1FKJA

Atomic structure of fkbp12-fk506, an immunophilin immunosuppressant complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rotamase
molecule keywords FK506 BINDING PROTEIN
publication title Comparative X-ray structures of the major binding protein for the immunosuppressant FK506 (tacrolimus) in unliganded form and in complex with FK506 and rapamycin.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkjA00
4LAWA 4GGQA 2N87A 1PINA 3B7XA 5HWCA 1ZCNA 3IHZA 5HWBA 3CGNA 4JFKA 4TNSA 3KABA 1JNSA 2KFWA 3TC5A 1FKKA 1J4HA 3O5RA 3KAIA 4JFLA 2MNTA 4ODPA 5HW7A 1L1PA 4DZ2A 1FKRA 1ZK6A 2XP3A 3NRKA 1EQ3A 2FKEA 4DRHA 1EYMA 5HUAA 4JFIA 3VAWA 5HKGA 3KAHA 2MF9A 4TX0A 2PBCA 4DRKA 3H9RB 2KE0A 2VCDA 1D7IA 2XP9A 4W9QA 2OFNA 4DIPA 1QZ2A 4GIVA 4ODKA 3JYJA 3RFWA 2XPBA 1Y0OA 3PRBA 1TCOC 2KR7A 2XP5A 3O5GA 3WH0A 5HW6A 3FAPA 1M5YA 1FAPA 2DG3A 2Y78A 1NMVA 1Q6IA 1FKFA 2AWGA 2DG4A 2RURA 3O5JA 3O5MA 5DIUA 2Q5AA 4QT2A 2ZR4A 1ROUA 4DRMA 4ODLA 1Q6UA 2ZQSA 1D6OA 1KT1A 4DT4A 4G50A 5GPGA 2RUCA 3KZ7A 5D75A 4JYSA 3UQIA 5DIVA 1KT0A 3EY6A 5HTGA 3KAGA 2ZQUA 2LGOA 3GPKA 3UI5A 5BXJA 2PV1A 3KCEA 1D7HA 4IQCA 2F4EA 1B6CA 2MLZA 4TYOA 1C9HA 3RGCA 4C02B 4NNRA 1N1AA 3UI4A 3TDBA 1A7XA 2XP4A 1P5QA 4DRQA 2JZVA 4R0XA 1FD9A 5B8IC 4U86A 4LAXA 4O2TA 3UI6A 4U85A 2KI3A 3O5DA 1YW5A 3O5IA 1D7JA 2MLYA 4DRNA 1FKIA 3NTPA 4J4OA 2PV3A 4J4NA 2LJ4A 1FKSA 2PPOA 4U84A 1FKJA 2ZR5A 4LAVA 4ODRA 3TCZA 3KAFA 2F21A 3O5QA 3KACA 1R9HA 3O5EA 1BL4A 3IKDA 3LUOA 4G2PA 2RUDA 2VN1A 3O5LA 1ROTA 4IPXA 2M08A 3O5FA 2PV2A 3IK8A 3ODKA 4ODNA 1FKTA 1QPFA 3O5PA 4DROA 1Q1CA 2K8IA 2M1IA 4DRPA 2FAPA 5J6EA 2RSEA 3NI6A 1FJDA 1W26A 2ZQTA 3JXVA 2XP6A 3O5OA 4DH0A 2D9FA 4TW7A 5DITA 1F8AB 3PA7A 4LAYA 4ODMA 3UF8A 4MSPA 3UQAA 4ODQA 3CGMA 2KGJA 3UQBA 4DRJA 1YATA 1J4RA 2RUQA 2IF4A 3OOBA 4ODOA 4W9PA 2MLXA 4QIBA 2LPVA 3PRDA 1BKFA 1J4IA 2L2SA 1FKLA 1T11A 4DRIA 3I6CA 3O5KA 1HXVA 1J6YA 1JVWA 2ITKA 4JFMA 1FKDA 3KADA 1F40A 4W9OA 4TW6A 1FKGA 4BF8A 1NMWA 1NSGA 4FN2A 2RQSA 2UZ5A 4JFJA 1QPLA 1U79A 2ZQVA 5HW8A 1Q6HA 2XPAA 2PPNA 3MDYB 2XP8A 4MGVA 2KO7A 2LKNA 2PPPA 4ITZA 5HT1A 1FKBA 5I98A 1PBKA 1JNTA 3JYMA 1FKHA 4QT3A 4N19A 4IQ2A 2XP7A 2DG9A 2F2DA 2M2AA 2MPHA 4FAPA 4TW8A 4DZ3A 3IKGA 2ZR6A
chains in the Genus database with same CATH superfamily
4LAWA 3ARUA 2N87A 1ZCNA 1EHNA 3RM4A 1OGGA 1J4HA 4JFLA 4NSBA 1L1PA 4DWSC 4MNLA 1EQ3A 1E44A 4JFIA 3KAHA 1HJXA 3AS0A 4URIA 3ARRA 4UDMA 2XP9A 5DEZA 4DIPA 2XPBA 2DSWA 1FFQA 1TCOC 1FAPA 2G8ZA 1OWQA 1NMVA 1Q6IA 1FKFA 3O5JA 2PI6A 5DIUA 4DRMA 5GPGA 2RUCA 4WKHA 3KZ7A 4S3KA 4JYSA 4WJXA 5DIVA 2WLYA 5HTGA 2LGOA 3UI5A 1W1VA 4TYOA 1D2KA 4NNRA 4XAKA 2G41A 3B9AA 3AS1A 1FD9A 3W4RA 3WL0A 1HKMA 4O2TA 1IX5A 1GOIA 3O5DA 1ZL1A 3ARSA 2MLYA 4DRNA 1E6ZA 4WIWA 1E6NA 3KAFA 3O5EA 3LUOA 2DSVA 1ROTA 2PV2A 1W1PA 1QPFA 1XHGA 1Q1CA 2K8IA 2FAPA 3NI6A 1FJDA 3JXVA 2XP6A 3O5OA 4MTVA 4NZCA 4DH0A 3B9EA 4TW7A 1LG2A 3UF8A 3UQBA 4DRJA 1YATA 4W9PA 2RUQA 2IF4A 1BKFA 2L2SA 2A3CA 4KR0B 4DRIA 3I6CA 1GPFA 1HXVA 1TFVA 1JVWA 2DT0A 3QOKA 1FKDA 1RD6A 2O92A 4IT4A 4TW6A 1FKGA 1WB0A 1NMWA 1NSGA 2RQSA 3ALFA 2ZQVA 1GRJA 3MDYB 4Z2IA 2KO7A 2PPPA 4PTMA 3ARZA 5I98A 2FDMA 3WD0A 4QT3A 4ZS6A 2DG9A 2F2DA 1SR0A 2A3EA 4TW8A 3RFWA 2ZR6A 3B7XA 5HWCA 3IHZA 3AS3A 3KABA 4ODPA 5HW7A 1W9VA 4MNKA 4MAVA 3B8SA 2XP3A 3NRKA 2FKEA 4DRHA 1EYMA 2A3AA 1LL4A 4TX0A 2PBCA 4ML4A 3CHDA 1LQ0A 2YBUA 2DPEA 1H0GA 3O5GA 5HW6A 2Y78A 3FXYA 2DG4A 2DSZA 3O5MA 3WKZA 1JCHB 2ZR4A 3ARYA 4P8VA 4DT4A 1ZU8A 3GTYX 4Z2LA 1KT0A 4LGXA 1D7HA 2MLZA 1N1AA 2F23A 3UI4A 3TDBA 1A7XA 2XP4A 1P5QA 2JZVA 4WK9A 5B8IC 4HBEA 4U86A 4LAXA 1OGBA 3RM9A 2KI3A 1YW5A 1HJVA 1FKIA 4J4OA 1CTNA 1SYTA 4U84A 1FKSA 1KFWA 3G6LA 1FKJA 2ZR5A 3CH9A 4ODRA 1K9TA 3O5QA 1NH6A 1ZBWA 3O5FA 2YBTA 4DROA 2M1IA 1JNDA 4R5EA 1W26A 2ZQTA 1F8AB 4ODMA 3ARWA 4MSPA 3CGMA 4S3JA 4P8UA 2MLXA 4QIBA 2WM0A 1J4IA 1XRVA 1FKLA 4DWSD 3O5KA 2O9OA 4JFMA 1F40A 5DO2A 2DT3A 2OLHA 3FY1A 4W5UA 2LKNA 2B5UB 2ETNA 1JNTA 4IT6A 3WD2A 2M2AA 4FAPA 3H9RB 4MPKA 4DWSB 3RMEA 1PINA 1E15A 5HWBA 3CGNA 4JFKA 4ZPVR 3ARTA 1JNSA 3TC5A 3O5RA 3KAIA 2MNTA 5JH8A 2WLZA 1LG1A 5HUAA 2AOSA 2P4VA 4WKFA 4DRKA 4HARA 4Z2KA 2KE0A 1D7IA 4W9QA 2OFNA 4GIVA 4ODKA 3WIJA 3PRBA 2KR7A 3WH0A 3FAPA 1M5YA 2DG3A 1ZBKA 3WL1A 1Q6UA 2ZQSA 1D6OA 5D75A 3UQIA 3EY6A 3KAGA 2ZQUA 2PV1A 1NWUA 2F4EA 1B6CA 5GQBA 3RGCA 1X6LA 3RM8A 1NWTA 1E6RA 1WAWA 1HKJA 1H0IA 4Z2GA 2B31A 3EIPA 4KQZA 3UI6A 2ESCA 4HBOA 1X6NA 1LJYA 1D7JA 3NTPA 3PR9A 2LJ4A 2PPOA 2QF8A 4Z2JA 3AROA 2F21A 3KACA 1BL4A 3IKDA 4G2PA 2RUDA 2VN1A 2M08A 1ZBVA 3IK8A 1HJWA 3OA5A 3ODKA 1FKTA 4ODNA 3O5PA 3CZ8A 1VF8A 5J6EA 2RSEA 2D9FA 5DITA 3PA7A 4LAYA 3UQAA 4ODQA 2KGJA 1E9LA 4AY1A 4ODOA 2LPVA 1W9UA 3PRDA 1T11A 1LL6A 1W1TA 3KADA 1JNEA 3ARQA 1ZBCA 4BF8A 4JFJA 1HKIA 5HW8A 1Q6HA 2XPAA 2XP8A 1O6IA 5HT1A 1FKBA 1PBKA 3JYMA 4N19A 4IQ2A 1FFRA 4DZ3A 1WNOA 4MNMA 4P8XA 4GGQA 3GU0A 4P8WA 4TNSA 3AQUA 4DWSA 2KFWA 1FKKA 5HBFA 4DZ2A 2EULA 1FKRA 1ZK6A 3WQVA 3VAWA 5HKGA 2MF9A 3ALGA 3ARPA 2VCDA 1EIBA 1NWSA 1QZ2A 3JYJA 2PN0A 3WD3A 1Y0OA 2XP5A 3AS2A 2AWGA 2RURA 2Q5AA 3CHFA 3ARVA 4QT2A 2DT2A 1ROUA 4ODLA 1KT1A 4G50A 4QZVB 1EDQA 3BMBA 1UR9A 4ZPTR 3GPKA 5BXJA 3KCEA 4IQCA 4L3NA 4C02B 1C9HA 3PRAA 4L72B 1ITXA 1LL7A 4Q22A 4DRQA 4R0XA 4U85A 3WQWA 3O5IA 2A3BA 2PV3A 4J4NA 1UR8A 4LAVA 3TCZA 1ZB5A 1R9HA 1W9PA 3O5LA 4IPXA 2IUZA 5GPRA 4DRPA 1HKKA 2WK2A 2DT1A 3ARXA 1J4RA 1E6PA 3WD1A 3OOBA 3B9DA 4Q7NA 1J6YA 2ITKA 4W9OA 1NWRA 2UZ5A 4FN2A 1QPLA 1U79A 4MNJA 4ZPWR 1W1YA 2PPNA 4MGVA 2DSUA 4ITZA 3WD4A 5DF0A 4WKAA 4Z2HA 1GUVA 1FKHA 3BXWA 3G6MA 2XP7A 3CHCA 3CHEA 2MPHA 3IKGA
chains in the Genus database with same CATH topology
4LAWA 3ARUA 2N87A 1ZCNA 1EHNA 3RM4A 1OGGA 1J4HA 4JFLA 4NSBA 1L1PA 4DWSC 4MNLA 1EQ3A 4JFIA 3KAHA 1HJXA 3AS0A 4URIA 3ARRA 2XP9A 5DEZA 4DIPA 2XPBA 2DSWA 1FFQA 1TCOC 1FAPA 2G8ZA 1OWQA 1NMVA 1Q6IA 1FKFA 3O5JA 2PI6A 5DIUA 4DRMA 5GPGA 2RUCA 4WKHA 3KZ7A 4S3KA 4JYSA 4WJXA 5DIVA 2WLYA 5HTGA 2LGOA 3UI5A 1W1VA 4TYOA 1D2KA 4NNRA 4XAKA 2G41A 3B9AA 3AS1A 1FD9A 3W4RA 3WL0A 1HKMA 4O2TA 1IX5A 1GOIA 3O5DA 1ZL1A 3ARSA 2MLYA 4DRNA 1E6ZA 4WIWA 1E6NA 3KAFA 3O5EA 3LUOA 2DSVA 1ROTA 2PV2A 1W1PA 1QPFA 1XHGA 1Q1CA 2K8IA 2FAPA 3NI6A 1FJDA 3JXVA 2XP6A 3O5OA 4MTVA 4NZCA 4DH0A 3B9EA 4TW7A 1LG2A 3UF8A 3UQBA 4DRJA 1YATA 4W9PA 2RUQA 2IF4A 1BKFA 2L2SA 2A3CA 4KR0B 4DRIA 3I6CA 1GPFA 1HXVA 1TFVA 1JVWA 2DT0A 3QOKA 1FKDA 1RD6A 2O92A 4IT4A 4TW6A 1FKGA 1WB0A 1NMWA 1NSGA 2RQSA 3ALFA 2ZQVA 3MDYB 4Z2IA 2KO7A 2PPPA 4PTMA 3ARZA 5I98A 2FDMA 3WD0A 4QT3A 4ZS6A 2DG9A 2F2DA 1SR0A 2A3EA 4TW8A 3RFWA 2ZR6A 3B7XA 5HWCA 3IHZA 3AS3A 3KABA 4ODPA 5HW7A 1W9VA 4MNKA 4MAVA 3B8SA 2XP3A 3NRKA 2FKEA 4DRHA 1EYMA 2A3AA 1LL4A 4TX0A 2PBCA 4ML4A 3CHDA 1LQ0A 2YBUA 2DPEA 1H0GA 3O5GA 5HW6A 2Y78A 3FXYA 2DG4A 2DSZA 3O5MA 3WKZA 2ZR4A 3ARYA 4P8VA 4DT4A 1ZU8A 4Z2LA 1KT0A 4LGXA 1D7HA 2MLZA 1N1AA 3UI4A 3TDBA 1A7XA 2XP4A 1P5QA 2JZVA 4WK9A 5B8IC 4HBEA 4U86A 4LAXA 1OGBA 3RM9A 2KI3A 1YW5A 1HJVA 1FKIA 4J4OA 1CTNA 1SYTA 4U84A 1FKSA 1KFWA 3G6LA 1FKJA 2ZR5A 3CH9A 4ODRA 1K9TA 3O5QA 1NH6A 1ZBWA 3O5FA 2YBTA 4DROA 2M1IA 1JNDA 4R5EA 1W26A 2ZQTA 1F8AB 4ODMA 3ARWA 4MSPA 3CGMA 4S3JA 4P8UA 2MLXA 4QIBA 2WM0A 1J4IA 1XRVA 1FKLA 4DWSD 3O5KA 2O9OA 4JFMA 1F40A 5DO2A 2DT3A 2OLHA 3FY1A 4W5UA 2LKNA 1JNTA 4IT6A 3WD2A 2M2AA 4FAPA 3H9RB 4MPKA 4DWSB 3RMEA 1PINA 1E15A 5HWBA 3CGNA 4JFKA 4ZPVR 3ARTA 1JNSA 3TC5A 3O5RA 3KAIA 2MNTA 5JH8A 2WLZA 1LG1A 5HUAA 2AOSA 4WKFA 4DRKA 4HARA 4Z2KA 2KE0A 1D7IA 4W9QA 2OFNA 4GIVA 4ODKA 3WIJA 3PRBA 2KR7A 3WH0A 3FAPA 1M5YA 2DG3A 1ZBKA 3WL1A 1Q6UA 2ZQSA 1D6OA 5D75A 3UQIA 3EY6A 3KAGA 2ZQUA 2PV1A 1NWUA 2F4EA 1B6CA 5GQBA 3RGCA 1X6LA 3RM8A 1NWTA 1E6RA 1WAWA 1HKJA 1H0IA 4Z2GA 2B31A 4KQZA 3UI6A 2ESCA 4HBOA 1X6NA 1LJYA 1D7JA 3NTPA 3PR9A 2LJ4A 2PPOA 2QF8A 4Z2JA 3AROA 2F21A 3KACA 1BL4A 3IKDA 4G2PA 2RUDA 2VN1A 2M08A 1ZBVA 3IK8A 1HJWA 3OA5A 3ODKA 1FKTA 4ODNA 3O5PA 3CZ8A 1VF8A 5J6EA 2RSEA 2D9FA 5DITA 3PA7A 4LAYA 3UQAA 4ODQA 2KGJA 1E9LA 4AY1A 4ODOA 2LPVA 1W9UA 3PRDA 1T11A 1LL6A 1W1TA 3KADA 1JNEA 3ARQA 1ZBCA 4BF8A 4JFJA 1HKIA 5HW8A 1Q6HA 2XPAA 2XP8A 1O6IA 5HT1A 1FKBA 1PBKA 3JYMA 4N19A 4IQ2A 1FFRA 4DZ3A 1WNOA 4MNMA 4P8XA 4GGQA 4P8WA 4TNSA 3AQUA 4DWSA 2KFWA 1FKKA 5HBFA 4DZ2A 1FKRA 1ZK6A 3WQVA 3VAWA 5HKGA 2MF9A 3ALGA 3ARPA 2VCDA 1EIBA 1NWSA 1QZ2A 3JYJA 3WD3A 1Y0OA 2XP5A 3AS2A 2AWGA 2RURA 2Q5AA 3CHFA 3ARVA 4QT2A 2DT2A 1ROUA 4ODLA 1KT1A 4G50A 4QZVB 1EDQA 1UR9A 4ZPTR 3GPKA 5BXJA 3KCEA 4IQCA 4L3NA 4C02B 1C9HA 3PRAA 4L72B 1ITXA 1LL7A 4Q22A 4DRQA 4R0XA 4U85A 3WQWA 3O5IA 2A3BA 2PV3A 4J4NA 1UR8A 4LAVA 3TCZA 1ZB5A 1R9HA 1W9PA 3O5LA 4IPXA 2IUZA 5GPRA 4DRPA 1HKKA 2WK2A 2DT1A 3ARXA 1J4RA 1E6PA 3WD1A 3OOBA 3B9DA 4Q7NA 1J6YA 2ITKA 4W9OA 1NWRA 2UZ5A 4FN2A 1QPLA 1U79A 4MNJA 4ZPWR 1W1YA 2PPNA 4MGVA 2DSUA 4ITZA 3WD4A 5DF0A 4WKAA 4Z2HA 1GUVA 1FKHA 3BXWA 3G6MA 2XP7A 3CHCA 3CHEA 2MPHA 3IKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAW A;  4GGQ A;  2N87 A;  1PIN A;  3B7X A;  5HWC A;  1ZCN A;  3IHZ A;  5HWB A;  3CGN A;  4JFK A;  4TNS A;  3KAB A;  1JNS A;  2KFW A;  3TC5 A;  1FKK A;  1J4H A;  3O5R A;  3KAI A;  4JFL A;  2MNT A;  4ODP A;  5HW7 A;  1L1P A;  4DZ2 A;  1FKR A;  1ZK6 A;  2XP3 A;  3NRK A;  1EQ3 A;  2FKE A;  4DRH A;  1EYM A;  5HUA A;  4JFI A;  3VAW A;  5HKG A;  3KAH A;  2MF9 A;  4TX0 A;  2PBC A;  4DRK A;  3H9R B;  2KE0 A;  2VCD A;  1D7I A;  2XP9 A;  4W9Q A;  2OFN A;  4DIP A;  1QZ2 A;  4GIV A;  4ODK A;  3JYJ A;  3RFW A;  2XPB A;  1Y0O A;  3PRB A;  1TCO C;  2KR7 A;  2XP5 A;  3O5G A;  3WH0 A;  5HW6 A;  3FAP A;  1M5Y A;  1FAP A;  2DG3 A;  2Y78 A;  1NMV A;  1Q6I A;  1FKF A;  2AWG A;  2DG4 A;  2RUR A;  3O5J A;  3O5M A;  5DIU A;  2Q5A A;  4QT2 A;  2ZR4 A;  1ROU A;  4DRM A;  4ODL A;  1Q6U A;  2ZQS A;  1D6O A;  1KT1 A;  4DT4 A;  4G50 A;  5GPG A;  2RUC A;  3KZ7 A;  5D75 A;  4JYS A;  3UQI A;  5DIV A;  1KT0 A;  3EY6 A;  5HTG A;  3KAG A;  2ZQU A;  2LGO A;  3GPK A;  3UI5 A;  5BXJ A;  2PV1 A;  3KCE A;  1D7H A;  4IQC A;  2F4E A;  1B6C A;  2MLZ A;  4TYO A;  1C9H A;  3RGC A;  4C02 B;  4NNR A;  1N1A A;  3UI4 A;  3TDB A;  1A7X A;  2XP4 A;  1P5Q A;  4DRQ A;  2JZV A;  4R0X A;  1FD9 A;  5B8I C;  4U86 A;  4LAX A;  4O2T A;  3UI6 A;  4U85 A;  2KI3 A;  3O5D A;  1YW5 A;  3O5I A;  1D7J A;  2MLY A;  4DRN A;  1FKI A;  3NTP A;  4J4O A;  2PV3 A;  4J4N A;  2LJ4 A;  1FKS A;  2PPO A;  4U84 A;  1FKJ A;  2ZR5 A;  4LAV A;  4ODR A;  3TCZ A;  3KAF A;  2F21 A;  3O5Q A;  3KAC A;  1R9H A;  3O5E A;  1BL4 A;  3IKD A;  3LUO A;  4G2P A;  2RUD A;  2VN1 A;  3O5L A;  1ROT A;  4IPX A;  2M08 A;  3O5F A;  2PV2 A;  3IK8 A;  3ODK A;  4ODN A;  1FKT A;  1QPF A;  3O5P A;  4DRO A;  1Q1C A;  2K8I A;  2M1I A;  4DRP A;  2FAP A;  5J6E A;  2RSE A;  3NI6 A;  1FJD A;  1W26 A;  2ZQT A;  3JXV A;  2XP6 A;  3O5O A;  4DH0 A;  2D9F A;  4TW7 A;  5DIT A;  1F8A B;  3PA7 A;  4LAY A;  4ODM A;  3UF8 A;  4MSP A;  3UQA A;  4ODQ A;  3CGM A;  2KGJ A;  3UQB A;  4DRJ A;  1YAT A;  1J4R A;  2RUQ A;  2IF4 A;  3OOB A;  4ODO A;  4W9P A;  2MLX A;  4QIB A;  2LPV A;  3PRD A;  1BKF A;  1J4I A;  2L2S A;  1FKL A;  1T11 A;  4DRI A;  3I6C A;  3O5K A;  1HXV A;  1J6Y A;  1JVW A;  2ITK A;  4JFM A;  1FKD A;  3KAD A;  1F40 A;  4W9O A;  4TW6 A;  1FKG A;  4BF8 A;  1NMW A;  1NSG A;  4FN2 A;  2RQS A;  2UZ5 A;  4JFJ A;  1QPL A;  1U79 A;  2ZQV A;  5HW8 A;  1Q6H A;  2XPA A;  2PPN A;  3MDY B;  2XP8 A;  4MGV A;  2KO7 A;  2LKN A;  2PPP A;  4ITZ A;  5HT1 A;  1FKB A;  5I98 A;  1PBK A;  1JNT A;  3JYM A;  1FKH A;  4QT3 A;  4N19 A;  4IQ2 A;  2XP7 A;  2DG9 A;  2F2D A;  2M2A A;  2MPH A;  4FAP A;  4TW8 A;  4DZ3 A;  3IKG A;  2ZR6 A; 
#chains in the Genus database with same CATH topology
 4LAW A;  3ARU A;  2N87 A;  1ZCN A;  1EHN A;  3RM4 A;  1OGG A;  1J4H A;  4JFL A;  4NSB A;  1L1P A;  4DWS C;  4MNL A;  1EQ3 A;  1E44 A;  4JFI A;  3KAH A;  1HJX A;  3AS0 A;  4URI A;  3ARR A;  4UDM A;  2XP9 A;  5DEZ A;  4DIP A;  2XPB A;  2DSW A;  1FFQ A;  1TCO C;  1FAP A;  2G8Z A;  1OWQ A;  1NMV A;  1Q6I A;  1FKF A;  3O5J A;  2PI6 A;  5DIU A;  4DRM A;  5GPG A;  2RUC A;  4WKH A;  3KZ7 A;  4S3K A;  4JYS A;  4WJX A;  5DIV A;  2WLY A;  5HTG A;  2LGO A;  3UI5 A;  1W1V A;  4TYO A;  1D2K A;  4NNR A;  4XAK A;  2G41 A;  3B9A A;  3AS1 A;  1FD9 A;  3W4R A;  3WL0 A;  1HKM A;  4O2T A;  1IX5 A;  1GOI A;  3O5D A;  1ZL1 A;  3ARS A;  2MLY A;  4DRN A;  1E6Z A;  4WIW A;  1E6N A;  3KAF A;  3O5E A;  3LUO A;  2DSV A;  1ROT A;  2PV2 A;  1W1P A;  1QPF A;  1XHG A;  1Q1C A;  2K8I A;  2FAP A;  3NI6 A;  1FJD A;  3JXV A;  2XP6 A;  3O5O A;  4MTV A;  4NZC A;  4DH0 A;  3B9E A;  4TW7 A;  1LG2 A;  3UF8 A;  3UQB A;  4DRJ A;  1YAT A;  4W9P A;  2RUQ A;  2IF4 A;  1BKF A;  2L2S A;  2A3C A;  4KR0 B;  4DRI A;  3I6C A;  1GPF A;  1HXV A;  1TFV A;  1JVW A;  2DT0 A;  3QOK A;  1FKD A;  1RD6 A;  2O92 A;  4IT4 A;  4TW6 A;  1FKG A;  1WB0 A;  1NMW A;  1NSG A;  2RQS A;  3ALF A;  2ZQV A;  1GRJ A;  3MDY B;  4Z2I A;  2KO7 A;  2PPP A;  4PTM A;  3ARZ A;  5I98 A;  2FDM A;  3WD0 A;  4QT3 A;  4ZS6 A;  2DG9 A;  2F2D A;  1SR0 A;  2A3E A;  4TW8 A;  3RFW A;  2ZR6 A;  3B7X A;  5HWC A;  3IHZ A;  3AS3 A;  3KAB A;  4ODP A;  5HW7 A;  1W9V A;  4MNK A;  4MAV A;  3B8S A;  2XP3 A;  3NRK A;  2FKE A;  4DRH A;  1EYM A;  2A3A A;  1LL4 A;  4TX0 A;  2PBC A;  4ML4 A;  3CHD A;  1LQ0 A;  2YBU A;  2DPE A;  1H0G A;  3O5G A;  5HW6 A;  2Y78 A;  3FXY A;  2DG4 A;  2DSZ A;  3O5M A;  3WKZ A;  1JCH B;  2ZR4 A;  3ARY A;  4P8V A;  4DT4 A;  1ZU8 A;  3GTY X;  4Z2L A;  1KT0 A;  4LGX A;  1D7H A;  2MLZ A;  1N1A A;  2F23 A;  3UI4 A;  3TDB A;  1A7X A;  2XP4 A;  1P5Q A;  2JZV A;  4WK9 A;  5B8I C;  4HBE A;  4U86 A;  4LAX A;  1OGB A;  3RM9 A;  2KI3 A;  1YW5 A;  1HJV A;  1FKI A;  4J4O A;  1CTN A;  1SYT A;  4U84 A;  1FKS A;  1KFW A;  3G6L A;  1FKJ A;  2ZR5 A;  3CH9 A;  4ODR A;  1K9T A;  3O5Q A;  1NH6 A;  1ZBW A;  3O5F A;  2YBT A;  4DRO A;  2M1I A;  1JND A;  4R5E A;  1W26 A;  2ZQT A;  1F8A B;  4ODM A;  3ARW A;  4MSP A;  3CGM A;  4S3J A;  4P8U A;  2MLX A;  4QIB A;  2WM0 A;  1J4I A;  1XRV A;  1FKL A;  4DWS D;  3O5K A;  2O9O A;  4JFM A;  1F40 A;  5DO2 A;  2DT3 A;  2OLH A;  3FY1 A;  4W5U A;  2LKN A;  2B5U B;  2ETN A;  1JNT A;  4IT6 A;  3WD2 A;  2M2A A;  4FAP A;  3H9R B;  4MPK A;  4DWS B;  3RME A;  1PIN A;  1E15 A;  5HWB A;  3CGN A;  4JFK A;  4ZPV R;  3ART A;  1JNS A;  3TC5 A;  3O5R A;  3KAI A;  2MNT A;  5JH8 A;  2WLZ A;  1LG1 A;  5HUA A;  2AOS A;  2P4V A;  4WKF A;  4DRK A;  4HAR A;  4Z2K A;  2KE0 A;  1D7I A;  4W9Q A;  2OFN A;  4GIV A;  4ODK A;  3WIJ A;  3PRB A;  2KR7 A;  3WH0 A;  3FAP A;  1M5Y A;  2DG3 A;  1ZBK A;  3WL1 A;  1Q6U A;  2ZQS A;  1D6O A;  5D75 A;  3UQI A;  3EY6 A;  3KAG A;  2ZQU A;  2PV1 A;  1NWU A;  2F4E A;  1B6C A;  5GQB A;  3RGC A;  1X6L A;  3RM8 A;  1NWT A;  1E6R A;  1WAW A;  1HKJ A;  1H0I A;  4Z2G A;  2B31 A;  3EIP A;  4KQZ A;  3UI6 A;  2ESC A;  4HBO A;  1X6N A;  1LJY A;  1D7J A;  3NTP A;  3PR9 A;  2LJ4 A;  2PPO A;  2QF8 A;  4Z2J A;  3ARO A;  2F21 A;  3KAC A;  1BL4 A;  3IKD A;  4G2P A;  2RUD A;  2VN1 A;  2M08 A;  1ZBV A;  3IK8 A;  1HJW A;  3OA5 A;  3ODK A;  1FKT A;  4ODN A;  3O5P A;  3CZ8 A;  1VF8 A;  5J6E A;  2RSE A;  2D9F A;  5DIT A;  3PA7 A;  4LAY A;  3UQA A;  4ODQ A;  2KGJ A;  1E9L A;  4AY1 A;  4ODO A;  2LPV A;  1W9U A;  3PRD A;  1T11 A;  1LL6 A;  1W1T A;  3KAD A;  1JNE A;  3ARQ A;  1ZBC A;  4BF8 A;  4JFJ A;  1HKI A;  5HW8 A;  1Q6H A;  2XPA A;  2XP8 A;  1O6I A;  5HT1 A;  1FKB A;  1PBK A;  3JYM A;  4N19 A;  4IQ2 A;  1FFR A;  4DZ3 A;  1WNO A;  4MNM A;  4P8X A;  4GGQ A;  3GU0 A;  4P8W A;  4TNS A;  3AQU A;  4DWS A;  2KFW A;  1FKK A;  5HBF A;  4DZ2 A;  2EUL A;  1FKR A;  1ZK6 A;  3WQV A;  3VAW A;  5HKG A;  2MF9 A;  3ALG A;  3ARP A;  2VCD A;  1EIB A;  1NWS A;  1QZ2 A;  3JYJ A;  2PN0 A;  3WD3 A;  1Y0O A;  2XP5 A;  3AS2 A;  2AWG A;  2RUR A;  2Q5A A;  3CHF A;  3ARV A;  4QT2 A;  2DT2 A;  1ROU A;  4ODL A;  1KT1 A;  4G50 A;  4QZV B;  1EDQ A;  3BMB A;  1UR9 A;  4ZPT R;  3GPK A;  5BXJ A;  3KCE A;  4IQC A;  4L3N A;  4C02 B;  1C9H A;  3PRA A;  4L72 B;  1ITX A;  1LL7 A;  4Q22 A;  4DRQ A;  4R0X A;  4U85 A;  3WQW A;  3O5I A;  2A3B A;  2PV3 A;  4J4N A;  1UR8 A;  4LAV A;  3TCZ A;  1ZB5 A;  1R9H A;  1W9P A;  3O5L A;  4IPX A;  2IUZ A;  5GPR A;  4DRP A;  1HKK A;  2WK2 A;  2DT1 A;  3ARX A;  1J4R A;  1E6P A;  3WD1 A;  3OOB A;  3B9D A;  4Q7N A;  1J6Y A;  2ITK A;  4W9O A;  1NWR A;  2UZ5 A;  4FN2 A;  1QPL A;  1U79 A;  4MNJ A;  4ZPW R;  1W1Y A;  2PPN A;  4MGV A;  2DSU A;  4ITZ A;  3WD4 A;  5DF0 A;  4WKA A;  4Z2H A;  1GUV A;  1FKH A;  3BXW A;  3G6M A;  2XP7 A;  3CHC A;  3CHE A;  2MPH A;  3IKG A; 
#chains in the Genus database with same CATH homology
 4LAW A;  3ARU A;  2N87 A;  1ZCN A;  1EHN A;  3RM4 A;  1OGG A;  1J4H A;  4JFL A;  4NSB A;  1L1P A;  4DWS C;  4MNL A;  1EQ3 A;  4JFI A;  3KAH A;  1HJX A;  3AS0 A;  4URI A;  3ARR A;  2XP9 A;  5DEZ A;  4DIP A;  2XPB A;  2DSW A;  1FFQ A;  1TCO C;  1FAP A;  2G8Z A;  1OWQ A;  1NMV A;  1Q6I A;  1FKF A;  3O5J A;  2PI6 A;  5DIU A;  4DRM A;  5GPG A;  2RUC A;  4WKH A;  3KZ7 A;  4S3K A;  4JYS A;  4WJX A;  5DIV A;  2WLY A;  5HTG A;  2LGO A;  3UI5 A;  1W1V A;  4TYO A;  1D2K A;  4NNR A;  4XAK A;  2G41 A;  3B9A A;  3AS1 A;  1FD9 A;  3W4R A;  3WL0 A;  1HKM A;  4O2T A;  1IX5 A;  1GOI A;  3O5D A;  1ZL1 A;  3ARS A;  2MLY A;  4DRN A;  1E6Z A;  4WIW A;  1E6N A;  3KAF A;  3O5E A;  3LUO A;  2DSV A;  1ROT A;  2PV2 A;  1W1P A;  1QPF A;  1XHG A;  1Q1C A;  2K8I A;  2FAP A;  3NI6 A;  1FJD A;  3JXV A;  2XP6 A;  3O5O A;  4MTV A;  4NZC A;  4DH0 A;  3B9E A;  4TW7 A;  1LG2 A;  3UF8 A;  3UQB A;  4DRJ A;  1YAT A;  4W9P A;  2RUQ A;  2IF4 A;  1BKF A;  2L2S A;  2A3C A;  4KR0 B;  4DRI A;  3I6C A;  1GPF A;  1HXV A;  1TFV A;  1JVW A;  2DT0 A;  3QOK A;  1FKD A;  1RD6 A;  2O92 A;  4IT4 A;  4TW6 A;  1FKG A;  1WB0 A;  1NMW A;  1NSG A;  2RQS A;  3ALF A;  2ZQV A;  3MDY B;  4Z2I A;  2KO7 A;  2PPP A;  4PTM A;  3ARZ A;  5I98 A;  2FDM A;  3WD0 A;  4QT3 A;  4ZS6 A;  2DG9 A;  2F2D A;  1SR0 A;  2A3E A;  4TW8 A;  3RFW A;  2ZR6 A;  3B7X A;  5HWC A;  3IHZ A;  3AS3 A;  3KAB A;  4ODP A;  5HW7 A;  1W9V A;  4MNK A;  4MAV A;  3B8S A;  2XP3 A;  3NRK A;  2FKE A;  4DRH A;  1EYM A;  2A3A A;  1LL4 A;  4TX0 A;  2PBC A;  4ML4 A;  3CHD A;  1LQ0 A;  2YBU A;  2DPE A;  1H0G A;  3O5G A;  5HW6 A;  2Y78 A;  3FXY A;  2DG4 A;  2DSZ A;  3O5M A;  3WKZ A;  2ZR4 A;  3ARY A;  4P8V A;  4DT4 A;  1ZU8 A;  4Z2L A;  1KT0 A;  4LGX A;  1D7H A;  2MLZ A;  1N1A A;  3UI4 A;  3TDB A;  1A7X A;  2XP4 A;  1P5Q A;  2JZV A;  4WK9 A;  5B8I C;  4HBE A;  4U86 A;  4LAX A;  1OGB A;  3RM9 A;  2KI3 A;  1YW5 A;  1HJV A;  1FKI A;  4J4O A;  1CTN A;  1SYT A;  4U84 A;  1FKS A;  1KFW A;  3G6L A;  1FKJ A;  2ZR5 A;  3CH9 A;  4ODR A;  1K9T A;  3O5Q A;  1NH6 A;  1ZBW A;  3O5F A;  2YBT A;  4DRO A;  2M1I A;  1JND A;  4R5E A;  1W26 A;  2ZQT A;  1F8A B;  4ODM A;  3ARW A;  4MSP A;  3CGM A;  4S3J A;  4P8U A;  2MLX A;  4QIB A;  2WM0 A;  1J4I A;  1XRV A;  1FKL A;  4DWS D;  3O5K A;  2O9O A;  4JFM A;  1F40 A;  5DO2 A;  2DT3 A;  2OLH A;  3FY1 A;  4W5U A;  2LKN A;  1JNT A;  4IT6 A;  3WD2 A;  2M2A A;  4FAP A;  3H9R B;  4MPK A;  4DWS B;  3RME A;  1PIN A;  1E15 A;  5HWB A;  3CGN A;  4JFK A;  4ZPV R;  3ART A;  1JNS A;  3TC5 A;  3O5R A;  3KAI A;  2MNT A;  5JH8 A;  2WLZ A;  1LG1 A;  5HUA A;  2AOS A;  4WKF A;  4DRK A;  4HAR A;  4Z2K A;  2KE0 A;  1D7I A;  4W9Q A;  2OFN A;  4GIV A;  4ODK A;  3WIJ A;  3PRB A;  2KR7 A;  3WH0 A;  3FAP A;  1M5Y A;  2DG3 A;  1ZBK A;  3WL1 A;  1Q6U A;  2ZQS A;  1D6O A;  5D75 A;  3UQI A;  3EY6 A;  3KAG A;  2ZQU A;  2PV1 A;  1NWU A;  2F4E A;  1B6C A;  5GQB A;  3RGC A;  1X6L A;  3RM8 A;  1NWT A;  1E6R A;  1WAW A;  1HKJ A;  1H0I A;  4Z2G A;  2B31 A;  4KQZ A;  3UI6 A;  2ESC A;  4HBO A;  1X6N A;  1LJY A;  1D7J A;  3NTP A;  3PR9 A;  2LJ4 A;  2PPO A;  2QF8 A;  4Z2J A;  3ARO A;  2F21 A;  3KAC A;  1BL4 A;  3IKD A;  4G2P A;  2RUD A;  2VN1 A;  2M08 A;  1ZBV A;  3IK8 A;  1HJW A;  3OA5 A;  3ODK A;  1FKT A;  4ODN A;  3O5P A;  3CZ8 A;  1VF8 A;  5J6E A;  2RSE A;  2D9F A;  5DIT A;  3PA7 A;  4LAY A;  3UQA A;  4ODQ A;  2KGJ A;  1E9L A;  4AY1 A;  4ODO A;  2LPV A;  1W9U A;  3PRD A;  1T11 A;  1LL6 A;  1W1T A;  3KAD A;  1JNE A;  3ARQ A;  1ZBC A;  4BF8 A;  4JFJ A;  1HKI A;  5HW8 A;  1Q6H A;  2XPA A;  2XP8 A;  1O6I A;  5HT1 A;  1FKB A;  1PBK A;  3JYM A;  4N19 A;  4IQ2 A;  1FFR A;  4DZ3 A;  1WNO A;  4MNM A;  4P8X A;  4GGQ A;  4P8W A;  4TNS A;  3AQU A;  4DWS A;  2KFW A;  1FKK A;  5HBF A;  4DZ2 A;  1FKR A;  1ZK6 A;  3WQV A;  3VAW A;  5HKG A;  2MF9 A;  3ALG A;  3ARP A;  2VCD A;  1EIB A;  1NWS A;  1QZ2 A;  3JYJ A;  3WD3 A;  1Y0O A;  2XP5 A;  3AS2 A;  2AWG A;  2RUR A;  2Q5A A;  3CHF A;  3ARV A;  4QT2 A;  2DT2 A;  1ROU A;  4ODL A;  1KT1 A;  4G50 A;  4QZV B;  1EDQ A;  1UR9 A;  4ZPT R;  3GPK A;  5BXJ A;  3KCE A;  4IQC A;  4L3N A;  4C02 B;  1C9H A;  3PRA A;  4L72 B;  1ITX A;  1LL7 A;  4Q22 A;  4DRQ A;  4R0X A;  4U85 A;  3WQW A;  3O5I A;  2A3B A;  2PV3 A;  4J4N A;  1UR8 A;  4LAV A;  3TCZ A;  1ZB5 A;  1R9H A;  1W9P A;  3O5L A;  4IPX A;  2IUZ A;  5GPR A;  4DRP A;  1HKK A;  2WK2 A;  2DT1 A;  3ARX A;  1J4R A;  1E6P A;  3WD1 A;  3OOB A;  3B9D A;  4Q7N A;  1J6Y A;  2ITK A;  4W9O A;  1NWR A;  2UZ5 A;  4FN2 A;  1QPL A;  1U79 A;  4MNJ A;  4ZPW R;  1W1Y A;  2PPN A;  4MGV A;  2DSU A;  4ITZ A;  3WD4 A;  5DF0 A;  4WKA A;  4Z2H A;  1GUV A;  1FKH A;  3BXW A;  3G6M A;  2XP7 A;  3CHC A;  3CHE A;  2MPH A;  3IKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...