1FKJA

Atomic structure of fkbp12-fk506, an immunophilin immunosuppressant complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title Comparative X-ray structures of the major binding protein for the immunosuppressant FK506 (tacrolimus) in unliganded form and in complex with FK506 and rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rotamase
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkjA00
4J4NA 2JZVA 2K8IA 2KO7A 3JXVA 3NI6A 4JFJA 3TCZA 3UI5A 4ITZA 1YATA 3KAFA 4TX0A 2M08A 2XP4A 3KAHA 3VAWA 3JYJA 2KFWA 2M1IA 2MPHA 4U84A 4FAPA 5HW8A 1QPFA 1JNTA 5HWBA 2XP6A 1JVWA 4ODPA 2XP7A 4DZ3A 3CGNA 1FKRA 1Q6UA 2RUDA 4FN2A 1ZCNA 4J4OA 1FAPA 2RUCA 4TW7A 5D75A 1JNSA 1FKDA 2PV1A 1W26A 1PBKA 2MF9A 2ZQTA 1J4IA 1FKLA 1FKTA 4LAWA 2OFNA 4TW6A 3UI4A 2ITKA 3FAPA 3TDBA 1QZ2A 3WH0A 1P5QA 4DRJA 4N19A 5DITA 1Q1CA 1D7JA 1FKSA 4ODLA 1FKIA 2ZR5A 3I6CA 3IHZA 3KAIA 3O5IA 1NMWA 4DRQA 4QT2A 1FKKA 5HUAA 1M5YA 4IPXA 4IQCA 5DIVA 3O5EA 4TW8A 3UQIA 1FD9A 1C9HA 2LKNA 2N87A 2RQSA 3CGMA 3KACA 3NRKA 4JFKA 4LAYA 4ODNA 3RFWA 3O5LA 1NMVA 3IKGA 4DRPA 1KT0A 5B8IC 2F4EA 2PV2A 2XPBA 3O5QA 3RGCA 3PRBA 2F21A 4DRIA 3UI6A 2RSEA 2XP9A 1J4HA 2XPAA 5GPGA 4W9OA 3UF8A 5J6EA 1U79A 4DH0A 1A7XA 2MLXA 4JFIA 4DRKA 1F40A 2Q5AA 5HW7A 2L2SA 2Y78A 4ODKA 4IQ2A 1J4RA 4DIPA 4U86A 3LUOA 1D7IA 3KZ7A 2PPNA 2KGJA 1N1AA 1T11A 1NSGA 4GGQA 2KE0A 4W9QA 3TC5A 1PINA 5HWCA 2XP5A 1B6CA 2RUQA 1KT1A 4LAVA 1J6YA 2PBCA 2RURA 4TYOA 3B7XA 4DZ2A 3UQBA 1YW5A 2DG4A 4W9PA 1L1PA 3NTPA 2VCDA 1BL4A 2M2AA 1Q6IA 5DIUA 4DROA 4JFLA 2ZQUA 3ODKA 4LAXA 3O5FA 3O5JA 5BXJA 2KI3A 2PPPA 1FKFA 1D6OA 3KADA 1FKGA 3O5PA 4BF8A 3EY6A 1FKHA 4DT4A 2FAPA 2LGOA 2DG9A 3H9RB 1TCOC 4G2PA 2ZQSA 3GPKA 1D7HA 4ODRA 4U85A 2LPVA 3O5KA 4C02B 4QIBA 2LJ4A 4ODQA 3O5RA 1F8AB 2MNTA 2ZR4A 1Y0OA 3O5MA 1ZK6A 1ROTA 2MLYA 4GIVA 4G50A 4JFMA 1R9HA 3KAGA 4DRNA 2F2DA 2VN1A 5HT1A 1BKFA 4R0XA 4QT3A 2KR7A 4TNSA 4DRMA 5HKGA 3IK8A 5HTGA 4NNRA 3O5GA 3UQAA 5I98A 1FKJA 2PV3A 3KABA 2IF4A 2XP3A 2AWGA 2ZQVA 2PPOA 2FKEA 4DRHA 4MSPA 1FJDA 3JYMA 1HXVA 1EYMA 1QPLA 2D9FA 3PA7A 2XP8A 3O5DA 3O5OA 1FKBA 2UZ5A 2MLZA 1Q6HA 3MDYB 3OOBA 4JYSA 4ODMA 5HW6A 3PRDA 1EQ3A 2DG3A 2ZR6A 3IKDA 3KCEA 1ROUA 4MGVA 4O2TA 4ODOA
chains in the Genus database with same CATH superfamily
3RMEA 3NI6A 4JFJA 4ITZA 1YATA 2PN0A 1HJWA 2A3AA 1XHGA 4U84A 1NWTA 3WD0A 3BXWA 1JVWA 4DWSA 2P4VA 3B9DA 2RUDA 1FAPA 4TW7A 2DSUA 3W4RA 1PBKA 2ZQTA 1H0IA 1FKLA 2OFNA 3ARUA 3TDBA 4W5UA 1P5QA 4DRJA 4Z2GA 5DITA 4HBOA 4ODLA 1FKIA 3WD4A 3I6CA 3O5IA 1JNEA 3WQVA 1NMWA 1WNOA 4QT2A 1FKKA 5HUAA 4IQCA 4Z2JA 1D2KA 2N87A 3O5LA 3RM4A 1NMVA 2PV2A 3ARQA 3RGCA 4DRIA 2ETNA 3ARTA 4W9OA 4S3JA 5J6EA 1A7XA 3GTYX 1E6PA 1F40A 2DSZA 4WJXA 4ODKA 1TFVA 4IQ2A 1J4RA 4QZVB 3LUOA 1OGBA 2KGJA 4R5EA 1N1AA 3AQUA 4P8UA 4W9QA 1CTNA 3TC5A 1PINA 2XP5A 2O9OA 2PBCA 2RURA 4NZCA 2WK2A 3FXYA 1L1PA 1ZBVA 3NTPA 2VCDA 2M2AA 1Q6IA 5DIUA 4JFLA 3KADA 1D6OA 1FKGA 2WM0A 3OA5A 2LGOA 3H9RB 1TCOC 1X6LA 3B9EA 3GPKA 1LG2A 1LL7A 1ZBCA 3O5RA 3ARSA 1ROTA 4GIVA 4JFMA 4DRMA 4QT3A 1JNDA 2KR7A 4TNSA 4Z2LA 5HKGA 5HTGA 2AOSA 2PV3A 2AWGA 1UR8A 1GOIA 2DT1A 1SR0A 1HXVA 4WIWA 1XRVA 1QPLA 3PA7A 4WKFA 3FY1A 1EQ3A 4ODMA 1Q6HA 5HW6A 3IKDA 4O2TA 1ROUA 4ODOA 1WB0A 2DSWA 3JXVA 2DT0A 1W9PA 4ZS6A 1E6RA 3UI5A 2EULA 4P8VA 2M08A 4WK9A 3AROA 4FAPA 2G8ZA 2DT3A 3CHFA 3CHDA 1E6ZA 4ODPA 4FN2A 1ZCNA 1ITXA 2OLHA 2G41A 5DEZA 3FAPA 1QZ2A 4N19A 1HKIA 1W1PA 1E44A 5DIVA 1RD6A 3UQIA 1FD9A 2WLZA 1C9HA 2LKNA 3KACA 4ODNA 2F23A 1SYTA 2A3BA 2XPBA 1HKKA 3UI6A 2XP9A 2XPAA 1LL6A 1U79A 3ARXA 1ZBWA 4DRKA 2Q5AA 5GPRA 4KR0B 4DIPA 4U86A 4GGQA 2RUQA 4L3NA 4KQZA 1OWQA 1KT1A 2A3CA 3UQBA 4HBEA 1YW5A 1W9VA 1JCHB 4IT6A 4DROA 1ZL1A 3CH9A 3ODKA 3ALFA 3O5FA 1LL4A 1HKMA 2KI3A 4Q22A 1NWRA 3EY6A 4DT4A 2FAPA 1HKJA 2ZQSA 3WL0A 2LPVA 2DPEA 1F8AB 3O5MA 2MLYA 4L72B 5HT1A 3O5GA 1FKJA 2ZQVA 4DWSB 2FKEA 4HARA 1WAWA 3O5DA 1E6NA 1FKBA 1ZB5A 4JYSA 3OOBA 1EDQA 1W9UA 1K9TA 3BMBA 3PRDA 4MGVA 3KCEA 4S3KA 3EIPA 4J4NA 1ZU8A 2JZVA 2YBUA 3ALGA 3TCZA 3CZ8A 2ESCA 4ZPTR 3G6LA 2WLYA 4TX0A 3WD2A 2XP4A 1NWSA 3VAWA 3JYJA 2M1IA 2MPHA 4ZPVR 4PTMA 3RM8A 4URIA 4DZ3A 3CGNA 1FKRA 4J4OA 5DF0A 4LGXA 1GUVA 5D75A 1IX5A 1W26A 1J4IA 3UI4A 4TW6A 1GRJA 2ITKA 3WH0A 2ZR5A 4ML4A 4DRQA 4Z2HA 3ARRA 1M5YA 4IPXA 4WKAA 3O5EA 4TW8A 4DWSD 3CGMA 3RFWA 4LAYA 1NH6A 4Z2KA 4MNLA 4MTVA 4DRPA 1KT0A 5B8IC 3O5QA 3PRBA 2RSEA 1J4HA 3QOKA 4DH0A 2MLXA 2YBTA 5HW7A 2Y78A 1D7IA 1GPFA 2PPNA 3KZ7A 1T11A 1NSGA 3WKZA 1B6CA 4MNKA 1J6YA 2B31A 4TYOA 3WD3A 1ZBKA 3WL1A 1BL4A 3O5JA 1KFWA 5BXJA 1FKFA 1HJVA 4BF8A 3PR9A 4NSBA 1W1VA 4ODRA 4U85A 3AS0A 4DWSC 4C02B 2LJ4A 3ARWA 2ZR4A 1ZK6A 4G50A 5JH8A 4IT4A 3KAGA 2F2DA 2VN1A 1W1TA 1BKFA 4R0XA 3IK8A 5I98A 2IUZA 2IF4A 3PRAA 4MAVA 2DT2A 4MSPA 5GQBA 3WQWA 3RM9A 1EYMA 2XP8A 3O5OA 2UZ5A 3MDYB 2MLZA 1H0GA 2DG3A 2ZR6A 3WIJA 4Q7NA 2K8IA 2KO7A 4MNMA 3B8SA 3KAFA 1O6IA 1NWUA 3KAHA 2KFWA 5HW8A 1QPFA 1JNTA 5HWBA 2XP6A 5DO2A 4XAKA 2XP7A 4P8XA 1Q6UA 2RUCA 1JNSA 1FKDA 1VF8A 2PV1A 2MF9A 1FFRA 1FKTA 1HJXA 4LAWA 4WKHA 1LJYA 1Q1CA 1D7JA 1FKSA 3IHZA 3KAIA 2A3EA 3ARZA 2RQSA 1EIBA 3NRKA 4JFKA 1LG1A 3IKGA 2F4EA 2F21A 2O92A 4MNJA 5GPGA 3UF8A 1W1YA 4JFIA 2L2SA 4AY1A 3ARVA 4Z2IA 2KE0A 5HWCA 3CHEA 1FFQA 3AS1A 3CHCA 3AS3A 4LAVA 1E9LA 2QF8A 3B7XA 4DZ2A 5HBFA 2DG4A 4W9PA 3AS2A 2B5UB 3G6MA 2ZQUA 4LAXA 2PPPA 3O5PA 1FKHA 2FDMA 4MPKA 2PI6A 1EHNA 3B9AA 2DG9A 4G2PA 1D7HA 4UDMA 3O5KA 4QIBA 4ODQA 3ARYA 2MNTA 1Y0OA 4ZPWR 1R9HA 4DRNA 3WD1A 4P8WA 4NNRA 1X6NA 3UQAA 3KABA 2XP3A 2DSVA 2PPOA 4DRHA 1E15A 3ARPA 3JYMA 2D9FA 1OGGA 3GU0A 1FJDA 1LQ0A 1UR9A
chains in the Genus database with same CATH topology
3RMEA 3NI6A 4JFJA 4ITZA 1YATA 1HJWA 2A3AA 1XHGA 4U84A 1NWTA 3WD0A 3BXWA 1JVWA 4DWSA 3B9DA 2RUDA 1FAPA 4TW7A 2DSUA 3W4RA 1PBKA 2ZQTA 1H0IA 1FKLA 2OFNA 3ARUA 3TDBA 4W5UA 1P5QA 4DRJA 4Z2GA 5DITA 4HBOA 4ODLA 1FKIA 3WD4A 3I6CA 3O5IA 1JNEA 3WQVA 1NMWA 1WNOA 4QT2A 1FKKA 5HUAA 4IQCA 4Z2JA 1D2KA 2N87A 3O5LA 3RM4A 1NMVA 2PV2A 3ARQA 3RGCA 4DRIA 3ARTA 4W9OA 4S3JA 5J6EA 1A7XA 1E6PA 1F40A 2DSZA 4WJXA 4ODKA 1TFVA 4IQ2A 1J4RA 4QZVB 3LUOA 1OGBA 2KGJA 4R5EA 1N1AA 3AQUA 4P8UA 4W9QA 1CTNA 3TC5A 1PINA 2XP5A 2O9OA 2PBCA 2RURA 4NZCA 2WK2A 3FXYA 1L1PA 1ZBVA 3NTPA 2VCDA 2M2AA 1Q6IA 5DIUA 4JFLA 3KADA 1D6OA 1FKGA 2WM0A 3OA5A 2LGOA 3H9RB 1TCOC 1X6LA 3B9EA 3GPKA 1LG2A 1LL7A 1ZBCA 3O5RA 3ARSA 1ROTA 4GIVA 4JFMA 4DRMA 4QT3A 1JNDA 2KR7A 4TNSA 4Z2LA 5HKGA 5HTGA 2AOSA 2PV3A 2AWGA 1UR8A 1GOIA 2DT1A 1SR0A 1HXVA 4WIWA 1XRVA 1QPLA 3PA7A 4WKFA 3FY1A 1EQ3A 4ODMA 1Q6HA 5HW6A 3IKDA 4O2TA 1ROUA 4ODOA 1WB0A 2DSWA 3JXVA 2DT0A 1W9PA 4ZS6A 1E6RA 3UI5A 4P8VA 2M08A 4WK9A 3AROA 4FAPA 2G8ZA 2DT3A 3CHFA 3CHDA 1E6ZA 4ODPA 4FN2A 1ZCNA 1ITXA 2OLHA 2G41A 5DEZA 3FAPA 1QZ2A 4N19A 1HKIA 1W1PA 5DIVA 1RD6A 3UQIA 1FD9A 2WLZA 1C9HA 2LKNA 3KACA 4ODNA 1SYTA 2A3BA 2XPBA 1HKKA 3UI6A 2XP9A 2XPAA 1LL6A 1U79A 3ARXA 1ZBWA 4DRKA 2Q5AA 5GPRA 4KR0B 4DIPA 4U86A 4GGQA 2RUQA 4L3NA 4KQZA 1OWQA 1KT1A 2A3CA 3UQBA 4HBEA 1YW5A 1W9VA 4IT6A 4DROA 1ZL1A 3CH9A 3ODKA 3ALFA 3O5FA 1LL4A 1HKMA 2KI3A 4Q22A 1NWRA 3EY6A 4DT4A 2FAPA 1HKJA 2ZQSA 3WL0A 2LPVA 2DPEA 1F8AB 3O5MA 2MLYA 4L72B 5HT1A 3O5GA 1FKJA 2ZQVA 4DWSB 2FKEA 4HARA 1WAWA 3O5DA 1E6NA 1FKBA 1ZB5A 4JYSA 3OOBA 1EDQA 1W9UA 1K9TA 3PRDA 4MGVA 3KCEA 4S3KA 4J4NA 1ZU8A 2JZVA 2YBUA 3ALGA 3TCZA 3CZ8A 2ESCA 4ZPTR 3G6LA 2WLYA 4TX0A 3WD2A 2XP4A 1NWSA 3VAWA 3JYJA 2M1IA 2MPHA 4ZPVR 4PTMA 3RM8A 4URIA 4DZ3A 3CGNA 1FKRA 4J4OA 5DF0A 4LGXA 1GUVA 5D75A 1IX5A 1W26A 1J4IA 3UI4A 4TW6A 2ITKA 3WH0A 2ZR5A 4ML4A 4DRQA 4Z2HA 3ARRA 1M5YA 4IPXA 4WKAA 3O5EA 4TW8A 4DWSD 3CGMA 3RFWA 4LAYA 1NH6A 4Z2KA 4MNLA 4MTVA 4DRPA 1KT0A 5B8IC 3O5QA 3PRBA 2RSEA 1J4HA 3QOKA 4DH0A 2MLXA 2YBTA 5HW7A 2Y78A 1D7IA 1GPFA 2PPNA 3KZ7A 1T11A 1NSGA 3WKZA 1B6CA 4MNKA 1J6YA 2B31A 4TYOA 3WD3A 1ZBKA 3WL1A 1BL4A 3O5JA 1KFWA 5BXJA 1FKFA 1HJVA 4BF8A 3PR9A 4NSBA 1W1VA 4ODRA 4U85A 3AS0A 4DWSC 4C02B 2LJ4A 3ARWA 2ZR4A 1ZK6A 4G50A 5JH8A 4IT4A 3KAGA 2F2DA 2VN1A 1W1TA 1BKFA 4R0XA 3IK8A 5I98A 2IUZA 2IF4A 3PRAA 4MAVA 2DT2A 4MSPA 5GQBA 3WQWA 3RM9A 1EYMA 2XP8A 3O5OA 2UZ5A 3MDYB 2MLZA 1H0GA 2DG3A 2ZR6A 3WIJA 4Q7NA 2K8IA 2KO7A 4MNMA 3B8SA 3KAFA 1O6IA 1NWUA 3KAHA 2KFWA 5HW8A 1QPFA 1JNTA 5HWBA 2XP6A 5DO2A 4XAKA 2XP7A 4P8XA 1Q6UA 2RUCA 1JNSA 1FKDA 1VF8A 2PV1A 2MF9A 1FFRA 1FKTA 1HJXA 4LAWA 4WKHA 1LJYA 1Q1CA 1D7JA 1FKSA 3IHZA 3KAIA 2A3EA 3ARZA 2RQSA 1EIBA 3NRKA 4JFKA 1LG1A 3IKGA 2F4EA 2F21A 2O92A 4MNJA 5GPGA 3UF8A 1W1YA 4JFIA 2L2SA 4AY1A 3ARVA 4Z2IA 2KE0A 5HWCA 3CHEA 1FFQA 3AS1A 3CHCA 3AS3A 4LAVA 1E9LA 2QF8A 3B7XA 4DZ2A 5HBFA 2DG4A 4W9PA 3AS2A 3G6MA 2ZQUA 4LAXA 2PPPA 3O5PA 1FKHA 2FDMA 4MPKA 2PI6A 1EHNA 3B9AA 2DG9A 4G2PA 1D7HA 3O5KA 4QIBA 4ODQA 3ARYA 2MNTA 1Y0OA 4ZPWR 1R9HA 4DRNA 3WD1A 4P8WA 4NNRA 1X6NA 3UQAA 3KABA 2XP3A 2DSVA 2PPOA 4DRHA 1E15A 3ARPA 3JYMA 2D9FA 1OGGA 1FJDA 1LQ0A 1UR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J4N A;  2JZV A;  2K8I A;  2KO7 A;  3JXV A;  3NI6 A;  4JFJ A;  3TCZ A;  3UI5 A;  4ITZ A;  1YAT A;  3KAF A;  4TX0 A;  2M08 A;  2XP4 A;  3KAH A;  3VAW A;  3JYJ A;  2KFW A;  2M1I A;  2MPH A;  4U84 A;  4FAP A;  5HW8 A;  1QPF A;  1JNT A;  5HWB A;  2XP6 A;  1JVW A;  4ODP A;  2XP7 A;  4DZ3 A;  3CGN A;  1FKR A;  1Q6U A;  2RUD A;  4FN2 A;  1ZCN A;  4J4O A;  1FAP A;  2RUC A;  4TW7 A;  5D75 A;  1JNS A;  1FKD A;  2PV1 A;  1W26 A;  1PBK A;  2MF9 A;  2ZQT A;  1J4I A;  1FKL A;  1FKT A;  4LAW A;  2OFN A;  4TW6 A;  3UI4 A;  2ITK A;  3FAP A;  3TDB A;  1QZ2 A;  3WH0 A;  1P5Q A;  4DRJ A;  4N19 A;  5DIT A;  1Q1C A;  1D7J A;  1FKS A;  4ODL A;  1FKI A;  2ZR5 A;  3I6C A;  3IHZ A;  3KAI A;  3O5I A;  1NMW A;  4DRQ A;  4QT2 A;  1FKK A;  5HUA A;  1M5Y A;  4IPX A;  4IQC A;  5DIV A;  3O5E A;  4TW8 A;  3UQI A;  1FD9 A;  1C9H A;  2LKN A;  2N87 A;  2RQS A;  3CGM A;  3KAC A;  3NRK A;  4JFK A;  4LAY A;  4ODN A;  3RFW A;  3O5L A;  1NMV A;  3IKG A;  4DRP A;  1KT0 A;  5B8I C;  2F4E A;  2PV2 A;  2XPB A;  3O5Q A;  3RGC A;  3PRB A;  2F21 A;  4DRI A;  3UI6 A;  2RSE A;  2XP9 A;  1J4H A;  2XPA A;  5GPG A;  4W9O A;  3UF8 A;  5J6E A;  1U79 A;  4DH0 A;  1A7X A;  2MLX A;  4JFI A;  4DRK A;  1F40 A;  2Q5A A;  5HW7 A;  2L2S A;  2Y78 A;  4ODK A;  4IQ2 A;  1J4R A;  4DIP A;  4U86 A;  3LUO A;  1D7I A;  3KZ7 A;  2PPN A;  2KGJ A;  1N1A A;  1T11 A;  1NSG A;  4GGQ A;  2KE0 A;  4W9Q A;  3TC5 A;  1PIN A;  5HWC A;  2XP5 A;  1B6C A;  2RUQ A;  1KT1 A;  4LAV A;  1J6Y A;  2PBC A;  2RUR A;  4TYO A;  3B7X A;  4DZ2 A;  3UQB A;  1YW5 A;  2DG4 A;  4W9P A;  1L1P A;  3NTP A;  2VCD A;  1BL4 A;  2M2A A;  1Q6I A;  5DIU A;  4DRO A;  4JFL A;  2ZQU A;  3ODK A;  4LAX A;  3O5F A;  3O5J A;  5BXJ A;  2KI3 A;  2PPP A;  1FKF A;  1D6O A;  3KAD A;  1FKG A;  3O5P A;  4BF8 A;  3EY6 A;  1FKH A;  4DT4 A;  2FAP A;  2LGO A;  2DG9 A;  3H9R B;  1TCO C;  4G2P A;  2ZQS A;  3GPK A;  1D7H A;  4ODR A;  4U85 A;  2LPV A;  3O5K A;  4C02 B;  4QIB A;  2LJ4 A;  4ODQ A;  3O5R A;  1F8A B;  2MNT A;  2ZR4 A;  1Y0O A;  3O5M A;  1ZK6 A;  1ROT A;  2MLY A;  4GIV A;  4G50 A;  4JFM A;  1R9H A;  3KAG A;  4DRN A;  2F2D A;  2VN1 A;  5HT1 A;  1BKF A;  4R0X A;  4QT3 A;  2KR7 A;  4TNS A;  4DRM A;  5HKG A;  3IK8 A;  5HTG A;  4NNR A;  3O5G A;  3UQA A;  5I98 A;  1FKJ A;  2PV3 A;  3KAB A;  2IF4 A;  2XP3 A;  2AWG A;  2ZQV A;  2PPO A;  2FKE A;  4DRH A;  4MSP A;  1FJD A;  3JYM A;  1HXV A;  1EYM A;  1QPL A;  2D9F A;  3PA7 A;  2XP8 A;  3O5D A;  3O5O A;  1FKB A;  2UZ5 A;  2MLZ A;  1Q6H A;  3MDY B;  3OOB A;  4JYS A;  4ODM A;  5HW6 A;  3PRD A;  1EQ3 A;  2DG3 A;  2ZR6 A;  3IKD A;  3KCE A;  1ROU A;  4MGV A;  4O2T A;  4ODO A; 
#chains in the Genus database with same CATH topology
 3RME A;  3NI6 A;  4JFJ A;  4ITZ A;  1YAT A;  2PN0 A;  1HJW A;  2A3A A;  1XHG A;  4U84 A;  1NWT A;  3WD0 A;  3BXW A;  1JVW A;  4DWS A;  2P4V A;  3B9D A;  2RUD A;  1FAP A;  4TW7 A;  2DSU A;  3W4R A;  1PBK A;  2ZQT A;  1H0I A;  1FKL A;  2OFN A;  3ARU A;  3TDB A;  4W5U A;  1P5Q A;  4DRJ A;  4Z2G A;  5DIT A;  4HBO A;  4ODL A;  1FKI A;  3WD4 A;  3I6C A;  3O5I A;  1JNE A;  3WQV A;  1NMW A;  1WNO A;  4QT2 A;  1FKK A;  5HUA A;  4IQC A;  4Z2J A;  1D2K A;  2N87 A;  3O5L A;  3RM4 A;  1NMV A;  2PV2 A;  3ARQ A;  3RGC A;  4DRI A;  2ETN A;  3ART A;  4W9O A;  4S3J A;  5J6E A;  1A7X A;  3GTY X;  1E6P A;  1F40 A;  2DSZ A;  4WJX A;  4ODK A;  1TFV A;  4IQ2 A;  1J4R A;  4QZV B;  3LUO A;  1OGB A;  2KGJ A;  4R5E A;  1N1A A;  3AQU A;  4P8U A;  4W9Q A;  1CTN A;  3TC5 A;  1PIN A;  2XP5 A;  2O9O A;  2PBC A;  2RUR A;  4NZC A;  2WK2 A;  3FXY A;  1L1P A;  1ZBV A;  3NTP A;  2VCD A;  2M2A A;  1Q6I A;  5DIU A;  4JFL A;  3KAD A;  1D6O A;  1FKG A;  2WM0 A;  3OA5 A;  2LGO A;  3H9R B;  1TCO C;  1X6L A;  3B9E A;  3GPK A;  1LG2 A;  1LL7 A;  1ZBC A;  3O5R A;  3ARS A;  1ROT A;  4GIV A;  4JFM A;  4DRM A;  4QT3 A;  1JND A;  2KR7 A;  4TNS A;  4Z2L A;  5HKG A;  5HTG A;  2AOS A;  2PV3 A;  2AWG A;  1UR8 A;  1GOI A;  2DT1 A;  1SR0 A;  1HXV A;  4WIW A;  1XRV A;  1QPL A;  3PA7 A;  4WKF A;  3FY1 A;  1EQ3 A;  4ODM A;  1Q6H A;  5HW6 A;  3IKD A;  4O2T A;  1ROU A;  4ODO A;  1WB0 A;  2DSW A;  3JXV A;  2DT0 A;  1W9P A;  4ZS6 A;  1E6R A;  3UI5 A;  2EUL A;  4P8V A;  2M08 A;  4WK9 A;  3ARO A;  4FAP A;  2G8Z A;  2DT3 A;  3CHF A;  3CHD A;  1E6Z A;  4ODP A;  4FN2 A;  1ZCN A;  1ITX A;  2OLH A;  2G41 A;  5DEZ A;  3FAP A;  1QZ2 A;  4N19 A;  1HKI A;  1W1P A;  1E44 A;  5DIV A;  1RD6 A;  3UQI A;  1FD9 A;  2WLZ A;  1C9H A;  2LKN A;  3KAC A;  4ODN A;  2F23 A;  1SYT A;  2A3B A;  2XPB A;  1HKK A;  3UI6 A;  2XP9 A;  2XPA A;  1LL6 A;  1U79 A;  3ARX A;  1ZBW A;  4DRK A;  2Q5A A;  5GPR A;  4KR0 B;  4DIP A;  4U86 A;  4GGQ A;  2RUQ A;  4L3N A;  4KQZ A;  1OWQ A;  1KT1 A;  2A3C A;  3UQB A;  4HBE A;  1YW5 A;  1W9V A;  1JCH B;  4IT6 A;  4DRO A;  1ZL1 A;  3CH9 A;  3ODK A;  3ALF A;  3O5F A;  1LL4 A;  1HKM A;  2KI3 A;  4Q22 A;  1NWR A;  3EY6 A;  4DT4 A;  2FAP A;  1HKJ A;  2ZQS A;  3WL0 A;  2LPV A;  2DPE A;  1F8A B;  3O5M A;  2MLY A;  4L72 B;  5HT1 A;  3O5G A;  1FKJ A;  2ZQV A;  4DWS B;  2FKE A;  4HAR A;  1WAW A;  3O5D A;  1E6N A;  1FKB A;  1ZB5 A;  4JYS A;  3OOB A;  1EDQ A;  1W9U A;  1K9T A;  3BMB A;  3PRD A;  4MGV A;  3KCE A;  4S3K A;  3EIP A;  4J4N A;  1ZU8 A;  2JZV A;  2YBU A;  3ALG A;  3TCZ A;  3CZ8 A;  2ESC A;  4ZPT R;  3G6L A;  2WLY A;  4TX0 A;  3WD2 A;  2XP4 A;  1NWS A;  3VAW A;  3JYJ A;  2M1I A;  2MPH A;  4ZPV R;  4PTM A;  3RM8 A;  4URI A;  4DZ3 A;  3CGN A;  1FKR A;  4J4O A;  5DF0 A;  4LGX A;  1GUV A;  5D75 A;  1IX5 A;  1W26 A;  1J4I A;  3UI4 A;  4TW6 A;  1GRJ A;  2ITK A;  3WH0 A;  2ZR5 A;  4ML4 A;  4DRQ A;  4Z2H A;  3ARR A;  1M5Y A;  4IPX A;  4WKA A;  3O5E A;  4TW8 A;  4DWS D;  3CGM A;  3RFW A;  4LAY A;  1NH6 A;  4Z2K A;  4MNL A;  4MTV A;  4DRP A;  1KT0 A;  5B8I C;  3O5Q A;  3PRB A;  2RSE A;  1J4H A;  3QOK A;  4DH0 A;  2MLX A;  2YBT A;  5HW7 A;  2Y78 A;  1D7I A;  1GPF A;  2PPN A;  3KZ7 A;  1T11 A;  1NSG A;  3WKZ A;  1B6C A;  4MNK A;  1J6Y A;  2B31 A;  4TYO A;  3WD3 A;  1ZBK A;  3WL1 A;  1BL4 A;  3O5J A;  1KFW A;  5BXJ A;  1FKF A;  1HJV A;  4BF8 A;  3PR9 A;  4NSB A;  1W1V A;  4ODR A;  4U85 A;  3AS0 A;  4DWS C;  4C02 B;  2LJ4 A;  3ARW A;  2ZR4 A;  1ZK6 A;  4G50 A;  5JH8 A;  4IT4 A;  3KAG A;  2F2D A;  2VN1 A;  1W1T A;  1BKF A;  4R0X A;  3IK8 A;  5I98 A;  2IUZ A;  2IF4 A;  3PRA A;  4MAV A;  2DT2 A;  4MSP A;  5GQB A;  3WQW A;  3RM9 A;  1EYM A;  2XP8 A;  3O5O A;  2UZ5 A;  3MDY B;  2MLZ A;  1H0G A;  2DG3 A;  2ZR6 A;  3WIJ A;  4Q7N A;  2K8I A;  2KO7 A;  4MNM A;  3B8S A;  3KAF A;  1O6I A;  1NWU A;  3KAH A;  2KFW A;  5HW8 A;  1QPF A;  1JNT A;  5HWB A;  2XP6 A;  5DO2 A;  4XAK A;  2XP7 A;  4P8X A;  1Q6U A;  2RUC A;  1JNS A;  1FKD A;  1VF8 A;  2PV1 A;  2MF9 A;  1FFR A;  1FKT A;  1HJX A;  4LAW A;  4WKH A;  1LJY A;  1Q1C A;  1D7J A;  1FKS A;  3IHZ A;  3KAI A;  2A3E A;  3ARZ A;  2RQS A;  1EIB A;  3NRK A;  4JFK A;  1LG1 A;  3IKG A;  2F4E A;  2F21 A;  2O92 A;  4MNJ A;  5GPG A;  3UF8 A;  1W1Y A;  4JFI A;  2L2S A;  4AY1 A;  3ARV A;  4Z2I A;  2KE0 A;  5HWC A;  3CHE A;  1FFQ A;  3AS1 A;  3CHC A;  3AS3 A;  4LAV A;  1E9L A;  2QF8 A;  3B7X A;  4DZ2 A;  5HBF A;  2DG4 A;  4W9P A;  3AS2 A;  2B5U B;  3G6M A;  2ZQU A;  4LAX A;  2PPP A;  3O5P A;  1FKH A;  2FDM A;  4MPK A;  2PI6 A;  1EHN A;  3B9A A;  2DG9 A;  4G2P A;  1D7H A;  4UDM A;  3O5K A;  4QIB A;  4ODQ A;  3ARY A;  2MNT A;  1Y0O A;  4ZPW R;  1R9H A;  4DRN A;  3WD1 A;  4P8W A;  4NNR A;  1X6N A;  3UQA A;  3KAB A;  2XP3 A;  2DSV A;  2PPO A;  4DRH A;  1E15 A;  3ARP A;  3JYM A;  2D9F A;  1OGG A;  3GU0 A;  1FJD A;  1LQ0 A;  1UR9 A; 
#chains in the Genus database with same CATH homology
 3RME A;  3NI6 A;  4JFJ A;  4ITZ A;  1YAT A;  1HJW A;  2A3A A;  1XHG A;  4U84 A;  1NWT A;  3WD0 A;  3BXW A;  1JVW A;  4DWS A;  3B9D A;  2RUD A;  1FAP A;  4TW7 A;  2DSU A;  3W4R A;  1PBK A;  2ZQT A;  1H0I A;  1FKL A;  2OFN A;  3ARU A;  3TDB A;  4W5U A;  1P5Q A;  4DRJ A;  4Z2G A;  5DIT A;  4HBO A;  4ODL A;  1FKI A;  3WD4 A;  3I6C A;  3O5I A;  1JNE A;  3WQV A;  1NMW A;  1WNO A;  4QT2 A;  1FKK A;  5HUA A;  4IQC A;  4Z2J A;  1D2K A;  2N87 A;  3O5L A;  3RM4 A;  1NMV A;  2PV2 A;  3ARQ A;  3RGC A;  4DRI A;  3ART A;  4W9O A;  4S3J A;  5J6E A;  1A7X A;  1E6P A;  1F40 A;  2DSZ A;  4WJX A;  4ODK A;  1TFV A;  4IQ2 A;  1J4R A;  4QZV B;  3LUO A;  1OGB A;  2KGJ A;  4R5E A;  1N1A A;  3AQU A;  4P8U A;  4W9Q A;  1CTN A;  3TC5 A;  1PIN A;  2XP5 A;  2O9O A;  2PBC A;  2RUR A;  4NZC A;  2WK2 A;  3FXY A;  1L1P A;  1ZBV A;  3NTP A;  2VCD A;  2M2A A;  1Q6I A;  5DIU A;  4JFL A;  3KAD A;  1D6O A;  1FKG A;  2WM0 A;  3OA5 A;  2LGO A;  3H9R B;  1TCO C;  1X6L A;  3B9E A;  3GPK A;  1LG2 A;  1LL7 A;  1ZBC A;  3O5R A;  3ARS A;  1ROT A;  4GIV A;  4JFM A;  4DRM A;  4QT3 A;  1JND A;  2KR7 A;  4TNS A;  4Z2L A;  5HKG A;  5HTG A;  2AOS A;  2PV3 A;  2AWG A;  1UR8 A;  1GOI A;  2DT1 A;  1SR0 A;  1HXV A;  4WIW A;  1XRV A;  1QPL A;  3PA7 A;  4WKF A;  3FY1 A;  1EQ3 A;  4ODM A;  1Q6H A;  5HW6 A;  3IKD A;  4O2T A;  1ROU A;  4ODO A;  1WB0 A;  2DSW A;  3JXV A;  2DT0 A;  1W9P A;  4ZS6 A;  1E6R A;  3UI5 A;  4P8V A;  2M08 A;  4WK9 A;  3ARO A;  4FAP A;  2G8Z A;  2DT3 A;  3CHF A;  3CHD A;  1E6Z A;  4ODP A;  4FN2 A;  1ZCN A;  1ITX A;  2OLH A;  2G41 A;  5DEZ A;  3FAP A;  1QZ2 A;  4N19 A;  1HKI A;  1W1P A;  5DIV A;  1RD6 A;  3UQI A;  1FD9 A;  2WLZ A;  1C9H A;  2LKN A;  3KAC A;  4ODN A;  1SYT A;  2A3B A;  2XPB A;  1HKK A;  3UI6 A;  2XP9 A;  2XPA A;  1LL6 A;  1U79 A;  3ARX A;  1ZBW A;  4DRK A;  2Q5A A;  5GPR A;  4KR0 B;  4DIP A;  4U86 A;  4GGQ A;  2RUQ A;  4L3N A;  4KQZ A;  1OWQ A;  1KT1 A;  2A3C A;  3UQB A;  4HBE A;  1YW5 A;  1W9V A;  4IT6 A;  4DRO A;  1ZL1 A;  3CH9 A;  3ODK A;  3ALF A;  3O5F A;  1LL4 A;  1HKM A;  2KI3 A;  4Q22 A;  1NWR A;  3EY6 A;  4DT4 A;  2FAP A;  1HKJ A;  2ZQS A;  3WL0 A;  2LPV A;  2DPE A;  1F8A B;  3O5M A;  2MLY A;  4L72 B;  5HT1 A;  3O5G A;  1FKJ A;  2ZQV A;  4DWS B;  2FKE A;  4HAR A;  1WAW A;  3O5D A;  1E6N A;  1FKB A;  1ZB5 A;  4JYS A;  3OOB A;  1EDQ A;  1W9U A;  1K9T A;  3PRD A;  4MGV A;  3KCE A;  4S3K A;  4J4N A;  1ZU8 A;  2JZV A;  2YBU A;  3ALG A;  3TCZ A;  3CZ8 A;  2ESC A;  4ZPT R;  3G6L A;  2WLY A;  4TX0 A;  3WD2 A;  2XP4 A;  1NWS A;  3VAW A;  3JYJ A;  2M1I A;  2MPH A;  4ZPV R;  4PTM A;  3RM8 A;  4URI A;  4DZ3 A;  3CGN A;  1FKR A;  4J4O A;  5DF0 A;  4LGX A;  1GUV A;  5D75 A;  1IX5 A;  1W26 A;  1J4I A;  3UI4 A;  4TW6 A;  2ITK A;  3WH0 A;  2ZR5 A;  4ML4 A;  4DRQ A;  4Z2H A;  3ARR A;  1M5Y A;  4IPX A;  4WKA A;  3O5E A;  4TW8 A;  4DWS D;  3CGM A;  3RFW A;  4LAY A;  1NH6 A;  4Z2K A;  4MNL A;  4MTV A;  4DRP A;  1KT0 A;  5B8I C;  3O5Q A;  3PRB A;  2RSE A;  1J4H A;  3QOK A;  4DH0 A;  2MLX A;  2YBT A;  5HW7 A;  2Y78 A;  1D7I A;  1GPF A;  2PPN A;  3KZ7 A;  1T11 A;  1NSG A;  3WKZ A;  1B6C A;  4MNK A;  1J6Y A;  2B31 A;  4TYO A;  3WD3 A;  1ZBK A;  3WL1 A;  1BL4 A;  3O5J A;  1KFW A;  5BXJ A;  1FKF A;  1HJV A;  4BF8 A;  3PR9 A;  4NSB A;  1W1V A;  4ODR A;  4U85 A;  3AS0 A;  4DWS C;  4C02 B;  2LJ4 A;  3ARW A;  2ZR4 A;  1ZK6 A;  4G50 A;  5JH8 A;  4IT4 A;  3KAG A;  2F2D A;  2VN1 A;  1W1T A;  1BKF A;  4R0X A;  3IK8 A;  5I98 A;  2IUZ A;  2IF4 A;  3PRA A;  4MAV A;  2DT2 A;  4MSP A;  5GQB A;  3WQW A;  3RM9 A;  1EYM A;  2XP8 A;  3O5O A;  2UZ5 A;  3MDY B;  2MLZ A;  1H0G A;  2DG3 A;  2ZR6 A;  3WIJ A;  4Q7N A;  2K8I A;  2KO7 A;  4MNM A;  3B8S A;  3KAF A;  1O6I A;  1NWU A;  3KAH A;  2KFW A;  5HW8 A;  1QPF A;  1JNT A;  5HWB A;  2XP6 A;  5DO2 A;  4XAK A;  2XP7 A;  4P8X A;  1Q6U A;  2RUC A;  1JNS A;  1FKD A;  1VF8 A;  2PV1 A;  2MF9 A;  1FFR A;  1FKT A;  1HJX A;  4LAW A;  4WKH A;  1LJY A;  1Q1C A;  1D7J A;  1FKS A;  3IHZ A;  3KAI A;  2A3E A;  3ARZ A;  2RQS A;  1EIB A;  3NRK A;  4JFK A;  1LG1 A;  3IKG A;  2F4E A;  2F21 A;  2O92 A;  4MNJ A;  5GPG A;  3UF8 A;  1W1Y A;  4JFI A;  2L2S A;  4AY1 A;  3ARV A;  4Z2I A;  2KE0 A;  5HWC A;  3CHE A;  1FFQ A;  3AS1 A;  3CHC A;  3AS3 A;  4LAV A;  1E9L A;  2QF8 A;  3B7X A;  4DZ2 A;  5HBF A;  2DG4 A;  4W9P A;  3AS2 A;  3G6M A;  2ZQU A;  4LAX A;  2PPP A;  3O5P A;  1FKH A;  2FDM A;  4MPK A;  2PI6 A;  1EHN A;  3B9A A;  2DG9 A;  4G2P A;  1D7H A;  3O5K A;  4QIB A;  4ODQ A;  3ARY A;  2MNT A;  1Y0O A;  4ZPW R;  1R9H A;  4DRN A;  3WD1 A;  4P8W A;  4NNR A;  1X6N A;  3UQA A;  3KAB A;  2XP3 A;  2DSV A;  2PPO A;  4DRH A;  1E15 A;  3ARP A;  3JYM A;  2D9F A;  1OGG A;  1FJD A;  1LQ0 A;  1UR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...