1SR0A

Crystal structure of signalling protein from sheep(sps-40) at 3.0a resolution using crystal grown in the presence of polysaccharides
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords signal processing protein
publication title Crystal structure of signalling protein from sheep(SPS-40) at 3.0A resolution using crystal grown in the presence of polysaccharides
rcsb
source organism Ovis aries
total genus 116
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1sr0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1sr0A01
2WCGA 2CPUA 3AHXA 4Z2LA 2PWEA 4OKDA 5ABHA 1PIFA 4A3YA 4DUVA 2ZUWA 4HOWA 3WDPP 4F8XA 5IXEA 3E1F1 3M46A 7A3HA 1XCXA 1XRVA 4K68A 3B8SA 5DF0A 2ZOXA 3ZJ6A 1E6NA 3CZLA 5IFTA 1UKOA 3VM5A 4YHEA 4AC1X 4FLRA 4JFUA 1PIGA 1H2JA 1WDRA 4Z2GA 3AXXA 4AZHA 4ZFMA 2VVNA 3BLPX 1CXIA 4F79A 1W9PA 4BS0A 1E4LA 1B31A 3AI0A 5DT7A 1NWSA 1R86A 2C7FA 2XTKA 5CJ5A 5BRQA 4GO9A 4UNIA 5I0DA 1QVBA 1V0KA 2JE8A 4V2XA 3VNZA 4D6IA 4W5UA 4EAMA 3AIQA 3II1A 5BXRA 1CENA 2DT2A 3KL3A 3A6OA 2WVTA 2V3FA 1XV8A 2XPKA 2BVTA 3HU7A 4D6HA 2OYMA 2WBKA 3GXDA 5ABEA 4E2OA 4W7UA 1LWHA 5A6BA 1TMQA 4AMCA 1QHPA 2WVVA 2YDSA 4JL1A 1E6PA 1HVXA 4QLKA 4IUGA 2ZX9A 2WCAA 1QW8A 3CUJA 1UHVA 3GNOA 3UESA 1K9FA 1Q6GA 3W38A 2WXDM 4W8LA 1QI2A 4H8VA 2V3GA 2X8RA 3CH9A 1VAHA 2E9LA 1YQ2A 4LYQA 1JYVA 5LYRA 3HJEA 2CESA 2HISA 4PEEA 2NSXA 3PTQA 4AZGA 1MVYA 1NOWA 1UD6A 1HKMA 2PF0A 1BVNP 2VZTA 8A3HA 1XC6A 2J79A 3L4VA 1VEPA 3VIJA 1WKYA 1D3CA 1UD8A 1CGUA 3BMWA 1XYFA 4PMOA 5ABFA 1DWAM 3WD3A 2GK1A 1JF5A 3N1AA 3TTYA 1GJWA 4YN5A 3W4RA 1C93A 3T0AA 4JKKA 1QW9A 2XVPA 4Z2JA 1XSIA 1HF6A 4AISA 1B3WA 4JL2A 5HBFA 5M3WA 5A6KA 4LYPA 3WF4A 1PBGA 4OIFA 3APGA 3CHDA 1XCWA 1GOMA 1OGBA 5I77A 1XH2A 2WW5A 4NRSA 1WE5A 3EDKA 3FN9A 4D6JA 2Y5EA 3ZT6A 2W4XA 4KMQA 3WKZA 1W2PA 2OWWA 1IT0A 1C90A 3OZOA 3EYPA 1JYXA 2XHYA 4CKQA 1UR9A 4ATDA 8CGTA 4WK9A 3PN8A 1WNOA 1W9DM 2WKLA 1LG2A 1ISZA 3MUIA 3AS1A 2NT1A 2Z1KA 1XH0A 3BMVA 3TTQA 2XIIA 3PZIA 5ABGA 4JIEA 3AISA 1C92A 3RCNA 2FHFA 4P7LA 4QAWA 5A6JA 3WFLA 1ECEA 1MQRA 3K46A 1UR1A 1V3KA 1TA3B 4H8UA 1VFMA 1KGUA 3N12A 5CPQA 1JZ7A 2QV4A 4ML4A 4QCEA 4XZWA 1HN1A 3ZJ8A 4R27A 1AVAA 4B15A 3UR7A 5CSUA 1UR0A 4P8XA 3ZR6A 1UKTA 1H0GA 4JAWA 4UQCA 3OBAA 3AYSA 1E40A 2WWCA 4JFWA 3PZ9A 1OGGA 1NQ6A 1EH9A 1R85A 4ATWA 4BZYA 1JD9A 1EOMA 3ZSSA 4C7GA 5GPRA 2GSJA 3N13A 4U5IA 4P7OA 1UG6A 2NW0A 1E6QM 2IXUA 2VQTA 4JCLA 2FHBA 1KXTA 1MW2A 4B9YA 2XVKA 3GNRA 3LMYA 5I23A 1ISVA 1GQKA 1CGYA 1XGZA 4DUXA 1W3JA 3RJXA 3CLWA 1XH1A 5CQ1A 1G94A 2JIWA 3QHOA 3RMEA 4M24A 5LA0A 4H41A 3SCWA 1VEMA 1V0NA 1P6WA 4C7FA 3JUGA 4N0RA 1S46A 4AD2A 3ZJKA 1BYAA 2WHLA 5CSYA 3WF0A 3OGRA 1J12A 2FH6A 2WZIA 3ARVA 4M56A 2OSYA 5D9NA 3WUGA 4Y7EA 3VILA 1J01A 3VGEA 5BCAA 3BLKA 4URIA 3WH5A 2GJPA 3AMKA 1OT2A 1K9TA 3GXFA 3AS3A 2AOSA 1WDQA 1JL8A 5A8QA 2WAGA 3WUBA 3SUUA 3CUGA 4TVUA 2WANA 2VT0A 4OBRA 3WELA 4W85A 3DECA 1E70M 4RE4A 2GVYA 3N9KA 3TTSA 4KRUA 1EOKA 2UY4A 5C70A 1BG9A 2V3DA 1LWJA 4AYSA 3VGGA 4PTWA 1C8YA 2VCAA 1JG9A 1FFQA 1ZBKA 4MB4A 2GJRA 3T08A 1UD4A 1I75A 2BVDA 3LPGA 1BYDA 3PZMA 4ZXLA 1UQYA 1JZ5A 2ZICA 1WDPA 4UFKA 2XGBA 1JI2A 1I1XA 1DWIM 1NOUA 1M04A 1E72M 3VVGA 1F4AA 1H49A 5F7UA 1JFXA 2WVSA 3WENA 3WDQA 1WP6A 2ZWZA 3EMQA 1A47A 1CLVA 5DFAA 2D0GA 1R87A 2W5FA 3SIMA 4MJ2A 3W25A 4AIUA 4W84A 5CGTA 3VUPA 4FMVA 2J7GA 3AJ7A 1KWKA 4DWSB 1KQZA 4TVCA 2J7EA 2VX4A 1BLIA 3EBVA 3VMOA 1KQYA 1C3FA 3QR3A 2VZOA 3MO4A 4TXEA 2DDXA 4PMUA 4MNMA 4W7VA 4CU8A 5AY7A 1E1FA 1JZ4A 1VRXA 2VC9A 4LQ1A 4TOQA 2ZX8A 2PWDA 1GONA 4FF5A 3VO0A 5A2CA 2DSVA 3SUTA 1K9DA 1NP2A 2IXVA 2W67A 3WD0A 1DHKA 1R8LA 3VIKA 2BY3A 2D24A 4YPJA 4WKAA 4CCCA 1TA3A 5AYBA 4W87A 4MADA 1W9XA 3WEMA 4PYSA 1CYGA 1WO2A 1UD5A 1WPCA 3AIWA 3VIHA 1XD1A 1RP8A 1PZ3A 1UZ1A 1US2A 1UUQA 3GTNA 3ZQ9A 3SCSA 3W26A 2G3JA 5LA2A 4CVWA 2ZWYA 2JIEA 5D9OA 4UFJA 3ALGA 1BQCA 2GK1B 1KB3A 5JIPA 1Q4NX 3NSMA 3W82A 2G3IA 2J8FA 4HZ8A 4J3WA 1PJ9A 2YL8A 4H8HA 4CU7A 5FD0A 1HJWA 3K8KA 4U2YA 5GNZA 3HN3A 4JFVA 4MAZA 2J47A 3L4WA 1E56A 1GZJA 2CYGA 2IUZA 3VINA 3CMJA 2F8QA 1UR4A 5A8PA 2PI6A 2WHKA 4IISA 4AD4A 2WSKA 3WBEA 3VDAA 3K4AA 2YIHA 3BAKA 3L4ZA 4JFTA 4J3XA 4PMQA 3WNKA 3MKKA 1AMYA 1R7OA 4AD0A 3BH4A 3N11A 3WF1A 1BG4A 1FA2A 1CPUA 4U2ZA 1CDGA 3BSGA 3VIOA 5HDRA 2WM0A 2G41A 4OOUA 1M03A 1GQIA 2XFYA 4CVUA 4FK9A 1RD6A 4BF7A 1FH9A 4MB3A 3AQUA 4J3SA 4V27A 3CPUA 3WQ6A 1KXHA 1VJZA 3S2CA 1JDDA 4Z2KA 1E43A 2VQUA 4TTUA 3CZEA 1FFRA 3ARYA 1OWQA 2YOCA 4QP0A 1E5JA 2BY0A 2UY3A 4M81A 4CD8A 2BNJA 2BY1A 3VD5A 4AWEA 2VNCA 3AIUA 1G01A 2E4TA 1TR1A 2J74A 5BRPA 5BROA 3OGSA 4CD7A 4W86A 4X9YA 4EKJA 4MTVA 4J27A 2BXZA 1UH3A 2VJXA 3N15A 4D6CA 4GIAA 2WSPA 3VDBA 4PTVA 5E6ZA 1GCYA 1SFSA 3B9DA 5CZKA 5CGMA 2D2OA 2EXOA 4AD3A 1VFUA 4JKLA 1BGAA 4L4PA 3NSNA 4WSJA 1JD7A 4J3VA 5JH8A 3UG5A 2PB1A 2VRKA 1EHNA 3AOFA 3BAYA 1UWIA 3VIMA 4GXPA 1E55A 4M8UA 2WVUA 1W1TA 4UZUA 1ZB5A 5D8ZA 4CUCA 2VRQA 3FW6A 4IM4A 2EPNA 2EPLX 2X0HA 3W37A 2F61A 1UWSA 1V3IA 3BAJA 3L4UA 1J0KA 1JFHA 2WHMA 4H2CA 3BAWA 3ZSTA 2D1ZA 2ZIDA 3CTTA 5FKYA 2V5DA 1J0ZA 2A3CA 2BS9A 3RJYA 3VGBA 1AQHA 4CU6A 4DWSA 1E4MM 4ZEPA 1Q6DA 1NWTA 2OWXA 2ZXBA 4KGJA 1UQZA 3NDZA 3PZGA 1Q6FA 4JZ5A 2BHYA 3DYOA 3VGDA 1M7XA 1MQPA 1UWQA 1ZBWA 2VX5A 2F2HA 4UR9A 3OLIA 1VJSA 2RGMA 1JZ8A 4KWUA 1QNPA 1KGWA 5CLTA 4DUWA 1JDAA 1X6LA 3WDIA 2J78A 4PUDA 2C8NA 1Q6EA 2WPGA 4PBGA 5FCZA 3L4TA 3TTOA 2E3ZA 3AXHA 4M82A 4UFLA 2XSBA 2BFGA 3L2MA 4HMEA 3T2OA 1V6WA 3FHAA 5A6BD 2D0HA 1CNVA 1J11A 5GNXA 5EB8A 2ZUUA 2E40A 1X6NA 1CXKA 5A69A 1E4IA 1XSJA 2X09A 1E0WA 5IFPA 3D5HA 2WMGA 1PEZA 1HKIA 2EO7A 1TE1A 1MW1A 2JEPA 3BXWA 2EQDA 5I6SA 1QBAA 3WL1A 1BFNA 2E9MA 2XWEA 1J9YA 3KWXA 4D6DA 5DMYA 4OJYA 2XJ7A 4BQ2A 5IDIA 1L0PA 3VNYA 2QMJA 1H1NA 2WZHA 2O9RA 3RIKA 3VU2A 3D3AA 2DT1A 4U33A 1M01A 3SCPA 3O2LA 3WNMA 4WF7A 4QCFA 2WMHA 1BGGA 3N04A 1W9BM 2WMJA 1W1YA 1G9HA 3SCVA 4HU0A 4HPGA 4UTFA 3B9AA 2ZXDA 2ZUNA 3FY1A 3OB8A 2ZUSA 3ARPA 2D0FA 3WD1A 3ECQA 3VD7A 2WZEA 1US3A 3ARWA 4XZBA 4UQBA 2GJXB 2UWFA 2VR4A 4A4AA 4MB5A 1JAKA 3L4YA 1NOFA 3W24A 1W3HA 3IK2A 3MV01 2ZUVA 3WDJA 4V28A 4GZEA 4PCTA 5C71A 3MMDA 1ZJAA 1MW3A 3RILA 1JXJA 3G6LA 2ZUTA 3WD4A 4JHOA 2YKKA 4AZCA 3OG2A 1CTNA 4Q7NA 3QHMA 1ODUA 3WQ4A 3OA5A 3FAWA 1ESWA 1VBRA 1PX4A 1J0IA 4MNLA 1BVZA 2YDRA 2V38A 4GI9A 4AD1A 4WJXA 5A2BA 2EPKX 5A2AA 4OZOA 3VD3A 1BSIA 5FL1A 2DQXA 4JFSA 3WH9A 2YA0A 3M7SA 4UQDA 2OWCA 4PMZA 1GOWA 5E0CA 1EO5A 2B31A 1UA3A 3AZRA 3WQ5A 4BCEA 1SMDA 1BF2A 1FP8A 3AHYA 1VFOA 1ISYA 1E6XM 1DWHM 2FDMA 3VIPA 4UZSA 1W9VA 1A3HA 1KXVA 2Y2WA 3UEQA 1QNRA 3ZT7A 3CUFA 5M5DA 1HP4A 3WMCA 5JBEA 1AQ0A 5D8WA 3MUY1 3WDRA 2UY2A 3DHPA 4ACYA 4S3KA 1OINA 2RGLA 4HTYA 5DO8A 3CHFA 4TX6A 2DSUA 4ATLA 2PWFA 1CZ1A 3IAPA 4YHGA 1CECA 2WC4A 3F5LA 1SYTA 1UKSA 3SUVA 1UA7A 5E09A 4F66A 3T2PA 4QLJA 4J7RA 1H5VA 2E0PA 2WB5A 1EDTA 1MXGA 2BHZA 3NIYA 4D1IA 1V3HA 3MSDA 3S6TA 3MMWA 3ZIZA 1VEOA 4D6GA 2XVGA 5AYIA 1B90A 2J8GA 2DSKA 4ZXOA 4W5ZA 3WNLA 3A3HA 2WNWA 3ZJ7A 4WIWA 1GHRA 2GDVA 1C91A 1CIUA 1B1YA 3NCOA 4CCDA 1TVNA 2VCCA 4R5EA 3HMCA 4D1JA 2OLHA 1EGZA 1E6ZA 3GYCA 4GKLA 4WLCA 2YLLA 3CMGA 3VGHA 3OLGA 4F9JA 1JNEA 2Y4SA 2FGLA 4CGTA 3WEZA 3VMNA 1CGXA 1OD8A 1KXQA 4B16A 1UZ4A 3PZQA 5M17A 1V6XA 1ISWA 2WC3A 1WB0A 1V3MA 2GUYA 3GDBA 5D9MA 2CETA 2JF7A 5CPTA 2WMFA 1JAEA 1UD2A 1M53A 2CKRA 2BXYA 4CCEA 1HJSA 4QDMA 4B3KA 4P7QA 4AD5A 1GQLA 1H3GA 3W0KA 3MV11 1B3ZA 3VDHA 2VX7A 2Z1SA 2QLYA 1IZJA 5C8BB 4UFHA 3GNPA 3AHVA 4XUYA 2CBIA 1E3XA 4L4OA 2VMFA 4D6FA 5A6SA 2DT0A 4H7VA 4WKFA 4BQ4A 2O9PA 1ZBCA 1L8NA 4PTMA 4XB3A 3U7VA 3DHUA 1LF1A 4IPLA 2D20A 2EBNA 1CGTA 3AIRA 1GOIA 1JYWA 1TCMA 3AS2A 1E71M 4UOQA 4DWSC 4RL3A 5HPCA 4MNJA 3GH4A 4Z2IA 4NSBA 3VPLA 5I3DA 3GBDA 3BGAA 1LQ0A 2A3AA 2VOTA 3CBWA 4LXFA 2FGZA 1BTCA 2GJXA 3WUFA 2J25A 3T0BA 1EDGA 4W7WA 1K9EA 4GO8A 3GM8A 4HPHA 1JZ2A 4TUFA 4AZ5A 3PTMA 1W3KA 3PZOA 4DM2A 1LL4A 2D3LA 1HNYA 2XVNA 2ZX5A 3THDA 2VRJA 2YA1A 4D6EA 5EFFA 2WBGA 4B3LA 3ARRA 2XVLA 1IZKA 2JF6A 1JF6A 4PUEA 4ZENA 1BPLB 1HL9A 2X0YA 3ALFA 4AEFA 5A1AA 1WAWA 3VIGA 2CHNA 1C7SA 3ZT5A 1V03A 2QMKA 3GH7A 3CZKA 2X05A 3QOMA 4EE9A 2C0HA 3CHEA 4JHZA 1E6RA 5I79A 1CGWA 5CPSA 3WEOA 5A8NA 5TD4A 4MJ4A 3WH8A 3WD2A 1OT1A 1KBBA 4PMXA 3BSHA 1NP0A 4UOJA 1HX0A 1JNDA 5AC5A 1SR0A 2ZE0A 1LL6A 1GOKA 1ITCA 4XX6A 1DWFM 3VX0A 1QNOA 2G4FA 1Q6CA 5JIWA 4EANA 1KCLA 3IAQA 1FHDA 3W29A 1V02E 1OIMA 5ECUA 2WC7A 4PSPA 3VOCA 3AMGA 7CGTA 1OSEA 1VB9A 2J77A 4GZJA 3EDFA 4ACZB 1EO7A 1QHZA 2Y8VA 3ARQA 2AMGA 3EDDA 4PMDA 2X1IA 4KRTA 3IANA 3WBAA 2VL4A 4M1RA 2WKGA 3MMUA 1UR2A 3WNPA 1CXLA 1E73M 1TFVA 2E9BA 1V0MA 3KZSA 2J62A 2ZX7A 2PBOA 2WLYA 3PHAA 4FLSA 3T09A 2CEQA 4UCFA 4JKMA 3MUAA 4HOZA 5I2UA 5IHSA 1E1EA 4AZCB 1OB0A 4F9DA 2DGAA 3AIBA 1QNSA 4AIOA 3LPPA 3BAIA 2CXGA 1SMAA 3MSGA 3PZUA 4TX8A 4JCMA 4CN6A 3F4VA 1C7TA 1JGIA 3PZNA 1FH8A 4W89A 3GH5A 4J28A 3NDYA 5EMYA 1TVPA 3OIHA 2XUCA 1GORA 2G3MA 3MUZ1 4NRRA 2Y24A 4HZ6A 4AXNA 1BYBA 1EIBA 1NWUA 3ARZA 2XWDA 1DWGM 1VFFA 4UFMA 1UKQA 2J7BA 1E3ZA 1RPKA 1U2YA 4KH2A 3AMLA 3I3DA 3OLDA 4J3UA 3ARXA 3TA9A 1E0VA 1V02A 3AYRA 3FNDA 4X0VA 2DT3A 1OD0A 3ZMRA 3IJ7A 4PTXA 5CXPA 1E6SM 1QI3A 1GNXA 2D23A 4CN1A 1Z32X 3LPFA 1JZ3A 2W91A 1NM9A 1D7FA 1E0XA 1MFUA 1KR1A 4LGXA 4GPNA 3OGVA 5CLWA 2GDUA 4BQ5A 2ZXAA 4AY1A 5FL0A 5A3HA 1HJXA 1GQJA 4MNKA 1CBGA 1HJQA 3NUKA 2X2YA 3SCUA 3ZO9A 3KE0A 3GXMA 3W53A 1LG1A 4E4PA 5E9AA 3F5KA 1V08A 1GPFA 1J0YA 2ZXQA 2YL5A 4NI3A 3VKKA 3A4AA 2EEXA 2VURA 4XV0A 1VENA 4AIEA 1KGXA 1CEOA 1LL7A 1PAMA 3K8MA 2DPEA 2WMIB 5A94A 5HOSA 2XIBA 1ZL1A 3KEHA 4DWSD 1J0JA 4MDPA 2WHJA 2YLAA 4HMCA 2YL6A 4HA3A 2WLZA 3A4WA 4HMDA 3AHZA 2XSAA 2DEPA 3TP4A 3WY1A 2YBTA 1XD0A 1KBKA 5BXTA 3AROA 5GQBA 3ZR5A 2DIEA 3QGVA 2QPSA 4AZ7A 4GINA 4H04A 1OM0A 2XYLA 4MPKA 2CKSA 3O9NA 1GOOA 2AAAA 4MAVA 4ZE5A 2CITA 1JXKA 1WCGA 1W3LA 5E0FA 1B2YA 2GFTA 1IV8A 3WQVA 4P7NA 3SCRA 1E9LA 3EDJA 3CHCA 3RM4A 3CUIA 3A4XA 3AHTA 2JFEX 3U7BA 3CGTA 3FAXA 1BHGA 4QFUA 4OOZA 2DSZA 2XM2A 4OBSA 1QI5A 1UWTA 1UYQA 1PX8A 3T2QA 4N42A 5EBAA 1HJVA 1R7AA 3CO4A 3BAXA 1GVIA 3SCNA 3SUWA 4ACZA 4IPNB 1GW1A 3SCTA 3VTRA 5A6LA 2V3EA 2QF8A 1HJUA 1AQMA 1PPIA 1TUXA 4CD6A 1B30A 1I1WA 4LYRA 1W91A 3KL5A 3OLEA 1JYNA 1H11A 2VUYA 2DH2A 3WQ8A 1MYRA 4P8WA 3TONA 3NYDA 4D72A 3I3EA 1KFWA 1G1YA 3UG4A 1OIFA 2VO5A 2CBJA 1H41A 1CWYA 5IHRA 1NH6A 2YJQA 4UQ9A 4GI6A 1HKKA 3RO8A 3WNOA 1HP5A 4KGLA 1G5AA 4NZCA 3NSXA 6CGTA 5I24A 2VCBA 3WQWA 1CXEA 2CNCA 1W9UA 3UCQA 1E4NA 2BV9A 3VIIA 1O6IA 2A3EA 3PZTA 4W93A 2PBGA 1DTUA 1J18A 2XM1A 3ARTA 4PN2A 2CBUA 3VD4A 3ARSA 3VDCA 3F5JA 2VR5A 1ISXA 1WDSA 2JEQA 3PZVA 4LX4A 4CD5A 1B3YA 3NJ3A 2EPMX 3K8LA 1ITXA 1MFVA 1QI4A 4OUEA 4PMRA 1O7AA 1FHLA 3O6AA 4BA0A 4UQAA 3M6DA 3WF2A 1UWUA 3AZSA 2WYSA 5JBDA 5LA1A 3BCDA 3M07A 4WSKA 2BY2A 1D2KA 1FOBA 4D71A 3N17A 1VF8A 5BXPA 3AMDA 1MQQA 3QHNA 1H0IA 2MANA 4J3TA 3W6MA 1N82A 4X0NA 1MXDA 1QOXA 2DH3A 1CLXA 1MWOA 1UD3A 2DIJA 2JALA 4RE3A 2UY5A 1F4HA 3KL0A 1QPKA 3AIVA 1ZJBA 3GZAA 1YHTA 1JDCA 4AZBA 3QOKA 3POCA 2VZUA 5FIPA 3VM7A 1E5NA 5A8MA 1G0CA 1DP0A 1U30A 1QNQA 3EMZA 3CZGA 2G3NA 3AFBA 2W92A 1GJUA 2WCSA 1FH7A 5HPOA 1W1VA 4A3HA 2J7HA 4W8AA 3EMCA 3SCOA 2XGIA 2BHUA 5GNYA 1U33A 1HT6A 3L2LA 5KZ6A 2J7DA 2Y8KA 1W2VA 2OSWA 3VD9A 1V0LA 2Q8XA 1X1NA 4TVDA 2WMIA 2D22A 1C8QA 2XFFA 1EDQA 4U3AA 3CZ8A 2J7FA 5A8OA 6A3HA 1UOKA 4AEEA 5EFDA 2E8YA 5A6MA 4Z2HA 1OBAA 3G6MA 1TZ7A 4AZIA 5HNNA 2EPOA 1H4PA 2ESCA 4Q22A 2CERA 2A3BA 4B9ZA 2W61A 1ZU8A 1QHOA 4HP5A 4PMNA 4GQRA 3U5UA 7TAAA 1EA9C 4U31A 3SCQA 3U5YA 4C7DA 4GZIA 4PMVA 1KWGA 2O9TA 5E6YA 3BCFA 2PC8A 3WNNA 3FHQA 4CN4A 4FLQA 4S3JA 1B3XA 2WWDA 1WZLA 4E8DA 4DM1A 5KEZA 1BYCA 1KR0A 2W63A 3UETA 1HXJA 4FLOA 3B9EA 3RPMA 2G8ZA 1GOQA 4AW7A 1WZKA 5JBFA 2O9OA 4ZE4A 3AIEA 3MANA 1JIBA 1C8XA 1NWRA 1HKJA 4NF7A 3WF3A 3WSUA 1WZMA 2FH8A 2D3NA 3RM9A 3PTKA 1V6UA 4TTGA 1VIWA 3J7HA 4P7RA 3WDHA 3K1DA 4E8CA 1FP9A 1DEDA 2YA2A 4P8UA 3W27A 3RM8A 3VX1A 1MW0A 4BQ3A 1RP9A 2YDQA 3EDEA 5E70A 1UKPA 1XHGA 3AS0A 3W81A 3PBGA 1ZS2A 3WL0A 1V3JA 1V6YA 1WZAA 4MDOA 9CGTA 1GHSA 6TAAA 1PZ2A 1PX3A 1QI0A 3W6LA 4HA4A 1CXHA 3AMCA 1TG7A 5DEZA 4GQQA 3W28A 3DYMA 3L4XA 4W8BA 1CXFA 5DT5A 3WH7A 5A6AA 2WVVB 2BVYA 3UERA 1EQCA 4UFIA 1ODZA 3CZJA 5CG0A 1J0HA 4RE2A 5BXSA 5M03A 3MU7A 1W32A 3AZTA 1V3LA 1B0IA 1K6AA 1HIZA 3FXYA 3UR8A 3ARUA 2O92A 2W66A 2YBUA 2E8ZA 3IJ8A 3SUSA 2ZUMA 3WFZA 2VX6A 1UWRA 2OYLA 4M80A 4U5KA 3N18A 2CCRA 1EQPA 3U57A 3K4DA 5I5RA 3UG3A 2NT0A 2QPUA 4WKHA 1CGVA 1OCQA 5HXMA 5ABFB 1NARA 4CD4A 2EJ1A 1XYZA 1EXPA 3WMSA 4U3CA 5I78A 3VMPA 1E15A 1KCKA 4AZ6A 1BAGA 4HZ7A 1LLOA 3GXIA 4UOZA 3SURA 4QLLA 1B3VA 3THCA 2XFRA 3WMBA 4PRWA 3MS8A 1GUVA 1JI1A 2VVSA 5D9PA 2V5CA 1H09A 4UQEA 2PWHA 1XSKA 3OZPA 3AXIA 4LPCA 3ZOAA 2W62A 2WMKA 1OGSA 2A3HA 5FOOA 3LPOA 1UH2A 2VZSA 2J75A 2QHAA 1QBBA 2ZX6A 4EK7A 4HA1A 3WUEA 3A47A 1VBUA 1Y7VA 2XG9A 2VI0A 3IJ9A 5D4YA 1W1PA 4PCSA 1B9ZA 4PSRA 1EHAA 4HOXA 3TOPA 3SEPA 2CIPA 5BWFA 2J7CA 2WK2A 4PMYA 3WN6A 3VIFA 3AICA 2VZVA 2CBVA 4P8VA 2HVMA 2PWGA 3DC0A 3WH6A 5AC4A 1JZ6A 1HL8A 3I3BA 4HU8A 2OSXA 3GBEA 4M29A 3POHA 3WIJA 3BC9A 2YL9A 2FHCA 5A95A 3VGFA 1DWJM 2TAAA 5JUVA 3CIVA 3ZM8A 3T0DA 2CHOA 1ZBVA 3CUHA 2J4GA 3DYPA 2DSWA 1LJYA 1J10A 1UH4A 5BYWA 1UR8A 1RH9A 1GVYA 4W88A 4MB1A 1HVQA 1V6VA 4GI8A 2OYKA 3RDKA 2VTFA
chains in the Genus database with same CATH superfamily
2WCGA 2EAWA 2PWEA 5DQPA 4HOWA 1I0DA 5FJUA 3WDPP 4F8XA 3NL6A 5D2TA 1Q13A 3H4WA 5DF0A 2ZOXA 3UQNA 1IX5A 3G1FA 4F0KA 1UKOA 2PDJA 4JFUA 2FKEA 4GOAA 1KA9F 3I4EA 1H2JA 2CZ5A 4DXKA 1TR9A 3AXXA 1W3IA 2VVNA 4ERIA 3UWQA 4F79A 4DH0A 3KLLA 4IP4A 3QQWA 3QV8A 1JCLA 1B31A 3AI0A 1TV7A 1ME7A 3CLMA 5DT7A 1R86A 3DGBA 4IPPA 5I0DA 3LY0A 1NFGA 2JE8A 3PANA 5BXRA 5I00A 2DT2A 1UP0A 3A6OA 2VGFA 1XV8A 2BVTA 4LANA 4IPXA 3GXDA 2WBKA 1H7WA 2LPVA 3GTHA 5ABEA 4MMWA 1LWHA 4RPQA 3EOUA 2QCDB 4GISA 4RLIA 3VCNA 3CIWA 1TMQA 4AMCA 4JL1A 2YDSA 4IL2A 2ZX9A 2WCAA 4NZ5A 1D8WA 1QMLA 3S9ZA 4H6QA 3CUJA 1UHVA 3M41A 1GTHA 3C52A 2XH0A 5KSWA 1Q6GA 2FZNA 4RE0A 4W8LA 3QN3A 3KZPA 3P84A 3NR0A 1JYVA 2OX1A 4AZGA 1PYFA 1MVYA 2OKOA 3QFWA 3VNJA 2PRLA 3GY1A 4YS1A 4LBSA 4JXCA 1TPUA 1VEPA 1XKJA 3CHVA 2OZTA 2YCLB 1HTIA 3E3HA 4ILSA 2ZRVA 2Z7GA 5ABFA 4QG8A 3WD3A 3N1AA 4ZOBA 1GJWA 2OB3A 4NG3A 1C93A 3RMJA 3T0AA 3THUA 1XRFA 3R8HA 4HSNA 3HFTA 4RCXA 3TH6A 1XSIA 1MNZA 3A5VA 2V6AA 4JL2A 5HBFA 1ZAJA 5JMUA 4ZQOA 4MY1A 4OIFA 3APGA 5FF0A 4GY1A 1IR2A 3GK0A 1OGBA 3ME3A 3EOOA 1TWZA 4C5YA 1HKVA 2WW5A 4XAZA 3BOXA 2Y5EA 3BPWA 4ZB5A 3VE9A 4KMQA 4I9JA 1JYXA 2V9DA 4CKQA 1YLVA 4HU4A 1JDEA 4ATDA 3FAPA 2WSQA 3NWRA 1X97A 4O1CA 3GVQA 3FYOA 2GGEA 3HG5A 2PU0A 1IGSA 4Z1AA 2ZE3A 1AFSA 3K30A 2OCZA 3HPXA 1TPC1 1L6WA 3AISA 3RCNA 2FHFA 2CWNA 3W1UA 5GJPA 3USBA 3WFLA 4L3NA 4M7SA 4IQCA 2J27A 2FPTA 4H8UA 5AZ1A 1VFMA 2H8XA 2Y1HA 5CPQA 4HYVA 4ML4A 4KS0A 3QV7A 3MC5A 1AVAA 3GFZA 4QITA 4JAWA 3GU2A 4L7ZA 1E40A 2A79A 3F4DA 4HT3A 3G24A 1W5PA 4JTHA 4JYFA 1EH9A 4ATWA 1JD9A 6TIMA 3K4WA 3ZLGA 4Z1CA 3FX4A 4U5IA 4P7OA 1XBVA 1UG6A 3UA4A 3MVTA 3VDGA 2ZRZA 4JYEA 1V5XA 4GHRA 4B9YA 4UTTA 2XVKA 1N55A 5I23A 1CGYA 3I7QA 3M0HA 4DUXA 3RJXA 3VYLA 3P0XA 4MWAD 3U3HA 1KNWA 3HBLA 4C6NA 1G94A 1MO0A 2ISWA 4N02A 3TW7A 3ZWSA 1ICSA 1F8AB 4H41A 3VFCA 4QZVB 4K8HA 3N9SA 3TTEA 3KOFA 1R0MA 4AD2A 1VYSX 2ONEA 4LAWA 4EF9A 1KC7A 1WDDA 2ACUA 2OSYA 5D9NA 4UMBA 4IT1A 3B4UA 3LUOA 5HUAA 4G1NA 3EWZA 3TC3A 5FEWA 3WH5A 3AMKA 4V15A 5PTDA 1OT2A 4M51A 3AS3A 1AH3A 1DXEA 4IJBA 4HK5A 4M5PA 1XLHA 1LLWA 3KXQA 4EPDC 1R46A 1OFRA 1RR2A 2YCKX 2BODX 4FR6A 3IJQA 2VT0A 3GW0A 4OBRA 4CLMA 4JNZA 2UZ9A 1YDOA 4L4LA 4GWEA 3S2JA 4RE4A 1RZMA 2GVYA 4O4WA 2Y85A 3S1GA 1EOKA 1R3SA 2PDLA 1BG9A 2CLMA 5HA7A 4MZYA 1SFLA 4FB7A 4QBXA 1FKRA 4O13A 4GJJA 4KIEA 3IIVA 1FFQA 4FHAA 1XICA 1ZBKA 4DIAA 2NUXA 1NY1A 4N7QA 3LQLA 4JNYA 3PPFA 1TRDA 1XLCA 2WJDA 3DI0A 3W83A 3DUGA 4CQDA 3TAOA 2BVDA 3LPGA 3MA8A 4A05A 1UQYA 1KLZA 1PBKA 4HYRA 2PPNA 4IIHA 1NOUA 3USZA 1TV5A 4YWSA 3W7IA 5F7UA 3WENA 1AG1O 2ZWZA 4LVAA 3LDVA 1CLVA 4G5DA 1R87A 1R3VA 4GK8A 1OJXA 3W25A 4AIUA 1IXOA 5CGTA 4KRZA 4YTRA 2J7GA 1X6UA 4NAFB 2VX4A 1BLIA 4HBEA 1XKYA 5BZAA 1Q45A 3IS4A 3AU6A 3QSRA 2GVJA 2CLPA 4TXEA 1OYAA 5KZDA 2VGBA 4MNMA 2I17A 2NUWA 1VRXA 2NQZA 4LC8A 4QIUA 4ERAA 4Z42C 2IF4A 3WD0A 4EWJA 4G9PA 3E2VA 3W1LA 1BKFA 3O5LA 4CNUA 2D24A 3URBA 4YPJA 1AD1A 4CCCA 5CAKA 3GNNA 4Q3MA 2QJIA 4Y96A 4J3ZA 1XDJA 1F5ZA 3AXKA 2ZDSA 1WPCA 2ZZ6A 3NL5A 3UJ2A 4UDMA 2ZZ7A 4JYSA 3H2NA 1Z9AA 2Z0IA 4JTFA 4E2BA 1P5QA 2JIEA 1FKSA 4ES4A 1WOAA 5D9OA 3CT2A 1BQCA 1KB3A 5C2XA 3MDWA 2VC6A 5JIPA 3LLDA 2E68A 3EB3A 2YL8A 4Q8PA 4I5RA 2PEVA 2JKEA 4MAZA 1R9YA 1E56A 1XFCA 2B7PA 4GQGA 5LNWA 2OTDA 3VINA 4G56A 3KBWA 1O5QA 3DBPA 1DVJA 3WLJA 3VDAA 4UTJA 3RGTA 2YIHA 4M7TA 4JFTA 4J3XA 4PMQA 1C9WA 4LS1A 3WBWA 2Y0FA 4JIHA 2PZNA 1TUFA 4DVOA 4AD0A 5G4EA 3WF1A 4DZIA 4U2ZA 3TYCA 5HDRA 2G4JA 3L68A 1M03A 3KM8A 2WO5A 4FK9A 1Q7MA 5GJMA 3GPKA 4TW7A 1EJ7L 1XLEA 4MB3A 3AQUA 4J3SA 4UTIA 1M7JA 3A13A 2VEIA 3WQ6A 2XINA 1VJZA 3S2CA 2AQOA 2CHRA 3MBFA 3NO1A 3RUBL 3VKBA 1E43A 5C9RA 4MGGA 4QP0A 1FFRA 1F9CA 2OFNA 1HKWA 1MUMA 2BNJA 2VNCA 2VEMA 3RF9A 3E2SA 3O5IA 4D8LA 4LUJA 3STEA 2PU1A 4AUBA 3LRKA 3OGSA 5F4XA 3O3RA 2P4VA 2Z1VA 4X9YA 4EKJA 1OX5A 1MMFA 1Q2RA 2DZTA 3Q58A 2VKZG 4GUIA 1PZ1A 4WX2A 3VDBA 2I56A 4YTSA 1J5TA 2E28A 2D2OA 5EA9A 3LCHA 4G50A 3UI5A 2PP0A 4LS2A 4GYKA 1VFUA 2BZNA 1XYBA 3NFUA 1F73A 4JKLA 3H54A 4H3DA 4WSJA 2OGYA 4J3VA 3RCMA 4Q7BA 2QCFA 1H1YA 1EHNA 3M5VA 4DZAA 3BAYA 4RDZA 2KAUC 3T0TA 1UWIA 4V33A 2WVUA 1RBOB 1W1TA 2RKXA 4XZ9A 4GG9A 4U84A 1K8CA 2GYIA 1SW7A 4W9TA 1M65A 1UWSA 1YTKA 3EXRA 3BAJA 2I14A 4HPJA 1J0KA 1RY0A 2DORA 1JFHA 3GDMA 4H2CA 3BAWA 2MUCA 1EJVC 2D1ZA 2ZIDA 1PHQA 2CLOA 1J0ZA 3RJYA 4DWSA 4H01A 3P0WA 3SY8A 3KBMA 3N73A 3PZGA 3DYOA 4ZR8A 2PMQA 1DJGA 3HQNA 1JQXA 1VJSA 4KWUA 3AAMA 1KGWA 1EJRC 3M7WA 4YMZA 1X6LA 3WDIA 2J78A 3N2BA 4PUDA 3TQ0A 1QOPA 2C8NA 3OVQA 1AW1A 3GIYA 2CLFA 3TMLA 4M3PA 3NQ8A 3ITTA 5A6BD 4K38A 3LXBA 4FXFA 4A8NA 5EB8A 2ZUUA 1K1DA 4Q8WA 5LZLA 2PBCA 2B5UB 1E4IA 2VFIA 4XBSA 1F8IA 4RUBA 4UR8A 1Q85A 3MY9A 1Y0OA 1XLMA 3LQGA 3T0CA 1BFNA 3IJ6A 4GJIA 4G2DA 1J4EA 3CV1A 4OJYA 4ASTA 1IEVA 3VZZA 5CPOA 4IIGA 2ODOA 4A22A 3KVMA 1Q6QA 3NI6A 3NOYA 2OQYA 2VDHA 5I3IA 1ICQA 2QUTA 4UUIA 1O5KA 1FKDA 4GX9A 3NQDA 4QCFA 3BJTA 4FXJA 1T41A 4I7UA 1Q7QA 3SCVA 4DZ2A 4HPGA 1U22A 3B9AA 2W79A 5HWJA 5HUPA 4GNJA 3FGCB 3CPGA 1H5YA 2ZUSA 2D0FA 3COTA 4V1YA 3IVTA 1BXBA 3A5FA 2GJXB 1JPIA 4A4AA 3MVIA 1NFPA 2OPJA 1NOFA 1W56A 5EU9A 2WJEA 3RX4A 3WLIA 3MV01 1TJRA 4GZEA 5C71A 4ZO9A 3IK8A 2R6OA 4AWSA 1MW3A 4Q4OA 2C15A 3SY5A 1TJPA 4JHOA 2GSHA 4AZCA 3OG2A 3UF9A 2Z1XA 1AW2A 1ODUA 2CLHA 3WQ4A 2HVOA 2QCHA 2PURA 2XIMA 4XAYA 3W7MA 4MNLA 1DE5A 4AYGA 4AY7A 2PD9A 2KX9A 2V38A 1SW3A 3P5ZA 4LY8A 2DVXA 5G2WA 4LOCA 3QV9A 2OWCA 2YCEA 2CWXA 3MW7A 4H9MA 3W7HA 4PUKA 2B31A 1K7FA 2P50A 1XUUA 1S1RA 1FP8A 4Q8MA 1ISYA 3GC2A 1E6XM 2VYOA 2WNZA 5EMKA 2NQJA 3GNXA 3ZT7A 1HP4A 3TJXA 3NPVA 3WMCA 3MUY1 3OW1A 5DBTA 1OINA 5DO8A 3RLHA 4TX6A 2DSUA 1Q63A 1KTNA 3F1QA 3IAPA 2FTYA 3I65A 4GUHA 1UKSA 3SUVA 3RG6A 5C9ZA 1H5VA 3RFAA 2E0PA 7TIMA 2WB5A 1EDTA 1MXGA 4AY8A 3UYIA 4D1IA 3C3NA 4JTKA 1V3HA 4ODKA 4TO8A 3OVGA 4FA3A 5DELA 5G1TA 3A3HA 3ZJ7A 5CC7A 4DROA 4GXMA 2GDVA 4UBPC 1B1YA 4N4QA 3NCOA 3KAIA 1TVNA 4R5EA 4D1JA 1E6ZA 2ANUA 2QCMA 4HK6A 4GKLA 3TQKA 3CMGA 3VNMA 3OLGA 3LM7A 1F3XA 4WY0F 1I2NA 1QJWA 1KM2A 4XO7A 4MGVA 1L2QA 4AMAA 5HWNA 3LI1A 4M0XA 4J9JA 1KXQA 1UZ4A 1W5QA 4CNSA 2IKGA 1V6XA 1WB0A 2GUYA 3GDBA 1PXGA 3MKVA 3DFOA 1DJNA 3R6IA 1M53A 4NX5A 1FCUA 1HJSA 4BEQA 1UCWA 4AD5A 1GQLA 2A6NA 4XTDA 2OQLA 5C7HA 3MV11 3TDBA 4F3HA 3URQA 2Z1SA 3MWAA 1W3TA 3C2EA 1IZJA 2A2IA 2FMNA 1REQA 4XBJA 3GNPA 1FD9A 5JU6A 1IWAA 3N6QA 1RAKA 4UB9A 2ZZ4A 3WK1A 3P60A 1ZBCA 1JPHA 5G4HC 1TMHA 3UXIA 2IQ0A 1RALA 2OU4A 3B03A 2BWGA 4XB3A 3U7VA 2HE8A 2MLXA 2RUCA 1G69A 1CGTA 3CTLA 1QO2A 3KZ7A 1H62A 1GOIA 4RL3A 4MNJA 5DIVA 3VPLA 1F6YA 3BGAA 1LQ0A 3IEBA 1SQ7A 4EIVA 3N4FA 4C02B 2BMBA 1DE6A 1A0CA 3WUFA 3PNZA 2OO6A 4L6HA 3W1TA 4GO8A 4I6VA 1GGOA 4OU1A 5KMYA 1XBYA 3PTMA 1W3KA 3HB9A 1UPPA 1UP3A 4IGSA 5AFDA 3TZNA 3BLOA 4B3LA 3ARRA 3PBUA 2BOEX 1UB3A 1P1MA 1PKYA 4MLRA 1HL9A 5D04C 1R3QA 5FAGA 3DGRA 1S2WA 1Q7ZA 1GKRA 2J88A 3ZT5A 1TCOC 3GH7A 4Y9AA 2X40A 4MPQA 3XINA 4JHZA 4GY0A 5I79A 1PB0A 1E1CA 1BRLA 2FB2A 2QZRA 2XP9A 3WD2A 3LOTA 2ZQVA 1XYLA 1Z8AA 5DO2A 1LOSA 2ZE0A 1LL6A 1GOKA 1ITCA 4DRJA 1DWFM 3SN0A 4DN1A 4JQ3A 1G7UA 5JIWA 4OQVA 3RAOA 2VFGA 3IGSA 3IAQA 1TIWA 1TZ9A 4LAUA 5ECUA 3VOCA 3NQAA 3JZEA 1OSEA 4GZJA 2QCLA 5HJXA 4ACZB 1FBAA 4PBEA 1OC5A 1EO7A 3ARQA 2AMGA 4JQAA 3HG2A 3JRKA 4KEVA 4KCVA 1LRQA 3WBAA 4M1RA 4F40A 4L9XA 5D05A 4DRMA 4J35A 1UR2A 1VYRA 3WNPA 3N25A 1E73M 2E9BA 5CZSA 3TKFA 1UJQA 3SQSA 4DRQA 1ZJIA 4FLSA 2NQLA 3T09A 4H7ZA 3S4TA 3TSBA 4JKMA 2ZRYA 5I2UA 2C6QA 2QGYA 2IQTA 3BDKA 1E1EA 2VDGA 1OB0A 1YKWA 1EKOA 3PWAA 1IEIA 1QNSA 2BLEA 3RRAA 2X16A 1N7KA 4PRRA 3LPPA 2WQPA 4TX8A 4JCMA 5D38A 2POTA 3F4VA 3KS6A 5B7ZA 3HG3A 3I4KA 1VH7A 2G3MA 4NT0A 1QPRA 1EJUC 5JVLA 4FR1A 4ADUA 2Y24A 1BYBA 3O8AA 1EIBA 1NWUA 1EPXA 4CNNA 2ZYFA 1CX9A 1VFFA 3UFYA 2NLIA 2J7BA 1RPKA 3L5LA 2EKGA 3I3DA 1XCFA 2OR2A 3W02A 1GVEA 2RAGA 5TBOA 4X0VA 5KTLA 4E5TA 3UGRA 4RDVA 1LRTA 4PB3A 4MWAC 5CXPA 3EPOA 1E6SM 2D23A 1GNXA 5TQLA 1F05A 4CN1A 4W4QA 3LPFA 1Q6UA 4AIBA 1JZ3A 2CZDA 5DMNA 3A21A 3TLLA 1KR1A 4GPNA 2QW5A 5I98A 1YPFA 3OHIA 4O4VA 4UR7A 3LGEA 3AUJA 1HJQA 2ICSA 5HAOA 2X2YA 4KQZA 2O4QA 3W53A 4LCRA 3EEGA 1LG1A 3F5KA 4RZ6A 4JTRA 2G37A 3R25A 3B8UA 1XIDA 2YL5A 5HMSA 3QGKC 3A4AA 3IJLA 3G2GA 3N2MA 5U7SA 3H6OA 3TYDA 3A3XA 1LL7A 1PAMA 2TRSA 2XIBA 3KEHA 1YATA 1TJ0A 4MDPA 1L6FA 1GK8A 3ODKA 3WJZA 3PULA 3L9CA 2YBTA 1ADOA 3KX6A 3QSTA 3HGRA 3ZXWA 3QGVA 3LNPA 3CAKA 3W01A 2NSOA 1GOOA 4MAVA 4ZE5A 2CITA 1JXKA 2DV0A 3FVMA 4JHMA 2O56A 3HA1A 1Q65A 2AAMA 3LHYA 1GQNA 3WQVA 4P7NA 3SCRA 1E9LA 4LEQA 4GJ1A 2ACSA 4WY0B 1VJIA 4YCPA 2XPAA 4NIRA 3GR7A 3U7BA 4NILA 4ODNA 3CYJA 2XM2A 3NURA 4NYYA 1F07A 4B3ZA 4LCSA 1UWTA 1IXQA 3T2QA 5EBAA 5BRBA 3BAXA 3I7RA 2EULA 5CC3A 3QBUA 2QXWA 3UR2A 4LRTA 1HJUA 2LJ4A 2ZQUA 3T8LA 2KFWA 3VNKA 4GVHA 3OLEA 1JYNA 1AJZA 2P76A 4QG6A 1KFEA 3SDOA 3WQ8A 3MUXA 3AJXA 4ITZA 1ADDA 1OIFA 2ZR6A 2PF8A 4DB7A 4RK8A 2IKIA 3KHJA 4GI6A 1HP5A 4I5UA 3PUDA 4KGLA 3NSXA 1RCQA 5F1UA 2WSYA 1ME9A 3UWUA 3AUOA 4AF0B 1E4NA 2BV9A 1P4CA 1XQKA 3FSUA 3PZTA 1CB2A 3O5JA 2Z2UA 1DTUA 2HSAA 2VFEA 2Y7EA 5DCEA 8XIMA 2P8CA 3UR5A 3ARSA 3F5JA 4H19A 1R2RA 3EY6A 1ZNNA 3OZYA 3EB2A 2JKPA 2ZTKA 5HMDA 3C8NA 3SRFA 4LX4A 4CD5A 4QT2A 1IHIA 1NDZA 4A3RA 4C1KA 4A2RA 3QPEA 3T42A 3KCOA 1QI4A 1WOBA 5B8IC 1FHLA 3OHMB 5HT1A 4UC5A 4MYAA 2REQB 1A53A 3G0XA 3L2IA 1QUMA 3A9IA 5K9CA 1U1JA 4O53A 5JBDA 1IEXA 3BCDA 1W8GA 2EGZA 3AMDA 4MWAA 1EP2A 2E5DA 4HD5A 1QOXA 4RE3A 3S47A 1F4HA 3TCZA 3W7DA 1D7KA 3GHUA 3KL0A 3M44A 3HFYA 1FWTA 3AIVA 1UUOA 4H9VA 3LMZA 3WLHA 3RPDA 3F2DA 5FEXA 1HQTA 1DP0A 1U30A 3EMZA 3CZGA 3AFBA 3R4IA 3VKDA 5HPOA 4DBWA 1SPQA 3EMCA 4IL0A 4CNPA 3VAVA 3P74A 5GNYA 1MUWA 5EBUA 1RSCA 1HT6A 3PB0A 3TC5A 1W2VA 3SJ3A 1BEUA 4JEJA 4LC6A 1X1NA 5KZEA 1A5LC 2DZBA 1C8QA 3U0HA 1EDQA 4U3AA 6A3HA 2J7FA 2NLYA 2G0WA 4Z2HA 1OBAA 4NZJA 3CC1A 3G6MA 3JU2A 1TZ7A 2G5WA 4GIVA 5LXXA 2AKMA 5FSDC 1Y5XA 3SIZA 1UZHA 4J5NA 4B9ZA 2W61A 4B2DD 3U5UA 4F0LA 2CXEA 2KZHA 1GWJA 1YPXA 2XDFA 1TKKA 1VYPX 3WNNA 3FHQA 3R94A 3GDTA 4CN4A 4XKYB 3VI2A 3LZ5A 4FLQA 4E8DA 4BY3A 3UXDA 3M16A 4ZL1A 3PSWA 1XGEA 3B8IA 4FLOA 3UETA 1KT0A 3FSTA 4PULA 5JBFA 4ZOCA 4Y8EA 3RRXA 3MANA 1JIBA 3BJSA 1C8XA 1SFTA 2JK2A 1RK6A 1NWRA 2NZLA 4O0ZA 3J7HA 2ASHA 5FJOA 3EA1A 1VD6A 4E8CA 5AYZA 1H7XA 3QGAC 4UTUA 1MW0A 3NQGA 3EX3A 3EKLA 4BQ3A 2P5NA 5E70A 3PBGA 3GU0A 4C6PA 1GHSA 1PZ2A 3W6LA 4HA4A 3C6CA 1CXHA 3W28A 5T9CE 2C16A 1X1ZA 3FJNA 2QCEA 3UERA 2PDGA 1W54A 4Q8UA 4UNLA 2PZ0A 2V8ZA 5C5YA 1TYGA 1W32A 3LCFA 3MT1A 4M19A 1B0IA 3LLFA 3UR8A 3KW3A 3ARUA 4XSMA 3O5MA 2W66A 5FI8A 3QTGA 4IIDA 5XINA 4YLWA 3A12A 5AYXA 4CQAA 2OYLA 3VFLA 3BURA 4DRKA 3K4DA 4JN6A 3NQEA 5FESA 1OCQA 5HXMA 5ABFB 2EJ1A 5HWBA 3IIOA 4LUYA 3WK2A 3M5XA 2NX1A 2KI3A 1GT8A 2V67A 4AZ6A 1B3VA 4MJZA 1AD4A 3P61A 4KERA 3FKRA 2RUDA 3FJ4A 4AHPA 2V5CA 4ODRA 2FGBA 1U79A 2HPIA 4N9BA 3ZOAA 1VLWA 5AVHA 2WMKA 1WDWA 2QJGA 3R0KA 3LPOA 4DZ5A 1Z7AA 1NDYA 1QBBA 1N8WA 4HA1A 1TWSA 3CMFA 3P8JA 5FJIA 2XG9A 4JTAA 1EJTC 4DF2A 3R43A 5FJJA 1NSGA 2FYMA 4HOXA 2AGKA 1DIKA 4KR0B 1OC6A 2L2SA 4O18A 4NQ1A 4PMYA 3VIFA 3AICA 1SJCA 2VZVA 2CBVA 2HVMA 2NWSA 5B80A 3LX9A 4M29A 3KOWA 1DWJM 4ZOAA 1W6TA 1YIXA 4JIQA 2CHOA 1ONWA 4FX8A 5M2FX 4O2TA 1UH4A 5BYWA 2VHLA 1YW1A 2C91A 5D2YA 1V6VA 3FA4A 2QJJA 1RD5A 3PY2A 1EEPA 1W0MA 2EPHA 2C13A 3L23A 3AHXA 5I3KA 2A7RA 1GW9A 2FIQA 4OKDA 4DUVA 1A3XA 3M46A 3EPNA 1QPQA 2PDCA 3JYMA 1E6NA 3CZLA 2IMRA 3GX9A 1FAPA 2XPBA 4QNEA 2LKNA 4IICA 4LH8A 3SFKA 4ZO7A 1W9PA 4BS0A 5HJYA 3B0VC 1NWSA 4C1NA 1FKXA 1XR2A 5CJ5A 4K8GA 4GO9A 2HMCA 9RUBA 4GC4A 1V0KA 4QIBA 4D6IA 4W5UA 4GE8A 1CENA 3KL3A 1W1B1 2Q01A 2WVTA 2X1TA 3PNUA 4WDTA 4YYFA 2XPKA 2PC4A 3QY7A 2OYMA 3BSMA 2BGNE 4E2OA 3RU6A 5A6BA 3NVDA 1OF8A 1DXIA 1Q6LA 3JW7A 3O15A 4BI5A 2WVVA 3UJFA 3R0DA 4IUGA 5CPNA 3VNDA 4GFIA 3GNOA 3UESA 3W38A 3C5QA 1EZWA 2J66A 2XN1A 3CH9A 2E9LA 2YFOA 2ZRUA 3QZ6A 1IQ8A 1LBLA 2CESA 2HISA 1ZQ5A 3PTQA 2ZCGA 4MY8A 4R9XA 4LWWA 2PS2A 4XAFA 1BVNP 4FS9A 4JTEA 2P88A 1WKYA 2NV2A 1BTMA 1ONRA 4PMOA 2PA6A 1EB3A 2PGFA 3BCJA 4GY7A 3ZVIA 4LW7A 4A21A 2RUSA 2XVPA 3H4XA 1KFCA 3C61A 4Z2JA 3CXOA 3W7PA 1SZRA 1B3WA 4JS3A 1E9YB 4LYPA 2FZ8A 5J5DA 3OO2A 3WF4A 3S5NA 3THAA 3EWBX 3M0XA 3ABRA 1Q2SA 1GOMA 5I77A 3KAOA 4NRSA 1WE5A 3EDKA 4N19A 5AHIA 3ZT6A 3EKGA 1TELA 1W2PA 3U6WA 3UXAA 1F7BA 2I5QA 4AXKA 3BK0A 4US5D 4AH7A 3OA3A 3DKLA 1FDZA 3MUIA 3O6CA 2NT1A 3ABSA 3XISA 2HNEA 1XH0A 3BMVA 5JH1A 1KO0A 1X98A 2XIIA 3PZIA 5ABGA 4BF9A 1YEYA 1EGVA 3PBYA 5DRCA 7ENLA 4A3UA 5HNTA 3EWDA 4KCTA 4R7OA 4RDWA 1ECEA 3RLGA 3XIMA 1K70A 1WA3A 3K46A 3H2MA 2ZQSA 1V3KA 4GUJA 3L12A 4IIEA 1Q3NA 4IGMA 4M6PA 3DFNA 3F4CA 4HNCA 3S6DA 4B15A 4JTSA 4P8XA 3T05A 1UKTA 3NM3A 4C60A 3AYSA 3QFEA 2WWCA 3ITXA 4JFWA 2CZEA 2PD5A 1TTJA 3H24A 2ISFA 3V0SA 1R85A 1WX0A 1JCMP 1W26A 2GSJA 2B7QA 4ZCWA 3N13A 4QSHA 1T8XA 2X41A 3KS5A 4GVFA 1UW9A 2H3DA 1XJBA 1EXBA 3QYQA 1S5WA 1PTDA 4S23A 3LMYA 4OVXA 3ABZA 1ISVA 1RBAA 1W3JA 1DBTA 1XH1A 1MRAA 2JIWA 2WKJA 3QHOA 1KKRA 4QE5A 4IX0A 1PVNA 3L0KA 4ZQCA 3B0UX 1V8EA 2J24A 4C7FA 1YW5A 5E93A 4P5UA 1S5TA 5BOEA 3PUGA 1BYAA 2CLKA 3GB6A 3W2LA 2OX4A 2FH6A 5DX7A 3ZS4A 3WUGA 5LIUX 2BGSA 3NZGA 1FKWA 4ICCX 4Y7EA 3W72A 2QUVA 3C3UA 3IGUA 1J01A 3VGEA 5BCAA 1OK4A 1FUYA 1FCQA 4GUGA 3TWAA 4NJJA 4URIA 3PUEA 2GJPA 1EX1A 2AOSA 3KBNA 3O5RA 3EXSA 3H9RB 4AVOA 4JFJA 2WAGA 2GUUA 4QQ3A 3OYXA 4YYCA 1W1IE 3B05A 3WELA 5CZTA 4LAKA 1E70M 1KKOA 3SSZA 4DBUA 4AFYA 2E6FA 4C6FA 3TYBA 3BL3A 4GRSA 1XBXA 1YNYA 2FVLA 4AG0A 3WX7A 1XISA 5DN1A 4IXXA 4H6EA 3E5BA 5CPMA 4MB4A 3G1XA 2GJRA 3U48A 1F40A 5J8LA 4PFHA 2R24A 1I75A 4ZXLA 3WK3A 3OQEA 3W00A 2Z25A 1WDPA 2XGBA 3B3DA 4F0MA 1W3NA 3IACA 4H8NA 1I1XA 1IZCA 4HB7A 3W74A 1M04A 2QQ6A 1JFXA 2WVSA 1OX6A 3EMQA 1A47A 3ITVA 2VWSA 2W5FA 3SIMA 4RW5A 5F2LA 4W84A 4FMVA 3BV7A 1DJHA 1KWKA 2VN1A 4DWSB 4PUUA 5AOUA 1TRIA 2VZOA 5AY7A 1IIGA 1JZ4A 4LQ1A 7PTDA 4DJEC 1TV3A 1D8CA 1GONA 1OFPA 3VO0A 5A2CA 2FB3A 2Z2AA 3FYPA 3S0CA 1NP2A 3PJWA 4IFKB 3FJ6A 1R8LA 2PGWA 2BY3A 4L1WA 2E6DA 4GQBA 4PCNA 3U4AA 3BOLA 4F2UA 2SFPA 4PYSA 4L9ZA 3MI3A 1WBHA 3G3DA 1XWYA 1OEPA 4MFDA 2HTMA 3VIHA 1UZ1A 3GTNA 3MSRA 1HL2A 2PFHA 2ZWYA 4MOZA 2FZMA 4XAGA 4AVFA 3M5YA 2DG4A 2GK1B 3B9OA 1VP5A 2I9UA 3KVJA 3UZZA 2A6LA 1F74A 2MNRA 2G3IA 2YCJA 1MSSA 4G2PA 3DX5A 2H8ZA 5TIMA 2V30A 3QW3A 5DY2A 2BXVA 4U2YA 3HN3A 1O4UA 5J5RA 2J47A 3ICJA 2J9ZA 3I10A 3VC6A 2NXIA 3BWWA 1CCWB 4GX8A 2F8QA 1JUBA 1OCBA 4IISA 3LBOA 3WBEA 1P0DA 2V81A 3KTCA 1UZDA 3DFPA 3MKKA 4HBKA 3F2BA 3TQPA 2L5HA 4C90A 3GW3A 5I02A 2JQXA 4FPSA 4IMGA 2DIKA 3LCIA 1A5BA 1TMLA 5BU6A 2CZVA 1CDGA 3BSGA 3VIOA 4GCAA 2CC0A 4B90A 2GGIA 3PS7A 2QUUA 3FJLA 1H7NA 4DF0A 4XTIA 2I16A 1XLJA 1VKFA 3BGGA 4BF7A 4DLFA 2FTWA 4IQLA 2QIWA 4V27A 3CPUA 2Z1BA 2BDQA 5H8PA 3O0KA 1OCNA 3HTWA 5D2VA 3GAYA 3ARYA 5CKSA 2BY0A 2UY3A 3VD5A 4AWEA 4J4NA 1G01A 1PYMA 3HGJA 2E4TA 1TX0A 2J74A 5BRPA 4KBXA 1PS9A 4CD7A 4W86A 1VFSA 5FJRA 4J27A 3KVLA 1ZALA 4FNPA 2BVWA 4FNSA 2M08A 3N29A 4CNOA 4TMCA 4GIAA 1GYLA 2WSPA 1Y5WA 1D7JA 4PTVA 5B7YA 2YW4A 1GCYA 1SFSA 4PUNA 3PBMA 2EXOA 1M9HA 1DL3A 4AD3A 3W75A 3U2ZA 1BGAA 2FKPA 1QCWA 1FWNA 2Z00A 5AHEA 1A5SA 1JD7A 4KWSA 1ME8A 1GVOA 3GUWA 1DYSA 3CQ0A 4EPEC 3M47A 3LYEA 1YDYA 2UZ5A 1LT8A 5CCZA 2Z24A 4J40A 1YYAA 4UZUA 4ODPA 1OFQA 5D8ZA 2VRQA 1L2UA 4IM4A 4O0KA 2EPNA 4LF2A 2F61A 3C2VA 3BLDA 2WHMA 2A3CA 2BS9A 4M6UA 1BD0A 3W85A 4KGJA 5F2IA 2ZZ1A 2VX5A 3HO8A 2RGMA 3BQ5A 1QO5A 1WKDA 5CLTA 4EACA 1S3HA 1Q6EA 1FKTA 4JTLA 4PBGA 3TCSA 5FCZA 4NJIA 4IF2A 5G1YA 1R47A 4M82A 2O4MA 4O1FA 3A4JA 4HMEA 3VABA 4O1EA 4KIRA 3FHAA 2XSXA 4INFA 3VKJA 3PRAA 5A69A 2DW7A 1XSJA 3TFXA 2P1FA 1E0WA 3THQA 2W3ZA 3T8QA 2VFFA 2WMGA 1S5MA 1SUXA 1HKIA 2EO7A 2TYSA 2ZQTA 4Y2WA 4HK7A 1F3WA 1REQB 2PDUA 3WL1A 2E25A 2OELA 1VCVA 1Z69A 5DMYA 1POKA 2E67A 4H1ZA 1H1NA 1TPFA 5HNUA 3GQYA 4WZHA 1O1HA 3RIKA 5HQMA 3O06A 4HIBA 1VBJA 3D3AA 2DT1A 1M01A 3M0JA 3SCPA 3UZWA 4F0HA 3O2LA 1XS2A 1W9BM 2WMJA 2ZRXA 4I8DA 2PTDA 4N2YA 2NV1A 4HU0A 1Y8BA 3O5EA 4PCFA 1FWBC 2ZQ0A 3ARPA 2EF9A 3VD7A 1DQUA 1L9WA 4UQBA 2VR4A 4MB5A 1ZFJA 1JAKA 3L4YA 4IQEA 3IIPA 2PAJA 3IK2A 1K7EA 1NSJA 2FDSA 4LV4A 1JXJA 3G6LA 3E2QA 5CBJA 2YZRA 2YKKA 4LAOA 2Z28A 1CTNA 4AQLA 4ODLA 4XIMA 3KOXA 3S1WA 4DYKA 4OECA 1J0IA 4QJ4B 1OFDA 4L61A 3B7XA 3GIPA 3QC0A 4AD1A 2Y6ZA 2HRWA 2EPKX 5A2AA 4OZOA 3WQEA 3VD3A 3V0UA 3E38A 4ADTA 1DJWA 4DWDA 2A0NA 4CEXC 5FL1A 2GL5A 4QR6A 3WH9A 1E1CB 4C91A 1BRLB 1XIMA 4LY4A 1GOWA 4N4PA 5E0CA 3IARA 3E9AA 1UA3A 3F4WA 3B8WA 1FHVA 4YNGA 3AHYA 3AWNA 2NQHA 4GQ0A 1E9IA 5BWAA 3GO2A 4UZSA 1LP6A 1QU4A 1W9VA 2HWGA 1A3HA 3UEQA 3LHZA 4L4MA 3CUFA 1T6MA 5JBEA 1RQEA 1FWJC 4BFAA 5D8WA 3WDRA 4HTYA 4Z1DA 3OIXA 4ATLA 4DLMA 4J2PA 2PWFA 1CZ1A 4OHQA 1XIJA 2WC4A 3F5LA 1SYTA 3FOKA 2PCEA 4QROA 3O5FA 2VELA 5E09A 4F66A 3T2PA 2XIQA 3WQOA 3UPWA 4Q4SA 3LUTA 4Q6JA 3S6TA 2VEGA 3ZIZA 1VEOA 4D6GA 2XVGA 4Y9MA 1JQVA 1N8IA 3CQHA 3W70A 1L8PA 1MDRA 3GXTA 1GHRA 1IYXA 5JXQA 3E5PA 5BMXA 2ABBA 1GG0A 3IIXA 3HMCA 1UROA 2F2KA 3R13A 2XIJA 3GYCA 3LTSA 2JGYA 2NXGA 2PDFA 5XIAA 2A4AA 1O94A 1JNEA 4B2DA 2DJXA 1RUSA 2FGLA 4CGTA 3VMNA 3UU0A 2OZ8A 4RX0A 1CGXA 4RPPA 4PB4A 3BO9A 1UIOA 2TPSA 2QF7A 2P3EA 5CPTA 2R1PA 3W88A 2RUQA 1JUKA 1JAEA 5K9XA 5CBIA 2BXYA 2YW3A 5T9BG 3TW6A 2Q02A 1H1ZA 2BOFX 3NRKA 1M3UA 3BLEA 3A22A 2VX7A 2CLEA 1F3EA 1K8YA 4QT3A 4RR4A 2ATSA 4UFHA 1SR9A 1PCWA 3AHVA 4XUYA 2CW6A 1PL9A 4JTQA 3TWBA 4X2PA 2VMFA 4D6FA 5C9UA 3SRKA 4HNOA 5CG7A 1AZ2A 4BF8A 4WUIA 1E51A 4IT6A 1LF1A 3TC7A 1YADA 4ZA0A 1TCMA 3AS2A 1E71M 4UOQA 1M7OA 3RLVA 4Z2IA 3KRZA 1SFJA 1SSGA 3U2OA 4MSSA 3CASA 3PR2A 2A3AA 3KAGA 2VOTA 3CBWA 4B4HA 4DHGA 1W1ZA 9XIAA 3N3MA 2NVDA 2J25A 3T0BA 2OQHA 4O0QA 4W7WA 3S46A 2YYUA 2Z4GA 3I68A 1LQ2A 3BTNA 4EWND 1LCOA 4Q8TA 2XP8A 4TUFA 1US0A 4AZ5A 2J6VA 1V4YA 3MSYA 4JTIA 1PUDA 3NL2A 4DM2A 3W22A 1OCJA 2A1YA 1EJWC 3EGJA 3W7JA 3IVUA 3CAQA 1VR6A 2WBGA 2GSEA 3ANVA 1O66A 1IZKA 2DUZA 2JF6A 3FYYA 4PUEA 3WFAA 3DH7A 1JCTA 5AHFA 2PDWA 2X0YA 5BOFA 4HN4A 4AEFA 2RJHA 5A1AA 1WAWA 4XWUA 3DERA 4XO6A 1IXNA 2AGTA 1OADA 3CZKA 5AZ0A 2HVNA 2RHGA 3G1RA 4GCXA 1ENUA 3WEOA 4MFEA 1FX6A 1OZQA 5F4WA 1UWAA 5F4SA 4EXBA 4PMXA 1GOXA 1JNDA 1FRBA 3BZGA 1WKFA 3N2TA 4XX6A 3SQMA 3VX0A 3WK0A 5HK4A 2ISSA 3RNDA 5SWUA 4XVEA 3T40A 1E9ZB 1FWAC 1IE7C 3CWHA 4G6CA 1VB9A 3O7UA 1XG4A 4I6KA 2F6UA 2XN0A 3DC8A 1EGMA 3C0QA 2VL4A 2WKGA 4H4IA 1OF6A 1CXLA 3NZPA 4DF1A 1TFVA 3KZSA 3KP1A 3SN4A 1VLIA 2VEKA 1GVQA 2PBOA 1FWFC 3O5KA 1EF2A 5EGRA 3DBNA 1GEQA 2PTZA 3LTPA 3SBFA 3O05A 3MUAA 4HOZA 5AKQA 3PFMA 4IGNA 4ODOA 4F9DA 4JYDA 1H7OA 3OOBA 4AIOA 2O7QA 2XP7A 1J4RA 4LB3A 4KF1A 3MSGA 1RLDA 4U86A 3W2UA 4FOKA 3PZNA 5AB3A 3PAOA 4J28A 1NMVA 3W1PA 2D9FA 2PE4A 3P67A 2XUCA 1X7FA 3BW4A 4C6DA 3H7VA 3MTWA 4DO7A 3E74A 4AXNA 4DYJA 1VZWA 1UKQA 3CV6A 1E3ZA 3ZVHA 4JTDA 3AMLA 3OLDA 3EOEA 2OEJA 2E5BA 3TA9A 4AHQA 3KAHA 2C3ZA 4DO6A 1ZZMA 3CWNA 1DIEA 4MWAB 4ZVJA 4L64A 3CT7A 3H55A 1Z32X 4YWIA 5L9FA 3TSMA 1NM9A 2HK0A 1D7FA 1R30A 4Q8NA 1E0XA 1MFUA 1TQJA 1DTNA 1TTQA 2PDPA 5CLWA 3TEVA 3ATZA 4ZQNA 3VZYA 1Y0EA 4XD3A 1DJIA 3HGSA 5IBXC 3GXMA 2A85A 3LHWA 1V08A 1Z3NA 2ZXQA 4QSFA 8TIMA 4ODMA 3VKKA 3UA3A 2PPOA 2IPWA 5I09A 2ZDRA 4AIEA 7ODCA 3O63A 5HOSA 1ZL1A 1J0JA 1TZZA 1XFBA 1W8SA 3TR2A 2ACRA 3QKEA 2R1KA 4HA3A 5LGZA 4HMDA 3LU2A 5K7JA 3UWWA 3WY1A 2P0IA 1TPB1 1XD0A 1KBKA 1QK2A 6ALDA 5GQBA 2YZ5A 2X7VA 4XD5A 2QPSA 3GHTA 1AZ1A 4GINA 1D6OA 2XYLA 2FQIA 4MPKA 4JNMA 5U4NA 3L0NA 3O9NA 3S5SA 1NF7A 3NTYA 2AAAA 4BI7A 2K8IA 5LNRA 2C14A 4NNBA 3CEUA 4HCLA 1SGJA 1ZGDA 1LQAA 1FWGC 1RJQA 2GFTA 3C0LA 1IV8A 3ZLFA 3PM6A 3RM4A 3A4XA 1TPEA 1BHGA 4QFUA 3GDLA 3TK7A 1MUCA 2R1LA 3PAJA 5D37A 1GVFA 4WOQA 4OFCA 1UYQA 1OC7A 1GVIA 3DFSA 4GUFA 1GW1A 1XIEA 4DY1A 3RGCA 3VTRA 5A6LA 2V3EA 4US5A 1TUXA 2WZTA 1I1WA 1J6PA 3G22A 5HW7A 4QM1A 4O16A 4LAYA 4LUSA 1M5YA 3TONA 7XIMA 3O16A 1I9CB 3I3EA 1R9XA 3P5YA 3UG4A 1AJ2A 1O68A 2GZXA 5ABTA 1TPWA 1OYCA 2D2HA 4H9UA 1KM0A 2YJQA 1W31A 2DW6A 4ZMGA 1I4NA 3UWVA 3WJSA 4UMAA 2DG3A 4R7WA 3UZJA 2CNCA 1W9UA 1O6IA 2A3EA 1GRJA 2G3FA 1IEQA 1LOLA 2CBUA 1RK5A 3I6RA 1B6CA 2Y62A 1WDSA 2JEQA 5I3JA 1R5YA 3CNYA 1XM3A 3DFYA 3NJ3A 4DRSA 2EPMX 1FWRA 3E0VA 1AJ0A 3DI1A 4PMRA 3CV2A 3TN5A 4BA0A 3V18A 4UQAA 2PP3A 3M6DA 3LRLA 3IUIA 3M07A 5AHNA 1FJDA 3QEZA 4WSKA 4B5WA 4S2BA 1FOBA 3CUZA 4D71A 3N17A 5A6TC 1J93A 1KM6A 5BXPA 2POZA 4US6A 2MANA 3IRDA 4JTTA 1E0TA 5A8GA 1RJRA 4KWWA 4AWTA 2DH3A 1UD3A 2OGJA 1B9BA 1RXOB 1XIIA 1QPKA 3VE7A 5HQEA 4JGDA 3ITGA 4AZBA 1WBJA 1E5NA 5A8MA 3D0CA 3TYAA 4N9DA 3UPBA 1QRQA 1SZNA 3MB9A 1EPVA 3NO3A 2WCSA 4A3HA 3T4CA 2J7HA 3ITYA 2F6KA 2XGIA 2ZVIA 2BHUA 3SN1A 1AL8A 4EXQA 3TFCA 3L2LA 4HNVA 3NPWA 5KZ6A 3HURA 2J7DA 2Y8KA 4DELA 3CO8A 4PE8A 1A5UA 3UBPC 4WDUA 1V0LA 2WMIA 4C6OA 1G4PA 1YE4A 1UOKA 2E8YA 5A6MA 2V2CA 3TVAA 5CJMA 1H4PA 3DFQA 3DG6A 5D32A 4QJ5B 4EPKA 2ESCA 2IS7A 4OGZA 1I2QA 1ZU8A 1NU5A 4B5TA 4PMNA 1NJJA 3PRDA 4GQRA 4ZO6A 4X2RA 2C71A 5HNRA 3P80A 3B8VA 4TQTA 2O9TA 3TDFA 5E6YA 1SZGA 1HFBA 3QPYA 3HPAA 3ZWTA 3DKJA 3LHUA 1XI3A 2E5CA 5HWMA 3B06A 1PO9A 1IIHA 4DM1A 3BICA 3NZQA 1KR0A 3K2GA 3LK6A 1U5VA 3RPMA 2X30A 1Q4WA 3C8FA 1WZKA 4O1AA 4ZE4A 2X0SA 4M6VA 4J2MA 4XG1A 2G97A 4NF7A 1WZMA 3RM9A 4NZ4A 2OKTA 4TTGA 5H6HA 1VIWA 4GNVA 4DZ3A 4P7RA 1FP9A 3B0PA 6REQA 2YA2A 4P8UA 3S1VA 1EC9A 4C1NB 3VX1A 3E12A 1SZEA 2B7NA 3A9BA 3EDEA 4FX6M 4GI4A 1UKPA 1XHGA 2H9AA 4S3BA 3CAWA 2NX9A 1V6YA 4MDOA 3FDGA 4H9XA 3AMCA 1XPGA 2ACQA 1CXFA 5DT5A 3WH7A 2HEJA 3H21A 1K4HA 5A6AA 2WVVB 2BVYA 1EQCA 4XKMA 1V93A 1FVPA 3BW3A 3CZJA 2D2JA 5CG0A 5BXSA 4WRHA 5M03A 4ERGA 1R9ZA 4NZ1A 3TXVA 2XP4A 5A5WA 4TU1A 4FAMA 5ECVA 1HGWA 1PE1A 1ZENA 4GIEA 2E8ZA 2O55A 3W86A 1AH0A 1R3WA 4HSOA 3IJ8A 2QPXA 2ISDA 4KEUA 3Q2DA 3RN6A 2ZUMA 2VX6A 2FTPA 4G1KA 4M80A 3CK5A 3KWSA 4HJFA 2XIOA 3ZZ1A 1O12A 3T7VA 3UG3A 2QPUA 1CGVA 3LNMA 4UTHA 5KZMA 1KT1A 4CD4A 3RX3A 3WMSA 1EXPA 1R2TA 3QJAA 2LGOA 5I78A 2ZA3A 4LTSA 5AC8A 1E15A 2PN0A 1ITQA 1VCFA 4R0XA 1BAGA 4HZ7A 1LLOA 1J6YA 1RCXB 4QLLA 2Y61A 3THCA 1JNSA 3QPZA 3MS8A 4GNKB 3S2MA 4A8RA 2VVSA 1FDJA 5D9PA 3GC4A 3PBWA 3WQGA 4UQEA 2PWHA 1EEXA 1TO3A 4LPCA 3MPGA 1R3RA 4GFSA 5FEZA 1F76A 2A3HA 3ES7A 3TYZA 1UH2A 3T1GA 2Y70A 4HQVA 3WUEA 1Q6HA 3H2EA 3PTDA 4JBRA 1VBUA 2BBFA 1EX5A 1Z6KA 4PCSA 4PSRA 2INEA 2GLKA 3TOPA 2QDDA 1QPFA 2OOFA 3M0LA 2VXNA 2RDXA 4NL1A 2CIPA 2J7CA 1YPIA 4OBTA 4P8VA 3WH6A 5AC4A 1JZ6A 3MZNA 3NG3A 3I3BA 3B0XA 1YTDA 1YTEA 2JBMA 3GBEA 4J1OA 3F03K 3LI0A 3POHA 3BUVA 2QCCA 5A95A 3VGFA 2TAAA 2GUBA 3UVAA 4IMAA 3IKGA 3GC5A 1ZHAA 3EXTA 2PTYA 4Z0SA 4DXVA 4MJMA 3Q65A 2PPGA 2J4GA 2ALRA 2HZGA 1J10A 1RH9A 1GVYA 2WOQA 3EIPA 4GI8A 4ECLA 1GYMA 1ZCNA 3GUGA 2VTFA 1YRRA 2OVLA 2CPUA 1XIGA 4DJDD 1PIFA 4A3YA 2ZUWA 2OMAA 3AYTA 4NKCA 2MNTA 1XUZA 5D2WA 4N9CA 2X42A 7A3HA 3U2EA 4K68A 3B8SA 3KDOA 1VHNA 5IFTA 3VM5A 4AC1X 4FLRA 5G1MA 3VK5A 4LBUA 2YXOA 2XH4A 2ZC8A 3DU0A 3NQCA 2ZVRA 1F2JA 3BLPX 3EPMA 1E4LA 5HR6A 4TNSA 2Y78A 2EG8A 2C7FA 2XTKA 5BRQA 5IM51 4JIRA 4HCHA 1XL9A 3W6YA 2F84A 3IUDA 3VNZA 4EAMA 3AIQA 3WBXA 3E0LA 1EFZA 2V3FA 3BG5A 1JCNA 2ZADA 3HU7A 4UTWC 1V7YA 4DI9A 4KPLA 3EKZA 5CJNA 4W7UA 4K8EA 3CU2A 1YX1A 1ZK6A 1QHPA 1E6PA 4L72B 4QJ1A 3P2VA 1TJ1A 1UASA 2DG9A 4BR1A 5C55A 3GLCA 1A5CA 4LSBA 1K9FA 1BWLA 4X60A 1WQ5A 4IFKA 4O1DA 2WXDM 3EX1A 1Y65A 2V3GA 3G77A 1VAHA 4ORIA 1UUMA 2V5JA 3HJEA 1SU5A 4PEEA 4XISA 2UBPC 2NSXA 5TAOA 1NOWA 1UD6A 4NAEA 1YBQB 2PF0A 1V51A 2YX0A 4CEUC 3N14A 2VZTA 2J79A 3L4VA 4A2SA 4GMEA 5AC7A 1D3CA 3BMWA 1XYFA 2GK1A 1JF5A 2QJNA 1T7LA 3MP4A 4H6KA 1F61A 3BJFA 1OG0A 4XZIA 1JNTA 3KBVA 3NYZA 5I7GA 1K8ZA 2RDWA 4FNRA 1ZAIA 3C2FA 5A6KA 3KRSA 1PBGA 5I3GA 1AW5A 4NJHA 3LG3A 5M1TA 4BJHA 3Q37A 1XH2A 3SGZA 5LNVA 3CH0A 3WQPA 3FN9A 1N2VA 4BF5A 4C6EA 4D8ZA 1LYXA 3I6CA 3WKZA 2OWWA 4YJ5A 1IT0A 1C90A 3OZOA 3EYPA 3DXIA 2XHYA 1IT8A 1GKPA 3PN8A 4NVTA 1FY6A 1WNOA 1W9DM 4B92A 2M1IA 2Y7FA 1LG2A 3U8GA 1ISZA 1ZUAX 4AX6A 2FVKA 2Z1KA 4KKXA 4QRNA 3W2NA 3SZ8A 2C0AA 2QDHA 3VNLA 3W71A 3T07A 4S1FA 5MKGA 4P7LA 4QAWA 2DZPA 1OY0A 1EIXA 5A6JA 4S39A 3WLRA 3EWCA 2J9XA 4Q8QA 1K77A 4ZQMA 2GGHA 1JZ7A 1XIHA 1JULA 4RNHA 1P6CA 4QCEA 1ZTVA 4XZWA 1HN1A 3ZJ8A 3DIPA 4R27A 5EMMA 3O1NA 3QMTA 5CSUA 1UR0A 3TNOA 3ZR6A 4UQCA 1F3TA 1OYBA 5EMLA 3PZ9A 4ZOEA 2I9EA 2OLAA 2E1DA 1LWIA 2PDMA 3VUSA 4AWUA 1FTXA 2AKZA 1X96A 2VQTA 4JCLA 1KXTA 1PWLA 3GVVA 4L80A 1MW2A 4HHHA 1LZOA 1GQKA 3FCPA 4JTCA 5CQ1A 3GDKA 1T11A 3RMEA 4UMCA 3GD6A 1I0BA 1ITUA 1VEMA 1V0NA 4H9ZA 3SR7A 4MY9A 2Z1WA 1P6WA 3RU8X 4H2HA 1U5JA 1S46A 4N0RA 3DOPA 3GG0A 3ZJKA 2WHLA 3APYA 5CSYA 3WF0A 2RURA 2R82A 3V5OA 1J12A 3E0FA 2PWVA 3ARVA 4HMNA 3HPSA 4M56A 2WNNA 3LSCA 3I6TA 3FA3A 3DG3A 3AWOA 2CLIA 1TB3A 1SO6A 3VNIA 1BWVA 4UTMA 5LIYX 4DYEA 4ZTXA 1K9TA 1WDQA 3WUBA 3CUGA 2Q71A 2WANA 3MO7A 4OV4A 2QUNA 3WCZA 4W85A 3RK8A 4XZLX 4C6LA 5HATA 1B54A 3KRBA 4IIBA 3EOSA 3OBEA 3TTSA 3K1GA 3V75A 2UY4A 5C70A 2V3DA 1LWJA 5HW6A 3KOZA 4PTWA 4PFMA 2VCAA 1JG9A 2OEKA 2HV5A 4EP8C 4ZPTR 3KCEA 1S1PA 2X1RA 1EC7A 1RVKA 3NL3A 3C2YA 4WSHA 1BYDA 5XIMA 3PZMA 1DIDA 4R88A 3A23A 3H53A 4I90A 1JZ5A 2ZICA 4UFKA 2ZZ2A 4RNJA 1G67A 1XP3A 2QJHA 1ML1A 1E72M 3VVGA 3Q45A 3AO0A 3MWCA 1F4AA 1VFTA 2PPPA 3KCLA 5DFAA 4PTDA 4PB5A 2D0GA 4O15A 2BTMA 3EBVA 3QR3A 4FEZA 1UMYA 3MO4A 5C2GA 1DJQA 2PWUA 2DDXA 4PMUA 3GVRA 3VOJA 1J8VA 2D2GA 4CU8A 3PPCA 1E1FA 4RJEA 3HJZA 4ZSUA 1JRCA 3LCGA 3E6EA 2HJPA 4TOQA 2DSVA 4IMFA 3SUTA 2IXVA 3WG6A 2O7SA 4CCZA 1DHKA 3GNDA 2I5IA 2PODA 3IGHX 1E44A 1XLGA 1TA3A 3MHUA 4MADA 1W9XA 3WEMA 1CYGA 2WSRA 3TN4A 3P82A 3TR9A 1UD5A 3AIWA 1RP8A 1UUQA 3V1HA 3W26A 2G3JA 2AWGA 4UIOA 1UBPC 4CVWA 4RNFA 1DV7A 3UY7A 3TZFA 3V35A 4UFJA 3ALGA 2HS8A 1Q4NX 1P6BA 4QX4A 4J3WA 1MXSA 2YXGA 3PK7A 4CU7A 2F2DA 1HJWA 3K8KA 4I7VA 2OG9A 4JX6A 5GNZA 3WMLA 4LT9A 4JFVA 4FIQA 2OT0A 2V68A 3L4WA 1F6KA 1O60A 3VOGA 3LM3A 5A8PA 5J6EA 5FF2A 2WHKA 4AD4A 1DXFA 2WSKA 3H2CA 3K4AA 2ISVA 3P6LA 1RCOB 1K8XA 3EA2A 1LUCB 1Z89A 3HIJA 1FWEC 4IP7A 3NQ2A 4L6OA 2Y8UA 1AMYA 1OK6A 2EG6A 4GXWA 1FA2A 5HANA 1A3WA 5T91A 3CGNA 2WM0A 4OOUA 3A24A 5AECA 1BKHA 2DZXA 1GQIA 4CVUA 5G2IA 4LUTA 3B8TA 3MI2A 1BXNA 1OWQA 3HM7A 1E5JA 1U1UA 3WJWA 2BY1A 3GFXA 5EMJA 3GYEA 3AIUA 1T40A 1TR1A 5BROA 3H2OA 4GA8A 4ZPVR 3UQIA 4MTVA 2ON3A 3BG3A 2BXZA 3W84A 5KETA 4DAIA 1XF0A 3N15A 1R38A 4D6CA 3IWPA 4K1GA 2XZ7A 4P2VA 4ROPA 1PDYA 5CGMA 1EUAA 4E0CA 3W87A 1DQXA 3UVIA 2DZSA 1XLLA 3B4YA 4HNLA 4UTTC 1CI1A 3UG5A 2PB1A 4Y90A 4F0SA 3S5ZA 3LS9A 1KLYA 1OX4A 1OFOA 3RO6A 3ES8A 3W23A 2RQSA 3VIMA 4O19A 4GXPA 2Z29A 3UI4A 4U10A 1FXQA 3FW6A 4HARA 3AC0A 2EJAA 1KRAC 2WNQA 2X0HA 4LVFA 3W37A 3L7RA 3QMSA 3UF8A 5FKYA 3CTTA 2V5DA 1NQKA 2QAFA 4JTGA 1KBIA 1BF6A 3VGBA 4POCA 2D73A 3UW6A 1A4LA 3UPMA 3IKDA 4E8GA 1ZLPA 4GLEA 1Q6DA 1NWTA 3UG8A 1N1AA 3MQTA 1O1ZA 2PCQA 4K36A 3Q4DA 4JZ5A 1M7XA 1MQPA 1UWQA 1ZBWA 2F2HA 4UR9A 1PV8A 4O14A 1Q6OA 4E4FA 3VZXA 1D3GA 4J4OA 1RBLA 1X39A 2WPGA 8XIAA 2DZVA 2B4GA 4L65A 3IPWA 2E3ZA 2VGGA 4K1WA 2XSBA 2BFGA 2UV8G 1V6WA 4E4UA 3FEQA 2D0HA 4V1XA 4RKAA 1S2TA 1TWWA 3QY6A 2Z6JA 3G8EA 3S6OA 5HQLA 1G4TA 4DJED 4W9PA 2X09A 2INFA 5IFPA 3MMTA 4J4KA 1PEZA 2M2AA 2I57A 1BSLA 1TE1A 3RR4A 1MW1A 2JEPA 3BXWA 5I6SA 2E9MA 1J9YA 3GRIA 3KWXA 4D6DA 4BQ2A 4E38A 5IDIA 3ONCA 2O9RA 4HNNA 4B5SA 1LT7A 4U33A 1XYCA 2F21A 2PDNA 1HUVA 1YXYA 4JIPA 1KRCC 2DJLA 1PCKA 3QV6A 4GYPC 1P7TA 3W2KA 3MDYB 3WNMA 4WF7A 3SRDA 2HK1A 2WMHA 1ZRQA 1X8FA 1NFBA 4MWAE 1W1YA 3LHVA 4UTFA 2ZKMX 2ZXDA 2ZUNA 1RQHA 3OB8A 3S9YA 3ATYA 3BV4A 4IQ2A 2B81A 3W7EA 3WD1A 4PMJA 1VC4A 2IW0A 3UNDA 3F2CA 3GTXA 4BK9A 3M5ZA 4ONVA 4IGHA 1W3HA 2VENA 2ZUVA 1XBZA 1ZJAA 4Z1YA 2ZUTA 3M4HA 2GOKA 3BANA 3WD4A 3CAVA 4ENLA 4Q7NA 5H1WA 3OPSA 1NEYA 3QHMA 1AK5A 1WV2A 3OA5A 4AC7C 4JX5A 1ESWA 2GQAA 4MZ1A 1VBRA 4G7EA 1PX4A 2A7PA 1YDVA 4WJXA 5A2BA 4Q7IA 5T8GA 1YMYA 2BASA 2DQXA 4IQDA 4DX3A 3M7SA 4F48A 3EAUA 1DIOA 2V5BA 3WQ5A 4BCEA 1P43A 1SMDA 2ZFAA 1VFOA 3FIGA 4ODQA 2AQVA 4YU1A 3TNBA 2E6AA 1XXXA 3QTPA 1KXVA 3L0GA 4DRNA