V5DA 4N0RA 4WF7A 4AC1X 4AXNA 4DWSD 1XSJA 4PSRA 1WDSA 5CXPA 3M46A 1GQIA 2VO5A 2OSXA 3WF1A 5C8BB 4GQQA 2PWGA 2YL8A 3N11A 3WDQA 2GVYA 1XSIA 4EKJA 1KGXA 2E9BA 1OIMA 2ZXBA 1HJWA 3IK2A 4D6DA 1UWSA 3EYPA 4ACYA 1MQRA 4D6CA 7A3HA 4MB3A 1JZ3A 2JF6A 1AQMA 1LL4A 3NIYA 1UZ4A 1W9UA 2V38A 2YL6A 4K68A 4AZ7A 1JAKA 3MUIA 4B3KA 4W7VA 1KXHA 4CCDA 3CHFA 4J3UA 3CUHA 3ARUA 3AIBA 2E8ZA 2J4GA 2WC4A 3CBWA 2GJRA 2A3EA 3TP4A 1F4HA 1CYGA 1EIBA 2GJXB 4JFWA 1QW9A 4PMDA 2CBUA 1RD6A 3WQ4A 1K9TA 1Q6GA 1UQZA 2G4FA 3BMVA 4HMDA 1SMAA 3WUBA 2NSXA 1KXTA 1TVNA 1B31A 3WUEA 4FMVA 4MDOA 4V28A 3JUGA 3KWXA 1LG1A 2PBGA 3DECA 1J18A 4GZJA 1KWGA 3W37A 4DUWA 4C7FA 3ZOAA 2ZX7A 5A8QA 4HMEA 2ZUSA 4U31A 1V0KA 1MVYA 1CGXA 2F8QA 1JG9A 1MFVA 1NM9A 2J8FA 3OBAA 5BRPA 1TCMA 2BHUA 4XZBA 1KBKA 3BGAA 2BY2A 5BROA 3A4AA 1W1PA 4W5UA 4IUGA 5KEZA 1SFSA 1US3A 4CN1A 3WQWA 3SCRA 3VDHA 4PMXA 3RIKA 1OD8A 3W24A 5FL1A 3L4UA 2XVLA 2XPKA 1HKIA 4OJYA 5A1AA 1W9DM 2EPNA 1Q6EA 1CGTA 2XM1A 1UD4A 1W9VA 2CPUA 2CEQA 4OKDA 4YPJA 3GNPA 3GXMA 4AZCB 1MXGA 4GKLA 4PTMA 3NDYA 1O6IA 1W2VA 2CYGA 4DM1A 4WSKA 3B9DA 2Y4SA 3KZSA 4WIWA 5A2BA 5I24A 2BS9A 4UTFA 2X09A 3BAIA 4FF5A 3FAXA 4P7QA 3W81A 1JYXA 1UD5A 3DYPA 4P7NA 3VMOA 5DEZA 1UH4A 4PTWA 1X1NA 3RDKA 4CUCA 1HKMA 1E5JA 1AMYA 4CU7A 5I23A 4F8XA 3GBDA 3VM7A 2B31A 3UR7A 1J01A 1JF5A 3PN8A 3PZQA 3PZIA 3ZJ7A 2WAGA 2BY0A 3ARRA 3WNLA 3ZR5A 4Z2LA 1QI3A 1TUXA 3AIQA 1EXPA 1UKOA 2WC7A 3ARWA 1V3KA 1UOKA 3SCPA 3OZOA 4NZCA 1QPKA 3RJYA 2YJQA 1W3KA 1JI1A 2JF7A 1CNVA 1OIFA 1FOBA 4XV0A 3ZMRA 1DWJM 3SIMA 3VDAA 4OBRA 1R86A 4QLLA 2WCAA 2CCRA 1GCYA 5I5RA 3NDZA 1MYRA 2CHOA 2YDRA 2VMFA 4F79A 3GTNA 3GNOA 3FHQA 3ZIZA 3AOFA 1WZMA 3AHZA 5M3WA 1BVNP 3BSGA 1NWTA 2GJXA 3WF2A 4V2XA 1JD7A 1OGBA 5HPCA 3CGTA 4AY1A 3NJ3A 4CVWA 2XSAA 3E1F1 4AMCA 3GZAA 1VEPA 4IPNB 1VENA 5BXPA 5EMYA 3T0BA 4A3YA 1V08A 5FD0A 4D6GA 3CTTA 4J28A 4AZBA 4JKMA 2D3NA 3ZT6A 1UR9A 1H41A 2YL5A 3EMQA 2X2YA 4H8VA 1UKQA 3F4VA 1UQYA 1OT2A 1G5AA 1OCQA 1E4IA 3MO4A 1KBBA 2Y8VA 5FKYA 3W38A 1V02E 2DSWA 2QMJA 4W8BA 2DT1A 1HN1A 4UNIA 2GSJA 1HX0A 5A6SA 2ZOXA 3WBAA 1E6QM 4MJ4A 2XTKA 1V6WA 3ALFA 1CLVA 3OGSA 1JF6A 4UOZA 1HF6A 4BF7A 3W25A 5HOSA 3W29A 3ZT7A 5E70A 4AZCA 2WNWA 3SCTA 5HBFA 1VB9A 1UWIA 2WW5A 3K8MA 4PMZA 1VEMA 1NH6A 3BSHA 3N18A 3CLWA 1E0XA 3CPUA 3WMSA 4W93A 3W6MA 1ECEA 1W1YA 1V3IA 4M29A 5AY7A 4UQAA 2TAAA 3N1AA 4TX6A 4MNLA 1CGVA 1KR1A 2WWDA 3ZO9A 3WH6A 1Q4NX 3NUKA 4UQ9A 3WQ5A 1PX3A 1VRXA 3SCWA 2J79A 5HNNA 4TTUA 4AZ5A 3HN3A 3M7SA 3SCVA 3WNNA 2VCAA 4ATLA 4CN4A 1DHKA 5IDIA 4Z2JA 3BXWA 2CHNA 1GOIA 4KH2A 2VR5A 4B15A 1SMDA 4Z2HA 4KRUA 2VJXA 4JFSA 5HPOA 1EH9A 2VZOA 2CERA 2ZUVA 3AIVA 2ESCA 2W4XA 1VFOA 1EOMA 1E72M 1JD9A 1OGSA 3FAWA 2VRJA 2DSZA 5DF0A 3SUTA 1EOKA 3RM8A 4PTVA 3D3AA 1HJUA 4PMVA 4P8XA 4TVDA 5BRQA 3VX0A 2D2OA 3VDBA 4NF7A 1BYCA 4N42A 5ABGA 1I1WA 2XWEA 4PMYA 2J25A 1J11A 2Y8KA 1OB0A 3AZTA 2OWXA 1UD6A 2VRKA 3UESA 2WZHA 4D72A 1V6UA 3N12A 3WD3A 5D9OA 3AIUA 3DYMA 1UHVA 2WZIA 1WKYA 4JCMA 2XYLA 3AZSA 1DWGM 5CG0A 4HOWA 1Q6CA 3CUIA 1FFQA 1UD8A 3U7VA 4ZXOA 2VR4A 2NW0A 3ZJ8A 4UOJA 4GIAA 4DWSC 4B9ZA 5M17A 4EAMA 4CCCA 1GJUA 3A4XA 2VCCA 4PUEA 1BYBA 4CD4A 4A3HA 2NT1A 3WH9A 3WNPA 4NRRA 3MSGA 1UD3A 4ATWA 2EXOA 3AIRA 4AD5A 4KWUA 1EHAA 2ZXQA 1C90A 1QNPA 1CTNA 4AD2A 4HU0A 1PIFA 1KWKA 1V02A 3WD1A 1C92A 2D23A 3CZLA 1XYFA 5GPRA 1E43A 3T0DA 3N13A 1B0IA 1E0WA 1B2YA 3MV01 1KGUA 2YL9A 4MNKA 2EPLX 2VC9A 1VJZA 2W91A 1NQ6A 3BMWA 3PTKA 1JDDA 1E0VA 4GXPA 1VFUA 5D9NA 1JZ8A 1GVYA 1JZ5A 3TTYA 1MW0A 3K4DA 4AZGA 3CUJA 1WZKA 1CZ1A 1MW3A 2JIWA 1HJQA 1NARA 1E40A 2XG9A 5FOOA 4WJXA 1WDRA 1UA7A 4BQ5A 4UQEA 3FN9A 1UR2A 4DWSA 3S6TA 3CHDA 4WKHA 3L4ZA 3I3BA 2J7HA 1TMQA 1HXJA 3VGGA 4S3KA 4A4AA 5C71A 1CENA 4D71A 2XHYA 2J74A 1GPFA 3HU7A 3TONA 1PAMA 1EQCA 1KR0A 5LYRA 2VX5A 1L0PA 5A6JA 2WLYA 2GDUA 3QOMA 3UG3A 4JFVA 2GFTA 3GBEA 3WDRA 3VD3A 5CSYA 3VILA 3EDDA 2ZXAA 1FH8A 4AIUA 4GPNA 2WK2A 3CZEA 4ZE4A 2WMKA 2CKSA 1W9XA 3AHVA 3AS0A 2VL4A 1GVIA 2XIBA 2EEXA 1ZU8A 2PF0A 2V3DA 3QGVA 1HIZA 3VGFA 2GJPA 1E6PA 3U7BA 3WEZA 1UH2A 5E9AA 4GI6A 1JDCA 4PTXA 4UQBA 2YLAA 2Y5EA 3AICA 3CMJA 3CZGA 4L4PA 2O9RA 4W8LA 1QI5A 1D7FA 2VNCA 1WDPA 1PPIA 1DWHM 5D8WA 3ARZA 1SR0A 3D5HA 4PMQA 5CPTA 2BHZA 1HJSA 4QCEA 3WQ6A 3AMDA 1N82A 1JFHA 2G8ZA 1B3WA 2YKKA 3CH9A 4CD8A 2GDVA 4GZEA 1BG9A 3B8SA 3PZUA 4MB1A 1CGUA 4E8DA 3L4TA 2PWEA 2X05A 1M53A 3WQVA 1W91A 2XGBA 3VIMA 4JHOA 3A47A 1WAWA 4UR9A 1FHLA 2QPSA 1HJXA 1ZJAA 4JCLA 1LLOA 3POCA 5JBEA 2WXDM 2QV4A 2WB5A 1NOUA 5EBAA 1ZBVA 3CZJA 2Y2WA 3PZ9A 3RPMA 1ISYA 3J7HA 4ACZB 3ZM8A 1D2KA 4U3CA 4ZE5A 2YA2A 2VCBA 2YOCA 2PWDA 4TTGA 2BFGA 3WEOA 3B9EA 4TXEA 5A94A 3OLDA 5A69A 1ZBKA 1XSKA 3WNMA 1KCKA 1WP6A 2GK1B 1EDTA 2X0HA 2W5FA 3W27A 3VU2A 4E4PA 5IFPA 3T2PA 1R8LA 4XZWA 2FH6A 1BFNA 1BPLB 7CGTA 2DH3A 2ZX9A 4ZENA 3K1DA 5IHRA 2RGLA 3G6LA 1VFMA 1V0MA 1JZ6A 2E9LA 4HTYA 4D6JA 4PMUA 1CBGA 4W88A 4HA1A 4H7VA 1XH2A 1UR1A 2WMGA 3VGDA 3VIIA 5BXTA 3VGBA 1XD0A 1UYQA 3ZT5A 3AMCA 1GHSA 4JL2A 3THDA 5M03A 2G3MA 4XB3A 3KL3A 3UERA 1H3GA 4UFMA 4CGTA 5AYBA 2G41A 2G3JA 4U2ZA 5A6BD 3L4YA 4RE4A 1NOFA 1UWQA 4W84A 4HOZA 2WYSA 4GO8A 1CWYA 4D1JA 3AZRA 5GNYA 1FH7A 1DP0A 5LA1A 1ZBWA 4AD3A 1JYVA 3PTQA 4CU8A 4M56A 1B9ZA 2UY2A 2FHBA 1UKPA 3PBGA 2WLZA 1QNOA 1XCWA 3GDBA 4QFUA 5CZKA 4YHGA 4GO9A 4NI3A 4Z2IA 2DH2A 1XC6A 1YHTA 1HP5A 4M8UA 4RL3A 2BNJA 1OINA 2DSUA 5A8OA 2EPKX 4MNJA 2D0GA
chains in the Genus database with same CATH superfamily
1UZHA 2OTDA 5CPLA 2IQDA 5IXEA 2VVNA 2OWWA 2F61A 2ABBA 3T1GA 3IIVA 2IKGA 4N4QA 4L1WA 4BZYA 2A3LA 3W1RA 2HISA 2UZ9A 5I78A 4UIOA 4W4QA 2PMQA 1NSJA 4QQUA 2W62A 4GY7A 4XAPA 1E6ZA 3A24A 1Z48A 2E4TA 3COTA 4DRKA 4W86A 3TR9A 3C2FA 3TFCA 1W17A 4QITA 3B9NA 4ZPVR 1UWRA 1VPYA 3KWSA 3H2OA 1KTCA 1W3LA 2AWGA 3LNMA 3ORWA 3UGVA 3L4XA 3E2QA 4UZUA 5TD4A 2PEVA 5D4YA 3MSDA 1EEXA 4L4OA 3WQPA 4OQVA 3G1SA 1ME7A 2XVPA 1TMLA 4IMAA 5A8PA 2QJIA 3FHAA 3DGBA 1B54A 1U1JA 3LM7A 2W66A 2F9RA 2EG6A 4YTUA 1CX9A 4ACZA 4H6EA 1QOXA 3TFXA 1ITXA 3AHYA 3IRDA 4H8HA 4R7OA 5FF0A 2ALDA 5REQA 3R0UA 4LC6A 1YE4A 4YN5A 3OB8A 1ZK6A 1OQFA 2N87A 1QHZA 4GJIA 4WY0A 1P0NA 4C6JA 3CUGA 3STFA 4B90A 1A3XA 4QISA 2BBFA 3A6OA 3V1PA 5IOBA 3SQSA 4LS2A 3WF0A 2PC4A 3PZMA 4LGXA 3QYSA 3CT2A 1FKBA 1HJVA 4J2PA 3HF3A 4HBOA 3SO7A 1IXNA 4W85A 3VOJA 2IUZA 2ZQTA 5I02A 2BSLA 3K1GA 4LNCA 3BZJA 3LYEA 2NQJA 4CNPA 2PZ0A 5CGMA 2ATSA 3UWQA 3L23A 3FJ6A 3GYCA 1H4PA 4HTBA 3SI9A 5LXEA 2Y5SA 1B1YA 2RUDA 4TR9A 4S3JA 4GGQA 1PKNA 3BVJA 4J5NA 4MUPA 1L6YA 1VC4A 1HW6A 4MJZA 1KXVA 1E0UA 2CZDA 1XI3A 1B30A 1TPFA 2XJ7A 2PV2A 2ZZ3A 1AD1A 4GZIA 1VBGA 3H2CA 3N6HA 1SSDA 1VYPX 3C6CA 1PIGA 2L5HA 4HYVA 3LHUA 3WQFA 2D1ZA 4F2BA 4PGLA 1GVEA 4QJ3B 5JIPA 4HZMA 4ODMA 3O5KA 1Q6OA 2RQSA 4IMDA 1IEXA 3KVJA 3LPFA 4U3AA 5KETA 4MPQA 1XDMA 2P88A 3OGVA 2MNRA 2WNNA 4PCSA 2XH7A 2VQUA 3IIZA 1A5MC 4CQCA 3DFNA 1J96A 1TIWA 4UDMA 4ML9A 1C9HA 1DXFA 3PK7A 4I7VA 1OZMA 4J3XA 1M1BA 1DJYA 1A4LA 2CZFA 4R85A 2WPBA 3PUGA 1JPDX 1GZ1A 1BL4A 2YX0A 4RZBA 4LX4A 4HOXA 3F5JA 1W1VA 2D3LA 3SUWA 1AG1O 3TYEA 4QT3A 1U5HA 3OHIA 1G6CA 4IFRA 4JKLA 5DMMA 3SCSA 3TC5A 5H8MA 2OEJA 1V3JA 1W2PA 3M07A 1PZ3A 4HU4A 3LBMA 4QSFA 4PE8A 1A3HA 3T44A 1XCXA 4CD6A 3UJFA 2LJ4A 2G0WA 4PODA 1JCXA 2PWUA 4PFMA 3UZ5A 4AYSA 3NXFA 4JTUA 3OTRA 3FSTA 4J3WA 4R53A 4FLSA 3THUA 5C9XA 2HEJA 3FW6A 2J8GA 2CIPA 3N2TA 1G0CA 2H8ZA 1JAEA 1QOPA 1OWQA 4PH6A 1LL6A 1SPQA 3BO9A 5AOUA 4EP8C 3S9IA 4H4IA 3QTPA 4YMZA 4X22A 4I8YA 4HCHA 2INFA 1ZFJA 2C16A 1AVAA 3I3DA 1QI0A 5FJUA 1BKFA 4CNNA 5I3GA 2YDQA 4JNMA 5CC5A 4Z1BA 4MADA 1OT1A 2H6RA 3E5PA 3CV1A 2P0IA 1K7XA 4L1XA 5BZAA 1CCWB 1W32A 1WZLA 3VNZA 2OQHA 1BTCA 3TYAA 4Q33A 1Q7QA 3CM4A 3C52A 3QZ6A 1TWWA 1I1XA 4UFHA 4G56A 4IIDA 4JQ2A 1HO1A 1L9WA 1CXFA 3QW3A 5E0KA 2X1SA 2VFDA 4IPLA 1K6WA 3RILA 3UXLA 2V3EA 1LBFA 4L1GA 4ES4A 1I2OA 3AUOA 1O5XA 1ISWA 2HVOA 1Y65A 2C8NA 4QEEA 2DY3A 4M24A 4K7YA 3SFKA 3E2SA 4JIEA 4JPGA 3W02A 4B5WA 2WCGA 4DZAA 1VBUA 3AXHA 1J4IA 1A4MA 5D2XA 5LNWA 3PG8A 2CESA 4N9BA 2J8TA 2WHKA 4CD7A 5BWFA 4X2RA 4DY1A 2OLHA 1DVJA 1G7UA 3GIYA 1NU5A 3LGDA 3ZJ6A 4ZO7A 1XP3A 2PC8A 1QNQA 2XU2A 3TQ0A 3UF8A 4YCPA 2WVVB 2WMFA 3I6EA 3LDVA 1JZ4A 1E9ZB 3BK0A 2Z1VA 4KR0B 4AHQA 4NG3A 1IXPA 3M7WA 9RUBA 3AFBA 1LG2A 3LRMA 3TSMA 5JH8A 4HNNA 4R5EA 5A95A 1KTNA 2ZQ0A 2FZMA 3MMUA 1P0DA 3SRHA 1YDNA 3I3EA 3O3RA 2OFNA 1RALA 3NTYA 1UUOA 2RDWA 4RNJA 2WO5A 4IXHA 2ZR6A 1J4RA 3UPMA 1S3TC 3A9BA 2YLLA 3A5VA 3DYOA 4GFSA 1NJJA 2QGYA 3AI0A 1EC7A 4LXFA 4KGJA 3W7PA 2INEA 2FGLA 1J6PA 3L0GA 3P8JA 3MMDA 1W1A1 1PCKA 3ABOA 1S2WA 2J9XA 1RH9A 4CVUA 1K6AA 1W31A 2HVNA 1Y7VA 1OBAA 2CWXA 4Y7EA 2I57A 3LXCA 3UWUA 3Q45A 1E3XA 2ZTJA 1Q6IA 1A0CA 4DRNA 1KCXA 9XIAA 1N8IA 4XAZA 2O0TA 1WCGA 3FFSA 3O05A 1XM3A 2PBCA 1VHCA 1E1FA 1HL8A 3BCFA 1KD0A 4S2CA 1IX5A 3NTPA 1NWRA 5G1MA 1XICA 2HQAA 3R7MA 3MB9A 1TPC1 1ICSA 1GPWA 2E5CA 2ZA1A 4IL0A 1UJPA 4OUEA 1UWUA 3UI5A 1X96A 2OYKA 1W8SA 4PR4A 1E73M 3P14A 2JK2A 1QVBA 3QEZA 3E96A 4NX5A 5FL0A 5I79A 1EB3A 4KWVA 5HWJA 2PBOA 1BQCA 3WJZA 3BQ6A 3IVUA 1LCOA 1WV2A 4Q22A 3KHJA 3AMKA 4M80A 3L5MA 4HK6A 1NOWA 3T2QA 4GGHA 3WDIA 2ZZ1A 4ZTYA 4GQGA 4JNYA 4ZXLA 3GXTA 1JYNA 5D9PA 3GK0A 2E5BA 3O5DA 3N15A 3KBVA 1YW5A 4JFLA 4ZOCA 3EX2A 1LWJA 4QT2A 3USZA 4AG0A 3AJ7A 1FP9A 4N2YA 4GC3A 1N7KA 3FA4A 5D32A 3PTMA 4PRWA 2F84A 3W07A 2YBUA 3SY5A 3RHGA 2WVVA 4PCPA 1A0EA 1Z69A 8TIMA 3A12A 5D8ZA 1RAKA 5F2GA 3VM5A 2J7CA 3CO8A 4AUBA 5J5DA 4RK8A 1WKDA 1XRTA 3ANYA 1NWUA 4QNWA 1LYXA 1DQWA 2BHYA 4O4WA 1M01A 5DBTA 4UTWC 3S1WA 3ZXWA 5L6UA 5LZLA 1AJ2A 2PN0A 2GUBA 1TR1A 3M47A 3IWPA 3MU7A 7ODCA 3PG9A 5JU6A 4AZHA 5BYWA 4C60A 4EF8A 2NLIA 1P7TB 5AC5A 4MJ2A 4JYFA 4C65A 3HGOA 1G1YA 1RJPA 2FMNA 3IGUA 5CJ5A 4S3BA 4AW7A 1Q6FA 4OIFA 3W1PA 2FTYA 1VFSA 3SJ3A 1X39A 1FX6A 3DAQA 1I8JA 3QYQA 1YLVA 5KINA 4DRIA 2ZIDA 5D09A 3EDJA 5HJLA 3AALA 1GQNA 3P2VA 5DMYA 4UTTC 1TV3A 2YZRA 3M43A 1GW9A 3UQNA 2ZE3A 2ZX6A 2I14A 1DTNA 1EZWA 2EPMX 4KCWA 3F7JA 3OQ8A 4C1LA 4XIAA 4PULA 4UTWA 1V77A 3VNKA 4GE8A 3AIEA 3VNDA 2AMGA 2RURA 1HZYA 3LCLA 3UZJA 4ZGYA 4C6BA 1MWOA 5LNVA 2QF7A 2JE8A 3V5OA 5JUVA 3IAQA 2YA1A 2CITA 3W00A 4Q8MA 1TVPA 1EBGA 4RE3A 3NQBA 4DJDC 5DFAA 3W86A 1JI2A 1U33A 4Q8TA 1S38A 3VINA 3EWUA 4Z42C 2A3BA 1J0HA 1S3HA 2Z00A 3A9IA 4NXKA 2FVMA 5G1YA 3VKKA 3W7GA 1CB7B 3U2OA 1WB0A 1QATA 3QMTA 3G24A 4GVFA 3CJPA 1Q6RA 1R87A 2FZ8A 3ICJA 3PZVA 1ZRQA 3REQB 4UTTA 4BJHA 4CNUA 3PJXA 3WDPP 1XV8A 2V67A 1R3WA 4AIOA 4P7RA 4I9AA 2PFHA 3DHUA 1DE6A 4Q4SA 4U84A 2HPIA 3GZ3A 4O16A 1BWLA 1KFKA 3KFTA 3WQGA 3GC5A 1PVNA 3I7SA 4NAEB 1PS9A 1H2JA 3LBCA 4BEUA 4QJ1A 4FOKA 1ESWA 2XH2A 2C7FA 3N9SA 1YE6A 1OX6A 2DIKA 3FY1A 5C2XA 4LRTA 1FWFC 1VP5A 4DJDA 1VBRA 3U9IA 1A7XA 1AK5A 5AHLA 1DJGA 2ZX5A 3MYOA 3WJXA 3C4UA 3K4AA 4QP0A 2VEGA 1LJYA 3CHEA 5FJPA 4DB7A 2Z24A 1R0MA 5F4XA 3TWBA 3GKFA 3EMZA 3NA8A 2J7DA 2CLHA 4O19A 1UMYA 4H9MA 3AO0A 3TAOA 4NP7A 5ABHA 1P7TA 2R82A 3OW1A 4OBTA 5LNSA 1AD4A 1V6XA 4JFTA 1HO4A 3EEZA 3HTWA 3BAXA 2JFEX 2CLOA 4H9XA 3S2CA 2XWDA 4IPPA 2JKPA 4ONVA 3ARTA 1A5SA 4WK9A 1E4LA 2FJKA 3N6QA 3L4WA 1E9LA 2EKCA 4LVBA 2VP8A 3N2BA 2AKZA 3OYXA 2ZICA 2JEQA 2Q3OA 1WBJA 3BLKA 1H5YA 4IGHA 1GVFA 3FGCB 3SRFA 3UVIA 5F2LA 4XZHA 3WN6A 2GGGA 1DEDA 2OZTA 2BX7A 2ZRXA 1O5RA 3GU9A 3L66A 4IQ2A 4PBGA 2Q09A 1AQFA 1R9HA 1MRAA 3QGKC 4N9CA 3UXIA 4PRRA 4DJDD 2E40A 4LYQA 3Q2DA 2WVUA 2X40A 4QTGA 4XVDA 3W84A 3R94A 1T41A 4LAZA 4J4KA 4RPQA 9CGTA 3CV2A 5GQBA 5A8NA 2BOFX 5C70A 4BQ4A 3THAA 3ARPA 3L67A 2L2SA 3LS9A 1E0TA 1JR1A 1MQQA 1Q6DA 3E2RA 1QPOA 1UA3A 5EMUA 1UR0A 3REQA 2J75A 1F8AB 4PBFA 1LQ2A 4LY8A 3T09A 4X3ZA 5D2YA 3NPUA 3URQA 6XIMA 2ZUWA 5F2IA 1H49A 5GNXA 2Y0FA 5LNUA 4XWUA 1DIOA 2Q71A 3TXVA 2BLEA 2VZSA 4R27A 2R1LA 1VR6A 3LEPA 1GK8A 4B16A 2OXNA 4NAEA 5IM51 2Q8ZA 2A7NA 1IE7C 2FDMA 1VIZA 2I1OA 4LB3A 8RUCA 5K9CA 4N6EA 4Q6XA 1FP8A 1XBZA 4FPSA 4JAWA 1TX2A 2PURA 3U4FA 3B9AA 1J10A 4DRHA 1KRAC 4BQ2A 3BAJA 1QOQA 3GW3A 4AX6A 4B5XA 3AWNA 2PTDA 3WL0A 3N14A 3IGSA 1PWLA 2QDGA 1KFLA 3N2OA 4NIRA 1NDYA 1QPLA 4GY0A 3G1RA 3VK5A 1QI4A 3FS2A 3TWAA 3O16A 5A6KA 1Q6HA 5K2ZA 1HL9A 3W28A 3FOKA 1S2AA 3S1VA 3TW7A 3W2MA 2PP0A 3ZR6A 3FGCA 3UYIA 1XRVA 5AHMA 2DSKA 3F2CA 5TF0A 2I5GA 4QS6A 4TNSA 2J24A 2JZVA 5AYYA 3AS2A 1LRQA 3B0VC 4WF7A 2YXGA 3EA2A 1XKJA 5C2GA 2IKJA 4PSRA 1WDSA 4O0QA 2X41A 3RFWA 5CXPA 1A80A 2PP3A 4ZQOA 2YL8A 4ZFCA 3SGGA 4GXWA 1KGXA 2E9BA 1OIMA 3IK2A 4EPDC 3GTYX 1MQRA 4MB3A 5GPGA 4H9UA 4DRMA 5E1QA 5GJPA 4JYSA 3NIYA 3LQGA 3I6RA 1A5UA 2ZADA 3RAOA 2VC6A 3MUIA 1M9HA 2RUQA 4FR1A 1G7VA 3ABQA 3LHWA 1LT7A 2PDLA 1FKXA 3B8TA 2GJRA 2OGJA 3O0FA 3TP4A 3QPYA 3FVMA 4U4MA 1EIBA 2FKEA 4PMDA 3WLHA 3BMVA 1K9TA 1Q6GA 1A50A 1Q3NA 1XLJA 1I45A 3ZVIA 3VE9A 3CGNA 4L4LA 1KXTA 4R7WA 1VCFA 4B92A 1VBHA 4TW6A 4FMVA 3RR4A 3U2ZA 3JUGA 2PBGA 1PSCA 4P61A 1KWGA 5HMDA 4GG9A 4DUWA 4XZIA 3V18A 1Z9AA 2ZUSA 2F8QA 1JG9A 1J5TA 4D8ZA 4GQ0A 3JW7A 2BHUA 4GLEA 3BGAA 1Q2RA 2PDCA 3A4AA 1SJDA 1R38A 3C2EA 4W5UA 1K8YA 5KEZA 1SFSA 1US3A 4LBUA 4F40A 4UMAA 5KMYA 5CC6A 2OO0A 2HMCA 2VEMA 1AW1A 3BQ5A 4AWUA 4O1FA 5BOOA 1FWRA 2EPNA 3GG7A 1R5YA 1UD4A 1TWZA 2CPUA 2CEQA 4OKDA 1AJZA 3WLLA 4AZCB 4GBDA 3QVQA 3VOHA 2PDPA 3NDYA 1O6IA 1K77A 4DO6A 3B9DA 3U2CA 3GNXA 4WIWA 3KZSA 2V5JA 1IYXA 5A2BA 2YSWA 3C8FA 3GSMA 3AYVA 2FZ9A 4C6QA 3EPOA 1OFPA 4P7NA 3VMOA 1UH4A 3HM7A 4AY7A 4DF0A 3LI0A 5HMEA 3W7DA 2A4AA 1E5JA 1AMYA 4F0HA 3V36A 4CU7A 5D2VA 3VM7A 4JFMA 1W56A 2PUZA 3UR7A 2FZDA 1JF5A 3MSRA 2V2DA 4DPPA 4O18A 3ANUA 1W37A 3I10A 2Y1HA 1P0BA 4Z2LA 1QI3A 3AIQA 4AWSA 1RV8A 1UKOA 2WC7A 3ARWA 4RDYA 4RUBA 1UOKA 3SCPA 2YCLB 5K4ZA 3W01A 4NZCA 4ODNA 1B4EA 4FOJA 2OFJA 2VOMA 1W3KA 2DZWA 4YVVA 1JI1A 2J9ZA 1CNVA 3TC6A 1OIFA 3KZPA 4NT0A 3H6OA 3ITOA 2JQXA 4K2SA 4OBRA 2CCRA 5I5RA 3OIXA 3MI2A 1MYRA 3TYDA 3FAPA 3L0KA 2YDRA 3GNOA 4Y9PA 5HT1A 5M3WA 1BTMA 2OU4A 4IG2A 5D30A 1BVNP 2XP4A 1NWTA 4F0RA 5HWBA 3RK8A 4FOUA 4V2XA 3C56A 4UBPC 5HKGA 3TCZA 3THQA 4WRHA 1MNSA 4FAPA 1DKWA 3CGTA 3MMTA 1YBQB 4CVWA 1FJDA 4AMCA 1PE1A 3GZAA 4WXYA 4JY9A 4H9VA 2P1FA 1OK6A 3U3HA 3CTTA 4J28A 1T5AA 5H8UA 3VCRA 3ZT6A 4DPQA 4H8VA 4YYFA 1UQYA 4ZBCA 1G5AA 1W5PA 4Z1YA 1SFTA 5H8PA 3C0QA 3NQCA 2DSWA 3QW4B 2GSJA 4O10A 1TPWA 2ZOXA 2DUZA 1ADOA 3BLIA 3IGXA 4MJ4A 1F61A 3ALFA 1G67A 3OGSA 4ZO9A 4UOZA 3W25A 4AZCA 5E70A 3UWYA 4XBSA 3KABA 5HBFA 1VB9A 1KRMA 2WW5A 3K8MA 1F3WA 4FIRA 1VEMA 3LLFA 3LTPA 3DFOA 3BSHA 3S42A 2R1PA 1XLMA 2QV5A 4I3GA 3VXGA 1FCBA 1TX0A 3CPUA 2XZ9A 1FKGA 3HPFA 3GU2A 4M29A 2ZRYA 5AY7A 4MNLA 3WH6A 3R0DA 3KBJA 4M6VA 3DBNA 1KTBA 5RUBA 4W9QA 4J4OA 1TV8A 1C9DA 3SCVA 1R3SA 2P8CA 2VCAA 4ATLA 2CHNA 1PDYA 2HXTA 4JEQA 2PU1A 2VR5A 1SMDA 4JFSA 3G1VA 1EH9A 2ZUVA 2PLMA 3RPTA 2W4XA 1VFOA 2VHLA 1FCVA 1SFLA 3CIXA 1M3UA 4WOQA 4I9TA 5JXQA 4C5YA 3FAWA 3UCCA 3MWCA 3NQ2A 4FNQA 4HPNA 5C7VA 1EOKA 1FCQA 3D3AA 3P60A 3S0CA 2UZ5A 4PMVA 3UCDA 3NEHA 2QJNA 2NQ9A 3VDBA 4GY1A 1BYCA 2P3ZA 4PMYA 1J11A 1OB0A 3SQLA 3DGRA 3H24A 4D72A 5CJMA 1XG4A 3EZ4A 4LOCA 3VCCA 4A8LA 1ECQA 1FWNA 3DKLA 2Z28A 1DWGM 1YBQA 3GG1A 4HOWA 4RZ5A 2ASHA 1I2NA 4GYFA 2QDEA 1Z44A 1UD8A 4K1GA 3TH6A 4CEUC 2VR4A 2NW0A 3W7LA 4HBEA 4AMAA 4B9ZA 5M17A 4NYYA 4CD4A 4M0XA 4A3HA 3GXNA 2NT1A 1S39A 3CNYA 3WNPA 4NRRA 3MSGA 2E6FA 3AIRA 3D47A 1EHAA 2QDDA 5GJMA 1C90A 3CQHA 1CTNA 4WOZA 1PIFA 4LCSA 3C61A 4I6KA 3DN5A 3CZLA 3UZYA 4TX0A 5GPRA 2F6UA 1E0WA 1B2YA 1OG6A 4KWOA 3P61A 2VC9A 4XTDA 1RCOB 5FAGA 4K6AA 3FEQA 4R88A 1ZJIA 1JDDA 3FYOA 3GO2A 4ZQMA 4R9OA 3ITVA 4R33A 1JZ8A 4IX2A 4DYJA 2B0MA 3DESA 3K4DA 3LHYA 5CAKA 3HPAA 1HJQA 1E40A 4IMCA 3G22A 2BDQA 4UQEA 1XINA 1UR2A 3S6TA 1FUYA 1UUMA 3W3OA 4LV9A 4C1KA 4Q7IA 2GVEA 1HXJA 3VGGA 1XIHA 2AQVA 4WD0A 1CENA 2PRHA 1R3VA 2XHYA 4DBSA 1GPFA 2NV1A 3QQ0A 3TONA 3TNBA 1EQCA 3IEBA 2B5UB 1PYMA 4G1NA 3QY6A 4NASA 4J1OA 4HHLA 1S1RA 3QOMA 1SVDA 2DZSA 1WBHA 3C86A 3W7IA 1XWYA 4PUJA 3WDRA 3EDDA 1FH8A 1FDYA 5U7SA 3FXGA 2Z4GA 4M5PA 4ZE4A 4Z08A 2VR2A 3V16A 1Z7AA 3A23A 2XIBA 3VKBA 4H8NA 2Q5AA 3U7BA 3BCJA 2REQB 2EKGA 4Q4RA 2OLSA 5PTDA 3S1UA 4X60A 4MGVA 3QC0A 2DG9A 2ZQSA 5FEXA 3GVGA 4GI6A 1D3GA 2HK0A 4B3ZA 2O7SA 3D46A 3SADA 4Z1AA 2XINA 1QI5A 3NQ6A 3OQEA 4JTGA 1DWHM 1NMVA 1HG3A 1K03A 2BHZA 3AMDA 3KTSA 1VH7A 2G8ZA 1FWAC 4CD8A 3O5JA 1DOSA 2YW4A 1BG9A 4F0LA 3PZUA 2F6KA 4XISA 2OEMA 4S3EA 2E67A 3JS3A 4QROA 2E68A 4GA8A 4WJEA 3GIPA 4UR9A 5H2ZA 3TYUA 4YNGA 2WB5A 1NOUA 1P6CA 3MYPA 1ZBVA 2QCEA 2ZR4A 1A5KC 3RPMA 1YNYA 3J7HA 3ERPA 4U3CA 2D9FA 4K37A 3O5IA 4HQVA 2BFGA 1KM0A 3B9EA 3KOZA 1XUUA 3M44A 3PSWA 4TXEA 3WQCA 1EPXA 3NGFA 1YXCA 2XP3A 3KUMA 3WNMA 1KCKA 1WP6A 1EDTA 2C0AA 3W27A 3VU2A 4L9XA 5IFPA 4MSSA 4XG1A 3T2PA 2FH6A 1BFNA 1BPLB 7CGTA 4ZQCA 4B4FA 4QXIA 1H1ZA 4J9JA 3CWNA 2BXVA 2VGBA 3CPRA 3LXAA 1JZ6A 4D6JA 2M2AA 4GUHA 1CBGA 4M19A 4JTTA 3VGDA 1JUKA 2WMGA 1UYQA 2ZZ7A 3S5SA 5H91A 1GHSA 3THDA 1OADA 4HPJA 2GGJA 4CGTA 2LLEA 1QJWA 4HMNA 4RNIA 1AODA 3EB3A 3ABZA 4MHBA 5DO2A 1FH7A 4J4NA 2EJAA 1ZBWA 2UY2A 3LCFA 2FHBA 3GB6A 1VLWA 1EJXC 4KS0A 3PPGA 2ZFAA 2DH2A 4Z1DA 1XC6A 3CT7A 2BNJA 3S5ZA 3TMLA 2CLEA 2A6LA 2Z2AA 4MNJA 3AQUA 2REQA 1G4TA 1CPUA 1Z3NA 3NL2A 1LBMA 3BDKA 1QHPA 4MYXA 4QIUA 1EEPA 1TZZA 1C3FA 1XIIA 4MUZA 3SY1A 5A3HA 1N55A 2GYIA 5CSUA 2BOGX 4MFDA 4UQCA 2DJXA 3WFZA 1GVQA 2HSAA 3OPSA 4CQDA 2ZA3A 5I3FA 3WBXA 3TTOA 2ZWZA 3HV9A 4E2BA 2TYSA 3O6AA 3SQMA 1U83A 1JVNA 3ARYA 1DQUA 3UZXA 2FHCA 2RGMA 3MW7A 1J6YA 1UJQA 4NAFB 4MLRA 5C6MA 2WSKA 4HNOA 2FIQA 2V0TA 4LY4A 3L4VA 4UFKA 2FB2A 3GDLA 3FA5A 2YGYA 4KRTA 2GVJA 3MUY1 3PNUA 3AU6A 3NZ1A 2H3DA 3PBVA 2OWCA 3MKKA 1A5BA 3N25A 3NQAA 2CLLA 4JL1A 5DQPA 4O54A 2XFFA 4UCGA 3HG5A 4JS3A 1RK6A 4K38A 5CAHA 1C8QA 3ITTA 4D6HA 1EC9A 3F4WA 2HNEA 1CEOA 4GQRA 2CNCA 4U2YA 2EULA 1E51A 3FKRA 2ZUTA 3PBWA 4XSMA 1PX8A 4UZSA 1OCJA 2VDHA 3UW6A 3GG8A 1V3LA 1C93A 2OYMA 3QMSA 2EPOA 4FEZA 1IEQA 2XIQA 5CPSA 2WSYA 1C29A 3T2OA 4KKXA 1KV5A 5A2CA 2YB4A 2YCEA 4R3UA 1QPNA 5GVJA 4KEVA 3UETA 5D05A 3FNDA 4AD0A 3HURA 1IWBA 3LPOA 4YTTA 3II1A 4MKNA 3PJTA 2EJ1A 3FIGA 1VPXA 2QCCA 1JGMA 1EO7A 3OEXA 3VIGA 4B3LA 1YATA 3U5UA 2QMKA 2WBGA 4GVHA 3CB8A 4HZ6A 4Q7NA 3LSCA 3TN6A 3S47A 4OWGA 4RPPA 4MY1A 1F6KA 2QS8A 1V0NA 3TOYA 2QR6A 1ZQ5A 3EPMA 3T40A 1DE5A 1W9PA 2YXOA 1GT8A 1JCNA 3L65A 1GVRA 2J78A 1QNSA 4A29A 1ONXA 4E2DA 1GOWA 2HJPA 3WK1A 4AWTA 4R34A 2A1YA 1AZ2A 3CAVA 3S5YA 2Z6IA 3WELA 3PAOA 4HB7A 3ONBA 4KCUA 4BI5A 1KFWA 4HPGA 2F2KA 1BSIA 4J27A 2E09A 1XDLA 5EMJA 3N6JA 2KGJA 1R7AA 3QY7A 4K1WA 1D3HA 4DBEA 2JIEA 1EDGA 4TX8A 1I6NA 1UW9A 2WBKA 4GACA 5BNKA 1VS1A 4PUMA 5F1VA 2P76A 2QZRA 3CUXA 2NQZA 1JGIA 2FPYA 2XN2A 3GRIA 4J3ZA 3OLEA 6TIMA 2Z29A 3OIHA 4L5ZA 3LY0A 2DUAA 2WM0A 1S5WA 3UT0A 3B8UA 3GXIA 5TNVA 4GNJA 1AMKA 4Q8PA 1T40A 4UCFA 5BXRA 2PGEA 4IUOA 4OGZA 2OKTA 4JICA 3RF9A 1RVKA 3VPLA 1BVZA 3PWIA 3O15A 3RM9A 4EOUA 4HNLA 3SBFA 3BOFA 1I75A 1XKYA 3PZTA 5SWUA 2O4QA 1S2UA 3ZSSA 2G50A 4JGDA 4JDBA 1M6JA 3CU2A 3EGJA 3NCOA 2V81A 1KFCA 3M5XA 3FYPA 2UY3A 1RQBA 2DUXA 1Z6KA 4I5RA 2GWNA 3TNOA 2YFNA 3WENA 3TDBA 1FTXA 3S9YA 2IXUA 2QHAA 4E3VA 1XYAA 1CGWA 3U57A 3NSNA 1TFVA 4M6UA 3LG3A 2P53A 2QQ6A 4JFJA 1SJAA 3VC5A 5CJNA 3VD5A 1FWDC 3WSUA 4NQ1A 5EMMA 3E0LA 2JKAA 3GXDA 1DL3A 3OVPA 2PPNA 4JTLA 4LB4A 5IHSA 2VQTA 3RO6A 3KL5A 4JKKA 2J47A 3GE7A 2NVAA 1KFBA 3P8IA 2VC5A 1UD2A 1D7KA 1HKVA 4DROA 4UTUA 3RX3A 4WJ8A 3G0XA 2VVSA 4GH1A 3T42A 2AOSA 4IPXA 1QPRA 1XJBA 4IQDA 3UWVA 4IGMA 4BWLC 4E4UA 2XUCA 1DIDA 1OG0A 1Z32X 1V3MA 4XD4A 3AHXA 1ODUA 4DHGA 4I5XA 4GXMA 1ISZA 3R43A 3RU6A 1T6MA 4JQ1A 3U4AA 3QR3A 1Y5XA 3BG3A 4EPEC 4FXFA 3HA1A 2OLAA 1QXLA 2Z26A 1GOOA 5T91A 3MUZ1 2ITKA 4OUIA 4E0CA 1DWIM 2R91A 2ZUNA 3IUDA 1CIUA 1H62A 3EWDA 1FWHC 1GG1A 3VVGA 4TVCA 4HJFA 3DG6A 4MMWA 3EDEA 2DORA 4DXXA 4O2TA 3CIVA 4NHVA 3UR2A 4BWLA 4W9OA 5FI8A 4C6IA 1GG0A 5CPOA 3WLOA 3PR2A 1E71M 3M0VA 2WJFA 1SZGA 3HJEA 2CLIA 4HNVA 1QNVA 4HSOA 4KRZA 2BY1A 4YTQA 1ZBCA 3MANA 5A6BA 1J2WA 3NR0A 3MT1A 4WSHA 1SJCA 3IJ9A 5AVHA 4RXFA 5BU6A 2PLJA 1J8VA 1GQJA 2PA6A 4A8NA 2DSVA 2DGAA 3GDTA 1PXGA 1WA3A 5D38A 2XFYA 3RPDA 2OB3A 4KETA 3O5QA 3LM3A 4PCFA 1AL7A 3ITGA 1CXHA 3WD2A 3GG0A 1PIIA 1XH0A 1K02A 1TA3B 4DYKA 4RNHA 2QYGA 1EX5A 3GC4A 4U5KA 3MDWA 1FH9A 3ZYZA 4PCTA 3VE7A 3OP2A 2DIEA 3LMYA 3JYMA 5CSSA 3BV4A 2OKOA 2FLIA 4Z2GA 1EJRC 3CPGA 3GAKA 2O9OA 4IT4A 2P4VA 3TAKA 4FB7A 4LRSA 4RE2A 3KRSA 3F2BA 1TG7A 1EXBA 5B8IC 1NDVA 5KZ6A 4BA0A 4AVNA 3SECA 4L9YA 3W7QA 1FKJA 3H4GA 3KRUA 3E74A 3W85A 3VOGA 5I6SA 2OCZA 3WQOA 1R30A 5CC3A 1F76A 1NY1A 5CPQA 1XLFA 2XIJA 2PI6A 4LAMA 4HU3A 3V7PA 1KQZA 2Y70A 1J0ZA 4UTJA 4ITZA 7PTDA 3CQ0A 2R94A 3VIOA 5AYZA 3GH5A 3G6MA 2XP6A 2FHFA 1WZAA 3OLGA 3W7OA 3OO2A 4DI9A 1I2RA 2BVDA 3VIPA 3DH7A 5JQ9A 3SW6A 3EWXA 1EYEA 3R89A 4U33A 1DORA 3AMLA 1R9ZA 1J2BA 4IFKB 2J7BA 3EWWA 2WJEA 4J3TA 4JTSA 3W74A 1KCLA 1JDEA 2X16A 4J3SA 1JNEA 2FAPA 1OM0A 1PB0A 4S23A 3ECQA 5I00A 2VURA 3LU2A 3N04A 4U10A 1FBAA 1RPXA 4ZOEA 3WD4A 3MI3A 4M82A 4ATDA 1LP6A 1GOKA 1ZNNA 3GTHA 4PYSA 4GZ7A 3BOXA 2UY5A 2DW6A 2OJPA 3MKCA 1NFPA 1WXZA 4EANA 6TAAA 4DWDA 1BAGA 3U48A 3A3HA 4M51A 3MCOA 3SURA 2HS6A 2BY3A 4JTCA 3TYBA 4ORMA 2K8IA 1H60A 3MZ2A 3MO7A 3SFWA 1HKJA 3XISA 4I7UA 3MCNA 5BW6A 2PDHA 3QSTA 3MC5A 3IVTA 3LQLA 3IANA 2AKMA 4H3DA 1TA3A 4DF2A 3PBYA 3VKJA 1LDCA 3RG6A 2Z1BA 4PBEA 1R7OA 4AWEA 1HVQA 1MEIA 2PRLA 1R2RA 3GXPA 4HD5A 4N7QA 1YW1A 3H26A 3CWHA 1NP0A 3LHVA 5LIWX 2YBVA 3T08A 5HANA 4S2BA 2PD9A 2PDIA 4MB5A 1BG4A 2IPWA 1IZKA 2PPOA 4GGBA 3ZLHA 5HW7A 3NOYA 3MHGA 2XFRA 3SUSA 4UTLA 1B3VA 1T8XA 5K3VA 4ENLA 3VZYA 2BVYA 1F05A 4JXCA 3N9RA 1KM1A 4Y96A 5LIXX 1FHDA 3V1HA 2O7QA 3QN3A 3GD6A 3UCQA 3AXIA 3N19B 1GZGA 1K7FA 3A3WA 2FVKA 1NVMA 3WF4A 3E6EA 4IFKA 1DJHA 3M0ZA 4GKTA 3IJ8A 1H0IA 1WOBA 2CXGA 3B4UA 1R85A 1TSIA 2PWVA 1QNRA 1CLXA 3WBWA 4DAIA 1ISVA 3AROA 4DWSB 1QW8A 2DVXA 1HGYA 1UPMB 3GH4A 1JNDA 3LTSA 2WQPA 5JVLA 3H2FA 3KCLA 4TVUA 1K9DA 4M6PA 1JYWA 3PFRA 5JH2A 4ZQPA 4A35A 4AH7A 3VYLA 4M6QA 3P62A 2RDUA 4IQLA 1AQ0A 4QZVB 2I5IA 4DBDA 3NRKA 3K30A 2PDUA 5CGQA 3TEVA 2WMJA 1EBHA 2H3BA 4AIBA 4H6RA 3LD5A 2C15A 3STCA 4X0VA 5AFDA 4IHCA 1UC4A 1RCXB 2UY4A 1TPUA 3N3TA 4Q4KA 1BHGA 4U85A 2Q01A 1JPMA 3S5OA 4PB5A 2F2DA 3H53A 2HRWA 3PC0A 1JULA 1XGZA 3G1XA 4F2UA 4OT7A 3LGEA 1SJBA 2WHLA 1KW1A 3F4NA 4QG8A 2QLYA 3M6DA 1XLCA 1QK0A 4ZFMA 4LYRA 1L6WA 3BAYA 3LK6A 1RP8A 4MAVA 1JCYA 2XFWA 1RBOB 3QF0A 1ZJHA 2VZVA 4LEFA 4JYDA 1O66A 4LAYA 2KX9A 4NNAA 1PTAA 3VGHA 3W70A 3ANVA 3QC3A 1K4GA 6REQB 1CXLA 1QWKA 2PS2A 4NJKA 1K9FA 4BCEA 1KRCC 3QQWA 4NVTA 4N02A 7XIMA 3GQYA 1JDFA 3O0KA 3L2LA 5C2CA 2F2HA 4WHBA 3OA3A 1VLIA 3ZVHB 4I9MA 3EIPA 2PAJA 1N8FA 1OYBA 3NSXA 3QTGA 4JTDA 4BHYA 1A53A 3KADA 3W2UA 4JEJA 2GGEA 4DVOA 3MUAA 1DHPA 3WLQA 3WLSA 4BKNA 5FF3A 3E0FA 3ARVA 2JEPA 4H00A 2YYUA 3LCHA 4MKVA 1IF2A 1XR2A 2W61A 2CBVA 3TN4A 1ZY9A 1FWJC 1XLDA 3WLIA 3HFTA 2IF4A 5KZMA 1UOZA 3GTIA 1EF3A 3EDFA 1RPKA 2CLFA 1EUAA 8CGTA 4D1IA 3NFUA 1XW8A 3N3MA 1FKKA 2WOQA 4JQ4A 1IR1A 4QE4A 3PRAA 3N29A 3VAVA 5LSMA 1G4SA 4XZNX 2DV0A 4GYPC 2CLPA 1UR3M 2ZE0A 1UB3A 4JHMA 2EAWA 1XLBA 3BJSA 1KQYA 1ISXA 5I3DA 3IKDA 4AEFA 3WKZA 2P3EA 2VT0A 3NEVA 4IH3A 1J79A 3P82A 1UR8A 2V5KA 4E8GA 3ITYA 4LPCA 3DIPA 3LSBA 3FJ4A 3NWRA 1E5NA 4N4PA 3UG4A 4A21A 1GW1A 4A8IA 4R7JA 1P5QA 1VFFA 5G2WA 4Q8QA 4FAMA 2YA0A 5FCZA 1AW5A 1EWEA 1VIWA 3AXXA 3H4WA 3LLDA 4QCFA 2PTZA 4A3QA 1S5MA 2EG7A 1R3QA 2W3ZA 1O12A 2G3IA 3HBLA 2FPTA 3R8GA 2XH0A 7TIMA 1H1NA 3NPVA 5C0QA 2O92A 1POKA 3FYYA 3QZEA 4JFKA 4GUFA 3STGA 3N2XA 1TTJA 4AC1X 3MHFA 4GYPA 2ACQA 4DWSD 3JVAA 3G1DA 4DJFC 3LRLA 3M46A 1ZAHA 3N11A 3PFMA 3OVQA 3WJWA 3RLVA 1FKRA 1HJWA 2OODA 1NMWA 1YTDA 5LGXA 3QR0A 4EAYA 2V38A 3TQVA 2OZ8A 1ONEA 4Z17A 4LJ3A 4MYAA 5K9DA 1W5NA 3P67A 3NURA 2VEPA 4CCDA 1VD6A 4J3UA 3CUHA 3BLOA 1V51A 3CBWA 1XBXA 4DELA 2A3EA 4DRJA 4WEVX 4KBXA 1RD6A 2G4FA 1UQZA 3W2JA 1TR9A 3KX6A 1SMAA 5T9CE 1Q8AA 2GQ9A 1XQKA 2NSXA 1YDVA 5REQB 1OFOA 1TVNA 3WUEA 4C1NB 3KWXA 5HA7A 4QGCA 3DECA 2IQ0A 3MP4A 4DJFA 4WY0B 3KVKA 3ZOAA 4WGXA 2ZX7A 3W71A 4YLWA 5A8QA 1O60A 4HMEA 4U31A 3SM0A 2J8FA 2A6NA 5DY2A 1S2VA 3T0TA 1I4NA 3B8VA 1TTPA 2BY2A 5TQLA 3W1LA 5BROA 1M68A 1W1PA 1SW3A 4DF1A 4JNZA 3HGRA 2V8ZA 1TVLA 1W1B1 2VEKA 4ADTA 3WQWA 2DQWA 4LF1A 2PTWA 3VDHA 4CQAA 1C9WA 4PMXA 4XD5A 4B91A 4TX9A 2XVLA 3BPWA 2P5NA 1GVOA 4OV9A 1CGTA 5M1TA 4IXXA 4H7CA 1GKRA 2V5BA 4G7EB 3UQIA 3E49A 2E25A 2GVGA 1VKFA 2CYGA 4K39A 4K3ZA 1TJ0A 3MCMA 2FVLA 2QULA 1EJWC 3S4TA 3IJDA 2BS9A 4US6A 5IBXC 4DBWA 3T78A 2GL5A 4QJ5B 3NQDA 3W81A 3ABXA 1ZAJA 4EXAA 4A3RA 3CMFA 3W2KA 3B0XA 1X1NA 1Q8JA 1YRRA 4POCA 3UFYA 4DJFD 4DNMA 2QVHA 1DYSA 4TMBA 4ZPWR 4Y9OA 4K8GA 2EF9A 4MIMA 5I23A 4YTRA 3BE7A 5EPDA 3PZIA 3WH0A 4KEUA 3TKFA 3ARRA 3UNTA 4IQEA 2RAGA 2XPAA 5IRPA 2Y7FA 1QPKA 4JTJA 3QKEA 2YJQA 1FWWA 4AB4A 3RMJA 2JF7A 3ATZA 3O5GA 1POJA 2NV9A 2W79A 1DV7A 3ZMRA 2Z1XA 5IBXA 3VDAA 2GDQA 4H01A 4XBKA 1R86A 3IJLA 4QLLA 4PUUA 1FAPA 3DG3A 4WR3A 4CNOA 3CUZA 2CHRA 2CHOA 4U86A 2HS8A 1DXIA 1Q6UA 2VMFA 3H9RB 2MNTA 3AOFA 1WZMA 1OCBA 2RUCA 4DRPA 3V4BA 3QMRA 1JD7A 3Q94A 4XQ6A 5HPCA 5DMNA 4AY1A 3B97A 3NJ3A 4XTIA 3A13A 4C1NA 3E02A 1VEPA 3LOTA 3GTFA 3T4CA 5BXPA 4G7FA 3SRDA 5H6HA 4A3YA 1E44A 2C14A 3IK4A 3W7NA 1L6GA 3QJAA 2RSEA 3I7RA 4JKMA 1QK2A 1OVDA 3UVAA 3W7MA 2WKJA 1OT2A 2X30A 1OCQA 5I3HA 3PA7A 1EJSC 1KBBA 3G3MA 5FKYA 3S6OA 3W38A 3GDKA 4W8BA 3EEGA 4C91A 1HX0A 3RRXA 3L5AA 5G4HC 2VD9A 3LLXA 2GJNA 2ZZ4A 3WBAA 2XP5A 2XTKA 2CW6A 3A5FA 5C9ZA 3IJ6A 1CLVA 1SO3A 4BF7A 3DC8A 3W29A 4G7EA 1P43A 3IARA 2WNWA 3HPSA 4FS9A 1A5CA 5M2FX 1NH6A 1TV4A 5E9XA 3MZNA 1W1YA 1V3IA 2TAAA 3N1AA 1QPQA 4H7ZA 2X2GA 4ZO8A 1KR1A 2WWDA 3ZO9A 1JQXA 2QAFA 3C0LA 2W6RA 4UQ9A 2FMOA 1PX3A 3KAOA 5J5RA 3N4EA 3SCWA 3B7XA 4UXDA 2XPBA 1WUFA 2HE5A 5BMWA 5HNNA 1B4KA 1W54A 1W3TA 1SW7A 1E1CB 3WFAA 3F4CA 1YYAA 1BXCA 1FCUA 3O6CA 4CN4A 4Z2JA 3AC0A 2PDGA 1GOIA 3GFZA 2QEZA 3DENA 3I6TA 5AN7A 4GYKA 3G1AA 4HARA 2VZOA 1W5MA 3L9CA 3EAUA 5KITA 1IEIA 1EOMA 3W1MA 1JD9A 1NF0A 2NZLA 5EA9A 2DJLA 2VRJA 1E9YB 5DF0A 3B8DA 4V15A 3K4WA 3SUTA 3RM8A 4MVAA 2NVCA 3MKVA 1FWGC 4X61A 3BJFA 3KZ7A 1YXDA 5HMFA 5FJJA 3VX0A 2DW7A 4NF7A 4O1AA 2QCDB 3VKCA 3SN1A 3DI0A 2MPHA 2Y8KA 4WDXA 3CYVA 4AYGA 1UD6A 4RW3A 2NQ5A 4FA3A 1J4EA 1V6UA 2V63A 3N12A 3BG5A 5D9OA 1THFD 2HNHA 2WZIA 1A5OC 5AHIA 4JCMA 3AZSA 5CG0A 1NTHA 4IQJA 1Q6CA 5FF4A 4EWND 3HQ1A 3R25A 3U7VA 4ZXOA 3ZJ8A 4GIAA 1XBYA 1U5JA 4EAMA 2PDXA 1GJUA 4IPJA 2VCCA 1BYBA 2PDQA 4HYRA 2ZBTA 4IP5A 1RR2A 3NXLA 2EXOA 1XS2A 1RVGA 4AD5A 2ZRZA 4KWUA 4M7TA 1V02A 4H6QA 4LCQA 3WD1A 2D23A 3B40A 5LIKX 4K36A 4QG6A 5DITA 3TJXA 1X8CA 3MV01 4L3NA 5HNRA 3IIXA 1RQHA 1LT8A 4E38A 4RXGA 1VJZA 1H61A 2W91A 1Q7MA 4X2PA 8XIAA 1TRDA 1RA0A 1KT0A 3CB3A 3S5NA 4G2PA 4DNHA 3UA3A 1NELA 4Z1CA 2LGOA 3TTYA 1MW0A 4H9ZA 4AZGA 3CUJA 1WZKA 4Q6JA 1NARA 2XG9A 3IHZA 2G5WA 4GQBA 4FXRA 1WDRA 4BQ5A 5CC7A 2FZNA 2G3FA 3CHDA 2VUNA 1NSGA 3I3BA 3ABSA 1E1CA 3UXDA 1Q4WA 1H7RA 3EOUA 4QG9A 2DZBA 4D71A 2J74A 1G4PA 1MO0A 1BEUA 1KR0A 2YCKX 1ZUAX 5A6JA 2WLYA 4GX8A 2PV1A 4JFVA 3TJ4A 3GVQA 5DRCA 3G8EA 3VD3A 2DFAA 4O13A 2ZXAA 5FF2A 4HK7A 3R58A 3CZEA 3KW3A 2J9YA 5FJIA 1XIMA 1SO6A 1EP1A 2EEXA 4R0XA 4RZ6A 1FHUA 2QCDA 4QDPA 1N8WA 3G8RA 1P0EA 1UH2A 5D2WA 1US0A 3CAWA 3GYEA 4MG4A 3NQFA 1Q1CA 4L80A 2POZA 2YLAA 3AICA 3CZGA 4WDTA 1YIXA 3PB2A 5FSEC 4JX6A 1EWDA 4HYWA 1PPIA 2C1IA 3ARZA 3D5HA 3TUUA 4QCEA 3WQ6A 1YNPA 1JFHA 4ODKA 3UBPC 4CNTA 4L72B 3W2NA 1IGSA 3C3NA 3MDYB 1CGUA 4E8DA 1SU5A 3L4TA 1TYGA 5EU9A 2X05A 1F2JA 1I9CB 4JHOA 4F2TA 2ICSA 3A47A 1WAWA 3N4AA 1FHLA 4PUKA 2QPSA 4XAFA 4JCLA 1IEWA 1LLOA 3TC7A 2OOGA 1JPIA 1F7BA 2WXDM 5EBAA 3GNNA 3KP0A 4NY2A 3CZJA 4F48A 3PZ9A 1FWBC 1ISYA 3RRAA 3FSUA 4ZE5A 1HFBA 1IR2A 4D9PA 2VCBA 1U1HA 2YOCA 4I5UA 4O1EA 1WX0A 4TTGA 1IQ8A 1MZRA 1ZTVA 4HN4A 4B5VA 4JTHA 5A69A 5DXYA 3PTDA 4INFA 2W5FA 1Q7ZA 4QS5A 4Q8OA 1BD0A 1DIEA 1NEYA 1S5TA 3QV8A 4ZENA 1O1HA 2ACUA 1UBSA 2DVUA 2PF8A 3G6LA 1V0MA 4IWWA 2E9LA 1WAUA 1VYSX 3FEMA 4PMUA 4W88A 3M0IA 4DN1A 5BXTA 2VN1A 2DVTA 1XD0A 3P5ZA 3ZT5A 4N9DA 4LNYA 4XB3A 5DIVA 3KL3A 5KZDA 3BOLA 1UROA 4O8RA 5AYBA 1PCWA 2G3JA 2WSQA 4MZ1A 4PMJA 4XO6A 4GUJA 2WYSA 4GO8A 3QKZA 2ACSA 5EMKA 4GH3A 5LA1A 5DRIA 4JIPA 1JYVA 1QFEA 3NDOA 3PTQA 1I2PA 1B9ZA 1O68A 3PF3A 3PBGA 3KCEA 2RUSA 4B2DA 5LKYA 1QNOA 3LX9A 3V35A 4NI3A 4QAIA 2NQHA 4RL3A 3RGCA 5A8OA 4X9SA 2A3HA 1M04A 2CFFA 2XIIA 5LHFA 4NU7A 3OZPA 2PCEA 2HPMA 1K8ZA 2BWGA 3NL5A 3W75A 1VEOA 2BXYA 3LUTA 3L68A 4HT3A 4HU8A 3CLMA 2VUYA 4C5ZA 3W26A 4EIVA 2QNEA 2OGYA 3IJ7A 4FI4A 3F1QA 3QFWA 4JTQA 4TQTA 2FTPA 4DIAA 3EKLA 1MXSA 3PR9A 5ECVA 1UR4A 3W1NA 4C7DA 1PZ2A 1ZCNA 1VCGA 2UBPC 1G01A 3NI6A 2O56A 3TMQA 3PBUA 2XVGA 3W53A 2VDIA 4A22A 5CH9A 1EC8A 1SO4A 1OY0A 3LERA 4JY8A 1EO5A 1JCMP 1CW2A 4AIEA 1E9IA 4KT2A 3BLPX 3RLUA 3RMEA 4YVPA 2XH4A 1HTIA 1XH1A 2PPPA 4MSPA 3LZ5A 4AVFA 2LPVA 3APYA 4UMCA 4HMCA 1FWIC 3CO4A 4WSJA 1RBLA 1KM2A 5B7ZA 3UQBA 1OFAA 2WVTA 4D6FA 1OZQA 4IJBA 3CZKA 2I5QA 5HAOA 2Z1SA 4XBJA 5I3IA 3DCPA 2MUCA 3N17A 2XM2A 4TOQA 4TYOA 3S46A 3HIJA 4O4VA 4UTIA 3VMPA 4BY3A 3MUCA 5A8GA 3PUEA 2E1WA 2OMAA 2ISWA 4FO4A 4J3VA 4UFIA 2PV3A 4RE0A 2H9AB 2NUWA 2ZVRA 2DEPA 1UKSA 3CV6A 2PGWA 1TZ7A 6CGTA 4YTSA 3W6LA 4UFLA 1YXYA 3LPPA 4QRNA 4RV3A 5EFFA 1IXOA 2YDSA 3WLNA 2RFGA 5E6YA 1WKFA 2J13A 4PB3A 1HVXA 1S46A 3OZMA 4DO7A 1D7JA 2YCJA 2R1MA 4IF2A 2X42A 5BXSA 6PTDA 1SW0A 5CQ1A 2PPGA 1Y8BA 3GHUA 3N9KA 4M81A 1DJIA 1XYCA 2GJLA 2RDXA 4CU6A 4EPBC 5AECA 1Q63A 1UKTA 3NZQA 2I9EA 4QE5A 2CWNA 3B8IA 2WZTA 5DXXA 1XIGA 1TV7A 3TA9A 3UEQA 4HHPA 2PWHA 5C9UA 1B90A 3CYJA 4ZEPA 4ADSA 2FKPA 1VGAA 1JPHA 3OZYA 1AQHA 3CAKA 3BH4A 4OOZA 2C18A 4OU1A 3STEA 4DO5A 3OODA 3MBFA 4HZ7A 2AL1A 3QHMA 1IZJA 2D20A 4Q4PA 4S3CA 3NYDA 3UG8A 4RW5A 4W9PA 5EL1A 4C6EA 5C54A 3M0LA 2OQYA 4PMNA 1C7TA 3F5LA 1W1TA 4PB4A 4HHHA 1Q5MA 1L6FA 2R1NA 4UNKA 2YBTA 2ZRWA 3CHVA 1W3HA 3AAMA 1R47A 1R6WA 4MY8A 3KCOA 3MJYA 2YDAA 4CKQA 3WQ8A 4GVIA 5AHNA 3VIKA 1VAHA 5E6ZA 5A6AA 1W1IE 3E5BA 3EBVA 2VEFA 3NL3A 3NO1A 3SSZA 3WF3A 1CXIA 3QHOA 4AC7C 5J6EA 2XP8A 4W5ZA 1X7IA 1PEZA 2D0HA 2NLYA 1F9CA 2VKZG 2OSYA 2VDGA 3BC9A 3M41A 4O1CA 3E0IA 4KCTA 5I2UA 2NUYA 5D02A 2YXXA 1UCWA 1BXBA 4ZODA 1OK4A 1IGWA 3NO5A 3QHNA 1GNXA 1WNOA 4QR6A 3OG2A 4O1BA 3W0KA 3U6WA 4X0NA 2H9AA 2JKEA 4UQDA 3KBNA 2Y89A 3KACA 3B4YA 3IAPA 3HQOA 2PWFA 2BOEX 1ITQA 1E15A 3QXBA 3HMJG 4AFYA 4GRSA 3WLPA 3RITA 4P7LA 3MUXA 3AYTA 3E38A 4P8UA 4M1RA 2INZA 4ADUA 5AB3A 1TQJA 1KKOA 1O4UA 1R2SA 4JN8A 5DT5A 3VTRA 1XLGA 1V03A 4LAOA 4W87A 3VZZA 5HR6A 1ELSA 4LUSB 4FF7A 3WL1A 2ZQVA 4FXJA 1W0MA 1Z89A 1TREA 3T05A 1H1YA 1GHRA 3MI6A 3RM4A 1LWHA 2BZNA 1QU4A 3B0UX 4J7RA 1KV8A 2FGZA 1H7PA 4RCXA 1E6XM 3RJXA 1X6LA 3VOFA 4DM2A 4AX7A 4UNLA 2CKRA 1JCHB 3EX1A 3M0MA 3FXYA 1H11A 3GVRA 4CD5A 3BCDA 3OA5A 1ADDA 2E28A 3EMCA 3H70A 1DWAM 4MPKA 1GKPA 1J4HA 4LBRA 5L9FA 1L8PA 2A7RA 4IIFA 4AZ6A 3WK3A 1BKSA 3S2NA 1QBAA 3V5CA 1Q6LA 3DDMA 4W89A 2X1IA 2SFPA 2WWCA 1EKOA 1SZFA 1AFSA 2WQDA 5U4NA 1P4CA 2J27A 3QLDA 1J12A 4RNFA 1V79A 1O7AA 2NSOA 1W8GA 4EWJA 1KM6A 2BGSA 3OBEA 1H09A 3NZRA 3JZUA 1H5VA 2A85A 3K8KA 2VGGA 3IJIA 4GABA 5FJOA 2PDWA 2ZUUA 1X8FA 3H23A 3JZEA 2YZ5A 4EXBA 3KOWA 2Y7DA 1FKFA 3K5XA 1P48A 2ZX8A 3H2AA 4NSBA 2B81A 3AJXA 2DT3A 4ZVJA 3K8LA 1DTUA 4Q8WA 2P50A 1I2QA 1OD0A 3R12A 4DRQA 3SGUA 2C3ZA 2KAUC 4FNUA 3W88A 1ZLPA 4OOUA 3WMBA 2CU0A 3DFQA 2RJGA 4NNCA 1JDAA 7ENLA 1LLWA 1A49A 2QW5A 1JIBA 4HSNA 1O5KA 1V3HA 3HO8A 1Q6QA 2ZUMA 1T11A 4AQLA 1F3EA 1ONWA 2NVDA 4UFJA 2F6XA 1VBJA 3KLKA 1E1EA 2OZ3A 1TIMA 1RHCA 3M5ZA 4C7GA 4M7SA 1V7YA 3W7EA 4H41A 4TV5A 2HVMA 3RLGA 3B04A 2AAMA 1TRIA 2NX1A 2XSXA 4IG2B 1E70M 1C7SA 4LUSA 4LVGA 4ASTA 3CZ8A 1LF1A 3UI4A 4UR8A 1BYAA 1P5BA 4H19A 3GFXA 1XGDA 4XUGA 3TVAA 3ARSA 1JFXA 1YTKA 1K7EA 3FA3A 3UR8A 4X63A 4LH8A 4F0KA 1EGVA 1GQKA 2GGHA 4MTVA 3WQEA 2Q8LA 4UMBA 3Q4DA 3W1QA 1TWSA 3VOCA 1W9BM 2J77A 4NZJA 4XAYA 1J93A 2V68A 3H12A 3H2EA 1GZJA 3BSMA 5G1TA 1E6NA 3ZWTA 4FN2A 3DFTA 4Z2KA 3GTXA 1MDLA 3A4WA 2GQAA 1OC6A 5DANA 4DH0A 4LUYA 2JGQA 1VFHA 4TW8A 2YIHA 4L56A 1ZZMA 3DG7A 4AU0A 1CXEA 5BRBA 2WMHA 4O15A 3CV7A 3F2DA 3EDKA 5HK4A 2WSRA 2ZXDA 4EACA 3ITLA 4DUXA 3GWQA 3JU2A 1EGZA 2GZXA 1X98A 2KI3A 1ADSA 2XIOA 1E3ZA 1E6SM 5LXXA 2JBMA 4FNSA 3VD7A 4OECA 2W92A 3OGRA 1LWIA 3S1XA 1RP9A 4IIGA 2YCIX 1LM1A 1YADA 2DIJA 3PHAA 4AD1A 4IISA 3PZGA 5MF5A 3L12A 4LYPA 4OVXA 3LA4A 3PRBA 2G4JA 3KDNA 1ZAIA 2X1RA 1VFTA 2WVSA 3SGZA 4DZHA 2MANA 1ZALA 1LL7A 1LZOA 2HZGA 1VJSA 2QAPA 2ON3A 2QIIA 3GXFA 4B5SA 3VKAA 4QDWA 2WNQA 3GR4A 4Z0SA 1C91A 2ZA2A 2NXGA 3H8AA 3L2MA 1SQ7A 4PUWA 4GFIA 2WJDA 4XUYA 2WSPA 2ISDA 2G96A 3EOOA 3MVIA 2FJUB 1OX5A 3ENLA 3SR7A 4I8DA 3W6YA 4O11A 3H7UA 1RY8A 1GOQA 4L6OA 4I90A 3G18A 3KOXA 1XFCA 3O06A 1SZNA 5ECUA 1R46A 2E9MA 4JX5A 4U5IA 3RR1A 5AYIA 5DN1A 1KC7A 2MF9A 2YW3A 4ZS6A 1JCTA 2G95A 1JZ2A 4Q7BA 4DZ3A 3APGA 2AMXA 3FJLA 3KAFA 3KTXA 4QM1A 2QCMA 3VNYA 4QLKA 1CLKA 4QJ4B 3AWOA 5EB8A 3T8LA 1IT8A 1OJXA 2G97A 2GSEA 4Q4MA 4ZL1A 4AAJA 3U5YA 5HNUA 4CQBA 3CK5A 4MOZA 4YU1A 3KEHA 3AXMA 2HWGA 1QT1A 3WIJA 4OFCA 4K8HA 1M5YA 2C91A 5F4WA 3MWAA 4P7OA 2XISA 3GM8A 4PEEA 3BW2A 2CBJA 1IT0A 3CWOX 1QASA 4G6CA 4XD6A 3EXRA 4JZ5A 1A5NC 5HXMA 2PTYA 4ODRA 5DBUA 2J7GA 4HA3A 4KQNA 4M3PA 4Q4QA 3NGJA 2DG4A 2XP7A 3A21A 1FRBA 1MUMA 1W3NA 4JIHA 3VNMA 2DPEA 1EA9C 3WZ0E 4QAWA 1SYTA 4L61A 4CN6A 2E1DA 5G2HA 3C0JA 4CNSA 3UJSA 4TO8A 3F5KA 4FX8A 1IWPA 4YHEA 1X7FA 3VX1A 1MSSA 3D6NA 1HNYA 1B3XA 4US5A 2VRQA 4KMQA 1PO9A 4JOMA 4URIA 4PRTA 3W7KA 3VUPA 4DO4A 3WD0A 2D69A 3WNKA 3RNDA 4RV8A 4TW7A 5CZ0A 2J6XA