1SR0A

Crystal structure of signalling protein from sheep(sps-40) at 3.0a resolution using crystal grown in the presence of polysaccharides
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords signal processing protein
molecule tags Unknown function
source organism Ovis aries
publication title Crystal structure of signalling protein from sheep(SPS-40) at 3.0A resolution using crystal grown in the presence of polysaccharides
rcsb
total genus 116
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1sr0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1sr0A01
2YBTA 3OZOA 1QI0A 1G5AA 4OUEA 4AMCA 1KR0A 4DUVA 4D6EA 2NT0A 2CEQA 4EANA 1B3ZA 1F4AA 2WZEA 3WH6A 1JD7A 1JFHA 1M04A 2XIIA 1R85A 3LMYA 4AZIA 4ZFMA 4GZJA 1CGUA 1BYDA 1CGYA 3I3DA 4B9YA 4DWSB 4UQCA 2O9RA 4CN4A 3AHYA 1E15A 1OT1A 6TAAA 2W92A 4HU8A 3B9DA 1GQKA 3NYDA 4BCEA 3QOKA 5E9AA 3WH5A 2PI6A 4MB4A 4MNLA 2YKKA 4A4AA 5CSUA 1JAEA 2QMJA 2XFFA 3CBWA 1WNOA 4LQ1A 2WVSA 2XVNA 1PEZA 3LPFA 2O9TA 1C90A 1W3LA 8A3HA 1VFFA 2ZUWA 1BVNP 1KQZA 3T0AA 5E70A 1MXGA 1QNSA 4Z2KA 2NT1A 1G0CA 3GNPA 4HOWA 1KB3A 2PWFA 2RGMA 3U5YA 3ZO9A 4FLOA 4B3LA 2EPLX 1WP6A 5CSYA 1UHVA 1RD6A 3ARPA 3VIJA 1BVZA 1C92A 2E9LA 5C71A 4WKHA 3VGBA 3WBEA 2YDQA 2OYKA 4PMQA 2ZX6A 3CUGA 2VZSA 1BF2A 1QNOA 3TONA 2VVNA 4JL1A 2J62A 5JIPA 4P8UA 1V6VA 1W9UA 4GZEA 5A2CA 1UD4A 1NOFA 4TTUA 4AD0A 4AC1X 3RMEA 1GOOA 5A2BA 1MQPA 3VGEA 4H04A 3L4TA 3AROA 1UUQA 4KMQA 3WF0A 2J47A 1UKPA 4QAWA 3KE0A 4EE9A 2WHJA 4IUGA 2O9OA 3AS2A 4DWSC 3GNRA 3W37A 1CGVA 4CU7A 4OKDA 2G4FA 1MQQA 4TVDA 1CXHA 2J74A 2GJRA 3IJ9A 2AMGA 3SCUA 3G6MA 1CLXA 2J25A 2EPKX 3OLDA 1H4PA 4PMYA 4WLCA 3SCRA 3WDJA 3VD5A 5CGTA 1EOMA 1EQPA 1GQLA 2ZUTA 2A3CA 4U33A 4P7QA 1GOQA 4URIA 2XVLA 4GKLA 4JHOA 3WUBA 1ZBKA 2ZX9A 4D72A 1FFQA 1I1XA 4C7FA 3AZRA 5HOSA 7CGTA 2A3HA 3VNYA 2CBUA 3POHA 1GPFA 1W1YA 1HF6A 1ODZA 2A3EA 2VMFA 1VIWA 3OIHA 1GZJA 3CHEA 5D9MA 1E56A 1CTNA 1CXFA 1HVXA 3F5JA 2ZUVA 3PZTA 1W9VA 3CUFA 2HISA 1BYCA 2F61A 2WCGA 4WKAA 4XV0A 1RP8A 4HPGA 1UH4A 3POCA 2V3FA 3AZSA 2J7BA 1M53A 1CZ1A 1K9DA 3WFLA 2FHCA 3ZSSA 2JALA 2VQTA 2VZVA 4W87A 1J12A 3AIBA 1SMDA 5A8NA 2NW0A 3CZEA 4ZENA 4AD5A 1VAHA 4AWEA 1HN1A 3RIKA 1PJ9A 3WD1A 3G6LA 3PTQA 1W1VA 3BSGA 1FH8A 1VF8A 3VOCA 3ECQA 4CD7A 1V6YA 4H8HA 5A8MA 2J8GA 3WFZA 4AISA 3ARQA 2XYLA 3ZJ6A 2DIEA 2X09A 4Z2IA 2XPKA 1SYTA 3CUIA 3T08A 4Z2GA 1QBAA 3CMGA 5D4YA 1KQYA 1G9HA 3A6OA 3ZIZA 2FGLA 4JCLA 5I23A 2C7FA 1V08A 3UR8A 5CGMA 5A2AA 2D0HA 2BNJA 1B30A 4U31A 3N9KA 3WH9A 2VT0A 1EO7A 2YDSA 4X0VA 4PCTA 3WNKA 3N11A 1W9PA 1MQRA 2DSKA 3W6MA 4JAWA 1UR1A 1BG9A 2IXVA 1JD9A 3EYPA 3T0DA 1XYFA 2BY1A 5AYBA 4AZCA 4PEEA 1NWTA 3K4AA 3VX0A 1ITXA 3AHVA 1X6NA 3NCOA 1TCMA 1ZL1A 1GVIA 3MMUA 2WNWA 1QI2A 3RJYA 1TFVA 1FA2A 1GORA 4Q7NA 1OT2A 1QW8A 3UERA 1LWHA 3WDRA 1FH7A 1GJUA 1FP9A 3KL5A 1DWIM 4PMDA 4UOZA 2VX6A 3EBVA 4QCEA 1EDGA 5AC4A 4EKJA 2OWXA 1SFSA 1JDAA 2J7HA 1VBRA 2G3MA 2YL6A 4DUWA 2VO5A 4PMZA 2OYLA 3ZR6A 1O7AA 1H1NA 4JFTA 4DWSA 4MJ2A 1JAKA 1QVBA 3A3HA 1GHSA 4S3JA 3WKZA 2WAGA 3OGRA 3SCVA 3F5LA 1JZ4A 1CEOA 5GNZA 1J9YA 4TUFA 1L8NA 5A6AA 4PCSA 1VEOA 1UZ1A 4BQ2A 1V0KA 3TTYA 3CLWA 5I5RA 1MW1A 3UETA 4MB1A 3S2CA 3RDKA 2XWEA 3ALGA 4OJYA 5A8QA 4F9JA 4AZ7A 3BGAA 1R8LA 1PBGA 3VGHA 2A3AA 5D9OA 1E9LA 3DHPA 2X8RA 5D8ZA 2QPSA 2WWDA 4UQEA 3K8KA 1QNQA 5A8PA 3PZOA 4CD8A 4LYPA 4M82A 5LYRA 2QLYA 5HPOA 3GXFA 4BQ4A 4PMNA 2D1ZA 2OWWA 1AVAA 1X6LA 3DHUA 4NSBA 1V0LA 4GPNA 4RE2A 1CBGA 2YDRA 3VD7A 4P8XA 3WEOA 2ZUNA 4QLLA 5HNNA 3W29A 1E73M 4YHEA 4UZSA 3AS0A 2DSWA 2ZX5A 3WDHA 2BHUA 4JFSA 4H2CA 4LYQA 3RILA 1LL4A 1UD2A 3K46A 2J78A 4ZE4A 3MSDA 3BAXA 1H49A 1QPKA 4MNJA 5D9PA 1CPUA 4MAZA 4UR9A 1D2KA 5E6ZA 3AMLA 2JIEA 1UQZA 3QR3A 2OWCA 3BH4A 3O6AA 1GJWA 1KCKA 2EJ1A 4IPLA 4J7RA 3WUFA 1JDDA 3ARSA 4GO9A 1OIFA 2DT0A 2W91A 3WQ4A 3DYOA 3WNOA 1UR8A 2CCRA 1CXKA 1HKKA 5D9NA 4BA0A 5BCAA 1XGZA 2YL8A 2VR5A 2PWGA 5BXRA 3K4DA 1E1FA 3PZMA 4GI6A 4JFWA 4IPNB 4HA4A 1TUXA 1KFWA 3GNOA 3MS8A 2DT1A 4GIAA 3CO4A 4WKFA 1Q6EA 4JFVA 2PWEA 2EBNA 3BAKA 3GXDA 2CERA 7A3HA 3O2LA 1W3KA 1DEDA 2ZWYA 3DYMA 2UY3A 1JXKA 4RE3A 1B0IA 1XD0A 5DT7A 4C7GA 4EK7A 2W66A 4AZHA 1WZKA 4F8XA 4HP5A 4Z2LA 3B9EA 5CJ5A 3FHAA 3WMBA 4D6FA 1CNVA 5DFAA 1CLVA 5IFTA 1KWKA 4AIUA 1TA3B 5JBDA 3W81A 1J0KA 7TAAA 1J0ZA 2Z1KA 2X05A 3CHFA 1ODUA 4NRSA 3J7HA 1GNXA 3CH9A 4AD4A 4H8VA 5GPRA 1KXQA 4UQAA 1B90A 1CECA 1B9ZA 2GK1B 5E0CA 3VGFA 5HBFA 1R7AA 2BHYA 1TE1A 3BLKA 4HU0A 2E9BA 3FAWA 4W93A 3VIPA 3BC9A 1UZ4A 3L2LA 3BLPX 3VX1A 1HJQA 2O9PA 3II1A 1B3YA 2WHKA 5BRPA 3RM8A 1UKOA 1HXJA 1GW1A 1UH3A 3WIJA 4WJXA 2WW5A 1MXDA 2VRJA 2XG9A 2VURA 2DT2A 2WBGA 3MUIA 3PZQA 5IFPA 4CGTA 5AC5A 2WVVA 3M07A 2YA2A 4HMEA 1J01A 4TX8A 4AD1A 4ZXLA 2XFRA 5FIPA 4MB5A 3UCQA 1FP8A 1EOKA 3WUGA 1R87A 1JG9A 4PN2A 1KXTA 2WPGA 4HZ6A 3ZM8A 3AIVA 3MV01 1QNPA 3PZNA 2AAAA 4F9DA 1UR9A 2VTFA 1QI4A 3WD2A 1J0JA 4AIEA 5FCZA 2WSPA 4UFLA 1GCYA 3AQUA 3FHQA 3TTSA 1BGAA 1E43A 1JI1A 1KGWA 1QNRA 3EDJA 2VZUA 2XM1A 3MUZ1 1GQJA 4L4OA 1V6UA 1J10A 3NSMA 1EH9A 3U5UA 1ZJBA 5D8WA 5CLTA 3SCPA 5IDIA 4AY1A 5FL0A 3SUVA 1H0IA 4CU6A 2J7FA 5A6LA 1VEPA 1I75A 1TZ7A 4J3TA 1E5NA 1K9FA 1UH2A 4OOZA 4W5UA 2V3DA 2YJQA 3A47A 1UOKA 3NSXA 3EDDA 1C8QA 4W8AA 4W7UA 4P7NA 4W86A 3GXMA 3LPPA 3PBGA 1ZBVA 1VJZA 1PZ3A 1NQ6A 3SUTA 3D5HA 1C8YA 1IV8A 1EIBA 8CGTA 1W32A 3SCWA 1GUVA 2TAAA 1G1YA 3VIFA 3TTQA 4LX4A 3VIIA 4AXNA 1SR0A 1CENA 4P7RA 1JYNA 1XH2A 1NOWA 2ZUUA 1WZMA 4AW7A 3B8SA 5BXSA 1E70M 1UG6A 2G8ZA 4HPHA 3WQVA 2CYGA 1PAMA 3ARWA 4UZUA 1UA3A 2NSXA 2FHBA 1C8XA 4MAVA 2E4TA 2W67A 1U2YA 2GJXA 2WMKA 3MMWA 4ACZB 3AI0A 5A8OA 4DWSD 1GHRA 3GDBA 4AYSA 3W82A 3BAWA 2WMJA 4R27A 2J7GA 1W1PA 3HMCA 4LPCA 1MWOA 4EAMA 4CCDA 1VFOA 3KWXA 2WC4A 3KEHA 2PBOA 2PB1A 1JNDA 1ISYA 5HDRA 1E4IA 1WKYA 3MMDA 5JBEA 2E9MA 3W38A 3N12A 1K9EA 1EA9C 2WB5A 2ZICA 3B9AA 1QHZA 4D6JA 1XSIA 3WQWA 2J7EA 2WHMA 1W9XA 4WSKA 4DM1A 4QLKA 1CYGA 2JIWA 4A3HA 4BF7A 2XJ7A 4AZ5A 3AYRA 4Q22A 1WDQA 1MYRA 2G41A 1H09A 4QP0A 5BYWA 4A3YA 4B9ZA 5I2UA 2XM2A 4UFKA 4U3CA 4X9YA 4AZBA 1TVPA 3U7VA 3CZ8A 2Y4SA 4H7VA 3W24A 2YA0A 3WQ5A 1QHOA 2E40A 2UWFA 3MU7A 1G01A 1N82A 3FXYA 2D20A 4XZWA 4PUDA 2WKLA 4AZCB 1V3MA 1MW3A 5A6SA 5A6KA 1UQYA 1HJXA 4UQ9A 1HJUA 4JKKA 1BSIA 1NWRA 3DYPA 4M24A 2A3BA 2XFYA 1ITCA 1QI5A 2O92A 5BWFA 3VMPA 2XGBA 1QHPA 4UQDA 1CXEA 1VEMA 1E5JA 1HJWA 2YOCA 2XVPA 4PMVA 4UOJA 5ECUA 4UOQA 1WE5A 3OLEA 2BS9A 2WXDM 3WD3A 5A95A 1IZJA 3N17A 2GJXB 2VC9A 2IXUA 4RL3A 3VUPA 4GI8A 5A1AA 3HU7A 5DT5A 2CPUA 1OBAA 3FNDA 5BRQA 9CGTA 2WVTA 4CCCA 2ZIDA 3N15A 2VR4A 4Z2HA 1HX0A 1IT0A 2PWHA 1RP9A 2G3IA 2CBVA 1LL7A 3A4XA 1QI3A 2D3LA 3U57A 3L4XA 1EHNA 1VENA 4FF5A 3VIKA 2YLAA 5I6SA 4UNIA 5EB8A 1BTCA 4KWUA 1JIBA 1E6SM 1FOBA 1V02A 4PMXA 2ZOXA 3VD3A 4P8VA 3NDYA 4F79A 3D3AA 3AMGA 3QHOA 4D71A 3LPGA 1NH6A 3WF1A 2Y8VA 2OLHA 2WMGA 5E09A 5HXMA 4HA1A 2JE8A 4JCMA 4CD6A 1E0VA 1CGWA 4AD2A 3OZPA 1DTUA 2J79A 2BXZA 3VDAA 4GXPA 1UWQA 3KL3A 5I77A 1SMAA 2W61A 1KGXA 1UKTA 1XH0A 3PZUA 4BQ5A 2G3NA 1DWHM 3GZAA 3WNPA 1M01A 1HIZA 1ESWA 4RE4A 2XHYA 2WMFA 5EFFA 2J7CA 3ZT7A 3UG3A 4PTVA 2E0PA 4HMDA 2ZXDA 5FD0A 5JBFA 2DDXA 1NP2A 3SCSA 3OG2A 1J0HA 1UD6A 1AQMA 3F5KA 3WBAA 5A69A 3WDQA 5FOOA 1ISVA 3ZJ7A 5CZKA 2PBGA 3T0BA 1C3FA 1U30A 1E6PA 2CHNA 4PTWA 4PSPA 1QOXA 2CKRA 3CZLA 1V03A 1WDPA 4JKLA 3CZKA 4JHZA 4DUXA 2CXGA 1DWGM 2GJPA 3HJEA 4UFJA 4AIOA 1HT6A 3OA5A 2BY3A 2DSUA 1XYZA 3QHNA 4MNMA 2WCSA 2VCBA 1AMYA 5EMYA 1CDGA 4AEFA 1JF5A 3ARZA 4W85A 1UWIA 3CZJA 4V28A 1OINA 3A4WA 3ZJ8A 3VIGA 3N1AA 4NRRA 1WZAA 3UESA 2YL9A 4TXEA 4FK9A 1VJSA 5IHSA 1C93A 5IHRA 3OBAA 5EFDA 3N13A 4W7WA 1V6XA 2BHZA 3RJXA 4MDOA 1HNYA 3TOPA 3ZR5A 3QHMA 1JXJA 4FMVA 1HKIA 4YN5A 2JF7A 1D7FA 4U2ZA 3BSHA 2XGIA 4D6CA 1VRXA 1W2PA 4J3WA 4D1IA 2X2YA 1Q6CA 4PSRA 1HL9A 4B3KA 4F66A 1PX4A 4GQRA 2ZXQA 2VZOA 4R5EA 1E4LA 1HP4A 1CGTA 1JYWA 1OGBA 1EGZA 5F7UA 1BLIA 1UR2A 2X1IA 3WH8A 1EDTA 1E55A 3UR7A 1V3HA 1VBUA 4XUYA 3EMQA 1WAWA 2WK2A 3VM7A 3IK2A 3WD4A 2ZE0A 2F2HA 5DMYA 1XC6A 2QHAA 3EMZA 4PRWA 1Q6DA 1LLOA 3HN3A 4P7OA 2CESA 1PZ2A 5I3DA 4MADA 3N18A 4C7DA 4PUEA 1H5VA 4HTYA 4QDMA 4W84A 4XB3A 1K9TA 5CG0A 3L2MA 1LQ0A 1OWQA 1G94A 1E6XM 1HL8A 4CD4A 3VDHA 1JI2A 3WF2A 3WNNA 2E8ZA 2FHFA 4M81A 1WDSA 3MKKA 2J75A 5DF0A 3PTKA 3VM5A 4XZBA 3VTRA 3QGVA 4HA3A 3UG4A 4W5ZA 1CGXA 1MFUA 3W4RA 1E6NA 4M56A 4NZCA 3F4VA 1OD0A 1FFRA 4PTMA 3WH7A 2EO7A 5M3WA 1WB0A 1F4HA 1Q6FA 2YA1A 5I24A 1YHTA 3ARTA 2PF0A 1JDCA 2Z1SA 3SCNA 1QBBA 1E1EA 1WPCA 4NF7A 3BCDA 3CMJA 4TOQA 5CQ1A 1W91A 3W25A 3VU2A 3ARXA 3AISA 3M46A 4JFUA 5E6YA 2ZWZA 4FLSA 5FL1A 2DEPA 4QCFA 1XD1A 1NP0A 1ECEA 4PMRA 2WVVB 5TD4A 2UY4A 1R86A 1HKMA 3THCA 3ARRA 5I79A 3BCFA 3WMSA 1MW2A 4CD5A 1EDQA 1BHGA 2BVYA 3BMWA 3MV11 3FN9A 3GH4A 2Y2WA 1U33A 1HVQA 2VRQA 2XIBA 3AS1A 3WF4A 4AEEA 2WC7A 3T09A 4PMOA 1V3JA 2WYSA 4MB3A 4MPKA 3UEQA 3NSNA 4MTVA 2X0HA 1TVNA 3U7BA 1ZU8A 1JYXA 1WCGA 3ZSTA 3AHZA 1OM0A 3OLGA 2DPEA 3CHCA 4HZ8A 4J3XA 1J11A 1CXIA 2OSWA 1KXVA 1UD5A 1XSJA 1H2JA 2WCAA 4GINA 1UR4A 2VX7A 3OGVA 1GOWA 3T2QA 1C7SA 3WDPP 2OYMA 3BMVA 3WEMA 4ATDA 1S46A 4J3SA 2WBKA 2VVSA 1ZB5A 4CU8A 2QPUA 3AS3A 2W5FA 3L4YA 3VILA 3OB8A 4W8BA 3VGDA 1L0PA 2JEQA 3AHTA 4D6DA 1Z32X 1XH1A 1ZS2A 1JZ7A 1PX3A 2GSJA 2FH8A 1TG7A 3CZGA 2FGZA 4J3VA 1GOIA 1B3XA 4UFHA 1YQ2A 5DEZA 3AIWA 2V5CA 3MANA 3ZQ9A 4GI9A 1KGUA 4U2YA 1OCQA 6A3HA 2RGLA 4ATWA 1MVYA 2VQUA 3WEZA 4D6IA 3W0KA 2WLYA 2WWCA 4L4PA 3ARYA 3S6TA 3WDIA 3WL0A 2WHLA 1XRVA 3PZ9A 3VMNA 5KZ6A 3E1F1 1M03A 3LPOA 3K1DA 1JNEA 1CWYA 5A94A 3APGA 4QFUA 3AFBA 3CPUA 3MO4A 1RH9A 1ZJAA 1ISZA 1FHDA 1OIMA 1LF1A 3NUKA 2WVUA 4KGJA 4GO8A 1XCXA 2GDUA 3VIOA 5LA2A 1A3HA 3WNLA 2J4GA 4D1JA 4WF7A 3PZIA 1UR0A 4P8WA 3VKKA 4M1RA 3GH5A 2WLZA 1PPIA 3SCOA 1HP5A 2EXOA 3AMCA 1CIUA 3AZTA 3NJ3A 4FLQA 1BQCA 1E72M 2VOTA 3RM9A 1JF6A 1H11A 1JL8A 1OB0A 1UD3A 3GTNA 4WSJA 5AY7A 4ATLA 1IZKA 4CCEA 3CHDA 2WZIA 1US3A 5I78A 1UKQA 4X0NA 4V2XA 1CXLA 4Z2JA 3PZVA 1UWSA 3L4VA 3AIRA 3AYSA 2OSYA 1DWAM 3M7SA 4E8CA 5ABFB 1B3WA 3CUJA 1E6QM 2D0FA 2ZX7A 2CKSA 4BQ3A 3RO8A 1E0WA 4PYSA 3ALFA 3T2PA 2WC3A 2VUYA 1KBBA 3GM8A 2V3EA 2F8QA 1BPLB 4LXFA 3WMCA 3WL1A 2XSBA 1J0IA 1OGGA 3GBEA 3TTOA 2C8NA 3VMOA 1BFNA 5ABGA 3VGGA 2GFTA 4UFMA 1XCWA 3WENA 2CNCA 3UG5A 1Q6GA 4Y7EA 1V3KA 3FAXA 1KBKA 4E8DA 5ABFA 4B16A 3M6DA 1MW0A 3VIMA 3SCTA 1E4NA 2W63A 1P6WA 5ABEA 5CPSA 3L4UA 2QMKA 4UFIA 5LA0A 3THDA 2BFGA 2ESCA 2CBIA 5KEZA 1NARA 5LA1A 1XV8A 3RCNA 3AMDA 4LGXA 2WMIB 3GXIA 1ISWA 1QW9A 2XSAA 4W8LA 2AOSA 1VFUA 2WANA 3CUHA 3MSGA 5JIWA 2VJXA 1V3IA 4CN1A 1AQ0A 2Y5EA 3NIYA 4TVUA 1ZBCA 1LJYA 2D24A 2VX5A 1V02E 1JZ5A 2J8FA 4B15A 3KZSA 4CUCA 2ZUSA 2JFEX 1I1WA 2GUYA 4CVWA 2IUZA 4OBRA 3KL0A 4ZE5A 3SUSA 3SEPA 1EHAA 1DHKA 1PIFA 2WKGA 4WK9A 3W53A 4UTFA 3OLIA 1RPKA 1XHGA 2XWDA 3W28A 1EO5A 2WSKA 3EDEA 2DGAA 1UYQA 2Y24A 3GBDA 4GZIA 2VCCA 4UCFA 3PZGA 1EXPA 4TVCA 1FHLA 4U5IA 3GYCA 4CKQA 1W1TA 2BV9A 5JH8A 2BVTA 4ACYA 1WDRA 3WNMA 5BXPA 2YL5A 2VCAA 2PC8A 3VO0A 1JZ2A 3WQ6A 5A3HA 3W6LA 1GVYA 2VNCA 2XTKA 2FH6A 2HVMA 2GVYA 4JKMA 3SUWA 2V38A 4ZXOA 3BAJA 1UKSA 3T2OA 2CIPA 4IISA 5GQBA 2DQXA 5I0DA 3WD0A 3CIVA 4FLRA 3O9NA 3VNZA 3GH7A 3I3EA 2D22A 1VB9A 1W9BM 3ARUA 1TMQA 4KRUA 1DWFM 2J7DA 2E3ZA 4PMUA 1OD8A 4K68A 5CXPA 1JYVA 4HZ7A 1LWJA 3L4ZA 1TR1A 3ARVA 5BXTA 1B1YA 1M7XA 3ZMRA 2UY2A 1B31A 4NI3A 1V3LA 2C0HA 4KRTA 3AOFA 4H41A 5JUVA 5FKYA 2MANA 3AICA 3SIMA 1KXHA 3VD9A 3VVGA 1VFMA 5M17A 4HOZA 4MDPA 3CGTA 1E0XA 2D2OA 2EEXA 2GDVA 2ZXBA 4IM4A 3WUEA 3WY1A 2GK1A 3DC0A 1V0MA 2W4XA 4U3AA 1OSEA 3BAIA 3AIUA 3RPMA 4MJ4A 1UD8A 1E4MM 4E2OA 1DWJM 1D3CA 1JZ6A 1UWUA 1KCLA 1FH9A 4CVUA 1Q4NX 3WELA 3N04A 5CLWA 2D3NA 2UY5A 1C91A 5A6JA 2CITA 5C70A 1HKJA 5IXEA 2BY2A 1KR1A 3AMKA 1BYAA 2ZX8A 2CBJA 2X0YA 3WSUA 2G3JA 5E0FA 3IJ8A 1MFVA 3EMCA 4UQBA 1NOUA 3TA9A 4JZ5A 2VX4A 4ZEPA 1E3ZA 4WIWA 3L4WA 5CPQA 1E6RA 2WMHA 1C7TA 4AD3A 5A6BD 4M8UA 1BAGA 1H3GA 4QLJA 1LG1A 3AXIA 1J0YA 4N42A 4W89A 2BVDA 3PHAA 3AXHA 4YHGA 1UA7A 1E6ZA 1UWRA 4PBGA 3W27A 1B3VA 3CTTA 4KGLA 1ISXA 3VIHA 3A4AA 2EPOA 1B2YA 4H8UA 5DO8A 1X1NA 2VL4A 1H41A 2D23A 4JIEA 4YPJA 3WQ8A 2V3GA 3VINA 2ZXAA 2YLLA 4W88A 1NWSA 3SUUA 3DECA 4P7LA 3AIEA 3EDKA 1O6IA 4GQQA 1E71M 4V27A 1BG4A 3VPLA 2DT3A 3AHXA 3BXWA 2PWDA 1E3XA 4TX6A 4XX6A 3TP4A 3QOMA 2CHOA 1WZLA 1PIGA 2ZUMA 1TA3A 2VRKA 1DP0A 5AYIA 2B31A 1W3HA 1V6WA 2E8YA 2W62A 1V0NA 4D6HA 1JZ3A 1J18A 4HMCA 4DM2A 1GONA 3PN8A 3ZOAA 2YBUA 1WO2A 2BY0A 4J27A 3IANA 1R7OA 2J77A 3NDZA 2WM0A 1JFXA 4LYRA 2JEPA 3WF3A 1Y7VA 1LL6A 1NWUA 2OSXA 5A6MA 5EBAA 1LG2A 3W26A 2VZTA 2D0GA 2QF8A 4CN6A 1US2A 3IAQA 3ZT5A 2XVKA 1HJVA 5C8BB 1BGGA 1NM9A 2Q8XA 1GOMA 4MNKA 4S3KA 2DH3A 3ZT6A 1EQCA 2V5DA 3AXXA 4U5KA 3JUGA 3VDCA 1W2VA 3VD4A 4E4PA 6CGTA 5BROA 1KWGA 4BS0A 3FY1A 1K6AA 2JF6A 4HOXA 4M29A 5GNYA 3ZJKA 5GNXA 4OIFA 1W9DM 1E40A 5HPCA 3MUAA 2Y8KA 3OGSA 2WZHA 3PTMA 4N0RA 1H0GA 4TTGA 2VI0A 3AJ7A 5ABHA 3K8MA 2QV4A 2EQDA 1AQHA 2EPMX 4OZOA 4M80A 2XVGA 3I3BA 3AIQA 3K8LA 4PTXA 5A6BA 1UWTA 3MUY1 3FW6A 1XSKA 1GQIA 5M5DA 2YIHA 3SURA 2WMIA 4D6GA 2FDMA 3IJ7A 2XUCA 4AZ6A 1BYBA 2DIJA 3EDFA 1OGSA 4KH2A 4BZYA 3WN6A 4J28A 1JZ8A 3RM4A 1W3JA 3SCQA 4J3UA 2DSVA 3BAYA 4AZGA 5M03A 2CETA 3IAPA 1PX8A 4ML4A 1JGIA 5CPTA 3VDBA 1ZBWA 2DH2A 4W7VA 4OOUA 4JL2A 2BXYA 1GOKA 2EPNA 1A47A 1HJSA 4OBSA 2DSZA 4ACZA
chains in the Genus database with same CATH superfamily
3FA4A 3URNA 3U0HA 1BVWA 4AWUA 4OUEA 2NT0A 4Q4OA 4LC6A 1M04A 1OQFA 3LMYA 2I9EA 3OIXA 1E1CA 4ZPVR 2QCHA 3IRDA 3BICA 3OQ8A 3W7MA 4Y96A 4RZBA 3I3DA 4KFPA 4A21A 4AVNA 3HO8A 4NZ1A 4S23A 5KMYA 2PDPA 2XP8A 4HPNA 1OT1A 3UW6A 4HU8A 3S1WA 4C6DA 4FXRA 5ENLA 2DUAA 2QUMA 3QM3A 3FCPA 4B5NA 2XFFA 1LOSA 1WNOA 4FR1A 3NZGA 3L21A 2OLAA 1PEZA 3LPFA 1O94A 2YXGA 1BWKA 3PM6A 2R91A 3T0AA 3ID7A 4JYSA 1QNSA 5FESA 4E3VA 3G8EA 4IG2A 2NT1A 1R3RA 1SO4A 3TCZA 4HOWA 1W54A 3EKZA 2DW6A 3U5YA 4IIBA 3C3NA 1VBHA 4FLOA 3OYXA 1WP6A 3O07A 5CSYA 4IPPA 1RD6A 4QG9A 3ARPA 4HIBA 3QLDA 2ZVIA 5HUPA 5C71A 4WKHA 2X7WA 4WVXA 2VEPA 4PMQA 3IGUA 3QW3A 3QSRA 1TTJA 3TONA 2VVNA 3L9CA 3CV1A 4GA8A 2V5KA 4FB7A 1V6VA 4GNVA 1OC5A 2NVAA 4DZIA 1NOFA 3S47A 3LQLA 4TTUA 3GXPA 3W7GA 4M1BA 3AROA 3WF0A 3KE0A 2EJAA 3MCMA 2ZTKA 5F2IA 4GBUA 4ENLA 1RCQA 3VYLA 1KLYA 3NL3A 5FEWA 3GNRA 4XZHA 1CGVA 4CU7A 4OKDA 3W37A 3N14A 2Z7GA 3AJXA 2GJRA 1F73A 1SZEA 1TSIA 1Q6HA 1H4PA 4R53A 1H7RA 3LN3A 3TSDA 3PR2A 4RZ6A 1GZGA 2OKTA 4HZMA 3WDJA 5CGTA 4QIUA 1EOMA 4CLMA 3QZEA 4TIMA 1XLHA 3TK7A 1MEHA 3C2VA 2A3CA 4U33A 1CB7B 1U5VA 2P53A 1ZBKA 4D72A 4JTGA 1I1XA 1GZ1A 4Q8TA 3WLHA 3QLLA 2ZTJA 3VNYA 1A4MA 4X22A 2VMFA 3SFWA 3QMTA 1DQUA 3CHEA 5D9MA 2O56A 1XLEA 4K6AA 1NDVA 1G7VA 1PTGA 3V35A 3PZTA 5FJJA 2F61A 3OVRA 2ETNA 3NM1A 3L67A 1V7YA 3POCA 1A5BA 3AZSA 1IIHA 1ZP4A 1TO3A 2VQTA 3TAOA 1J12A 4Q8UA 4FNTA 4ZQNA 2Y62A 2AQWA 2NW0A 4EXQA 1R3VA 3CB8A 2GUUA 3PAJA 1R9YA 1ZUAX 5EYWA 2J27A 4DJFA 3WD1A 4F48A 2RHGA 4I7WA 4RNHA 3PTQA 5AVHA 3BV4A 3O6DA 4MZ8A 1TIWA 4RXGA 3SM0A 3ECQA 4H7ZA 4WZHA 3MPGA 3QFWA 1IWAA 2ZCGA 4MGVA 4TNSA 1H7XA 2BTMA 1POJA 2XYLA 1HTIA 3FVMA 3I4EA 2NX3A 2ZR4A 3T08A 1FDZA 5D4YA 3LUTA 1KQYA 1EPXA 1G9HA 1O1ZA 4MKNA 2FGLA 5I23A 1BXCA 5CC5A 1V08A 3P14A 2E09A 3K30A 2HRWA 3N9KA 2VT0A 3CUXA 4PCTA 4XSMA 1W9PA 4XBKA 1IZCA 5F2GA 1UR1A 4JAWA 2IXVA 3TIMA 1JD9A 5CBIA 4GC4A 4PEEA 3V1PA 3VX0A 1ITXA 3NCOA 3V36A 3HV8A 2YGYA 1FA2A 1R3TA 1OT2A 1QW8A 1KKRA 1FP9A 2WNNA 4HHLA 1I60A 2VKZG 2DP3A 4JN6A 1Z9AA 1YLVA 3GVVA 5AC4A 3E2RA 5U7SA 4R0XA 2B81A 5AYZA 3TYUA 4G7EA 1Q66A 4Y9AA 2VO5A 2HE5A 3ZR6A 4MJ2A 4JTQA 1MMFA 3WKZA 3OVQA 3F5LA 1JZ4A 1OHLA 1H7PA 1CEOA 1J9YA 4TUFA 1OFQA 4GH3A 4PCSA 3TTYA 3CLWA 3VAVA 1KM6A 5I5RA 3UETA 3WBYA 3TEVA 3MHUA 4HMNA 2E6AA 1PBGA 2PPOA 3VCNA 2H90A 5D8ZA 3SRFA 4AH7A 4XAGA 4UQEA 3K8KA 5I3IA 1A53A 1HW6A 1R9ZA 2CLIA 4LYPA 5LYRA 3ABSA 3BJTA 3MI2A 5D37A 5HPOA 3GXFA 4LBRA 2QNEA 4I6VA 5IM51 4BWLC 1ZY9A 3IV3A 3KOFA 2P88A 3SY1A 3THUA 3W29A 1E73M 3JW7A 4UZSA 3CL6A 3NA8A 1REQA 5CSSA 2EG8A 4JS3A 1LL4A 3K46A 3LV6A 3MI3A 2J78A 3BDKA 4ADUA 4J3ZA 5E6ZA 5BXJA 5I02A 1JCXA 4QDWA 5BMWA 3GHUA 2EJ1A 1XW8A 1UP3A 3C52A 4IPLA 4XIAA 1TX0A 3ONBA 5CZTA 2W91A 2DT0A 4IFOA 2OZ8A 3WNOA 3BW4A 2V5LA 3TW9A 3VCRA 1E44A 4QQ3A 4S1FA 1PV8A 3LCLA 4N7QA 1HKKA 3R7MA 5D9NA 4H00A 4WUIA 2YL8A 4DY1A 1VR6A 4GK8A 1RBAA 1IE7C 3K4DA 3DH7A 2ZVRA 3WJXA 4KQNA 5LKYA 1KFWA 1R3YA 2RUCA 3BG5A 1FD9A 3E74A 1T99A 3B04A 2PWEA 3BAKA 1UIPA 2I9UA 3M0HA 2EAWA 7A3HA 4N9BA 1AFSA 3DYMA 4HYVA 5A8GA 2UY3A 4B5XA 1JXKA 1OZMA 2P8BA 5F1VA 4KWOA 5I3JA 2HVNA 3WK2A 4ZQOA 3B9EA 2HWGA 3GY1A 1GG0A 4XVDA 3VABA 3T0TA 4OHQA 3FHAA 3AU6A 1Q6LA 1UWAA 1V51A 4YWSA 3VE7A 4IGMA 1CNVA 4DXKA 5LIKX 5JBDA 1T6MA 4GIVA 1IF2A 2XPBA 4DJFD 4HNVA 1ODUA 1U5JA 4CQ8A 4NRSA 3J7HA 3P5ZA 2IMRA 1S5NA 1TJ0A 1CECA 2NUXA 1IGWA 3DFNA 3PUGA 2YR1A 1L6WA 1R7AA 2BHYA 2AQOA 4HU0A 1GYNA 3KDNA 2E9BA 2DZTA 4UTHA 1HKVA 4LVDA 4LAYA 3DERA 3TJIA 4AEOA 1WQ5A 2NUYA 3BLPX 3U4AA 4QGCA 1LUCA 3EWCA 3GUWA 1NF0A 1TWWA 3RM8A 2Q01A 3LDVA 4FXFA 1I2NA 1GW1A 1UH3A 4O19A 2WW5A 1MXDA 2VRJA 2XG9A 2INFA 3IUDA 3P6LA 4XKMA 1FKDA 2VURA 4JTHA 1UB3A 2DT2A 2GL5A 2WBGA 3MUIA 3PZQA 4I7VA 3ABXA 4JQ2A 4S2CA 4HU3A 3M07A 1AJ0A 3I7QA 1J01A 4M6QA 3LGGA 5LIXX 5DN1A 2OZTA 1EOKA 1R87A 3RLVA 1JG9A 5HK4A 4AC7C 1H63A 3MV01 1QNPA 2AAAA 4QE5A 2NQHA 2Z2UA 4O11A 3WD2A 1J0JA 4AIEA 2ZZ5A 1Y8BA 5H8MA 3AQUA 5M2FX 3VK5A 3VE9A 5BMXA 1TMLA 3EXSA 4KEMA 1W1ZA 4FOKA 3V16A 2XM1A 2ZRZA 4LBUA 3CS2A 1YXYA 1GVEA 3S5ZA 1EH9A 3ATZA 3U5UA 2DZUA 3LB0A 1JPKA 4H8NA 4UMBA 4PZVA 1RJQA 4DBDA 1EP3A 1XLKA 1O1HA 4JQ3A 4OOZA 2YJQA 1FKJA 4OGZA 1UOKA 4I5XA 3ZXWA 3WBWA 2PTZA 4W8AA 4P7NA 3TNBA 3C8NA 3QPEA 1EXBA 3GXMA 5L6UA 1VJZA 3GIQA 1NQ6A 3GC5A 4ZQCA 1IV8A 1EIBA 3ABOA 3BGJA 2E6DA 2DZSA 3B3DA 3SCWA 3LUOA 2TAAA 4YCPA 1LWIA 3CMFA 3VIFA 4L6OA 4GYPA 3L0GA 5BU6A 1OFAA 1SR0A 1CENA 2BBFA 4IMFA 4E38A 2ZUUA 3H9RB 2H6RA 4AW7A 5BXSA 1AG1O 2PRMA 4GQGA 4HPHA 3BOXA 3BJFA 4P2VA 3Q45A 3E2SA 3IV8A 3AYVA 3W1AA 2E4TA 3MHFA 3GDLA 2ZE3A 3AI0A 2J66A 5A8OA 5C9XA 3HJZA 4AYSA 2XDFA 3W82A 2C19A 1W1PA 4EAMA 2PBOA 4BR1A 5HDRA 4XAZA 3E0VA 1E4IA 4LUSA 1X7IA 4JX4A 3EZ4A 3IJQA 4C6EA 1K9EA 1UBPC 2ZA3A 4JTEA 3RRAA 4D6JA 1XSIA 2J7EA 2BLEA 4DRQA 1W9XA 1K8ZA 3LCWA 4BF7A 3KAFA 4YJ5A 4M6PA 1WDQA 3SGGA 2G41A 1L2QA 3PPFA 1KKOA 5BYWA 4A3YA 2O7QA 3RK8A 4Q6XA 1TVPA 3KS5A 3U7VA 3ZS4A 5HJLA 2XP7A 3FS2A 5D32A 4OBTA 1OYAA 3SW6A 2FFCA 1F5ZA 3IJ6A 5EY5A 3QBUA 3EWBX 1ZCCA 3KOZA 3Q65A 1RHCA 2Y70A 3GFZA 1MRAA 3EWYA 1UJPA 3EPOA 2D20A 4XZWA 2W9MA 1FWHC 2E6FA 1QUMA 6REQB 3ITTA 4AZCB 5A6SA 5A6KA 2XIQA 1F9CA 2HDJA 1HJUA 1EC8A 1XF0A 4JKKA 1EYEA 4PL1A 1BD0A 3IJLA 4ZCWA 1AJZA 2A3BA 3QV7A 4WRHA 1ITCA 3NDOA 2FMOA 5BWFA 2XGBA 4IIHA 1BXBA 1VEMA 3OU8A 4B90A 1TELA 5CPOA 5J5DA 2QT3A 4J5NA 2YFOA 3WD3A 3HQNA 1VYRA 2L5HA 3W7DA 3KLKA 1JUKA 3VUPA 3ZVHB 1DOSA 1XM3A 5TF0A 1DE6A 2PDCA 4A3QA 4ICCX 4GFIA 2Z24A 3O5EA 3UXAA 2WVTA 4R3UA 1XRFA 3RAOA 4Z2HA 1HX0A 4DXVA 2J13A 3R13A 1IT0A 2PWHA 2QZRA 2G3IA 1WXZA 3DHFA 4IPJA 1GK8A 3RU8X 3M4HA 2VFDA 1R9XA 2OOFA 8RUCA 1ZENA 3CHVA 1MNSA 5I6SA 1JIBA 1FOBA 2XP4A 2POTA 3VD3A 3NDYA 2FYMA 3KP1A 2Z1BA 4PRTA 3PRDA 2OLHA 2F23A 5E09A 3U8GA 4HA1A 1SZRA 2JE8A 3PWGA 4CD6A 1F3WA 1W5NA 4MWAE 4AD2A 4JTUA 3TDFA 2J79A 4GXPA 2ISDA 1AQFA 1Q85A 5I77A 2M2AA 1KGXA 1UKTA 4KWVA 3CIWA 4BQ5A 3L0NA 4AF0B 5D09A 4MSSA 4HSOA 2J7CA 2OQYA 3TYDA 4KEZA 4O50A 4O16A 2WJDA 2E0PA 3RPDA 5C7HA 5FD0A 5JBFA 2FJKA 3TJLA 3P61A 3GPKA 4JX6A 1NP2A 2BX7A 2V2HA 2E5DA 1TJRA 1AQMA 2PFHA 1XLJA 3P60A 5FOOA 1S1PA 2PBGA 1E6PA 2A3LA 2CHNA 3LCIA 4HTBA 2TPSA 2Y61A 4DUXA 3TC3A 1X1OA 3EB2A 3LHWA 1VQTA 3QHNA 2ZDSA 4MNMA 1PDZA 4FNRA 1ZHAA 4IQJA 2I14A 5EMYA 4JD4A 2V5BA 1SJAA 2QJHA 3ZLGA 2YFNA 1ZNNA 3HG2A 2ABAA 3KW3A 3A4WA 3ZJ8A 4GX8A 4NRRA 1YADA 3W1TA 1R3WA 3KABA 4FK9A 5I03A 2BG5A 1VJSA 5IHRA 3OBAA 1Z8AA 6PTDA 4DO4A 2PRHA 4FMVA 3B0UX 2JKPA 5DXXA 4YXGA 4IQDA 1FQ0A 4AXKA 1EJ7L 3I7RA 4MFEA 1T7LA 4D6CA 3MDWA 4AHQA 1AK5A 3FJLA 1Y5VA 3TX9A 1HL9A 3D46A 3QV9A 1IEWA 2PTWA 2A6NA 1PX4A 2Q71A 3NG3A 4R5EA 2BGSA 4C1LA 1E4LA 4BKNA 2WKJA 4LBSA 1ZK6A 1UR2A 2HXUA 3WH8A 3UR7A 1V3HA 4XUYA 4B5VA 3VM7A 2OQHA 3GVGA 2F2HA 2HPMA 1XC6A 2NXHA 2QHAA 4LANA 3P93A 5HJYA 1ELSA 4GUHA 4PRWA 3GDTA 4P7OA 5I3DA 1D7KA 1YDOA 4L56A 4W84A 1K9TA 1O5RA 4QJ5B 1LQ0A 1OWQA 4RPQA 3SGZA 1G94A 1HL8A 4QQUA 4KCTA 3HPSA 4NYYA 2QCDB 1DQXA 2BODX 1XCFA 2PLCA 2FHFA 1WDSA 2J75A 5DF0A 4W9QA 3O16A 4HA3A 3BARA 3UG4A 3U2OA 2VWSA 3PSVA 2FJUB 4G9PA 4S3AA 3OP2A 1QT1A 5JH1A 4IPIA 1AH3A 4N4QA 4PTNA 2ONEA 4O8AA 2EO7A 5M3WA 1WB0A 1ZJIA 1H7OA 2PF0A 1XJBA 2O7SA 4ILSA 1JDCA 4Z17A 3PUDA 4ICNA 1QBBA 2Z7KA 3KWSA 4NF7A 1W91A 1JPMA 3LBMA 4MMWA 3UZXA 3M46A 1R30A 4JFUA 4DNMA 2DEPA 2GOKA 4QCFA 3S1UA 1XD1A 3E5BA 3CXOA 2JZVA 1ECEA 4PMRA 3USZA 3G1XA 1AUSL 1B57A 2UY4A 4TV6A 5REQA 4YYCA 1BHGA 1NELA 3E0WA 3BMWA 5GJNA 1XLAA 1A80A 3QY8A 2C1HA 3WJYA 1U33A 2MPHA 5EMKA 3P0WA 2WC7A 3T09A 1OFPA 4S39A 2M08A 3P82A 4MPKA 3UEQA 3BURA 3NSNA 1W5PA 2E5CA 3DFTA 4GKTA 3RU6A 1ZU8A 1WCGA 2QEZA 3ZSTA 3LG3A 3OLGA 4Y90A 3T6CA 3O63A 4GZ7A 1K77A 5C2GA 1UD5A 1LRQA 1JCTA 2WCAA 1FDJA 1GOWA 3T2QA 1DV7A 3E12A 4ATDA 3BMVA 1S46A 4J3SA 1KV8A 3EWDA 4DRKA 4JXCA 4JEJA 3TZFA 4CU8A 4LOCA 3M5ZA 1FCVA 2XGZA 3LBOA 1MEIA 2JEQA 2F21A 2LGOA 4HSHA 3AHTA 4D6DA 2D69A 1XLLA 1PX3A 4N9CA 3CZGA 5IBXA 3TSMA 1QPQA 3DFOA 1B3XA 3JRKA 1TQXA 1YQ2A 3ZQ9A 4WJ8A 1KGUA 4U2YA 1IIGA 4EF9A 2RGLA 3MUXA 2VQUA 5JU6A 3LSBA 5FSEC 2DZXA 3S6TA 4YVXA 3WL0A 2R1KA 3N29A 2ZC1A 1YBQB 1BWLA 1M03A 1ZPTA 5K9CA 4ROPA 2KE0A 2Z00A 1CWYA 4ODMA 3APGA 3CPUA 1DE5A 4C90A 1RH9A 1ZJAA 1A0CA 3W74A 3NUKA 1GEHA 3RX4A 4WEVX 2D9FA 4FAPA 2X0SA 2ZRWA 3W2LA 4GO8A 5FF3A 4ZQRA 2DZAA 2XSXA 2DG3A 3MVIA 3CIXA 4OECA 1XUZA 5FJPA 4NNRA 2PDGA 5CKSA 3N6HA 3N34A 1EFZA 4OT7A 1KW1A 1UR0A 1DJYA 3VKKA 3GH5A 1GRJA 3WX7A 3KAOA 3SCOA 4KFOA 4C6PA 2EXOA 3AMCA 3NJ3A 4ZOEA 1JF6A 1H11A 1JL8A 1OB0A 1SZFA 4WSJA 2FZDA 4IMEA 4AHPA 1W1A1 4IJRA 1GQNA 3TFCA 3CHDA 4RKAA 1US3A 1X98A 1R46A 3LS9A 4J9JA 2QAFA 1YX1A 1FKFA 2OSYA 3NXFA 3CWOX 1NU5A 3K4WA 4ZMGA 3FFSA 1B3WA 3CUJA 1VBJA 3VXGA 2D0FA 2WSRA 1EWEA 3O15A 2PF8A 5REQB 3SQSA 1E0WA 1V77A 3EEZA 3VOFA 2WC3A 3GM8A 1JVWA 1BPLB 3DIPA 4LXFA 4V1YA 4HHPA 3UI5A 2W79A 4A3RA 2C8NA 1ADOA 1YE6A 1PE1A 3NQFA 2NVDA 3FAXA 4M19A 3BCJA 4JOMA 5ABFA 4B16A 3M6DA 3SCTA 4DB7A 1Q4WA 3Q67A 3L4UA 3V4BA 1CCWB 3GXIA 1EA0A 4XD3A 2WANA 2VJXA 1RZMA 3KP0A 5BOFA 2Y5EA 3NIYA 5AOUA 3O5KA 3GTHA 3QGKC 3S1XA 4TVUA 4X61A 1ZBCA 3RXZA 2D24A 1JZ5A 5D33A 3YPIA 3LHZA 1AW5A 1XFBA 3TWAA 4FOUA 4AVOA 5DMLA 3DFQA 4GACA 4ORMA 5K9XA 5CCZA 2CLOA 2JFEX 2IUZA 4OBRA 4S3BA 3KLLA 1PIFA 1JGMA 4UTFA 3OLIA 1XHGA 2ACQA 2XWDA 4C1NA 3LI1A 1EO5A 2WSKA 4LT9A 5TQLA 1M65A 3TN5A 2Y24A 4GZIA 1GVOA 3S5YA 1R38A 1VGAA 4U5IA 5EMLA 4CKQA 5JH8A 1PINA 4L72B 4ACYA 1S2AA 2Q8ZA 3KADA 4AX6A 5BXPA 4EIVA 2VCAA 4B92A 3VO0A 1J96A 4TMCA 5I3GA 5AVNA 3W6LA 4DELA 2VP8A 4ERIA 2HVMA 1LQ2A 2QVHA 4FPSA 4JKMA 1QNVA 3QZAA 3O5IA 2CIPA 4IISA 2DFAA 1BXNA 1XG3A 4BHYA 3O9NA 1L2UA 4J35A 3M0YA 4KBXA 4UB9A 5CG7A 4DJEC 2RAGA 1I9CB 1DWFM 2PRLA 4Q7BA 1PHQA 3G22A 5CXPA 1JYVA 4ONVA 1RLCL 5BXTA 1D7IA 3ZMRA 2QCGA 3OBKA 5KZEA 3EX6A 1V4YA 3NR0A 1SZNA 3KHDA 4GWEA 1V3LA 3T44A 4QNEA 3F2BA 1FXQA 2MANA 1KXHA 1VFMA 4NU7A 4HOZA 3LM3A 5HUOA 3CGTA 1PYMA 1E0XA 4DEFA 2HS8A 4YTSA 3WK3A 3JXVA 4U3AA 3L12A 1V7AA 5CZ0A 5HQLA 1LTDA 4PTDA 4H9YA 1K4GA 1E4MM 3SAZA 3S0CA 2VXNA 4PC8A 3GFXA 1NMWA 3O6CA 1Q4NX 3VDGA 3UJSA 3N04A 4CEXC 1UBSA 5A6JA 1O12A 1SPQA 3AWOA 4UUIA 3AMKA 1XYLA 3UZZA 1BYAA 4KFNA 3RLHA 2CBJA 1VLWA 4N02A 4DI9A 2H3DA 1TCOC 3C2EA 4UQBA 1NOUA 2PURA 4H6EA 3SRHA 3ZR4A 4O1BA 1TPB1 1P7TB 4DRJA 2WZTA 1C7TA 2WMHA 4Y8EA 1H3GA 4NXKA 3AXIA 2G4JA 1J0YA 1N2VA 4W89A 3PHAA 4Q4RA 3QC3A 1LRTA 3LCXA 4PBGA 4IX2A 3W27A 4KGLA 2ZBTA 1FWJC 4I9JA 4DO6A 2PC4A 5DO8A 4KWSA 3KOYA 1X1NA 3CC1A 1H41A 5G5IA 2V3GA 4NT0A 3AIEA 1RCOB 3ANVA 1QTWA 4GX9A 1MUWA 1O6IA 4V27A 4E2DA 3VPLA 3T9PA 4ZR8A 3BXWA 3PJXA 1GKRA 2VR2A 1A5LC 1E3XA 3QN3A 1D8WA 4YU1A 3TP4A 1MO0A 3S42A 4ZB2A 3S4TA 4L6DA 8TIMA 1TA3A 1DP0A 2ALDA 1W3HA 2E8YA 1V0NA 2DG9A 4WY0B 2Z1XA 4HMCA 1ZFJA 2I1OA 1Q6IA 2YBUA 4K7VA 3C3UA 1IR2A 1JFXA 2W3ZA 1Q5MA 2JEPA 3WF3A 4LY4A 3OZMA 1XFCA 1LG2A 3HG5A 2PUZA 4FS9A 3MP4A 3IAQA 4Y9NA 1BGGA 1NM9A 4A2RA 4GJIA 4MNKA 1TRIA 3NI6A 4XD4A 2EF9A 2V5DA 3AXXA 1E9ZB 1XI3A 1BRLB 1I8JA 2EULA 3NFUA 6CGTA 4K8HA 3FIGA 1EGMA 4BS0A 3FY1A 1K6AA 1C9WA 2QJMA 4G6CA 3UXKA 2HJPA 4NXSA 3ZJKA 4MJMA 5FSDC 4S3CA 5LNSA 3G2GA 1QMLA 4CQBA 1E40A 1RR2A 3MUAA 2NZLA 3OGSA 3UBPC 3I4KA 1PTDA 1ADSA 3PTMA 4N0RA 1H0GA 2IW0A 3V0UA 5HWCA 3O5LA 4TTGA 1LLWA 3V7PA 2PV3A 4H19A 2GDQA 3K8MA 2EQDA 1PSCA 3PWIA 1JCJA 3I3BA 3K8LA 4C6LA 4PTXA 5A6BA 3B03A 1NSGA 1GQIA 2P5NA 3G1YA 2WMIA 4D6GA 3IJ7A 3Q58A 4C02B 2EG6A 2DIJA 4KH2A 3LA4A 3WN6A 1JZ8A 4Z0JA 3W00A 5FJIA 2A7NA 1RQHA 4J4NA 5HW8A 1NJJA 3IAPA 4A6GA 4PL2A 4ZOBA 2R24A 2OCZA 3ICJA 1RV8A 4OOUA 2RKXA 2F4EA 4W88A 2DSZA 3CT7A 3R2GA 4XD5A 1JVNA 5HKGA 1EF2A 2QJGA 5I09A 1KR0A 1EZWA 1PZ1A 1X96A 1JFHA 2QCEA 2YPIA 4A05A 5CEWA 1TE6A 4ZBCA 1J4HA 4DWSB 4UQCA 4CN4A 3AHYA 1E15A 3M9YA 1L6GA 4E2BA 2DW7A 3NYDA 3UI4A 4V1XA 1B9BA 3W87A 3QOKA 3WH5A 1K4HA 5CSUA 1ZSXA 3EX4A 4LALA 5IBXC 3QRHA 1XR2A 1SSDA 2ZADA 1UIOA 3C2RA 2WVSA 5DBUA 1I2QA 2O9TA 1C90A 3PUOA 1BVNP 1KQZA 5E70A 1MXGA 2X1TA 4C1NB 4YTQA 1K1DA 1XKJA 2N87A 1W5MA 4NAEA 3CQIA 2RGMA 3ZO9A 1GVSA 1EBGA 4NAFB 4B3LA 4DRMA 4Q8OA 1R3QA 3VIJA 3GVQA 3P80A 4O57A 1DORA 4F40A 1XISA 3UP8A 5CPMA 2YDQA 3A24A 3BG3A 2GGIA 2ZX6A 1YEYA 1DQWA 1Q6RA 1QNOA 4MFDA 1QCWA 4JL1A 4QX4A 2J62A 3GTXA 1W9UA 4GZEA 4MVAA 1UD4A 3H2AA 4IWWA 1JR1A 4AYGA 1GOOA 1WDWA 1HQTA 2YBVA 2J47A 4QAWA 4HBEA 1K8CA 1SFJA 1AD1A 4LUJA 4IUGA 4L5ZA 5AHNA 2NV9A 2O9OA 4ORIA 4XKYB 1AODA 4GVHA 4LFYA 3C86A 1ITQA 4JN7A 4GY1A 4DWSC 3FSUA 1V79A 4H9ZA 4ZGYA 3R58A 1ADDA 4RR4A 1CXHA 4UTKA 4NVTA 3S9ZA 4NJGA 3OPSA 3SCUA 3G6MA 1CLXA 1DPMA 4EPKA 2J25A 3NRKA 2EPKX 2PU1A 3T8LA 4PMYA 3SCRA 3I6CA 1GQLA 3JVAA 4KCWA 2A21A 4P7QA 1GOQA 3MSYA 7ODCA 2XVLA 4GUFA 1W5OA 3AYTA 2ZX9A 1FFQA 3V1HA 1OFOA 2X16A 5HOSA 3Q37A 7CGTA 2A3HA 3BG9A 2CBUA 1XPYA 2A2IA 2HK1A 4PBFA 1E56A 4HQVA 2HISA 1BYCA 2WCGA 1XBXA 4WKAA 4HJWA 3PJUA 1RP8A 3G5EA 4HPGA 1UH4A 3LRLA 5XIAA 2PPNA 4HYRA 5KITA 1DHPA 1CT5A 3URAA 4GYPC 3OOBA 3V5FA 1T5AA 1PJ9A 3URBA 3DU0A 4OTKA 3GNDA 3WQEA 1FH8A 1VF8A 4CD7A 3SJ3A 4H8HA 5G4WA 3C56A 3WFZA 4AISA 1CB2A 1E51A 4BEQA 4FR6A 5DLCA 2X09A 4Z2IA 1PCWA 2XPKA 1SYTA 3E38A 2HTMA 4JTLA 2BMBA 3ZIZA 3RO6A 3UWYA 2VD8A 2E7FA 2NVCA 2C14A 2C7FA 4Q8QA 5GVJA 3UJEA 2BNJA 3H12A 4Z1DA 4X0VA 3WNKA 1MQRA 2DSKA 4U85A 1M41A 2BY1A 4LTSA 3UXLA 3TWBA 4AZCA 1OFBA 4KWWA 3K4AA 2P0OA 3AHVA 4R88A 1X6NA 4MLRA 3W9ZA 4AB4A 1GVIA 1OVDA 2IPWA 4BI6A 1TFVA 1GORA 2FZMA 3UERA 1XYAA 2BSLA 2ZKMX 2VEFA 1GJUA 2CLLA 4DZ5A 3KL5A 4PMDA 1D8CA 1A5NC 2PDBA 4QCEA 3CWHA 3UNDA 5FF7A 3ZFHA 1JDAA 1VBRA 1TPH1 1XC4A 1QJWA 4IJBA 2G3MA 4PMZA 1MXSA 3IIPA 3D0CA 3GHSA 1QVBA 3A5VA 1XGEA 1RAKA 2WAGA 4DRNA 2XH2A 1KRBC 4IIFA 4Z1YA 5A6AA 7REQA 1UZ1A 4XBJA 1MW1A 2A79A 3S2CA 3DFYA 1XIGA 3UF9A 2D73A 3RDKA 2G97A 3EA2A 3TQVA 1S3TC 4J40A 3QMSA 2NXIA 3DHPA 4W9PA 2X8RA 4IG2B 3F4CA 3TZNA 1ONEA 3N2CA 3RYSA 5A8PA 3PZOA 1TZ9A 4U28A 3M47A 1EJTC 4GC3A 2D1ZA 2IKHA 1AVAA 2OWWA 4QDPA 3TC7A 3W2UA 4GPNA 4DPPA 1RBOB 2YDRA 3VD7A 4P8XA 2ZUNA 1YKWA 4QLLA 2X40A 4I9TA 4ODNA 3NO3A 3AS0A 3W1XA 3UA4A 4JFSA 1O5KA 2DU2A 3IIVA 1OJXA 3PUEA 1E9IA 1QPLA 2OX4A 1QPKA 4MAZA 3B0PA 3IUIA 3TSBA 2V2CA 1I2PA 3F1QA 2OWCA 3F4DA 2GQ9A 5BOEA 1GJWA 1X6UA 4GO9A 4L6HA 1OIFA 4ALDA 2NLIA 2MNRA 1CXKA 3CV2A 1PBKA 4E3TA 2PWGA 2AGKA 3S6DA 1FKKA 1UJQA 4HYWA 4RW5A 4GI6A 2H3BA 2QJNA 4IPNB 1TUXA 3GNOA 3MA8A 1T0OA 4PE8A 4WKFA 3MDYB 1PHWA 1ZLPA 2EBNA 3B4UA 3S1VA 4LH8A 3LZ3A 3FJ6A 1B0IA 5DT7A 4AZHA 3TU9A 3VNIA 1WZKA 3GTFA 4HP5A 4GE8A 2G0WA 1HGWA 1XLBA 3EXTA 4XK2A 3KCEA 1YTDA 4ZVJA 4F0MA 3C0JA 3ME3A 4IICA 1EJVC 3WMBA 1FBAA 2OZ0A 3TYAA 5CC3A 2H9AA 1J0KA 1J0ZA 2Z1KA 4LVBA 3UCDA 4AD4A 5GPRA 4H9VA 4HCHA 4UQAA 1B90A 1GT8A 1B9ZA 6ALDA 5E0CA 5HBFA 3CPRA 2DY3A 1TE1A 3BLKA 4UDMA 3FAWA 4FNSA 4W93A 3VIPA 3BC9A 2DG4A 1LT7A 2BXVA 5C2XA 3ZWSA 1HJQA 2O9PA 1I45A 5C2CA 2R14A 2Y85A 4QJ3B 5CC7A 2QIIA 1UKOA 4A8IA 3HIJA 4WJXA 2OTDA 2PD5A 3DKJA 4CGTA 5AC5A 2WVVA 3MMTA 4HMEA 4TX8A 2RUDA 4ZXLA 5FIPA 2RH9A 1D6OA 1ZRQA 3UCQA 1Q3NA 5M1TA 1EWDA 4B91A 4XAFA 4XQ6A 3AIVA 3PZNA 2VEMA 3ANYA 2NQ9A 1UR9A 2VTFA 3QVQA 1QI4A 1J6OA 3SY5A 1MUMA 4JNYA 3FHQA 3WLOA 4YYFA 4DQWA 4KQZA 4IQ2A 2V82A 4UR8A 1OCNA 1KGWA 1TJ2A 1F07A 3EDJA 1LM1A 4IX0A 3MUZ1 3TOYA 3E5PA 3T4CA 3UZ5A 5D8WA 2X41A 5FL0A 3SUVA 4CU6A 4XZMX 1VEPA 1YXDA 1I75A 3BQ5A 2H8XA 4W5UA 2V3DA 2MUCA 3NVTA 4GCAA 3FEQA 1G69A 1IWBA 2QUTA 1JPIA 1PZ3A 1WKDA 3D5HA 3W73A 5XINA 4M7SA 1F05A 4QAIA 3IVUA 4QRNA 1E1CB 3TROA 1ME9A 1YNQA 4ZTXA 3TTQA 3R0DA 1UCWA 1Y5WA 4AXNA 4JIIX 1XH2A 1P0KA 1XLIA 3R4IA 4C6QA 4CCZA 1E70M 1UG6A 5KZMA 3WQVA 3GC2A 3R0KA 1P5QA 1FWBC 3JS3A 2REQB 4DVOA 3IJIA 1HL2A 4DJDD 4X9SA 1QXLA 2ICSA 3STEA 2WMKA 1FCQA 4DBEA 3Q2DA 1GHRA 1KFEA 2A7RA 3MYPA 3BAWA 2WMJA 4R27A 3N6QA 3WLIA 2J7GA 4LPCA 1VFOA 3KEHA 1A3WA 1VPYA 1ISYA 2HXTA 2RJHA 1WKYA 4W9OA 2B7OA 1YNPA 5JBEA 3W38A 3DG3A 4K36A 4RX0A 3KTSA 2VDHA 2UV8G 3A9IA 2WB5A 1IWPA 1LOQA 3WQWA 1WUEA 1NFGA 2DJLA 4FX7A 2XJ7A 3AYRA 2J6VA 3KVKA 4QP0A 1BKFA 2XM2A 3CZ8A 2O55A 1M6JA 2Y4SA 2ABBA 4UTTA 3VZYA 4GIEA 3NAVA 1QHOA 3REQA 2E40A 2OZ3A 3EY6A 2VHLA 3FAPA 2UWFA 4XKYA 1XKYA 5CZJA 5AYXA 2DORA 3MU7A 3M64A 3FXYA 3V3WA 1P6BA 1PXGA 4ZO6A 1V3MA 3M6YA 2PGEA 4UQ9A 3TAKA 2B4GA 1BSIA 4R85A 5I7GA 5HWBA 4RNJA 2GQAA 6XIMA 1JCLA 3JR2A 2XVPA 2C18A 4PMVA 4RE0A 2IPGA 3OLEA 2BS9A 2E1DA 3GK0A 3U6WA 2GJXB 2I5IA 2VC9A 4S2BA 3UY8A 4KKXA 2PBCA 4GI8A 5FJUA 2Z4GA 5A1AA 3P74A 1J93A 3L68A 3FNDA 5BRQA 4CCCA 3A21A 2ZIDA 2ISSA 4PA8A 1ONRA 3S2JA 4LAKA 1LL7A 1QI3A 2VUNA 3KS6A 2D3LA 5GJPA 1NFPA 3R25A 1UP2A 3L4XA 1Q2SA 1QATA 3ES8A 1EC9A 1VENA 2NWRA 2WPBA 2PEVA 1FDYA 1WV2A 3UCCA 4L1WA 3ZZ1A 4ASTA 4PMXA 2XPAA 4F79A 3D3AA 3QHOA 4D71A 3LPGA 3HGJA 2Y8VA 4JCMA 3GR8A 2XH4A 5T9CE 5CH9A 3VDAA 3PBYA 1W31A 4U10A 4QZVB 3SECA 1SMAA 2W61A 1GW9A 4M6VA 1DIDA 1S3HA 1TWSA 1TZZA 2GGJA 2G3NA 2ZR6A 3C5QA 4QXIA 1VFSA 1ESWA 3TXZA 4RE4A 2WMFA 3LMZA 3UG3A 4PTVA 3GR7A 1YIXA 5FEXA 2OPJA 1UOZA 1Y5XA 2DDXA 4QJ4B 1NDZA 1TPVA 1UD6A 3PK7A 1M1BA 4DRIA 3SB0A 4X63A 5FF2A 1F7BA 4ODOA 3T0BA 1R2TA 9XIMA 3WJSA 1QOXA 1YE4A 2CKRA 3CZLA 3TCSA 3LGEA 4ZO9A 5CSRA 2OJPA 3CZKA 2HROA 2BOEX 2CXGA 3V75A 3HJEA 2VGIA 4UFJA 4IMAA 2C1IA 4AIOA 5HR7A 3JYJA 3OA5A 1XYZA 4HPXA 1LUCB 3H23A 4XVEA 1RLDA 4W85A 4MKSA 4UBPC 3CZJA 3A13A 4D8ZA 1ICSA 3NEVA 4UR7A 1XIMA 2XZ9A 5EA9A 1OF6A 3R89A 4B5SA 4CNNA 5IHSA 2DZVA 3W7PA 3N13A 4TX0A 4O1CA 1JPDX 4KR0B 4W4QA 3XIMA 2P50A 3MCNA 1HNYA 4DHGA 1ZCOA 3W1RA 1Q63A 2BGNE 4KETA 1FWDC 3CL8A 4EAYA 1HKIA 1M68A 5HR6A 2KFWA 1I2OA 1ICQA 1D7FA 3UT0A 4U2ZA 4O0KA 3GUGA 3HA1A 3S2MA 1VRXA 1W2PA 3IPWA 2OX1A 3RFWA 1BEUA 1ZZMA 5EL1A 2X2YA 1Q6CA 2FKPA 1X97A 2ZXQA 2DVTA 1GYLA 4EPEC 5HNRA 1WKEA 3MWCA 4L65A 4GNJA 3M0MA 2OR2A 4DNHA 1JYWA 1EGZA 5F7UA 3OHIA 4QHRA 1P1MA 3WD4A 4LAUA 2A4AA 4QT3A 3M0VA 3O5OA 3C2YA 2QDHA 3HN3A 1B3OA 2W6RA 4MADA 1H5VA 4F0RA 1Q7MA 5CG0A 1IXNA 1R3SA 1H60A 4HVXA 3BO9A 3QKZA 2R1LA 1E6XM 3M5XA 2FTYA 1RA0A 4NG3A 1TTQA 3WF2A 3QY6A 4QG6A 3MWAA 3LHYA 3HQOA 3L65A 4JTTA 3WLQA 3QV8A 2H8ZA 3MO7A 3VTRA 3Q94A 1CGXA 5L9FA 1KBIA 1MI3A 1BTMA 3JU2A 3VNMA 4FALA 3H4XA 3QTGA 1F4HA 5I24A 4S3DA 2PD9A 3OO2A 1DXIA 2Z1SA 3ONCA 3BCDA 5CQ1A 4OFCA 4UNLA 2ITKA 4J1OA 3UPMA 4JY9A 2ZWZA 4DN1A 1KRCC 3W86A 1ZTVA 3CAKA 1XXXA 3IVTA 3ARRA 2NXGA 2OO0A 1MW2A 5H8UA 2BVYA 3FJ4A 4Q32A 3MV11 3R10A 3FN9A 4DJED 3UWUA 1H7NA 1HVQA 1KLZA 3DC8A 3KBWA 4D9PA 4AEEA 4BI7A 1DKWA 1V3JA 2QCLA 3NL6A 4ZOAA 3U7BA 3NVDA 1XDMA 2DPEA 4J3XA 2QCFA 2UZ5A 2OSWA 1LROA 1ME8A 4O12A 4QBXA 4B3ZA 4LSBA 5LIWX 4IIGA 2OYMA 3HTWA 3LCGA 3WEMA 3S9IA 3UZWA 2WBKA 2VVSA 3M0JA 2ISVA 3IJDA 4DYEA 2QPUA 4WOZA 3AS3A 3GSMA 3GIYA 4D8AA 3OB8A 3VGDA 2QXWA 1FVPA 1L0PA 4JTRA 2Y7GA 1LBFA 3D47A 3ZLHA 1Z32X 3LXBA 5C7VA 2HBVA 2GSJA 2FH8A 1TG7A 2FGZA 4J3VA 2FGBA 3L2IA 3OVPA 1H7WA 4UFHA 3MANA 4GI9A 3NQ2A 3HB9A 1I0DA 4FNUA 1OCQA 6A3HA 2FZ9A 5D2WA 3KFTA 3WEZA 1LQAA 3NO1A 2F38A 2OFNA 2WLYA 2F7FA 4D2JA 3GO2A 3DCPA 5CZSA 1TPUA 4TQTA 3WDIA 3JYMA 2WHLA 1XRVA 3PZ9A 3C61A 3LPOA 3FA3A 1S5VA 1JNEA 4H3DA 1LBMA 4O1EA 4QFUA 2NWSA 2LPVA 4LB3A 1FHDA 1Q13A 2QCNA 3CYJA 3UGRA 1UC4A 1QR7A 1V93A 2WVUA 4KGJA 1C8VA 4EF8A 4JIHA 4RW3A 3VIOA 5LA2A 3S46A 2QF7A 2Z26A 1A3HA 4US5A 4O18A 1MDLA 2GQ3A 4D1JA 4LEFA 3QR1A 3P84A 1XG4A 3UVIA 4H9MA 4WF7A 1TMHA 4P8WA 1JNSA 3B9OA 4IMGA 1TRDA 2GGHA 1CIUA 4FLQA 1BQCA 2VOTA 3M1ZA 1UD3A 3GTNA 3W7KA 4ATLA 5I78A 3MVTA 4X0NA 4V2XA 3RX2A 3PZVA 4WDUA 1UWSA 1MZHA 3AYSA 4WQ6A 3W1LA 1W17A 4Q8NA 4HU4A 3THAA 5ABFB 1E6QM 3CH0A 1GEQA 4QS6A 2CKSA 3RO8A 4CQCA 4PYSA 1W1IE 1TPWA 2QGYA 1XIFA 1H5YA 2Y7DA 4C60A 3ABQA 2GFTA 4UFMA 4DBSA 3G0XA 1V3KA 3U3HA 4PUUA 1KBKA 1G4SA 4LJ3A 1MW0A 2AMXA 3VIMA 1E4NA 2W63A 5ABEA 4POCA 3HPFA 4UFIA 1SVDA 2IKJA 3THDA 3KBSA 2CBIA 3O5GA 1NARA 1XV8A 3AMDA 3QJAA 4ADSA 5J6EA 4G2DA 1V3IA 3PR9A 1WYIA 5F1UA 3ZVIA 5HINA 1LP6A 2QR6A 2RUQA 2VX5A 4LVFA 1U1HA 3N9SA 2PE4A 3I68A 4FIQA 1S2WA 4ZTYA 4B15A 3KZSA 2ZUSA 3LRKA 2GUYA 3T78A 3KL0A 3SUSA 4JX5A 1S5WA 1G4PA 1EHAA 1DHKA 3STPA 1RY8A 3W53A 5FEPA 1H61A 1RPKA 3W28A 3W1UA 3SQMA 4JR5A 3M0XA 3EDEA 1UYQA 4P61A 2B7NA 2YCLB 1B4EA 1X38A 3PZGA 1FHLA 3GZ3A 4Q8PA 3S6OA 4YNGA 3OBEA 1WDRA 4LB4A 3LHVA 3CT2A 3OG3A 3O8AA 3NL5A 3KAIA 4K8EA 4MIMA 2YCIX 1ROUA 2VDIA 2XP5A 5HATA 2GLKA 2VNCA 1J6YA 3QYQA 3LCFA 2FH6A 3GHRA 1VH7A 3IACA 1OG0A 3TC5A 3SUWA 1AJ2A 4ZXOA 3BAJA 1UKSA 4NZFA 3EPNA 3KDOA 3MZ2A 2DQXA 1KFLA 2V69A 1A3XA 1A5MC 1JULA 4C6MA 2WJFA 2Z1WA 5E1QA 4P5UA 1JNTA 2F6XA 4FA3A 2V8ZA 3WFAA 5I00A 4Z1CA 4HK6A 2OEMA 1WXJA 1LWJA 1Z41A 1M7XA 1YTKA 4E4FA 4A22A 1B31A 1VPXA 3B40A 4FX6M 2PDKA 4LCRA 1TWDA 4NI3A 3B97A 2AKMA 3EIPA 2C79A 4GHRA 3M7WA 3AICA 3AALA 1VPQA 2CZEA 2R1NA 5EU9A 3WUEA 3AUJA 2GK1A 3ODKA 3DC0A 1OSEA 5AC6A 1FUYA 3AIUA 4V33A 3RPMA 1VYPX 3IEBA 4K38A 4JIPA 1D3CA 3HGOA 2I5GA 2JK2A 1MUCA 4JHMA 2GWNA 4HKPA 2D3NA 1C91A 3F4WA 2OG9A 1HKJA 2PP0A 1FKBA 4WSHA 3G0SA 3SSZA 3C4UA 1PS9A 2Y63A 2ZX8A 3QC0A 2X0YA 3WQFA 4IP4A 3B4YA 3IARA 4L9ZA 3IJ8A 4IT1A 4H01A 3EMCA 4JFLA 3UWVA 3M0IA 5DELA 3PNZA 3UQBA 4HBOA 2PGWA 3GG8A 1VD6A 3N73A 4A8RA 4FNQA 1S39A 1TIMA 4ZEPA 1F6KA 5I98A 3QYSA 1I4NA 4O53A 4M8UA 1FWWA 3C2FA 1TV7A 1LG1A 4MZ1A 5AYYA 3WLJA 1UA7A 1UWRA 1MZRA 2P0IA 3DI1A 2XN1A 4DLMA 3VIHA 3W3OA 4F0HA 5BNKA 3L5AA 3IIOA 4JIEA 3CQ0A 2YLLA 3PPHA 3SUUA 2Q3RA 5H2ZA 1XBYA 4P7LA 1TPFA 5H91A 3UQIA 4YWIA 4DZ3A 4YTTA 3PRAA 4WR3A 2Z0IA 4Q8MA 3O5JA 5K9DA 5D02A 4H6KA 2VC7A 3FX4A 3W1PA 3LU2A 1ZCNA 3TYEA 4FZIA 2PWDA 4IQEA 3VKCA 3VOHA 2C0AA 5CPLA 1DL3A 4CNTA 4GCXA 1PIGA 2VRKA 5AYIA 2B31A 1V6WA 1KFCA 3L5MA 2FPYA 3RFAA 3WLPA 4EVZA 3ZOAA 3HG3A 1GG1A 3FV9A 1WO2A 3SJNA 3IANA 8XIMA 4FIRA 2QYGA 3CB3A 1R7OA 2J77A 3EX2A 3GU0A 4LYRA 1Y7VA 1LL6A 4HN8A 2OSXA 4DWDA 3EWWA 3T4WA 1ECQA 1QWKA 3OOQA 2V30A 2VZTA 2QF8A 4CN6A 4RZ5A 5LGZA 4DIAA 3QEZA 1C9HA 5I07A 3S2LA 3R43A 4UC5A 4ES4A 3VNLA 1WBHA 3ZT6A 4U5KA 5HA7A 3VDCA 3G3MA 4E4PA 5JVLA 1NEYA 3GW3A 1KWGA 1XIDA 4HOXA 4M29A 2G96A 1W5QA 2C16A 2BWGA 5GNXA 1W3IA 3Q4DA 1A5UA 4UTUA 2Y8KA 3S5NA 2WZHA 4I9AA 4O17A 3GNXA 4A8LA 5FEZA 1RUSA 4YMZA 1V5XA 3BK0A 3I7SA 2O4MA 4CNUA 2XVGA 3AO0A 1WOBA 1FWEC 4HNTA 2R94A 4IT4A 1XX1A 3FYYA 2G50A 1IX5A 5LSMA 5M5DA 4G2PA 3SURA 3NQ6A 3EWZA 4AG0A 4IH3A 4KCUA 4NX0A 1BYBA 1OGSA 6TIMA 4BZYA 5FAGA 4JNZA 4J3UA 4DZAA 4LUIA 1A5SA 1PX8A 1IR1A 5K7JA 1P0NA 1QDSA 4ML4A 2PZNA 4AU0A 5CPTA 2B5UB 2P3ZA 2PZ0A 5G1MA 2G37A 2DH2A 4YL2A 4W7VA 3VC6A 1KD0A 1GOKA 2UBPC 5BZAA 4MY9A 3HQ1A 4HNCA 3OYZA 4GGBA 4OBSA 1EPVA 5G4EA 4UMCA 3OZOA 1QI0A 1O66A 4AMCA 4C1KA 3KM8A 4DUVA 1KM3A 1OG6A 2NQJA 3RR1A 1P7TA 5CPNA 1JD7A 4N2YA 2X7VA 2XIIA 2BVWA 5G2HA 4AZIA 3W72A 3H2CA 1CGUA 1K03A 2I16A 4JIQA 2QCMA 4GXWA 5LNWA 1R2SA 4HN4A 4C5YA 1KFJA 4GNKB 1Z3NA 6TAAA 2W92A 2IS7A 3NM3A 3B9DA 1GQKA 3TQKA 1GKQA 4BCEA 5E9AA 4NNBA 2PI6A 4MB4A 4BI5A 2FB2A 2YKKA 4A4AA 1JAEA 2QMJA 3CEUA 5C6MA 4US6A 4LQ1A 2FAPA 4PFHA 3EX3A 1EC7A 4DX3A 1W3LA 1K7XA 3PPGA 1Z89A 8A3HA 2ZUWA 3LLDA 1W8GA 4O28A 4R9XA 5DMMA 4REQA 4XZIA 3GVRA 4ITZA 1G0CA 1LOLA 3GNPA 1S1RA 1J2BA 1OF8A 3EEGA 1KB3A 3LI0A 1SO3A 1TJ1A 1IGSA 3CJPA 5A6TC 4F0KA 3L7RA 5D2XA 1IEIA 3HMJG 1C92A 2ZRXA 3IGSA 3W7IA 1YRRA 1TTPA 3VGBA 3WBEA 2Z6IA 5JXQA 5LXEA 1SW7A 1BF2A 3N2TA 3KTCA 3RGCA 1RJPA 3WLKX 5JIPA 2AL1A 4P8UA 3QY7A 2GVGA 4Q8WA 5A2CA 3HPAA 1BKHA 1CX9A 1JEZA 3TYZA 4AC1X 3RMEA 5A2BA 4IIDA 2IPFA 4H04A 4KMQA 1VHNA 4M5PA 3DG6A 1LT8A 1UKPA 5D2VA 1IEXA 5D2YA 4EE9A 2WHJA 4PCNA 3V5CA 2QCCA 5TNVA 3AS2A 2V68A 2ALRA 3FJNA 2DJXA 2VEIA 4YLWA 3WQCA 3G0UA 1MQQA 4GVIA 4TVDA 4NJKA 4AVFA 3UQAA 4QM1A 2PMQA 3OLDA 4XBSA 4BY3A 1OY0A 3GD6A 4JQ4A 4NI8A 3WLTA 2ZUTA 4AMAA 2ZC8A 3QQWA 1O4UA 2FVKA 2QUVA 3KX6A 4MF4A 3WUBA 3EGJA 3WLNA 3RRXA 3AZRA 2PTYA 4MWAC 1RJRA 2FKEA 4HK5A 4GVGA 1W1YA 1HF6A 1ODZA 1Z6KA 1QOQA 1VIWA 1GZJA 3CAQA 2QULA 1CTNA 1CXFA 3KAGA 3F5JA 1W9VA 2OOGA 4LUTA 4XV0A 3TW6A 3NEHA 2V3FA 3ATYA 3B8UA 5AC7A 4NNAA 4YTRA 3VUSA 1CZ1A 2PWVA 2JALA 2VZVA 3FK4A 3AIBA 5EMJA 4RXFA 1SMDA 5A8NA 6ENLA 3O0FA 4ZENA 4M6UA 4AWEA 1JCMP 1HN1A 1YW1A 3M0ZA 3RIKA 2YB4A 4NJJA 1YDVA 3NGJA 3BMXA 4PCPA 3O3RA 3BSGA 1TWZA 3N2BA 4NP7A 5A8MA 2J8GA 2FZNA 1PKYA 1PB0A 4UCGA 3S9YA 4LUSB 4XAKA 3HF3A 2OEJA 3ZJ6A 2DIEA 3PPCA 1JQXA 4EPBC 3CUIA 4Z2GA 1L6YA 1QBAA 2GUBA 3CMGA 2GZXA 5EBUA 3VCCA 4JCLA 2Z28A 2ZYFA 4AWSA 1WX0A 3UR8A 5CGMA 1B30A 4U31A 3WH9A 4GD0A 2YDSA 2CHRA 1XUUA 3EOLA 1XLCA 1GGOA 1BG9A 3W6MA 4K1GA 1F6YA 1T96A 3UYCA 3WJWA 1XYFA 3V0TA 3DZ1A 3N19B 3RF9A 3W2KA 2QJIA 2F2KA 5F2MA 2AL2A 3B8WA 5F4WA 1LWHA 1FH7A 3U48A 3FKKA 4UOZA 2VX6A 1PO9A 1VCGA 2TRSA 4RZ4A 5ABTA 2J7HA 3U2EA 1EX1A 1TTIA 2QDGA 2V63A 4DUWA 3BLOA 5AZ1A 1DBTA 1Q45A 2FMNA 4JFTA 3W23A 4DWSA 2DV0A 4HK7A 3A3HA 2CLMA 3M44A 2TYSA 5CBBA 4RDWA 4MWAB 2PDNA 3GG0A 1VEOA 4BQ2A 4NZ4A 3EB4A 2PDFA 3VFCA 2ZZ4A 3CPGA 2LJ4A 4OJYA 2HZGA 4AZ7A 3GXNA 5D9OA 1E9LA 2QPSA 1N8WA 3CWNA 3GX9A 4I8DA 4JYDA 2PGRA 4CD8A 3EWXA 2NUWA 1TV3A 4PMNA 1OZQA 3KZPA 1X6LA 3PG8A 1IEVA 4NSBA 3XINA 3QGAC 3NWRA 2V5JA 5C9ZA 4RE2A 1CBGA 2AQVA 2CZFA 4NZJA 1W3NA 3G24A 7REQB 2DSWA 4QT2A 2ZX5A 1L6FA 3WDHA 2ZRUA 4G7FA 3RILA 2ODOA 4MNJA 2PLMA 1S2UA 4UR9A 3AMLA 3URQA 1UQZA 3QR3A 3BH4A 4RLIA 1XIJA 2ZQVA 3H2EA 1XDLA 3O6AA 3WUFA 4ZFCA 5DRCA 2FQIA 1PUDA 3WQ4A 1UR8A 3UGVA 4TR9A 2J88A 4JIRA 3LNMA 4LAOA 4MOZA 1RCXB 2VR5A 5BXRA 2BOFX 1D3HA 3PZMA 4JFWA 4HA4A 1P0BA 3MS8A 1PDYA 2DT1A 2WO5A 4PMJA 4UMAA 1QK0A 4LVAA 1Q6EA 3GXDA 3W6YA 2CERA 2GGEA 3LK6A 3O2LA 1W3KA 4CEUC 1DEDA 4I5RA 4H1ZA 1JPHA 2OFJA 2VC6A 3CYVA 1W1B1 1FJDA 1GJPA 5CC6A 4RE3A 2Z2AA 1XD0A 1ZAHA 2W66A 3B05A 2TSYA 3WLRA 5GPGA 4Z2LA 4J4KA 5CJ5A 2ZZ7A 1A50A 4DI8A 2Y89A 4HGXA 3VZZA 2XP3A 2V2DA 1L9WA 1GOXA 4TW6A 1CLVA 1KWKA 1TA3B 1GNXA 3DBNA 5AB3A 1EUNA 2POZA 4H8VA 3OTRA 1KXQA 1ROTA 2GK1B 3FSTA 3CQJA 3VGFA 1HUVA 3TLQA 4PUJA 1K8XA 2E5BA 7TIMA 1RK5A 2CZ5A 1C29A 2K8IA 1UZ4A 1P6CA 3L2LA 1XLGA 2WZMA 1I2RA 4IXXA 3RX3A 2WHKA 6XIAA 1O68A 1D9EA 2NLYA 4PBEA 4GXMA 3DUGA 4XISA 1BF6A 1XIEA 1TKKA 1TQJA 2FDSA 2Q3OA 2ON3A 1ALDA 2W0UA 5IFPA 3CO8A 4PODA 3KZ7A 4EPDC 2I5QA 2I7GA 1EJXC 3KACA 3KCOA 1XQLA 2XFRA 4E8GA 3TN4A 4MB5A 4PULA 3N9RA 1FP8A 4XSLA 3N3MA 3WUGA 2Z2BA 4PH6A 1MEWA 4LS2A 3WK0A 4PN2A 1KXTA 3SADA 4Z08A 1I0BA 3DDMA 1EJRC 3W76A 5XIMA 4G7EB 3F7JA 4QE4A 2A5HA 4XZNX 2E68A 4E0CA 3IIZA 2PV1A 3COTA 5G2WA 4WD0A 4YVVA 3UXIA 2AWGA 4B4HA 4EACA 2WSPA 5FCZA 3TQ0A 3O6YX 4UFLA 1GCYA 3MHGA 3PFRA 5ECVA 5HMFA 1UZHA 3W7OA 3CM4A 3KRBA 1XWYA 3WG6A 2GVEA 4I90A 1JI1A 1U79A 4Y6GA 2VZUA 2G5WA 5AHEA 2ZRVA 4XAPA 1GQJA 4L4OA 3NSMA 3PC0A 1PWMA 1A5CA 3H55A 4E5TA 2C3ZA 5IDIA 4AY1A 3VNDA 5T91A 2HS6A 4Z1BA 4L4MA 5CBJA 1H0IA 4EXAA 1T11A 1GVFA 5A6LA 3MJMA 5E93A 3FA5A 3A47A 3NSXA 1KV5A 3EDDA 3ES7A 3QQ0A 4W7UA 1RK6A 4FNPA 3LPPA 3PBGA 3BL3A 1ZBVA 1DYSA 1VS1A 3UY7A 3ERPA 1C8YA 1SJCA 8CGTA 1YXCA 1DVJA 1W32A 5DX7A 5BWAA 1ZGDA 4WXYA 3UVAA 1G1YA 1XYMA 4MLJA 2YB1A 3LOTA 4LX4A 3VIIA 1AZ1A 4P7RA 3QW4B 1JYNA 3PJTA 1NOWA 3KOWA 2YYUA 2EPHA 3QMRA 4UIOA 1F3XA 4LWWA 2GSEA 3LV5A 2XH7A 3ARWA 3PSWA 5D04C 1UA3A 1C8XA 4MAVA 1FCUA 2W67A 3DEQA 4AF0A 1VJIA 1SZGA 5BW6A 4JGDA 5IRPA 4IXHA 3KHJA 4GBDA 4XTIA 4CCDA 4QSHA 3BMBA 3BLEA 4GH1A 1XGDA 4K39A 1VCVA 1ENUA 1FWTA 4E6MA 3BVJA 2FTWA 3MMDA 2E9MA 5FACA 1O60A 1XYBA 4DO5A 5LGXA 1UMYA 1VBGA 4US5D 2QW5A 3B9AA 2CZVA 4MUPA 5D03A 4MM1A 1K02A 4WJEA 4DM1A 4WSKA 4ZSTA 3R11A 1NTHA 1CYGA 2JIWA 3XISA 4A3HA 3O7UA 2WSQA 3C2OA 5DCEA 3H8AA 2DVUA 1SJDA 4Q22A 3CAWA 3MCOA 2FPTA 1TR9A 4DAIA 1A5OC 4B9ZA 4U3CA 4AZBA 3W24A 1QASA 5TIMA 2DZWA 1E0UA 4RPPA 5HAOA 3GE7A 3KTXA 4MGGA 3WQOA 5IOBA 3MTWA 1N82A 3UXDA 1M5YA 4NNCA 4IOTA 1RQBA 1MW3A 1HJXA 4DRSA 3G1HA 4JTAA 1JRCA 1NWRA 4OQVA 7XIMA 4H6QA 2XFYA 2ISFA 1QI5A 3DFPA 3A4JA 4ZL1A 1QHPA 4UQDA 1CXEA 2XFWA 1E5JA 4QNWA 2DUXA 1HJWA 2YOCA 1AD4A 3LCHA 1THFD 4UOJA 5ECUA 1UZDA 1YTEA 2ACUA 5RUBA 4BF9A 2FVMA 3GLCA 2WXDM 5A95A 1IZJA 3O1NA 4C65A 5BRBA 2IXUA 4ZO7A 5DCBA 5D30A 1EIXA 3T07A 4MG4A 2GJLA 3LNPA 3DGRA 3HU7A 3OQEA 5HT1A 3DX5A 2CPUA