1FKSA

Solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of FKBP, a rotamase enzyme and receptor for FK506 and rapamycin.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
molecule keywords FK506 AND RAPAMYCIN-BINDING PROTEIN
total genus 12
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fksA00
1NSGA 2ZQVA 3O5KA 5HTGA 1F40A 5HW6A 3IKGA 3UQBA 2ZR5A 2MLXA 4DIPA 1J4IA 4ODQA 2LPVA 4IQCA 1EYMA 1W26A 2LKNA 4NNRA 2PV3A 1T11A 2MPHA 1KT0A 3PRBA 2RQSA 1FKRA 2PPNA 4LAYA 2DG3A 2F2DA 3GPKA 4TW8A 3KZ7A 2OFNA 4LAVA 4J4OA 3KCEA 3TDBA 3KAIA 1QPFA 2LJ4A 3I6CA 2PV1A 4U84A 1FKSA 1N1AA 2IF4A 4ODMA 2M2AA 1FKTA 2RUQA 3LUOA 4J4NA 1U79A 1F8AB 2M1IA 2MF9A 1J4HA 2LGOA 4JFMA 4DRNA 3JYJA 1A7XA 2ZR6A 5DIVA 4DRHA 4LAWA 1EQ3A 2XP8A 3O5RA 4O2TA 4DH0A 3NTPA 1Q1CA 2ZQSA 3IHZA 1ROUA 3UQIA 2ZQTA 2D9FA 2FKEA 4W9OA 1FKLA 2XPBA 3FAPA 3PRDA 4TW7A 1FKBA 4DZ3A 1QPLA 3KADA 4DRMA 4MSPA 2XP7A 4QT2A 1C9HA 2MNTA 5DIUA 1JVWA 2ZR4A 2M08A 1R9HA 3UI4A 1PINA 4JFLA 4U86A 3RGCA 4DT4A 2PBCA 2Y78A 3VAWA 4QIBA 1FKJA 1TCOC 3KAGA 5HWBA 1D7HA 2RUDA 1P5QA 2RUCA 3CGMA 3O5JA 5I98A 4GIVA 2PPPA 4ITZA 4N19A 2PPOA 4ODRA 5HW8A 3O5IA 4ODLA 4DZ2A 2K8IA 2XPAA 1PBKA 3KAHA 2KFWA 3CGNA 4MGVA 1KT1A 4TNSA 3IKDA 3UF8A 3KACA 4R0XA 3NI6A 1FAPA 4ODPA 3TCZA 1JNTA 1NMVA 5DITA 1ZK6A 1HXVA 1D6OA 3IK8A 2KI3A 4TW6A 5GPGA 2XP9A 4JYSA 3O5QA 3TC5A 5HUAA 1J6YA 2XP4A 4TX0A 1D7JA 3PA7A 3UQAA 2DG9A 1Q6HA 1ROTA 1FD9A 4IPXA 4QT3A 3O5DA 4FAPA 4JFIA 3WH0A 3KABA 2Q5AA 4W9QA 1JNSA 2XP6A 5HKGA 5HT1A 5BXJA 3JXVA 5J6EA 2F4EA 3KAFA 3MDYB 4ODKA 2RURA 1M5YA 3UI5A 1FKGA 1Q6UA 3RFWA 4DRKA 4G2PA 3O5OA 3ODKA 4JFJA 1J4RA 5HWCA 4TYOA 4BF8A 1FKDA 2KR7A 3O5EA 4W9PA 2UZ5A 3O5GA 1NMWA 2RSEA 4GGQA 3UI6A 4U85A 4FN2A 1YW5A 2N87A 5HW7A 3NRKA 2VN1A 4DRIA 4ODOA 1YATA 2ITKA 3B7XA 2AWGA 2FAPA 4G50A 5D75A 1FKFA 2KE0A 1Y0OA 4JFKA 5B8IC 4IQ2A 2VCDA 1B6CA 2XP3A 2ZQUA 1Q6IA 4C02B 1L1PA 4LAXA 3EY6A 4ODNA 2JZVA 3H9RB 2MLZA 4DRQA 2KGJA 1FKIA 1D7IA 3JYMA 4DRPA 4DRJA 2XP5A 2DG4A 2F21A 3O5PA 1FKHA 1BL4A 2L2SA 3O5LA 3O5MA 1ZCNA 2PV2A 3OOBA 2MLYA 3O5FA 1QZ2A 4DROA 1FJDA 1FKKA 2KO7A 1BKFA
chains in the Genus database with same CATH superfamily
5GQBA 2ZQVA 1FFQA 4ODQA 4S3JA 3GU0A 1T11A 2MPHA 1HJXA 1FKRA 1LQ0A 2DSUA 2F2DA 2OFNA 4LAVA 3TDBA 1JCHB 1W1PA 4QZVB 1FKSA 4ODMA 4Q22A 2RUQA 2MF9A 2A3AA 4ZPVR 3GTYX 2XP8A 4O2TA 1XHGA 1Q1CA 2B5UB 3ALFA 2ETNA 1LL6A 3ARZA 2D9FA 2FKEA 4W9OA 3FXYA 4Z2JA 1C9HA 3B9EA 2MNTA 1PINA 2PN0A 2Y78A 3WD2A 4DWSC 1FKJA 3KAGA 1P5QA 5I98A 2PPOA 3O5IA 4ODLA 3PRAA 2K8IA 1CTNA 2KFWA 4MGVA 4R0XA 3B9DA 1X6LA 5HUAA 2XP4A 1Q6HA 1WB0A 4QT3A 5GPRA 3WH0A 3KABA 3G6MA 2Q5AA 2WK2A 4ZPTR 2B31A 5BXJA 5J6EA 3UI5A 3RFWA 4G2PA 3WQVA 2G8ZA 1HKMA 3ODKA 3ARPA 1X6NA 1FKDA 3BMBA 1HJVA 4W9PA 4GGQA 3AQUA 3CHEA 2DSZA 4HARA 1SR0A 5HW7A 2DT3A 2ITKA 3B7XA 5D75A 4DWSB 2KE0A 4WJXA 4MNLA 2VCDA 1B6CA 4C02B 1GOIA 1GRJA 3H9RB 2KGJA 1IX5A 1D7IA 4DRJA 1ITXA 5DF0A 3O5PA 4ML4A 5HBFA 4MAVA 1WNOA 1QZ2A 3CZ8A 2DT1A 1BKFA 5HTGA 1F40A 5HW6A 3IKGA 3UQBA 2MLXA 3WD0A 4IQCA 3WD3A 1EYMA 4NNRA 1GPFA 2PV3A 3CHFA 1HJWA 3RM4A 3FY1A 2PI6A 2PPNA 2DG3A 3GPKA 4IT4A 3KAIA 1QPFA 1WAWA 2LJ4A 2OLHA 2PV1A 2IF4A 1VF8A 1FKTA 1GUVA 1U79A 3WQWA 1E6NA 4WIWA 4LGXA 1A7XA 5DIVA 4NSBA 4DWSD 3O5RA 3ALGA 1EHNA 2ZQSA 3IHZA 1ROUA 1LL4A 3UQIA 2ZQTA 1FKLA 4P8UA 3KADA 5DEZA 1FFRA 3B9AA 5DIUA 1JVWA 1R9HA 4JFLA 4DT4A 2PBCA 3VAWA 1ZBKA 2YBUA 1TCOC 3OA5A 3W4RA 1D7HA 2RUDA 3CGMA 4GIVA 2PPPA 4ITZA 3AS1A 4P8XA 2G41A 4TNSA 3IKDA 2WM0A 1NMVA 5DITA 1HXVA 2KI3A 3CHDA 1J6YA 3UQAA 1FD9A 3WKZA 3ARVA 3AS3A 4W9QA 1JNSA 3CHCA 1JNEA 3WL1A 1OWQA 3JXVA 2F4EA 1HKJA 1M5YA 2RURA 1FKGA 1H0IA 1ZU8A 3BXWA 3O5EA 4FN2A 2VN1A 3AS2A 4ODOA 1OGBA 1FKFA 1Y0OA 2ZQUA 5JH8A 2XP3A 4Q7NA 1LJYA 3EY6A 4Z2IA 4ODNA 2JZVA 2MLZA 2YBTA 4DRQA 1FKIA 3JYMA 3WD1A 2DG4A 1SYTA 1FKHA 4S3KA 3ARYA 3O5MA 4DROA 1FJDA 1FKKA 2KO7A 1NSGA 3RM8A 1KFWA 4DIPA 2LPVA 5DO2A 1OGGA 1H0GA 1W26A 2FDMA 4WK9A 2RQSA 3ARXA 1E44A 4LAYA 4TW8A 1UR8A 3I6CA 1N1AA 1UR9A 2M2AA 1ZBVA 4J4NA 1J4HA 2LGOA 1LG2A 4DRNA 3JYJA 2ZR6A 4P8WA 4DRHA 4LAWA 2A3BA 1D2KA 4MNMA 1E6RA 3FAPA 2XPBA 4TW7A 1FKBA 1QPLA 4MPKA 4Z2LA 4ZS6A 4WKHA 4MNJA 2DSWA 3EIPA 4NZCA 1ZBCA 3G6LA 2M08A 3UI4A 1W9PA 3RGCA 4U86A 3WL0A 4QIBA 2AOSA 4N19A 3PR9A 4UDMA 3RMEA 4ODRA 4DZ2A 2P4VA 3UF8A 1W1TA 3NI6A 1FAPA 4KQZA 3TCZA 1JNTA 4KR0B 1ZK6A 4JYSA 3O5QA 1K9TA 4TX0A 1D7JA 4R5EA 3PA7A 1O6IA 1ROTA 2EULA 1W1VA 4JFIA 2XP6A 5HT1A 4Z2GA 3KAFA 3MDYB 4JFJA 1J4RA 4TYOA 4BF8A 3CH9A 3ARQA 2UZ5A 1EDQA 3O5GA 2RSEA 3UI6A 1E6PA 4ZPWR 2AWGA 2FAPA 1EIBA 4G50A 1NWTA 5B8IC 1Q6IA 4LAXA 4DRPA 2XP5A 2DPEA 2F21A 1BL4A 2O9OA 3ARRA 1ZCNA 4IT6A 1LG1A 2WLYA 3O5KA 4W5UA 4MTVA 2ZR5A 3B8SA 1J4IA 2LKNA 2A3EA 1W9VA 1KT0A 3PRBA 4Z2HA 3KZ7A 2O92A 4J4OA 3KCEA 4WKAA 4Z2KA 4L72B 4U84A 2QF8A 3LUOA 1F8AB 2M1IA 4JFMA 3WIJA 1EQ3A 1XRVA 1LL7A 1TFVA 3NTPA 4DH0A 1W1YA 3PRDA 4DZ3A 3AS0A 4MSPA 2XP7A 2DT2A 4AY1A 4QT2A 4XAKA 2ZR4A 4L3NA 1E6ZA 1HKIA 3RM9A 5HWBA 2RUCA 3O5JA 1NWSA 1NH6A 5HW8A 2IUZA 2DSVA 1JNDA 2XPAA 1PBKA 3KAHA 3ARTA 3CGNA 1KT1A 2ESCA 3KACA 4ODPA 4HBEA 1D6OA 3IK8A 3TC5A 4TW6A 5GPGA 2XP9A 1ZL1A 3ARSA 3QOKA 2DG9A 4IPXA 3O5DA 4FAPA 2WLZA 2DT0A 4P8VA 4HBOA 5HKGA 4ODKA 3AROA 4DRMA 4DRKA 1RD6A 1Q6UA 3O5OA 5HWCA 2KR7A 1NMWA 1E9LA 1ZBWA 4U85A 1YW5A 1ZB5A 2N87A 3NRKA 4DRIA 4PTMA 1YATA 3ARWA 4JFKA 4IQ2A 1HKKA 4WKFA 1L1PA 4URIA 3WD4A 1NWRA 4MNKA 4DWSA 1W9UA 3ARUA 2A3CA 1E15A 2L2SA 3O5LA 2F23A 3OOBA 2PV2A 2MLYA 3O5FA 1NWUA
chains in the Genus database with same CATH topology
5GQBA 2ZQVA 1FFQA 4ODQA 4S3JA 1T11A 2MPHA 1HJXA 1FKRA 1LQ0A 2DSUA 2F2DA 2OFNA 4LAVA 3TDBA 1W1PA 4QZVB 1FKSA 4ODMA 4Q22A 2RUQA 2MF9A 2A3AA 4ZPVR 2XP8A 4O2TA 1XHGA 1Q1CA 3ALFA 1LL6A 3ARZA 2D9FA 2FKEA 4W9OA 3FXYA 4Z2JA 1C9HA 3B9EA 2MNTA 1PINA 2Y78A 3WD2A 4DWSC 1FKJA 3KAGA 1P5QA 5I98A 2PPOA 3O5IA 4ODLA 3PRAA 2K8IA 1CTNA 2KFWA 4MGVA 4R0XA 3B9DA 1X6LA 5HUAA 2XP4A 1Q6HA 1WB0A 4QT3A 5GPRA 3WH0A 3KABA 3G6MA 2Q5AA 2WK2A 4ZPTR 2B31A 5BXJA 5J6EA 3UI5A 3RFWA 4G2PA 3WQVA 2G8ZA 1HKMA 3ODKA 3ARPA 1X6NA 1FKDA 1HJVA 4W9PA 4GGQA 3AQUA 3CHEA 2DSZA 4HARA 1SR0A 5HW7A 2DT3A 2ITKA 3B7XA 5D75A 4DWSB 2KE0A 4WJXA 4MNLA 2VCDA 1B6CA 4C02B 1GOIA 3H9RB 2KGJA 1IX5A 1D7IA 4DRJA 1ITXA 5DF0A 3O5PA 4ML4A 5HBFA 4MAVA 1WNOA 1QZ2A 3CZ8A 2DT1A 1BKFA 5HTGA 1F40A 5HW6A 3IKGA 3UQBA 2MLXA 3WD0A 4IQCA 3WD3A 1EYMA 4NNRA 1GPFA 2PV3A 3CHFA 1HJWA 3RM4A 3FY1A 2PI6A 2PPNA 2DG3A 3GPKA 4IT4A 3KAIA 1QPFA 1WAWA 2LJ4A 2OLHA 2PV1A 2IF4A 1VF8A 1FKTA 1GUVA 1U79A 3WQWA 1E6NA 4WIWA 4LGXA 1A7XA 5DIVA 4NSBA 4DWSD 3O5RA 3ALGA 1EHNA 2ZQSA 3IHZA 1ROUA 1LL4A 3UQIA 2ZQTA 1FKLA 4P8UA 3KADA 5DEZA 1FFRA 3B9AA 5DIUA 1JVWA 1R9HA 4JFLA 4DT4A 2PBCA 3VAWA 1ZBKA 2YBUA 1TCOC 3OA5A 3W4RA 1D7HA 2RUDA 3CGMA 4GIVA 2PPPA 4ITZA 3AS1A 4P8XA 2G41A 4TNSA 3IKDA 2WM0A 1NMVA 5DITA 1HXVA 2KI3A 3CHDA 1J6YA 3UQAA 1FD9A 3WKZA 3ARVA 3AS3A 4W9QA 1JNSA 3CHCA 1JNEA 3WL1A 1OWQA 3JXVA 2F4EA 1HKJA 1M5YA 2RURA 1FKGA 1H0IA 1ZU8A 3BXWA 3O5EA 4FN2A 2VN1A 3AS2A 4ODOA 1OGBA 1FKFA 1Y0OA 2ZQUA 5JH8A 2XP3A 4Q7NA 1LJYA 3EY6A 4Z2IA 4ODNA 2JZVA 2MLZA 2YBTA 4DRQA 1FKIA 3JYMA 3WD1A 2DG4A 1SYTA 1FKHA 4S3KA 3ARYA 3O5MA 4DROA 1FJDA 1FKKA 2KO7A 1NSGA 3RM8A 1KFWA 4DIPA 2LPVA 5DO2A 1OGGA 1H0GA 1W26A 2FDMA 4WK9A 2RQSA 3ARXA 4LAYA 4TW8A 1UR8A 3I6CA 1N1AA 1UR9A 2M2AA 1ZBVA 4J4NA 1J4HA 2LGOA 1LG2A 4DRNA 3JYJA 2ZR6A 4P8WA 4DRHA 4LAWA 2A3BA 1D2KA 4MNMA 1E6RA 3FAPA 2XPBA 4TW7A 1FKBA 1QPLA 4MPKA 4Z2LA 4ZS6A 4WKHA 4MNJA 2DSWA 4NZCA 1ZBCA 3G6LA 2M08A 3UI4A 1W9PA 3RGCA 4U86A 3WL0A 4QIBA 2AOSA 4N19A 3PR9A 3RMEA 4ODRA 4DZ2A 3UF8A 1W1TA 3NI6A 1FAPA 4KQZA 3TCZA 1JNTA 4KR0B 1ZK6A 4JYSA 3O5QA 1K9TA 4TX0A 1D7JA 4R5EA 3PA7A 1O6IA 1ROTA 1W1VA 4JFIA 2XP6A 5HT1A 4Z2GA 3KAFA 3MDYB 4JFJA 1J4RA 4TYOA 4BF8A 3CH9A 3ARQA 2UZ5A 1EDQA 3O5GA 2RSEA 3UI6A 1E6PA 4ZPWR 2AWGA 2FAPA 1EIBA 4G50A 1NWTA 5B8IC 1Q6IA 4LAXA 4DRPA 2XP5A 2DPEA 2F21A 1BL4A 2O9OA 3ARRA 1ZCNA 4IT6A 1LG1A 2WLYA 3O5KA 4W5UA 4MTVA 2ZR5A 3B8SA 1J4IA 2LKNA 2A3EA 1W9VA 1KT0A 3PRBA 4Z2HA 3KZ7A 2O92A 4J4OA 3KCEA 4WKAA 4Z2KA 4L72B 4U84A 2QF8A 3LUOA 1F8AB 2M1IA 4JFMA 3WIJA 1EQ3A 1XRVA 1LL7A 1TFVA 3NTPA 4DH0A 1W1YA 3PRDA 4DZ3A 3AS0A 4MSPA 2XP7A 2DT2A 4AY1A 4QT2A 4XAKA 2ZR4A 4L3NA 1E6ZA 1HKIA 3RM9A 5HWBA 2RUCA 3O5JA 1NWSA 1NH6A 5HW8A 2IUZA 2DSVA 1JNDA 2XPAA 1PBKA 3KAHA 3ARTA 3CGNA 1KT1A 2ESCA 3KACA 4ODPA 4HBEA 1D6OA 3IK8A 3TC5A 4TW6A 5GPGA 2XP9A 1ZL1A 3ARSA 3QOKA 2DG9A 4IPXA 3O5DA 4FAPA 2WLZA 2DT0A 4P8VA 4HBOA 5HKGA 4ODKA 3AROA 4DRMA 4DRKA 1RD6A 1Q6UA 3O5OA 5HWCA 2KR7A 1NMWA 1E9LA 1ZBWA 4U85A 1YW5A 1ZB5A 2N87A 3NRKA 4DRIA 4PTMA 1YATA 3ARWA 4JFKA 4IQ2A 1HKKA 4WKFA 1L1PA 4URIA 3WD4A 1NWRA 4MNKA 4DWSA 1W9UA 3ARUA 2A3CA 1E15A 2L2SA 3O5LA 3OOBA 2PV2A 2MLYA 3O5FA 1NWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NSG A;  2ZQV A;  3O5K A;  5HTG A;  1F40 A;  5HW6 A;  3IKG A;  3UQB A;  2ZR5 A;  2MLX A;  4DIP A;  1J4I A;  4ODQ A;  2LPV A;  4IQC A;  1EYM A;  1W26 A;  2LKN A;  4NNR A;  2PV3 A;  1T11 A;  2MPH A;  1KT0 A;  3PRB A;  2RQS A;  1FKR A;  2PPN A;  4LAY A;  2DG3 A;  2F2D A;  3GPK A;  4TW8 A;  3KZ7 A;  2OFN A;  4LAV A;  4J4O A;  3KCE A;  3TDB A;  3KAI A;  1QPF A;  2LJ4 A;  3I6C A;  2PV1 A;  4U84 A;  1FKS A;  1N1A A;  2IF4 A;  4ODM A;  2M2A A;  1FKT A;  2RUQ A;  3LUO A;  4J4N A;  1U79 A;  1F8A B;  2M1I A;  2MF9 A;  1J4H A;  2LGO A;  4JFM A;  4DRN A;  3JYJ A;  1A7X A;  2ZR6 A;  5DIV A;  4DRH A;  4LAW A;  1EQ3 A;  2XP8 A;  3O5R A;  4O2T A;  4DH0 A;  3NTP A;  1Q1C A;  2ZQS A;  3IHZ A;  1ROU A;  3UQI A;  2ZQT A;  2D9F A;  2FKE A;  4W9O A;  1FKL A;  2XPB A;  3FAP A;  3PRD A;  4TW7 A;  1FKB A;  4DZ3 A;  1QPL A;  3KAD A;  4DRM A;  4MSP A;  2XP7 A;  4QT2 A;  1C9H A;  2MNT A;  5DIU A;  1JVW A;  2ZR4 A;  2M08 A;  1R9H A;  3UI4 A;  1PIN A;  4JFL A;  4U86 A;  3RGC A;  4DT4 A;  2PBC A;  2Y78 A;  3VAW A;  4QIB A;  1FKJ A;  1TCO C;  3KAG A;  5HWB A;  1D7H A;  2RUD A;  1P5Q A;  2RUC A;  3CGM A;  3O5J A;  5I98 A;  4GIV A;  2PPP A;  4ITZ A;  4N19 A;  2PPO A;  4ODR A;  5HW8 A;  3O5I A;  4ODL A;  4DZ2 A;  2K8I A;  2XPA A;  1PBK A;  3KAH A;  2KFW A;  3CGN A;  4MGV A;  1KT1 A;  4TNS A;  3IKD A;  3UF8 A;  3KAC A;  4R0X A;  3NI6 A;  1FAP A;  4ODP A;  3TCZ A;  1JNT A;  1NMV A;  5DIT A;  1ZK6 A;  1HXV A;  1D6O A;  3IK8 A;  2KI3 A;  4TW6 A;  5GPG A;  2XP9 A;  4JYS A;  3O5Q A;  3TC5 A;  5HUA A;  1J6Y A;  2XP4 A;  4TX0 A;  1D7J A;  3PA7 A;  3UQA A;  2DG9 A;  1Q6H A;  1ROT A;  1FD9 A;  4IPX A;  4QT3 A;  3O5D A;  4FAP A;  4JFI A;  3WH0 A;  3KAB A;  2Q5A A;  4W9Q A;  1JNS A;  2XP6 A;  5HKG A;  5HT1 A;  5BXJ A;  3JXV A;  5J6E A;  2F4E A;  3KAF A;  3MDY B;  4ODK A;  2RUR A;  1M5Y A;  3UI5 A;  1FKG A;  1Q6U A;  3RFW A;  4DRK A;  4G2P A;  3O5O A;  3ODK A;  4JFJ A;  1J4R A;  5HWC A;  4TYO A;  4BF8 A;  1FKD A;  2KR7 A;  3O5E A;  4W9P A;  2UZ5 A;  3O5G A;  1NMW A;  2RSE A;  4GGQ A;  3UI6 A;  4U85 A;  4FN2 A;  1YW5 A;  2N87 A;  5HW7 A;  3NRK A;  2VN1 A;  4DRI A;  4ODO A;  1YAT A;  2ITK A;  3B7X A;  2AWG A;  2FAP A;  4G50 A;  5D75 A;  1FKF A;  2KE0 A;  1Y0O A;  4JFK A;  5B8I C;  4IQ2 A;  2VCD A;  1B6C A;  2XP3 A;  2ZQU A;  1Q6I A;  4C02 B;  1L1P A;  4LAX A;  3EY6 A;  4ODN A;  2JZV A;  3H9R B;  2MLZ A;  4DRQ A;  2KGJ A;  1FKI A;  1D7I A;  3JYM A;  4DRP A;  4DRJ A;  2XP5 A;  2DG4 A;  2F21 A;  3O5P A;  1FKH A;  1BL4 A;  2L2S A;  3O5L A;  3O5M A;  1ZCN A;  2PV2 A;  3OOB A;  2MLY A;  3O5F A;  1QZ2 A;  4DRO A;  1FJD A;  1FKK A;  2KO7 A;  1BKF A; 
#chains in the Genus database with same CATH topology
 5GQB A;  2ZQV A;  1FFQ A;  4ODQ A;  4S3J A;  3GU0 A;  1T11 A;  2MPH A;  1HJX A;  1FKR A;  1LQ0 A;  2DSU A;  2F2D A;  2OFN A;  4LAV A;  3TDB A;  1JCH B;  1W1P A;  4QZV B;  1FKS A;  4ODM A;  4Q22 A;  2RUQ A;  2MF9 A;  2A3A A;  4ZPV R;  3GTY X;  2XP8 A;  4O2T A;  1XHG A;  1Q1C A;  2B5U B;  3ALF A;  2ETN A;  1LL6 A;  3ARZ A;  2D9F A;  2FKE A;  4W9O A;  3FXY A;  4Z2J A;  1C9H A;  3B9E A;  2MNT A;  1PIN A;  2PN0 A;  2Y78 A;  3WD2 A;  4DWS C;  1FKJ A;  3KAG A;  1P5Q A;  5I98 A;  2PPO A;  3O5I A;  4ODL A;  3PRA A;  2K8I A;  1CTN A;  2KFW A;  4MGV A;  4R0X A;  3B9D A;  1X6L A;  5HUA A;  2XP4 A;  1Q6H A;  1WB0 A;  4QT3 A;  5GPR A;  3WH0 A;  3KAB A;  3G6M A;  2Q5A A;  2WK2 A;  4ZPT R;  2B31 A;  5BXJ A;  5J6E A;  3UI5 A;  3RFW A;  4G2P A;  3WQV A;  2G8Z A;  1HKM A;  3ODK A;  3ARP A;  1X6N A;  1FKD A;  3BMB A;  1HJV A;  4W9P A;  4GGQ A;  3AQU A;  3CHE A;  2DSZ A;  4HAR A;  1SR0 A;  5HW7 A;  2DT3 A;  2ITK A;  3B7X A;  5D75 A;  4DWS B;  2KE0 A;  4WJX A;  4MNL A;  2VCD A;  1B6C A;  4C02 B;  1GOI A;  1GRJ A;  3H9R B;  2KGJ A;  1IX5 A;  1D7I A;  4DRJ A;  1ITX A;  5DF0 A;  3O5P A;  4ML4 A;  5HBF A;  4MAV A;  1WNO A;  1QZ2 A;  3CZ8 A;  2DT1 A;  1BKF A;  5HTG A;  1F40 A;  5HW6 A;  3IKG A;  3UQB A;  2MLX A;  3WD0 A;  4IQC A;  3WD3 A;  1EYM A;  4NNR A;  1GPF A;  2PV3 A;  3CHF A;  1HJW A;  3RM4 A;  3FY1 A;  2PI6 A;  2PPN A;  2DG3 A;  3GPK A;  4IT4 A;  3KAI A;  1QPF A;  1WAW A;  2LJ4 A;  2OLH A;  2PV1 A;  2IF4 A;  1VF8 A;  1FKT A;  1GUV A;  1U79 A;  3WQW A;  1E6N A;  4WIW A;  4LGX A;  1A7X A;  5DIV A;  4NSB A;  4DWS D;  3O5R A;  3ALG A;  1EHN A;  2ZQS A;  3IHZ A;  1ROU A;  1LL4 A;  3UQI A;  2ZQT A;  1FKL A;  4P8U A;  3KAD A;  5DEZ A;  1FFR A;  3B9A A;  5DIU A;  1JVW A;  1R9H A;  4JFL A;  4DT4 A;  2PBC A;  3VAW A;  1ZBK A;  2YBU A;  1TCO C;  3OA5 A;  3W4R A;  1D7H A;  2RUD A;  3CGM A;  4GIV A;  2PPP A;  4ITZ A;  3AS1 A;  4P8X A;  2G41 A;  4TNS A;  3IKD A;  2WM0 A;  1NMV A;  5DIT A;  1HXV A;  2KI3 A;  3CHD A;  1J6Y A;  3UQA A;  1FD9 A;  3WKZ A;  3ARV A;  3AS3 A;  4W9Q A;  1JNS A;  3CHC A;  1JNE A;  3WL1 A;  1OWQ A;  3JXV A;  2F4E A;  1HKJ A;  1M5Y A;  2RUR A;  1FKG A;  1H0I A;  1ZU8 A;  3BXW A;  3O5E A;  4FN2 A;  2VN1 A;  3AS2 A;  4ODO A;  1OGB A;  1FKF A;  1Y0O A;  2ZQU A;  5JH8 A;  2XP3 A;  4Q7N A;  1LJY A;  3EY6 A;  4Z2I A;  4ODN A;  2JZV A;  2MLZ A;  2YBT A;  4DRQ A;  1FKI A;  3JYM A;  3WD1 A;  2DG4 A;  1SYT A;  1FKH A;  4S3K A;  3ARY A;  3O5M A;  4DRO A;  1FJD A;  1FKK A;  2KO7 A;  1NSG A;  3RM8 A;  1KFW A;  4DIP A;  2LPV A;  5DO2 A;  1OGG A;  1H0G A;  1W26 A;  2FDM A;  4WK9 A;  2RQS A;  3ARX A;  1E44 A;  4LAY A;  4TW8 A;  1UR8 A;  3I6C A;  1N1A A;  1UR9 A;  2M2A A;  1ZBV A;  4J4N A;  1J4H A;  2LGO A;  1LG2 A;  4DRN A;  3JYJ A;  2ZR6 A;  4P8W A;  4DRH A;  4LAW A;  2A3B A;  1D2K A;  4MNM A;  1E6R A;  3FAP A;  2XPB A;  4TW7 A;  1FKB A;  1QPL A;  4MPK A;  4Z2L A;  4ZS6 A;  4WKH A;  4MNJ A;  2DSW A;  3EIP A;  4NZC A;  1ZBC A;  3G6L A;  2M08 A;  3UI4 A;  1W9P A;  3RGC A;  4U86 A;  3WL0 A;  4QIB A;  2AOS A;  4N19 A;  3PR9 A;  4UDM A;  3RME A;  4ODR A;  4DZ2 A;  2P4V A;  3UF8 A;  1W1T A;  3NI6 A;  1FAP A;  4KQZ A;  3TCZ A;  1JNT A;  4KR0 B;  1ZK6 A;  4JYS A;  3O5Q A;  1K9T A;  4TX0 A;  1D7J A;  4R5E A;  3PA7 A;  1O6I A;  1ROT A;  2EUL A;  1W1V A;  4JFI A;  2XP6 A;  5HT1 A;  4Z2G A;  3KAF A;  3MDY B;  4JFJ A;  1J4R A;  4TYO A;  4BF8 A;  3CH9 A;  3ARQ A;  2UZ5 A;  1EDQ A;  3O5G A;  2RSE A;  3UI6 A;  1E6P A;  4ZPW R;  2AWG A;  2FAP A;  1EIB A;  4G50 A;  1NWT A;  5B8I C;  1Q6I A;  4LAX A;  4DRP A;  2XP5 A;  2DPE A;  2F21 A;  1BL4 A;  2O9O A;  3ARR A;  1ZCN A;  4IT6 A;  1LG1 A;  2WLY A;  3O5K A;  4W5U A;  4MTV A;  2ZR5 A;  3B8S A;  1J4I A;  2LKN A;  2A3E A;  1W9V A;  1KT0 A;  3PRB A;  4Z2H A;  3KZ7 A;  2O92 A;  4J4O A;  3KCE A;  4WKA A;  4Z2K A;  4L72 B;  4U84 A;  2QF8 A;  3LUO A;  1F8A B;  2M1I A;  4JFM A;  3WIJ A;  1EQ3 A;  1XRV A;  1LL7 A;  1TFV A;  3NTP A;  4DH0 A;  1W1Y A;  3PRD A;  4DZ3 A;  3AS0 A;  4MSP A;  2XP7 A;  2DT2 A;  4AY1 A;  4QT2 A;  4XAK A;  2ZR4 A;  4L3N A;  1E6Z A;  1HKI A;  3RM9 A;  5HWB A;  2RUC A;  3O5J A;  1NWS A;  1NH6 A;  5HW8 A;  2IUZ A;  2DSV A;  1JND A;  2XPA A;  1PBK A;  3KAH A;  3ART A;  3CGN A;  1KT1 A;  2ESC A;  3KAC A;  4ODP A;  4HBE A;  1D6O A;  3IK8 A;  3TC5 A;  4TW6 A;  5GPG A;  2XP9 A;  1ZL1 A;  3ARS A;  3QOK A;  2DG9 A;  4IPX A;  3O5D A;  4FAP A;  2WLZ A;  2DT0 A;  4P8V A;  4HBO A;  5HKG A;  4ODK A;  3ARO A;  4DRM A;  4DRK A;  1RD6 A;  1Q6U A;  3O5O A;  5HWC A;  2KR7 A;  1NMW A;  1E9L A;  1ZBW A;  4U85 A;  1YW5 A;  1ZB5 A;  2N87 A;  3NRK A;  4DRI A;  4PTM A;  1YAT A;  3ARW A;  4JFK A;  4IQ2 A;  1HKK A;  4WKF A;  1L1P A;  4URI A;  3WD4 A;  1NWR A;  4MNK A;  4DWS A;  1W9U A;  3ARU A;  2A3C A;  1E15 A;  2L2S A;  3O5L A;  2F23 A;  3OOB A;  2PV2 A;  2MLY A;  3O5F A;  1NWU A; 
#chains in the Genus database with same CATH homology
 5GQB A;  2ZQV A;  1FFQ A;  4ODQ A;  4S3J A;  1T11 A;  2MPH A;  1HJX A;  1FKR A;  1LQ0 A;  2DSU A;  2F2D A;  2OFN A;  4LAV A;  3TDB A;  1W1P A;  4QZV B;  1FKS A;  4ODM A;  4Q22 A;  2RUQ A;  2MF9 A;  2A3A A;  4ZPV R;  2XP8 A;  4O2T A;  1XHG A;  1Q1C A;  3ALF A;  1LL6 A;  3ARZ A;  2D9F A;  2FKE A;  4W9O A;  3FXY A;  4Z2J A;  1C9H A;  3B9E A;  2MNT A;  1PIN A;  2Y78 A;  3WD2 A;  4DWS C;  1FKJ A;  3KAG A;  1P5Q A;  5I98 A;  2PPO A;  3O5I A;  4ODL A;  3PRA A;  2K8I A;  1CTN A;  2KFW A;  4MGV A;  4R0X A;  3B9D A;  1X6L A;  5HUA A;  2XP4 A;  1Q6H A;  1WB0 A;  4QT3 A;  5GPR A;  3WH0 A;  3KAB A;  3G6M A;  2Q5A A;  2WK2 A;  4ZPT R;  2B31 A;  5BXJ A;  5J6E A;  3UI5 A;  3RFW A;  4G2P A;  3WQV A;  2G8Z A;  1HKM A;  3ODK A;  3ARP A;  1X6N A;  1FKD A;  1HJV A;  4W9P A;  4GGQ A;  3AQU A;  3CHE A;  2DSZ A;  4HAR A;  1SR0 A;  5HW7 A;  2DT3 A;  2ITK A;  3B7X A;  5D75 A;  4DWS B;  2KE0 A;  4WJX A;  4MNL A;  2VCD A;  1B6C A;  4C02 B;  1GOI A;  3H9R B;  2KGJ A;  1IX5 A;  1D7I A;  4DRJ A;  1ITX A;  5DF0 A;  3O5P A;  4ML4 A;  5HBF A;  4MAV A;  1WNO A;  1QZ2 A;  3CZ8 A;  2DT1 A;  1BKF A;  5HTG A;  1F40 A;  5HW6 A;  3IKG A;  3UQB A;  2MLX A;  3WD0 A;  4IQC A;  3WD3 A;  1EYM A;  4NNR A;  1GPF A;  2PV3 A;  3CHF A;  1HJW A;  3RM4 A;  3FY1 A;  2PI6 A;  2PPN A;  2DG3 A;  3GPK A;  4IT4 A;  3KAI A;  1QPF A;  1WAW A;  2LJ4 A;  2OLH A;  2PV1 A;  2IF4 A;  1VF8 A;  1FKT A;  1GUV A;  1U79 A;  3WQW A;  1E6N A;  4WIW A;  4LGX A;  1A7X A;  5DIV A;  4NSB A;  4DWS D;  3O5R A;  3ALG A;  1EHN A;  2ZQS A;  3IHZ A;  1ROU A;  1LL4 A;  3UQI A;  2ZQT A;  1FKL A;  4P8U A;  3KAD A;  5DEZ A;  1FFR A;  3B9A A;  5DIU A;  1JVW A;  1R9H A;  4JFL A;  4DT4 A;  2PBC A;  3VAW A;  1ZBK A;  2YBU A;  1TCO C;  3OA5 A;  3W4R A;  1D7H A;  2RUD A;  3CGM A;  4GIV A;  2PPP A;  4ITZ A;  3AS1 A;  4P8X A;  2G41 A;  4TNS A;  3IKD A;  2WM0 A;  1NMV A;  5DIT A;  1HXV A;  2KI3 A;  3CHD A;  1J6Y A;  3UQA A;  1FD9 A;  3WKZ A;  3ARV A;  3AS3 A;  4W9Q A;  1JNS A;  3CHC A;  1JNE A;  3WL1 A;  1OWQ A;  3JXV A;  2F4E A;  1HKJ A;  1M5Y A;  2RUR A;  1FKG A;  1H0I A;  1ZU8 A;  3BXW A;  3O5E A;  4FN2 A;  2VN1 A;  3AS2 A;  4ODO A;  1OGB A;  1FKF A;  1Y0O A;  2ZQU A;  5JH8 A;  2XP3 A;  4Q7N A;  1LJY A;  3EY6 A;  4Z2I A;  4ODN A;  2JZV A;  2MLZ A;  2YBT A;  4DRQ A;  1FKI A;  3JYM A;  3WD1 A;  2DG4 A;  1SYT A;  1FKH A;  4S3K A;  3ARY A;  3O5M A;  4DRO A;  1FJD A;  1FKK A;  2KO7 A;  1NSG A;  3RM8 A;  1KFW A;  4DIP A;  2LPV A;  5DO2 A;  1OGG A;  1H0G A;  1W26 A;  2FDM A;  4WK9 A;  2RQS A;  3ARX A;  4LAY A;  4TW8 A;  1UR8 A;  3I6C A;  1N1A A;  1UR9 A;  2M2A A;  1ZBV A;  4J4N A;  1J4H A;  2LGO A;  1LG2 A;  4DRN A;  3JYJ A;  2ZR6 A;  4P8W A;  4DRH A;  4LAW A;  2A3B A;  1D2K A;  4MNM A;  1E6R A;  3FAP A;  2XPB A;  4TW7 A;  1FKB A;  1QPL A;  4MPK A;  4Z2L A;  4ZS6 A;  4WKH A;  4MNJ A;  2DSW A;  4NZC A;  1ZBC A;  3G6L A;  2M08 A;  3UI4 A;  1W9P A;  3RGC A;  4U86 A;  3WL0 A;  4QIB A;  2AOS A;  4N19 A;  3PR9 A;  3RME A;  4ODR A;  4DZ2 A;  3UF8 A;  1W1T A;  3NI6 A;  1FAP A;  4KQZ A;  3TCZ A;  1JNT A;  4KR0 B;  1ZK6 A;  4JYS A;  3O5Q A;  1K9T A;  4TX0 A;  1D7J A;  4R5E A;  3PA7 A;  1O6I A;  1ROT A;  1W1V A;  4JFI A;  2XP6 A;  5HT1 A;  4Z2G A;  3KAF A;  3MDY B;  4JFJ A;  1J4R A;  4TYO A;  4BF8 A;  3CH9 A;  3ARQ A;  2UZ5 A;  1EDQ A;  3O5G A;  2RSE A;  3UI6 A;  1E6P A;  4ZPW R;  2AWG A;  2FAP A;  1EIB A;  4G50 A;  1NWT A;  5B8I C;  1Q6I A;  4LAX A;  4DRP A;  2XP5 A;  2DPE A;  2F21 A;  1BL4 A;  2O9O A;  3ARR A;  1ZCN A;  4IT6 A;  1LG1 A;  2WLY A;  3O5K A;  4W5U A;  4MTV A;  2ZR5 A;  3B8S A;  1J4I A;  2LKN A;  2A3E A;  1W9V A;  1KT0 A;  3PRB A;  4Z2H A;  3KZ7 A;  2O92 A;  4J4O A;  3KCE A;  4WKA A;  4Z2K A;  4L72 B;  4U84 A;  2QF8 A;  3LUO A;  1F8A B;  2M1I A;  4JFM A;  3WIJ A;  1EQ3 A;  1XRV A;  1LL7 A;  1TFV A;  3NTP A;  4DH0 A;  1W1Y A;  3PRD A;  4DZ3 A;  3AS0 A;  4MSP A;  2XP7 A;  2DT2 A;  4AY1 A;  4QT2 A;  4XAK A;  2ZR4 A;  4L3N A;  1E6Z A;  1HKI A;  3RM9 A;  5HWB A;  2RUC A;  3O5J A;  1NWS A;  1NH6 A;  5HW8 A;  2IUZ A;  2DSV A;  1JND A;  2XPA A;  1PBK A;  3KAH A;  3ART A;  3CGN A;  1KT1 A;  2ESC A;  3KAC A;  4ODP A;  4HBE A;  1D6O A;  3IK8 A;  3TC5 A;  4TW6 A;  5GPG A;  2XP9 A;  1ZL1 A;  3ARS A;  3QOK A;  2DG9 A;  4IPX A;  3O5D A;  4FAP A;  2WLZ A;  2DT0 A;  4P8V A;  4HBO A;  5HKG A;  4ODK A;  3ARO A;  4DRM A;  4DRK A;  1RD6 A;  1Q6U A;  3O5O A;  5HWC A;  2KR7 A;  1NMW A;  1E9L A;  1ZBW A;  4U85 A;  1YW5 A;  1ZB5 A;  2N87 A;  3NRK A;  4DRI A;  4PTM A;  1YAT A;  3ARW A;  4JFK A;  4IQ2 A;  1HKK A;  4WKF A;  1L1P A;  4URI A;  3WD4 A;  1NWR A;  4MNK A;  4DWS A;  1W9U A;  3ARU A;  2A3C A;  1E15 A;  2L2S A;  3O5L A;  3OOB A;  2PV2 A;  2MLY A;  3O5F A;  1NWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...