1FKJA

Atomic structure of fkbp12-fk506, an immunophilin immunosuppressant complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title Comparative X-ray structures of the major binding protein for the immunosuppressant FK506 (tacrolimus) in unliganded form and in complex with FK506 and rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rotamase
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkjA00
3O5MA 3H9RB 1M5YA 1F8AB 3OOBA 1FKKA 1U79A 2KR7A 3FAPA 4J4OA 2MPHA 4R0XA 4ODLA 4DRKA 2DG4A 1Q6UA 4J4NA 2RQSA 2K8IA 2MLYA 2F2DA 2PPOA 2LGOA 2KE0A 2AWGA 3O5EA 3O5LA 4ODPA 2XP9A 3TCZA 3CGMA 4DZ3A 1PBKA 5HW8A 2D9FA 3IHZA 4TW8A 3RGCA 2F21A 3IK8A 1YATA 2ZQSA 4LAWA 2M1IA 2ITKA 3O5QA 4DT4A 4IQ2A 1FKBA 2VN1A 3UI5A 1Q6HA 1T11A 3UI4A 1Y0OA 4JFKA 2LKNA 3KCEA 1FKLA 2PV2A 2VCDA 1FKSA 1C9HA 1D6OA 1ROTA 3O5IA 3UI6A 5HTGA 1QZ2A 4DRQA 5DIVA 4FN2A 3O5RA 2KFWA 1FD9A 4LAVA 3KACA 3RFWA 4DRIA 5HT1A 1BKFA 2RSEA 2RUCA 2ZR4A 1J4HA 1YW5A 1J4IA 4LAYA 4ODOA 4DRJA 1FKRA 2MLXA 3O5KA 5BXJA 3PA7A 3IKDA 4QIBA 1N1AA 4QT2A 4C02B 2MF9A 1FKHA 4U84A 4ODKA 2XP6A 4N19A 1W26A 3UQIA 1R9HA 3KABA 5HUAA 3KAHA 3B7XA 3GPKA 2OFNA 2XP4A 5I98A 4JFJA 4DRHA 2L2SA 4TYOA 1PINA 2FAPA 2KI3A 3O5DA 3ODKA 4G2PA 2PPNA 2MNTA 1ZCNA 4DRPA 5HWCA 4DH0A 2LJ4A 2M08A 4MGVA 1F40A 3EY6A 4ODRA 3JXVA 4JFLA 4DROA 2XP5A 1NMWA 1D7HA 3O5FA 4ODNA 3O5JA 5DITA 1FKDA 3KADA 5D75A 5GPGA 4QT3A 4BF8A 1JNSA 1Q6IA 4TX0A 2LPVA 2PBCA 4ODQA 5DIUA 5HWBA 1P5QA 4DRNA 3IKGA 2ZQVA 2RUDA 4IQCA 3UF8A 2M2AA 1JVWA 4W9PA 4TW7A 1FJDA 4MSPA 2UZ5A 3O5GA 4NNRA 4U86A 4W9QA 1L1PA 3TDBA 5B8IC 4JFIA 3UQAA 3KAFA 4DRMA 1FKTA 1KT0A 2DG9A 5HKGA 5HW6A 1FAPA 2JZVA 3WH0A 4FAPA 2IF4A 4JFMA 1HXVA 1FKFA 2PPPA 4G50A 1D7JA 2XP7A 3KAIA 3O5OA 1J4RA 3O5PA 4W9OA 3PRBA 3CGNA 2RURA 4IPXA 2XPAA 1ROUA 2XP3A 1A7XA 1Q1CA 1TCOC 2DG3A 2XPBA 3I6CA 1FKJA 4JYSA 4TNSA 3MDYB 1JNTA 4ODMA 2ZR5A 2KGJA 2RUQA 3PRDA 2KO7A 1B6CA 4U85A 1FKGA 3TC5A 1QPLA 1D7IA 2Q5AA 1EQ3A 2Y78A 3KAGA 1FKIA 1NMVA 4GIVA 2ZQUA 2PV1A 4DZ2A 1ZK6A 1BL4A 1KT1A 2MLZA 2N87A 3NRKA 3JYJA 4GGQA 4TW6A 2F4EA 2FKEA 1J6YA 1QPFA 4ITZA 4O2TA 4DIPA 3JYMA 2ZQTA 4LAXA 1EYMA 3NI6A 5HW7A 5J6EA 2ZR6A 1NSGA 3VAWA 3UQBA 3KZ7A 3NTPA 2XP8A 3LUOA 2PV3A
chains in the Genus database with same CATH superfamily
4Z2JA 4DRKA 4J4OA 2DG4A 2WLZA 2RQSA 2K8IA 2MLYA 1FFQA 2LGOA 3TCZA 2A3EA 5HW8A 1LG2A 4Z2KA 3IHZA 4Z2HA 1UR8A 2ZQSA 3O5QA 2VN1A 1NWRA 1Y0OA 2LKNA 3KCEA 1NWUA 2PV2A 3AS0A 2PI6A 3UI6A 1ROTA 1QZ2A 1LG1A 3WL1A 4FN2A 4WKHA 4IT6A 3O5RA 3KACA 5HT1A 4L3NA 2DT0A 1YW5A 1ITXA 4ODOA 1FKRA 5DEZA 4QIBA 1N1AA 1FKHA 4P8XA 3B7XA 2OFNA 1NH6A 4DRHA 3O5DA 4G2PA 2MNTA 1NWSA 5HWCA 1GUVA 2A3BA 1ZU8A 4MGVA 1LL7A 3JXVA 4DWSD 4ODNA 4MNMA 5DITA 3O5FA 5GPGA 1EIBA 3KADA 3GU0A 5D75A 1JNSA 5HWBA 1D2KA 3B8SA 3WQVA 3IKGA 4ZS6A 2DSWA 3UF8A 2G41A 3AS3A 2M2AA 1JVWA 3BXWA 2UZ5A 1L1PA 4MNLA 3TDBA 4DRMA 3WD4A 2O9OA 5HKGA 1VF8A 1LL4A 2A3CA 2YBUA 1JCHB 4KQZA 3ARPA 2F23A 3KAIA 3O5PA 3CGNA 4MTVA 1W1VA 1JNDA 1Q1CA 4QZVB 4R5EA 4AY1A 1FKGA 1EQ3A 2Y78A 3KAGA 1NMVA 1HJVA 2ZQUA 4DZ2A 1ZK6A 1GRJA 4W9PA 4TW6A 2FKEA 3QOKA 4XAKA 4ITZA 4O2TA 2ZQTA 3NI6A 5J6EA 3NTPA 3LUOA 4P8WA 3H9RB 4R0XA 1LJYA 4ODLA 3PRAA 1HJWA 1Q6UA 1ZBCA 3O5LA 4DZ3A 3FY1A 2D9FA 4TW8A 1LL6A 2ESCA 2FDMA 1E6NA 4DT4A 4IQ2A 1Q6HA 2DT3A 3UI4A 1E6ZA 1H0IA 2VCDA 3O5IA 1D6OA 5HTGA 3CH9A 3RM9A 5DIVA 1WNOA 3ARQA 4LGXA 1FD9A 2RUCA 2RSEA 1UR9A 4Z2GA 4P8UA 4DRJA 1LQ0A 3PA7A 4W5UA 2DSZA 1OGGA 2MF9A 4ODKA 4N19A 3UQIA 3GPKA 2XP4A 4JFJA 4WJXA 1OGBA 2O92A 1HJXA 1PINA 2FAPA 4NZCA 3CHEA 4DH0A 5DF0A 3EY6A 4JFLA 4DROA 1D7HA 3O5JA 1HKKA 1FKDA 3CHCA 4BF8A 4QT3A 1WB0A 1Q6IA 4HBOA 3AS1A 1ZBKA 2ZQVA 2RUDA 1JNEA 1SYTA 2P4VA 1ZL1A 1FJDA 4U86A 5GQBA 3UQAA 3ARTA 3GTYX 1FAPA 4Q22A 1CTNA 4FAPA 4MNKA 1D7JA 2YBTA 5JH8A 3W4RA 4Z2IA 1WAWA 3PRBA 3WD3A 2RURA 4IPXA 3ALFA 1XRVA 2XP3A 3I6CA 4UDMA 1JNTA 2RUQA 3PRDA 2KO7A 1B6CA 1QPLA 1HKMA 1E44A 4WIWA 3CHDA 3RM4A 2PV1A 4URIA 1KT1A 1IX5A 4MPKA 1GPFA 3ARYA 3JYMA 4LAXA 3UQBA 1NSGA 3ARSA 3KZ7A 4HARA 1KFWA 2AOSA 3OA5A 2PV3A 1XHGA 4ML4A 1F8AB 3OOBA 1FKKA 3FAPA 2MPHA 2QF8A 4J4NA 4S3JA 2F2DA 2PPOA 3WD0A 2AWGA 2DPEA 3AQUA 1PBKA 3IK8A 4LAWA 2M1IA 5DO2A 1FKBA 3UI5A 1T11A 4JFKA 2EULA 1FKLA 1RD6A 3FXYA 1C9HA 4DRQA 2DT2A 3ARUA 2KFWA 4HBEA 3RFWA 3G6LA 3BMBA 2ZR4A 1J4IA 4LAYA 2MLXA 4WK9A 5BXJA 3IKDA 4QT2A 4C02B 2XP6A 1FFRA 1W26A 3KABA 3KAHA 5I98A 3ODKA 2PPNA 1SR0A 1ZCNA 1ZB5A 2LJ4A 1NMWA 2IUZA 3CZ8A 5DIUA 2PBCA 4IQCA 4MSPA 4NNRA 5B8IC 1FKTA 1KT0A 2DG9A 5HW6A 4L72B 3WH0A 4JFMA 1HXVA 1FKFA 4G50A 3EIPA 2XP7A 3O5OA 4W9OA 1E15A 1E9LA 2XPAA 3ARRA 1A7XA 1GOIA 1TCOC 1FKJA 3MDYB 3WD2A 1HKJA 2ZR5A 3RMEA 4DWSA 2B31A 5HBFA 2A3AA 2Q5AA 1D7IA 3B9AA 1FKIA 4GIVA 3NRKA 1BL4A 2MLZA 2N87A 3JYJA 4GGQA 2F4EA 1QPFA 1ZBVA 1EYMA 1EHNA 3VAWA 4ZPWR 4DWSB 3ALGA 3PR9A 3O5MA 1M5YA 3WL0A 4DWSC 1O6IA 1U79A 2KR7A 2PN0A 3B9DA 2KE0A 3O5EA 4ODPA 2XP9A 3CGMA 1EDQA 3RGCA 2F21A 1YATA 4P8VA 2ITKA 4WKFA 3ARZA 2ETNA 4MNJA 4KR0B 1W1TA 1FKSA 3WKZA 4DRIA 1BKFA 1J4HA 1W9VA 1NWTA 3AROA 1E6PA 3O5KA 4Z2LA 2DT1A 4S3KA 4NSBA 4U84A 2WM0A 1R9HA 1ZBWA 5HUAA 2L2SA 4TYOA 2KI3A 4DRPA 3ARVA 2M08A 3WIJA 1F40A 4ODRA 2XP5A 5GPRA 4TX0A 2LPVA 3CHFA 4ODQA 1X6LA 3B9EA 1P5QA 4DRNA 1OWQA 1E6RA 1K9TA 1TFVA 4TW7A 3O5GA 4W9QA 4ZPTR 3G6MA 4JFIA 3KAFA 4PTMA 2DSUA 3WQWA 4Q7NA 2DSVA 1W1PA 2JZVA 1W1YA 2IF4A 2B5UB 2PPPA 1J4RA 4IT4A 1ROUA 2DG3A 2XPBA 4JYSA 4TNSA 1H0GA 4ODMA 4ZPVR 2KGJA 1HKIA 3WD1A 2WK2A 4U85A 2WLYA 2G8ZA 3RM8A 3TC5A 4MAVA 3ARXA 3AS2A 2OLHA 1J6YA 4WKAA 4DIPA 1X6NA 1W9PA 5HW7A 2ZR6A 1W9UA 2XP8A 4LAVA 3ARWA
chains in the Genus database with same CATH topology
4Z2JA 4DRKA 4J4OA 2DG4A 2WLZA 2RQSA 2K8IA 2MLYA 1FFQA 2LGOA 3TCZA 2A3EA 5HW8A 1LG2A 4Z2KA 3IHZA 4Z2HA 1UR8A 2ZQSA 3O5QA 2VN1A 1NWRA 1Y0OA 2LKNA 3KCEA 1NWUA 2PV2A 3AS0A 2PI6A 3UI6A 1ROTA 1QZ2A 1LG1A 3WL1A 4FN2A 4WKHA 4IT6A 3O5RA 3KACA 5HT1A 4L3NA 2DT0A 1YW5A 1ITXA 4ODOA 1FKRA 5DEZA 4QIBA 1N1AA 1FKHA 4P8XA 3B7XA 2OFNA 1NH6A 4DRHA 3O5DA 4G2PA 2MNTA 1NWSA 5HWCA 1GUVA 2A3BA 1ZU8A 4MGVA 1LL7A 3JXVA 4DWSD 4ODNA 4MNMA 5DITA 3O5FA 5GPGA 1EIBA 3KADA 5D75A 1JNSA 5HWBA 1D2KA 3B8SA 3WQVA 3IKGA 4ZS6A 2DSWA 3UF8A 2G41A 3AS3A 2M2AA 1JVWA 3BXWA 2UZ5A 1L1PA 4MNLA 3TDBA 4DRMA 3WD4A 2O9OA 5HKGA 1VF8A 1LL4A 2A3CA 2YBUA 4KQZA 3ARPA 3KAIA 3O5PA 3CGNA 4MTVA 1W1VA 1JNDA 1Q1CA 4QZVB 4R5EA 4AY1A 1FKGA 1EQ3A 2Y78A 3KAGA 1NMVA 1HJVA 2ZQUA 4DZ2A 1ZK6A 4W9PA 4TW6A 2FKEA 3QOKA 4XAKA 4ITZA 4O2TA 2ZQTA 3NI6A 5J6EA 3NTPA 3LUOA 4P8WA 3H9RB 4R0XA 1LJYA 4ODLA 3PRAA 1HJWA 1Q6UA 1ZBCA 3O5LA 4DZ3A 3FY1A 2D9FA 4TW8A 1LL6A 2ESCA 2FDMA 1E6NA 4DT4A 4IQ2A 1Q6HA 2DT3A 3UI4A 1E6ZA 1H0IA 2VCDA 3O5IA 1D6OA 5HTGA 3CH9A 3RM9A 5DIVA 1WNOA 3ARQA 4LGXA 1FD9A 2RUCA 2RSEA 1UR9A 4Z2GA 4P8UA 4DRJA 1LQ0A 3PA7A 4W5UA 2DSZA 1OGGA 2MF9A 4ODKA 4N19A 3UQIA 3GPKA 2XP4A 4JFJA 4WJXA 1OGBA 2O92A 1HJXA 1PINA 2FAPA 4NZCA 3CHEA 4DH0A 5DF0A 3EY6A 4JFLA 4DROA 1D7HA 3O5JA 1HKKA 1FKDA 3CHCA 4BF8A 4QT3A 1WB0A 1Q6IA 4HBOA 3AS1A 1ZBKA 2ZQVA 2RUDA 1JNEA 1SYTA 1ZL1A 1FJDA 4U86A 5GQBA 3UQAA 3ARTA 1FAPA 4Q22A 1CTNA 4FAPA 4MNKA 1D7JA 2YBTA 5JH8A 3W4RA 4Z2IA 1WAWA 3PRBA 3WD3A 2RURA 4IPXA 3ALFA 1XRVA 2XP3A 3I6CA 1JNTA 2RUQA 3PRDA 2KO7A 1B6CA 1QPLA 1HKMA 4WIWA 3CHDA 3RM4A 2PV1A 4URIA 1KT1A 1IX5A 4MPKA 1GPFA 3ARYA 3JYMA 4LAXA 3UQBA 1NSGA 3ARSA 3KZ7A 4HARA 1KFWA 2AOSA 3OA5A 2PV3A 1XHGA 4ML4A 1F8AB 3OOBA 1FKKA 3FAPA 2MPHA 2QF8A 4J4NA 4S3JA 2F2DA 2PPOA 3WD0A 2AWGA 2DPEA 3AQUA 1PBKA 3IK8A 4LAWA 2M1IA 5DO2A 1FKBA 3UI5A 1T11A 4JFKA 1FKLA 1RD6A 3FXYA 1C9HA 4DRQA 2DT2A 3ARUA 2KFWA 4HBEA 3RFWA 3G6LA 2ZR4A 1J4IA 4LAYA 2MLXA 4WK9A 5BXJA 3IKDA 4QT2A 4C02B 2XP6A 1FFRA 1W26A 3KABA 3KAHA 5I98A 3ODKA 2PPNA 1SR0A 1ZCNA 1ZB5A 2LJ4A 1NMWA 2IUZA 3CZ8A 5DIUA 2PBCA 4IQCA 4MSPA 4NNRA 5B8IC 1FKTA 1KT0A 2DG9A 5HW6A 4L72B 3WH0A 4JFMA 1HXVA 1FKFA 4G50A 2XP7A 3O5OA 4W9OA 1E15A 1E9LA 2XPAA 3ARRA 1A7XA 1GOIA 1TCOC 1FKJA 3MDYB 3WD2A 1HKJA 2ZR5A 3RMEA 4DWSA 2B31A 5HBFA 2A3AA 2Q5AA 1D7IA 3B9AA 1FKIA 4GIVA 3NRKA 1BL4A 2MLZA 2N87A 3JYJA 4GGQA 2F4EA 1QPFA 1ZBVA 1EYMA 1EHNA 3VAWA 4ZPWR 4DWSB 3ALGA 3PR9A 3O5MA 1M5YA 3WL0A 4DWSC 1O6IA 1U79A 2KR7A 3B9DA 2KE0A 3O5EA 4ODPA 2XP9A 3CGMA 1EDQA 3RGCA 2F21A 1YATA 4P8VA 2ITKA 4WKFA 3ARZA 4MNJA 4KR0B 1W1TA 1FKSA 3WKZA 4DRIA 1BKFA 1J4HA 1W9VA 1NWTA 3AROA 1E6PA 3O5KA 4Z2LA 2DT1A 4S3KA 4NSBA 4U84A 2WM0A 1R9HA 1ZBWA 5HUAA 2L2SA 4TYOA 2KI3A 4DRPA 3ARVA 2M08A 3WIJA 1F40A 4ODRA 2XP5A 5GPRA 4TX0A 2LPVA 3CHFA 4ODQA 1X6LA 3B9EA 1P5QA 4DRNA 1OWQA 1E6RA 1K9TA 1TFVA 4TW7A 3O5GA 4W9QA 4ZPTR 3G6MA 4JFIA 3KAFA 4PTMA 2DSUA 3WQWA 4Q7NA 2DSVA 1W1PA 2JZVA 1W1YA 2IF4A 2PPPA 1J4RA 4IT4A 1ROUA 2DG3A 2XPBA 4JYSA 4TNSA 1H0GA 4ODMA 4ZPVR 2KGJA 1HKIA 3WD1A 2WK2A 4U85A 2WLYA 2G8ZA 3RM8A 3TC5A 4MAVA 3ARXA 3AS2A 2OLHA 1J6YA 4WKAA 4DIPA 1X6NA 1W9PA 5HW7A 2ZR6A 1W9UA 2XP8A 4LAVA 3ARWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5M A;  3H9R B;  1M5Y A;  1F8A B;  3OOB A;  1FKK A;  1U79 A;  2KR7 A;  3FAP A;  4J4O A;  2MPH A;  4R0X A;  4ODL A;  4DRK A;  2DG4 A;  1Q6U A;  4J4N A;  2RQS A;  2K8I A;  2MLY A;  2F2D A;  2PPO A;  2LGO A;  2KE0 A;  2AWG A;  3O5E A;  3O5L A;  4ODP A;  2XP9 A;  3TCZ A;  3CGM A;  4DZ3 A;  1PBK A;  5HW8 A;  2D9F A;  3IHZ A;  4TW8 A;  3RGC A;  2F21 A;  3IK8 A;  1YAT A;  2ZQS A;  4LAW A;  2M1I A;  2ITK A;  3O5Q A;  4DT4 A;  4IQ2 A;  1FKB A;  2VN1 A;  3UI5 A;  1Q6H A;  1T11 A;  3UI4 A;  1Y0O A;  4JFK A;  2LKN A;  3KCE A;  1FKL A;  2PV2 A;  2VCD A;  1FKS A;  1C9H A;  1D6O A;  1ROT A;  3O5I A;  3UI6 A;  5HTG A;  1QZ2 A;  4DRQ A;  5DIV A;  4FN2 A;  3O5R A;  2KFW A;  1FD9 A;  4LAV A;  3KAC A;  3RFW A;  4DRI A;  5HT1 A;  1BKF A;  2RSE A;  2RUC A;  2ZR4 A;  1J4H A;  1YW5 A;  1J4I A;  4LAY A;  4ODO A;  4DRJ A;  1FKR A;  2MLX A;  3O5K A;  5BXJ A;  3PA7 A;  3IKD A;  4QIB A;  1N1A A;  4QT2 A;  4C02 B;  2MF9 A;  1FKH A;  4U84 A;  4ODK A;  2XP6 A;  4N19 A;  1W26 A;  3UQI A;  1R9H A;  3KAB A;  5HUA A;  3KAH A;  3B7X A;  3GPK A;  2OFN A;  2XP4 A;  5I98 A;  4JFJ A;  4DRH A;  2L2S A;  4TYO A;  1PIN A;  2FAP A;  2KI3 A;  3O5D A;  3ODK A;  4G2P A;  2PPN A;  2MNT A;  1ZCN A;  4DRP A;  5HWC A;  4DH0 A;  2LJ4 A;  2M08 A;  4MGV A;  1F40 A;  3EY6 A;  4ODR A;  3JXV A;  4JFL A;  4DRO A;  2XP5 A;  1NMW A;  1D7H A;  3O5F A;  4ODN A;  3O5J A;  5DIT A;  1FKD A;  3KAD A;  5D75 A;  5GPG A;  4QT3 A;  4BF8 A;  1JNS A;  1Q6I A;  4TX0 A;  2LPV A;  2PBC A;  4ODQ A;  5DIU A;  5HWB A;  1P5Q A;  4DRN A;  3IKG A;  2ZQV A;  2RUD A;  4IQC A;  3UF8 A;  2M2A A;  1JVW A;  4W9P A;  4TW7 A;  1FJD A;  4MSP A;  2UZ5 A;  3O5G A;  4NNR A;  4U86 A;  4W9Q A;  1L1P A;  3TDB A;  5B8I C;  4JFI A;  3UQA A;  3KAF A;  4DRM A;  1FKT A;  1KT0 A;  2DG9 A;  5HKG A;  5HW6 A;  1FAP A;  2JZV A;  3WH0 A;  4FAP A;  2IF4 A;  4JFM A;  1HXV A;  1FKF A;  2PPP A;  4G50 A;  1D7J A;  2XP7 A;  3KAI A;  3O5O A;  1J4R A;  3O5P A;  4W9O A;  3PRB A;  3CGN A;  2RUR A;  4IPX A;  2XPA A;  1ROU A;  2XP3 A;  1A7X A;  1Q1C A;  1TCO C;  2DG3 A;  2XPB A;  3I6C A;  1FKJ A;  4JYS A;  4TNS A;  3MDY B;  1JNT A;  4ODM A;  2ZR5 A;  2KGJ A;  2RUQ A;  3PRD A;  2KO7 A;  1B6C A;  4U85 A;  1FKG A;  3TC5 A;  1QPL A;  1D7I A;  2Q5A A;  1EQ3 A;  2Y78 A;  3KAG A;  1FKI A;  1NMV A;  4GIV A;  2ZQU A;  2PV1 A;  4DZ2 A;  1ZK6 A;  1BL4 A;  1KT1 A;  2MLZ A;  2N87 A;  3NRK A;  3JYJ A;  4GGQ A;  4TW6 A;  2F4E A;  2FKE A;  1J6Y A;  1QPF A;  4ITZ A;  4O2T A;  4DIP A;  3JYM A;  2ZQT A;  4LAX A;  1EYM A;  3NI6 A;  5HW7 A;  5J6E A;  2ZR6 A;  1NSG A;  3VAW A;  3UQB A;  3KZ7 A;  3NTP A;  2XP8 A;  3LUO A;  2PV3 A; 
#chains in the Genus database with same CATH topology
 4Z2J A;  4DRK A;  4J4O A;  2DG4 A;  2WLZ A;  2RQS A;  2K8I A;  2MLY A;  1FFQ A;  2LGO A;  3TCZ A;  2A3E A;  5HW8 A;  1LG2 A;  4Z2K A;  3IHZ A;  4Z2H A;  1UR8 A;  2ZQS A;  3O5Q A;  2VN1 A;  1NWR A;  1Y0O A;  2LKN A;  3KCE A;  1NWU A;  2PV2 A;  3AS0 A;  2PI6 A;  3UI6 A;  1ROT A;  1QZ2 A;  1LG1 A;  3WL1 A;  4FN2 A;  4WKH A;  4IT6 A;  3O5R A;  3KAC A;  5HT1 A;  4L3N A;  2DT0 A;  1YW5 A;  1ITX A;  4ODO A;  1FKR A;  5DEZ A;  4QIB A;  1N1A A;  1FKH A;  4P8X A;  3B7X A;  2OFN A;  1NH6 A;  4DRH A;  3O5D A;  4G2P A;  2MNT A;  1NWS A;  5HWC A;  1GUV A;  2A3B A;  1ZU8 A;  4MGV A;  1LL7 A;  3JXV A;  4DWS D;  4ODN A;  4MNM A;  5DIT A;  3O5F A;  5GPG A;  1EIB A;  3KAD A;  3GU0 A;  5D75 A;  1JNS A;  5HWB A;  1D2K A;  3B8S A;  3WQV A;  3IKG A;  4ZS6 A;  2DSW A;  3UF8 A;  2G41 A;  3AS3 A;  2M2A A;  1JVW A;  3BXW A;  2UZ5 A;  1L1P A;  4MNL A;  3TDB A;  4DRM A;  3WD4 A;  2O9O A;  5HKG A;  1VF8 A;  1LL4 A;  2A3C A;  2YBU A;  1JCH B;  4KQZ A;  3ARP A;  2F23 A;  3KAI A;  3O5P A;  3CGN A;  4MTV A;  1W1V A;  1JND A;  1Q1C A;  4QZV B;  4R5E A;  4AY1 A;  1FKG A;  1EQ3 A;  2Y78 A;  3KAG A;  1NMV A;  1HJV A;  2ZQU A;  4DZ2 A;  1ZK6 A;  1GRJ A;  4W9P A;  4TW6 A;  2FKE A;  3QOK A;  4XAK A;  4ITZ A;  4O2T A;  2ZQT A;  3NI6 A;  5J6E A;  3NTP A;  3LUO A;  4P8W A;  3H9R B;  4R0X A;  1LJY A;  4ODL A;  3PRA A;  1HJW A;  1Q6U A;  1ZBC A;  3O5L A;  4DZ3 A;  3FY1 A;  2D9F A;  4TW8 A;  1LL6 A;  2ESC A;  2FDM A;  1E6N A;  4DT4 A;  4IQ2 A;  1Q6H A;  2DT3 A;  3UI4 A;  1E6Z A;  1H0I A;  2VCD A;  3O5I A;  1D6O A;  5HTG A;  3CH9 A;  3RM9 A;  5DIV A;  1WNO A;  3ARQ A;  4LGX A;  1FD9 A;  2RUC A;  2RSE A;  1UR9 A;  4Z2G A;  4P8U A;  4DRJ A;  1LQ0 A;  3PA7 A;  4W5U A;  2DSZ A;  1OGG A;  2MF9 A;  4ODK A;  4N19 A;  3UQI A;  3GPK A;  2XP4 A;  4JFJ A;  4WJX A;  1OGB A;  2O92 A;  1HJX A;  1PIN A;  2FAP A;  4NZC A;  3CHE A;  4DH0 A;  5DF0 A;  3EY6 A;  4JFL A;  4DRO A;  1D7H A;  3O5J A;  1HKK A;  1FKD A;  3CHC A;  4BF8 A;  4QT3 A;  1WB0 A;  1Q6I A;  4HBO A;  3AS1 A;  1ZBK A;  2ZQV A;  2RUD A;  1JNE A;  1SYT A;  2P4V A;  1ZL1 A;  1FJD A;  4U86 A;  5GQB A;  3UQA A;  3ART A;  3GTY X;  1FAP A;  4Q22 A;  1CTN A;  4FAP A;  4MNK A;  1D7J A;  2YBT A;  5JH8 A;  3W4R A;  4Z2I A;  1WAW A;  3PRB A;  3WD3 A;  2RUR A;  4IPX A;  3ALF A;  1XRV A;  2XP3 A;  3I6C A;  4UDM A;  1JNT A;  2RUQ A;  3PRD A;  2KO7 A;  1B6C A;  1QPL A;  1HKM A;  1E44 A;  4WIW A;  3CHD A;  3RM4 A;  2PV1 A;  4URI A;  1KT1 A;  1IX5 A;  4MPK A;  1GPF A;  3ARY A;  3JYM A;  4LAX A;  3UQB A;  1NSG A;  3ARS A;  3KZ7 A;  4HAR A;  1KFW A;  2AOS A;  3OA5 A;  2PV3 A;  1XHG A;  4ML4 A;  1F8A B;  3OOB A;  1FKK A;  3FAP A;  2MPH A;  2QF8 A;  4J4N A;  4S3J A;  2F2D A;  2PPO A;  3WD0 A;  2AWG A;  2DPE A;  3AQU A;  1PBK A;  3IK8 A;  4LAW A;  2M1I A;  5DO2 A;  1FKB A;  3UI5 A;  1T11 A;  4JFK A;  2EUL A;  1FKL A;  1RD6 A;  3FXY A;  1C9H A;  4DRQ A;  2DT2 A;  3ARU A;  2KFW A;  4HBE A;  3RFW A;  3G6L A;  3BMB A;  2ZR4 A;  1J4I A;  4LAY A;  2MLX A;  4WK9 A;  5BXJ A;  3IKD A;  4QT2 A;  4C02 B;  2XP6 A;  1FFR A;  1W26 A;  3KAB A;  3KAH A;  5I98 A;  3ODK A;  2PPN A;  1SR0 A;  1ZCN A;  1ZB5 A;  2LJ4 A;  1NMW A;  2IUZ A;  3CZ8 A;  5DIU A;  2PBC A;  4IQC A;  4MSP A;  4NNR A;  5B8I C;  1FKT A;  1KT0 A;  2DG9 A;  5HW6 A;  4L72 B;  3WH0 A;  4JFM A;  1HXV A;  1FKF A;  4G50 A;  3EIP A;  2XP7 A;  3O5O A;  4W9O A;  1E15 A;  1E9L A;  2XPA A;  3ARR A;  1A7X A;  1GOI A;  1TCO C;  1FKJ A;  3MDY B;  3WD2 A;  1HKJ A;  2ZR5 A;  3RME A;  4DWS A;  2B31 A;  5HBF A;  2A3A A;  2Q5A A;  1D7I A;  3B9A A;  1FKI A;  4GIV A;  3NRK A;  1BL4 A;  2MLZ A;  2N87 A;  3JYJ A;  4GGQ A;  2F4E A;  1QPF A;  1ZBV A;  1EYM A;  1EHN A;  3VAW A;  4ZPW R;  4DWS B;  3ALG A;  3PR9 A;  3O5M A;  1M5Y A;  3WL0 A;  4DWS C;  1O6I A;  1U79 A;  2KR7 A;  2PN0 A;  3B9D A;  2KE0 A;  3O5E A;  4ODP A;  2XP9 A;  3CGM A;  1EDQ A;  3RGC A;  2F21 A;  1YAT A;  4P8V A;  2ITK A;  4WKF A;  3ARZ A;  2ETN A;  4MNJ A;  4KR0 B;  1W1T A;  1FKS A;  3WKZ A;  4DRI A;  1BKF A;  1J4H A;  1W9V A;  1NWT A;  3ARO A;  1E6P A;  3O5K A;  4Z2L A;  2DT1 A;  4S3K A;  4NSB A;  4U84 A;  2WM0 A;  1R9H A;  1ZBW A;  5HUA A;  2L2S A;  4TYO A;  2KI3 A;  4DRP A;  3ARV A;  2M08 A;  3WIJ A;  1F40 A;  4ODR A;  2XP5 A;  5GPR A;  4TX0 A;  2LPV A;  3CHF A;  4ODQ A;  1X6L A;  3B9E A;  1P5Q A;  4DRN A;  1OWQ A;  1E6R A;  1K9T A;  1TFV A;  4TW7 A;  3O5G A;  4W9Q A;  4ZPT R;  3G6M A;  4JFI A;  3KAF A;  4PTM A;  2DSU A;  3WQW A;  4Q7N A;  2DSV A;  1W1P A;  2JZV A;  1W1Y A;  2IF4 A;  2B5U B;  2PPP A;  1J4R A;  4IT4 A;  1ROU A;  2DG3 A;  2XPB A;  4JYS A;  4TNS A;  1H0G A;  4ODM A;  4ZPV R;  2KGJ A;  1HKI A;  3WD1 A;  2WK2 A;  4U85 A;  2WLY A;  2G8Z A;  3RM8 A;  3TC5 A;  4MAV A;  3ARX A;  3AS2 A;  2OLH A;  1J6Y A;  4WKA A;  4DIP A;  1X6N A;  1W9P A;  5HW7 A;  2ZR6 A;  1W9U A;  2XP8 A;  4LAV A;  3ARW A; 
#chains in the Genus database with same CATH homology
 4Z2J A;  4DRK A;  4J4O A;  2DG4 A;  2WLZ A;  2RQS A;  2K8I A;  2MLY A;  1FFQ A;  2LGO A;  3TCZ A;  2A3E A;  5HW8 A;  1LG2 A;  4Z2K A;  3IHZ A;  4Z2H A;  1UR8 A;  2ZQS A;  3O5Q A;  2VN1 A;  1NWR A;  1Y0O A;  2LKN A;  3KCE A;  1NWU A;  2PV2 A;  3AS0 A;  2PI6 A;  3UI6 A;  1ROT A;  1QZ2 A;  1LG1 A;  3WL1 A;  4FN2 A;  4WKH A;  4IT6 A;  3O5R A;  3KAC A;  5HT1 A;  4L3N A;  2DT0 A;  1YW5 A;  1ITX A;  4ODO A;  1FKR A;  5DEZ A;  4QIB A;  1N1A A;  1FKH A;  4P8X A;  3B7X A;  2OFN A;  1NH6 A;  4DRH A;  3O5D A;  4G2P A;  2MNT A;  1NWS A;  5HWC A;  1GUV A;  2A3B A;  1ZU8 A;  4MGV A;  1LL7 A;  3JXV A;  4DWS D;  4ODN A;  4MNM A;  5DIT A;  3O5F A;  5GPG A;  1EIB A;  3KAD A;  5D75 A;  1JNS A;  5HWB A;  1D2K A;  3B8S A;  3WQV A;  3IKG A;  4ZS6 A;  2DSW A;  3UF8 A;  2G41 A;  3AS3 A;  2M2A A;  1JVW A;  3BXW A;  2UZ5 A;  1L1P A;  4MNL A;  3TDB A;  4DRM A;  3WD4 A;  2O9O A;  5HKG A;  1VF8 A;  1LL4 A;  2A3C A;  2YBU A;  4KQZ A;  3ARP A;  3KAI A;  3O5P A;  3CGN A;  4MTV A;  1W1V A;  1JND A;  1Q1C A;  4QZV B;  4R5E A;  4AY1 A;  1FKG A;  1EQ3 A;  2Y78 A;  3KAG A;  1NMV A;  1HJV A;  2ZQU A;  4DZ2 A;  1ZK6 A;  4W9P A;  4TW6 A;  2FKE A;  3QOK A;  4XAK A;  4ITZ A;  4O2T A;  2ZQT A;  3NI6 A;  5J6E A;  3NTP A;  3LUO A;  4P8W A;  3H9R B;  4R0X A;  1LJY A;  4ODL A;  3PRA A;  1HJW A;  1Q6U A;  1ZBC A;  3O5L A;  4DZ3 A;  3FY1 A;  2D9F A;  4TW8 A;  1LL6 A;  2ESC A;  2FDM A;  1E6N A;  4DT4 A;  4IQ2 A;  1Q6H A;  2DT3 A;  3UI4 A;  1E6Z A;  1H0I A;  2VCD A;  3O5I A;  1D6O A;  5HTG A;  3CH9 A;  3RM9 A;  5DIV A;  1WNO A;  3ARQ A;  4LGX A;  1FD9 A;  2RUC A;  2RSE A;  1UR9 A;  4Z2G A;  4P8U A;  4DRJ A;  1LQ0 A;  3PA7 A;  4W5U A;  2DSZ A;  1OGG A;  2MF9 A;  4ODK A;  4N19 A;  3UQI A;  3GPK A;  2XP4 A;  4JFJ A;  4WJX A;  1OGB A;  2O92 A;  1HJX A;  1PIN A;  2FAP A;  4NZC A;  3CHE A;  4DH0 A;  5DF0 A;  3EY6 A;  4JFL A;  4DRO A;  1D7H A;  3O5J A;  1HKK A;  1FKD A;  3CHC A;  4BF8 A;  4QT3 A;  1WB0 A;  1Q6I A;  4HBO A;  3AS1 A;  1ZBK A;  2ZQV A;  2RUD A;  1JNE A;  1SYT A;  1ZL1 A;  1FJD A;  4U86 A;  5GQB A;  3UQA A;  3ART A;  1FAP A;  4Q22 A;  1CTN A;  4FAP A;  4MNK A;  1D7J A;  2YBT A;  5JH8 A;  3W4R A;  4Z2I A;  1WAW A;  3PRB A;  3WD3 A;  2RUR A;  4IPX A;  3ALF A;  1XRV A;  2XP3 A;  3I6C A;  1JNT A;  2RUQ A;  3PRD A;  2KO7 A;  1B6C A;  1QPL A;  1HKM A;  4WIW A;  3CHD A;  3RM4 A;  2PV1 A;  4URI A;  1KT1 A;  1IX5 A;  4MPK A;  1GPF A;  3ARY A;  3JYM A;  4LAX A;  3UQB A;  1NSG A;  3ARS A;  3KZ7 A;  4HAR A;  1KFW A;  2AOS A;  3OA5 A;  2PV3 A;  1XHG A;  4ML4 A;  1F8A B;  3OOB A;  1FKK A;  3FAP A;  2MPH A;  2QF8 A;  4J4N A;  4S3J A;  2F2D A;  2PPO A;  3WD0 A;  2AWG A;  2DPE A;  3AQU A;  1PBK A;  3IK8 A;  4LAW A;  2M1I A;  5DO2 A;  1FKB A;  3UI5 A;  1T11 A;  4JFK A;  1FKL A;  1RD6 A;  3FXY A;  1C9H A;  4DRQ A;  2DT2 A;  3ARU A;  2KFW A;  4HBE A;  3RFW A;  3G6L A;  2ZR4 A;  1J4I A;  4LAY A;  2MLX A;  4WK9 A;  5BXJ A;  3IKD A;  4QT2 A;  4C02 B;  2XP6 A;  1FFR A;  1W26 A;  3KAB A;  3KAH A;  5I98 A;  3ODK A;  2PPN A;  1SR0 A;  1ZCN A;  1ZB5 A;  2LJ4 A;  1NMW A;  2IUZ A;  3CZ8 A;  5DIU A;  2PBC A;  4IQC A;  4MSP A;  4NNR A;  5B8I C;  1FKT A;  1KT0 A;  2DG9 A;  5HW6 A;  4L72 B;  3WH0 A;  4JFM A;  1HXV A;  1FKF A;  4G50 A;  2XP7 A;  3O5O A;  4W9O A;  1E15 A;  1E9L A;  2XPA A;  3ARR A;  1A7X A;  1GOI A;  1TCO C;  1FKJ A;  3MDY B;  3WD2 A;  1HKJ A;  2ZR5 A;  3RME A;  4DWS A;  2B31 A;  5HBF A;  2A3A A;  2Q5A A;  1D7I A;  3B9A A;  1FKI A;  4GIV A;  3NRK A;  1BL4 A;  2MLZ A;  2N87 A;  3JYJ A;  4GGQ A;  2F4E A;  1QPF A;  1ZBV A;  1EYM A;  1EHN A;  3VAW A;  4ZPW R;  4DWS B;  3ALG A;  3PR9 A;  3O5M A;  1M5Y A;  3WL0 A;  4DWS C;  1O6I A;  1U79 A;  2KR7 A;  3B9D A;  2KE0 A;  3O5E A;  4ODP A;  2XP9 A;  3CGM A;  1EDQ A;  3RGC A;  2F21 A;  1YAT A;  4P8V A;  2ITK A;  4WKF A;  3ARZ A;  4MNJ A;  4KR0 B;  1W1T A;  1FKS A;  3WKZ A;  4DRI A;  1BKF A;  1J4H A;  1W9V A;  1NWT A;  3ARO A;  1E6P A;  3O5K A;  4Z2L A;  2DT1 A;  4S3K A;  4NSB A;  4U84 A;  2WM0 A;  1R9H A;  1ZBW A;  5HUA A;  2L2S A;  4TYO A;  2KI3 A;  4DRP A;  3ARV A;  2M08 A;  3WIJ A;  1F40 A;  4ODR A;  2XP5 A;  5GPR A;  4TX0 A;  2LPV A;  3CHF A;  4ODQ A;  1X6L A;  3B9E A;  1P5Q A;  4DRN A;  1OWQ A;  1E6R A;  1K9T A;  1TFV A;  4TW7 A;  3O5G A;  4W9Q A;  4ZPT R;  3G6M A;  4JFI A;  3KAF A;  4PTM A;  2DSU A;  3WQW A;  4Q7N A;  2DSV A;  1W1P A;  2JZV A;  1W1Y A;  2IF4 A;  2PPP A;  1J4R A;  4IT4 A;  1ROU A;  2DG3 A;  2XPB A;  4JYS A;  4TNS A;  1H0G A;  4ODM A;  4ZPV R;  2KGJ A;  1HKI A;  3WD1 A;  2WK2 A;  4U85 A;  2WLY A;  2G8Z A;  3RM8 A;  3TC5 A;  4MAV A;  3ARX A;  3AS2 A;  2OLH A;  1J6Y A;  4WKA A;  4DIP A;  1X6N A;  1W9P A;  5HW7 A;  2ZR6 A;  1W9U A;  2XP8 A;  4LAV A;  3ARW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...