1FKJA

Atomic structure of fkbp12-fk506, an immunophilin immunosuppressant complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative X-ray structures of the major binding protein for the immunosuppressant FK506 (tacrolimus) in unliganded form and in complex with FK506 and rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rotamase
molecule keywords FK506 BINDING PROTEIN
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkjA00
4DRPA 3O5GA 2L2SA 4ITZA 3KAHA 4QT2A 2XP4A 4DT4A 3UQIA 1YW5A 2FKEA 1M5YA 4TW6A 5HW6A 4W9OA 4DRIA 2RUQA 3JXVA 5HW8A 3KACA 1Q6HA 1QPFA 1YATA 2PV1A 1NMVA 4ODPA 2KGJA 4ODLA 5GPGA 2PBCA 1F8AB 2ZR5A 4MSPA 2ZQTA 4JFIA 4C02B 3O5LA 2KR7A 1TCOC 4DIPA 4DRMA 4QIBA 3UQBA 4ODQA 1PBKA 2DG9A 4ODOA 2LKNA 2PV3A 1ZK6A 1FJDA 4QT3A 2XP8A 2RQSA 1FKLA 2RURA 1EYMA 2M08A 3KADA 4ODNA 2ZQSA 4TW8A 3UI4A 4DRKA 3LUOA 1FKDA 4ODMA 4W9PA 1FKFA 4MGVA 3PRBA 2RUCA 3FAPA 4TNSA 1Q6UA 5D75A 2UZ5A 3OOBA 3UI5A 4DZ2A 4G2PA 3KABA 5HUAA 4JFKA 1D7JA 2JZVA 1FKIA 1KT0A 2XPAA 4NNRA 2KI3A 3H9RB 2RUDA 4J4NA 4U84A 1D6OA 2ITKA 3TC5A 4JYSA 4BF8A 4DROA 5I98A 1J6YA 1ROTA 2DG4A 3EY6A 1J4HA 3JYMA 3O5MA 1F40A 1ROUA 3KAIA 4ODKA 1FKKA 3PA7A 1FKTA 2D9FA 2Y78A 3UQAA 5DIVA 2AWGA 1KT1A 1Y0OA 2VCDA 3IHZA 4LAXA 1FKGA 2MPHA 1NSGA 4GGQA 2ZR6A 4DZ3A 1J4RA 1FKRA 1JNSA 4R0XA 3O5PA 1Q1CA 4TYOA 4U86A 5B8IC 2M2AA 2XP6A 3KAGA 4LAVA 2N87A 5HWBA 2XPBA 2XP3A 3O5IA 1BKFA 2XP9A 2MF9A 2IF4A 4DRQA 5HW7A 3I6CA 1W26A 3O5QA 1FKHA 3PRDA 4JFMA 3KCEA 4O2TA 4W9QA 4JFLA 1FD9A 1P5QA 2KO7A 3KZ7A 3O5FA 3ODKA 5HTGA 3CGNA 3CGMA 1R9HA 2MNTA 2MLYA 2XP5A 1BL4A 2ZQUA 3O5EA 1C9HA 2LJ4A 3RFWA 3RGCA 2LGOA 1D7HA 1PINA 1ZCNA 3TCZA 3UI6A 1B6CA 1N1AA 4J4OA 1EQ3A 2Q5AA 1FKJA 2M1IA 2VN1A 2ZQVA 4DRHA 4FAPA 5HT1A 5BXJA 4TW7A 2PPOA 2XP7A 3GPKA 4DRJA 4IQ2A 4IQCA 3B7XA 3IKDA 3NTPA 1D7IA 2KE0A 3NRKA 1FAPA 2FAPA 2KFWA 3IKGA 2ZR4A 4U85A 2MLZA 3UF8A 4DH0A 3O5RA 4ODRA 3O5OA 2DG3A 5DIUA 2F4EA 2F21A 2OFNA 2K8IA 4FN2A 3TDBA 2F2DA 1A7XA 4IPXA 3O5KA 1T11A 3KAFA 1HXVA 4LAYA 1QPLA 4GIVA 3MDYB 3NI6A 3O5JA 5HKGA 2LPVA 3JYJA 1JVWA 2PPNA 4G50A 5DITA 1J4IA 1NMWA 3O5DA 4LAWA 4N19A 1JNTA 3VAWA 1U79A 1FKSA 3IK8A 2MLXA 3WH0A 4DRNA 5HWCA 4TX0A 2RSEA 5J6EA 1L1PA 1QZ2A 4JFJA 1FKBA 1Q6IA 2PV2A 2PPPA
chains in the Genus database with same CATH superfamily
4S3JA 2A3BA 3UQIA 4WKHA 2FKEA 5HW6A 4L72B 4P8VA 4W5UA 1Q6HA 1YATA 4MNKA 4ODPA 2KGJA 4WKAA 4JFIA 3O5LA 1TCOC 2WK2A 4DRMA 4QIBA 4URIA 4MTVA 2XP8A 2M08A 2ETNA 2ZQSA 4DWSD 3OOBA 4WJXA 1RD6A 1W9PA 1HKIA 1ZBCA 1KT0A 3AROA 1FFQA 3W4RA 1GUVA 1OGBA 2RUDA 4J4NA 4QZVB 2WLZA 3BMBA 2ITKA 4BF8A 3TC5A 4JYSA 5JH8A 1LL4A 2F23A 2DG4A 1GRJA 1F40A 3ARRA 1ZBWA 3PA7A 1FKTA 3UQAA 2PI6A 1LJYA 2VCDA 1GPFA 1VF8A 1NSGA 4P8WA 1FKRA 1JNSA 3CHFA 4R0XA 5B8IC 4TYOA 1TFVA 3KAGA 1WNOA 1FFRA 4Z2IA 5HW7A 3O5QA 3PRDA 3FXYA 1UR8A 1HKKA 3KCEA 4W9QA 2DSWA 3O5FA 3B9DA 1NH6A 3WD3A 4DWSB 1UR9A 1E44A 1ZCNA 1HJWA 1N1AA 4J4OA 4ZPWR 5GQBA 4FAPA 2M1IA 1EQ3A 5HT1A 5BXJA 3GPKA 3WIJA 4IQCA 4Z2GA 4WK9A 2ZR4A 3AS2A 1XRVA 2F4EA 1A7XA 1NWRA 4P8XA 1W9VA 1HXVA 5DEZA 4NSBA 3ARQA 3O5JA 5HKGA 4AY1A 1JVWA 2PPNA 4G50A 3WL0A 1J4IA 3O5DA 4LAWA 1U79A 1L1PA 1NWSA 4TX0A 2DT3A 3O5GA 1W1VA 1LL6A 1E6NA 4W9OA 4Q7NA 1QPFA 2PV1A 3WD4A 1SYTA 4C02B 1LL7A 3CHDA 1GOIA 2DG9A 4ODOA 4QT3A 1FKLA 2RURA 4ODNA 4TW8A 1W9UA 4DRKA 4W9PA 3FAPA 3ALFA 4TNSA 1Q6UA 5D75A 5HUAA 2OLHA 2JZVA 1FKIA 4KR0B 4NNRA 3H9RB 1XHGA 1D6OA 1ZBKA 4Z2HA 1ROTA 2WM0A 3EY6A 1HKJA 3GTYX 4ODKA 1E6PA 3ARVA 1FKKA 5DIVA 2AWGA 3WD0A 1Y0OA 4LAXA 1W1YA 4GGQA 4DZ3A 3CH9A 2XP6A 2XPBA 3O5IA 2XP9A 2MF9A 4DWSA 1W26A 1FKHA 1NWTA 1WAWA 1IX5A 3RM4A 2DT0A 2KO7A 1JNEA 1R9HA 3ARSA 2XP5A 3O5EA 3RGCA 3ARYA 1PINA 1E9LA 4ZS6A 4TW7A 4DRJA 3NTPA 1W1TA 3B7XA 4DRPA 4DH0A 2MLZA 5HBFA 3O5OA 1H0GA 2K8IA 3TDBA 4IPXA 4MPKA 4LAYA 1QPLA 3MDYB 3JYJA 1D2KA 5DITA 1JNTA 4PTMA 4DRNA 3ARPA 2MLXA 4KQZA 2RSEA 4JFJA 1HKMA 2A3EA 4ITZA 1YW5A 3ARTA 1M5YA 4TW6A 2RUQA 2DT2A 1SR0A 2G41A 3ARXA 3KACA 4ODLA 1W1PA 1X6LA 1F8AB 2ZR5A 2DT1A 2KR7A 4DIPA 2FDMA 4ODQA 3B8SA 2LKNA 2PV3A 1FJDA 1O6IA 4MNMA 3CHEA 3UI4A 1FKDA 1EIBA 2RUCA 3CZ8A 1JNDA 2UZ5A 4DZ2A 4ML4A 1D7JA 4L3NA 2XPAA 4XAKA 2P4VA 4S3KA 3AS1A 4WIWA 1ZB5A 4U84A 1JCHB 2YBTA 1CTNA 5I98A 1Q6IA 2QF8A 1ROUA 4IT4A 3QOKA 2AOSA 2Y78A 1K9TA 2MPHA 4MNJA 3ARZA 3O5PA 2M2AA 3B9EA 2N87A 3WKZA 4P8UA 1BKFA 2DPEA 3OA5A 4JFMA 2G8ZA 4ZPVR 3B9AA 3CHCA 4Z2LA 2MLYA 2ZQUA 2O92A 4NZCA 1C9HA 2LJ4A 2LGOA 4HBOA 1D7HA 1OGGA 3FY1A 3UI6A 2EULA 4R5EA 2Q5AA 2ZQVA 4DRHA 4LGXA 1H0IA 4IQ2A 3IKDA 3NRKA 2KE0A 3G6MA 1FAPA 2WLYA 4Q22A 3O5RA 4MNLA 5DO2A 4FN2A 3WD1A 3ALGA 3WQVA 3KAFA 4IT6A 2YBUA 3AQUA 3NI6A 4MAVA 2LPVA 1NMWA 4HBEA 1ITXA 1HJVA 2PV2A 3RM8A 2PPPA 1E6ZA 5DF0A 2L2SA 1LG2A 3KAHA 2XP4A 4QT2A 4DT4A 1ZBVA 2A3CA 5HW8A 3JXVA 1EHNA 1X6NA 1NMVA 3GU0A 5GPGA 2B31A 2PBCA 4HARA 4MSPA 2ZQTA 3UQBA 1PBKA 1ZK6A 2RQSA 1EYMA 3KADA 3LUOA 4ODMA 1FKFA 1LG1A 4MGVA 3PRBA 2B5UB 1E6RA 1NWUA 3UI5A 4G2PA 3KABA 4JFKA 2DSUA 2A3AA 2KI3A 3PRAA 1WB0A 2DSVA 2DSZA 4Z2KA 2PN0A 4DROA 1J6YA 1J4HA 3JYMA 3O5MA 3EIPA 3KAIA 3WL1A 1KFWA 3RMEA 2D9FA 1EDQA 1KT1A 3IHZA 3AS0A 1FKGA 2ZR6A 1J4RA 4WKFA 1Q1CA 4U86A 3BXWA 4LAVA 1OWQA 5GPRA 5HWBA 3RM9A 2XP3A 2IF4A 4DRQA 3ARWA 3I6CA 4UDMA 1LQ0A 4O2TA 2O9OA 3ARUA 4JFLA 3ODKA 3KZ7A 1FD9A 1P5QA 5HTGA 3CGNA 3CGMA 2MNTA 1BL4A 3RFWA 1ZL1A 3TCZA 1B6CA 3WQWA 2VN1A 1FKJA 3AS3A 2PPOA 2XP7A 4ODRA 1D7IA 2FAPA 2KFWA 3IKGA 4U85A 3UF8A 3G6LA 2DG3A 5DIUA 2OFNA 2F21A 2IUZA 1E15A 3WD2A 2F2DA 3O5KA 1T11A 4GIVA 2ESCA 1HJXA 4N19A 4Z2JA 4DWSC 3VAWA 3PR9A 4ZPTR 1FKSA 3IK8A 3WH0A 5HWCA 5J6EA 1QZ2A 1FKBA 1ZU8A 4DRIA
chains in the Genus database with same CATH topology
4S3JA 2A3BA 3UQIA 4WKHA 2FKEA 5HW6A 4L72B 4P8VA 4W5UA 1Q6HA 1YATA 4MNKA 4ODPA 2KGJA 4WKAA 4JFIA 3O5LA 1TCOC 2WK2A 4DRMA 4QIBA 4URIA 4MTVA 2XP8A 2M08A 2ZQSA 4DWSD 3OOBA 4WJXA 1RD6A 1W9PA 1HKIA 1ZBCA 1KT0A 3AROA 1FFQA 3W4RA 1GUVA 1OGBA 2RUDA 4J4NA 4QZVB 2WLZA 2ITKA 4BF8A 3TC5A 4JYSA 5JH8A 1LL4A 2DG4A 1F40A 3ARRA 1ZBWA 3PA7A 1FKTA 3UQAA 2PI6A 1LJYA 2VCDA 1GPFA 1VF8A 1NSGA 4P8WA 1FKRA 1JNSA 3CHFA 4R0XA 5B8IC 4TYOA 1TFVA 3KAGA 1WNOA 1FFRA 4Z2IA 5HW7A 3O5QA 3PRDA 3FXYA 1UR8A 1HKKA 3KCEA 4W9QA 2DSWA 3O5FA 3B9DA 1NH6A 3WD3A 4DWSB 1UR9A 1ZCNA 4J4OA 1HJWA 1N1AA 4ZPWR 5GQBA 4FAPA 2M1IA 1EQ3A 5HT1A 5BXJA 3GPKA 3WIJA 4IQCA 4Z2GA 4WK9A 2ZR4A 3AS2A 1XRVA 2F4EA 1A7XA 1NWRA 4P8XA 1W9VA 1HXVA 5DEZA 4NSBA 3ARQA 3O5JA 5HKGA 4AY1A 1JVWA 2PPNA 4G50A 3WL0A 1J4IA 3O5DA 4LAWA 1U79A 1L1PA 1NWSA 4TX0A 2DT3A 3O5GA 1W1VA 1LL6A 1E6NA 4W9OA 4Q7NA 1QPFA 2PV1A 3WD4A 1SYTA 4C02B 1LL7A 3CHDA 1GOIA 2DG9A 4ODOA 4QT3A 1FKLA 2RURA 4ODNA 4TW8A 1W9UA 4DRKA 4W9PA 3FAPA 3ALFA 4TNSA 1Q6UA 5D75A 5HUAA 2OLHA 2JZVA 1FKIA 4KR0B 4NNRA 3H9RB 1XHGA 1D6OA 1ZBKA 4Z2HA 1ROTA 2WM0A 3EY6A 1HKJA 4ODKA 1E6PA 3ARVA 1FKKA 5DIVA 2AWGA 3WD0A 1Y0OA 4LAXA 1W1YA 4GGQA 4DZ3A 3CH9A 2XP6A 2XPBA 3O5IA 2XP9A 2MF9A 4DWSA 1W26A 1FKHA 1NWTA 1WAWA 1IX5A 3RM4A 2DT0A 2KO7A 1JNEA 1R9HA 3ARSA 2XP5A 3O5EA 3RGCA 3ARYA 1PINA 1E9LA 4ZS6A 4TW7A 4DRJA 3NTPA 1W1TA 3B7XA 4DRPA 4DH0A 2MLZA 5HBFA 3O5OA 1H0GA 2K8IA 3TDBA 4IPXA 4MPKA 4LAYA 1QPLA 3MDYB 3JYJA 1D2KA 5DITA 1JNTA 4PTMA 4DRNA 3ARPA 2MLXA 4KQZA 2RSEA 4JFJA 1HKMA 2A3EA 4ITZA 1YW5A 3ARTA 1M5YA 4TW6A 2RUQA 2DT2A 1SR0A 2G41A 3ARXA 3KACA 4ODLA 1W1PA 1X6LA 1F8AB 2ZR5A 2DT1A 2KR7A 4DIPA 2FDMA 4ODQA 3B8SA 2LKNA 2PV3A 1FJDA 1O6IA 4MNMA 3CHEA 3UI4A 1FKDA 1EIBA 2RUCA 3CZ8A 1JNDA 2UZ5A 4DZ2A 4ML4A 1D7JA 4L3NA 2XPAA 4XAKA 4S3KA 3AS1A 4WIWA 1ZB5A 4U84A 2YBTA 1CTNA 5I98A 1Q6IA 2QF8A 1ROUA 4IT4A 3QOKA 2AOSA 2Y78A 1K9TA 2MPHA 4MNJA 3ARZA 3O5PA 2M2AA 3B9EA 2N87A 3WKZA 4P8UA 1BKFA 2DPEA 3OA5A 4JFMA 2G8ZA 4ZPVR 3B9AA 3CHCA 4Z2LA 2MLYA 2ZQUA 2O92A 4NZCA 1C9HA 2LJ4A 2LGOA 4HBOA 1D7HA 1OGGA 3FY1A 3UI6A 4R5EA 2Q5AA 2ZQVA 4DRHA 4LGXA 1H0IA 4IQ2A 3IKDA 3NRKA 2KE0A 3G6MA 1FAPA 2WLYA 4Q22A 3O5RA 4MNLA 5DO2A 4FN2A 3WD1A 3ALGA 3WQVA 3KAFA 4IT6A 2YBUA 3AQUA 3NI6A 4MAVA 2LPVA 1NMWA 4HBEA 1ITXA 1HJVA 2PV2A 3RM8A 2PPPA 1E6ZA 5DF0A 2L2SA 1LG2A 3KAHA 2XP4A 4QT2A 4DT4A 1ZBVA 2A3CA 5HW8A 3JXVA 1EHNA 1X6NA 1NMVA 5GPGA 2B31A 2PBCA 4HARA 4MSPA 2ZQTA 3UQBA 1PBKA 1ZK6A 2RQSA 1EYMA 3KADA 3LUOA 4ODMA 1FKFA 1LG1A 4MGVA 3PRBA 1E6RA 1NWUA 3UI5A 4G2PA 3KABA 4JFKA 2DSUA 2A3AA 2KI3A 3PRAA 1WB0A 2DSVA 2DSZA 4Z2KA 4DROA 1J6YA 1J4HA 3JYMA 3O5MA 3KAIA 3WL1A 1KFWA 3RMEA 2D9FA 1EDQA 1KT1A 3IHZA 3AS0A 1FKGA 2ZR6A 1J4RA 4WKFA 1Q1CA 4U86A 3BXWA 4LAVA 1OWQA 5GPRA 5HWBA 3RM9A 2XP3A 2IF4A 4DRQA 3ARWA 3I6CA 1LQ0A 4O2TA 2O9OA 3ARUA 4JFLA 3ODKA 3KZ7A 1FD9A 1P5QA 5HTGA 3CGNA 3CGMA 2MNTA 1BL4A 3RFWA 1ZL1A 3TCZA 1B6CA 3WQWA 2VN1A 1FKJA 3AS3A 2PPOA 2XP7A 4ODRA 1D7IA 2FAPA 2KFWA 3IKGA 4U85A 3UF8A 3G6LA 2DG3A 5DIUA 2OFNA 2F21A 2IUZA 1E15A 3WD2A 2F2DA 3O5KA 1T11A 4GIVA 2ESCA 1HJXA 4N19A 4Z2JA 4DWSC 3VAWA 3PR9A 4ZPTR 1FKSA 3IK8A 3WH0A 5HWCA 5J6EA 1QZ2A 1FKBA 1ZU8A 4DRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRP A;  3O5G A;  2L2S A;  4ITZ A;  3KAH A;  4QT2 A;  2XP4 A;  4DT4 A;  3UQI A;  1YW5 A;  2FKE A;  1M5Y A;  4TW6 A;  5HW6 A;  4W9O A;  4DRI A;  2RUQ A;  3JXV A;  5HW8 A;  3KAC A;  1Q6H A;  1QPF A;  1YAT A;  2PV1 A;  1NMV A;  4ODP A;  2KGJ A;  4ODL A;  5GPG A;  2PBC A;  1F8A B;  2ZR5 A;  4MSP A;  2ZQT A;  4JFI A;  4C02 B;  3O5L A;  2KR7 A;  1TCO C;  4DIP A;  4DRM A;  4QIB A;  3UQB A;  4ODQ A;  1PBK A;  2DG9 A;  4ODO A;  2LKN A;  2PV3 A;  1ZK6 A;  1FJD A;  4QT3 A;  2XP8 A;  2RQS A;  1FKL A;  2RUR A;  1EYM A;  2M08 A;  3KAD A;  4ODN A;  2ZQS A;  4TW8 A;  3UI4 A;  4DRK A;  3LUO A;  1FKD A;  4ODM A;  4W9P A;  1FKF A;  4MGV A;  3PRB A;  2RUC A;  3FAP A;  4TNS A;  1Q6U A;  5D75 A;  2UZ5 A;  3OOB A;  3UI5 A;  4DZ2 A;  4G2P A;  3KAB A;  5HUA A;  4JFK A;  1D7J A;  2JZV A;  1FKI A;  1KT0 A;  2XPA A;  4NNR A;  2KI3 A;  3H9R B;  2RUD A;  4J4N A;  4U84 A;  1D6O A;  2ITK A;  3TC5 A;  4JYS A;  4BF8 A;  4DRO A;  5I98 A;  1J6Y A;  1ROT A;  2DG4 A;  3EY6 A;  1J4H A;  3JYM A;  3O5M A;  1F40 A;  1ROU A;  3KAI A;  4ODK A;  1FKK A;  3PA7 A;  1FKT A;  2D9F A;  2Y78 A;  3UQA A;  5DIV A;  2AWG A;  1KT1 A;  1Y0O A;  2VCD A;  3IHZ A;  4LAX A;  1FKG A;  2MPH A;  1NSG A;  4GGQ A;  2ZR6 A;  4DZ3 A;  1J4R A;  1FKR A;  1JNS A;  4R0X A;  3O5P A;  1Q1C A;  4TYO A;  4U86 A;  5B8I C;  2M2A A;  2XP6 A;  3KAG A;  4LAV A;  2N87 A;  5HWB A;  2XPB A;  2XP3 A;  3O5I A;  1BKF A;  2XP9 A;  2MF9 A;  2IF4 A;  4DRQ A;  5HW7 A;  3I6C A;  1W26 A;  3O5Q A;  1FKH A;  3PRD A;  4JFM A;  3KCE A;  4O2T A;  4W9Q A;  4JFL A;  1FD9 A;  1P5Q A;  2KO7 A;  3KZ7 A;  3O5F A;  3ODK A;  5HTG A;  3CGN A;  3CGM A;  1R9H A;  2MNT A;  2MLY A;  2XP5 A;  1BL4 A;  2ZQU A;  3O5E A;  1C9H A;  2LJ4 A;  3RFW A;  3RGC A;  2LGO A;  1D7H A;  1PIN A;  1ZCN A;  3TCZ A;  3UI6 A;  1B6C A;  1N1A A;  4J4O A;  1EQ3 A;  2Q5A A;  1FKJ A;  2M1I A;  2VN1 A;  2ZQV A;  4DRH A;  4FAP A;  5HT1 A;  5BXJ A;  4TW7 A;  2PPO A;  2XP7 A;  3GPK A;  4DRJ A;  4IQ2 A;  4IQC A;  3B7X A;  3IKD A;  3NTP A;  1D7I A;  2KE0 A;  3NRK A;  1FAP A;  2FAP A;  2KFW A;  3IKG A;  2ZR4 A;  4U85 A;  2MLZ A;  3UF8 A;  4DH0 A;  3O5R A;  4ODR A;  3O5O A;  2DG3 A;  5DIU A;  2F4E A;  2F21 A;  2OFN A;  2K8I A;  4FN2 A;  3TDB A;  2F2D A;  1A7X A;  4IPX A;  3O5K A;  1T11 A;  3KAF A;  1HXV A;  4LAY A;  1QPL A;  4GIV A;  3MDY B;  3NI6 A;  3O5J A;  5HKG A;  2LPV A;  3JYJ A;  1JVW A;  2PPN A;  4G50 A;  5DIT A;  1J4I A;  1NMW A;  3O5D A;  4LAW A;  4N19 A;  1JNT A;  3VAW A;  1U79 A;  1FKS A;  3IK8 A;  2MLX A;  3WH0 A;  4DRN A;  5HWC A;  4TX0 A;  2RSE A;  5J6E A;  1L1P A;  1QZ2 A;  4JFJ A;  1FKB A;  1Q6I A;  2PV2 A;  2PPP A; 
#chains in the Genus database with same CATH topology
 4S3J A;  2A3B A;  3UQI A;  4WKH A;  2FKE A;  5HW6 A;  4L72 B;  4P8V A;  4W5U A;  1Q6H A;  1YAT A;  4MNK A;  4ODP A;  2KGJ A;  4WKA A;  4JFI A;  3O5L A;  1TCO C;  2WK2 A;  4DRM A;  4QIB A;  4URI A;  4MTV A;  2XP8 A;  2M08 A;  2ETN A;  2ZQS A;  4DWS D;  3OOB A;  4WJX A;  1RD6 A;  1W9P A;  1HKI A;  1ZBC A;  1KT0 A;  3ARO A;  1FFQ A;  3W4R A;  1GUV A;  1OGB A;  2RUD A;  4J4N A;  4QZV B;  2WLZ A;  3BMB A;  2ITK A;  4BF8 A;  3TC5 A;  4JYS A;  5JH8 A;  1LL4 A;  2F23 A;  2DG4 A;  1GRJ A;  1F40 A;  3ARR A;  1ZBW A;  3PA7 A;  1FKT A;  3UQA A;  2PI6 A;  1LJY A;  2VCD A;  1GPF A;  1VF8 A;  1NSG A;  4P8W A;  1FKR A;  1JNS A;  3CHF A;  4R0X A;  5B8I C;  4TYO A;  1TFV A;  3KAG A;  1WNO A;  1FFR A;  4Z2I A;  5HW7 A;  3O5Q A;  3PRD A;  3FXY A;  1UR8 A;  1HKK A;  3KCE A;  4W9Q A;  2DSW A;  3O5F A;  3B9D A;  1NH6 A;  3WD3 A;  4DWS B;  1UR9 A;  1E44 A;  1ZCN A;  1HJW A;  1N1A A;  4J4O A;  4ZPW R;  5GQB A;  4FAP A;  2M1I A;  1EQ3 A;  5HT1 A;  5BXJ A;  3GPK A;  3WIJ A;  4IQC A;  4Z2G A;  4WK9 A;  2ZR4 A;  3AS2 A;  1XRV A;  2F4E A;  1A7X A;  1NWR A;  4P8X A;  1W9V A;  1HXV A;  5DEZ A;  4NSB A;  3ARQ A;  3O5J A;  5HKG A;  4AY1 A;  1JVW A;  2PPN A;  4G50 A;  3WL0 A;  1J4I A;  3O5D A;  4LAW A;  1U79 A;  1L1P A;  1NWS A;  4TX0 A;  2DT3 A;  3O5G A;  1W1V A;  1LL6 A;  1E6N A;  4W9O A;  4Q7N A;  1QPF A;  2PV1 A;  3WD4 A;  1SYT A;  4C02 B;  1LL7 A;  3CHD A;  1GOI A;  2DG9 A;  4ODO A;  4QT3 A;  1FKL A;  2RUR A;  4ODN A;  4TW8 A;  1W9U A;  4DRK A;  4W9P A;  3FAP A;  3ALF A;  4TNS A;  1Q6U A;  5D75 A;  5HUA A;  2OLH A;  2JZV A;  1FKI A;  4KR0 B;  4NNR A;  3H9R B;  1XHG A;  1D6O A;  1ZBK A;  4Z2H A;  1ROT A;  2WM0 A;  3EY6 A;  1HKJ A;  3GTY X;  4ODK A;  1E6P A;  3ARV A;  1FKK A;  5DIV A;  2AWG A;  3WD0 A;  1Y0O A;  4LAX A;  1W1Y A;  4GGQ A;  4DZ3 A;  3CH9 A;  2XP6 A;  2XPB A;  3O5I A;  2XP9 A;  2MF9 A;  4DWS A;  1W26 A;  1FKH A;  1NWT A;  1WAW A;  1IX5 A;  3RM4 A;  2DT0 A;  2KO7 A;  1JNE A;  1R9H A;  3ARS A;  2XP5 A;  3O5E A;  3RGC A;  3ARY A;  1PIN A;  1E9L A;  4ZS6 A;  4TW7 A;  4DRJ A;  3NTP A;  1W1T A;  3B7X A;  4DRP A;  4DH0 A;  2MLZ A;  5HBF A;  3O5O A;  1H0G A;  2K8I A;  3TDB A;  4IPX A;  4MPK A;  4LAY A;  1QPL A;  3MDY B;  3JYJ A;  1D2K A;  5DIT A;  1JNT A;  4PTM A;  4DRN A;  3ARP A;  2MLX A;  4KQZ A;  2RSE A;  4JFJ A;  1HKM A;  2A3E A;  4ITZ A;  1YW5 A;  3ART A;  1M5Y A;  4TW6 A;  2RUQ A;  2DT2 A;  1SR0 A;  2G41 A;  3ARX A;  3KAC A;  4ODL A;  1W1P A;  1X6L A;  1F8A B;  2ZR5 A;  2DT1 A;  2KR7 A;  4DIP A;  2FDM A;  4ODQ A;  3B8S A;  2LKN A;  2PV3 A;  1FJD A;  1O6I A;  4MNM A;  3CHE A;  3UI4 A;  1FKD A;  1EIB A;  2RUC A;  3CZ8 A;  1JND A;  2UZ5 A;  4DZ2 A;  4ML4 A;  1D7J A;  4L3N A;  2XPA A;  4XAK A;  2P4V A;  4S3K A;  3AS1 A;  4WIW A;  1ZB5 A;  4U84 A;  1JCH B;  2YBT A;  1CTN A;  5I98 A;  1Q6I A;  2QF8 A;  1ROU A;  4IT4 A;  3QOK A;  2AOS A;  2Y78 A;  1K9T A;  2MPH A;  4MNJ A;  3ARZ A;  3O5P A;  2M2A A;  3B9E A;  2N87 A;  3WKZ A;  4P8U A;  1BKF A;  2DPE A;  3OA5 A;  4JFM A;  2G8Z A;  4ZPV R;  3B9A A;  3CHC A;  4Z2L A;  2MLY A;  2ZQU A;  2O92 A;  4NZC A;  1C9H A;  2LJ4 A;  2LGO A;  4HBO A;  1D7H A;  1OGG A;  3FY1 A;  3UI6 A;  2EUL A;  4R5E A;  2Q5A A;  2ZQV A;  4DRH A;  4LGX A;  1H0I A;  4IQ2 A;  3IKD A;  3NRK A;  2KE0 A;  3G6M A;  1FAP A;  2WLY A;  4Q22 A;  3O5R A;  4MNL A;  5DO2 A;  4FN2 A;  3WD1 A;  3ALG A;  3WQV A;  3KAF A;  4IT6 A;  2YBU A;  3AQU A;  3NI6 A;  4MAV A;  2LPV A;  1NMW A;  4HBE A;  1ITX A;  1HJV A;  2PV2 A;  3RM8 A;  2PPP A;  1E6Z A;  5DF0 A;  2L2S A;  1LG2 A;  3KAH A;  2XP4 A;  4QT2 A;  4DT4 A;  1ZBV A;  2A3C A;  5HW8 A;  3JXV A;  1EHN A;  1X6N A;  1NMV A;  3GU0 A;  5GPG A;  2B31 A;  2PBC A;  4HAR A;  4MSP A;  2ZQT A;  3UQB A;  1PBK A;  1ZK6 A;  2RQS A;  1EYM A;  3KAD A;  3LUO A;  4ODM A;  1FKF A;  1LG1 A;  4MGV A;  3PRB A;  2B5U B;  1E6R A;  1NWU A;  3UI5 A;  4G2P A;  3KAB A;  4JFK A;  2DSU A;  2A3A A;  2KI3 A;  3PRA A;  1WB0 A;  2DSV A;  2DSZ A;  4Z2K A;  2PN0 A;  4DRO A;  1J6Y A;  1J4H A;  3JYM A;  3O5M A;  3EIP A;  3KAI A;  3WL1 A;  1KFW A;  3RME A;  2D9F A;  1EDQ A;  1KT1 A;  3IHZ A;  3AS0 A;  1FKG A;  2ZR6 A;  1J4R A;  4WKF A;  1Q1C A;  4U86 A;  3BXW A;  4LAV A;  1OWQ A;  5GPR A;  5HWB A;  3RM9 A;  2XP3 A;  2IF4 A;  4DRQ A;  3ARW A;  3I6C A;  4UDM A;  1LQ0 A;  4O2T A;  2O9O A;  3ARU A;  4JFL A;  3ODK A;  3KZ7 A;  1FD9 A;  1P5Q A;  5HTG A;  3CGN A;  3CGM A;  2MNT A;  1BL4 A;  3RFW A;  1ZL1 A;  3TCZ A;  1B6C A;  3WQW A;  2VN1 A;  1FKJ A;  3AS3 A;  2PPO A;  2XP7 A;  4ODR A;  1D7I A;  2FAP A;  2KFW A;  3IKG A;  4U85 A;  3UF8 A;  3G6L A;  2DG3 A;  5DIU A;  2OFN A;  2F21 A;  2IUZ A;  1E15 A;  3WD2 A;  2F2D A;  3O5K A;  1T11 A;  4GIV A;  2ESC A;  1HJX A;  4N19 A;  4Z2J A;  4DWS C;  3VAW A;  3PR9 A;  4ZPT R;  1FKS A;  3IK8 A;  3WH0 A;  5HWC A;  5J6E A;  1QZ2 A;  1FKB A;  1ZU8 A;  4DRI A; 
#chains in the Genus database with same CATH homology
 4S3J A;  2A3B A;  3UQI A;  4WKH A;  2FKE A;  5HW6 A;  4L72 B;  4P8V A;  4W5U A;  1Q6H A;  1YAT A;  4MNK A;  4ODP A;  2KGJ A;  4WKA A;  4JFI A;  3O5L A;  1TCO C;  2WK2 A;  4DRM A;  4QIB A;  4URI A;  4MTV A;  2XP8 A;  2M08 A;  2ZQS A;  4DWS D;  3OOB A;  4WJX A;  1RD6 A;  1W9P A;  1HKI A;  1ZBC A;  1KT0 A;  3ARO A;  1FFQ A;  3W4R A;  1GUV A;  1OGB A;  2RUD A;  4J4N A;  4QZV B;  2WLZ A;  2ITK A;  4BF8 A;  3TC5 A;  4JYS A;  5JH8 A;  1LL4 A;  2DG4 A;  1F40 A;  3ARR A;  1ZBW A;  3PA7 A;  1FKT A;  3UQA A;  2PI6 A;  1LJY A;  2VCD A;  1GPF A;  1VF8 A;  1NSG A;  4P8W A;  1FKR A;  1JNS A;  3CHF A;  4R0X A;  5B8I C;  4TYO A;  1TFV A;  3KAG A;  1WNO A;  1FFR A;  4Z2I A;  5HW7 A;  3O5Q A;  3PRD A;  3FXY A;  1UR8 A;  1HKK A;  3KCE A;  4W9Q A;  2DSW A;  3O5F A;  3B9D A;  1NH6 A;  3WD3 A;  4DWS B;  1UR9 A;  1ZCN A;  4J4O A;  1HJW A;  1N1A A;  4ZPW R;  5GQB A;  4FAP A;  2M1I A;  1EQ3 A;  5HT1 A;  5BXJ A;  3GPK A;  3WIJ A;  4IQC A;  4Z2G A;  4WK9 A;  2ZR4 A;  3AS2 A;  1XRV A;  2F4E A;  1A7X A;  1NWR A;  4P8X A;  1W9V A;  1HXV A;  5DEZ A;  4NSB A;  3ARQ A;  3O5J A;  5HKG A;  4AY1 A;  1JVW A;  2PPN A;  4G50 A;  3WL0 A;  1J4I A;  3O5D A;  4LAW A;  1U79 A;  1L1P A;  1NWS A;  4TX0 A;  2DT3 A;  3O5G A;  1W1V A;  1LL6 A;  1E6N A;  4W9O A;  4Q7N A;  1QPF A;  2PV1 A;  3WD4 A;  1SYT A;  4C02 B;  1LL7 A;  3CHD A;  1GOI A;  2DG9 A;  4ODO A;  4QT3 A;  1FKL A;  2RUR A;  4ODN A;  4TW8 A;  1W9U A;  4DRK A;  4W9P A;  3FAP A;  3ALF A;  4TNS A;  1Q6U A;  5D75 A;  5HUA A;  2OLH A;  2JZV A;  1FKI A;  4KR0 B;  4NNR A;  3H9R B;  1XHG A;  1D6O A;  1ZBK A;  4Z2H A;  1ROT A;  2WM0 A;  3EY6 A;  1HKJ A;  4ODK A;  1E6P A;  3ARV A;  1FKK A;  5DIV A;  2AWG A;  3WD0 A;  1Y0O A;  4LAX A;  1W1Y A;  4GGQ A;  4DZ3 A;  3CH9 A;  2XP6 A;  2XPB A;  3O5I A;  2XP9 A;  2MF9 A;  4DWS A;  1W26 A;  1FKH A;  1NWT A;  1WAW A;  1IX5 A;  3RM4 A;  2DT0 A;  2KO7 A;  1JNE A;  1R9H A;  3ARS A;  2XP5 A;  3O5E A;  3RGC A;  3ARY A;  1PIN A;  1E9L A;  4ZS6 A;  4TW7 A;  4DRJ A;  3NTP A;  1W1T A;  3B7X A;  4DRP A;  4DH0 A;  2MLZ A;  5HBF A;  3O5O A;  1H0G A;  2K8I A;  3TDB A;  4IPX A;  4MPK A;  4LAY A;  1QPL A;  3MDY B;  3JYJ A;  1D2K A;  5DIT A;  1JNT A;  4PTM A;  4DRN A;  3ARP A;  2MLX A;  4KQZ A;  2RSE A;  4JFJ A;  1HKM A;  2A3E A;  4ITZ A;  1YW5 A;  3ART A;  1M5Y A;  4TW6 A;  2RUQ A;  2DT2 A;  1SR0 A;  2G41 A;  3ARX A;  3KAC A;  4ODL A;  1W1P A;  1X6L A;  1F8A B;  2ZR5 A;  2DT1 A;  2KR7 A;  4DIP A;  2FDM A;  4ODQ A;  3B8S A;  2LKN A;  2PV3 A;  1FJD A;  1O6I A;  4MNM A;  3CHE A;  3UI4 A;  1FKD A;  1EIB A;  2RUC A;  3CZ8 A;  1JND A;  2UZ5 A;  4DZ2 A;  4ML4 A;  1D7J A;  4L3N A;  2XPA A;  4XAK A;  4S3K A;  3AS1 A;  4WIW A;  1ZB5 A;  4U84 A;  2YBT A;  1CTN A;  5I98 A;  1Q6I A;  2QF8 A;  1ROU A;  4IT4 A;  3QOK A;  2AOS A;  2Y78 A;  1K9T A;  2MPH A;  4MNJ A;  3ARZ A;  3O5P A;  2M2A A;  3B9E A;  2N87 A;  3WKZ A;  4P8U A;  1BKF A;  2DPE A;  3OA5 A;  4JFM A;  2G8Z A;  4ZPV R;  3B9A A;  3CHC A;  4Z2L A;  2MLY A;  2ZQU A;  2O92 A;  4NZC A;  1C9H A;  2LJ4 A;  2LGO A;  4HBO A;  1D7H A;  1OGG A;  3FY1 A;  3UI6 A;  4R5E A;  2Q5A A;  2ZQV A;  4DRH A;  4LGX A;  1H0I A;  4IQ2 A;  3IKD A;  3NRK A;  2KE0 A;  3G6M A;  1FAP A;  2WLY A;  4Q22 A;  3O5R A;  4MNL A;  5DO2 A;  4FN2 A;  3WD1 A;  3ALG A;  3WQV A;  3KAF A;  4IT6 A;  2YBU A;  3AQU A;  3NI6 A;  4MAV A;  2LPV A;  1NMW A;  4HBE A;  1ITX A;  1HJV A;  2PV2 A;  3RM8 A;  2PPP A;  1E6Z A;  5DF0 A;  2L2S A;  1LG2 A;  3KAH A;  2XP4 A;  4QT2 A;  4DT4 A;  1ZBV A;  2A3C A;  5HW8 A;  3JXV A;  1EHN A;  1X6N A;  1NMV A;  5GPG A;  2B31 A;  2PBC A;  4HAR A;  4MSP A;  2ZQT A;  3UQB A;  1PBK A;  1ZK6 A;  2RQS A;  1EYM A;  3KAD A;  3LUO A;  4ODM A;  1FKF A;  1LG1 A;  4MGV A;  3PRB A;  1E6R A;  1NWU A;  3UI5 A;  4G2P A;  3KAB A;  4JFK A;  2DSU A;  2A3A A;  2KI3 A;  3PRA A;  1WB0 A;  2DSV A;  2DSZ A;  4Z2K A;  4DRO A;  1J6Y A;  1J4H A;  3JYM A;  3O5M A;  3KAI A;  3WL1 A;  1KFW A;  3RME A;  2D9F A;  1EDQ A;  1KT1 A;  3IHZ A;  3AS0 A;  1FKG A;  2ZR6 A;  1J4R A;  4WKF A;  1Q1C A;  4U86 A;  3BXW A;  4LAV A;  1OWQ A;  5GPR A;  5HWB A;  3RM9 A;  2XP3 A;  2IF4 A;  4DRQ A;  3ARW A;  3I6C A;  1LQ0 A;  4O2T A;  2O9O A;  3ARU A;  4JFL A;  3ODK A;  3KZ7 A;  1FD9 A;  1P5Q A;  5HTG A;  3CGN A;  3CGM A;  2MNT A;  1BL4 A;  3RFW A;  1ZL1 A;  3TCZ A;  1B6C A;  3WQW A;  2VN1 A;  1FKJ A;  3AS3 A;  2PPO A;  2XP7 A;  4ODR A;  1D7I A;  2FAP A;  2KFW A;  3IKG A;  4U85 A;  3UF8 A;  3G6L A;  2DG3 A;  5DIU A;  2OFN A;  2F21 A;  2IUZ A;  1E15 A;  3WD2 A;  2F2D A;  3O5K A;  1T11 A;  4GIV A;  2ESC A;  1HJX A;  4N19 A;  4Z2J A;  4DWS C;  3VAW A;  3PR9 A;  4ZPT R;  1FKS A;  3IK8 A;  3WH0 A;  5HWC A;  5J6E A;  1QZ2 A;  1FKB A;  1ZU8 A;  4DRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...