1FKSA

Solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of FKBP, a rotamase enzyme and receptor for FK506 and rapamycin.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
molecule keywords FK506 AND RAPAMYCIN-BINDING PROTEIN
total genus 12
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fksA00
2FAPA 3NRKA 3KABA 2XPBA 1FKBA 2MPHA 2LPVA 2ZQTA 4TW6A 2RSEA 4IQ2A 4J4NA 1D6OA 1J4IA 3MDYB 2KR7A 4JFMA 4TW7A 1Q1CA 3TC5A 5DIUA 3CGNA 4DRQA 3OOBA 2L2SA 5B8IC 3O5DA 3O5JA 3ODKA 4TYOA 1FKKA 1KT1A 1W26A 2ZR4A 5HT1A 2ZQUA 1TCOC 2XP7A 4MSPA 4C02B 3O5LA 1M5YA 3IK8A 4MGVA 3NTPA 1FAPA 3UI4A 1FKDA 1KT0A 3KAHA 1FKSA 2RUQA 4W9OA 3B7XA 3LUOA 4DZ2A 1JNTA 3O5QA 4FN2A 1J4RA 2LJ4A 3O5OA 5HW7A 5HW8A 2PPNA 3UQIA 4DRHA 1T11A 3PA7A 4DRNA 3JYMA 4TNSA 2XP4A 2M2AA 2KGJA 1HXVA 4R0XA 2PV1A 1FKGA 2F21A 1EYMA 5HW6A 4TW8A 2MNTA 4IPXA 4J4OA 4DT4A 2M08A 2ZR6A 1Q6IA 4LAVA 4DIPA 2FKEA 1D7IA 1J4HA 4ODQA 2KE0A 3O5GA 3WH0A 3PRDA 4ODKA 3I6CA 4U84A 1C9HA 2AWGA 2KI3A 4LAYA 1NMVA 1N1AA 1QPFA 2LKNA 2DG4A 2XP8A 3O5KA 2MF9A 2MLXA 2PPPA 3FAPA 3KAIA 3O5EA 4W9QA 3JYJA 4JFIA 1U79A 5HUAA 1D7JA 4U85A 2UZ5A 1Q6UA 5DIVA 5GPGA 4ODOA 4LAXA 4GGQA 3EY6A 2XP5A 1NSGA 3IHZA 3KCEA 4DH0A 1P5QA 1J6YA 1JNSA 3TDBA 5HWBA 2VN1A 3UI6A 4DROA 2KFWA 2Y78A 2PV2A 2XP3A 1Y0OA 2VCDA 4G2PA 4TX0A 1PBKA 3O5MA 1JVWA 4N19A 3RGCA 2ZQVA 4LAWA 3JXVA 4JFKA 3UQAA 1BL4A 1YW5A 1PINA 2Q5AA 1QPLA 2ZR5A 3H9RB 1ROUA 4ODRA 3GPKA 4QIBA 4DRPA 3KZ7A 3UI5A 1FKJA 3UQBA 2KO7A 3IKGA 4ODLA 2DG3A 2RURA 1FKIA 2PV3A 3CGMA 2IF4A 4ODNA 1FKTA 4IQCA 4NNRA 1ZK6A 2MLZA 4JFLA 3IKDA 5D75A 3NI6A 4DRKA 1Q6HA 3O5PA 1B6CA 2D9FA 4G50A 4DRIA 2K8IA 2LGOA 1EQ3A 1FJDA 2XP9A 5HKGA 4FAPA 2XPAA 4DRMA 4DZ3A 2ZQSA 2M1IA 2RUDA 3UF8A 3VAWA 3RFWA 5BXJA 1FKFA 1D7HA 2N87A 2PBCA 2ITKA 4JFJA 4ODPA 3TCZA 2JZVA 2F4EA 2RUCA 4QT3A 3O5IA 1F8AB 1FKRA 2OFNA 2PPOA 4QT2A 5DITA 4ITZA 1R9HA 5HTGA 3KAFA 3KADA 4O2TA 3KACA 4DRJA 4ODMA 5I98A 4JYSA 1F40A 1QZ2A 1YATA 1L1PA 1FKLA 1ZCNA 2DG9A 1ROTA 4W9PA 5HWCA 1A7XA 5J6EA 1FD9A 1NMWA 2RQSA 2F2DA 3O5FA 2MLYA 3PRBA 4BF8A 3O5RA 3KAGA 4U86A 4GIVA 1BKFA 2XP6A 1FKHA
chains in the Genus database with same CATH superfamily
1NWRA 2DSZA 2EULA 3CH9A 4HARA 1J4IA 1D2KA 4WIWA 4DRQA 3B9EA 1ZB5A 4S3JA 3O5JA 2DSVA 3WQVA 1KT1A 2ZQUA 4MSPA 2XP7A 3O5LA 3WL1A 3KAHA 2RUQA 4W9OA 3W4RA 3B7XA 4DZ2A 1JCHB 2A3BA 3BMBA 3O5OA 5HW7A 4MNLA 4DRHA 3RMEA 3PA7A 4DRNA 3JYMA 2XP4A 1NH6A 1E9LA 2PV1A 4MAVA 1SYTA 2F21A 1HJVA 4DT4A 4ZS6A 4HBEA 3WH0A 4ODKA 4LAYA 4Z2GA 4WK9A 3ARWA 1OWQA 1RD6A 1NWTA 2MF9A 3O5EA 5JH8A 3FY1A 3WD1A 4GGQA 4MPKA 2KFWA 4P8XA 1XRVA 1LL7A 3CHDA 1PBKA 3O5MA 2ZR5A 3H9RB 4DRPA 1KFWA 3GPKA 4P8VA 3UQBA 1K9TA 2DG3A 2RURA 2IF4A 1FKTA 5DF0A 3IKDA 3O5PA 1B6CA 1E6NA 4DRIA 4FAPA 4DZ3A 3ARTA 1HKIA 4Z2JA 4DWSA 2YBTA 1FKFA 2ITKA 4QT3A 3ARVA 3O5IA 2PPOA 1OGGA 1HJXA 4UDMA 1R9HA 3KACA 5I98A 4DWSC 4JYSA 1H0IA 1FKLA 1ZCNA 4IT6A 1NWUA 3B9AA 5HWCA 1UR9A 3WL0A 3PRBA 4BF8A 4IT4A 3RM9A 2QF8A 1BKFA 4KQZA 1FKHA 2FAPA 3AS0A 1WNOA 1FKBA 1D6OA 1E6ZA 1Q1CA 2O9OA 3WIJA 3OOBA 5DO2A 3O5DA 3FXYA 4R5EA 1X6LA 2DT1A 3ALGA 1W26A 2ZR4A 1W1VA 2O92A 1EIBA 1E44A 3IK8A 4MGVA 2G41A 4L72B 3WD3A 1FAPA 4WKAA 1FKDA 3B8SA 3WQWA 1J4RA 5GQBA 4TNSA 2M2AA 3WKZA 1VF8A 1FKGA 1EYMA 2MNTA 4J4OA 2M08A 2ZR6A 1Q6IA 2FKEA 3G6LA 2KE0A 3O5GA 4DWSD 3PRDA 2AWGA 1NMVA 1QPFA 2DG4A 3O5KA 4W9QA 2PI6A 2P4VA 4JFIA 1D7JA 2UZ5A 1Q6UA 5DIVA 4W5UA 5GPGA 4ZPVR 1NSGA 3KCEA 1P5QA 1JNSA 2DPEA 3TDBA 3GTYX 2VN1A 3EIPA 4MTVA 2Y78A 2XP3A 1Y0OA 4TX0A 1E6RA 3PR9A 1CTNA 4N19A 2ZQVA 4LAWA 3JXVA 4WKFA 3UQAA 2Q5AA 4QIBA 1ROUA 4Z2HA 1FKJA 4Q7NA 3AS2A 3ARPA 4ODNA 4IQCA 2MLZA 4JFLA 1EHNA 3NI6A 3AQUA 2K8IA 4DWSB 1EQ3A 1FJDA 2XP9A 2XPAA 4DRMA 2ZQSA 1LG1A 1D7HA 2RUCA 1F8AB 1GRJA 3ARYA 1JNEA 4ITZA 3KADA 2F23A 4ODMA 4WKHA 1HKMA 3ARXA 4QZVB 2G8ZA 1ROTA 1EDQA 1NWSA 5J6EA 1FD9A 1NMWA 1W9VA 1ZBWA 2IUZA 2RQSA 2MLYA 1LJYA 3O5RA 4NSBA 1IX5A 1TFVA 2A3AA 3KABA 2XPBA 3RM4A 1LG2A 2ZQTA 1W9PA 4J4NA 2WM0A 4TW7A 4JFMA 2KR7A 3TC5A 3CGNA 2L2SA 3ODKA 4TYOA 3ARSA 3AS1A 2DSUA 5HT1A 1LL6A 3ALFA 4Z2LA 4PTMA 1HJWA 3NTPA 1JNTA 3GU0A 4FN2A 2LJ4A 5HW8A 3UQIA 1T11A 3B9DA 2KGJA 1HXVA 5DEZA 4R0XA 4TW8A 4ZPWR 4IPXA 4LGXA 4LAVA 1W9UA 1J4HA 2PN0A 1C9HA 2XP8A 3QOKA 2MLXA 3FAPA 2PPPA 2WLYA 3ARUA 4HBOA 4P8UA 1ZL1A 4LAXA 4S3KA 3EY6A 1GPFA 1J6YA 1WB0A 4NZCA 2PV2A 3CZ8A 2VCDA 1JVWA 1X6NA 3CHEA 1YW5A 4ODRA 3BXWA 3AROA 3CHFA 3OA5A 1FKIA 1FFQA 1ZBVA 2AOSA 2DSWA 2PV3A 4XAKA 1ZK6A 2A3EA 5D75A 2DT3A 4DRKA 2D9FA 1SR0A 5BXJA 1WAWA 4JFJA 3TCZA 2JZVA 2DT0A 2OFNA 1O6IA 3ARQA 4QT2A 1ZU8A 3G6MA 3KAFA 3RM8A 4DRJA 2DG9A 4L3NA 2DT2A 2F2DA 2OLHA 3O5FA 1E6PA 3ARRA 3KAGA 4U86A 4GIVA 2ESCA 1ITXA 3NRKA 1E15A 2A3CA 2MPHA 1HKJA 2LPVA 4TW6A 2RSEA 4IQ2A 3MDYB 5DIUA 5B8IC 2WK2A 3CHCA 1FKKA 1XHGA 1TCOC 4C02B 1M5YA 2FDMA 1FFRA 5GPRA 4MNJA 1KT0A 4MNMA 3UI4A 1FKSA 3LUOA 3O5QA 2PPNA 2YBUA 1HKKA 5HW6A 1W1PA 4Q22A 2WLZA 4DIPA 1D7IA 4ODQA 3I6CA 4U84A 2KI3A 1H0GA 1N1AA 2ETNA 2LKNA 3WD0A 3KAIA 1W1TA 3JYJA 5HBFA 1U79A 5HUAA 4U85A 1OGBA 1LQ0A 3WD4A 4ODOA 2XP5A 3IHZA 4DH0A 3ARZA 5HWBA 3UI6A 4DROA 3AS3A 4Z2KA 4G2PA 1W1YA 4P8WA 3RGCA 4JFKA 1BL4A 1PINA 1QPLA 3PRAA 3KZ7A 1ZBCA 3UI5A 1ZBKA 2KO7A 3IKGA 4ODLA 3CGMA 4AY1A 4NNRA 1JNDA 1Q6HA 4G50A 2LGOA 4MNKA 5HKGA 1LL4A 1UR8A 2M1IA 2RUDA 3UF8A 3VAWA 3RFWA 2N87A 2PBCA 4ODPA 2F4EA 1GUVA 3WD2A 1FKRA 4Z2IA 2B5UB 4URIA 5DITA 5HTGA 4O2TA 1F40A 1QZ2A 1YATA 4ZPTR 1L1PA 2B31A 1GOIA 4W9PA 1A7XA 4ML4A 4KR0B 4WJXA 2XP6A
chains in the Genus database with same CATH topology
1NWRA 2DSZA 3CH9A 4HARA 1J4IA 1D2KA 4WIWA 4DRQA 3B9EA 1ZB5A 4S3JA 3O5JA 2DSVA 3WQVA 1KT1A 2ZQUA 4MSPA 2XP7A 3O5LA 3WL1A 3KAHA 2RUQA 4W9OA 3W4RA 3B7XA 4DZ2A 2A3BA 3O5OA 5HW7A 4MNLA 4DRHA 3RMEA 3PA7A 4DRNA 3JYMA 2XP4A 1NH6A 1E9LA 2PV1A 4MAVA 1SYTA 2F21A 1HJVA 4DT4A 4ZS6A 4HBEA 3WH0A 4ODKA 4LAYA 4Z2GA 4WK9A 3ARWA 1OWQA 1RD6A 1NWTA 2MF9A 3O5EA 5JH8A 3FY1A 3WD1A 4GGQA 4MPKA 2KFWA 4P8XA 1XRVA 1LL7A 3CHDA 1PBKA 3O5MA 2ZR5A 3H9RB 4DRPA 1KFWA 3GPKA 4P8VA 3UQBA 1K9TA 2DG3A 2RURA 2IF4A 1FKTA 5DF0A 3IKDA 3O5PA 1B6CA 1E6NA 4DRIA 4FAPA 4DZ3A 3ARTA 1HKIA 4Z2JA 4DWSA 2YBTA 1FKFA 2ITKA 4QT3A 3ARVA 3O5IA 2PPOA 1OGGA 1HJXA 1R9HA 3KACA 5I98A 4DWSC 4JYSA 1H0IA 1FKLA 1ZCNA 4IT6A 1NWUA 3B9AA 5HWCA 1UR9A 3WL0A 3PRBA 4BF8A 4IT4A 3RM9A 2QF8A 1BKFA 4KQZA 1FKHA 2FAPA 3AS0A 1WNOA 1FKBA 1D6OA 1E6ZA 1Q1CA 2O9OA 3WIJA 3OOBA 5DO2A 3O5DA 3FXYA 4R5EA 1X6LA 2DT1A 3ALGA 1W26A 2ZR4A 1W1VA 2O92A 1EIBA 3IK8A 4MGVA 2G41A 4L72B 3WD3A 1FAPA 4WKAA 1FKDA 3B8SA 3WQWA 1J4RA 5GQBA 4TNSA 2M2AA 3WKZA 1VF8A 1FKGA 1EYMA 2MNTA 4J4OA 2M08A 2ZR6A 1Q6IA 2FKEA 3G6LA 2KE0A 3O5GA 4DWSD 3PRDA 2AWGA 1NMVA 1QPFA 2DG4A 3O5KA 4W9QA 2PI6A 4JFIA 1D7JA 2UZ5A 1Q6UA 5DIVA 4W5UA 5GPGA 4ZPVR 1NSGA 3KCEA 1P5QA 1JNSA 2DPEA 3TDBA 2VN1A 4MTVA 2Y78A 2XP3A 1Y0OA 4TX0A 1E6RA 3PR9A 1CTNA 4N19A 2ZQVA 4LAWA 3JXVA 4WKFA 3UQAA 2Q5AA 4QIBA 1ROUA 4Z2HA 1FKJA 4Q7NA 3AS2A 3ARPA 4ODNA 4IQCA 2MLZA 4JFLA 1EHNA 3NI6A 3AQUA 2K8IA 4DWSB 1EQ3A 1FJDA 2XP9A 2XPAA 4DRMA 2ZQSA 1LG1A 1D7HA 2RUCA 1F8AB 3ARYA 1JNEA 4ITZA 3KADA 4ODMA 4WKHA 1HKMA 3ARXA 4QZVB 2G8ZA 1ROTA 1EDQA 1NWSA 5J6EA 1FD9A 1NMWA 1W9VA 1ZBWA 2IUZA 2RQSA 2MLYA 1LJYA 3O5RA 4NSBA 1IX5A 1TFVA 2A3AA 3KABA 2XPBA 3RM4A 1LG2A 2ZQTA 1W9PA 4J4NA 2WM0A 4TW7A 4JFMA 2KR7A 3TC5A 3CGNA 2L2SA 3ODKA 4TYOA 3ARSA 3AS1A 2DSUA 5HT1A 1LL6A 3ALFA 4Z2LA 4PTMA 1HJWA 3NTPA 1JNTA 4FN2A 2LJ4A 5HW8A 3UQIA 1T11A 3B9DA 2KGJA 1HXVA 5DEZA 4R0XA 4TW8A 4ZPWR 4IPXA 4LGXA 4LAVA 1W9UA 1J4HA 1C9HA 2XP8A 3QOKA 2MLXA 3FAPA 2PPPA 2WLYA 3ARUA 4HBOA 4P8UA 1ZL1A 4LAXA 4S3KA 3EY6A 1GPFA 1J6YA 1WB0A 4NZCA 2PV2A 3CZ8A 2VCDA 1JVWA 1X6NA 3CHEA 1YW5A 4ODRA 3BXWA 3AROA 3CHFA 3OA5A 1FKIA 1FFQA 1ZBVA 2AOSA 2DSWA 2PV3A 4XAKA 1ZK6A 2A3EA 5D75A 2DT3A 4DRKA 2D9FA 1SR0A 5BXJA 1WAWA 4JFJA 3TCZA 2JZVA 2DT0A 2OFNA 1O6IA 3ARQA 4QT2A 1ZU8A 3G6MA 3KAFA 3RM8A 4DRJA 2DG9A 4L3NA 2DT2A 2F2DA 2OLHA 3O5FA 1E6PA 3ARRA 3KAGA 4U86A 4GIVA 2ESCA 1ITXA 3NRKA 1E15A 2A3CA 2MPHA 1HKJA 2LPVA 4TW6A 2RSEA 4IQ2A 3MDYB 5DIUA 5B8IC 2WK2A 3CHCA 1FKKA 1XHGA 1TCOC 4C02B 1M5YA 2FDMA 1FFRA 5GPRA 4MNJA 1KT0A 4MNMA 3UI4A 1FKSA 3LUOA 3O5QA 2PPNA 2YBUA 1HKKA 5HW6A 1W1PA 4Q22A 2WLZA 4DIPA 1D7IA 4ODQA 3I6CA 4U84A 2KI3A 1H0GA 1N1AA 2LKNA 3WD0A 3KAIA 1W1TA 3JYJA 5HBFA 1U79A 5HUAA 4U85A 1OGBA 1LQ0A 3WD4A 4ODOA 2XP5A 3IHZA 4DH0A 3ARZA 5HWBA 3UI6A 4DROA 3AS3A 4Z2KA 4G2PA 1W1YA 4P8WA 3RGCA 4JFKA 1BL4A 1PINA 1QPLA 3PRAA 3KZ7A 1ZBCA 3UI5A 1ZBKA 2KO7A 3IKGA 4ODLA 3CGMA 4AY1A 4NNRA 1JNDA 1Q6HA 4G50A 2LGOA 4MNKA 5HKGA 1LL4A 1UR8A 2M1IA 2RUDA 3UF8A 3VAWA 3RFWA 2N87A 2PBCA 4ODPA 2F4EA 1GUVA 3WD2A 1FKRA 4Z2IA 4URIA 5DITA 5HTGA 4O2TA 1F40A 1QZ2A 1YATA 4ZPTR 1L1PA 2B31A 1GOIA 4W9PA 1A7XA 4ML4A 4KR0B 4WJXA 2XP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAP A;  3NRK A;  3KAB A;  2XPB A;  1FKB A;  2MPH A;  2LPV A;  2ZQT A;  4TW6 A;  2RSE A;  4IQ2 A;  4J4N A;  1D6O A;  1J4I A;  3MDY B;  2KR7 A;  4JFM A;  4TW7 A;  1Q1C A;  3TC5 A;  5DIU A;  3CGN A;  4DRQ A;  3OOB A;  2L2S A;  5B8I C;  3O5D A;  3O5J A;  3ODK A;  4TYO A;  1FKK A;  1KT1 A;  1W26 A;  2ZR4 A;  5HT1 A;  2ZQU A;  1TCO C;  2XP7 A;  4MSP A;  4C02 B;  3O5L A;  1M5Y A;  3IK8 A;  4MGV A;  3NTP A;  1FAP A;  3UI4 A;  1FKD A;  1KT0 A;  3KAH A;  1FKS A;  2RUQ A;  4W9O A;  3B7X A;  3LUO A;  4DZ2 A;  1JNT A;  3O5Q A;  4FN2 A;  1J4R A;  2LJ4 A;  3O5O A;  5HW7 A;  5HW8 A;  2PPN A;  3UQI A;  4DRH A;  1T11 A;  3PA7 A;  4DRN A;  3JYM A;  4TNS A;  2XP4 A;  2M2A A;  2KGJ A;  1HXV A;  4R0X A;  2PV1 A;  1FKG A;  2F21 A;  1EYM A;  5HW6 A;  4TW8 A;  2MNT A;  4IPX A;  4J4O A;  4DT4 A;  2M08 A;  2ZR6 A;  1Q6I A;  4LAV A;  4DIP A;  2FKE A;  1D7I A;  1J4H A;  4ODQ A;  2KE0 A;  3O5G A;  3WH0 A;  3PRD A;  4ODK A;  3I6C A;  4U84 A;  1C9H A;  2AWG A;  2KI3 A;  4LAY A;  1NMV A;  1N1A A;  1QPF A;  2LKN A;  2DG4 A;  2XP8 A;  3O5K A;  2MF9 A;  2MLX A;  2PPP A;  3FAP A;  3KAI A;  3O5E A;  4W9Q A;  3JYJ A;  4JFI A;  1U79 A;  5HUA A;  1D7J A;  4U85 A;  2UZ5 A;  1Q6U A;  5DIV A;  5GPG A;  4ODO A;  4LAX A;  4GGQ A;  3EY6 A;  2XP5 A;  1NSG A;  3IHZ A;  3KCE A;  4DH0 A;  1P5Q A;  1J6Y A;  1JNS A;  3TDB A;  5HWB A;  2VN1 A;  3UI6 A;  4DRO A;  2KFW A;  2Y78 A;  2PV2 A;  2XP3 A;  1Y0O A;  2VCD A;  4G2P A;  4TX0 A;  1PBK A;  3O5M A;  1JVW A;  4N19 A;  3RGC A;  2ZQV A;  4LAW A;  3JXV A;  4JFK A;  3UQA A;  1BL4 A;  1YW5 A;  1PIN A;  2Q5A A;  1QPL A;  2ZR5 A;  3H9R B;  1ROU A;  4ODR A;  3GPK A;  4QIB A;  4DRP A;  3KZ7 A;  3UI5 A;  1FKJ A;  3UQB A;  2KO7 A;  3IKG A;  4ODL A;  2DG3 A;  2RUR A;  1FKI A;  2PV3 A;  3CGM A;  2IF4 A;  4ODN A;  1FKT A;  4IQC A;  4NNR A;  1ZK6 A;  2MLZ A;  4JFL A;  3IKD A;  5D75 A;  3NI6 A;  4DRK A;  1Q6H A;  3O5P A;  1B6C A;  2D9F A;  4G50 A;  4DRI A;  2K8I A;  2LGO A;  1EQ3 A;  1FJD A;  2XP9 A;  5HKG A;  4FAP A;  2XPA A;  4DRM A;  4DZ3 A;  2ZQS A;  2M1I A;  2RUD A;  3UF8 A;  3VAW A;  3RFW A;  5BXJ A;  1FKF A;  1D7H A;  2N87 A;  2PBC A;  2ITK A;  4JFJ A;  4ODP A;  3TCZ A;  2JZV A;  2F4E A;  2RUC A;  4QT3 A;  3O5I A;  1F8A B;  1FKR A;  2OFN A;  2PPO A;  4QT2 A;  5DIT A;  4ITZ A;  1R9H A;  5HTG A;  3KAF A;  3KAD A;  4O2T A;  3KAC A;  4DRJ A;  4ODM A;  5I98 A;  4JYS A;  1F40 A;  1QZ2 A;  1YAT A;  1L1P A;  1FKL A;  1ZCN A;  2DG9 A;  1ROT A;  4W9P A;  5HWC A;  1A7X A;  5J6E A;  1FD9 A;  1NMW A;  2RQS A;  2F2D A;  3O5F A;  2MLY A;  3PRB A;  4BF8 A;  3O5R A;  3KAG A;  4U86 A;  4GIV A;  1BKF A;  2XP6 A;  1FKH A; 
#chains in the Genus database with same CATH topology
 1NWR A;  2DSZ A;  2EUL A;  3CH9 A;  4HAR A;  1J4I A;  1D2K A;  4WIW A;  4DRQ A;  3B9E A;  1ZB5 A;  4S3J A;  3O5J A;  2DSV A;  3WQV A;  1KT1 A;  2ZQU A;  4MSP A;  2XP7 A;  3O5L A;  3WL1 A;  3KAH A;  2RUQ A;  4W9O A;  3W4R A;  3B7X A;  4DZ2 A;  1JCH B;  2A3B A;  3BMB A;  3O5O A;  5HW7 A;  4MNL A;  4DRH A;  3RME A;  3PA7 A;  4DRN A;  3JYM A;  2XP4 A;  1NH6 A;  1E9L A;  2PV1 A;  4MAV A;  1SYT A;  2F21 A;  1HJV A;  4DT4 A;  4ZS6 A;  4HBE A;  3WH0 A;  4ODK A;  4LAY A;  4Z2G A;  4WK9 A;  3ARW A;  1OWQ A;  1RD6 A;  1NWT A;  2MF9 A;  3O5E A;  5JH8 A;  3FY1 A;  3WD1 A;  4GGQ A;  4MPK A;  2KFW A;  4P8X A;  1XRV A;  1LL7 A;  3CHD A;  1PBK A;  3O5M A;  2ZR5 A;  3H9R B;  4DRP A;  1KFW A;  3GPK A;  4P8V A;  3UQB A;  1K9T A;  2DG3 A;  2RUR A;  2IF4 A;  1FKT A;  5DF0 A;  3IKD A;  3O5P A;  1B6C A;  1E6N A;  4DRI A;  4FAP A;  4DZ3 A;  3ART A;  1HKI A;  4Z2J A;  4DWS A;  2YBT A;  1FKF A;  2ITK A;  4QT3 A;  3ARV A;  3O5I A;  2PPO A;  1OGG A;  1HJX A;  4UDM A;  1R9H A;  3KAC A;  5I98 A;  4DWS C;  4JYS A;  1H0I A;  1FKL A;  1ZCN A;  4IT6 A;  1NWU A;  3B9A A;  5HWC A;  1UR9 A;  3WL0 A;  3PRB A;  4BF8 A;  4IT4 A;  3RM9 A;  2QF8 A;  1BKF A;  4KQZ A;  1FKH A;  2FAP A;  3AS0 A;  1WNO A;  1FKB A;  1D6O A;  1E6Z A;  1Q1C A;  2O9O A;  3WIJ A;  3OOB A;  5DO2 A;  3O5D A;  3FXY A;  4R5E A;  1X6L A;  2DT1 A;  3ALG A;  1W26 A;  2ZR4 A;  1W1V A;  2O92 A;  1EIB A;  1E44 A;  3IK8 A;  4MGV A;  2G41 A;  4L72 B;  3WD3 A;  1FAP A;  4WKA A;  1FKD A;  3B8S A;  3WQW A;  1J4R A;  5GQB A;  4TNS A;  2M2A A;  3WKZ A;  1VF8 A;  1FKG A;  1EYM A;  2MNT A;  4J4O A;  2M08 A;  2ZR6 A;  1Q6I A;  2FKE A;  3G6L A;  2KE0 A;  3O5G A;  4DWS D;  3PRD A;  2AWG A;  1NMV A;  1QPF A;  2DG4 A;  3O5K A;  4W9Q A;  2PI6 A;  2P4V A;  4JFI A;  1D7J A;  2UZ5 A;  1Q6U A;  5DIV A;  4W5U A;  5GPG A;  4ZPV R;  1NSG A;  3KCE A;  1P5Q A;  1JNS A;  2DPE A;  3TDB A;  3GTY X;  2VN1 A;  3EIP A;  4MTV A;  2Y78 A;  2XP3 A;  1Y0O A;  4TX0 A;  1E6R A;  3PR9 A;  1CTN A;  4N19 A;  2ZQV A;  4LAW A;  3JXV A;  4WKF A;  3UQA A;  2Q5A A;  4QIB A;  1ROU A;  4Z2H A;  1FKJ A;  4Q7N A;  3AS2 A;  3ARP A;  4ODN A;  4IQC A;  2MLZ A;  4JFL A;  1EHN A;  3NI6 A;  3AQU A;  2K8I A;  4DWS B;  1EQ3 A;  1FJD A;  2XP9 A;  2XPA A;  4DRM A;  2ZQS A;  1LG1 A;  1D7H A;  2RUC A;  1F8A B;  1GRJ A;  3ARY A;  1JNE A;  4ITZ A;  3KAD A;  2F23 A;  4ODM A;  4WKH A;  1HKM A;  3ARX A;  4QZV B;  2G8Z A;  1ROT A;  1EDQ A;  1NWS A;  5J6E A;  1FD9 A;  1NMW A;  1W9V A;  1ZBW A;  2IUZ A;  2RQS A;  2MLY A;  1LJY A;  3O5R A;  4NSB A;  1IX5 A;  1TFV A;  2A3A A;  3KAB A;  2XPB A;  3RM4 A;  1LG2 A;  2ZQT A;  1W9P A;  4J4N A;  2WM0 A;  4TW7 A;  4JFM A;  2KR7 A;  3TC5 A;  3CGN A;  2L2S A;  3ODK A;  4TYO A;  3ARS A;  3AS1 A;  2DSU A;  5HT1 A;  1LL6 A;  3ALF A;  4Z2L A;  4PTM A;  1HJW A;  3NTP A;  1JNT A;  3GU0 A;  4FN2 A;  2LJ4 A;  5HW8 A;  3UQI A;  1T11 A;  3B9D A;  2KGJ A;  1HXV A;  5DEZ A;  4R0X A;  4TW8 A;  4ZPW R;  4IPX A;  4LGX A;  4LAV A;  1W9U A;  1J4H A;  2PN0 A;  1C9H A;  2XP8 A;  3QOK A;  2MLX A;  3FAP A;  2PPP A;  2WLY A;  3ARU A;  4HBO A;  4P8U A;  1ZL1 A;  4LAX A;  4S3K A;  3EY6 A;  1GPF A;  1J6Y A;  1WB0 A;  4NZC A;  2PV2 A;  3CZ8 A;  2VCD A;  1JVW A;  1X6N A;  3CHE A;  1YW5 A;  4ODR A;  3BXW A;  3ARO A;  3CHF A;  3OA5 A;  1FKI A;  1FFQ A;  1ZBV A;  2AOS A;  2DSW A;  2PV3 A;  4XAK A;  1ZK6 A;  2A3E A;  5D75 A;  2DT3 A;  4DRK A;  2D9F A;  1SR0 A;  5BXJ A;  1WAW A;  4JFJ A;  3TCZ A;  2JZV A;  2DT0 A;  2OFN A;  1O6I A;  3ARQ A;  4QT2 A;  1ZU8 A;  3G6M A;  3KAF A;  3RM8 A;  4DRJ A;  2DG9 A;  4L3N A;  2DT2 A;  2F2D A;  2OLH A;  3O5F A;  1E6P A;  3ARR A;  3KAG A;  4U86 A;  4GIV A;  2ESC A;  1ITX A;  3NRK A;  1E15 A;  2A3C A;  2MPH A;  1HKJ A;  2LPV A;  4TW6 A;  2RSE A;  4IQ2 A;  3MDY B;  5DIU A;  5B8I C;  2WK2 A;  3CHC A;  1FKK A;  1XHG A;  1TCO C;  4C02 B;  1M5Y A;  2FDM A;  1FFR A;  5GPR A;  4MNJ A;  1KT0 A;  4MNM A;  3UI4 A;  1FKS A;  3LUO A;  3O5Q A;  2PPN A;  2YBU A;  1HKK A;  5HW6 A;  1W1P A;  4Q22 A;  2WLZ A;  4DIP A;  1D7I A;  4ODQ A;  3I6C A;  4U84 A;  2KI3 A;  1H0G A;  1N1A A;  2ETN A;  2LKN A;  3WD0 A;  3KAI A;  1W1T A;  3JYJ A;  5HBF A;  1U79 A;  5HUA A;  4U85 A;  1OGB A;  1LQ0 A;  3WD4 A;  4ODO A;  2XP5 A;  3IHZ A;  4DH0 A;  3ARZ A;  5HWB A;  3UI6 A;  4DRO A;  3AS3 A;  4Z2K A;  4G2P A;  1W1Y A;  4P8W A;  3RGC A;  4JFK A;  1BL4 A;  1PIN A;  1QPL A;  3PRA A;  3KZ7 A;  1ZBC A;  3UI5 A;  1ZBK A;  2KO7 A;  3IKG A;  4ODL A;  3CGM A;  4AY1 A;  4NNR A;  1JND A;  1Q6H A;  4G50 A;  2LGO A;  4MNK A;  5HKG A;  1LL4 A;  1UR8 A;  2M1I A;  2RUD A;  3UF8 A;  3VAW A;  3RFW A;  2N87 A;  2PBC A;  4ODP A;  2F4E A;  1GUV A;  3WD2 A;  1FKR A;  4Z2I A;  2B5U B;  4URI A;  5DIT A;  5HTG A;  4O2T A;  1F40 A;  1QZ2 A;  1YAT A;  4ZPT R;  1L1P A;  2B31 A;  1GOI A;  4W9P A;  1A7X A;  4ML4 A;  4KR0 B;  4WJX A;  2XP6 A; 
#chains in the Genus database with same CATH homology
 1NWR A;  2DSZ A;  3CH9 A;  4HAR A;  1J4I A;  1D2K A;  4WIW A;  4DRQ A;  3B9E A;  1ZB5 A;  4S3J A;  3O5J A;  2DSV A;  3WQV A;  1KT1 A;  2ZQU A;  4MSP A;  2XP7 A;  3O5L A;  3WL1 A;  3KAH A;  2RUQ A;  4W9O A;  3W4R A;  3B7X A;  4DZ2 A;  2A3B A;  3O5O A;  5HW7 A;  4MNL A;  4DRH A;  3RME A;  3PA7 A;  4DRN A;  3JYM A;  2XP4 A;  1NH6 A;  1E9L A;  2PV1 A;  4MAV A;  1SYT A;  2F21 A;  1HJV A;  4DT4 A;  4ZS6 A;  4HBE A;  3WH0 A;  4ODK A;  4LAY A;  4Z2G A;  4WK9 A;  3ARW A;  1OWQ A;  1RD6 A;  1NWT A;  2MF9 A;  3O5E A;  5JH8 A;  3FY1 A;  3WD1 A;  4GGQ A;  4MPK A;  2KFW A;  4P8X A;  1XRV A;  1LL7 A;  3CHD A;  1PBK A;  3O5M A;  2ZR5 A;  3H9R B;  4DRP A;  1KFW A;  3GPK A;  4P8V A;  3UQB A;  1K9T A;  2DG3 A;  2RUR A;  2IF4 A;  1FKT A;  5DF0 A;  3IKD A;  3O5P A;  1B6C A;  1E6N A;  4DRI A;  4FAP A;  4DZ3 A;  3ART A;  1HKI A;  4Z2J A;  4DWS A;  2YBT A;  1FKF A;  2ITK A;  4QT3 A;  3ARV A;  3O5I A;  2PPO A;  1OGG A;  1HJX A;  1R9H A;  3KAC A;  5I98 A;  4DWS C;  4JYS A;  1H0I A;  1FKL A;  1ZCN A;  4IT6 A;  1NWU A;  3B9A A;  5HWC A;  1UR9 A;  3WL0 A;  3PRB A;  4BF8 A;  4IT4 A;  3RM9 A;  2QF8 A;  1BKF A;  4KQZ A;  1FKH A;  2FAP A;  3AS0 A;  1WNO A;  1FKB A;  1D6O A;  1E6Z A;  1Q1C A;  2O9O A;  3WIJ A;  3OOB A;  5DO2 A;  3O5D A;  3FXY A;  4R5E A;  1X6L A;  2DT1 A;  3ALG A;  1W26 A;  2ZR4 A;  1W1V A;  2O92 A;  1EIB A;  3IK8 A;  4MGV A;  2G41 A;  4L72 B;  3WD3 A;  1FAP A;  4WKA A;  1FKD A;  3B8S A;  3WQW A;  1J4R A;  5GQB A;  4TNS A;  2M2A A;  3WKZ A;  1VF8 A;  1FKG A;  1EYM A;  2MNT A;  4J4O A;  2M08 A;  2ZR6 A;  1Q6I A;  2FKE A;  3G6L A;  2KE0 A;  3O5G A;  4DWS D;  3PRD A;  2AWG A;  1NMV A;  1QPF A;  2DG4 A;  3O5K A;  4W9Q A;  2PI6 A;  4JFI A;  1D7J A;  2UZ5 A;  1Q6U A;  5DIV A;  4W5U A;  5GPG A;  4ZPV R;  1NSG A;  3KCE A;  1P5Q A;  1JNS A;  2DPE A;  3TDB A;  2VN1 A;  4MTV A;  2Y78 A;  2XP3 A;  1Y0O A;  4TX0 A;  1E6R A;  3PR9 A;  1CTN A;  4N19 A;  2ZQV A;  4LAW A;  3JXV A;  4WKF A;  3UQA A;  2Q5A A;  4QIB A;  1ROU A;  4Z2H A;  1FKJ A;  4Q7N A;  3AS2 A;  3ARP A;  4ODN A;  4IQC A;  2MLZ A;  4JFL A;  1EHN A;  3NI6 A;  3AQU A;  2K8I A;  4DWS B;  1EQ3 A;  1FJD A;  2XP9 A;  2XPA A;  4DRM A;  2ZQS A;  1LG1 A;  1D7H A;  2RUC A;  1F8A B;  3ARY A;  1JNE A;  4ITZ A;  3KAD A;  4ODM A;  4WKH A;  1HKM A;  3ARX A;  4QZV B;  2G8Z A;  1ROT A;  1EDQ A;  1NWS A;  5J6E A;  1FD9 A;  1NMW A;  1W9V A;  1ZBW A;  2IUZ A;  2RQS A;  2MLY A;  1LJY A;  3O5R A;  4NSB A;  1IX5 A;  1TFV A;  2A3A A;  3KAB A;  2XPB A;  3RM4 A;  1LG2 A;  2ZQT A;  1W9P A;  4J4N A;  2WM0 A;  4TW7 A;  4JFM A;  2KR7 A;  3TC5 A;  3CGN A;  2L2S A;  3ODK A;  4TYO A;  3ARS A;  3AS1 A;  2DSU A;  5HT1 A;  1LL6 A;  3ALF A;  4Z2L A;  4PTM A;  1HJW A;  3NTP A;  1JNT A;  4FN2 A;  2LJ4 A;  5HW8 A;  3UQI A;  1T11 A;  3B9D A;  2KGJ A;  1HXV A;  5DEZ A;  4R0X A;  4TW8 A;  4ZPW R;  4IPX A;  4LGX A;  4LAV A;  1W9U A;  1J4H A;  1C9H A;  2XP8 A;  3QOK A;  2MLX A;  3FAP A;  2PPP A;  2WLY A;  3ARU A;  4HBO A;  4P8U A;  1ZL1 A;  4LAX A;  4S3K A;  3EY6 A;  1GPF A;  1J6Y A;  1WB0 A;  4NZC A;  2PV2 A;  3CZ8 A;  2VCD A;  1JVW A;  1X6N A;  3CHE A;  1YW5 A;  4ODR A;  3BXW A;  3ARO A;  3CHF A;  3OA5 A;  1FKI A;  1FFQ A;  1ZBV A;  2AOS A;  2DSW A;  2PV3 A;  4XAK A;  1ZK6 A;  2A3E A;  5D75 A;  2DT3 A;  4DRK A;  2D9F A;  1SR0 A;  5BXJ A;  1WAW A;  4JFJ A;  3TCZ A;  2JZV A;  2DT0 A;  2OFN A;  1O6I A;  3ARQ A;  4QT2 A;  1ZU8 A;  3G6M A;  3KAF A;  3RM8 A;  4DRJ A;  2DG9 A;  4L3N A;  2DT2 A;  2F2D A;  2OLH A;  3O5F A;  1E6P A;  3ARR A;  3KAG A;  4U86 A;  4GIV A;  2ESC A;  1ITX A;  3NRK A;  1E15 A;  2A3C A;  2MPH A;  1HKJ A;  2LPV A;  4TW6 A;  2RSE A;  4IQ2 A;  3MDY B;  5DIU A;  5B8I C;  2WK2 A;  3CHC A;  1FKK A;  1XHG A;  1TCO C;  4C02 B;  1M5Y A;  2FDM A;  1FFR A;  5GPR A;  4MNJ A;  1KT0 A;  4MNM A;  3UI4 A;  1FKS A;  3LUO A;  3O5Q A;  2PPN A;  2YBU A;  1HKK A;  5HW6 A;  1W1P A;  4Q22 A;  2WLZ A;  4DIP A;  1D7I A;  4ODQ A;  3I6C A;  4U84 A;  2KI3 A;  1H0G A;  1N1A A;  2LKN A;  3WD0 A;  3KAI A;  1W1T A;  3JYJ A;  5HBF A;  1U79 A;  5HUA A;  4U85 A;  1OGB A;  1LQ0 A;  3WD4 A;  4ODO A;  2XP5 A;  3IHZ A;  4DH0 A;  3ARZ A;  5HWB A;  3UI6 A;  4DRO A;  3AS3 A;  4Z2K A;  4G2P A;  1W1Y A;  4P8W A;  3RGC A;  4JFK A;  1BL4 A;  1PIN A;  1QPL A;  3PRA A;  3KZ7 A;  1ZBC A;  3UI5 A;  1ZBK A;  2KO7 A;  3IKG A;  4ODL A;  3CGM A;  4AY1 A;  4NNR A;  1JND A;  1Q6H A;  4G50 A;  2LGO A;  4MNK A;  5HKG A;  1LL4 A;  1UR8 A;  2M1I A;  2RUD A;  3UF8 A;  3VAW A;  3RFW A;  2N87 A;  2PBC A;  4ODP A;  2F4E A;  1GUV A;  3WD2 A;  1FKR A;  4Z2I A;  4URI A;  5DIT A;  5HTG A;  4O2T A;  1F40 A;  1QZ2 A;  1YAT A;  4ZPT R;  1L1P A;  2B31 A;  1GOI A;  4W9P A;  1A7X A;  4ML4 A;  4KR0 B;  4WJX A;  2XP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...