4DWSC

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
539
structure length
526
Chain Sequence
KPTENIPSPILVEDKYTEETYSRPDVNFEDGSQGNLSYTATRVCAPMYNHYVGDKTPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKVQEVWDGWNAQAPSLGLPQIGKGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDDGENYVLLIKELRSALDSRFGYSNREISIACSGVALKKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAGHFISLDTPRTVKQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADSNQETIDMGPLYNPGEIYLKSISEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
molecule tags Sugar binding protein
molecule keywords Chi2
total genus 184
structure length 526
sequence length 539
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsC01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsC02
3OLDA 4H41A 3NSMA 3AOFA 1UWUA 1W1YA 1B3XA 1G94A 1W3JA 1B1YA 3VNZA 1FP8A 1OT1A 1OGSA 2J78A 3VGEA 2ZOXA 1GUVA 3BAIA 3MSDA 1TE1A 1CXIA 3WQ8A 3K46A 2IUZA 4HP5A 2GK1A 1CPUA 1N82A 3MUIA 2GFTA 4HU8A 2CIPA 1M04A 2UY4A 4CVWA 1WDPA 1EDTA 4ATWA 2V3EA 3AICA 1BYBA 1DHKA 1H4PA 4JCMA 3ZT5A 4XUYA 3KL0A 3MS8A 5A8NA 1QI5A 4FLQA 4TTGA 3KL3A 4ACYA 1KBKA 3WN6A 1E4MM 3PZQA 1US3A 1HJQA 3CUJA 3W28A 2EPNA 1Q6CA 2O9TA 3BAWA 4TVDA 2CBVA 5IHSA 2OYKA 4M80A 2JE8A 3UCQA 1HP4A 1NOFA 3J7HA 3PZIA 2EO7A 4OOUA 3TONA 2E4TA 1X6NA 3VIIA 4XZWA 2CHOA 1JZ6A 3WKZA 1MW0A 3GM8A 3L4WA 3F5KA 1JF5A 1MWOA 2QMKA 2WMJA 1E70M 1XSKA 3SURA 2NT0A 4CU8A 1WKYA 1E0VA 3ARQA 2V3FA 3GBEA 1QI3A 5BXSA 4LYPA 1SYTA 1Q4NX 3IJ7A 1XH1A 1CGXA 4ZE5A 2W66A 1G01A 5M03A 4BQ3A 2BV9A 4QAWA 3O9NA 1DTUA 3EDFA 1JZ5A 1QI0A 3LPOA 1J01A 1UQYA 3AMCA 1CXFA 2W61A 2E0PA 3AIRA 2D3LA 5D9NA 1GOWA 2RGMA 1XYFA 1RD6A 2G3IA 1JAEA 3ZR5A 1QNQA 3SCQA 4AZ6A 2YJQA 2BFGA 2D0HA 3ZJ7A 1W3KA 1Z32X 2PWGA 4EKJA 1H41A 2YLLA 3TOPA 2JIWA 1JYVA 2EPMX 5JBEA 1B3VA 5JIPA 2IXVA 4A4AA 1A47A 2OSWA 4CCDA 1HIZA 1CBGA 3UETA 1UD6A 3K4AA 4B16A 3PBGA 1J12A 2WVVB 3HJEA 3AYRA 2PBOA 4QLJA 1E5JA 4XB3A 2F8QA 4B3KA 3GTNA 2VZVA 3CO4A 1R8LA 1HVQA 2D2OA 3B9AA 1ECEA 2DT0A 1CGYA 4QLLA 1VRXA 1ZJAA 4JZ5A 1C7SA 4DWSD 1H0IA 1CDGA 1E6QM 4B9YA 3IJ8A 4PMVA 5GQBA 2C8NA 3EDDA 4C7GA 3AFBA 1KWGA 1UR1A 1FH9A 4F9DA 3CHFA 2CKSA 1VFOA 2VRQA 2BVTA 1E4LA 1UOKA 2XVNA 5DEZA 5FIPA 3SEPA 4W85A 3GXDA 4JFUA 1H1NA 1NQ6A 4UQDA 4RL3A 1JL8A 2XPKA 4JHOA 4D1JA 2E40A 4GO9A 3UG4A 1VEPA 3G6MA 3CHEA 2QV4A 2O92A 2E9LA 4MNKA 3RIKA 4M81A 4PSPA 3PTQA 2VR5A 1G0CA 1DWHM 3SIMA 3GBDA 4CCCA 2V5CA 4UQBA 1MFUA 4E2OA 2VI0A 3OLEA 1QW8A 3FHQA 3GH4A 1CGUA 3T0AA 4E4PA 1F4AA 3EDJA 1CXKA 2JEPA 4H04A 4M8UA 4D1IA 3CZEA 4AEEA 1ISYA 1HP5A 4D6IA 2J8FA 4OKDA 4CUCA 3AIQA 3W6MA 2BVDA 1NH6A 2ESCA 4YPJA 5HBFA 1U2YA 4UZUA 3CPUA 5E09A 1PEZA 4MAZA 3VD3A 2ZUTA 1QOXA 2VVSA 3WNLA 2D0FA 1XD1A 1MW1A 2XWEA 3NCOA 4HMEA 5D8WA 1VEOA 3I3BA 4HZ7A 4GINA 3K4DA 3TTYA 1V0LA 3ZJ6A 7TAAA 3WEOA 1UA7A 3VINA 4CCEA 3MV01 4MADA 3K8LA 2W4XA 4MJ4A 4HA1A 2BNJA 2FHBA 3PHAA 5A6BD 1X1NA 2YL9A 2ZWZA 1HL8A 4D71A 1DWIM 1XRVA 2WWCA 3KZSA 1BG9A 1VB9A 2F61A 4KMQA 3SCSA 3CUIA 3L4YA 2WHLA 1GQKA 4HTYA 3VDAA 1GONA 5D9PA 3CUGA 4P7NA 2D22A 5A94A 3SUSA 2ZICA 4BQ2A 3SCNA 1JNEA 4JKKA 4AZHA 1GOOA 4TX6A 5AC5A 1BGGA 2CKRA 1R7AA 1MVYA 1GJUA 1NM9A 1W91A 3WDQA 3L4UA 3ECQA 4FLOA 2XJ7A 2WANA 1BG4A 3TTSA 2EPOA 1HJSA 4W8AA 1FHDA 2C0HA 2BHUA 3W0KA 1UWIA 3BH4A 5FL0A 1MQQA 4K68A 1PX8A 2XTKA 3L4XA 4HMDA 2BY2A 4UQEA 4YN5A 1YHTA 1E72M 3T08A 4OOZA 4Z2IA 3GYCA 1I1XA 3MU7A 3WEMA 1JAKA 4W86A 5BXTA 3NDYA 5GPRA 3UG5A 5AY7A 1V6WA 4ZFMA 3GXMA 1CGVA 5DMYA 3ARXA 4D6HA 3B9EA 5I5RA 1BQCA 2YIHA 1ITCA 1IV8A 4TUFA 5HNNA 3CHCA 2G3MA 3OZPA 4FLRA 1GOIA 4NRSA 2D20A 2EQDA 3THDA 1BSIA 3ZQ9A 4W8BA 1R86A 3UESA 1LL6A 4UOJA 1HKIA 3WF0A 4DUWA 1YQ2A 4P7RA 2Y8VA 1X6LA 3NSXA 1TVNA 2QLYA 4J3UA 3WENA 3RDKA 2VO5A 1MYRA 4UFJA 1L0PA 1GHRA 4TXEA 2DH3A 1E6XM 5C70A 3T0BA 1US2A 4NSBA 4PMNA 4RE2A 4PCTA 5LA2A 1CYGA 4F79A 3WQ4A 1E1FA 3I3EA 1UUQA 1CECA 2E8YA 3N1AA 3VIKA 2J7GA 1C3FA 2DIJA 4W7WA 1PX3A 3QOKA 1GCYA 2J7HA 4PTXA 3EDEA 1HX0A 3A6OA 2DT2A 1QW9A 4W5UA 2J8GA 4DM2A 2VZOA 3BMVA 2AAAA 2W91A 1KWKA 4TOQA 1VBRA 1ZU8A 1PAMA 5I77A 3E1F1 2OSXA 1UH3A 1OD8A 1W2VA 4DWSC 4M56A 4AZIA 3WF2A 5IHRA 1JZ7A 3TTOA 2W62A 3L2LA 1UD8A 1J0YA 4D6CA 1I75A 4IPNB 2X05A 5GNYA 3WBEA 4AY1A 1IZJA 4CD5A 3ARWA 3PZNA 2HVMA 3ARPA 5HOSA 4Z2LA 2WWDA 1W9DM 3SCUA 3AHZA 3AMGA 1UQZA 4JIEA 2F2HA 4J3VA 3WNPA 2WLZA 4JL2A 4GQQA 4IM4A 4H8VA 2DSUA 2GJXB 3FW6A 1QBBA 3SUUA 3MANA 3BAXA 1ODUA 4UFMA 1TCMA 1MFVA 3PZUA 9CGTA 3PZOA 4CD8A 1NWTA 1UH2A 5DT5A 1RPKA 4RE4A 4GKLA 1KFWA 2OYMA 3OGVA 3WFZA 4AD5A 3W81A 1BGAA 4AZ5A 3VGFA 3ZO9A 1UR9A 1IT0A 2WCGA 2YL5A 4P7LA 4RE3A 1UG6A 2PWFA 2VOTA 2DSWA 3VKKA 2WCAA 3GH7A 1QNPA 3ZSTA 2UY2A 3OIHA 2UY3A 5FOOA 1QNOA 4MAVA 2QPSA 4D6DA 1B0IA 4KRUA 5CG0A 3ZT7A 2ZX5A 3QHNA 1HJUA 3W26A 4LX4A 4OIFA 3CBWA 5HXMA 2E3ZA 5A1AA 5E9AA 3HU7A 1H0GA 4AWEA 2ZIDA 4A3YA 1GOKA 3VGBA 3T2OA 1EGZA 2J25A 4QCEA 1ISVA 5CXPA 4M1RA 2V3DA 1J10A 1UR8A 3UERA 3AIBA 2WMHA 4ACZA 3AI0A 3WQWA 4F66A 4ZXOA 3AS0A 2JEQA 1K9EA 4N0RA 1ISZA 1KGWA 1W9VA 2XFYA 3PTKA 5CPSA 1E15A 3VM7A 4LGXA 1LWJA 1W32A 4TVUA 3SUWA 2XIIA 1BFNA 2VMFA 3MUY1 2Z1KA 3VO0A 2WM0A 2GUYA 5FD0A 3IK2A 3POHA 3AXIA 3ARZA 1FH7A 4JFWA 4UFHA 2FHCA 4F8XA 4D72A 4UNIA 4WK9A 4M24A 1PZ3A 1R87A 1H49A 4FF5A 4PBGA 3ZIZA 3WUBA 1BHGA 1ZJBA 4U5KA 1WCGA 3CUFA 4AD2A 1BYDA 4HMCA 4E8DA 3ZT6A 1UKQA 3BC9A 2WVUA 5JBFA 1TA3A 2VCCA 1ISWA 5E6ZA 1SR0A 1G5AA 1ZS2A 2WLYA 1JI2A 3GZAA 3VGHA 2WBKA 2CXGA 1UD2A 5EFDA 3PN8A 3ARYA 2J75A 4W89A 4W8LA 2VX7A 4DM1A 4HOWA 2C7FA 3GH5A 1HKMA 2YKKA 2DIEA 4JL1A 4XV0A 2VL4A 2Y4SA 5E6YA 2DGAA 7CGTA 1UD4A 5ABFA 1EDGA 4M29A 5D9OA 5BWFA 1OM0A 1F4HA 4WSKA 5DO8A 1OWQA 1BYCA 2W5FA 2PWHA 3DHPA 3FHAA 5A6LA 3WEZA 3AHXA 1VF8A 3W37A 1OINA 1CGTA 3SCVA 2D0GA 1O6IA 2VURA 1GZJA 1C92A 1W3HA 4BF7A 1VFMA 2WHKA 4UFLA 5BRPA 4JHZA 2WVSA 2WMIB 1AMYA 3BMWA 2OWCA 4WLCA 3L4VA 2D24A 4H8UA 3GNOA 2G3NA 3A4XA 3AS2A 1HKKA 4MNMA 2WPGA 2QMJA 1XV8A 5E0CA 2XM2A 5I3DA 1WZLA 2UWFA 3GNRA 5EFFA 2PWDA 5A6SA 4NRRA 2D1ZA 1CLXA 3VIFA 3D5HA 1NWUA 2BXYA 3N17A 4H2CA 2JALA 2ZX6A 3AQUA 4UR9A 3WBAA 1V3LA 2VR4A 1TG7A 3ARTA 2XVLA 1Q6EA 1GVYA 1FFRA 3ARVA 4UOQA 3ZOAA 1FP9A 1OGGA 1QNRA 3FNDA 3OLGA 1TA3B 2VC9A 3WDHA 1JZ3A 1ODZA 2WYSA 3N04A 4X0NA 1VFUA 2CETA 3ALGA 3THCA 1LG2A 1WAWA 5A6KA 3W53A 4D6FA 3AXXA 4W93A 3QOMA 2YDSA 3WY1A 1WDRA 2ZXBA 1J11A 1R7OA 1ZBWA 1C8XA 3NDZA 1XHGA 3AJ7A 4OBSA 4AZGA 3II1A 1BVZA 3AS3A 4J3SA 1BYAA 4AXNA 2PWEA 1E6SM 3GDBA 1C90A 4GIAA 4Z2KA 3N15A 4UCFA 1E9LA 1EH9A 2Y2WA 3KE0A 1Q6FA 2CNCA 1MXDA 7A3HA 1O7AA 6A3HA 4LYRA 1UWQA 2QF8A 1UWTA 1UWSA 5A3HA 1KXTA 3O6AA 4GPNA 2ZUSA 2VUYA 1B90A 2XVKA 5A8OA 4JFSA 2CBJA 1RP8A 3WQVA 3BXWA 1CNVA 1OIFA 3SCWA 5BXPA 3OBAA 5HPCA 1V3JA 1FOBA 1W9PA 4JCLA 3F5JA 3W24A 2TAAA 1UKOA 2E9MA 4P8WA 1HNYA 4NZCA 1UHVA 4W7VA 2VZUA 1PIFA 4HPGA 4NI3A 4W87A 1SMDA 5GNZA 2ZXDA 3NYDA 3VPLA 3WMSA 4A3HA 2YA0A 4WF7A 2OSYA 3WQ5A 1E0XA 5CQ1A 2X0HA 5AYBA 1JYNA 4UZSA 4EAMA 1E5NA 3CH9A 3K8MA 1EHNA 3WH9A 4MJ2A 1OB0A 1ZBKA 2W67A 4LPCA 5I2UA 4PMYA 1LG1A 2UY5A 3CMGA 2OWWA 3CHDA 3KEHA 1B3WA 1PBGA 4MPKA 3QGVA 2PI6A 4W5ZA 2DSKA 4P8XA 1NP2A 1QPKA 5HDRA 3VMNA 2GJXA 3WH8A 5IFTA 1FHLA 1U30A 2NW0A 4EE9A 1V3KA 2WHJA 4HPHA 2DSVA 2VJXA 5I79A 3ARRA 1B31A 3EMCA 1KGXA 2ZXQA 1I1WA 3W6LA 3EDKA 1LL7A 2BVYA 4QP0A 2EBNA 1V0MA 3K8KA 1OGBA 8A3HA 3WFLA 1E71M 1RH9A 1KR1A 5D4YA 5ABHA 5CGMA 1E40A 4Y7EA 1WZKA 1KCKA 2IXUA 1WZMA 1JIBA 5CGTA 4KGLA 1E6NA 1MXGA 2X1IA 2YL8A 4DWSB 1FA2A 1JYXA 1XH2A 5ABGA 1G9HA 3A4AA 2ZXAA 4S3KA 5F7UA 3T2QA 2GJRA 4GI8A 3WDPP 5I78A 5C71A 4AD1A 3NJ3A 3RJXA 4HU0A 3SCOA 5EBAA 2Y8KA 2GDUA 2FH8A 5A6JA 1W1TA 2W92A 3T09A 1JXJA 2XIBA 3B8SA 3AZTA 3AMKA 3DC0A 2G3JA 3CLWA 1AVAA 3OG2A 4BQ4A 3ZJKA 3OGRA 2ZX7A 4ZE4A 1KBBA 4FLSA 2ZE0A 3WELA 3U7VA 3T0DA 5LA1A 1ZL1A 1VAHA 3WNMA 2VCBA 4WKFA 2PF0A 4PTVA 3D3AA 1K9TA 3AMDA 3BCFA 1E56A 1E4IA 4H8HA 5JBDA 3VILA 1XSIA 4J3XA 4D6JA 5HPOA 4YHGA 4YHEA 3AMLA 4OJYA 4R27A 1GQLA 3MO4A 1B3ZA 3VTRA 3HMCA 2VCAA 5M3WA 1VENA 4HA3A 1J9YA 4AZCA 1EXPA 5CZKA 2YDQA 1J0KA 4TVCA 2J7EA 3BSGA 5A69A 3WL1A 4AYSA 5IXEA 2JF6A 2WC7A 1UKTA 5DFAA 2RGLA 4Z2JA 3RM4A 4OBRA 4U5IA 1JYWA 2YL6A 1E6PA 1HF6A 3WD0A 4CKQA 3UG3A 4FK9A 1UYQA 1LJYA 1JG9A 2XG9A 3WIJA 2WMFA 4KWUA 2E9BA 2XUCA 2B31A 4M82A 4BZYA 1MQPA 1J0JA 4PTMA 1UR2A 1K9DA 4AIEA 1UZ4A 1OT2A 1SFSA 2WC4A 2XGBA 3LPGA 1ISXA 1V6UA 3W29A 3JUGA 5GNXA 5A2CA 3QR3A 3MMWA 4U3CA 3VIGA 4PMZA 2YLAA 1W1VA 1HJXA 1EIBA 3W38A 5KEZA 3RJYA 1UD5A 3WF4A 2Z1SA 2X0YA 3VGDA 4LYQA 4Q7NA 1EDQA 3VOCA 2WVTA 3ZMRA 3AS1A 1WP6A 4W7UA 2V3GA 3GXFA 3EMQA 2PC8A 2WSKA 1HXJA 1H2JA 5JIWA 1DWJM 2WMGA 2OWXA 2V5DA 4CN1A 4J27A 2WZHA 1CXHA 1H09A 3WD2A 2XGIA 3OA5A 2YBUA 1CTNA 5E0FA 3BSHA 1W9BM 1JI1A 4WSJA 4BQ5A 2D3NA 2V38A 4UQCA 1DWAM 1UA3A 1DEDA 3GXIA 4H7VA 2WC3A 4V27A 1V0KA 1VBUA 5M17A 2NSXA 4D6GA 4CGTA 3WH6A 5LA0A 1WNOA 2GSJA 1KB3A 2PB1A 3OB8A 4URIA 1M53A 1JDDA 1C91A 1NARA 1JF6A 5EB8A 4UQAA 1VIWA 5BRQA 4PSRA 1E55A 2JF7A 3ALFA 1HT6A 3N18A 2XHYA 4ZEPA 2CEQA 3ZM8A 5I24A 3BAKA 2GVYA 4JKLA 3W27A 5JUVA 3F5LA 1LWHA 4CU7A 5KZ6A 1NWRA 1UKPA 4IISA 2GDVA 4J7RA 3VIMA 2A3CA 3AHYA 1JGIA 1HN1A 2YA2A 2VVNA 3U7BA 3DYPA 3A47A 4B3LA 1UD3A 2VZSA 3NUKA 2GJPA 4IUGA 4ATLA 3AHVA 4MDPA 5IDIA 1E6RA 2YBTA 4JFVA 4WIWA 3FY1A 5BXRA 1V02E 1PX4A 3PZGA 4UFIA 4ZENA 4C7DA 4ACZB 1VFFA 4U3AA 4N42A 3MMDA 1W1PA 1ZBCA 1OSEA 1FFQA 1JXKA 3OZOA 2EPLX 3M07A 2YA1A 3LPFA 3VGGA 1GORA 1CWYA 1V6XA 2VQUA 1GW1A 2WNWA 3IANA 4CD7A 1GHSA 2VRKA 3AISA 1BF2A 1CIUA 2WBGA 2ZUVA 4JKMA 4AC1X 4BS0A 4CU6A 1LLOA 5DT7A 3VX1A 2CPUA 1KR0A 5CLWA 2EEXA 2O9OA 1TR1A 1ESWA 4PYSA 4KH2A 2XFFA 3DECA 1A3HA 5LYRA 2AMGA 3WDIA 2VX6A 4DUVA 2XFRA 4AD0A 4IPLA 4UTFA 1XCWA 4AZ7A 5A6BA 2DDXA 3PTMA 5A2BA 2XVPA 1CGWA 4LQ1A 2WAGA 4L4OA 2DQXA 2WCSA 3WNOA 3BLPX 1C93A 4E8CA 1JDCA 3WNNA 1ZBVA 3LMYA 1GVIA 2QHAA 1CENA 3KL5A 4W84A 2CBUA 1NOUA 2EXOA 2FGZA 1Q6DA 4B9ZA 2XYLA 2BHYA 3AHTA 1WDSA 2DEPA 3FAXA 4OUEA 4HA4A 3VIPA 1NOWA 3A4WA 1WO2A 3N12A 5FCZA 1GQIA 1XGZA 4PTWA 1ITXA 1OBAA 4V28A 3CZJA 3L4ZA 2WMKA 2ZUUA 1H3GA 4AISA 1WPCA 3MKKA 4GXPA 4AZBA 3VUPA 2HISA 3NSNA 1S46A 1JNDA 1BTCA 1XCXA 2ZX8A 3AIWA 1H5VA 3CUHA 3WDRA 1CZ1A 1J0HA 4Z2HA 3FN9A 2DH2A 3DHUA 3ZSSA 4LXFA 1JZ2A 3L2MA 1HJWA 3WMCA 3BCDA 2YDRA 3CTTA 4P8UA 1SMAA 3BLKA 1JZ8A 1HKJA 1CXLA 1M01A 1BPLB 4KGJA 2JFEX 4MTVA 1TVPA 2W63A 8CGTA 4KRTA 1BAGA 1WDQA 4QFUA 5CSUA 4UFKA 4MNJA 4XX6A 1KXQA 3RM9A 1QI4A 4EK7A 3WD1A 2E8ZA 3SCRA 3WMBA 1NWSA 3VIHA 2XVGA 4GQRA 4U33A 3PZVA 3MMUA 4CVUA 1XC6A 1JFXA 2VX4A 1V3IA 3WNKA 5AC4A 2WKGA 3CGTA 2XM1A 3VVGA 3U57A 1KXVA 4PRWA 5C8BB 1B2YA 5CSYA 1W3LA 3MSGA 1E1EA 4GI6A 1KXHA 1QHZA 2CYGA 3I3DA 3K1DA 1OCQA 3S6TA 3WUEA 2WXDM 2Y5EA 3RCNA 4DWSA 3WF1A 3CIVA 4AD4A 4NF7A 4X0VA 1BVNP 1W9XA 3GNPA 3SCPA 1V08A 1XYZA 1E3XA 3WDJA 1QHOA 3CZGA 3U5UA 1E6ZA 5CJ5A 4U31A 1HL9A 2WW5A 3AXHA 2X09A 4F9JA 2A3AA 2CITA 3PZMA 1QBAA 4PMRA 5A6MA 4BCEA 2WZIA 4AMCA 2XSBA 1VEMA 4AD3A 1JDAA 3VIJA 3F4VA 1GPFA 1PZ2A 1B30A 3VU2A 2J7DA 1J0ZA 2VZTA 3SUTA 3VD9A 2EPKX 5A8PA 3VD7A 2X2YA 4MB3A 3W82A 1WZAA 3O2LA 3WD4A 3EMZA 1XD0A 4HOXA 5DF0A 3AIEA 1E4NA 1EHAA 4PMOA 4PMQA 1WB0A 3QHMA 1W9UA 1WE5A 1VJZA 3WSUA 4CD6A 4JFTA 4XZBA 3N13A 4MB1A 3M6DA 3UR8A 1UZ1A 1R85A 2ZUMA 3DYMA 3WF3A 5TD4A 2O9RA 1DWFM 1DP0A 2D23A 1CXEA 3PZTA 5D9MA 3VD5A 2FH6A 5ABFB 4P7QA 4PMDA 5AYIA 2DPEA 4PUEA 1D2KA 4PUDA 4CD4A 1EQPA 2BHZA 2ZUNA 3U5YA 1CLVA 3SUVA 2NT1A 5A6AA 3EYPA 1V03A 2VRJA 2WZEA 2Q8XA 4PMUA 1UR4A 3RILA 2G41A 2GK1B 2J7CA 1TZ7A 4FMVA 1M03A 2BY0A 2CBIA 3CZKA 3WH7A 4GZEA 1HJVA 1AQ0A 2VT0A 2CERA 1GOQA 1XH0A 1GJWA 2FDMA 3T2PA 2EJ1A 5BROA 1EA9C 2YOCA 4BA0A 3NIYA 4MDOA 3VIOA 5EMYA 1QHPA 4R5EA 4EANA 1QI2A 1TUXA 2DT3A 2O9PA 5JH8A 3IAQA 3RPMA 2WVVA 4X9YA 4B15A 1G1YA 3FXYA 3SCTA 5I0DA 4AIUA 1PIGA 3POCA 3TA9A 3MUZ1 3CZLA 1VJSA 4GZIA 4AEFA 3A3HA 3S2CA 4CN6A 3B9DA 4DUXA 4C7FA 4AIOA 2WHMA 3N9KA 3W4RA 3AZSA 3VX0A 2WKLA 2FGLA 4QCFA 4QDMA 3VM5A 5CLTA 2JIEA 4TX8A 4MNLA 2BS9A 4GZJA 2G4FA 5ABEA 3KWXA 2BXZA 3VMPA 1J18A 4AW7A 3AZRA 1C8QA 1PPIA 1UWRA 1EO7A 3FAWA 3WL0A 3TTQA 1DWGM 1M7XA 1B9ZA 4WJXA 4U2YA 1W2PA 1TFVA 4MB4A 4GO8A 5D8ZA 1UH4A 2ZX9A 3VDCA 5A2AA 1UKSA 2G8ZA 1JFHA 2J62A 3EBVA 4L4PA 2ZWYA 4GI9A 3N11A 4CN4A 1Q6GA 1L8NA 1JD7A 2VNCA 1EQCA 4W88A 2CHNA 1PJ9A 4QLKA 3ZJ8A 5BYWA 3VNYA 2AOSA 3RO8A 1LQ0A 1ZB5A 1E0WA 3M7SA 1C8YA 1GQJA 3DYOA 1D3CA 1GOMA 4P7OA 1IZKA 1JZ4A 3L4TA 5I23A 1MW2A 1KGUA 2J79A 3WH5A 4J3WA 1U33A 3WQ6A 4U2ZA 5FL1A 1E3ZA 3M46A 2XWDA 3IJ9A 3ARSA 2MANA 1JD9A 4UQ9A 4HOZA 5M5DA 4J28A 2BY1A 2FHFA 5CPTA 4TTUA 3UR7A 1OD0A 5A8QA 1E73M 4ATDA 4JAWA 1K6AA 6CGTA 3CMJA 3AROA 4Z2GA 1KCLA 3WUFA 1K9FA 3BAJA 3BGAA 2J74A 4AZCB 2PBGA 1RP9A 4D6EA 5CPQA 1V3HA 1XSJA 3CZ8A 3AYSA 1P6WA 1E43A 2WMIA 4HZ6A 1H11A 5ECUA 1TMQA 3APGA 1FH8A 1B3YA 2VTFA 3LPPA 3RMEA 5IFPA 2WK2A 6TAAA 2OYLA 1V0NA 1CEOA 1EOKA 1V6VA 2J77A 4PEEA 1QVBA 2J7FA 3PZ9A 5A8MA 1AQHA 2VX5A 4PMXA 4S3JA 1V3MA 2DSZA 3VMOA 2WB5A 1KQYA 2CESA 2J47A 1MW3A 1J0IA 2CCRA 2A3HA 2WSPA 3VDHA 3WUGA 5FKYA 5I6SA 2OLHA 2J4GA 2XSAA 1Y7VA 5BCAA 3MUAA 4UOZA 4PN2A 1AQMA 4WKHA 3UEQA 2J7BA 3W25A 1D7FA 1V02A 5E70A 2DT1A 3ZR6A 4PCSA 1C7TA 3QHOA 3AIUA 1HVXA 1OIMA 4HZ8A 3RM8A 3ARUA 3IAPA 3VD4A 2ZUWA 2BY3A 1MQRA 4Q22A 1LF1A 1QNSA 3TP4A 1BLIA 1V6YA 3VDBA 1UR0A 3MV11 1EOMA 1NP0A 1LL4A 1KQZA 4MB5A 5A95A 4V2XA 3WD3A 4P8VA 4WKAA 1GNXA 2VQTA 3OGSA 2Y24A 2X8RA 3G6LA 4ML4A 3HN3A 4ZXLA 4OZOA 3BAYA 2A3EA 3AIVA 2A3BA 4J3TA 3OLIA 2QPUA 1EO5A
chains in the Genus database with same CATH superfamily
3NSMA 2B81A 1UWUA 4JYFA 6REQA 4RV3A 4GX9A 1S3TC 2QAPA 2LKNA 3VNZA 1RQHA 1OT1A 1TPB1 3IVTA 1DXEA 5BU6A 1PYMA 1TE1A 1O1HA 2X41A 3QV6A 2HZGA 3K4WA 2RUDA 2GFTA 2LJ4A 4HNTA 4LNCA 4PUJA 3REQA 2XISA 4XSMA 4C6EA 4Q7BA 4GCXA 3SZ8A 3ZT5A 4XUYA 5A8NA 3C8FA 3A9BA 4RKAA 2GL5A 1JPIA 4JXCA 3M6YA 4DZAA 2ZVRA 4I9MA 4LCSA 5HMSA 3CUJA 1POKA 3W28A 2O9TA 1X39A 2XIMA 3HJZA 4TVDA 1P43A 3UCQA 4FNTA 3KOZA 1NOFA 5LNWA 2EO7A 1MDRA 3VIIA 3PFRA 1JZ6A 2RHGA 5I06A 4UR7A 1AD4A 1XSKA 5FJOA 3APTA 1WKYA 2V3FA 3CXOA 4LYPA 4ZE5A 2W66A 1G01A 2ABAA 4GUIA 1B4KA 1DTUA 3EDFA 5D2WA 4XUGA 1K1DA 3QF0A 1QI0A 3M4HA 3LHUA 4YVVA 2AAMA 2W61A 3G77A 3AIRA 4V33A 5D9NA 1WBJA 2E25A 5HWMA 1P0EA 3MA8A 1J2BA 5BRBA 3UW6A 2OT0A 2NXGA 3CAWA 2JIWA 1B3VA 2IXVA 5HW8A 1P6BA 3ZZ1A 1W26A 1HIZA 3UETA 1UD6A 3K4AA 3PBGA 1QO5A 4FALA 1XF0A 4R9XA 2WVVB 3HJEA 3A3XA 3AYRA 4QNEA 1GKQA 3RLGA 4QLJA 3HPXA 4XB3A 1XC4A 2FVMA 2A0NA 2F8QA 4LS0A 3WLTA 3B9AA 4QLLA 1VRXA 4JZ5A 1CDGA 5CGQA 1TWZA 5GQBA 3GAKA 3AFBA 4JTDA 3EWXA 4IPXA 4F9DA 4NZFA 1POJA 2VRQA 1LORA 3TDBA 2BVTA 3G0SA 5DEZA 4JTHA 5FIPA 1H1NA 3TQPA 2G96A 4Q4MA 4WOQA 3CYVA 1AH3A 1T7LA 3A13A 4ZVJA 3F03K 2ZRYA 4QNWA 1FX6A 3GHUA 4YCOA 4QG6A 1HGYA 2W6RA 5AB3A 4GO9A 5LIWX 1VEPA 3NRKA 4NZ5A 3G6MA 4MYXA 3QC3A 1MDLA 2PU0A 3FFSA 3IIZA 5M1TA 3BV4A 3GHTA 2FVKA 3DOPA 2E9LA 1JQVA 1Q6LA 1VZWA 2C19A 3FA3A 2HROA 4ONVA 4DN1A 4CCCA 2EG8A 3FEQA 2PDPA 4XKMA 2OOGA 5GVJA 2VI0A 3ATZA 2VWSA 3GH4A 3EX3A 3WLQA 1CXKA 5HW7A 4H04A 2F84A 4J9JA 4D1IA 3K30A 2Z29A 2J8FA 4CUCA 3AIQA 1S39A 4QBXA 1EJTC 1YEYA 2ATMA 4B5WA 1BRLB 2PDNA 1PEZA 2IQ0A 3R2GA 2ZRZA 4F2UA 1EUNA 3G0XA 2D0FA 1XD1A 4NX5A 4C6BA 3UBPC 1Z7AA 1DJGA 1WX0A 3IJQA 3TQVA 3WLKX 3K4DA 3ZJ6A 7TAAA 3WEOA 4KWVA 1UA7A 4CCEA 3WLPA 3C5QA 3V16A 2BNJA 3W2UA 4QT3A 3PHAA 4R0XA 1X1NA 4CEUC 4D71A 4LC8A 3KZSA 3LN3A 1FXQA 3H8AA 3OHMB 1FWIC 3ZLGA 2NUXA 5A94A 4WR3A 4IFKA 4MY1A 2QCDB 1GJPA 2BSLA 3BLDA 2NQZA 4C6NA 3KRBA 4KRZA 4AZHA 1GOOA 1K3UA 2F21A 1FKTA 2CKRA 1R7AA 3DG6A 3LHTA 1MVYA 1NM9A 4DROA 4GCAA 1YXDA 1OFAA 2ACQA 1KC7A 1VHNA 5G4HC 2Y7GA 3TTSA 2EPOA 3GU2A 3CUXA 4LAKA 1S5NA 1HO1A 3TQKA 2C0HA 3KBVA 1IQ8A 3SADA 4FOKA 1UASA 1JVWA 3OQ8A 3QLLA 3ZVHA 1MNZA 3SECA 4YN5A 4HNCA 1H7NA 2QJIA 4BI6A 4Z2IA 1I1XA 3MU7A 1I0BA 3BTNA 5GPRA 3UG5A 1J6YA 4MKNA 2PTYA 1CGVA 2DORA 4ZOAA 1GTEA 1DE6A 4Q8PA 3ARXA 1Q8AA 1EUAA 1OF8A 5I5RA 1JJKA 2YIHA 3K2GA 2DFAA 1ITCA 3NZRA 2PDXA 3A4JA 3L5LA 3OZPA 4NRSA 2TYSA 1LYXA 2CZ5A 3GDKA 3ZQ9A 1Q6QA 1XDMA 3FK4A 3DI1A 3TH6A 1R86A 5D30A 3UESA 1JCTA 3BG9A 4IT4A 4Q7IA 2X7VA 1LT8A 2A79A 5BMWA 3WENA 6XIAA 3UY8A 2VO5A 1MYRA 4GI4A 4FAMA 1SJDA 4GQ0A 1L0PA 4TXEA 1ZUAX 2P5NA 1M65A 3P84A 1YPIA 2MLXA 1VLWA 4RE2A 3P81A 4F79A 3VOJA 4FI4A 4KCUA 1H5YA 1UUQA 1CECA 2E8YA 3PULA 1XIFA 4FR6A 4IMDA 2PWUA 3QOKA 3PJWA 1HX0A 1FUYA 3QTGA 2NVAA 2FJUB 3TSMA 3M41A 4WCJA 4A3UA 2VZOA 4MHBA 5BWAA 3GDRA 1KWKA 2XU2A 1PAMA 3BLFA 5I77A 4LUIA 4H7ZA 4DUOA 1EQ3A 1PKYA 4O57A 1GK8A 1LRNA 3L2LA 1UC5A 1UD8A 3W1AA 2X05A 5C2CA 5GNYA 3M9YA 4MGGA 3PZNA 1FKFA 4LH8A 5I3JA 3I6RA 2XPAA 1EZ2A 3O3RA 3AHZA 3CLMA 3AMGA 2HTMA 3QY8A 4JIEA 3TC6A 3N6HA 5B8IC 3W2JA 3TIMA 4DBDA 4GQQA 4JTRA 4IM4A 3QY7A 2GJXB 2Y1HA 3FW6A 1M41A 1EC9A 3WLLA 2X7WA 2NLIA 3LB0A 3MANA 3R0UA 9CGTA 4TQTA 4QZVB 3GKFA 5DT5A 1DJYA 4GKLA 4AD5A 3W81A 4MFEA 1BGAA 4G1KA 3T07A 1EL3A 1UR9A 2MUCA 2WCGA 2YZRA 3ONBA 4P7LA 3HQOA 1HFBA 2PWFA 4IMAA 1TR9A 2DSWA 3CAQA 2WCAA 4GOAA 3GH7A 1YTEA 1QNPA 4PUUA 1UBPC 3DGBA 3GFZA 3HFYA 5AHIA 4F3HA 1GOXA 4JN6A 5FOOA 4MAVA 1DJIA 3NURA 3UXAA 5K7JA 1VHCA 3W26A 1DJXA 3CL6A 2E3ZA 4PB3A 4BFAA 1EX5A 2PDCA 1RBLA 1UB3A 4WRHA 3VGBA 3EX1A 2J25A 3TE9A 1ISVA 4L64A 3U3HA 4M1RA 2XH7A 3UERA 5IOBA 3AIBA 2YCKX 4GC4A 3GXTA 4ACZA 3SFKA 1JCYA 1EJSC 1FCUA 3MPGA 1K9EA 3ODKA 4HK6A 1KGWA 2ICSA 4ICMA 1KM5A 3LCFA 2VFIA 4JTJA 4I9AA 3EB4A 4H9MA 3LBOA 1QMLA 3CB3A 2IW0A 1EGVA 2PC4A 2V68A 4YVXA 2FJKA 3IK2A 1DORA 1EBGA 1R3WA 3S9IA 3EY6A 2PWVA 1JRCA 1FWBC 5AFDA 2VEIA 2FFIA 2FHCA 3I68A 2Z0IA 4UNIA 5F4WA 4WK9A 2QJGA 3UR2A 1R38A 1FDZA 3EGJA 4PBGA 3WQEA 3WUBA 3L67A 4OQVA 4B5VA 4E8DA 2WVUA 1TA3A 1ISWA 5E6ZA 4BEUA 1EA0A 3UYIA 1G5AA 3LS9A 3ZLHA 4EF8A 1JI2A 1NF0A 3VGHA 3IJIA 4W9OA 4W89A 4WGHA 4W8LA 1XG3A 2VX7A 3DAQA 2YKKA 2DIEA 4HKPA 4A8IA 2VL4A 1OCNA 2X40A 4XSLA 2XH2A 3ZXWA 4OVXA 3REQB 1YW1A 4DY1A 1ROUA 4IZGA 1AFSA 5DO8A 2WSQA 2R1LA 2DZSA 1BYCA 2PWHA 3FHAA 3T8QA 3EX2A 3AHXA 3NQ2A 2CU0A 3G24A 4DBEA 3O5MA 3SRHA 3C3NA 3WLMA 1GZJA 2HCVA 4IF2A 3EX4A 3S46A 3F1QA 3BMWA 4GNKB 3A5VA 1RJPA 3NO1A 1XINA 4H8UA 2J6XA 3MWAA 2G3NA 3PUEA 5HWJA 3G1VA 4C6OA 5DY3A 1GT8A 1NSJA 2XM2A 4J4OA 2KFWA 3FJ6A 3D3FA 2UWFA 3O6DA 4N02A 2UBPC 2PWDA 3TJIA 5JVLA 2D1ZA 1CLXA 4HSHA 3NA8A 2QCHA 3L9CA 4HU3A 3U6WA 2Y0FA 3HG3A 2I5IA 2ZX6A 2PURA 3NQBA 4AEOA 4RZ5A 1J5TA 4EACA 3R94A 5I3FA 3DX5A 1TG7A 1R2SA 1VH7A 4BF5A 3ARVA 1QNRA 3FNDA 3WQOA 3FJLA 4BWLC 2JKAA 2VC9A 3RFAA 3N04A 2PTWA 4X0NA 1VFUA 2G0WA 4AIBA 1TSIA 3ALGA 4GIRA 5A6KA 3AXXA 4IIBA 2YDSA 1G69A 1REQB 3KAHA 1ZBWA 3NDZA 1XHGA 4OBSA 4JYDA 1UIPA 1GVRA 3BZJA 5EU9A 5G4EA 4JEJA 2PWEA 1ITUA 4M19A 1LWIA 4HNLA 2Y2WA 5HNUA 3WQCA 1MXDA 7A3HA 6A3HA 2TSYA 4X2PA 3VFLA 1YXCA 2QF8A 5AHEA 3IKDA 3BGJA 3BVJA 3PVFA 2XVKA 3PJXA 4ZZ9A 4I7WA 4ZB0A 5LHFA 2CBJA 1W0MA 1EWDA 1G7VA 4N2YA 1RP8A 3F4NA 5G1YA 3WQVA 1XLMA 4DEFA 5XINA 1L1PA 3KLKA 2ZR5A 3OBAA 2Z2AA 2PPPA 1FOBA 3NQ6A 3W24A 1XICA 3TN5A 2O7QA 3CAKA 1RQBA 3BOXA 3LCLA 3P93A 2X16A 1O94A 1SMDA 4LCQA 1ML1A 3WMSA 1XBYA 4XK2A 3VKDA 3ZLFA 5DANA 3WQ5A 3OA3A 4FB7A 5CQ1A 2X0HA 5AYBA 3CH9A 2FVLA 1EHNA 4JQ3A 4JYEA 3WH9A 4MJ2A 3L68A 4LANA 3WX7A 2M2AA 4LPCA 4WVXA 3CMGA 2OWWA 3CASA 1B3WA 3RLHA 4W5ZA 4NZ3A 2DSKA 1QPKA 2I56A 2EAWA 3UWZA 2NVDA 5IFTA 4ZGYA 1K8XA 4DRNA 3KTCA 3QYQA 2DSVA 2VJXA 3SR7A 2YZ5A 1KRAC 1B31A 3TW6A 4I5RA 3LXAA 4RNJA 2ZXQA 2EBNA 3UPMA 3WFLA 4R7WA 4BI7A 3PG8A 5K9CA 3QYSA 3HTWA 3QLDA 5CGMA 4N9CA 1R3VA 5FF2A 1XUZA 3EXSA 1O12A 5K9XA 4KGLA 1S1RA 5DCDA 4IGMA 4I90A 2WJZA 2X1IA 1GPWA 4DWSB 3NZQA 3NZGA 4AF0B 1WOBA 1G9HA 3KS6A 4GI8A 3HO8A 3RPDA 1YE6A 4WY0A 3MHUA 4ORIA 4R85A 3B4UA 1I9CB 3AXKA 5FEXA 2Y5JA 3NYZA 1R47A 3SCOA 2GWNA 2Z1BA 2FH8A 3T09A 3G1FA 2XIBA 5EKYA 3QMSA 3AYTA 3B8SA 3DC0A 1W17A 1QPOA 2ZE3A 3CLWA 1AVAA 4AAJA 3OG2A 1Q7QA 4IL0A 4AMAA 4DYEA 3OGRA 2ZX7A 1J6PA 3RU8X 2PDBA 1KBBA 3TQ0A 3UA4A 3B03A 5LA1A 1VAHA 2PF0A 4PTVA 3D3AA 2IPGA 5GJNA 3V18A 4UB9A 3NGFA 1F40A 1M5YA 1JPKA 4RK8A 4JHMA 2Q5AA 2HS8A 2ZQ0A 3VILA 1OHLA 4DWDA 4D6JA 4YHGA 4H3DA 2JZVA 5IM51 4R27A 4FXJA 1GQLA 3BANA 1B3ZA 1LRTA 3EWBX 3NM1A 4H6QA 3BLLA 2YCJA 5FF7A 4K1GA 4H1ZA 1XBVA 2PRHA 2LGOA 5HINA 5IDZA 3DFSA 3W74A 5HWNA 2JF6A 2WC7A 1UKTA 3CWNA 3UNDA 2Y7EA 4OBRA 4NXSA 1Q6HA 5CPNA 2OTDA 3G1SA 4X63A 3SI9A 4DRPA 3GU1A 3UG3A 1F73A 3TZNA 4TYOA 1TTJA 1UUMA 2WMFA 3Q65A 3TK7A 2E9BA 4MKVA 3UF9A 4M82A 1UJPA 1J0JA 2F2KA 2HPIA 5LNSA 1UR2A 1V7AA 2ACSA 4AIEA 1UZ4A 1SFSA 2WC4A 5D05A 1Y5XA 1BF6A 3LPGA 1TJ1A 5DITA 1ISXA 3W29A 4AHPA 3RO6A 5A2CA 4O53A 3MMWA 4CLMA 3VIGA 3V4BA 1EIBA 1G4EA 5E5CA 2Z1SA 2A85A 3I7SA 3R6IA 5EMUA 3LGEA 3M0ZA 1RPXA 1ZP4A 4E0CA 2A6LA 2PC8A 4UNLA 2WSKA 1H2JA 3WJXA 1O5KA 5JIWA 3PJTA 1DWJM 4ML9A 2CLMA 3PS7A 3H9RB 2HJPA 4AQLA 4MLRA 3SW6A 2REQB 5FSDC 1JULA 3WK1A 3CYJA 4IGHA 1RA5A 3EX6A 4O4WA 2CZFA 4UQCA 3UCCA 2EHHA 3PB2A 4PFMA 4H7VA 3NL6A 2PU1A 4DRHA 5C9UA 1H7WA 5DRCA 4D6GA 2X42A 3H4GA 3IIXA 1KB3A 2CWXA 1HGWA 4URIA 1M53A 3MJMA 1JDDA 3DESA 2EULA 1GW9A 2VM8A 5FJUA 4BK9A 3KAOA 3SY5A 1B54A 3T1GA 1O5RA 4PSRA 5BRQA 5AYYA 3TNOA 1E55A 2NV2A 2JF7A 2P0OA 3BAKA 3IUIA 4O0ZA 1FWGC 1MUWA 5AVHA 4CNSA 2MPHA 2OOFA 5KITA 1IX5A 3VIMA 1NAL1 3QKEA 1JGIA 3U7BA 3DYPA 4RR4A 5AZ0A 3NUKA 3GC4A 4LS1A 2OKTA 4MDPA 5IDIA 1E6RA 2YBTA 3KM8A 4ALDA 1PX4A 1RCOB 4C7DA 4JN8A 3GTYX 4IGNA 5LZLA 4W9PA 1ZBCA 3PUGA 4Z1AA 2ZZ6A 3ES7A 2EPLX 3NQCA 2NQ9A 1V4YA 2F23A 1TX2A 3VGGA 3RFWA 1CWYA 1V6XA 1L6YA 3O06A 4EWJA 1YX1A 2VRKA 4CD7A 5G2HA 1TJRA 4AC1X 4XG1A 2D2HA 2Q8LA 2PDYA 5DT7A 3EA1A 1WAUA 2O9OA 1ESWA 3TC5A 5LYRA 5D2VA 1NFPA 3VAWA 1BXNA 2VX6A 2XFRA 2VFHA 4LAYA 4DIAA 1KKOA 1XCWA 1CGWA 4JOMA 1H50A 3VXGA 1TVLA 1QASA 1WUEA 1KV8A 4L9ZA 2HRWA 4DLMA 3GC2A 4H6EA 3ANVA 4OBTA 4E8CA 1JDCA 1K7FA 2OQLA 3K13A 4W84A 3LMYA 1CENA 4LS2A 3IGHX 3E38A 1EB3A 1XLBA 2J13A 3QSRA 3UJFA 4TV5A 1NOUA 3B9NA 1Q6DA 1Q8JA 4OHQA 2ZADA 1XIIA 2D2JA 4FP1A 3RHGA 4QIUA 3QZEA 1BEUA 1XIHA 4OUEA 4U86A 2AGTA 2DG4A 1Q7ZA 1WO2A 1A4MA 4HVXA 2V8ZA 4OE7A 2KI3A 3FCPA 3L4ZA 2ZUUA 3E2SA 1H3GA 4IHCA 3MKKA 4FHAA 4GK8A 3E02A 3FVDA 1XLGA 1JNDA 1AD1A 1XCXA 1A80A 4L3NA 4ODNA 1QW7A 1VRDA 4LUTB 1XLAA 4GGBA 3ZSSA 2CZEA 3OVGA 5KZMA 2Z2UA 3WMCA 3DGRA 3DFNA 3BCDA 3KHJA 4D9PA 1MI3A 2YDRA 4BY3A 1SMAA 1BPLB 3RRAA 1TVPA 1PCWA 4KRTA 5AN7A 4QFUA 5CSUA 4PTNA 1X98A 4XX6A 1KXQA 4EK7A 3TR9A 2H8ZA 3WD1A 2E8ZA 5CG7A 3WMBA 5I3KA 3VIHA 3B3DA 4GNVA 3MMUA 2PDFA 2PDJA 1N55A 1JFXA 2GSEA 4ZQNA 4I8DA 1KXVA 4U84A 2GGIA 4PRWA 5C8BB 4U10A 3RX2A 3MSGA 1KXHA 4XISA 6ENLA 4DNMA 1CB2A 1OCQA 3N2CA 4UCGA 3S6TA 2PPGA 3WUEA 3RCNA 4G50A 1WA3A 4X0VA 1W9XA 2MNTA 2QXWA 4HHPA 1P7TA 4HGXA 2F6KA 2M1IA 2INZA 4U31A 2XH4A 2X09A 3KVJA 2A3AA 2WJFA 1F7BA 1AODA 1OZQA 5A6MA 1QBAA 2WZIA 4AMCA 4J2PA 2B7OA 1VEMA 3Q67A 4AD3A 3Q45A 3VIJA 1RHCA 1GPFA 1PZ2A 2J7DA 9XIMA 4OFCA 3VD7A 3B8WA 4YWIA 4MB3A 1WZAA 2GOKA 3O2LA 3EMZA 4DBSA 3NNTA 1EHAA 1W9UA 2QS8A 3IK4A 5BMXA 8XIMA 4L4LA 1WE5A 1LTDA 1KM4A 1VJZA 4J4NA 3WSUA 4ZO8A 4XZBA 4O15A 3UR8A 1R85A 3O6CA 1FD9A 2ZUMA 2QCDA 3WF3A 1DWFM 4B2DD 3KCJA 1P0BA 3LQLA 1GVSA 2YB1A 2FH6A 5ABFB 4P7QA 4PMDA 5AYIA 4PUEA 4CD4A 4Q4PA 3DHDA 2UZ5A 4NZ1A 1LP6A 2RJGA 3EKZA 3GZ3A 5AHFA 2C15A 3WLJA 4PCFA 1V03A 2VRJA 3W7DA 2Q8XA 4L7ZA 4XKYB 5H8MA 1Z41A 4NVTA 3KDNA 2BY0A 3VOFA 3CZKA 3WH7A 3OEXA 2PN0A 3M0JA 1AQ0A 2CERA 1FWNA 1XH0A 2DUAA 1IR1A 4IP7A 1GYMA 1VCGA 1IYXA 3NIYA 4DF1A 4BJHA 4ODKA 3RPMA 4JIQA 2NZLA 4B5NA 4C1NA 2OEJA 3SCTA 3NEVA 4AIUA 2ODOA 1ADOA 4TW6A 2ZRUA 4DUXA 4C7FA 1I4NA 9RUBA 1U79A 4DXXA 2I1OA 1OF6A 4KFOA 4QJ4B 3R25A 4Z1DA 3W4RA 3AZSA 4QCFA 2IS7A 4QDMA 2Y88A 4NI8A 4GZJA 2I9UA 5ABEA 1JCXA 4D8LA 2BXZA 3T55A 3VMPA 5I98A 4AW7A 2VEMA 1C8QA 1UWRA 3WL0A 3U9IA 2XP5A 1B9ZA 4GE8A 3CIWA 4FF7A 2DZBA 2PLKA 1HZYA 1TFVA 4MB4A 2ZA1A 4QJ3B 1UH4A 2ZX9A 1UKSA 1S38A 1LDCA 4H6RA 3NPUA 3EBVA 4L4PA 1ME8A 4CN4A 1FWFC 3FVMA 1E9ZB 2GGHA 2VNCA 3G18A 3H4XA 4GGQA 4QLKA 4WDTA 3JS3A 4OWGA 3TYDA 3ITOA 5J5DA 4QQUA 1FWAC 1IF2A 4RLIA 1XLIA 1IZKA 3KOXA 1JZ4A 1MW2A 1XLCA 3T44A 4ZSUA 3P3BA 4JX4A 4F0MA 3VNDA 2WZTA 1K7EA 1F6YA 3BE7A 3NFUA 3RCYA 2BY1A 4IQJA 1E73M 4JAWA 4O0QA 2VDGA 3HV9A 5T8GA 4GKTA 4O16A 3MBFA 3W02A 2J74A 4AZCB 2PBGA 1RP9A 3T81A 3KBWA 1V3HA 3KFTA 4XD6A 3AYSA 3H24A 4JFIA 1EWEA 5HUPA 4GUGA 3OBKA 1KRMA 3TFXA 2C18A 3AC0A 3IGXA 3XIMA 2VTFA 1Z6KA 3URBA 3THUA 4IMEA 2GUBA 4I7UA 3UG8A 4C5ZA 6TAAA 2OYLA 1V0NA 2OXNA 1CEOA 3KRUA 2C3ZA 4O8AA 4PEEA 1SZRA 4QROA 3TA6A 2F38A 1V3MA 2DSZA 3QPEA 3C52A 4AVOA 2JK2A 4PUWA 3KOWA 3VC6A 1FJDA 2XSAA 3LLXA 1EJWC 3MUAA 4HNNA 2V81A 4WKHA 3UEQA 3GKAA 2QZRA 4UMCA 4NJIA 4DJDD 3TCSA 3N4EA 3H7UA 2VUNA 1V02A 3PSVA 3LEPA 3QHOA 1HVXA 4UBPC 1OIMA 4HZ8A 3GXPA 2R24A 5JH2A 3HPAA 4LCRA 1FXPA 1F3TA 2GQ3A 3S5YA 2BY3A 4Y9NA 1PB0A 1MQRA 3A12A 3BK0A 1LF1A 1QNSA 1HO4A 3TP4A 4PL1A 3VDBA 3SSZA 5HKGA 5DXYA 4FIRA 2XGZA 5A5WA 4P8VA 1HL2A 4WKAA 3O7UA 4N4PA 1FWCC 1UPMB 2Y24A 1TKKA 4G7EB 1A5UA 1RALA 1XUUA 4K7YA 4OZOA 1QPFA 3GVWA 1JIBA 2QPUA 1EO5A 2CLHA 5CZJA 4JY9A 1W1YA 1H60A 2QUVA 4RX0A 4RW5A 1K7XA 3NOEA 3RX4A 1G94A 5CPMA 1B1YA 3WK0A 4JTCA 3O5OA 2J78A 4DHGA 1IGWA 3GD6A 3BAIA 3LGGA 1CXIA 1LBFA 1UC4A 5FA5A 3PBYA 1CPUA 1N82A 1KCXA 4HU8A 3B06A 3EA2A 1M04A 4NP7A 3C56A 4JQ2A 1WDPA 4NAFB 1FDYA 2V3EA 4KIEA 3KTSA 1M3UA 1DHKA 1JDFA 2DG9A 1H4PA 5C7VA 3MS8A 1T40A 1KM1A 3BJTA 4FLQA 4TTGA 3KL3A 1I2RA 3W23A 3GB6A 2CLLA 1Y5WA 2E1DA 2FZ8A 3IV8A 2EPNA 4NY2A 1W5OA 3ITTA 3DFYA 2ZRXA 4A2RA 5IHSA 2OYKA 4M80A 3LSBA 3O5QA 4AFYA 1HP4A 8RUCA 1O5QA 2QJJA 1X6NA 4LRSA 3BMXA 2CHOA 2WZMA 1XRSA 2Z25A 1R6WA 3GM8A 3BQ5A 1H7XA 2ZC1A 2KX9A 2DW7A 1MWOA 4ZB5A 5JH1A 1CI1A 2VC5A 2WMJA 3N6JA 4Z0SA 3SURA 2NT0A 4CU8A 1E0VA 1FAPA 4DXKA 5BXSA 4XTDA 1EJRC 1EJVC 1Q4NX 1QCWA 1UBSA 1XH1A 2RH9A 2YYUA 3PK7A 3QEZA 5M03A 1ZGDA 2C1GA 3VNLA 3SRDA 4NYYA 2INFA 3T4WA 3GSMA 3U0HA 4G7FA 1Y0OA 1TCDA 3CM4A 1IWPA 4O8RA 2RGMA 1XYFA 1JAEA 1XM3A 1QNQA 1FBAA 1Z32X 2PWGA 1OK4A 1H41A 1A0EA 2AMXA 2YLLA 2EPMX 1PVNA 5JIPA 2AL2B 1GTHA 4QITA 2I5QA 1IXOA 1TWSA 3W7KA 1BVWA 1DBTA 1GZ1A 1TRIA 4B16A 3NM3A 4DJFA 1TPDA 3O5DA 4C6PA 3CEUA 1I8JA 1E5JA 1K8CA 2DT0A 2YXGA 1CGYA 4GQBA 4ZOBA 3VA8A 2BLEA 3M64A 1E6QM 3IJ8A 3KVMA 4PMVA 3EDDA 4JIHA 3ZS4A 3CHFA 1KCZA 1VFOA 3UGVA 2CLOA 4R33A 5KZDA 2ZZ3A 3ISIX 3SEPA 3VOHA 2IKGA 2V67A 2NUWA 1NQ6A 3E0IA 4UQDA 4JHOA 2OG9A 3HPZA 3B04A 1J4RA 4S3AA 4Z1YA 2D9FA 3TNBA 4D1JA 8XIAA 2E40A 3URNA 4KQNA 1Q6RA 2OFNA 3PR2A 1ECQA 3WLRA 3M0LA 3H2OA 1W54A 3CHEA 2QV4A 5JMUA 3LXBA 2EPHA 3CTLA 4KBXA 2G95A 2QIWA 2R1NA 3KADA 3RIKA 3SY8A 3H2NA 4Z1BA 3PTQA 2VR5A 4PUKA 3O5LA 1TO3A 4S3FA 3SIMA 3B0UX 5FJPA 3PNUA 1TV2A 3GBDA 3VOGA 2V5CA 4HD5A 1IGSA 3WZ0E 5LSMA 1MFUA 1KM0A 4E2OA 3FHQA 1T41A 1F4AA 3EDJA 3QQ0A 3WBXA 3GTXA 1J96A 1HP5A 4D6IA 3VDGA 3W6MA 1NH6A 5G2IA 5HBFA 1J4EA 5E09A 4MAZA 6ALDA 1QOXA 3WNLA 5HNTA 4DJFD 1KTNA 3L0NA 3NCOA 4HMEA 2FB2A 5D8WA 4TX9A 4RXFA 3S2MA 4HZ7A 3THQA 1A5BA 3VINA 3F2DA 3QV7A 4Q8UA 1EX1A 1AK5A 2ON3A 4IIDA 2XP8A 4C6DA 1FDJA 1TELA 1BD0A 4JTGA 2B7PA 3NQVA 4IMGA 5A6BD 3MDWA 4RDZA 1VPYA 1PDZA 4O18A 1J4HA 2ZWZA 1HL8A 3ELFA 4O28A 1DWIM 1XRVA 1DIKA 4IICA 2D73A 4KMQA 3SCSA 1D3GA 3CUIA 2WHLA 3DU0A 4PODA 2PGRA 3IACA 4QXIA 4AF0A 5BU9A 3GPKA 3VDAA 1M5WA 1GONA 1L6GA 4IX0A 4PRRA 2LLEA 5D9PA 4EIVA 3CUGA 4ZQOA 2DJLA 5I3GA 3G8EA 2ZICA 1MUMA 3W7GA 2OVLA 4BQ2A 4P61A 1JNEA 2PP3A 5AC5A 1L6SA 1XW8A 4IQ2A 2YB4A 2OEKA 3TJLA 3SQMA 1OCJA 5FI8A 4HN8A 3TC7A 4Q8MA 3EKLA 3ZWSA 3E12A 1HJSA 4YWSA 3W1RA 1XRTA 2HWGA 1MQQA 1OADA 2XTKA 1SZGA 3L4XA 3TJ4A 1KKRA 4X60A 2BY2A 3I10A 2EG6A 3GXNA 4C5YA 3T08A 3GYCA 3L0GA 3KBJA 3EWCA 4W86A 4G56A 2DZAA 3PSWA 1V6WA 5AY7A 4ZFMA 1Q1CA 3GXMA 3CWOX 3C0SA 3UVIA 3AWOA 3QRHA 3B9EA 4TUFA 2ZRVA 3M5VA 5HNNA 3CHCA 3P62A 6REQB 4FLRA 3OYZA 2D20A 4K38A 2UV8G 4XQ6A 1J6OA 4U4MA 4WUIA 4QS5A 1LL6A 4UOJA 1HKIA 4I6KA 2Y8VA 1X6LA 3NSXA 4H9TA 2PCEA 5LNVA 2PSNA 2QPXA 4L9XA 3EOSA 3O5JA 5EMMA 4NSBA 1Q6OA 3S0CA 1S2CA 3BARA 3KABA 4CNOA 1OFQA 1NMWA 1E1FA 3I3EA 4JDYA 1DPMA 3H21A 3N1AA 2CZDA 3L23A 1AH4A 2PS2A 3MTWA 4M7TA 2DIJA 1GCYA 3UT0A 1SW3A 4KKXA 1Q6UA 2QCMA 3TN4A 2AAAA 4LVGA 4UMBA 4MGVA 1ZU8A 2XZ9A 3E1F1 2E68A 1W1A1 3SFWA 1UH3A 1P5QA 1P1XA 2INEA 2Z7KA 3WF2A 2RDXA 3URAA 2W62A 4YTQA 1PTAA 3T40A 3UNTA 4D6CA 2YW3A 4DRMA 4WOZA 3W1MA 4O0KA 1MRQA 1SJCA 2HVMA 2C79A 5HOSA 4UC5A 4Z2LA 2WWDA 1TV4A 2HNHA 4UTLA 4JTSA 4J3VA 5IBXA 3WNPA 4JL2A 1Z48A 4H8VA 4MSSA 3SUUA 2V69A 1D9EA 5H8PA 4UFMA 4RZ6A 1I2OA 4B4HA 5HULA 4FOUA 1MFVA 4WXYA 1F2JA 3P67A 1UH2A 1RZMA 2OYMA 3G3MA 4MYAA 3L21A 4LBUA 2YL5A 3T6CA 4W9QA 3C61A 3N19B 4DZ5A 1LOLA 4P5UA 2UY2A 4H6KA 3MY9A 3Q58A 3KAGA 1QNOA 2QPSA 3ITYA 5JQ9A 1WXJA 2ZX5A 4TO8A 4LF2A 1R2TA 4FS9A 3A9IA 4JQ1A 3HU7A 3GW3A 2XFWA 4AWEA 3NAVA 1EGZA 1DJHA 4DI8A 2V0TA 1J10A 1UR8A 1D7KA 1YMYA 2WMHA 4RZBA 3WQWA 1RD5A 3GVVA 1FWRA 3KRSA 2P88A 3JRKA 3CGNA 4GY1A 4LGXA 2X30A 5B7ZA 5RUBA 1WQ5A 3E6EA 4QR6A 1U1HA 5EA9A 2VMFA 1YBQB 3GTIA 2PLCA 1AJ0A 1QJWA 3VO0A 2WM0A 3OQEA 2B4GA 4E5TA 4S38A 4QE1A 5FD0A 2AQOA 3GDLA 4PFHA 1FH7A 2R94A 1KTCA 4H00A 1WKDA 4G7EA 4F8XA 3P7YA 1LUCB 4IMFA 1TE6A 3UWQA 1Q66A 2V5BA 5T9CE 4DPPA 3R12A 3W7MA 4LBRA 3CUFA 1V5XA 1TIWA 1SFJA 2DUXA 5JBFA 4PULA 1SR0A 4YYFA 2WLYA 3A24A 3PM6A 1M7PA 1J5SA 4REQA 4I7VA 4XZIA 3CS2A 4C1LA 4D8AA 2C7FA 3QTPA 3SGZA 3E96A 4JTIA 3WO8A 4YJ5A 1M1BA 3VNIA 1EDGA 2E6YA 4BF9A 1BXCA 5BWFA 4GUJA 1F4HA 1RXOB 4WSKA 3UQIA 3E2QA 3EOLA 3IIPA 3QJAA 3U4FA 5C9RA 3DHPA 3C6CA 3SJNA 3ZYZA 3WJZA 2G50A 4UTTA 4O1FA 1ENUA 1XP3A 2FIQA 4FX7A 2HV5A 3QN3A 3W37A 1OINA 4K37A 1AW5A 3U2OA 1FWEC 2ISFA 4UFLA 5BRPA 2ZA2A 1PV8A 4MWAE 1XJBA 1AMYA 1KV5A 3V3WA 1Q85A 1QU4A 1W1B1 1P0KA 4XVDA 2NQ5A 1KM2A 3GNOA 3A4XA 4OGZA 3KAIA 1HKKA 2OR2A 1XV8A 4QG8A 3E0WA 4GGHA 4XZMX 1KO0A 4KEVA 4MVAA 1OFDA 3MZ2A 4S2BA 4NRRA 3VIFA 1B57A 1NWUA 2NQLA 3N17A 4H2CA 1B6CA 2JALA 3PR9A 3RITA 4DO7A 1V3LA 4IJCA 3AAMA 2VR4A 3DXIA 2CFFA 5D09A 1XYCA 3CT2A 3W01A 3Q94A 3U2ZA 2V6AA 1CCWB 1Q6EA 1GVYA 1FFRA 3ZOAA 1FP9A 3OLGA 4QEEA 3C0QA 4V1XA 4O1EA 3BLEA 3P80A 3WK3A 4Y9PA 4B3ZA 2HBVA 2WYSA 1QT1A 4NX0A 3G1AA 4CQ8A 4NYUA 3R4IA 4GX8A 1LG2A 2Z1WA 4PBEA 4FNQA 1VBHA 2GVJA 4W93A 2QAFA 4LVDA 1KFLA 3S9ZA 2ZXBA 1J11A 1O66A 3R5EA 1W5MA 3AJ7A 3II1A 3VE9A 3EEZA 3PP7A 4S39A 2PV1A 3SN4A 5G5IA 1C90A 2B5UB 4UCFA 1EH9A 3CT7A 3LZ5A 2YBVA 3IJLA 3IK8A 4O12A 3B7XA 1UWTA 1UWSA 1KLYA 5KSWA 4GPNA 3DKLA 4AX6A 3FA5A 2ANUA 1LCOA 2Z4GA 1F3WA 3GLCA 1BL4A 4EPBC 3H2FA 3LM7A 1CNVA 3SCWA 4TR9A 4MJMA 3O07A 4K8HA 1W9PA 3PJUA 4Q8VA 4HHLA 1UHVA 2TODA 3S42A 1FHUA 1PIFA 1YTKA 4UTTC 3RR1A 4C65A 1RCXB 5GNZA 4IWWA 2J6VA 1XLDA 1C29A 4IXHA 4A3HA 3OVPA 2YA0A 3CNYA 2OSYA 4WF7A 3GW0A 1B4EA 2O56A 3VZXA 1JYNA 1EEPA 1E51A 3EB3A 2C16A 1RBAA 3W7PA 1ZBKA 1A5SA 5I2UA 5BW6A 4PMYA 6PTDA 3CHDA 3D6NA 2BASA 5I09A 1C9WA 3KP0A 1PBGA 4MPKA 4JGDA 2PI6A 4XAPA 1MNSA 4P8XA 2OT1A 1TWWA 3VMNA 2OQHA 2GJXA 1SPQA 4EE9A 2WHJA 3DFTA 3RPTA 4C6JA 4ODQA 5I79A 1ONXA 3L5AA 2CLIA 1L2UA 3N6QA 3ARRA 3L2IA 4I5XA 1ZFJA 1KGXA 1K03A 3WLIA 4IQDA 3PANA 3V75A 4EPKA 3EDKA 2BVYA 4QP0A 2PGWA 1OG6A 1TQJA 3H26A 5DQPA 1E71M 3TSDA 1RH9A 2QUMA 2VEGA 1B3OA 5ABHA 1P0DA 1W8GA 5LIUX 4HARA 3M5XA 4GUHA 1S5MA 4CCZA 2HXUA 5CGTA 1E6NA 2WOQA 1TPC1 1LOSA 3EOUA 2CZVA 3EWDA 4P2VA 3UZXA 2YL8A 1V93A 3P5ZA 1JYXA 4LWWA 3NL5A 3GDMA 2BODX 3A4AA 3E0LA 4NXKA 4S3KA 5F7UA 3HF3A 3IVUA 3T2QA 3WDPP 3LRKA 3WBWA 5CH9A 1BKFA 4G8TA 1OC7A 2G5WA 5C71A 4ZO7A 3NJ3A 2QJHA 1DJNA 2NVCA 4IFOA 3DIPA 5EBAA 2GDUA 4ICNA 4M6UA 2W92A 5T91A 1JXJA 3SN1A 3AZTA 3AMKA 2FQIA 3HPFA 1GGOA 4BQ4A 3NZPA 5FEWA 3GDTA 3BOFA 3UJRA 3HQNA 4FLSA 1EF3A 1K4HA 2ZE0A 3WELA 3T0DA 3LUOA 1ZL1A 1PKNA 1HTIA 3BL3A 5BZAA 4A6GA 1E56A 1S2VA 5JBDA 2IF4A 2IKHA 5HPOA 4YHEA 4IJRA 4S3DA 3PWIA 3T05A 3VTRA 5D02A 3S5NA 3GU0A 3MYPA 4F0LA 5M3WA 5E0KA 1NIUA 4LVBA 1XQKA 4AZCA 1GVOA 1KA9F 2IPFA 2QUTA 1J0KA 4GISA 4TVCA 2VD8A 4BI5A 3P61A 4ZPVR 3V0SA 5C54A 4PBFA 3QBUA 3VC5A 5DFAA 1F76A 2WNZA 3S1GA 4DYKA 1XBZA 3LA4A 2R14A 4Q33A 3MP3A 1JYWA 3WD0A 4CKQA 4IG2B 2F6XA 4FK9A 2X0SA 3PUOA 3W75A 2XUCA 2B31A 3VYLA 2IPWA 1MQPA 4POCA 1EC8A 4J2MA 4MZ8A 3CV2A 3MB9A 3WCZA 3TVAA 3PG9A 1D8CA 2OODA 2IQDA 1A0CA 2XGBA 1C9HA 1JQXA 2ZTJA 3JUGA 4MUPA 5GNXA 3O5EA 4HQVA 4PMZA 2KZHA 3U48A 1EP1A 2OGYA 3W38A 1YDNA 5KEZA 2XIJA 1UD5A 2CC0A 2X0YA 3HG5A 1EDQA 1UPPA 5F1UA 3ID7A 4YCPA 3FAPA 1OY0A 1XPYA 1PKLA 1HXJA 2XN1A 5I03A 1BTMA 2WMGA 2V5DA 4KF1A 4J27A 2WZHA 3TZFA 3G1HA 1CXHA 2XGIA 3OA5A 1KT1A 2YBUA 2OFJA 1FWTA 3H7VA 1XGDA 1F8IA 1KD0A 1AW1A 2D3NA 3TYCA 2V38A 2D69A 3CPGA 5FESA 3GXIA 4A21A 2Z28A 4PB5A 5F2MA 4JTEA 2WC3A 2HK1A 4Q4KA 2Y78A 3B05A 3LLDA 2NSXA 4CGTA 3ONCA 1IXNA 1A5LC 2FGBA 3OB8A 2X1RA 2G97A 3LCGA 2DJXA 1SSGA 1NARA 3DC8A 1JF6A 4XBKA 5EB8A 1ZAHA 1TV7A 2VEKA 3MHFA 2AWGA 1IIGA 5TBOA 1O1ZA 2XP3A 3C4UA 2HBXA 3QW4B 4NAFA 3HURA 1HT6A 3N18A 2XHYA 4QIBA 4MJZA 5I24A 4I6VA 1S2WA 1X1ZA 3UWWA 3TU9A 4GA8A 5HW6A 2VYOA 4F2BA 3W27A 5JUVA 3EXRA 3AYVA 4CU7A 1M7JA 2WO5A 1NWRA 4LALA 3RF9A 4IISA 1XLLA 2GDVA 5HA7A 3VCNA 4CQCA 2YA2A 2HDJA 2MLYA 2ZQUA 4PC8A 3T9PA 2GJPA 3FDGA 4IUGA 3LOTA 3STCA 1JCHB 4FNRA 5KZEA 1TUFA 3FY1A 1V02E 3C0LA 4UFIA 4ZENA 1W1PA 1FFQA 1JXKA 3OZOA 1FWWA 3M07A 3JVAA 3RN6A 4PCNA 3OIXA 4O1CA 3P8IA 3LPFA 5D2TA 2DZVA 1GORA 4LU0A 3FJNA 3TMLA 3AISA 3GG7A 3A23A 1CIUA 4JKMA 2ZUVA 4J4KA 2X2GA 4HA0A 1B9BA 5CLWA 1TR1A 4KH2A 4Z1CA 4QT2A 1A3HA 4MY8A 1GG1A 4NIRA 3CIXA 1A49A 3DFPA 5D38A 3BV7A 4AZ7A 5A2BA 2WAGA 4LQ1A 2WM1A 3OYXA 2Z24A 4PEKA 1C93A 3H12A 1ZBVA 4LUTA 2TMDA 1GVIA 4UTMA 4U28A 3S4TA 3CB8A 3F7JA 4GH3A 1DTNA 4V1YA 2EXOA 4ROQA 2FGZA 3C86A 3W7HA 4IXXA 1FCQA 2XYLA 4GABA 4C6FA 4Y2WA 1WDSA 5U4NA 1Q6IA 2YSWA 4DJDC 1Q63A 3FAXA 4ERAA 4HA4A 4XZHA 2YYTA 4L56A 4L1GA 5FCZA 3OG3A 1GEQA 4V28A 4QISA 1OBAA 1ITXA 3CZJA 4QE5A 2WMKA 1Z42A 2C71A 2Z2BA 1WPCA 3HA1A 2LPVA 5GJPA 4OT7A 2HISA 3NSNA 3MQTA 4EOUA 1BTCA 3QZAA 3LCHA 1CZ1A 3HZ3A 2XPBA 3DHUA 5SWUA 1JZ2A 3L2MA 3M0IA 1FKIA 1HJWA 4P8UA 1CXLA 1M01A 3N9RA 2OO0A 1WDDA 3SRKA 1R30A 5AC6A 4FIQA 4C6LA 8CGTA 4IH3A 1BAGA 1WDQA 4YVPA 1RJRA 2VR2A 4LW7A 3RM9A 4GZ7A 2PTDA 3SCRA 5HTGA 1NWSA 3W70A 3GR8A 3OW1A 4GQRA 4JICA 4NJJA 3PZVA 3UJSA 4GD0A 1XC6A 4FNSA 1R46A 3WNKA 2WKJA 5AKQA 4DZ3A 1G6CA 3O5PA 5HUOA 2QDGA 5CSYA 4M3PA 4DRJA 2CYGA 1BSLA 2QGHA 4DWSA 3CIVA 4AD4A 4NF7A 4LAUA 1PTGA 4DZ2A 5DBUA 3SCPA 5I3HA 1D7IA 3S47A 2OJPA 3OVRA 2FTYA 3CZGA 4HCDA 4M0XA 4IOTA 4IP5A 4HBOA 2WW5A 4DZIA 4EXBA 1R5YA 4F9JA 2XP9A 4I9TA 2BBFA 1LRQA 2ISSA 3PZMA 4PMRA 2H9AA 1AZ2A 1VCVA 1JDAA 2AQWA 3S1VA 4PB4A 2NX9A 4XD5A 3CQJA 4FEZA 2GOUA 4WY0F 2VZTA 3EAUA 3W82A 3GO2A 4DT4A 2BG5A 5MF5A 3HGOA 1J93A 1E4NA 3S8HA 2CXEA 5LNRA 2GSHA 3O5GA 3RX3A 4G9PA 4N4QA 2OMAA 3QPYA 4CD6A 2M08A 2Q01A 3N13A 1UZ1A 4JIPA 4PUMA 2P76A 4KCVA 3UD6A 3DYMA 4KWWA 3GR7A 5TD4A 4DJFC 1DP0A 2D23A 1CXEA 2G37A 4B91A 3HB9A 4O4VA 3B97A 3BMBA 3KW3A 3LD5A 2DPEA 3PAJA 5MKGB 3DFQA 2BHZA 4LEQA 5FF0A 2ZUNA 1CLVA 4MM1A 1ADDA 1UP3A 2NT1A 2BB0A 1A5MC 2WZEA 1OFBA 4PMUA 3MHGA 2G41A 3CQKA 2J7CA 1TZ7A 1QR7A 4FMVA 1VLIA 3B40A 3NVDA 4GZEA 3KBMA 4GFIA 4JNZA 4NAEA 1L6FA 1GOQA 2QF7A 1GJWA 1DL3A 2Y89A 1TPFA 2EJ1A 4KERA 1TZZA 4ZCWA 4L6HA 2YOCA 4MG4A 4BA0A 1XBXA 5EMYA 3RRXA 4R5EA 1QI2A 4QAIA 2DT3A 4QSFA 3IAQA 5CCZA 3FXYA 3TYUA 3CZLA 3O6YX 3A3HA 4Q4SA 3B9DA 4UTUA 3FOKA 4AIOA 2PA6A 2WHMA 1V51A 2NUYA 3N9KA 5CPLA 3C8NA 4LOCA 2EGZA 4WEVX 2FGLA 5CLTA 3PUDA 2ZVIA 2PPNA 4Q32A 5HAOA 2G4FA 4GC3A 1IEIA 3O05A 4LY8A 3AZRA 1EO7A 2E5CA 3TTQA 1M7XA 1X96A 1YATA 2REQA 3F2BA 1JVNA 1W2PA 4HCHA 2NWRA 1EPXA 5LXXA 4X2RA 4MFDA 1QPQA 3VKJA 1XLEA 1XL9A 1SO3A 3W22A 1XS2A 4GRSA 4FZIA 1JFHA 1TREA 1VPQA 3BJSA 1L8NA 3S1WA 1ZPTA 2AQVA 1MZHA 3EKGA 3RU6A 5BYWA 3VNYA 2AOSA 2Z6IA 5DO2A 5AVNA 1ZB5A 3VNJA 1GOMA 4P7OA 3UXKA 3L4TA 5I23A 3MP4A 3OODA 1KGUA 5FL1A 3M46A 4PL2A 2MANA 4UQ9A 3CWHA 4HNUA 4HOZA 3LBMA 5HATA 4J28A 2FHFA 4QJ5B 5CPTA 1AA1B 4LBSA 3RLUA 3V1HA 1OD0A 3W1QA 1OEPA 4ATDA 3LK6A 4MWAD 5FJRA 3NEHA 3I7QA 6CGTA 3LV6A 4G6CA 3CMJA 3AROA 4UTIA 3FKRA 3BGAA 1A3WA 3TYEA 5DRIA 4D6EA 1XSJA 2P4VA 2PEVA 4AY8A 1EKOA 4HZ6A 4XZ9A 1TMQA 2Y70A 2ZCGA 1IR2A 1FH8A 4ERGA 3UR5A 1R3TA 3LPPA 2C1HA 4ZPTR 1I2NA 4GIEA 4AX7A 1QATA 5CJNA 2OZTA 4RE0A 3GNNA 1V6VA 2J77A 4HB7A 5IBXC 1AQHA 2VX5A 3UI6A 4S3JA 2OZ0A 3VCCA 3P74A 3KBSA 4RDYA 3ZWTA 1J0IA 7REQB 3LI0A 4S1FA 3WUGA 2OLHA 2PFHA 2X1TA 1Y7VA 1YPXA 4LAWA 1GVEA 1XGEA 4Q4QA 5LGZA 1NTHA 5E70A 3S1XA 4AG0A 4PCSA 1Q45A 3ARUA 1S1PA 3VD4A 1N8FA 4IPIA 4LAVA 2ZRWA 2ZZ4A 1U83A 3P6LA 3BOLA 2J9YA 1BLIA 1V6YA 3BO9A 3WLSA 3SSJA 3BPWA 2VQTA 3OGSA 4ODMA 5CZ0A 3B0PA 4JTTA 4ZXLA 2IQTA 2Y7DA 1QK2A 3AIVA 4J3TA 3IRDA 4JS3A 4H41A 3AOFA 3APYA 4AHOA 1B3XA 1NU5A 1ZJIA 3L7RA 2D2GA 3V36A 5CBIA 3WK2A 3VGEA 4C6CA 2BX7A 2O4MA 3WQGA 1GUVA 2QT3A 4IQEA 1U22A 4RDWA 3WQ8A 3K46A 2IUZA 2GK1A 4YIWA 4IFKB 4LAMA 3MUIA 3O5FA 4IL2A 4JFKA 3AU2A 1WBHA 4HU4A 1EDTA 3W1TA 4Q8TA 4JCMA 3KL0A 1OVDA 4W9TA 1QI5A 4ACYA 1KBKA 3PZQA 1US3A 3W85A 3RG6A 3GNDA 1IEWA 1Q6CA 4O2TA 3BAWA 2ZDRA 1X8FA 4ZSTA 2OU4A 1QFEA 4KS0A 1FKDA 3WJSA 3FYOA 4L9YA 2JE8A 1Z69A 4DAFA 3MC5A 2OQYA 1FQ0A 5F4XA 3PZIA 5D04C 3TSBA 3QGKC 3L12A 3ZVHB 4OUIA 3TONA 1I6NA 4XZWA 1Q2RA 4ASTA 2KAUC 1MW0A 4JBRA 4ILSA 3V5OA 3TC3A 1JF5A 2ZZ5A 1XIMA 1E70M 1J8VA 3ARQA 3GBEA 4WXZA 4CEXC 4Q4OA 1QI3A 3GTHA 3VKCA 4XAFA 3IJ7A 1PIIA 1CGXA 3H2AA 2PTZA 3DI0A 2PLJA 3NL3A 4BQ3A 5CKSA 3RGTA 3SBFA 1XYBA 4QAWA 2B7NA 2DIKA 3O9NA 1PL9A 4YMZA 4PGLA 3LPOA 2GZXA 1GVQA 1J01A 1UQYA 1VFHA 2E0PA 2D3LA 3T0TA 1S2UA 2OGJA 1GOWA 3QY6A 2G3IA 4LTSA 2YJQA 1W3KA 2V5KA 3TOPA 1SZFA 4GWEA 3NPWA 1A47A 4KWOA 1CBGA 3B0VC 1IIHA 3S3GA 4J1OA 1J12A 4K3ZA 1OYBA 1TV3A 3DBNA 4B3KA 3GTNA 1YNQA 2VZVA 3FKKA 1HVQA 2D2OA 1ECEA 5DXXA 1SVDA 4DWSD 3A64A 1H0IA 4B9YA 1OFRA 3MKCA 1KWGA 1LZOA 1JR1A 1UR1A 1FH9A 1YADA 5GPGA 3LHWA 2CKSA 3ENLA 1XLFA 1E4LA 1UOKA 4XKYA 3UP8A 2XVNA 4N19A 4CNNA 1UUOA 3W73A 3NQMA 1ZRQA 2HVNA 3V5CA 2W27A 4L6DA 2X1UA 3LG3A 3ANYA 5G4WA 4DX3A 4RL3A 3M0MA 1JPDX 5CC6A 3GC5A 4Q8OA 4JTQA 1FKKA 1UMLA 3AALA 3FYYA 5FACA 2E1WA 3W1XA 4B92A 1Q65A 2P0IA 1SUXA 4MNKA 4M81A 5LIKX 3R1ZA 1DWHM 4A35A 3OU8A 7TIMA 5DMNA 3R43A 3GNXA 3CGMA 2O7SA 3XINA 1XDLA 1JCNA 3OLEA 3NXLA 5LGXA 1CGUA 2FKPA 4AB4A 2XP7A 2P3EA 2JEPA 4YXGA 3NOYA 1QAPA 4HSNA 1ISYA 2I16A 4OKDA 2RQSA 2FTWA 2ESCA 1U2YA 4Z0JA 4K8GA 2QCLA 2VVSA 1GKPA 4AWSA 4TW8A 4D8ZA 4BR1A 4FX6M 3RCMA 1VEOA 3M5YA 4GINA 2H9AB 3RXZA 3TTYA 3JZUA 2E6AA 3LRLA 5HQEA 3MV01 1A5CA 1F6PA 4MADA 2RDTA 2W4XA 1JCLA 5T9BG 3SB0A 4IQCA 3B8UA 1G4PA 4KPLA 2F61A 3L4YA 3TYBA 1UWAA 4QGCA 4LNYA 1U5JA 2D22A 4J3ZA 3SUSA 4ZO6A 3O15A 1R2RA 4PE8A 1WKFA 4HCLA 3NL2A 3SCNA 1BKHA 3I7RA 2BGQA 4JKKA 1OZMA 2XH0A 2GVLA 3W7RA 1GJUA 5I00A 1W91A 2OO6A 4Z42C 3VUSA 4M6VA 3ECQA 3O5IA 3GQYA 1T6MA 2WANA 1IZCA 4A3QA 2V5LA 4M5PA 3NQEA 3P5YA 4W8AA 2GQAA 2BHUA 3BH4A 5FL0A 2XP6A 4K68A 1EBHA 3DFHA 4HMDA 4IGSA 1YHTA 1E72M 2YR1A 3VZYA 3WEMA 3CJPA 1DOSA 1JAKA 5BXTA 3NDYA 3I6TA 2E67A 3GUWA 1SR9A 1KM6A 5DMYA 2ALDA 5ABTA 1M7OA 1IV8A 2G3MA 4QEHA 4S3EA 3H22A 4E6MA 2Y8UA 1DIEA 4JIIX 4O11A 1L2QA 1DYSA 2ZC8A 4W8BA 1W31A 4KIRA 4DUWA 1HKWA 1YQ2A 4RUBA 5EPDA 4J3UA 1TVNA 3RMJA 4JIRA 5AYZA 2FZMA 1EGMA 2KGJA 2JKEA 1HXVA 4UFJA 3FXGA 1GHRA 2DH3A 1XFBA 1MMFA 4ZODA 1E6XM 5C70A 4YS1A 3ME3A 5LXEA 4MIMA 4ZR8A 1VBGA 5LA2A 1ZCCA 1GEHA 3WQ4A 4H8NA 1UROA 2R6OA 2GWGA 1ICQA 4KW2A 3TXVA 1C3FA 4XVEA 4W7WA 1THFD 1PX3A 3LXCA 2J7HA 1ROTA 1PE1A 3EDEA 3N3MA 3A6OA 4EX4A 3OZYA 2J8GA 3V0UA 4L61A 4DM2A 5J6EA 3BMVA 1XYLA 4TOQA 1VBRA 4JX6A 5K4ZA 3CC1A 4DRKA 3QQ1A 1RR2A 2GYIA 4DWSC 4M56A 2B7QA 4AZIA 5IHRA 3TTOA 2K8IA 2ZQVA 5EYWA 1EJUC 1ZTVA 2NXHA 4JPGA 1J0YA 4MSPA 1IZJA 1DHPA 2I17A 4CD5A 4J5NA 4S3CA 5I3IA 3ARWA 2KE0A 3ARPA 2FFCA 4LJ3A 1W5NA 1JPMA 1UQZA 2P53A 2WLZA 4CNPA 4N6FA 3LDVA 4DBWA 2PD9A 1F74A 2RUSA 3KLLA 2QCGA 5E9XA 1ODUA 5F2LA 3DEQA 3PZUA 2KO7A 3PZOA 4CD8A 1NWTA 5AYXA 4LEFA 1RPKA 4RE4A 3TTEA 1KFWA 3PY2A 1YDVA 3CPRA 3WFZA 2NLYA 4EXQA 1TPVA 4AZ5A 2Z7GA 3ZO9A 1IT0A 3A5FA 1ZAJA 3HIJA 1UG6A 3VKKA 2O4QA 1PDYA 3TMQA 3NQGA 3MI3A 2UY3A 4DH0A 4UWMA 3QFWA 1OYCA 4KRUA 3ZT7A 1JEZA 2EKCA 4INFA 6TIMA 3QHNA 1V8EA 1HJUA 1EYMA 1HG3A 4GYJA 3CBWA 4JEQA 1O4UA 3FX4A 4ODLA 4S3BA 5E9AA 1H0GA 2FKEA 1JNSA 1PKMA 1TPUA 1QK0A 2ZIDA 7REQA 4A3YA 1GOKA 3HBLA 3T2OA 3DUGA 1MO0A 4RW3A 2XZ7A 2V3DA 2Q3RA 3CK5A 2QDHA 4LB3A 3AS0A 2JEQA 4N0RA 1ISZA 1W9VA 2XFYA 5CPSA 5EMLA 1E15A 1Q7MA 4REQB 1ZQ5A 1XFCA 5D2XA 2HQAA 3SUWA 1K8YA 2XIIA 4DO5A 2Z1KA 3T42A 1TTIA 1S5TA 3O1NA 4WJEA 2GUYA 3POHA 4A3RA 3ARZA 3O63A 4I3GA 4JTLA 4JFWA 1VFSA 5HJYA 4B4FA 1YLVA 2RURA 1GRJA 4UFHA 3STGA 2VXNA 3RK8A 4MWAB 4L80A 4M24A 1PZ3A 1R87A 4GFSA 4FF5A 1ZJBA 4L1XA 3LYEA 5H91A 1LQ2A 1BYDA 3ZFHA 1OYAA 4E4UA 3ZT6A 2DZWA 3BC9A 2VCCA 2J9ZA 4HBKA 1GWJA 3R58A 2CXGA 3USBA 5EFDA 2AL1A 2J75A 2VEPA 4Y9OA 4DM1A 1SW7A 3GH5A 1HKMA 3B0XA 3PC0A 4XV0A 4OU1A 2Y4SA 2E6FA 1XIGA 3PBUA 5LNUA 5ABFA 2QJNA 5D9OA 1OM0A 2PUZA 2VFGA 2W5FA 3N2TA 5A6LA 3WEZA 1HQTA 1VF8A 2ATSA 1CGTA 4OV4A 2D0GA 4CNTA 1MRAA 1H51A 5H6HA 2WHKA 3VI2A 3N25A 4GLEA 4JN7A 2WMIB 4KEUA 2Q02A 3UZ5A 5JXQA 3GE7A 3EOEA 1QOPA 2H3DA 2D24A 2I9EA 1PBKA 1HKVA 4GYPC 5EGRA 3AS2A 4US6A 3SY1A 2WPGA 1ZP3A 1JUKA 3K5XA 5FEPA 1WZLA 2QUNA 5LIXX 3KACA 5A6SA 2V82A 3IUDA 3DBPA 4ICCX 3G1DA 4TMCA 4XO6A 2B0MA 2BXYA 4US5D 3NTPA 1TB3A 5A8GA 3G8RA 3IGUA 1JRBA 3WBAA 5C2GA 2YGYA 4LFYA 1F8MA 5HK4A 4Q8QA 2Q3OA 3E0VA 4UOQA 5L9FA 1OGGA 3LM3A 5HJXA 2E28A 1MEIA 3PPFA 1EYWA 3WDHA 1ZJHA 1ODZA 2ADAA 3KUMA 2QW5A 2BTMA 2CETA 3W9ZA 3RYSA 4YNGA 1WAWA 2E6DA 4JFJ