3O5PA

Fk1 domain mutant a19t of fkbp51, crystal form iv
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 35
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5pA00
3TC5A 2PPPA 3UI6A 3O5PA 1W26A 1L1PA 4TNSA 3TDBA 1NMWA 5HW6A 4TW6A 2KE0A 2D9FA 3CGMA 3O5RA 1F40A 2DG9A 2XPBA 2XP8A 4JFLA 1F8AB 2DG4A 2KO7A 2OFNA 2PPOA 2PV3A 4JFJA 1ROUA 2MLZA 3O5JA 3FAPA 2FKEA 1NSGA 3VAWA 3UQBA 2RUCA 1JNTA 4IQCA 3O5LA 4W9PA 3KAFA 5D75A 3UF8A 4G50A 1ZCNA 1FKSA 1D7IA 1FD9A 2XP9A 2ZQUA 2AWGA 2N87A 4TW8A 1NMVA 1FKIA 1D7JA 1JVWA 2PV2A 2UZ5A 4JFKA 4O2TA 5HTGA 2MPHA 2JZVA 4DRPA 4IPXA 1Q1CA 3NRKA 3ODKA 4J4NA 1J6YA 3JYJA 3KAIA 2PV1A 2RUQA 4ODOA 3MDYB 4MGVA 3O5KA 5HKGA 2MNTA 3UI5A 1J4IA 5B8IC 1Q6UA 1EQ3A 2Y78A 2PBCA 3O5EA 2MLXA 2ZQTA 2XP4A 4W9OA 2XP7A 1J4RA 1Y0OA 4LAVA 2K8IA 3RFWA 1FKLA 1BKFA 4DRIA 2F2DA 1D7HA 2LGOA 5DIVA 2M1IA 2ZQSA 3KCEA 1Q6IA 4LAYA 2DG3A 4MSPA 3RGCA 3IKDA 4GIVA 3UI4A 4DROA 2VCDA 1FAPA 2LJ4A 4BF8A 1FJDA 2KR7A 3OOBA 4ITZA 3B7XA 3IHZA 2XPAA 4DIPA 1TCOC 4QT3A 4ODNA 1T11A 1KT0A 1D6OA 4DRHA 3O5DA 2M2AA 3KAGA 4R0XA 3I6CA 3NTPA 2ZR5A 4QIBA 4ODPA 4ODMA 3WH0A 1YATA 2M08A 3TCZA 4JFMA 1N1AA 2PPNA 4DRNA 4FAPA 5I98A 3UQIA 1FKDA 1FKGA 4JFIA 5HT1A 4W9QA 2KI3A 2Q5AA 3GPKA 2RSEA 4C02B 2F21A 3PA7A 2XP5A 3O5OA 4QT2A 5DIUA 5BXJA 1Q6HA 2ITKA 1FKTA 1FKKA 3JYMA 1C9HA 1ROTA 1ZK6A 3KZ7A 1QZ2A 4GGQA 5J6EA 1QPFA 5HW8A 1U79A 4FN2A 4TX0A 3KADA 4IQ2A 1FKBA 4LAWA 5GPGA 4ODRA 3KAHA 5DITA 4DH0A 4ODLA 4DZ2A 1QPLA 2F4EA 2VN1A 1PBKA 2LPVA 4G2PA 4DRQA 1HXVA 4LAXA 2FAPA 2KFWA 3IK8A 4TW7A 2ZQVA 4N19A 3O5GA 1PINA 1KT1A 3O5MA 3O5IA 3NI6A 3PRBA 4JYSA 1FKJA 2ZR6A 4TYOA 3KACA 4DZ3A 4U84A 5HUAA 1JNSA 1BL4A 2LKNA 3UQAA 4ODQA 1A7XA 1EYMA 1M5YA 5HW7A 1FKHA 4DT4A 1FKFA 1P5QA 2XP6A 3EY6A 2MF9A 3H9RB 4DRJA 1J4HA 5HWBA 3IKGA 4NNRA 4DRMA 4J4OA 3LUOA 2KGJA 3JXVA 3O5QA 2IF4A 4U86A 4U85A 4DRKA 2MLYA 1R9HA 1B6CA 4ODKA 1FKRA 3O5FA 2RUDA 2ZR4A 3CGNA 2XP3A 2L2SA 1YW5A 3PRDA 5HWCA 2RQSA 3KABA 2RURA
chains in the Genus database with same CATH superfamily
2WK2A 2D9FA 1HKIA 4JFJA 1TFVA 4IQCA 3O5LA 3ARTA 3UF8A 2ESCA 4Q7NA 1RD6A 2N87A 1NMVA 4Q22A 4TW8A 4O2TA 4XAKA 2OLHA 1Q1CA 3B8SA 1GUVA 3JYJA 4DWSB 4MGVA 5HKGA 3ARWA 1EQ3A 2Y78A 4Z2IA 2PBCA 3O5EA 2YBUA 2XP7A 3AROA 4ML4A 2A3CA 4LAVA 4DWSD 3RFWA 1NWRA 1H0IA 2ZQSA 1Q6IA 3RGCA 4DROA 3UI4A 2VCDA 4BF8A 4MNMA 1E15A 3IHZA 2XPAA 2G41A 4QT3A 1T11A 1HKJA 2DT0A 3KAGA 4R0XA 4Z2JA 4QZVB 3NTPA 1EDQA 4LGXA 2M08A 1W1YA 4JFMA 3B9EA 3W4RA 2PPNA 5I98A 4JFIA 2Q5AA 3GTYX 2A3BA 3PA7A 4QT2A 4Z2HA 3WD1A 2ITKA 3JYMA 3ARSA 1ROTA 1QZ2A 3BMBA 1QPFA 4UDMA 4TX0A 5GPGA 4DZ2A 2WM0A 3WL0A 5DF0A 2ZQVA 4N19A 4IT6A 3O5IA 1ZB5A 3PRBA 4WKHA 1FKJA 3WD2A 3ARQA 1BL4A 5GQBA 3UQAA 2DSVA 1M5YA 1FKHA 1X6NA 4DRJA 3H9RB 3IKGA 4NNRA 4J4OA 1NWTA 4U86A 3JXVA 3O5QA 2IF4A 1KFWA 3RM9A 1FKRA 4L3NA 1SR0A 3PRDA 4P8XA 1XHGA 5HWCA 2RQSA 2RURA 2PPPA 1L1PA 4TNSA 3TDBA 1WAWA 4TW6A 3O5RA 2DG9A 2XP8A 4JFLA 1F8AB 2KO7A 2OFNA 2PPOA 3ARRA 2WLYA 2FDMA 1E6PA 2FKEA 1ZU8A 1JNTA 4WK9A 3GU0A 4Z2KA 3EIPA 1FD9A 4MPKA 4WKFA 1JNDA 5HTGA 1WNOA 3RM4A 2MPHA 4IPXA 3NRKA 1J6YA 2PV1A 2PI6A 1EHNA 2DSUA 2WLZA 5B8IC 1ITXA 2G8ZA 1O6IA 2LGOA 5DIVA 2M1IA 4MSPA 2DG3A 4ZPTR 4GIVA 2LJ4A 3B7XA 3RM8A 1TCOC 4ODNA 1D6OA 2M2AA 1LL4A 3I6CA 2ZR5A 3TCZA 4HBEA 4FAPA 4KR0B 5HT1A 1W9UA 4W9QA 1NH6A 2RSEA 2F21A 4WIWA 1JNEA 5DIUA 3WD0A 1FKKA 2AOSA 2DSWA 2F23A 4FN2A 4IQ2A 4ODRA 5DITA 2P4VA 3ALGA 2PN0A 1QPLA 2F4EA 5DO2A 4ZPWR 1UR8A 2QF8A 3IK8A 3AS3A 4MNKA 4MAVA 1KT1A 3O5MA 4JYSA 2ZR6A 3QOKA 4TYOA 3KACA 1ZBCA 5JH8A 4U84A 2LKNA 3ARUA 1EYMA 5HW7A 3AS0A 4DT4A 4AY1A 2XP6A 3EY6A 2MF9A 1OWQA 3LUOA 1LL6A 2MLYA 3FY1A 2ZR4A 3CGNA 4DWSA 4P8WA 1YW5A 3UI6A 5HW6A 1NMWA 3CGMA 3ALFA 3WKZA 2XPBA 4P8UA 2PV3A 1ROUA 3VAWA 2DPEA 4W9PA 1FFQA 5D75A 2DT3A 1FKSA 4WKAA 2XP9A 2ZQUA 2AWGA 1D7JA 2PV2A 2JZVA 1W9VA 4S3KA 2YBTA 4ODOA 4PTMA 3O5KA 4MNLA 2DT1A 2A3AA 1J4IA 3UI5A 1Q6UA 2MLXA 4W9OA 1Y0OA 2EULA 3ARZA 2K8IA 4MNJA 4ZPVR 1FKLA 1BKFA 2F2DA 1D7HA 3IKDA 3G6LA 1FJDA 1UR9A 3ARYA 2KR7A 2IUZA 4DIPA 4P8VA 1KT0A 4DRHA 3O5DA 4QIBA 1E44A 4ODMA 3WH0A 2B31A 1N1AA 4IT4A 3UQIA 1FKDA 1FKGA 1SYTA 1ZBVA 3GPKA 4C02B 3O5OA 3CHDA 1FKTA 1C9HA 4GGQA 3CHFA 1GPFA 1OGBA 5J6EA 1K9TA 1FFRA 4HBOA 1NWSA 3AS2A 3PRAA 1FKBA 4ODLA 3PR9A 4W5UA 1E6RA 4DRQA 2DT2A 1X6LA 2FAPA 4S3JA 3O5GA 1PINA 3CZ8A 1JNSA 3WD4A 5GPRA 1HKMA 1FKFA 1P5QA 4KQZA 1W1TA 5HWBA 1H0GA 1LL7A 4DRMA 3ARXA 1E9LA 3AS1A 3WL1A 1R9HA 4L72B 1B6CA 3WD3A 2RUDA 2XP3A 2L2SA 1VF8A 3TC5A 3O5PA 1W26A 4Z2GA 2KE0A 1F40A 2DG4A 2MLZA 3O5JA 3FAPA 1NSGA 3UQBA 3AQUA 2RUCA 1OGGA 3KAFA 4G50A 1ZCNA 1D7IA 3RMEA 1FKIA 1JVWA 1NWUA 2UZ5A 4JFKA 2A3EA 4R5EA 4DRPA 3ODKA 4J4NA 3KAIA 1ZBKA 2RUQA 1GOIA 2B5UB 3MDYB 1IX5A 1D2KA 5DEZA 2MNTA 3CHEA 1W1VA 2ZQTA 2XP4A 1WB0A 1J4RA 4DRIA 3KCEA 4LAYA 3B9AA 1FAPA 1JCHB 3CHCA 3CH9A 3OOBA 4ITZA 1E6ZA 3ARVA 1HJVA 1LG2A 4ODPA 1YATA 4DRNA 1XRVA 3WQVA 2KI3A 1W9PA 2XP5A 4HARA 5BXJA 1Q6HA 1LQ0A 1ZK6A 3KZ7A 3ARPA 3G6MA 4NZCA 1W1PA 5HW8A 4Z2LA 1U79A 2DSZA 3KADA 4LAWA 4DH0A 3KAHA 4DWSC 4WJXA 1ZBWA 4URIA 2VN1A 4G2PA 1PBKA 2LPVA 3BXWA 1HXVA 4LAXA 2KFWA 4TW7A 3WIJA 1CTNA 2O9OA 4ZS6A 4NSBA 1GRJA 3NI6A 1LG1A 3OA5A 3B9DA 4DZ3A 5HUAA 5HBFA 4ODQA 1A7XA 1J4HA 1HJXA 1EIBA 2ETNA 1HJWA 3WQWA 2KGJA 4DRKA 4U85A 3FXYA 4ODKA 2O92A 3O5FA 1ZL1A 1E6NA 1HKKA 4MTVA 3KABA 1LJYA
chains in the Genus database with same CATH topology
2WK2A 2D9FA 1HKIA 4JFJA 1TFVA 4IQCA 3O5LA 3ARTA 3UF8A 2ESCA 4Q7NA 1RD6A 2N87A 1NMVA 4Q22A 4TW8A 4O2TA 4XAKA 2OLHA 1Q1CA 3B8SA 1GUVA 3JYJA 4DWSB 4MGVA 5HKGA 3ARWA 1EQ3A 2Y78A 4Z2IA 2PBCA 3O5EA 2YBUA 2XP7A 3AROA 4ML4A 2A3CA 4LAVA 4DWSD 3RFWA 1NWRA 1H0IA 2ZQSA 1Q6IA 3RGCA 4DROA 3UI4A 2VCDA 4BF8A 4MNMA 1E15A 3IHZA 2XPAA 2G41A 4QT3A 1T11A 1HKJA 2DT0A 3KAGA 4R0XA 4Z2JA 4QZVB 3NTPA 1EDQA 4LGXA 2M08A 1W1YA 4JFMA 3B9EA 3W4RA 2PPNA 5I98A 4JFIA 2Q5AA 2A3BA 3PA7A 4QT2A 4Z2HA 3WD1A 2ITKA 3JYMA 3ARSA 1ROTA 1QZ2A 1QPFA 4TX0A 5GPGA 4DZ2A 2WM0A 3WL0A 5DF0A 2ZQVA 4N19A 4IT6A 3O5IA 1ZB5A 3PRBA 4WKHA 1FKJA 3WD2A 3ARQA 1BL4A 5GQBA 3UQAA 2DSVA 1M5YA 1FKHA 1X6NA 4DRJA 3H9RB 3IKGA 4NNRA 4J4OA 1NWTA 4U86A 3JXVA 3O5QA 2IF4A 1KFWA 3RM9A 1FKRA 4L3NA 1SR0A 3PRDA 4P8XA 1XHGA 5HWCA 2RQSA 2RURA 2PPPA 1L1PA 4TNSA 3TDBA 1WAWA 4TW6A 3O5RA 2DG9A 2XP8A 4JFLA 1F8AB 2KO7A 2OFNA 2PPOA 3ARRA 2WLYA 2FDMA 1E6PA 2FKEA 1ZU8A 1JNTA 4WK9A 4Z2KA 1FD9A 4MPKA 4WKFA 1JNDA 5HTGA 1WNOA 3RM4A 2MPHA 4IPXA 3NRKA 1J6YA 2PV1A 2PI6A 1EHNA 2DSUA 2WLZA 5B8IC 1ITXA 2G8ZA 1O6IA 2LGOA 5DIVA 2M1IA 4MSPA 2DG3A 4ZPTR 4GIVA 2LJ4A 3B7XA 3RM8A 1TCOC 4ODNA 1D6OA 2M2AA 1LL4A 3I6CA 2ZR5A 3TCZA 4HBEA 4FAPA 4KR0B 5HT1A 1W9UA 4W9QA 1NH6A 2RSEA 2F21A 4WIWA 1JNEA 5DIUA 3WD0A 1FKKA 2AOSA 2DSWA 4FN2A 4IQ2A 4ODRA 5DITA 3ALGA 1QPLA 2F4EA 5DO2A 4ZPWR 1UR8A 2QF8A 3IK8A 3AS3A 4MNKA 4MAVA 1KT1A 3O5MA 4JYSA 2ZR6A 3QOKA 4TYOA 3KACA 1ZBCA 5JH8A 4U84A 2LKNA 3ARUA 1EYMA 5HW7A 3AS0A 4DT4A 4AY1A 2XP6A 3EY6A 2MF9A 1OWQA 3LUOA 1LL6A 2MLYA 3FY1A 2ZR4A 3CGNA 4DWSA 4P8WA 1YW5A 3UI6A 5HW6A 1NMWA 3CGMA 3ALFA 3WKZA 2XPBA 4P8UA 2PV3A 1ROUA 3VAWA 2DPEA 4W9PA 1FFQA 5D75A 2DT3A 1FKSA 4WKAA 2XP9A 2ZQUA 2AWGA 1D7JA 2PV2A 2JZVA 1W9VA 4S3KA 2YBTA 4ODOA 4PTMA 3O5KA 4MNLA 2DT1A 2A3AA 1J4IA 3UI5A 1Q6UA 2MLXA 4W9OA 1Y0OA 3ARZA 2K8IA 4MNJA 4ZPVR 1FKLA 1BKFA 2F2DA 1D7HA 3IKDA 3G6LA 1FJDA 1UR9A 3ARYA 2KR7A 2IUZA 4DIPA 4P8VA 1KT0A 4DRHA 3O5DA 4QIBA 4ODMA 3WH0A 2B31A 1N1AA 4IT4A 3UQIA 1FKDA 1FKGA 1SYTA 1ZBVA 3GPKA 4C02B 3O5OA 3CHDA 1FKTA 1C9HA 4GGQA 3CHFA 1GPFA 1OGBA 5J6EA 1K9TA 1FFRA 4HBOA 1NWSA 3AS2A 3PRAA 1FKBA 4ODLA 3PR9A 4W5UA 1E6RA 4DRQA 2DT2A 1X6LA 2FAPA 4S3JA 3O5GA 1PINA 3CZ8A 1JNSA 3WD4A 5GPRA 1HKMA 1FKFA 1P5QA 4KQZA 1W1TA 5HWBA 1H0GA 1LL7A 4DRMA 3ARXA 1E9LA 3AS1A 3WL1A 1R9HA 4L72B 1B6CA 3WD3A 2RUDA 2XP3A 2L2SA 1VF8A 3TC5A 3O5PA 1W26A 4Z2GA 2KE0A 1F40A 2DG4A 2MLZA 3O5JA 3FAPA 1NSGA 3UQBA 3AQUA 2RUCA 1OGGA 3KAFA 4G50A 1ZCNA 1D7IA 3RMEA 1FKIA 1JVWA 1NWUA 2UZ5A 4JFKA 2A3EA 4R5EA 4DRPA 3ODKA 4J4NA 3KAIA 1ZBKA 2RUQA 1GOIA 3MDYB 1IX5A 1D2KA 5DEZA 2MNTA 3CHEA 1W1VA 2ZQTA 2XP4A 1WB0A 1J4RA 4DRIA 3KCEA 4LAYA 3B9AA 1FAPA 3CHCA 3CH9A 3OOBA 4ITZA 1E6ZA 3ARVA 1HJVA 1LG2A 4ODPA 1YATA 4DRNA 1XRVA 3WQVA 2KI3A 1W9PA 2XP5A 4HARA 5BXJA 1Q6HA 1LQ0A 1ZK6A 3KZ7A 3ARPA 3G6MA 4NZCA 1W1PA 5HW8A 4Z2LA 1U79A 2DSZA 3KADA 4LAWA 4DH0A 3KAHA 4DWSC 4WJXA 1ZBWA 4URIA 2VN1A 4G2PA 1PBKA 2LPVA 3BXWA 1HXVA 4LAXA 2KFWA 4TW7A 3WIJA 1CTNA 2O9OA 4ZS6A 4NSBA 3NI6A 1LG1A 3OA5A 3B9DA 4DZ3A 5HUAA 5HBFA 4ODQA 1A7XA 1J4HA 1HJXA 1EIBA 1HJWA 3WQWA 2KGJA 4DRKA 4U85A 3FXYA 4ODKA 2O92A 3O5FA 1ZL1A 1E6NA 1HKKA 4MTVA 3KABA 1LJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TC5 A;  2PPP A;  3UI6 A;  3O5P A;  1W26 A;  1L1P A;  4TNS A;  3TDB A;  1NMW A;  5HW6 A;  4TW6 A;  2KE0 A;  2D9F A;  3CGM A;  3O5R A;  1F40 A;  2DG9 A;  2XPB A;  2XP8 A;  4JFL A;  1F8A B;  2DG4 A;  2KO7 A;  2OFN A;  2PPO A;  2PV3 A;  4JFJ A;  1ROU A;  2MLZ A;  3O5J A;  3FAP A;  2FKE A;  1NSG A;  3VAW A;  3UQB A;  2RUC A;  1JNT A;  4IQC A;  3O5L A;  4W9P A;  3KAF A;  5D75 A;  3UF8 A;  4G50 A;  1ZCN A;  1FKS A;  1D7I A;  1FD9 A;  2XP9 A;  2ZQU A;  2AWG A;  2N87 A;  4TW8 A;  1NMV A;  1FKI A;  1D7J A;  1JVW A;  2PV2 A;  2UZ5 A;  4JFK A;  4O2T A;  5HTG A;  2MPH A;  2JZV A;  4DRP A;  4IPX A;  1Q1C A;  3NRK A;  3ODK A;  4J4N A;  1J6Y A;  3JYJ A;  3KAI A;  2PV1 A;  2RUQ A;  4ODO A;  3MDY B;  4MGV A;  3O5K A;  5HKG A;  2MNT A;  3UI5 A;  1J4I A;  5B8I C;  1Q6U A;  1EQ3 A;  2Y78 A;  2PBC A;  3O5E A;  2MLX A;  2ZQT A;  2XP4 A;  4W9O A;  2XP7 A;  1J4R A;  1Y0O A;  4LAV A;  2K8I A;  3RFW A;  1FKL A;  1BKF A;  4DRI A;  2F2D A;  1D7H A;  2LGO A;  5DIV A;  2M1I A;  2ZQS A;  3KCE A;  1Q6I A;  4LAY A;  2DG3 A;  4MSP A;  3RGC A;  3IKD A;  4GIV A;  3UI4 A;  4DRO A;  2VCD A;  1FAP A;  2LJ4 A;  4BF8 A;  1FJD A;  2KR7 A;  3OOB A;  4ITZ A;  3B7X A;  3IHZ A;  2XPA A;  4DIP A;  1TCO C;  4QT3 A;  4ODN A;  1T11 A;  1KT0 A;  1D6O A;  4DRH A;  3O5D A;  2M2A A;  3KAG A;  4R0X A;  3I6C A;  3NTP A;  2ZR5 A;  4QIB A;  4ODP A;  4ODM A;  3WH0 A;  1YAT A;  2M08 A;  3TCZ A;  4JFM A;  1N1A A;  2PPN A;  4DRN A;  4FAP A;  5I98 A;  3UQI A;  1FKD A;  1FKG A;  4JFI A;  5HT1 A;  4W9Q A;  2KI3 A;  2Q5A A;  3GPK A;  2RSE A;  4C02 B;  2F21 A;  3PA7 A;  2XP5 A;  3O5O A;  4QT2 A;  5DIU A;  5BXJ A;  1Q6H A;  2ITK A;  1FKT A;  1FKK A;  3JYM A;  1C9H A;  1ROT A;  1ZK6 A;  3KZ7 A;  1QZ2 A;  4GGQ A;  5J6E A;  1QPF A;  5HW8 A;  1U79 A;  4FN2 A;  4TX0 A;  3KAD A;  4IQ2 A;  1FKB A;  4LAW A;  5GPG A;  4ODR A;  3KAH A;  5DIT A;  4DH0 A;  4ODL A;  4DZ2 A;  1QPL A;  2F4E A;  2VN1 A;  1PBK A;  2LPV A;  4G2P A;  4DRQ A;  1HXV A;  4LAX A;  2FAP A;  2KFW A;  3IK8 A;  4TW7 A;  2ZQV A;  4N19 A;  3O5G A;  1PIN A;  1KT1 A;  3O5M A;  3O5I A;  3NI6 A;  3PRB A;  4JYS A;  1FKJ A;  2ZR6 A;  4TYO A;  3KAC A;  4DZ3 A;  4U84 A;  5HUA A;  1JNS A;  1BL4 A;  2LKN A;  3UQA A;  4ODQ A;  1A7X A;  1EYM A;  1M5Y A;  5HW7 A;  1FKH A;  4DT4 A;  1FKF A;  1P5Q A;  2XP6 A;  3EY6 A;  2MF9 A;  3H9R B;  4DRJ A;  1J4H A;  5HWB A;  3IKG A;  4NNR A;  4DRM A;  4J4O A;  3LUO A;  2KGJ A;  3JXV A;  3O5Q A;  2IF4 A;  4U86 A;  4U85 A;  4DRK A;  2MLY A;  1R9H A;  1B6C A;  4ODK A;  1FKR A;  3O5F A;  2RUD A;  2ZR4 A;  3CGN A;  2XP3 A;  2L2S A;  1YW5 A;  3PRD A;  5HWC A;  2RQS A;  3KAB A;  2RUR A; 
#chains in the Genus database with same CATH topology
 2WK2 A;  2D9F A;  1HKI A;  4JFJ A;  1TFV A;  4IQC A;  3O5L A;  3ART A;  3UF8 A;  2ESC A;  4Q7N A;  1RD6 A;  2N87 A;  1NMV A;  4Q22 A;  4TW8 A;  4O2T A;  4XAK A;  2OLH A;  1Q1C A;  3B8S A;  1GUV A;  3JYJ A;  4DWS B;  4MGV A;  5HKG A;  3ARW A;  1EQ3 A;  2Y78 A;  4Z2I A;  2PBC A;  3O5E A;  2YBU A;  2XP7 A;  3ARO A;  4ML4 A;  2A3C A;  4LAV A;  4DWS D;  3RFW A;  1NWR A;  1H0I A;  2ZQS A;  1Q6I A;  3RGC A;  4DRO A;  3UI4 A;  2VCD A;  4BF8 A;  4MNM A;  1E15 A;  3IHZ A;  2XPA A;  2G41 A;  4QT3 A;  1T11 A;  1HKJ A;  2DT0 A;  3KAG A;  4R0X A;  4Z2J A;  4QZV B;  3NTP A;  1EDQ A;  4LGX A;  2M08 A;  1W1Y A;  4JFM A;  3B9E A;  3W4R A;  2PPN A;  5I98 A;  4JFI A;  2Q5A A;  3GTY X;  2A3B A;  3PA7 A;  4QT2 A;  4Z2H A;  3WD1 A;  2ITK A;  3JYM A;  3ARS A;  1ROT A;  1QZ2 A;  3BMB A;  1QPF A;  4UDM A;  4TX0 A;  5GPG A;  4DZ2 A;  2WM0 A;  3WL0 A;  5DF0 A;  2ZQV A;  4N19 A;  4IT6 A;  3O5I A;  1ZB5 A;  3PRB A;  4WKH A;  1FKJ A;  3WD2 A;  3ARQ A;  1BL4 A;  5GQB A;  3UQA A;  2DSV A;  1M5Y A;  1FKH A;  1X6N A;  4DRJ A;  3H9R B;  3IKG A;  4NNR A;  4J4O A;  1NWT A;  4U86 A;  3JXV A;  3O5Q A;  2IF4 A;  1KFW A;  3RM9 A;  1FKR A;  4L3N A;  1SR0 A;  3PRD A;  4P8X A;  1XHG A;  5HWC A;  2RQS A;  2RUR A;  2PPP A;  1L1P A;  4TNS A;  3TDB A;  1WAW A;  4TW6 A;  3O5R A;  2DG9 A;  2XP8 A;  4JFL A;  1F8A B;  2KO7 A;  2OFN A;  2PPO A;  3ARR A;  2WLY A;  2FDM A;  1E6P A;  2FKE A;  1ZU8 A;  1JNT A;  4WK9 A;  3GU0 A;  4Z2K A;  3EIP A;  1FD9 A;  4MPK A;  4WKF A;  1JND A;  5HTG A;  1WNO A;  3RM4 A;  2MPH A;  4IPX A;  3NRK A;  1J6Y A;  2PV1 A;  2PI6 A;  1EHN A;  2DSU A;  2WLZ A;  5B8I C;  1ITX A;  2G8Z A;  1O6I A;  2LGO A;  5DIV A;  2M1I A;  4MSP A;  2DG3 A;  4ZPT R;  4GIV A;  2LJ4 A;  3B7X A;  3RM8 A;  1TCO C;  4ODN A;  1D6O A;  2M2A A;  1LL4 A;  3I6C A;  2ZR5 A;  3TCZ A;  4HBE A;  4FAP A;  4KR0 B;  5HT1 A;  1W9U A;  4W9Q A;  1NH6 A;  2RSE A;  2F21 A;  4WIW A;  1JNE A;  5DIU A;  3WD0 A;  1FKK A;  2AOS A;  2DSW A;  2F23 A;  4FN2 A;  4IQ2 A;  4ODR A;  5DIT A;  2P4V A;  3ALG A;  2PN0 A;  1QPL A;  2F4E A;  5DO2 A;  4ZPW R;  1UR8 A;  2QF8 A;  3IK8 A;  3AS3 A;  4MNK A;  4MAV A;  1KT1 A;  3O5M A;  4JYS A;  2ZR6 A;  3QOK A;  4TYO A;  3KAC A;  1ZBC A;  5JH8 A;  4U84 A;  2LKN A;  3ARU A;  1EYM A;  5HW7 A;  3AS0 A;  4DT4 A;  4AY1 A;  2XP6 A;  3EY6 A;  2MF9 A;  1OWQ A;  3LUO A;  1LL6 A;  2MLY A;  3FY1 A;  2ZR4 A;  3CGN A;  4DWS A;  4P8W A;  1YW5 A;  3UI6 A;  5HW6 A;  1NMW A;  3CGM A;  3ALF A;  3WKZ A;  2XPB A;  4P8U A;  2PV3 A;  1ROU A;  3VAW A;  2DPE A;  4W9P A;  1FFQ A;  5D75 A;  2DT3 A;  1FKS A;  4WKA A;  2XP9 A;  2ZQU A;  2AWG A;  1D7J A;  2PV2 A;  2JZV A;  1W9V A;  4S3K A;  2YBT A;  4ODO A;  4PTM A;  3O5K A;  4MNL A;  2DT1 A;  2A3A A;  1J4I A;  3UI5 A;  1Q6U A;  2MLX A;  4W9O A;  1Y0O A;  2EUL A;  3ARZ A;  2K8I A;  4MNJ A;  4ZPV R;  1FKL A;  1BKF A;  2F2D A;  1D7H A;  3IKD A;  3G6L A;  1FJD A;  1UR9 A;  3ARY A;  2KR7 A;  2IUZ A;  4DIP A;  4P8V A;  1KT0 A;  4DRH A;  3O5D A;  4QIB A;  1E44 A;  4ODM A;  3WH0 A;  2B31 A;  1N1A A;  4IT4 A;  3UQI A;  1FKD A;  1FKG A;  1SYT A;  1ZBV A;  3GPK A;  4C02 B;  3O5O A;  3CHD A;  1FKT A;  1C9H A;  4GGQ A;  3CHF A;  1GPF A;  1OGB A;  5J6E A;  1K9T A;  1FFR A;  4HBO A;  1NWS A;  3AS2 A;  3PRA A;  1FKB A;  4ODL A;  3PR9 A;  4W5U A;  1E6R A;  4DRQ A;  2DT2 A;  1X6L A;  2FAP A;  4S3J A;  3O5G A;  1PIN A;  3CZ8 A;  1JNS A;  3WD4 A;  5GPR A;  1HKM A;  1FKF A;  1P5Q A;  4KQZ A;  1W1T A;  5HWB A;  1H0G A;  1LL7 A;  4DRM A;  3ARX A;  1E9L A;  3AS1 A;  3WL1 A;  1R9H A;  4L72 B;  1B6C A;  3WD3 A;  2RUD A;  2XP3 A;  2L2S A;  1VF8 A;  3TC5 A;  3O5P A;  1W26 A;  4Z2G A;  2KE0 A;  1F40 A;  2DG4 A;  2MLZ A;  3O5J A;  3FAP A;  1NSG A;  3UQB A;  3AQU A;  2RUC A;  1OGG A;  3KAF A;  4G50 A;  1ZCN A;  1D7I A;  3RME A;  1FKI A;  1JVW A;  1NWU A;  2UZ5 A;  4JFK A;  2A3E A;  4R5E A;  4DRP A;  3ODK A;  4J4N A;  3KAI A;  1ZBK A;  2RUQ A;  1GOI A;  2B5U B;  3MDY B;  1IX5 A;  1D2K A;  5DEZ A;  2MNT A;  3CHE A;  1W1V A;  2ZQT A;  2XP4 A;  1WB0 A;  1J4R A;  4DRI A;  3KCE A;  4LAY A;  3B9A A;  1FAP A;  1JCH B;  3CHC A;  3CH9 A;  3OOB A;  4ITZ A;  1E6Z A;  3ARV A;  1HJV A;  1LG2 A;  4ODP A;  1YAT A;  4DRN A;  1XRV A;  3WQV A;  2KI3 A;  1W9P A;  2XP5 A;  4HAR A;  5BXJ A;  1Q6H A;  1LQ0 A;  1ZK6 A;  3KZ7 A;  3ARP A;  3G6M A;  4NZC A;  1W1P A;  5HW8 A;  4Z2L A;  1U79 A;  2DSZ A;  3KAD A;  4LAW A;  4DH0 A;  3KAH A;  4DWS C;  4WJX A;  1ZBW A;  4URI A;  2VN1 A;  4G2P A;  1PBK A;  2LPV A;  3BXW A;  1HXV A;  4LAX A;  2KFW A;  4TW7 A;  3WIJ A;  1CTN A;  2O9O A;  4ZS6 A;  4NSB A;  1GRJ A;  3NI6 A;  1LG1 A;  3OA5 A;  3B9D A;  4DZ3 A;  5HUA A;  5HBF A;  4ODQ A;  1A7X A;  1J4H A;  1HJX A;  1EIB A;  2ETN A;  1HJW A;  3WQW A;  2KGJ A;  4DRK A;  4U85 A;  3FXY A;  4ODK A;  2O92 A;  3O5F A;  1ZL1 A;  1E6N A;  1HKK A;  4MTV A;  3KAB A;  1LJY A; 
#chains in the Genus database with same CATH homology
 2WK2 A;  2D9F A;  1HKI A;  4JFJ A;  1TFV A;  4IQC A;  3O5L A;  3ART A;  3UF8 A;  2ESC A;  4Q7N A;  1RD6 A;  2N87 A;  1NMV A;  4Q22 A;  4TW8 A;  4O2T A;  4XAK A;  2OLH A;  1Q1C A;  3B8S A;  1GUV A;  3JYJ A;  4DWS B;  4MGV A;  5HKG A;  3ARW A;  1EQ3 A;  2Y78 A;  4Z2I A;  2PBC A;  3O5E A;  2YBU A;  2XP7 A;  3ARO A;  4ML4 A;  2A3C A;  4LAV A;  4DWS D;  3RFW A;  1NWR A;  1H0I A;  2ZQS A;  1Q6I A;  3RGC A;  4DRO A;  3UI4 A;  2VCD A;  4BF8 A;  4MNM A;  1E15 A;  3IHZ A;  2XPA A;  2G41 A;  4QT3 A;  1T11 A;  1HKJ A;  2DT0 A;  3KAG A;  4R0X A;  4Z2J A;  4QZV B;  3NTP A;  1EDQ A;  4LGX A;  2M08 A;  1W1Y A;  4JFM A;  3B9E A;  3W4R A;  2PPN A;  5I98 A;  4JFI A;  2Q5A A;  2A3B A;  3PA7 A;  4QT2 A;  4Z2H A;  3WD1 A;  2ITK A;  3JYM A;  3ARS A;  1ROT A;  1QZ2 A;  1QPF A;  4TX0 A;  5GPG A;  4DZ2 A;  2WM0 A;  3WL0 A;  5DF0 A;  2ZQV A;  4N19 A;  4IT6 A;  3O5I A;  1ZB5 A;  3PRB A;  4WKH A;  1FKJ A;  3WD2 A;  3ARQ A;  1BL4 A;  5GQB A;  3UQA A;  2DSV A;  1M5Y A;  1FKH A;  1X6N A;  4DRJ A;  3H9R B;  3IKG A;  4NNR A;  4J4O A;  1NWT A;  4U86 A;  3JXV A;  3O5Q A;  2IF4 A;  1KFW A;  3RM9 A;  1FKR A;  4L3N A;  1SR0 A;  3PRD A;  4P8X A;  1XHG A;  5HWC A;  2RQS A;  2RUR A;  2PPP A;  1L1P A;  4TNS A;  3TDB A;  1WAW A;  4TW6 A;  3O5R A;  2DG9 A;  2XP8 A;  4JFL A;  1F8A B;  2KO7 A;  2OFN A;  2PPO A;  3ARR A;  2WLY A;  2FDM A;  1E6P A;  2FKE A;  1ZU8 A;  1JNT A;  4WK9 A;  4Z2K A;  1FD9 A;  4MPK A;  4WKF A;  1JND A;  5HTG A;  1WNO A;  3RM4 A;  2MPH A;  4IPX A;  3NRK A;  1J6Y A;  2PV1 A;  2PI6 A;  1EHN A;  2DSU A;  2WLZ A;  5B8I C;  1ITX A;  2G8Z A;  1O6I A;  2LGO A;  5DIV A;  2M1I A;  4MSP A;  2DG3 A;  4ZPT R;  4GIV A;  2LJ4 A;  3B7X A;  3RM8 A;  1TCO C;  4ODN A;  1D6O A;  2M2A A;  1LL4 A;  3I6C A;  2ZR5 A;  3TCZ A;  4HBE A;  4FAP A;  4KR0 B;  5HT1 A;  1W9U A;  4W9Q A;  1NH6 A;  2RSE A;  2F21 A;  4WIW A;  1JNE A;  5DIU A;  3WD0 A;  1FKK A;  2AOS A;  2DSW A;  4FN2 A;  4IQ2 A;  4ODR A;  5DIT A;  3ALG A;  1QPL A;  2F4E A;  5DO2 A;  4ZPW R;  1UR8 A;  2QF8 A;  3IK8 A;  3AS3 A;  4MNK A;  4MAV A;  1KT1 A;  3O5M A;  4JYS A;  2ZR6 A;  3QOK A;  4TYO A;  3KAC A;  1ZBC A;  5JH8 A;  4U84 A;  2LKN A;  3ARU A;  1EYM A;  5HW7 A;  3AS0 A;  4DT4 A;  4AY1 A;  2XP6 A;  3EY6 A;  2MF9 A;  1OWQ A;  3LUO A;  1LL6 A;  2MLY A;  3FY1 A;  2ZR4 A;  3CGN A;  4DWS A;  4P8W A;  1YW5 A;  3UI6 A;  5HW6 A;  1NMW A;  3CGM A;  3ALF A;  3WKZ A;  2XPB A;  4P8U A;  2PV3 A;  1ROU A;  3VAW A;  2DPE A;  4W9P A;  1FFQ A;  5D75 A;  2DT3 A;  1FKS A;  4WKA A;  2XP9 A;  2ZQU A;  2AWG A;  1D7J A;  2PV2 A;  2JZV A;  1W9V A;  4S3K A;  2YBT A;  4ODO A;  4PTM A;  3O5K A;  4MNL A;  2DT1 A;  2A3A A;  1J4I A;  3UI5 A;  1Q6U A;  2MLX A;  4W9O A;  1Y0O A;  3ARZ A;  2K8I A;  4MNJ A;  4ZPV R;  1FKL A;  1BKF A;  2F2D A;  1D7H A;  3IKD A;  3G6L A;  1FJD A;  1UR9 A;  3ARY A;  2KR7 A;  2IUZ A;  4DIP A;  4P8V A;  1KT0 A;  4DRH A;  3O5D A;  4QIB A;  4ODM A;  3WH0 A;  2B31 A;  1N1A A;  4IT4 A;  3UQI A;  1FKD A;  1FKG A;  1SYT A;  1ZBV A;  3GPK A;  4C02 B;  3O5O A;  3CHD A;  1FKT A;  1C9H A;  4GGQ A;  3CHF A;  1GPF A;  1OGB A;  5J6E A;  1K9T A;  1FFR A;  4HBO A;  1NWS A;  3AS2 A;  3PRA A;  1FKB A;  4ODL A;  3PR9 A;  4W5U A;  1E6R A;  4DRQ A;  2DT2 A;  1X6L A;  2FAP A;  4S3J A;  3O5G A;  1PIN A;  3CZ8 A;  1JNS A;  3WD4 A;  5GPR A;  1HKM A;  1FKF A;  1P5Q A;  4KQZ A;  1W1T A;  5HWB A;  1H0G A;  1LL7 A;  4DRM A;  3ARX A;  1E9L A;  3AS1 A;  3WL1 A;  1R9H A;  4L72 B;  1B6C A;  3WD3 A;  2RUD A;  2XP3 A;  2L2S A;  1VF8 A;  3TC5 A;  3O5P A;  1W26 A;  4Z2G A;  2KE0 A;  1F40 A;  2DG4 A;  2MLZ A;  3O5J A;  3FAP A;  1NSG A;  3UQB A;  3AQU A;  2RUC A;  1OGG A;  3KAF A;  4G50 A;  1ZCN A;  1D7I A;  3RME A;  1FKI A;  1JVW A;  1NWU A;  2UZ5 A;  4JFK A;  2A3E A;  4R5E A;  4DRP A;  3ODK A;  4J4N A;  3KAI A;  1ZBK A;  2RUQ A;  1GOI A;  3MDY B;  1IX5 A;  1D2K A;  5DEZ A;  2MNT A;  3CHE A;  1W1V A;  2ZQT A;  2XP4 A;  1WB0 A;  1J4R A;  4DRI A;  3KCE A;  4LAY A;  3B9A A;  1FAP A;  3CHC A;  3CH9 A;  3OOB A;  4ITZ A;  1E6Z A;  3ARV A;  1HJV A;  1LG2 A;  4ODP A;  1YAT A;  4DRN A;  1XRV A;  3WQV A;  2KI3 A;  1W9P A;  2XP5 A;  4HAR A;  5BXJ A;  1Q6H A;  1LQ0 A;  1ZK6 A;  3KZ7 A;  3ARP A;  3G6M A;  4NZC A;  1W1P A;  5HW8 A;  4Z2L A;  1U79 A;  2DSZ A;  3KAD A;  4LAW A;  4DH0 A;  3KAH A;  4DWS C;  4WJX A;  1ZBW A;  4URI A;  2VN1 A;  4G2P A;  1PBK A;  2LPV A;  3BXW A;  1HXV A;  4LAX A;  2KFW A;  4TW7 A;  3WIJ A;  1CTN A;  2O9O A;  4ZS6 A;  4NSB A;  3NI6 A;  1LG1 A;  3OA5 A;  3B9D A;  4DZ3 A;  5HUA A;  5HBF A;  4ODQ A;  1A7X A;  1J4H A;  1HJX A;  1EIB A;  1HJW A;  3WQW A;  2KGJ A;  4DRK A;  4U85 A;  3FXY A;  4ODK A;  2O92 A;  3O5F A;  1ZL1 A;  1E6N A;  1HKK A;  4MTV A;  3KAB A;  1LJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...