1SR0A

Crystal structure of signalling protein from sheep(sps-40) at 3.0a resolution using crystal grown in the presence of polysaccharides
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of signalling protein from sheep(SPS-40) at 3.0A resolution using crystal grown in the presence of polysaccharides
rcsb
source organism Ovis aries
molecule tags Unknown function
molecule keywords signal processing protein
total genus 116
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1sr0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1sr0A01
2UY2A 2UY3A 4GINA 2E4TA 3FN9A 2JFEX 2WMKA 1J0YA 2BY1A 3GNPA 4CD5A 4HPHA 3T2QA 1GVYA 4W85A 3BMVA 3ZT6A 5BROA 2YBTA 2XJ7A 4HMDA 1UWIA 3IJ9A 1R8LA 1VIWA 3PZVA 4HOXA 2A3AA 1FFRA 2YBUA 2D3NA 3WD1A 1LG2A 2BY2A 2D0HA 1U33A 4K68A 3AHVA 5IXEA 1SYTA 2FGZA 1UD4A 5CJ5A 4AWEA 1VBUA 2D24A 4QP0A 4WJXA 4JCLA 4CD6A 4UNIA 1OIMA 4C7FA 1E3ZA 4JKKA 1MW2A 3T09A 5CPQA 4PSRA 5A1AA 2WVSA 1CZ1A 3MANA 4P7NA 4M29A 2PB1A 3ARTA 5CLWA 3ARZA 1VFMA 2OSYA 3PZNA 2D2OA 3PTMA 3LPPA 4M8UA 1R7OA 1UD6A 2G3NA 3K8KA 4UFKA 3GXDA 1WZMA 3VD7A 1PJ9A 1OM0A 3VDHA 3VIOA 3MO4A 1WZAA 3VUPA 1WNOA 3CZGA 1Y7VA 1VJSA 4H8UA 1B2YA 1VEOA 1WZKA 3AROA 2VVSA 5I79A 4AZ7A 2AMGA 1E6SM 4C7GA 3K4AA 4FLRA 3W6MA 1ECEA 1MW1A 1YHTA 4MNKA 2X2YA 3QHNA 1W9XA 1UYQA 2WVVB 1MWOA 1WP6A 1E4MM 4MDPA 4AIOA 2CBUA 4HOZA 1QNSA 2A3BA 1VEMA 4PCTA 1C8QA 2QPSA 3BCDA 5GNZA 1JXJA 4AEFA 1H41A 2WKLA 3ARXA 1C7TA 2WZIA 1QNPA 3N1AA 3VIJA 1E6ZA 1H09A 4HOWA 5DMYA 1OD0A 3FHQA 5I2UA 3O6AA 4FLOA 1J0HA 1LJYA 3OGSA 1KQZA 1V0KA 3AQUA 1NH6A 1OGSA 2WVTA 2ZUNA 1BGGA 1NARA 4GZJA 5AC5A 3WY1A 1E6NA 4E2OA 5BXRA 1QI4A 4PMRA 3BCFA 3SCRA 2QV4A 6TAAA 1XCXA 1HT6A 4ZENA 1NP2A 2WHMA 2WBGA 1VBRA 3L4XA 5ABGA 1SR0A 4J27A 1E55A 3SCQA 2WHJA 4Z2KA 4CVUA 1M7XA 3N04A 4D6CA 1OCQA 3WIJA 4IISA 3VIHA 3EMCA 3BAJA 1J9YA 2BVYA 4Z2GA 5JBFA 4J3XA 1JZ6A 3WDQA 4AD1A 1FHLA 1PIFA 2ZX8A 2O92A 3D5HA 1QBBA 4TTGA 3WNMA 2B31A 4DWSD 1PPIA 3GXFA 1WB0A 2EQDA 3SIMA 1C3FA 1EA9C 5A6LA 1HKJA 1V6WA 4AYSA 3WH5A 2WC3A 3NIYA 1HJVA 3I3EA 1B3ZA 3GXIA 3MS8A 2CEQA 4J3UA 2WBKA 4JFVA 4DWSA 3WFLA 2VTFA 4N0RA 1JF5A 1V6VA 1UG6A 3KL5A 1B1YA 1UHVA 4ACZA 4LYQA 3ZR6A 4Z2LA 2UY5A 3VDAA 3WL1A 2V38A 1XH1A 1MQPA 4JFWA 1JD7A 1XYZA 1H1NA 3GTNA 4M24A 1NOFA 1GCYA 1HL9A 3ZMRA 5E6YA 1BVNP 2YL5A 4P7LA 3MKKA 1M04A 1ZBVA 3BAKA 2PWDA 2YA2A 4OOUA 1ZJBA 1JI2A 5D9PA 3WMCA 1H2JA 4S3KA 2NSXA 1MQQA 4HMCA 5JBEA 3KZSA 1CECA 2YLAA 1W1TA 1TCMA 3ZSTA 2CHOA 1V0MA 4J3VA 3T08A 3PZ9A 1E0VA 1OB0A 3N18A 3WD2A 3A4AA 4NI3A 3W28A 3NDZA 1UR4A 4FLQA 2YDQA 2Z1SA 4F9JA 3WN6A 4W86A 4TVUA 1QI5A 1R87A 2CITA 4MPKA 3SCPA 3UESA 4GO8A 1H3GA 1XV8A 2BVDA 3RMEA 1ZBCA 1E5JA 4TVDA 4HA3A 3TONA 3W37A 2YA0A 5M3WA 1CXHA 4JIEA 1XD1A 4JHZA 4PMZA 3AZSA 4LXFA 2VZOA 1JYNA 3AXXA 1J0ZA 1C92A 4D71A 1C8XA 1BG9A 1X6LA 2XSAA 1ZS2A 2W63A 2QMKA 3QR3A 2PI6A 1JDDA 1VRXA 1E6RA 2BXYA 2YL9A 5E09A 2FDMA 4F9DA 3A4XA 4GPNA 1JNDA 4KRUA 1VEPA 3NUKA 3SCOA 3M7SA 1B90A 1XRVA 2A3EA 4CCCA 2V3EA 3AMDA 4CD4A 4QFUA 2ZWYA 5EB8A 3VU2A 2BY3A 1B30A 1CGYA 4MAVA 3L4YA 3TTSA 1BYDA 1MQRA 4JL2A 4WKHA 1UWRA 1WDSA 3II1A 4JCMA 5DEZA 4OZOA 2O9RA 3SURA 2NT1A 2W61A 3T0DA 2BNJA 4WKAA 1UUQA 4WSJA 3RJXA 4CD8A 2J62A 3W26A 4E4PA 3W81A 3RILA 2DSVA 1X1NA 2CESA 5I6SA 2D23A 4JKMA 4PCSA 2WPGA 2BS9A 1GPFA 1HL8A 2VZUA 3UR8A 3WEOA 3PBGA 1BSIA 3PZIA 4KGLA 8CGTA 3OGRA 1JNEA 3CH9A 1GOKA 4UZSA 3PN8A 5JUVA 4W7UA 3PZOA 1JL8A 2VI0A 3GBDA 1LL6A 2VVNA 2PBGA 4HPGA 3EDEA 1ODZA 3OA5A 1W9UA 1ITCA 1UWTA 9CGTA 3EDFA 5D9NA 3SCTA 2WNWA 2BY0A 2ZOXA 1AQHA 5LA2A 3GZAA 1PZ3A 3N12A 1ZBKA 1V3JA 2X0YA 4C7DA 1C91A 4PMUA 3I3BA 3CPUA 1JZ5A 1OINA 2Y4SA 3DYMA 2WB5A 3W25A 5D4YA 4ATLA 3D3AA 3BSGA 1TR1A 1QI3A 1K9DA 4PMYA 1FH8A 1X6NA 1FA2A 1L0PA 2TAAA 1UH2A 5BYWA 6A3HA 1IZJA 2FHBA 1UH3A 3POCA 4P7QA 2JEQA 5BXSA 2EJ1A 4JFUA 1UD3A 3RDKA 4ACZB 1QNRA 3VTRA 4MDOA 5I0DA 1E73M 3VMNA 5JH8A 2O9TA 1FH9A 1GOIA 4P8WA 1LWHA 4AZGA 3W6LA 4P8VA 3GBEA 4UCFA 4DUXA 1ZU8A 4OBRA 3SUWA 3VGHA 3KL0A 1UWQA 4W8BA 4U2YA 4W84A 3AFBA 5CGTA 2ZX6A 2RGLA 4MTVA 4H8VA 2E0PA 2VX5A 4P8XA 4WK9A 2YIHA 2CCRA 2CHNA 3CBWA 3BAIA 1H11A 3VD3A 3WNOA 2GJRA 1QBAA 3K1DA 2WM0A 4WIWA 1EXPA 4PMOA 2C0HA 3N15A 2JALA 4IM4A 1UKOA 2XG9A 4X0NA 1KGUA 1KCLA 2WHLA 5D8WA 4CUCA 1WO2A 1NOWA 2DEPA 4D72A 3POHA 1FFQA 5A2AA 1K9EA 5FD0A 1UKSA 5E9AA 3UCQA 3CZLA 4UOZA 3WUGA 3WDPP 5ABFB 3CZJA 1WDQA 1J18A 1E56A 1SFSA 2GJPA 1N82A 3IANA 3AIUA 1KWKA 4KRTA 1O7AA 4AD3A 1FH7A 1BPLB 1PIGA 3F5LA 1ITXA 2BXZA 5TD4A 2WKGA 1QW9A 4CVWA 4YPJA 2ZWZA 3L2MA 3VD4A 5A94A 5D9OA 2CXGA 1JFXA 1E43A 3GM8A 4U3CA 1E6PA 1JZ3A 3QGVA 1C90A 5BWFA 4OKDA 1JG9A 2VX6A 1RP8A 1J10A 4PRWA 2WYSA 2QLYA 3A6OA 4MJ4A 3W53A 3JUGA 3OZOA 5FL0A 2V5DA 1W9DM 3AHYA 4W8AA 2DSUA 2XHYA 2J75A 4GIAA 3RCNA 2XM2A 3QHOA 2EBNA 1TA3A 3ZJKA 2VL4A 1M53A 1NWTA 3CUGA 2XUCA 3ZJ8A 2D3LA 3EBVA 1WCGA 1GJUA 4AD2A 3VGEA 3LPOA 3M07A 1J12A 1UQZA 3ZQ9A 4W5UA 2QF8A 3TTQA 2J79A 3VGGA 3AI0A 1K9TA 5CSUA 5I24A 3RM8A 3G6MA 4DUWA 2CBVA 3VOCA 2IXUA 4FLSA 1QOXA 3FAWA 4QCFA 1WDRA 2C7FA 2J7CA 1G0CA 1RH9A 1Q6GA 4D6JA 3ALFA 1XGZA 1WKYA 3WL0A 1JDAA 1NWUA 2Y5EA 4ZXOA 5FCZA 1EOMA 3WELA 4TX8A 3W29A 5A6MA 4P7OA 5D9MA 1DEDA 4UOQA 1GQIA 3K4DA 2VCCA 4UQAA 4AMCA 2FHFA 3SCWA 1F4AA 1R7AA 1QHPA 4AEEA 3M6DA 3WBAA 1ZJAA 1EQPA 2ZUMA 2RGMA 4PYSA 5I5RA 1V3MA 5C70A 3AXHA 5HNNA 2WMHA 3AYRA 2GSJA 3O9NA 3MUIA 2GJXB 3WNLA 3AMLA 3UG4A 2YA1A 4UFJA 2FHCA 3WH9A 4PEEA 5DT5A 2X09A 2E9LA 2ZXDA 4PMNA 3PHAA 2AAAA 1PX8A 1B3WA 2GJXA 7CGTA 4V2XA 3VIKA 2IXVA 3VIPA 2Y2WA 2PC8A 2J74A 1B3XA 1OT1A 4LGXA 4JHOA 4DWSB 4BQ5A 3IJ8A 5IDIA 1UA3A 4GXPA 4TVCA 2YOCA 2J7GA 2J25A 4PBGA 2XVNA 1W9PA 1RP9A 4MADA 1FHDA 1HKMA 3WUEA 2W5FA 3W38A 3U7VA 1UKQA 5A8MA 4V27A 3OLDA 5D8ZA 5BXPA 4AIUA 1D3CA 3MMWA 2W62A 1CXFA 2XPKA 4P7RA 5FKYA 1JYVA 3OG2A 4BQ3A 1OWQA 4UTFA 3NSMA 3WNPA 2WMIA 4U33A 2JF6A 1UWSA 4OOZA 4UFHA 1LL4A 1Q6CA 5LA0A 2D0FA 2F61A 3N11A 4U31A 4AD4A 5ABEA 1UR2A 4S3JA 3WSUA 1O6IA 3U5YA 1LLOA 2XM1A 2J4GA 1HIZA 5I77A 2WMIB 3GXMA 1V02A 1KXTA 2DSZA 1U30A 1HKIA 1KXVA 1XC6A 1NOUA 2XFYA 1G1YA 1ESWA 1GJWA 1ODUA 4GKLA 2VX7A 4BA0A 2DH2A 4M56A 2ZX7A 1JD9A 1UKTA 5DF0A 1E71M 1W3LA 2V3DA 1F4HA 1ZBWA 1PEZA 3OB8A 1E0XA 4W89A 1UQYA 1HJWA 4TUFA 4U5IA 5E70A 4F8XA 1XD0A 2VO5A 4UQ9A 3RJYA 3VIMA 3AIVA 1HX0A 1C7SA 3FHAA 1GONA 4ZXLA 4AZIA 3VX1A 2VQTA 5A95A 1MFVA 2ZICA 2V5CA 3KE0A 1GOOA 1BYAA 5I78A 4YN5A 2XVPA 3VD5A 2J8GA 3KWXA 2ZX9A 2XWDA 4IPLA 1V3KA 2F8QA 1EIBA 2V3FA 3ZR5A 2J7FA 5ECUA 4W93A 2JF7A 2CETA 5I23A 1EHAA 1XH0A 2WXDM 1NM9A 3NYDA 4W7WA 1JYXA 3T2PA 2VCAA 2E9BA 3WEMA 4JFTA 3L4VA 1EO5A 3BLPX 5A8OA 2FH8A 4JKLA 2WVVA 3AIBA 2BHUA 3L4ZA 3AXIA 3BXWA 5HPCA 2J47A 3HU7A 3KEHA 1ISZA 1UH4A 5KEZA 3FY1A 1E3XA 2VOTA 3L2LA 1V03A 3CMJA 2WHKA 1KGWA 2XIBA 3TTOA 3TTYA 1US2A 4A3YA 1LWJA 1G01A 2YKKA 4D6HA 1OD8A 2WWCA 3AJ7A 1CGTA 2EPKX 1MW0A 3VIIA 4UQBA 1V6XA 4PTVA 3VGDA 1TUXA 1WPCA 5A6BD 1P6WA 4TX6A 1JZ7A 2E9MA 4N42A 2EXOA 1AVAA 4B3KA 4CN6A 1W1YA 2DGAA 1ISVA 3WF0A 2CBJA 3MUY1 4AZCB 3W24A 1CXKA 1W9BM 2ZX5A 3EDKA 2GVYA 1MW3A 4MJ2A 4AISA 4ZE4A 4FMVA 2AOSA 1WDPA 1HJSA 2VURA 2ZUWA 3AICA 3NJ3A 4B9YA 5BCAA 5EFDA 3WMBA 4AXNA 2VQUA 1W2VA 4JL1A 4AC1X 4NSBA 1OBAA 4MNMA 4BS0A 3AS2A 3IK2A 5A8PA 2J7DA 3OZPA 3VGFA 1WE5A 1CENA 4XZBA 2ZXBA 5DFAA 2OSWA 2VZSA 1EOKA 1HF6A 3QOKA 4KWUA 4JAWA 2ZUUA 1W1VA 1CIUA 1UZ1A 4UQDA 1UR8A 2YL6A 2VUYA 1E5NA 3AZRA 4OBSA 1UKPA 5HOSA 2OWXA 2X8RA 1B3VA 1U2YA 2XVKA 3ARQA 2CKRA 1OSEA 3OBAA 4AZHA 1GQLA 1VFOA 1E4LA 2VR4A 1I1XA 1V3LA 3BC9A 1HJQA 1IT0A 4NRRA 1QI2A 2WZHA 1TG7A 4QLLA 3CHEA 1G94A 2G8ZA 4XZWA 3RO8A 4PMXA 1JZ2A 4H04A 3FW6A 4D6FA 4UFLA 1VFUA 3L4WA 3VMOA 3F4VA 1VF8A 4ML4A 3GH7A 1US3A 3CHDA 1OGGA 3VM7A 1D7FA 3QHMA 4FF5A 3K8MA 1V3HA 2F2HA 2XVLA 4BF7A 2PWFA 3GH4A 3GNOA 4U5KA 4P8UA 2Y24A 3L4TA 5FIPA 4ZFMA 5A2CA 1KXQA 2EPNA 2VMFA 1LL7A 8A3HA 2WZEA 1GHSA 3SCUA 1W9VA 2BHYA 3EDDA 4GI6A 2CNCA 2X1IA 1HVXA 3RM9A 4OUEA 2CERA 3CZEA 3AISA 3VINA 5C71A 4CGTA 4HU8A 1GZJA 3PZQA 5JIPA 3L4UA 2HVMA 1V02E 1W1PA 4CN1A 4U2ZA 3RPMA 1HN1A 1E1EA 2WVUA 1KBBA 1OT2A 1E1FA 3ARYA 3T0BA 1M03A 4PN2A 1CLVA 1CXLA 5A3HA 4D6EA 1W2PA 3BAWA 1CYGA 4DM2A 1W3JA 1H4PA 1J0KA 1KXHA 1Q6FA 2YDSA 4M1RA 1Q6DA 1KCKA 5M17A 2WMFA 3AHXA 1ZB5A 3ARRA 1QNQA 4H41A 3WQ8A 2EPMX 2XFRA 3WDRA 1KWGA 3SUSA 2WAGA 1JFHA 1Z32X 2G3JA 3CZ8A 4AD5A 3AZTA 1EO7A 2YLLA 3CHCA 4IUGA 3WUFA 3PZMA 4D1JA 4QDMA 3CZKA 1EQCA 1E9LA 1GUVA 4M80A 3AS3A 1CXIA 1HNYA 1I75A 3MMDA 1XSIA 2XTKA 1ISYA 4W8LA 5A69A 3EMZA 2DH3A 4TOQA 1BF2A 5LYRA 3WEZA 6CGTA 4HZ8A 4W87A 2DT1A 5GNXA 4ATDA 3DECA 1JAKA 3WKZA 3GH5A 4WSKA 4L4PA 4CU7A 4A3HA 2IUZA 1C93A 3HMCA 2PWHA 2YJQA 3DHPA 5HPOA 3U57A 2D20A 3A3HA 1GQJA 4X9YA 3THDA 3GNRA 2NW0A 5BXTA 3SUUA 4HMEA 3RIKA 1PZ2A 2DIJA 2VCBA 4UQEA 1JAEA 2FH6A 2VX4A 3VO0A 2ZXQA 5IHSA 4UR9A 4E8DA 1BYBA 3OLGA 4MB5A 3PZGA 3PTKA 1UR0A 3S6TA 4JZ5A 1E72M 5CSYA 2WCAA 1GOMA 4BQ4A 2DT3A 5FOOA 4MB1A 5CPSA 2FGLA 4RE3A 1HJUA 2WMGA 3ZO9A 1L8NA 3A47A 3SCVA 2OWCA 3WQVA 3OLEA 3EMQA 4HA1A 3AMGA 3VX0A 3MUAA 5GNYA 4JFSA 2VRJA 3T2OA 4MB4A 2Y8VA 4CCDA 1NWSA 3AHTA 1G9HA 4LQ1A 1FP9A 4HTYA 2WC4A 1CTNA 1WZLA 4ATWA 2E8YA 1VFFA 2DQXA 2PBOA 1MFUA 2XFFA 1LQ0A 1CGXA 2D0GA 3CUIA 4J3SA 1NP0A 1Q4NX 4HZ7A 3BMWA 4J7RA 1W3HA 1IZKA 4PMDA 1JGIA 2GFTA 4J3TA 7A3HA 3M46A 4CU8A 3A4WA 1JXKA 3F5JA 2ZUTA 1AQMA 4PTMA 5A8QA 2E3ZA 2JEPA 5M5DA 2MANA 4HZ6A 2QPUA 4GZEA 1KGXA 1NQ6A 4GZIA 2GDUA 4B3LA 5HDRA 3B9DA 2J77A 4W7VA 4WKFA 1EHNA 4M81A 1NWRA 2WSKA 1CPUA 1QPKA 2WWDA 3ECQA 1S46A 1AMYA 4MAZA 1RD6A 1QNOA 2VZVA 1LG1A 3S2CA 1J0JA 4RE4A 1ISWA 2OSXA 3WQ5A 5IFPA 4PTWA 1M01A 4A4AA 2NT0A 5A6JA 2EO7A 4LPCA 3RM4A 4PUDA 1H0IA 2DT2A 1B31A 3WH7A 4DWSC 4ACYA 4PMVA 2GDVA 3NSXA 3WFZA 7TAAA 5EMYA 5ABFA 5HXMA 1QVBA 4KH2A 1BQCA 4EE9A 3WD3A 3AIRA 1UD2A 3W82A 1VJZA 1UZ4A 2WW5A 3LPFA 3ZJ6A 5E0FA 5CLTA 3VDCA 2XGIA 1GOWA 4TXEA 1UD8A 1CBGA 1A47A 2BFGA 1BVZA 2ZIDA 2WCSA 1AQ0A 1XSJA 3VMPA 4LYRA 1TVNA 4XB3A 5EBAA 1JYWA 4L4OA 4EK7A 2O9OA 1GW1A 1CWYA 1C8YA 1UA7A 1G5AA 3DC0A 4YHEA 3WENA 2QHAA 4XV0A 4CCEA 5LA1A 1GVIA 4HU0A 3VKKA 4PTXA 1WAWA 3WF1A 2G3MA 3W27A 3AS1A 3EDJA 2VRKA 4Z2JA 5AY7A 3G6LA 4RE2A 5AYBA 4WF7A 3IAPA 4J3WA 1PX3A 5A2BA 2DT0A 1V6UA 1BGAA 4D6GA 5GPRA 2CIPA 1W3KA 3DYPA 2YDRA 2DSKA 2WK2A 5CG0A 5IHRA 4Q7NA 1UD5A 1EGZA 1BHGA 4F79A 2CKSA 1JIBA 5BRPA 2XGBA 3WF4A 2GUYA 3CUHA 3OGVA 3WQ6A 1TZ7A 2J7EA 3TP4A 2XIIA 3B9EA 3T0AA 3IAQA 1EDQA 1J11A 3ARWA 1JDCA 3K46A 3AIWA 4AIEA 2WSPA 4GQQA 2OYKA 1Q6EA 4UFMA 2OWWA 3UETA 4H8HA 5CGMA 4V28A 2ZXAA 3MUZ1 2J7HA 1GORA 3WNKA 4AD0A 1TMQA 3OIHA 4J28A 2Z1KA 2OYLA 2VZTA 3VM5A 1HP5A 1SMAA 3FXYA 3PZTA 1XHGA 4R5EA 5A6SA 2JE8A 3NSNA 3W0KA 1JZ8A 1XH2A 1KR1A 3WH6A 2WANA 1EH9A 5DO8A 5A6AA 2BHZA 2YL8A 3WQWA 1EDGA 2A3HA 3U5UA 1TVPA 1CXEA 1K6AA 2DDXA 1SMDA 3ARPA 1H5VA 2WC7A 2W67A 2XVGA 3CIVA 3BH4A 1J0IA 1W91A 4D6DA 2X05A 1JZ4A 2VT0A 2E40A 2O9PA 2W66A 4GO9A 1GQKA 1QHOA 3ARUA 1HKKA 1B0IA 3VILA 4W5ZA 1H0GA 3HJEA 4NRSA 4AZCA 5CZKA 4W88A 1R85A 1DHKA 2EPLX 1KR0A 4ZEPA 4EANA 4TTUA 4DUVA 3DYOA 5CXPA 2EPOA 4ZE5A 4CU6A 4LX4A 1DWIM 4QAWA 1BFNA 3OLIA 4R27A 4GI9A 5CPTA 1OIFA 2D22A 1UOKA 2DSWA 2G4FA 1MYRA 4WLCA 1BLIA 3CTTA 1JF6A 2ZUVA 1PAMA 3WMSA 3CHFA 3AS0A 4E8CA 4X0VA 3WF3A 4QLJA 2VRQA 5HBFA 5BRQA 1KQYA 3UR7A 3ZSSA 3N9KA 1RPKA 3WNNA 1BTCA 3AMCA 1V0LA 3FAXA 1HP4A 3ZT5A 1GOQA 2ZUSA 3UG5A 4BZYA 3WUBA 2GK1B 3CUJA 2DPEA 1FP8A 3WH8A 1R86A 3FNDA 5A6BA 3W4RA 3VNYA 3QOMA 4QCEA 3IJ7A 3AYSA 3CO4A 3F5KA 4MNLA 3WBEA 1IV8A 2UWFA 1CDGA 3VNZA 3SEPA 2GK1A 5I3DA 1UR9A 4IPNB 1DWGM 2W92A 4GI8A 3BSHA 2WCGA 1OGBA 2W91A 3N17A 1KB3A 1E6QM 3PTQA 1MXDA 4AZBA 1HXJA 4H7VA 3B9AA 3VGBA 4AY1A 2WMJA 3O2LA 3MMUA 4PSPA 3WD0A 4QLKA 2JIEA 3ZIZA 2OLHA 1MXGA 1PBGA 3ARVA 2CBIA 1XYFA 1D2KA 5AC4A 2VC9A 2CPUA 4KGJA 1BYCA 5EFFA 3I3DA 4LYPA 1QW8A 5KZ6A 4AZ6A 2C8NA 1PX4A 3CMGA 4XX6A 3VIGA 1E70M 3ALGA 4CN4A 1E6XM 3BAYA 1ZL1A 3BAXA 1V6YA 4H2CA 1BAGA 2PWGA 3HN3A 4UFIA 4CKQA 1VAHA 5ABHA 2J78A 1A3HA 2PF0A 1DTUA 2ZE0A 3VIFA 5JBDA 1V3IA 4OJYA 2W4XA 3SUVA 2J7BA 4B16A 1CGUA 1YQ2A 2BVTA 1DWJM 2E8ZA 4XUYA 2QMJA 2JIWA 5F7UA 1DWHM 3BGAA 3AMKA 3MSGA 1W32A 1DP0A 2PWEA 2VJXA 3CLWA 2D1ZA 5A6KA 3VPLA 4GQRA 4U3AA 1CEOA 4EAMA 3B8SA 2XWEA 3WQ4A 3UEQA 3J7HA 1UR1A 5DT7A 2Q8XA 3ZJ7A 2CYGA 3VDBA 3GDBA 3U7BA 1TFVA 5E6ZA 5FL1A 1TA3B 3NCOA 3EYPA 3PZUA 2EEXA 1E4NA 2VNCA 3GYCA 1JI1A 2XSBA 1HJXA 1VENA 1K9FA 3SCSA 3AIQA 1B9ZA 3MV01 4D1IA 1E40A 4Y7EA 4NF7A 3WDHA 5A8NA 4HA4A 4MB3A 3LMYA 4F66A 1UWUA 4AZ5A 3WDJA 3UG3A 2G41A 4B15A 3K8LA 1KBKA 1V0NA 1DWFM 1CGVA 3WD4A 3WDIA 3TOPA 1CGWA 5AYIA 4KMQA 2DIEA 5M03A 1LF1A 1MVYA 1QI0A 4BQ2A 1E4IA 1FOBA 3CGTA 4M82A 4D6IA 1QHZA 1BG4A 5GQBA 1I1WA 3BLKA 4AW7A 3AOFA 3APGA 1TE1A 2J8FA 3NDYA 1CNVA 4DM1A 5JIWA 1EDTA 3MV11 1KFWA 1J01A 3SCNA 3ZT7A 3VVGA 3LPGA 4Z2HA 3AIEA 4B9ZA 4PMQA 2XYLA 1B3YA 3DHUA 3N13A 4Z2IA 5CQ1A 4UZUA 4NZCA 3CUFA 3KL3A 3MU7A 4HP5A 2Y8KA 4UOJA 2OYMA 4OIFA 4BCEA 2HISA 2WLYA 5C8BB 1H49A 3AHZA 2BV9A 3WF2A 4CD7A 4UQCA 2VR5A 3VD9A 4RL3A 1XCWA 2A3CA 3THCA 2X0HA 2G3IA 5E0CA 3TA9A 3SUTA 3UERA 2ESCA 1GHRA 1CLXA 4Q22A 1HVQA 1DWAM 1E0WA 1E15A 3ARSA 2V3GA 3ZM8A 4EKJA 1GNXA 2UY4A 1ISXA 5IFTA 2WLZA 3E1F1 4MNJA 3MSDA 4YHGA 1VB9A 1V08A 4FK9A 3ZOAA 4PUEA 1XSKA 4URIA
chains in the Genus database with same CATH superfamily
2UY3A 4LUIA 2E4TA 2VM8A 1J0YA 1OK6A 1RBAA 3GNPA 4AHOA 5BROA 3KDNA 3T0CA 4K6AA 3RFAA 4IJCA 1UWIA 4PRTA 2LJ4A 4G2PA 1EJSC 5HJYA 3TROA 1VIWA 4IFKB 2A3AA 5JH2A 5AHEA 2CLPA 2E6AA 3UNTA 1PINA 3PBMA 2BY2A 3QN3A 5TNVA 4N9EA 5IXEA 1SYTA 1Q7QA 1V8EA 2B7PA 3RO6A 1VBUA 2D24A 3CWNA 4WJXA 3TFXA 4DXKA 3K1GA 3T09A 3S0CA 1LP6A 5CPQA 3LLDA 1R9HA 2YB1A 4M29A 1OY0A 1XISA 1XIJA 4LY8A 1ZAJA 1VFMA 3MDYB 1CW2A 1C9HA 1IEXA 3SO7A 3PZNA 4M8UA 3WLMA 3NQ8A 3K8KA 1K7XA 3Q58A 1AODA 2W3ZA 2PDLA 4RW5A 1HFBA 3A23A 3VIOA 2NWSA 1VC4A 3LMZA 2HMCA 1Y7VA 2DZAA 2YFOA 3B0YA 3EX2A 3O5PA 3HOJA 4GVIA 3A21A 2D73A 5FF3A 2GQAA 1B2YA 3KCJA 4O1CA 3AROA 2PDXA 2VVSA 4PB4A 1SW7A 2QUVA 5I79A 4AZ7A 2AMGA 1ADDA 3BTNA 3IV3A 2EG6A 4C7GA 4FLRA 4NNCA 3RX4A 1MW1A 1JPHA 1YHTA 2NQJA 5IRPA 2X2YA 3MTWA 4H9VA 4BK9A 1HUVA 1E4MM 2J88A 4DZIA 3I4EA 5K4ZA 2YDAA 4H1ZA 2Z4GA 4MOZA 2DY3A 4FR6A 3UGRA 4US5A 1E0UA 1GEHA 4HOWA 1OD0A 1ZCNA 1H7WA 4FLOA 2FPYA 1LJYA 4B2DD 1KQZA 1V0KA 3AQUA 3DFTA 3URBA 2V5LA 1Q65A 1BGGA 1NARA 2I1OA 3QW4B 4KPLA 3WY1A 3RRXA 3NRKA 4E2OA 2PDYA 6TAAA 3UQAA 1R47A 1RA0A 2ZDSA 1NP2A 1LOSA 4FOKA 1F05A 1TCOC 2WHMA 1UIPA 2CLIA 3M7WA 4R33A 3SCQA 1CB7B 3ATYA 3I6RA 1RCXB 1DQXA 5FESA 1J9YA 2BVYA 4JTCA 1YPXA 4YCOA 5C2GA 4Z2GA 4KFNA 4FR1A 1XF0A 2FZMA 3D5HA 1QBBA 5AHNA 4NG3A 1JEZA 3V75A 3WNMA 3W7NA 1WB0A 1AJ0A 2EQDA 4ZOAA 5CZJA 3SIMA 4DJDD 1SVDA 3LM3A 3FSTA 3I3EA 3GXIA 2CEQA 4U4MA 4RE0A 2VEGA 2INFA 4FI4A 1LDCA 1AW5A 2EKGA 1FWGC 4UUIA 4Z2LA 1FWCC 2DQWA 2UY5A 3I6EA 4BHYA 3H12A 2NLIA 3NTPA 3BG3A 1XH1A 1H1NA 4M24A 2M08A 1HL9A 3KFTA 4ZO9A 1RLCL 4H9YA 2YL5A 1W17A 1M04A 4OVXA 1S2TA 4DJEA 3HTWA 4M7TA 1D7HA 1OC6A 5CG7A 3M5YA 1MQQA 1D8WA 1FRBA 5JBEA 3KZSA 3BICA 2KGJA 2YLAA 4P2VA 4NP7A 4B4HA 1F8MA 3D3FA 3FGCA 2ZQUA 4X2RA 3RG6A 4X22A 2O4QA 3IACA 4NI3A 4FX8A 1SO4A 3W28A 3SGGA 1D8CA 5K9DA 1A5SA 2PD5A 3INPA 4IWWA 4AF0B 3E2VA 3GS6A 2VHLA 3UESA 1TTIA 4KWWA 1H3GA 1XV8A 1Q66A 2BVDA 4XD4A 3P82A 3EKZA 4ZODA 3WQDA 3N4EA 4TVDA 4HA3A 4LAVA 2PRHA 4KIEA 3W37A 4ML9A 3VABA 3BPWA 3MW7A 1C9WA 2WSRA 4PUWA 3GDTA 4LXFA 1O4UA 2FTPA 1SZEA 2QJJA 1J79A 1RJQA 3DXIA 2DIKA 4YCPA 2NQLA 1UB3A 1JGMA 4S1FA 1ZPTA 1TWSA 2H8XA 4ROPA 2FDMA 4HYRA 3A4XA 3B4YA 1AH0A 1JNDA 1ZRQA 2SFPA 3SCOA 4NAEB 3PBYA 4DZHA 2KAUC 3CNYA 1GTEA 5EB8A 4G56A 2BY3A 4QRNA 1BYDA 3W75A 4XZHA 3NM1A 1WDSA 1QOQA 4AU0A 4F48A 3UJRA 1ZSXA 3N4AA 4IQLA 2NT1A 2QKFA 1UUQA 1S1RA 4LS0A 2BB0A 1FVPA 4TV6A 3TA6A 1R9ZA 2CLOA 4DJEC 1S38A 4PCSA 2WPGA 2BS9A 4DRPA 3HPXA 3S2JA 3WQFA 1HL8A 3S2MA 5CC7A 4PUUA 4AWTA 2PDWA 1BSIA 4G2DA 1XIEA 8CGTA 2IKHA 3CH9A 3KCEA 1W37A 3WK2A 3PFMA 3Q37A 3CEPA 2VI0A 1W5MA 4DN1A 1ZLPA 4HPGA 4ODLA 3LLFA 1UUMA 4O15A 3ZR4A 1XKJA 3CQKA 1UWTA 9CGTA 2W27A 3EDFA 3SCTA 2OPJA 3PAJA 3MT1A 4WHBA 2DG4A 4AAJA 2YCJA 3O63A 5DY2A 2PFHA 1F8AB 4C7DA 1C91A 4Y2WA 4PMUA 5C9ZA 3H9RB 4AVNA 2PPNA 4ZQPA 1OINA 3R13A 2WB5A 3M0JA 5D4YA 5L9FA 3D3AA 3TLQA 4C6JA 1TR1A 1QI3A 4IFRA 1FH8A 3CV2A 3OYXA 2OMAA 1POKA 3FA5A 3B8TA 2VWTA 3KBJA 2GJLA 2TAAA 6A3HA 4HU3A 2FHBA 1EIXA 3GC5A 3POCA 5E0KA 1LTDA 3DN5A 3W7QA 1UD3A 4UTTC 4AX7A 4JTKA 3PJWA 3GXTA 4LV9A 2ZVRA 3ABRA 1R3RA 2A85A 4P8VA 2PDJA 3MHUA 3W6LA 4B91A 4DUXA 4OBRA 3UY8A 4KKXA 3KL0A 3KRZA 4W8BA 4W84A 1TELA 3FK4A 5CGTA 2ZX6A 2YFNA 2E0PA 4P8XA 3LCWA 1FWEC 3BAIA 2CLFA 1H11A 3ABZA 4J4OA 3K1DA 4WIWA 1H7XA 2JALA 4FIRA 3UA3A 4IM4A 2XG9A 1ML1A 1WO2A 1NOWA 1DJYA 1XBVA 5K7JA 3VZXA 2DEPA 3LS9A 3POHA 1DOSA 4XVDA 3NQ6A 1K9EA 5FD0A 3OP2A 3O5FA 3Q94A 5E9AA 3VA8A 1KM2A 3IKGA 1QZ2A 1VYSX 3CZJA 4GA8A 3IANA 4E8GA 3CUXA 4L65A 1O7AA 4AD3A 4UR8A 3GHRA 3STPA 1VBGA 3HIJA 5F2MA 3L2MA 3FYPA 1F61A 4UR7A 2J13A 3CEUA 4L1XA 1P0BA 2PF8A 5BNKA 1IE7C 4IX0A 3PJUA 5BWFA 1XIHA 2BZNA 3P80A 3MKVA 3RYSA 1TTPA 4OKDA 4PR4A 2VX6A 3RFWA 4RK8A 3DFSA 1M41A 5DLCA 4LVGA 2GOUA 4YU1A 4Y90A 2V5DA 3FEMA 3DEQA 1D9EA 1W9DM 4N02A 1IEIA 2DSUA 3VFLA 3QHOA 4B5TA 3ZJKA 4DBSA 1M53A 3B06A 1KRBC 2XUCA 4PBFA 4S3BA 3EBVA 2UV8G 4S3DA 4RXFA 1UQZA 1Q3NA 1J4IA 4W5UA 3UG8A 2PPGA 1UIOA 3VGGA 2HV5A 5HWJA 3AI0A 1K9TA 5I24A 1KT0A 1YEYA 3NAVA 5G4EA 3G6MA 1KFLA 2CBVA 2YZRA 2YCEA 2D2JA 3L68A 5HANA 3T6CA 4H01A 1UW9A 3N73A 5D09A 5AC6A 1WDRA 3VOIA 3RNDA 2PP0A 2J7CA 3BGGA 4IG2B 5DMNA 2FVLA 4UTIA 1XGZA 4JTIA 1NWUA 1NELA 1S5VA 5FCZA 4TX8A 5EMMA 5D9MA 4X2PA 1DEDA 2VCCA 4UQAA 3RUBL 3AYVA 1L1PA 1K8ZA 4WJEA 3IK4A 3PWIA 1GVSA 2X1SA 1QHPA 3T1GA 3UCCA 4D9PA 3PS7A 1QASA 4DY1A 1A53A 3PR2A 2J6XA 4D8AA 4PYSA 3NPWA 3AXHA 3EA2A 2VR2A 3C2YA 1IWBA 4Q8VA 1VJIA 2WMHA 1DTNA 3AYRA 3G22A 4B90A 3W84A 4A6GA 3O9NA 5CSRA 4GIRA 3N19B 4PEEA 3SRFA 1XLCA 3ODKA 1R46A 2G4JA 1EX1A 1W0MA 2ZXDA 4JIIX 3GWQA 1GEQA 1PCKA 1XDJA 7CGTA 4V2XA 3VIKA 4E38A 5HJXA 2Y2WA 2CW6A 4V1XA 1LT8A 2DUXA 2OELA 3TR2A 3FOKA 4DWSB 3R10A 2Q5AA 3W87A 1AL8A 1UA3A 3ES8A 2OZTA 2YOCA 1TCDA 3DH7A 2NX1A 4PBGA 3UU0A 3M1ZA 2H3DA 4MADA 1FHDA 4ZBCA 4Q7BA 3W38A 2QV5A 5HKGA 3U7VA 1UKQA 1ITUA 3KS6A 4NNBA 3G0SA 3OU8A 3FSUA 3OLDA 5AKQA 5D8ZA 4CCZA 4AQLA 4AIUA 1D3CA 1I8JA 2P5NA 4F0KA 3MVTA 3H23A 3GU2A 4ADTA 2Y85A 2JK2A 3GG0A 4GJJA 4UTFA 4JS3A 3WNPA 1W5NA 2ZYFA 2JF6A 2Z25A 1Q6CA 2Q8LA 1GTHA 1ROUA 3N11A 5LA0A 4U31A 1W1IE 1I0BA 1AZ1A 3G1SA 3U5YA 4GISA 3N4FA 2J4GA 1TVLA 2Q3RA 5I3FA 3GKAA 2DSZA 1NOUA 1GOXA 3GTIA 1F9CA 2XSXA 3T05A 4IMGA 4XG1A 4RPPA 1IX5A 4PUKA 4BA0A 3H4XA 2ZX7A 5F2GA 1R2TA 3GVGA 3QV7A 1UKTA 5DF0A 3PBVA 1P0KA 5HWBA 1TX0A 4HHHA 1E0XA 3TQPA 4TUFA 2CLMA 3N3TA 3KUMA 7PTDA 2ODOA 3VIMA 1JR1A 1PO9A 4TNSA 4BEQA 4QZVB 2VQTA 4L6HA 2V2HA 1R3WA 2YPIA 1BYAA 3WQGA 2OLSA 3N2MA 2ZTKA 3HURA 4YN5A 1ALDA 4YVVA 3QKEA 1SFTA 4FIQA 3IIVA 3FJNA 3W83A 3ZR5A 2J7FA 2I9UA 4FSAA 2JF7A 4DF0A 1XH0A 1NM9A 4N4QA 1M6JA 3OVRA 1XLDA 2QYGA 1JYXA 3H2FA 3NL3A 5D2XA 2IKIA 3L5MA 3WLHA 1O12A 4LUTA 1TJ0A 3WEMA 3CB8A 5A8OA 4Q33A 3KZ7A 3CQ0A 1XIBA 2ANUA 4EXQA 3ENLA 3HMJG 1RAKA 1XCFA 3W72A 2A2IA 3RU6A 1ISZA 1E3XA 3C3UA 4HPXA 3L2LA 1V03A 2VUNA 3CMJA 6TIMA 4LRTA 5SWUA 4EVZA 5HMEA 2OQHA 2QT3A 3F1QA 3UJEA 2ISSA 2WWCA 4A3RA 3AJ7A 3CUZA 1CGTA 1MW0A 4E6MA 4MLJA 4HGXA 4B5XA 1YDNA 1TUXA 3CV7A 1WPCA 1SJAA 1BRLA 1XG4A 1H51A 2E9MA 6ENLA 4N42A 1AVAA 4LOCA 4CN6A 1ISVA 3UWVA 1CXKA 3NZ1A 2GVYA 1MW3A 1FKIA 4MJ2A 4PUJA 2HVNA 4AISA 4ZE4A 1LWIA 4FXJA 4C6PA 3UP8A 2RUDA 1XS2A 2ZUWA 5BCAA 1DPMA 5AVHA 3M4HA 4JL1A 4MNMA 4BS0A 5A8PA 2QPXA 4NZ4A 3OZPA 4AIBA 1R2SA 3GNXA 3PA7A 4HNNA 5I3JA 5DFAA 2GGIA 2NV1A 3LNMA 4JAWA 2Q8ZA 1VYRA 2PDUA 4XBKA 3U3HA 3N6JA 2VUYA 1BXCA 3AZRA 1DIDA 1UKPA 1B3VA 2P53A 1U2YA 4ZO8A 2FKEA 3KRSA 3L21A 2CKRA 1MXSA 3GO2A 1I1XA 3C2FA 1HJQA 1IT0A 1KM3A 3U2CA 3SZ8A 4V33A 4NRRA 3N2OA 4JNMA 2LPVA 2WZHA 4QLLA 3CHEA 1G94A 4C1LA 1TPH1 2RDUA 4PMXA 2CU0A 1JZ2A 4H04A 2E25A 3VMOA 5KINA 1LM1A 2ZRUA 1OGGA 3VM7A 1D7FA 3K8MA 2E67A 3W6YA 1V3HA 2XVLA 4BF7A 2YCKX 2PWFA 3GH4A 1A3WA 4PL1A 1PHWA 1VGAA 2ISDA 3GXPA 3PC0A 2CC0A 4ZFMA 2VMFA 3RPTA 4NUWA 2C13A 2QDGA 3IUIA 3OVPA 1LUCB 1W9VA 3CL6A 3BK0A 4D8ZA 3EDDA 1SO5A 1RVKA 1F8IA 1I60A 3OA3A 3VINA 1CT5A 1GZJA 1KM6A 2HVMA 1W1PA 4CN1A 4ZA0A 1X6UA 1YNPA 1E1EA 2WVUA 2W79A 4FX6M 3SSZA 1JCLA 4Q4QA 3FVDA 1CI1A 3T0BA 4H9MA 5A3HA 4D6EA 1OFEA 5EMJA 2PLCA 4I7VA 2DVTA 4DAIA 1CYGA 2HTMA 1ME9A 1KXHA 3QGKC 4M1RA 3K13A 1SJCA 2GUUA 3LXBA 4W9OA 2C3ZA 4H8NA 1KWGA 2RUSA 2WAGA 1JFHA 4AD5A 4JTRA 3KAFA 5T91A 4Q6XA 3BJSA 3LHUA 1U83A 4QDMA 3CZKA 1E9LA 1UROA 3KVJA 1LQ2A 2VDGA 3MMDA 3CT7A 4ZO6A 2XTKA 3SSJA 1ISYA 4FAMA 3O5RA 1DJGA 2H9AA 4W8LA 2PZ0A 1K1DA 3PPGA 5D05A 4W87A 1EB3A 1FBAA 3DECA 3IJ6A 1TRIA 3UFYA 4QR6A 4O10A 4QBXA 3S9IA 1C93A 3EWZA 3HMCA 3H2MA 4ERGA 4S23A 2D20A 2QUMA 4C6MA 1O95A 3A3HA 4OECA 3L2IA 4X9YA 1GQNA 1GW9A 3P84A 3GNRA 2OQYA 3SUUA 2R91A 4HMEA 2DIJA 1E1CB 3C0SA 4X60A 3GAYA 1BYBA 3OLGA 3S6TA 1M3UA 4IPPA 3SR7A 3PAOA 1LRTA 2EJAA 3GVRA 4BJHA 2QUUA 4RE3A 4MY1A 4NASA 3EMQA 2NXIA 2HK0A 4GGQA 3MMTA 3MUAA 2DW7A 3VNJA 2REQA 3GK0A 2P50A 2Y8VA 1NWSA 2JKAA 3H2OA 4M6UA 3TWBA 2PP1A 1XUZA 4HTYA 2WC4A 1VFFA 4JTDA 4HPJA 4LCRA 3TIMA 3REQB 1CGXA 2BX7A 2D0GA 3JRKA 3RR1A 3GU0A 3IIXA 2HROA 2Y89A 3BMWA 3NO1A 1I2RA 4J7RA 3BQ6A 1W3HA 2WJZA 1IZKA 1J2WA 3LBOA 1JVWA 4J3TA 4JFIA 3STGA 4CU8A 3A4WA 1KLZA 3WJZA 4BI7A 1G67A 5M5DA 1IXQA 2DUAA 1DQWA 1NQ6A 3W23A 2GDUA 4B3LA 4XD6A 4LF1A 2J77A 4W7VA 5CSSA 4M81A 4CQCA 4ZOCA 1QPKA 4KWVA 3M41A 1M65A 1X98A 3SY1A 2DZVA 2VZVA 4Q8MA 2CLLA 4TMBA 1ISWA 1F3XA 3WQ5A 4LSBA 1M01A 2X7VA 1L6SA 4O54A 2NT0A 2NVCA 4LPCA 1UP3A 4MJZA 4ACYA 2OU4A 1Q13A 4XIAA 4FO4A 4IH3A 3W7DA 3B8IA 3PNZA 4GYPC 2CLEA 4KH2A 4NIRA 4EE9A 4H3DA 3DFYA 3AIRA 1VJZA 1F3EA 2WKJA 2KX9A 4GYJA 3CH0A 5E0FA 1PDYA 2VWSA 3W7JA 4XO6A 1CBGA 2BFGA 1BVZA 4FN2A 2F23A 1TSIA 1AQ0A 1SJDA 1TVNA 4S39A 5EBAA 4EK7A 3BANA 1DJNA 1CWYA 1AQFA 2ZZ4A 2OX1A 1KNWA 5RUBA 5T9CE 3N3MA 4Q4KA 4YHEA 2QHAA 3WENA 4CCEA 5LA1A 3TQVA 1ONRA 3A9BA 3C2EA 2V82A 1IGWA 3EDJA 4JEJA 4AHQA 3B8UA 4Z2JA 3NNTA 3OQEA 5D03A 3UXDA 2A7PA 5KTLA 4RE2A 4YJ5A 4N4PA 4WF7A 3IAPA 4J3WA 2V8ZA 2DT0A 3QY7A 3RAOA 3FJ4A 3C2RA 2YDRA 3V36A 2WNZA 4DJDC 3TN3A 4EAYA 4Q7NA 3QZEA 2CKSA 1JIBA 3RCYA 3WF4A 3EAUA 5K9CA 1TZ7A 2WZMA 1XYBA 4ZTYA 4Z1YA 3CV6A 4M6PA 3W3OA 3S6OA 3T0AA 3WLJA 5DMLA 3WK1A 5DXXA 4C6BA 5GPGA 3NQCA 5LHFA 5IOBA 2OWWA 2OYKA 2POZA 1K4GA 1VKFA 4I6VA 3MUZ1 3KOZA 4AD0A 3C6CA 2OT0A 3WLKX 4IQCA 3W74A 1NDWA 2OYLA 3ZVHA 3HPSA 4L56A 4HD5A 5KSWA 3UW6A 2C14A 2V0TA 1HP5A 3A3WA 1SMAA 3FXYA 3NR0A 1ZUAX 3PZTA 1OX4B 3IIOA 3NSNA 3SGZA 1ROTA 1XH2A 1KR1A 2X40A 4IJBA 1TPWA 3E02A 5DO8A 1OQFA 5KZMA 1KFEA 3EOEA 4G5DA 2BHZA 5F2IA 1DXEA 3WQWA 4Q32A 4UTLA 3U5UA 1CXEA 3KOXA 4ONVA 3LSBA 1V93A 4F4RA 4XAYA 4IL0A 4LS1A 5HJLA 3CIVA 1J0IA 1W91A 3H70A 3A4JA 2R94A 3QV6A 3PULA 2X05A 1JZ4A 2VT0A 2XP6A 2W66A 1VFLA 3BLEA 4RDZA 5EU9A 1B0IA 1JDFA 4W5ZA 3OJGA 4AZCA 1Z7AA 4WJ8A 4QNWA 1UMLA 4W88A 3C56A 3H2EA 4ZQOA 1TO3A 2XH4A 1TPEA 1R85A 4Y96A 4EANA 2BGQA 3BMBA 1U79A 4TTUA 5HNTA 5CPMA 4LANA 4DUVA 4N6EA 4ZE5A 4CU6A 2Y8UA 4HK7A 3H54A 3OLIA 3SJ3A 1OIFA 2D22A 1UOKA 4M6VA 1MYRA 2B7OA 3B4UA 4WLCA 1K03A 3SW6A 3CTTA 1JF6A 4IJRA 2QCDA 2PDBA 2YW3A 1PAMA 4Q8NA 5A8GA 3CHFA 3EA3A 5B7ZA 3MWAA 2NQ9A 1XL9A 3UR7A 3N9KA 3TWAA 2PS2A 1HP4A 3TZNA 3ZT5A 3UG5A 3LV5A 3LRMA 5HWCA 3WUBA 4XIMA 4QG6A 5F1VA 1JCHB 5GJPA 4UXDA 1R86A 3IJ7A 1E1CA 4JX5A 1S2VA 3F5KA 1GG1A 1CDGA 3I6TA 1XGDA 4GCXA 4I5RA 4H83A 4IPNB 1DWGM 3BSHA 3V0SA 4YTRA 2QDHA 2GZXA 1KB3A 4QHRA 4GUHA 1A0CA 1IHIA 2W6RA 2EGZA 1MXDA 3GVVA 3OBEA 1CCWB 1VHNA 2BDQA 3GIQA 2FFIA 2WMJA 3DG3A 4NXKA 3AXMA 1SW3A 1XINA 3S4TA 4YNGA 1W5QA 3GVWA 3UYCA 3BLIA 1XLEA 1PUDA 1MXGA 4HNCA 2CBIA 5LKYA 1D2KA 2O7SA 5AC4A 4RZBA 5EFFA 4RLIA 3I3DA 4G7FA 4DBUA 2TMDA 3VOGA 1X8FA 3XIMA 2KO7A 1X7IA 4ZOBA 4XX6A 3W9ZA 3MWCA 4DO4A 5G4WA 5HUOA 2AGKA 4IP7A 3HN3A 4UFIA 4CKQA 1VAHA 3G8RA 5ABHA 2J78A 4ILSA 5JBDA 1Z8AA 3LQLA 1V3IA 4DF2A 1GJPA 4OJYA 2J7BA 4B16A 1IT8A 3EWYA 2BVTA 2E8ZA 1QAPA 1XLJA 1DV7A 1Y5VA 3BGAA 1G7VA 2Y5JA 1BVWA 4PZVA 2X0SA 5AOUA 2VJXA 2AQWA 5MKGA 3PR9A 4MYAA 2D1ZA 2R9RA 5A6KA 3P74A 3N2XA 1JNTA 1EFZA 3B8SA 4JTAA 2QCLA 4ZQNA 1UR1A 3FFSA 3THAA 2Z2BA 2CYGA 4K2SA 3VDBA 3GDBA 1JVNA 2HBVA 1FKKA 1ZFJA 3ITVA 1KM5A 1TPVA 3PZUA 3BARA 3ZZ1A 3L23A 1HJXA 1ECQA 2R1MA 1GYLA 3W7EA 4S2CA 4D1IA 3SQMA 4Y7EA 1GVFA 1DIEA 1RSCA 2YYTA 3QC0A 4HA4A 2C71A 4QJ1A 3OVQA 3UNDA 4BFAA 1TWDA 2FIQA 2QQ6A 1HW6A 1KT1A 5GVJA 2GGGA 3TOPA 5M03A 1LF1A 3MDUA 1H7PA 2QVNA 4XAFA 2WSQA 2VFHA 4BQ2A 1XLKA 1E4IA 5I07A 3UWWA 4ZS6A 1QHZA 1BG4A 4RW3A 4AW7A 1Q4WA 3APGA 3B0VC 5EPDA 1ADOA 3UJSA 3FVMA 2HE8A 5G2IA 2J8FA 4JBRA 3TSMA 3NDYA 2PUZA 3DDMA 4XTIA 3ANVA 3I65A 1EDTA 1J01A 3W7OA 3SCNA 3VVGA 3AIEA 3LHYA 1PIIA 3FDGA 2DJLA 3ICJA 1GT8A 4C6IA 4O8AA 4DZ5A 3PWAA 4UZUA 4NZCA 3KL3A 3EWBX 2Y6ZA 4H9TA 4QIBA 2Y8KA 2A1YA 1QO5A 2OYMA 4BCEA 3IGUA 3QPEA 3KRBA 5CC5A 3AHZA 3V7PA 5HUAA 4UQCA 2VR5A 1XCWA 3QSTA 3S5SA 1O1ZA 2G3IA 1GHRA 4PUNA 1LOLA 4Q22A 1FKSA 2A21A 3PB0A 3C0LA 3IUHA 2OXNA 3ABOA 5IFTA 1VB9A 1V08A 4DBEA 3KW3A 3FS2A 4QTGA 3A22A 4MY9A 4HJFA 3NXFA 4URIA 2UY2A 4GINA 2JFEX 1Z41A 1O5RA 2H6RA 1PCWA 2E7FA 4DEFA 2N87A 3BLLA 4W85A 2CFFA 3BMVA 3ZT6A 2YBTA 1GWJA 4GIYA 5HWMA 2Z29A 3M0XA 1EPXA 2FDSA 2J27A 1FFRA 3BCJA 3EA1A 2D3NA 3ZLHA 4F0LA 2D0HA 3HB9A 3IJLA 2Y62A 3RX2A 2YBVA 3AHVA 1FKHA 1V77A 4Q8WA 3URQA 1Z9AA 3FIGA 2V67A 1E3ZA 1QMLA 3LRLA 4JKKA 1MW2A 1SFLA 4PSRA 5A1AA 2WVSA 1CZ1A 3UXIA 3MANA 4P7NA 1EJRC 2ZQVA 4TW8A 4GJIA 2DJXA 3QM3A 2OSYA 3ABSA 3LPPA 3R79A 3VD7A 1PJ9A 2QJMA 2LGOA 1OM0A 3VDHA 4GNKB 3VUPA 1WNOA 1KFBA 2I5QA 3UWZA 1VJSA 3VNIA 4NY2A 1U1JA 2OODA 2DVUA 5HNUA 3S1XA 3VZYA 3ATZA 1Z6KA 3S1WA 3KCLA 3W6MA 1ECEA 3MI3A 3N34A 4QITA 1OCBA 3TN5A 4ORIA 1ONWA 3D6NA 2V30A 4R88A 4AWUA 4DJED 5JQ9A 4L5ZA 3FAPA 4MDPA 1QPNA 1QNSA 3DGBA 2AMXA 1VEMA 2HZGA 1C8QA 1W1ZA 5GNZA 1DQUA 4AEFA 1BRLB 2XDFA 3W76A 1C7TA 2WZIA 3N25A 3N1AA 2FFCA 1XIIA 2CWNA 4RPQA 5LIUX 4UDMA 4MZYA 4UNLA 4X9SA 5DMYA 4UTMA 3FHQA 3NO3A 2WNNA 4PA8A 2QEZA 3O6AA 2H3BA 3ABQA 1SQ7A 2ZUNA 2YB4A 3FDKA 5BXRA 3M0ZA 4YIWA 4C6KA 4PMRA 3BCFA 2I17A 1XCXA 4I8YA 4LW7A 2WBGA 1SR0A 2Z6JA 1W6TA 4J27A 4L4MA 4NX0A 1TUFA 2WHJA 3R94A 4D6CA 1OCQA 4HYVA 4ZMGA 4H7ZA 3DGRA 4O8RA 4CQ9A 2PBCA 1J5TA 3TCZA 4GY7A 3WDQA 2FPTA 2VFEA 4AH7A 2ZX8A 2O92A 3T0TA 3GXFA 1PPIA 1DIKA 1C3FA 1EA9C 2PSNA 5A6LA 4O1DA 1QO2A 4EXBA 2PU1A 4LAWA 4YTTA 4NAEA 3NIYA 1HJVA 3KOWA 1DL3A 1B3ZA 1LT7A 1UPMB 3W1NA 4JFVA 3UY7A 2VTFA 1K8CA 5CJMA 1Y5XA 4IIHA 3W7RA 1UG6A 4R7OA 1FWAC 1B1YA 2FZ8A 3STCA 9RUBA 1A50A 5FSDC 3WL1A 1XYZA 3GTNA 4K8GA 1GCYA 3ZMRA 4IGSA 5E6YA 1BVNP 4O13A 3C0QA 1ZBVA 1P7TB 5D9PA 3WMCA 4S3KA 2JGYA 3ONBA 5FF2A 1GVQA 3G0XA 3WH0A 1M5WA 1CECA 3E0FA 3BJFA 3E12A 3WQOA 5BZAA 1S5MA 3FEQA 4BI6A 9XIMA 3MPGA 1E0VA 1N8IA 3CL7A 3N18A 3WD2A 3A4AA 3PUGA 1S2AA 3NDZA 4FLQA 2YDQA 1AZ2A 2CWXA 4EPKA 2E68A 2Z2UA 1ZNNA 2WOQA 4AHPA 4GO8A 2BGSA 1YNYA 4JQ1A 3M0YA 4LV4A 1RBOB 3IJQA 4QNEA 2I5IA 4O4WA 1TREA 1XIDA 1W1B1 4A05A 1G7UA 3ZLGA 3QKZA 8XIMA 1XD1A 4N2YA 3PK7A 4PMZA 5HATA 1BWLA 2IKGA 3TYUA 1VCVA 3USBA 1J0ZA 1DE6A 1E9ZB 4D71A 3W22A 4QE1A 4M51A 4ODPA 4XQ6A 2QMKA 4J5NA 4GY0A 5BU6A 4WGHA 2BXYA 3IGSA 3DHDA 3C5QA 1WBHA 2FTWA 3IKDA 4F9DA 5IBXC 1VEPA 1T7LA 2Z1XA 2Z00A 1B90A 4UTJA 3TTEA 5H8PA 4OBTA 4E3TA 1XRVA 2V3EA 3QLLA 4QFUA 1YTEA 1S3HA 2OOGA 3BLOA 3M5XA 3E5PA 3LXCA 1CGYA 3CYVA 4WKHA 1Q6HA 4JCMA 5DEZA 4HARA 1TV5A 4GQ0A 4OZOA 3SURA 3TSBA 3T0DA 2BNJA 4I9AA 4AXKA 5D2YA 4WSJA 3RJXA 3RILA 2WJEA 1UCWA 4K8HA 1FKXA 2CESA 3WJWA 4JKMA 2F4EA 3EB2A 5HAOA 2VZUA 3UR8A 3PBGA 4B5SA 4ZL1A 3PZIA 4KGLA 1OADA 5CPNA 3OGRA 1JNEA 1EYWA 3DESA 1ZZMA 5J6EA 2OTDA 3PZOA 1L6GA 3GBDA 4QDPA 2VVNA 3MQTA 1AH3A 2DVXA 2VGFA 1Q2SA 1O94A 2C79A 2ZOXA 4TYOA 1PKLA 5FI8A 1AJZA 3GZAA 1WXYA 3N12A 3WYZA 1EP1A 3R2GA 1YDYA 3ID7A 2Y4SA 4ATLA 2VEFA 5DCDA 3QH2A 3E2SA 4QE4A 4GC3A 4QISA 5FJRA 3QFWA 4PMYA 1X6NA 3NQEA 2OGJA 3RLUA 3WBXA 3GZ3A 3QRHA 1L0PA 1TV8A 1ITQA 1IZJA 5HMFA 4P7QA 2XP7A 5D32A 2JEQA 5BXSA 1IEQA 4UBPC 3N9SA 4JFUA 2ZRYA 4D2JA 1U5HA 3DZ1A 4ACZB 2OR2A 4MDOA 1MO0A 2ZDRA 3HGRA 1X97A 3VMNA 4ODRA 1Q45A 2FLIA 2O9TA 4IIFA 1LWHA 2O55A 5AYYA 4UCFA 2JBMA 1ZU8A 1I2NA 1X96A 3LHWA 3VGHA 1QPRA 5DXYA 1FCVA 4C5YA 3NL5A 5K3VA 1LCOA 1VRDA 4U2YA 1W31A 5LIYX 1MRQA 2RGLA 4MTVA 4QT2A 4O12A 4H2HA 1POJA 2CHNA 3LDVA 3WNOA 2GJRA 1QBAA 2WM0A 4FNQA 3KM8A 3BW3A 4MGVA 3N15A 5LNRA 3P62A 3T81A 1KCLA 2WHLA 1EPVA 5D8WA 4YS1A 4CUCA 4IFKA 2ICSA 4G6CA 4DBDA 3GDKA 4D72A 2H90A 1WKEA 2PCEA 3CZLA 2BSLA 5LXXA 4JFMA 4HCHA 3WDPP 4OV9A 1J18A 1SFSA 2R6OA 1KWKA 4KRTA 4DPQA 2PN0A 2WQPA 2PV1A 2GGJA 2E1DA 5TD4A 2X7WA 4CVWA 1L9WA 2XN2A 3VD4A 3EWUA 2CXGA 3TNBA 1E43A 3HF3A 4FEZA 6XIAA 4C02B 4JX4A 8TIMA 1JZ3A 1JNSA 1GK8A 1S2UA 2ZC1A 1OFAA 1JG9A 3JZUA 5HT1A 2WYSA 4DUOA 1AMKA 4Z42C 4PRRA 3W86A 4F0HA 4DZ3A 3R25A 4MJ4A 1J4HA 3JUGA 2HVOA 2Y61A 4FNRA 2EG8A 2OGYA 5I03A 4W8AA 2XHYA 2XM2A 4JTTA 3PUEA 1FWTA 3ZJ8A 4FOUA 3CS2A 1JCTA 2P10A 3DBPA 3W70A 4YVXA 4HKPA 1GZGA 3W2NA 2ITKA 1D3HA 1RQBA 4HHLA 5EMUA 2OZ3A 4QS6A 4IIGA 1FKTA 5CSUA 3CYJA 3RM8A 4DUWA 4LALA 3KAGA 1DBTA 3H4GA 5DIUA 5EY5A 3VOCA 6XIMA 4LB4A 3LTYA 4FLSA 5CJNA 3FAWA 4JHMA 2PV3A 1EF3A 2QIIA 2B4GA 3CWHA 4XTDA 3MKCA 3WBYA 1XX1A 4IGNA 4LAXA 1GYMA 1H5YA 4LUSB 2V2DA 2VN1A 3WELA 5A6MA 1YE4A 1FXPA 1NMWA 4P61A 1EC7A 5I3GA 4UOQA 3K4DA 3EPOA 3NYZA 3SCWA 4UCGA 4XUGA 1R3TA 1RY8A 3B05A 4AEEA 3M6DA 3WBAA 1M5YA 5C0QA 2TPSA 3QW3A 3L5AA 2HEJA 2J8TA 2RJGA 3WLRA 4W9QA 1GVEA 3KLKA 2I16A 5C70A 1ZJHA 5HNNA 3VUSA 1KM0A 2PLKA 1TMHA 3BLFA 4XISA 2PDCA 3WNLA 2YA1A 2WNQA 4GC4A 4GIVA 2JKEA 1R5YA 3S6DA 3LGDA 2AAAA 5B8IC 1BXNA 1UJQA 1PWMA 4EF8A 2F6KA 3G5EA 4G1KA 1H62A 2J74A 5JVLA 1OT1A 1TQJA 1F76A 1K70A 1VFHA 2QS8A 4R85A 4DRIA 4XZ9A 1A49A 2Y7GA 3BW2A 4BQ5A 3OYZA 2WZTA 3IJ8A 4C91A 4MPQA 1BKFA 1B4KA 1YNQA 5MF5A 4HHPA 4LNCA 2X2GA 1P43A 3W2UA 4Y9MA 1RP9A 3LTPA 3DU0A 4TQTA 2VENA 2LLEA 4DELA 4WXYA 4XK2A 2I7GA 3CAQA 2O4MA 2VCDA 4K7VA 3MMWA 4RJEA 5TBOA 1CXFA 3IGHX 4P7RA 2PGRA 4LC6A 1DHPA 3OG2A 1OFQA 1RCQA 1UWSA 4GFIA 1LL4A 2D0FA 2Z0IA 3WSUA 4JNYA 3OPSA 2Y70A 3GXMA 3L65A 4O14A 2NLYA 1PTDA 4H6EA 2ACUA 4GH3A 3MI6A 1ESWA 1GJWA 2J66A 4XKMA 4Y8FA 1WX0A 4UMCA 3O5LA 3AC0A 1E71M 1S3TC 3DC8A 5C9XA 2V3DA 4MLRA 4M7SA 1UQYA 2PDGA 4U5IA 2X30A 3PUOA 5BOFA 3RU8X 2P8BA 1C7SA 4AZIA 3VX1A 2IPWA 1O5XA 4LNYA 5A95A 2QZRA 2L5HA 1RK6A 2WSYA 4DPPA 1DJQA 1A80A 3VD5A 2J8GA 4DYKA 3KWXA 3HJZA 2XPBA 4IHCA 2HPIA 3HGOA 4WGXA 4ZCWA 1V3KA 3S1UA 2F8QA 2QULA 4W93A 4O2TA 4F0RA 4LC8A 2WQDA 2BMBA 2OB3A 3CPRA 1S5WA 3DOPA 4W7WA 1ZHAA 1L6YA 4TX0A 5AHLA 2EG7A 1PV8A 3L4VA 3N2TA 1EO5A 2FH8A 3AIBA 1RBLA 3HG3A 3L4ZA 3AXIA 1FWHC 1U1HA 3BXWA 2IF4A 1P6BA 2MLZA 1ENUA 5HPCA 4KQZA 4A29A 1TWZA 3LHTA 2ZA1A 1JQXA 2WHKA 4I9JA 4JTHA 3THQA 2XIBA 3TTYA 1US2A 5EA9A 1Q6IA 3GLCA 1LWJA 2Y63A 2YKKA 4D6HA 3BW4A 3C8NA 1HGWA 4M19A 1Q6LA 1ZP4A 3TQ0A 3LCLA 3SFKA 4XAKA 3V5OA 4Z1BA 2NUYA 3A13A 5J8LA 1P6WA 4KCUA 4TX6A 2DZSA 4C1NB 3CGMA 3ANYA 2PDNA 1W1YA 1SFJA 2DGAA 1ICQA 1T0OA 5HWNA 1VYPX 4AZCB 2Q09A 2KZHA 2H8ZA 3EGJA 3EDKA 2F6UA 2BOEX 2XP8A 4FMVA 3UWQA 4GYFA 2POTA 3GTHA 4GE8A 4HZMA 2AOSA 1WDPA 3KADA 4EWJA 1IEWA 3S5NA 4AXNA 2OEJA 4WCJA 4L80A 1PSCA 3WQPA 3P93A 2QCDB 3QEZA 3I68A 3VGFA 2GLKA 2ZXBA 3VK5A 4UIOA 1T96A 1FD9A 2OSWA 4NQ1A 2VZSA 4FB7A 4WY0B 4QEEA 4W9PA 4UQDA 2X41A 2YL6A 1M7JA 3UWUA 4OBSA 1YLVA 2YW4A 4J35A 3O15A 5HOSA 2OWXA 3B0XA 4QQUA 4FHAA 3BV4A 4O53A 1XPYA 4R9OA 4TW7A 2VEPA 3CQHA 4Y9OA 5CZ0A 3LOTA 5REQB 5HA7A 2VR4A 4FP1A 1CLKA 4Y6GA 3JS3A 1EP2A 4ODQA 2G8ZA 2VFGA 4TO8A 1NF7A 3RO8A 4L7ZA 3FA3A 2PCQA 1WUFA 4LBSA 1VFUA 3L4WA 1UP0A 2A0NA 3GFXA 3GDLA 3QHMA 3SQSA 2F2HA 1EUNA 5LXEA 3OZYA 4L6OA 2DG9A 2Y24A 2XISA 1XLMA 2E77A 3FKKA 3TCSA 3AALA 3SCUA 1I2QA 5G1YA 1TPUA 2BHYA 2D69A 2X1IA 4LBUA 3CZEA 1WYIA 5CBIA 4CGTA 1V6TA 1SUXA 3L4UA 3EXTA 4L1WA 5HQEA 4EX4A 5HW6A 3QQ0A 3UJ2A 3RPMA 2A6LA 3UVIA 1KBBA 3UWEA 3STFA 3ARYA 1M03A 1ONXA 4PN2A 1CXLA 4NKCA 2IW0A 3PJTA 3URAA 3R8RA 1J0KA 1OFBA 1MUMA 4WOQA 3M0VA 1JCNA 4R7WA 2C18A 1KCKA 5M17A 2R1NA 1ZB5A 1QNQA 4H41A 3E0LA 3V0UA 2EPMX 2XFRA 3AU2A 5ABTA 3H7VA 3T4WA 2G3JA 3CXOA 3CZ8A 2ZKMX 2YLLA 1FWNA 3WUFA 4LAYA 4ITZA 3NQDA 5FJTA 2ABBA 3PVFA 6PTDA 5LYRA 3WEZA 3T07A 3M5ZA 2J9YA 3O5JA 4O17A 2DT1A 3BWWA 4Q8TA 2YZ5A 2P88A 3K2GA 1JAKA 1EJTC 1HO1A 3W2LA 2NUWA 1OYBA 4AF0A 3DHPA 3VE7A 3KDOA 4C6OA 2QJHA 2VC5A 3KBMA 4UTWC 4IIDA 4U85A 2NW0A 2BP1A 3RIKA 4HJWA 1OFDA 4UQEA 3PFRA 2VX4A 2FH6A 3G1XA 4ORMA 2YYUA 5IHSA 4UR9A 2J9XA 4PB3A 4E8DA 3MUXA 4FS9A 2QCNA 3PTKA 4Z0JA 2Z26A 3GYEA 1E72M 2DG3A 1KRMA 1X7FA 3MUCA 5F4WA 1GOMA 2NWRA 1PL9A 5CZTA 4ASTA 5FOOA 1SSGA 3LEPA 1KM4A 1IGSA 3SCVA 2XIJA 4MYXA 4ADUA 4NJKA 4JTSA 2V5JA 2DV0A 3HFTA 2DZWA 3AMGA 4ZO7A 1I9CB 2VRJA 1BEUA 2AQOA 3NURA 4YYCA 5H8UA 3B8VA 4JGDA 3GUWA 1L2UA 3AHTA 2FVMA 1FP9A 4EOUA 1XLIA 2IPFA 2E8YA 3R58A 1NEYA 3AO0A 3I7QA 2XFFA 4QAIA 1LQ0A 3TDFA 3P0WA 3BMXA 4J3SA 1NP0A 1MSSA 3QGAC 1EBGA 4UNKA 1ZCOA 2A4AA 3WLTA 4X3ZA 4PMDA 1TV2A 3IPWA 2GFTA 4KS0A 7A3HA 2VD8A 3M46A 4RCXA 1JXKA 3F5JA 3UXKA 4ZFCA 2E1WA 1YX1A 5A8QA 4PTMA 4JQAA 3TJXA 2Z2AA 2E3ZA 3KRUA 2MANA 4HZ6A 1ME8A 2F21A 4JR5A 4HSNA 5DRCA 1I6NA 4DRQA 3CU2A 1NWRA 2AL2A 2C16A 3ZVIA 4O1BA 9XIAA 4FXFA 2WWDA 4DWDA 3PF3A 3VI2A 1UR3M 5LNUA 1S46A 3ITGA 4UTWA 3S2CA 1J0JA 2F38A 3PWGA 2OSXA 1H7NA 3ZWSA 5IFPA 4DX3A 5A6JA 3SN1A 1ZP3A 1DE5A 5I7GA 3MP5A 5FEPA 1H0IA 2Z24A 3PSVA 4DWSC 3EOUA 4LUSA 3SM0A 3MC5A 4ODNA 1OEPA 5EMYA 5ABFA 5HXMA 4FNSA 2G96A 1S39A 3A5VA 1X39A 2BG5A 2HQAA 4L1GA 4HCDA 1UD2A 4KT2A 3LPFA 2HCVA 3ZJ6A 1GOWA 1R3SA 1UD8A 1A47A 4REQA 3N6HA 3GNDA 3VNMA 3LXAA 4S3GA 5H8MA 4L4OA 3UZYA 5C7VA 3SDOA 1IWPA 3F7JA 4GK8A 1C8YA 1UA7A 2TODA 4BY3A 2PE4A 3DC0A 3G24A 1WAWA 1A0DA 3WF1A 3W27A 3AS1A 1MZHA 2VRKA 1OX4A 4N19A 2GDQA 4IP5A 2F2DA 6REQB 2QAFA 3TCEA 5AYBA 3GTFA 1XLAA 5C55A 1V6UA 3DIPA 4ALDA 6ALDA 1S1PA 5GPRA 3DERA 1LRQA 2ZADA 3NGFA 4HNTA 1JJKA 1T8QA 2OJPA 2QDDA 4P5UA 4U10A 2G0WA 4JDYA 4ZQCA 1BHGA 4F79A 2OT1A 1FKDA 4GVGA 3OGVA 3WQ6A 2IQDA 5B7YA 1QATA 4MWAB 5FJIA 2HS8A 2XIIA 3B9EA 1J11A 3ARWA 1VP5A 1JDCA 4E4UA 3K46A 3IVUA 4GMEA 3OTRA 4L9ZA 3HQPA 3UETA 1JPIA 4H8HA 5DCBA 2ZXAA 1QR7A 3QQ1A 1V7AA 2J7HA 1GORA 2RQSA 1TMQA 4GABA 5CPOA 2VP8A 2Z1KA 2VZTA 3B04A 3VNKA 1BD0A 2IS7A 1O1HA 1F2JA 3F2DA 5LGXA 1LBLA 4WDUA 1XHGA 3HBLA 4R5EA 5A6SA 3LRKA 2JE8A 1JZ8A 3WH6A 4OV4A 1EH9A 5F1UA 4JDBA 1AG1O 3NQFA 5A6AA 2YL8A 1C29A 1MZRA 3TKFA 5G4HC 4B5NA 3H55A 5JMUA 3MP4A 1YXYA 1SMDA 3ARPA 3FJ6A 4RNHA 2Y7EA 2XVGA 3BH4A 3BG9A 1DJHA 4ZGYA 1A5CA 4LAOA 3BOFA 2DZUA 3ISIX 4GO9A 1QHOA 3ARUA 4LUTB 2CZEA 1KFCA 5HNRA 1H0GA 3HJEA 4KCWA 1RY0A 3KX6A 4C90A 3GSMA 1VLWA 3P8IA 1DHKA 2EPLX 1KR0A 5FJOA 4WVXA 1EJVC 2L2SA 1XLHA 1GRJA 3LB0A 4XBJA 1VPYA 3A24A 4JD4A 4RDVA 5CPTA 5FA5A 3M0IA 4FNTA 2ATMA 4C5ZA 3M0KA 1BLIA 4I9MA 2ZUVA 4S2BA 3WMSA 5BWAA 4DBWA 4Q6JA 4JXCA 1KLYA 4Q4RA 4E8CA 3EWXA 4DVOA 2XPAA 3UYIA 1KTCA 4E2BA 1RPKA 3WNNA 4TV5A 3TC3A 4L3NA 1OG0A 3IUDA 2P3ZA 4AY7A 2GK1B 1ZJIA 2DPEA 4HN8A 3WH8A 4FPSA 2X16A 5MKGB 3QJAA 4QCEA 3E0WA 3QOMA 3ITLA 3AYSA 3IIZA 4I7WA 3CO4A 4ZPTR 1IV8A 2GK1A 5K4XA 3REQA 3JVAA 2GPTA 4RNFA 4A8LA 4KEVA 1DJXA 1FWBC 1NDVA 2W91A 1IXOA 4FALA 2UZ9A 4AZBA 2XZ9A 4ICMA 3VGBA 3SQLA 5DMMA 1Y8BA 1T11A 2B7NA 2Q71A 1UPPA 5HMDA 3CK5A 4QLKA 2OLHA 1PBGA 2JZVA 3ARVA 3CIXA 3TW7A 3SGUA 2C19A 1BYCA 4PMJA 4LYPA 3VKCA 1QW8A 1BWKA 5KZ6A 3CMGA 4CN4A 3O7UA 3PRBA 3HA1A 1E6XM 1ZL1A 1EXBA 4ZSUA 1V6YA 2V2CA 3VCCA 3VKBA 3CB3A 2M2AA 2A79A 4B5WA 1SZFA 2J24A 3O5KA 1A3HA 4XAZA 1PYFA 3VIFA 1YIXA 3CAVA 2DW6A 1UP2A 2W4XA 4AY8A 4ZR8A 4C6NA 1CGUA 4K37A 1R38A 3QPZA 1Q6RA 1XLFA 2HDJA 4O50A 2HNHA 1DWHM 4WQ6A 3AMKA 1XUUA 4OWGA 3MSGA 1RQHA 4RUBA 3M6YA 3LHZA 4OGZA 1F3WA 4O18A 4RV3A 2A5HA 5D2WA 4GQRA 1A5OC 1CEOA 4TIMA 5DITA 5LSMA 2XWEA 4HSHA 1FKLA 4M5PA 2C0AA 2G3FA 3UEQA 3J7HA 4EWND 2XP4A 3ZJ7A 4F2TA 4A2SA 1QFEA 4IMAA 7REQB 5E6ZA 1RR2A 5FL1A 3TYCA 3NCOA 3S5YA 3HG2A 1E4NA 4N9DA 3GYCA 1JI1A 3B9NA 1VENA 1K9FA 3SCSA 1OC7A 1ZALA 3AIQA 4GIEA 3UZJA 1LZOA 1E40A 4NF7A 3WDHA 1OYAA 3TMLA 3LMYA 4F66A 3WDJA 4HHMA 3W7KA 4ODOA 1F6PA 2G41A 4NNRA 1ONEA 1KBKA 1V0NA 2PRMA 1WDDA 3E2QA 4IX2A 2ZRVA 5HULA 5FJJA 1CGVA 3WD4A 3GPKA 1CGWA 5AYIA 4IIBA 2Z6IA 1MVYA 3USZA 3VNDA 3QSRA 3W7IA 2NVDA 4J40A 3MYOA 3BLKA 1A5AA 1EYEA 3AOFA 2BODX 1B5TA 4GUGA 1V4YA 2FB3A 1YW5A 3KCOA 3P6LA 1EX5A 1DYSA 4E4FA 2KR7A 3UZXA 3C61A 3MV11 4DI8A 4IQDA 3ZT7A 3ZYZA 3LN3A 3LPGA 4B9ZA 3C86A 4PMQA 3NVTA 1OFRA 4NAFA 3S5ZA 4FAPA 5CQ1A 3CUFA 4TX9A 3R5EA 1O68A 3SB0A 4ZZ9A 4W4QA 1A5BA 5C8BB 4J1OA 4CD7A 4ZVJA 2A3CA 3THCA 1QCWA 3TA9A 3AUJA 1XGEA 1CLXA 1DWAM 1E15A 1KKOA 4AUBA 2R24A 3UWYA 3TYZA 2V3GA 3ZM8A 1ISXA 2WLZA 3E1F1 3T7VA 3MSDA 2RKXA 3W1PA 1PWLA 2AAMA 4ZPWR 2VD9A 4CNSA 4K7YA 4FK9A 4ROQA 1YXCA 2BXVA 3SY5A 5JU6A 1XSKA 3D0CA 2IKJA 4QDWA 3URNA 2WMKA 3NZPA 3HQ1A 4JN7A 4IL2A 2BY1A 3EB3A 2Y5SA 4CD5A 4EXAA 5CZSA 3O5GA 2XJ7A 2CHRA 1P1XA 4HMDA 3IJ9A 4EPBC 2RDXA 1XQKA 1IYXA 2YBUA 1PZ1A 4PODA 3L0NA 1U33A 4A8IA 3UR5A 3ELFA 1XBZA 4B2DA 2ISWA 2FGZA 1UD4A 5CJ5A 1REQB 4QP0A 5DQPA 4CD6A 3PBUA 4UNIA 1OIMA 4C7FA 3QPYA 2LKNA 4RDWA 5LNVA 3RGCA 4QT3A 4K3ZA 3SI9A 4NJJA 4G7EB 2PB1A 3ARTA 4JY8A 5CLWA 4JFKA 3EOOA 3LNPA 3OEXA 5FACA 1R7OA 2YXOA 4PGLA 2G3NA 1QPFA 3LTSA 3GXDA 4S3CA 2BASA 1BKHA 3DI1A 1YTKA 2ZTJA 1HKWA 3CZGA 3N14A 2R1PA 3CASA 3U8GA 3G1AA 4H9UA 2V6AA 4BWLA 4H8UA 5CEWA 3RGTA 2O0TA 1Q85A 1WZKA 3UCDA 4HPNA 3H22A 1I4NA 1E6SM 3JR2A 2RHGA 3K4AA 4JYSA 4EACA 4MNKA 1AJ2A 2ZBTA 1UYQA 1MWOA 1WP6A 2FVKA 4HOZA 4TMCA 3KHJA 4ENLA 1IIGA 1VCGA 3EWCA 3H2AA 4EPDC 4PCTA 3BCDA 5TQLA 3IWPA 1OX6A 1JXJA 1RV8A 1U22A 1G4TA 3NQMA 2W0UA 4H9ZA 1E6ZA 3F03K 3DG7A 1H09A 2VFIA 4LFYA 1KO0A 4WDWA 5M2FX 4KEZA 2ZZ2A 5I09A 1H60A 5I2UA 4IFOA 1J0HA 3OGSA 3NTYA 1NH6A 1I45A 1HG3A 1OGSA 2WVTA 3ZLFA 3GU9A 4GYKA 3G1VA 4GZJA 5AC5A 1GVRA 1QRQA 2Y7FA 5L6UA 2P3EA 4G9PA 1HT6A 3GTYX 3JXVA 1XIGA 1VBRA 3L4XA 5ABGA 5T8GA 5LIXX 3NQAA 3O5EA 3I7RA 4Z2KA 3B97A 4CVUA 3N04A 4IISA 2ZQTA 3O16A 1IT7A 1K7FA 4EIVA 3M44A 3S3GA 4C1KA 2XIMA 3DFPA 4J3XA 4IZGA 4AD1A 1FHLA 1XW8A 1IXPA 1MUWA 2PLMA 1DJWA 3WZ0E 3LERA 3MCNA 4TTGA 4U86A 2B31A 5EKYA 1HKJA 4MGGA 4AYSA 3WH5A 2QGYA 1V5XA 2GVJA 3MS8A 1ELSA 2UBPC 3NVDA 4H6RA 4J3UA 1OVDA 4LUYA 3S47A 3WFLA 5E5CA 3MA8A 1JF5A 2CZDA 1V6VA 1V7YA 5I02A 4I6KA 3LZ5A 1UHVA 3VDAA 1FWRA 2DZXA 2V38A 4L9XA 3TSDA 1MQPA 2ZZ3A 1EJ7L 1IF2A 1YTDA 4P7LA 3MKKA 3NQGA 1ZJBA 1H2JA 2V5KA 2X1UA 3E9AA 7REQA 3ZFHA 2GL5A 1EZWA 5D02A 1W1TA 1NFPA 1TCMA 3O5IA 2ASHA 3ZSTA 1V0MA 3O5OA 1XI3A 1RUSA 4J3VA 1TIWA 2DZTA 1OB0A 3TE9A 2OOFA 4IMFA 4JTGA 2Z1SA 4F9JA 3WN6A 4C6CA 1QI5A 1R9YA 1R87A 4MPKA 4HQVA 1U5JA 2OX4A 1ZGDA 1ZBCA 1B4EA 2YA0A 2YXXA 1MUCA 1NF0A 4JHZA 4JIEA 4PTNA 4LS2A 2VZOA 1WKFA 1JYNA 3W2MA 1FKJA 3AXXA 3FCPA 4ZOEA 3HM7A 4KBXA 2WJFA 3VXGA 2W63A 3QR3A 3QZAA 1JDDA 3KOFA 4RDYA 1Q7MA 1E6RA 3WFAA 2YL9A 5E09A 4GPNA 4KRUA 1EYMA 1ZCCA 3M7SA 2PDQA 4JFJA 1BL4A 1MNSA 3B0PA 2A3EA 4CCCA 3AMDA 1LBFA 5CKSA 2PP3A 2ZWYA 1DIOA 2P4VA 1A5MC 1B30A 2HXTA 4JL2A 4MM1A 4LVDA 2V9DA 1UWRA 3II1A 2MLXA 3GXNA 4RR4A 3FV9A 1B57A 1WKDA 1FDJA 3NPVA 2QCMA 1UC5A 2EULA 4JY9A 2BBFA 3W26A 3EPNA 5G5IA 5I6SA 4XZLX 3AU6A 2D23A 2O7QA 1UBSA 3OZMA 5CBJA 1DJZA 3IV8A 4QQ3A 2ZRWA 4C6EA 2FZNA 1J8VA 3GHSA 5CH9A 3S83A 4Z1AA 3PN8A 1UMYA 4W7UA 4CEXC 4KERA 4PTDA 3SECA 3QY6A 1ODZA 3OA5A 1W9UA 1XXXA 5LGZA 4Q4OA 3KTXA 3U0HA 1NFGA 4AVOA 1TRDA 5D9NA 3OHIA 2BY0A 3W1MA 1AQHA 1MI3A 2GWNA 2HE5A 1PZ3A 3PSWA 1ME7A 1TQXA 3I3BA 4N9BA 1LLZA 1AA1B 1FX6A 1JZ5A 2OO0A 3TX9A 3DYMA 4GOAA 3W25A 4ZTXA 2V63A 3BSGA 3QV9A 1K9DA 4HNLA 1P5BA 4PL2A 2FZBA 1H63A 5BMXA 2PTXA 3FYOA 1UH2A 1AW2A 5AZ1A 4M3PA 2EJ1A 4DYJA 2AQVA 3DBNA 2B0MA 3G2GA 2PU0A 2NV2A 1E51A 3RDKA 3VTRA 3KAOA 1KCZA 5H6HA 3NOEA 1E73M 4J9JA 4QJ5B 2BVWA 4RZ4A 4P8WA 1F3TA 4AZGA 1JRCA 3QMRA 4TR9A 3SUWA 4I8DA 3T4CA 2XH7A 2FYMA 2YX0A 1T6MA 5LIWX 4Q8QA 1TV3A 2VX5A 4WK9A 1XIMA 1YDOA 2YIHA 1ZAHA 3CBWA 2XP3A 2C91A 4HNOA 4PMOA 4NJGA 3U6WA 2Z27A 1E0TA 3H26A 1KGUA 3UZZA 1XLGA 3O5DA 3LENA 3W7GA 1J6PA 3NQ7A 5A2AA 2GSHA 3G18A 4UOZA 4Z0SA 1P48A 4N6FA 1WDQA 2GJPA 1E56A 1N82A 1TMLA 1KA9F 3GG7A 5CBBA 5K9XA 1BPLB 4GBUA 3F5LA 1FY6A 1ITXA 3RK8A 2Y7DA 1WXZA 1FKWA 4S3EA 1QW9A 3WCZA 4YPJA 1RCOB 2ZWZA 3WMLA 5A94A 5D9OA 1JFXA 1N7KA 3GM8A 1W1A1 1E44A 3EWWA 1NJJA 2ZQSA 4U3CA 4R7JA 3CGNA 4GACA 4XZMX 3QGVA 3LY0A 1C90A 2GUBA 3LU2A 5C2XA 1Q6QA 2QLYA 4WDXA 1JUBA 1FHUA 3NZRA 3CJPA 5FL0A 3TC5A 3AHYA 2J75A 4BKNA 3KTSA 2R82A 2EBNA 1TA3A 2VL4A 5T9BG 3LA4A 1NWTA 3CUGA 2Z7KA 4K38A 2D3LA 1ZTVA 3PB2A 4ADSA 1RK5A 1DJIA 3LI1A 4AD2A 3LPOA 1J12A 4HB7A 3BURA 2QF8A 3TTQA 2J79A 4BF5A 3E5BA 3LHVA 3TYAA 2FTYA 1TKKA 4YVPA 2IXUA 5FEZA 1QOXA 4QCFA 1BXBA 2C7FA 2QJNA 4H9XA 1Q6GA 3IRDA 4IXXA 2Y5EA 1US0A 2YXGA 4ZXOA 1EOMA 4PCFA 2BLEA 3G1YA 3PTDA 4AMCA 3LUTA 3D47A 1B54A 1PZ0A 1F4AA 1FWIC 1EZ2A 3UPMA 2AGTA 1R7AA 5D2VA 1ZJAA 1W3NA 3AWOA 2V69A 3H2NA 3KS5A 5G2WA 3W1UA 2MNRA 3R43A 2GSJA 3MUIA 4WR3A 3AMLA 1TJ2A 4UFJA