1FKSA

Solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cis-trans isomerase
molecule keywords FK506 AND RAPAMYCIN-BINDING PROTEIN
publication title Solution structure of FKBP, a rotamase enzyme and receptor for FK506 and rapamycin.
pubmed rcsb
source organism Homo sapiens
total genus 12
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fksA00
1EQ3A 3UI4A 1JNTA 2AWGA 2DG4A 1PBKA 2MLZA 1W26A 4IPXA 4DROA 2ZR6A 4DRIA 1J4IA 1NMVA 2RUQA 2ZQSA 3KAFA 3KCEA 3O5OA 2XP5A 1T11A 1FKGA 3O5KA 4JFMA 4U85A 3KAIA 4G50A 2VCDA 2ZR4A 1FKRA 4W9OA 2MPHA 2KI3A 4DIPA 1YW5A 4DRQA 3TC5A 2PV3A 1D7IA 4ODNA 1Q6UA 2MLXA 4JFLA 2MF9A 2RQSA 2XP6A 1C9HA 1EYMA 1JVWA 5HKGA 4MSPA 1F8AB 4TNSA 3UI5A 1BL4A 4ITZA 3JXVA 4ODOA 3JYMA 4ODPA 2M1IA 1QPLA 3ODKA 4ODKA 1D7JA 4QT2A 4NNRA 2KGJA 5BXJA 2RUDA 1FKTA 2M08A 3KAGA 3IKGA 2JZVA 3UQIA 3UF8A 1KT0A 2XP3A 4LAWA 4ODQA 4ODLA 1Y0OA 1R9HA 3O5RA 3JYJA 1N1AA 2VN1A 1JNSA 4TW7A 1FKJA 5DITA 1HXVA 3FAPA 2KO7A 1ZCNA 2XP7A 4IQ2A 1Q1CA 2XP4A 4DRMA 5HT1A 5GPGA 4G2PA 1U79A 2RSEA 3NI6A 1J6YA 2RUCA 2XP9A 2FAPA 2Q5AA 4TX0A 4N19A 4BF8A 1B6CA 4JYSA 1FD9A 2PV2A 5DIVA 4FN2A 3NRKA 2K8IA 2F2DA 2PBCA 4GIVA 4J4NA 5HW7A 3VAWA 3RFWA 1ZK6A 3IK8A 5HTGA 2M2AA 4DH0A 4DRHA 4J4OA 1BKFA 2FKEA 4LAXA 2D9FA 2KFWA 1Q6IA 3PA7A 1QPFA 3TDBA 1P5QA 4FAPA 3O5JA 2LKNA 1PINA 5D75A 3WH0A 3KAHA 1KT1A 3MDYB 3O5GA 4LAVA 2LJ4A 4W9QA 4DRPA 1FKKA 2RURA 4DZ2A 3IHZA 4TW6A 5HWBA 4TW8A 1FKLA 1L1PA 4QT3A 4R0XA 5DIUA 5HUAA 2MNTA 3KACA 1Q6HA 2MLYA 3O5PA 4QIBA 4DRJA 1A7XA 2F21A 3H9RB 2N87A 3OOBA 1NSGA 2ZR5A 5J6EA 4JFJA 2ZQUA 1ROUA 3UQAA 1FKBA 3RGCA 1ROTA 1J4HA 3KADA 5HW6A 5HWCA 2XPAA 2UZ5A 1FKDA 4DRKA 4DRNA 2F4EA 1F40A 2ZQTA 4IQCA 4DZ3A 4DT4A 1D6OA 2KE0A 4JFKA 4ODMA 4U86A 1FKSA 3O5MA 3O5QA 2PPOA 5HW8A 2KR7A 5B8IC 3IKDA 3GPKA 5I98A 2PPPA 3B7XA 3KABA 4W9PA 2ZQVA 1YATA 2IF4A 2L2SA 3O5LA 3O5DA 2ITKA 3I6CA 3O5FA 1NMWA 3TCZA 2LPVA 2DG9A 4MGVA 1J4RA 3UQBA 1FJDA 1TCOC 3CGNA 4O2TA 2OFNA 4ODRA 2PPNA 3PRBA 4U84A 1FKFA 1D7HA 2XPBA 3EY6A 1FKHA 2XP8A 3KZ7A 2PV1A 3O5IA 1FAPA 4TYOA 1QZ2A 1FKIA 1M5YA 4C02B 3UI6A 3CGMA 3LUOA 2LGOA 4JFIA 3NTPA 2Y78A 3PRDA 3O5EA 4LAYA 2DG3A 4GGQA
chains in the Genus database with same CATH superfamily
5DO2A 2PN0A 1NWUA 2DG4A 4IPXA 1XHGA 3O5KA 4Q7NA 4JFMA 1FKGA 3KAIA 1ITXA 3AS2A 3TC5A 1E6PA 1Q6UA 4JFLA 1H0GA 1JNEA 1C9HA 1JVWA 5HKGA 3UI5A 2M1IA 4KQZA 3CHCA 2KGJA 4NNRA 5BXJA 1FKTA 2A3CA 2JZVA 3UF8A 4IT6A 2DT2A 1KT0A 4LAWA 4NSBA 4ODQA 1EIBA 1R9HA 3O5RA 1N1AA 3ARXA 2XP7A 1GPFA 5GPGA 2RSEA 1J6YA 2DPEA 2Q5AA 4TX0A 1B6CA 4DWSD 1FD9A 4J4NA 3VAWA 4WJXA 2D9FA 3PA7A 3TDBA 3B8SA 4FAPA 1LL6A 2LKNA 3ARQA 3WH0A 3O5GA 4W9QA 1FKLA 3CHFA 4NZCA 4ZS6A 3KACA 1Q6HA 1NSGA 2DT3A 3GTYX 3RMEA 1FKBA 3WQVA 4PTMA 4DRNA 4Z2LA 4DZ3A 3EIPA 1UR8A 1NWRA 1FKSA 3B9DA 3O5QA 2PPOA 3CH9A 2PPPA 3WKZA 4W9PA 1YATA 2YBUA 3I6CA 2DG9A 1GOIA 2OFNA 3PRBA 1FKFA 3EY6A 2XPBA 1FKHA 1X6LA 3ARSA 3CGMA 4JFIA 2DSWA 2WK2A 4Q22A 2QF8A 4MNLA 3O5EA 3CHEA 3RFWA 3ALFA 1E6RA 1LQ0A 1JNTA 2EULA 2MLZA 1ZBKA 1W26A 1J4IA 1NMVA 2RUQA 2YBTA 1FKRA 4W9OA 4DIPA 4P8XA 1D7IA 2RQSA 1SR0A 3CHDA 1FFQA 1F8AB 3WD3A 1BL4A 3JXVA 4ODOA 3ODKA 4QT2A 4P8VA 2RUDA 4L72B 1W1PA 2XP3A 1Y0OA 2OLHA 3FAPA 2KO7A 2WLYA 1Q1CA 3WQWA 4IT4A 4DRMA 5HT1A 4G2PA 1U79A 2O92A 2B5UB 1E6ZA 2WM0A 4BF8A 4JYSA 3ARRA 2PV2A 5DIVA 4QZVB 2F2DA 2PBCA 1WAWA 4S3JA 4S3KA 1ZK6A 5HTGA 1KFWA 4DH0A 2FKEA 1LL4A 4Z2KA 3RM8A 3WIJA 1PINA 2IUZA 4ZPTR 1W1TA 2LJ4A 1SYTA 1H0IA 2RURA 4DZ2A 4WK9A 3FY1A 4TW8A 1LJYA 1JCHB 2MNTA 1OWQA 3O5PA 4DRJA 1A7XA 3WL0A 3ARYA 2WLZA 4MPKA 1UR9A 1GRJA 3CZ8A 3UQAA 1ROTA 3GU0A 4ML4A 5DEZA 2UZ5A 1ZL1A 2ZQTA 4IQCA 1D6OA 4JFKA 5HW8A 3OA5A 2KR7A 5B8IC 3IKDA 3GPKA 1HJVA 3B7XA 2PI6A 1D2KA 3TCZA 4MGVA 1FJDA 5JH8A 2PPNA 3WD2A 1VF8A 2XP8A 2PV1A 4TYOA 1FAPA 1QZ2A 2LGOA 4DWSB 2F23A 3G6LA 3ARVA 2DG3A 2ESCA 1EQ3A 3UI4A 2AWGA 4DROA 4DRIA 3KAFA 3O5OA 1T11A 4WKFA 4U85A 4XAKA 2MPHA 2KI3A 1W9VA 4DRQA 1WB0A 2PV3A 4P8UA 4ODNA 1IX5A 4R5EA 2MF9A 4Z2JA 4MSPA 1EHNA 3RM9A 1JNDA 4ODPA 1ZU8A 1D7JA 2M08A 3UQIA 1W9PA 4Z2IA 1LG1A 4ODLA 1HXVA 1FKJA 3AS0A 1HKKA 2DSVA 2XP4A 4DWSA 3WD4A 3PRAA 1E15A 3NI6A 2XP9A 1ZBWA 2FAPA 3QOKA 1NWTA 4N19A 3B9AA 2K8IA 4GIVA 1CTNA 3IK8A 1HKMA 1HKJA 4DRHA 1HKIA 4HBOA 4J4OA 4LAXA 2KFWA 4ZPWR 1Q6IA 1QPFA 3O5JA 5D75A 3MDYB 1KT1A 4LAVA 1ZBCA 3ARPA 1FKKA 2DSUA 2FDMA 1E9LA 2B31A 4QT3A 4R0XA 5DIUA 3ARZA 1ZBVA 1HJXA 4QIBA 3FXYA 3ARTA 2ZR5A 3RM4A 4URIA 4JFJA 2ZQUA 1ROUA 3RGCA 4HBEA 5HW6A 4MNMA 4MNKA 4HARA 3W4RA 2F4EA 4DRKA 1F40A 5DF0A 1W9UA 2KE0A 4ODMA 1E6NA 2AOSA 1HJWA 1L1PA 3KABA 2ZQVA 2IF4A 2L2SA 4Z2GA 2ITKA 4KR0B 1O6IA 3AROA 2ETNA 1J4RA 3UQBA 1TCOC 4O2TA 4U84A 1FKIA 3UI6A 1ZB5A 3LUOA 1WNOA 4P8WA 3NTPA 2Y78A 4LAYA 3O5IA 2DT1A 4GGQA 1X6NA 1PBKA 1EDQA 2ZR6A 2DSZA 1GUVA 2O9OA 2ZQSA 3KCEA 2XP5A 4L3NA 4G50A 2DT0A 2VCDA 2ZR4A 1OGBA 1YW5A 2A3EA 4AY1A 3ARWA 1E44A 2MLXA 2XP6A 1EYMA 3B9EA 4TNSA 5GQBA 4ITZA 3AQUA 3JYMA 1QPLA 4ODKA 3KAGA 3WD1A 3IKGA 4MTVA 1LL7A 4Z2HA 1RD6A 3ARUA 3BMBA 3JYJA 2VN1A 1JNSA 4TW7A 3PR9A 5DITA 4IQ2A 1ZCNA 4WKHA 4MNJA 2RUCA 5HBFA 2A3BA 4FN2A 3NRKA 5HW7A 3AS3A 4LGXA 2M2AA 1BKFA 1LG2A 1P5QA 1OGGA 1TFVA 3KAHA 4UDMA 4DRPA 4W5UA 3IHZA 4TW6A 5HWBA 5HUAA 3ALGA 3AS1A 2MLYA 2F21A 1NWSA 2G8ZA 2N87A 3H9RB 3OOBA 1XRVA 4WIWA 5J6EA 1J4HA 3KADA 5HWCA 2XPAA 1FKDA 5GPRA 4DT4A 4ZPVR 4U86A 1FFRA 3O5MA 4WKAA 5I98A 3O5LA 3O5DA 3G6MA 1K9TA 3O5FA 1NMWA 2LPVA 3WD0A 3CGNA 1NH6A 1W1VA 4ODRA 4DWSC 1D7HA 1W1YA 3WL1A 3KZ7A 2G41A 1M5YA 4C02B 2A3AA 3BXWA 4MAVA 3PRDA 2P4VA
chains in the Genus database with same CATH topology
5DO2A 1NWUA 2DG4A 4IPXA 1XHGA 3O5KA 4Q7NA 4JFMA 1FKGA 3KAIA 1ITXA 3AS2A 3TC5A 1E6PA 1Q6UA 4JFLA 1H0GA 1JNEA 1C9HA 1JVWA 5HKGA 3UI5A 2M1IA 4KQZA 3CHCA 2KGJA 4NNRA 5BXJA 1FKTA 2A3CA 2JZVA 3UF8A 4IT6A 2DT2A 1KT0A 4LAWA 4NSBA 4ODQA 1EIBA 1R9HA 3O5RA 1N1AA 3ARXA 2XP7A 1GPFA 5GPGA 2RSEA 1J6YA 2DPEA 2Q5AA 4TX0A 1B6CA 4DWSD 1FD9A 4J4NA 3VAWA 4WJXA 2D9FA 3PA7A 3TDBA 3B8SA 4FAPA 1LL6A 2LKNA 3ARQA 3WH0A 3O5GA 4W9QA 1FKLA 3CHFA 4NZCA 4ZS6A 3KACA 1Q6HA 1NSGA 2DT3A 3RMEA 1FKBA 3WQVA 4PTMA 4DRNA 4Z2LA 4DZ3A 1UR8A 1NWRA 1FKSA 3B9DA 3O5QA 2PPOA 3CH9A 2PPPA 3WKZA 4W9PA 1YATA 2YBUA 3I6CA 2DG9A 1GOIA 2OFNA 3PRBA 1FKFA 3EY6A 2XPBA 1FKHA 1X6LA 3ARSA 3CGMA 4JFIA 2DSWA 2WK2A 4Q22A 2QF8A 4MNLA 3O5EA 3CHEA 3RFWA 3ALFA 1E6RA 1LQ0A 1JNTA 2MLZA 1ZBKA 1W26A 1J4IA 1NMVA 2RUQA 2YBTA 1FKRA 4W9OA 4DIPA 4P8XA 1D7IA 2RQSA 1SR0A 3CHDA 1FFQA 1F8AB 3WD3A 1BL4A 3JXVA 4ODOA 3ODKA 4QT2A 4P8VA 2RUDA 4L72B 1W1PA 2XP3A 1Y0OA 2OLHA 3FAPA 2KO7A 2WLYA 1Q1CA 3WQWA 4IT4A 4DRMA 5HT1A 4G2PA 1U79A 2O92A 1E6ZA 2WM0A 4BF8A 4JYSA 3ARRA 2PV2A 5DIVA 4QZVB 2F2DA 2PBCA 1WAWA 4S3JA 4S3KA 1ZK6A 5HTGA 1KFWA 4DH0A 2FKEA 1LL4A 4Z2KA 3RM8A 3WIJA 1PINA 2IUZA 4ZPTR 1W1TA 2LJ4A 1SYTA 1H0IA 2RURA 4DZ2A 4WK9A 3FY1A 4TW8A 1LJYA 2MNTA 1OWQA 3O5PA 4DRJA 1A7XA 3WL0A 3ARYA 2WLZA 4MPKA 1UR9A 3CZ8A 3UQAA 1ROTA 4ML4A 5DEZA 2UZ5A 1ZL1A 2ZQTA 4IQCA 1D6OA 4JFKA 5HW8A 3OA5A 2KR7A 5B8IC 3IKDA 3GPKA 1HJVA 3B7XA 2PI6A 1D2KA 3TCZA 4MGVA 1FJDA 5JH8A 2PPNA 3WD2A 1VF8A 2XP8A 2PV1A 4TYOA 1FAPA 1QZ2A 2LGOA 4DWSB 3G6LA 3ARVA 2DG3A 2ESCA 1EQ3A 3UI4A 2AWGA 4DROA 4DRIA 3KAFA 3O5OA 1T11A 4WKFA 4U85A 4XAKA 2MPHA 2KI3A 1W9VA 4DRQA 1WB0A 2PV3A 4P8UA 4ODNA 1IX5A 4R5EA 2MF9A 4Z2JA 4MSPA 1EHNA 3RM9A 1JNDA 4ODPA 1ZU8A 1D7JA 2M08A 3UQIA 1W9PA 4Z2IA 1LG1A 4ODLA 1HXVA 1FKJA 3AS0A 1HKKA 2DSVA 2XP4A 4DWSA 3WD4A 3PRAA 1E15A 3NI6A 2XP9A 1ZBWA 2FAPA 3QOKA 1NWTA 4N19A 3B9AA 2K8IA 4GIVA 1CTNA 3IK8A 1HKMA 1HKJA 4DRHA 1HKIA 4HBOA 4J4OA 4LAXA 2KFWA 4ZPWR 1Q6IA 1QPFA 3O5JA 5D75A 3MDYB 1KT1A 4LAVA 1ZBCA 3ARPA 1FKKA 2DSUA 2FDMA 1E9LA 2B31A 4QT3A 4R0XA 5DIUA 3ARZA 1ZBVA 1HJXA 4QIBA 3FXYA 3ARTA 2ZR5A 3RM4A 4URIA 4JFJA 2ZQUA 1ROUA 3RGCA 4HBEA 5HW6A 4MNMA 4MNKA 4HARA 3W4RA 2F4EA 4DRKA 1F40A 5DF0A 1W9UA 2KE0A 4ODMA 1E6NA 2AOSA 1HJWA 1L1PA 3KABA 2ZQVA 2IF4A 2L2SA 4Z2GA 2ITKA 4KR0B 1O6IA 3AROA 1J4RA 3UQBA 1TCOC 4O2TA 4U84A 1FKIA 3UI6A 1ZB5A 3LUOA 1WNOA 4P8WA 3NTPA 2Y78A 4LAYA 3O5IA 2DT1A 4GGQA 1X6NA 1PBKA 1EDQA 2ZR6A 2DSZA 1GUVA 2O9OA 2ZQSA 3KCEA 2XP5A 4L3NA 4G50A 2DT0A 2VCDA 2ZR4A 1OGBA 1YW5A 2A3EA 4AY1A 3ARWA 2MLXA 2XP6A 1EYMA 3B9EA 4TNSA 5GQBA 4ITZA 3AQUA 3JYMA 1QPLA 4ODKA 3KAGA 3WD1A 3IKGA 4MTVA 1LL7A 4Z2HA 1RD6A 3ARUA 3JYJA 2VN1A 1JNSA 4TW7A 3PR9A 5DITA 4IQ2A 1ZCNA 4WKHA 4MNJA 2RUCA 5HBFA 2A3BA 4FN2A 3NRKA 5HW7A 3AS3A 4LGXA 2M2AA 1BKFA 1LG2A 1P5QA 1OGGA 1TFVA 3KAHA 4DRPA 4W5UA 3IHZA 4TW6A 5HWBA 5HUAA 3ALGA 3AS1A 2MLYA 2F21A 1NWSA 2G8ZA 2N87A 3H9RB 3OOBA 1XRVA 4WIWA 5J6EA 1J4HA 3KADA 5HWCA 2XPAA 1FKDA 5GPRA 4DT4A 4ZPVR 4U86A 1FFRA 3O5MA 4WKAA 5I98A 3O5LA 3O5DA 3G6MA 1K9TA 3O5FA 1NMWA 2LPVA 3WD0A 3CGNA 1NH6A 1W1VA 4ODRA 4DWSC 1D7HA 1W1YA 3WL1A 3KZ7A 2G41A 1M5YA 4C02B 2A3AA 3BXWA 4MAVA 3PRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQ3 A;  3UI4 A;  1JNT A;  2AWG A;  2DG4 A;  1PBK A;  2MLZ A;  1W26 A;  4IPX A;  4DRO A;  2ZR6 A;  4DRI A;  1J4I A;  1NMV A;  2RUQ A;  2ZQS A;  3KAF A;  3KCE A;  3O5O A;  2XP5 A;  1T11 A;  1FKG A;  3O5K A;  4JFM A;  4U85 A;  3KAI A;  4G50 A;  2VCD A;  2ZR4 A;  1FKR A;  4W9O A;  2MPH A;  2KI3 A;  4DIP A;  1YW5 A;  4DRQ A;  3TC5 A;  2PV3 A;  1D7I A;  4ODN A;  1Q6U A;  2MLX A;  4JFL A;  2MF9 A;  2RQS A;  2XP6 A;  1C9H A;  1EYM A;  1JVW A;  5HKG A;  4MSP A;  1F8A B;  4TNS A;  3UI5 A;  1BL4 A;  4ITZ A;  3JXV A;  4ODO A;  3JYM A;  4ODP A;  2M1I A;  1QPL A;  3ODK A;  4ODK A;  1D7J A;  4QT2 A;  4NNR A;  2KGJ A;  5BXJ A;  2RUD A;  1FKT A;  2M08 A;  3KAG A;  3IKG A;  2JZV A;  3UQI A;  3UF8 A;  1KT0 A;  2XP3 A;  4LAW A;  4ODQ A;  4ODL A;  1Y0O A;  1R9H A;  3O5R A;  3JYJ A;  1N1A A;  2VN1 A;  1JNS A;  4TW7 A;  1FKJ A;  5DIT A;  1HXV A;  3FAP A;  2KO7 A;  1ZCN A;  2XP7 A;  4IQ2 A;  1Q1C A;  2XP4 A;  4DRM A;  5HT1 A;  5GPG A;  4G2P A;  1U79 A;  2RSE A;  3NI6 A;  1J6Y A;  2RUC A;  2XP9 A;  2FAP A;  2Q5A A;  4TX0 A;  4N19 A;  4BF8 A;  1B6C A;  4JYS A;  1FD9 A;  2PV2 A;  5DIV A;  4FN2 A;  3NRK A;  2K8I A;  2F2D A;  2PBC A;  4GIV A;  4J4N A;  5HW7 A;  3VAW A;  3RFW A;  1ZK6 A;  3IK8 A;  5HTG A;  2M2A A;  4DH0 A;  4DRH A;  4J4O A;  1BKF A;  2FKE A;  4LAX A;  2D9F A;  2KFW A;  1Q6I A;  3PA7 A;  1QPF A;  3TDB A;  1P5Q A;  4FAP A;  3O5J A;  2LKN A;  1PIN A;  5D75 A;  3WH0 A;  3KAH A;  1KT1 A;  3MDY B;  3O5G A;  4LAV A;  2LJ4 A;  4W9Q A;  4DRP A;  1FKK A;  2RUR A;  4DZ2 A;  3IHZ A;  4TW6 A;  5HWB A;  4TW8 A;  1FKL A;  1L1P A;  4QT3 A;  4R0X A;  5DIU A;  5HUA A;  2MNT A;  3KAC A;  1Q6H A;  2MLY A;  3O5P A;  4QIB A;  4DRJ A;  1A7X A;  2F21 A;  3H9R B;  2N87 A;  3OOB A;  1NSG A;  2ZR5 A;  5J6E A;  4JFJ A;  2ZQU A;  1ROU A;  3UQA A;  1FKB A;  3RGC A;  1ROT A;  1J4H A;  3KAD A;  5HW6 A;  5HWC A;  2XPA A;  2UZ5 A;  1FKD A;  4DRK A;  4DRN A;  2F4E A;  1F40 A;  2ZQT A;  4IQC A;  4DZ3 A;  4DT4 A;  1D6O A;  2KE0 A;  4JFK A;  4ODM A;  4U86 A;  1FKS A;  3O5M A;  3O5Q A;  2PPO A;  5HW8 A;  2KR7 A;  5B8I C;  3IKD A;  3GPK A;  5I98 A;  2PPP A;  3B7X A;  3KAB A;  4W9P A;  2ZQV A;  1YAT A;  2IF4 A;  2L2S A;  3O5L A;  3O5D A;  2ITK A;  3I6C A;  3O5F A;  1NMW A;  3TCZ A;  2LPV A;  2DG9 A;  4MGV A;  1J4R A;  3UQB A;  1FJD A;  1TCO C;  3CGN A;  4O2T A;  2OFN A;  4ODR A;  2PPN A;  3PRB A;  4U84 A;  1FKF A;  1D7H A;  2XPB A;  3EY6 A;  1FKH A;  2XP8 A;  3KZ7 A;  2PV1 A;  3O5I A;  1FAP A;  4TYO A;  1QZ2 A;  1FKI A;  1M5Y A;  4C02 B;  3UI6 A;  3CGM A;  3LUO A;  2LGO A;  4JFI A;  3NTP A;  2Y78 A;  3PRD A;  3O5E A;  4LAY A;  2DG3 A;  4GGQ A; 
#chains in the Genus database with same CATH topology
 5DO2 A;  2PN0 A;  1NWU A;  2DG4 A;  4IPX A;  1XHG A;  3O5K A;  4Q7N A;  4JFM A;  1FKG A;  3KAI A;  1ITX A;  3AS2 A;  3TC5 A;  1E6P A;  1Q6U A;  4JFL A;  1H0G A;  1JNE A;  1C9H A;  1JVW A;  5HKG A;  3UI5 A;  2M1I A;  4KQZ A;  3CHC A;  2KGJ A;  4NNR A;  5BXJ A;  1FKT A;  2A3C A;  2JZV A;  3UF8 A;  4IT6 A;  2DT2 A;  1KT0 A;  4LAW A;  4NSB A;  4ODQ A;  1EIB A;  1R9H A;  3O5R A;  1N1A A;  3ARX A;  2XP7 A;  1GPF A;  5GPG A;  2RSE A;  1J6Y A;  2DPE A;  2Q5A A;  4TX0 A;  1B6C A;  4DWS D;  1FD9 A;  4J4N A;  3VAW A;  4WJX A;  2D9F A;  3PA7 A;  3TDB A;  3B8S A;  4FAP A;  1LL6 A;  2LKN A;  3ARQ A;  3WH0 A;  3O5G A;  4W9Q A;  1FKL A;  3CHF A;  4NZC A;  4ZS6 A;  3KAC A;  1Q6H A;  1NSG A;  2DT3 A;  3GTY X;  3RME A;  1FKB A;  3WQV A;  4PTM A;  4DRN A;  4Z2L A;  4DZ3 A;  3EIP A;  1UR8 A;  1NWR A;  1FKS A;  3B9D A;  3O5Q A;  2PPO A;  3CH9 A;  2PPP A;  3WKZ A;  4W9P A;  1YAT A;  2YBU A;  3I6C A;  2DG9 A;  1GOI A;  2OFN A;  3PRB A;  1FKF A;  3EY6 A;  2XPB A;  1FKH A;  1X6L A;  3ARS A;  3CGM A;  4JFI A;  2DSW A;  2WK2 A;  4Q22 A;  2QF8 A;  4MNL A;  3O5E A;  3CHE A;  3RFW A;  3ALF A;  1E6R A;  1LQ0 A;  1JNT A;  2EUL A;  2MLZ A;  1ZBK A;  1W26 A;  1J4I A;  1NMV A;  2RUQ A;  2YBT A;  1FKR A;  4W9O A;  4DIP A;  4P8X A;  1D7I A;  2RQS A;  1SR0 A;  3CHD A;  1FFQ A;  1F8A B;  3WD3 A;  1BL4 A;  3JXV A;  4ODO A;  3ODK A;  4QT2 A;  4P8V A;  2RUD A;  4L72 B;  1W1P A;  2XP3 A;  1Y0O A;  2OLH A;  3FAP A;  2KO7 A;  2WLY A;  1Q1C A;  3WQW A;  4IT4 A;  4DRM A;  5HT1 A;  4G2P A;  1U79 A;  2O92 A;  2B5U B;  1E6Z A;  2WM0 A;  4BF8 A;  4JYS A;  3ARR A;  2PV2 A;  5DIV A;  4QZV B;  2F2D A;  2PBC A;  1WAW A;  4S3J A;  4S3K A;  1ZK6 A;  5HTG A;  1KFW A;  4DH0 A;  2FKE A;  1LL4 A;  4Z2K A;  3RM8 A;  3WIJ A;  1PIN A;  2IUZ A;  4ZPT R;  1W1T A;  2LJ4 A;  1SYT A;  1H0I A;  2RUR A;  4DZ2 A;  4WK9 A;  3FY1 A;  4TW8 A;  1LJY A;  1JCH B;  2MNT A;  1OWQ A;  3O5P A;  4DRJ A;  1A7X A;  3WL0 A;  3ARY A;  2WLZ A;  4MPK A;  1UR9 A;  1GRJ A;  3CZ8 A;  3UQA A;  1ROT A;  3GU0 A;  4ML4 A;  5DEZ A;  2UZ5 A;  1ZL1 A;  2ZQT A;  4IQC A;  1D6O A;  4JFK A;  5HW8 A;  3OA5 A;  2KR7 A;  5B8I C;  3IKD A;  3GPK A;  1HJV A;  3B7X A;  2PI6 A;  1D2K A;  3TCZ A;  4MGV A;  1FJD A;  5JH8 A;  2PPN A;  3WD2 A;  1VF8 A;  2XP8 A;  2PV1 A;  4TYO A;  1FAP A;  1QZ2 A;  2LGO A;  4DWS B;  2F23 A;  3G6L A;  3ARV A;  2DG3 A;  2ESC A;  1EQ3 A;  3UI4 A;  2AWG A;  4DRO A;  4DRI A;  3KAF A;  3O5O A;  1T11 A;  4WKF A;  4U85 A;  4XAK A;  2MPH A;  2KI3 A;  1W9V A;  4DRQ A;  1WB0 A;  2PV3 A;  4P8U A;  4ODN A;  1IX5 A;  4R5E A;  2MF9 A;  4Z2J A;  4MSP A;  1EHN A;  3RM9 A;  1JND A;  4ODP A;  1ZU8 A;  1D7J A;  2M08 A;  3UQI A;  1W9P A;  4Z2I A;  1LG1 A;  4ODL A;  1HXV A;  1FKJ A;  3AS0 A;  1HKK A;  2DSV A;  2XP4 A;  4DWS A;  3WD4 A;  3PRA A;  1E15 A;  3NI6 A;  2XP9 A;  1ZBW A;  2FAP A;  3QOK A;  1NWT A;  4N19 A;  3B9A A;  2K8I A;  4GIV A;  1CTN A;  3IK8 A;  1HKM A;  1HKJ A;  4DRH A;  1HKI A;  4HBO A;  4J4O A;  4LAX A;  2KFW A;  4ZPW R;  1Q6I A;  1QPF A;  3O5J A;  5D75 A;  3MDY B;  1KT1 A;  4LAV A;  1ZBC A;  3ARP A;  1FKK A;  2DSU A;  2FDM A;  1E9L A;  2B31 A;  4QT3 A;  4R0X A;  5DIU A;  3ARZ A;  1ZBV A;  1HJX A;  4QIB A;  3FXY A;  3ART A;  2ZR5 A;  3RM4 A;  4URI A;  4JFJ A;  2ZQU A;  1ROU A;  3RGC A;  4HBE A;  5HW6 A;  4MNM A;  4MNK A;  4HAR A;  3W4R A;  2F4E A;  4DRK A;  1F40 A;  5DF0 A;  1W9U A;  2KE0 A;  4ODM A;  1E6N A;  2AOS A;  1HJW A;  1L1P A;  3KAB A;  2ZQV A;  2IF4 A;  2L2S A;  4Z2G A;  2ITK A;  4KR0 B;  1O6I A;  3ARO A;  2ETN A;  1J4R A;  3UQB A;  1TCO C;  4O2T A;  4U84 A;  1FKI A;  3UI6 A;  1ZB5 A;  3LUO A;  1WNO A;  4P8W A;  3NTP A;  2Y78 A;  4LAY A;  3O5I A;  2DT1 A;  4GGQ A;  1X6N A;  1PBK A;  1EDQ A;  2ZR6 A;  2DSZ A;  1GUV A;  2O9O A;  2ZQS A;  3KCE A;  2XP5 A;  4L3N A;  4G50 A;  2DT0 A;  2VCD A;  2ZR4 A;  1OGB A;  1YW5 A;  2A3E A;  4AY1 A;  3ARW A;  1E44 A;  2MLX A;  2XP6 A;  1EYM A;  3B9E A;  4TNS A;  5GQB A;  4ITZ A;  3AQU A;  3JYM A;  1QPL A;  4ODK A;  3KAG A;  3WD1 A;  3IKG A;  4MTV A;  1LL7 A;  4Z2H A;  1RD6 A;  3ARU A;  3BMB A;  3JYJ A;  2VN1 A;  1JNS A;  4TW7 A;  3PR9 A;  5DIT A;  4IQ2 A;  1ZCN A;  4WKH A;  4MNJ A;  2RUC A;  5HBF A;  2A3B A;  4FN2 A;  3NRK A;  5HW7 A;  3AS3 A;  4LGX A;  2M2A A;  1BKF A;  1LG2 A;  1P5Q A;  1OGG A;  1TFV A;  3KAH A;  4UDM A;  4DRP A;  4W5U A;  3IHZ A;  4TW6 A;  5HWB A;  5HUA A;  3ALG A;  3AS1 A;  2MLY A;  2F21 A;  1NWS A;  2G8Z A;  2N87 A;  3H9R B;  3OOB A;  1XRV A;  4WIW A;  5J6E A;  1J4H A;  3KAD A;  5HWC A;  2XPA A;  1FKD A;  5GPR A;  4DT4 A;  4ZPV R;  4U86 A;  1FFR A;  3O5M A;  4WKA A;  5I98 A;  3O5L A;  3O5D A;  3G6M A;  1K9T A;  3O5F A;  1NMW A;  2LPV A;  3WD0 A;  3CGN A;  1NH6 A;  1W1V A;  4ODR A;  4DWS C;  1D7H A;  1W1Y A;  3WL1 A;  3KZ7 A;  2G41 A;  1M5Y A;  4C02 B;  2A3A A;  3BXW A;  4MAV A;  3PRD A;  2P4V A; 
#chains in the Genus database with same CATH homology
 5DO2 A;  1NWU A;  2DG4 A;  4IPX A;  1XHG A;  3O5K A;  4Q7N A;  4JFM A;  1FKG A;  3KAI A;  1ITX A;  3AS2 A;  3TC5 A;  1E6P A;  1Q6U A;  4JFL A;  1H0G A;  1JNE A;  1C9H A;  1JVW A;  5HKG A;  3UI5 A;  2M1I A;  4KQZ A;  3CHC A;  2KGJ A;  4NNR A;  5BXJ A;  1FKT A;  2A3C A;  2JZV A;  3UF8 A;  4IT6 A;  2DT2 A;  1KT0 A;  4LAW A;  4NSB A;  4ODQ A;  1EIB A;  1R9H A;  3O5R A;  1N1A A;  3ARX A;  2XP7 A;  1GPF A;  5GPG A;  2RSE A;  1J6Y A;  2DPE A;  2Q5A A;  4TX0 A;  1B6C A;  4DWS D;  1FD9 A;  4J4N A;  3VAW A;  4WJX A;  2D9F A;  3PA7 A;  3TDB A;  3B8S A;  4FAP A;  1LL6 A;  2LKN A;  3ARQ A;  3WH0 A;  3O5G A;  4W9Q A;  1FKL A;  3CHF A;  4NZC A;  4ZS6 A;  3KAC A;  1Q6H A;  1NSG A;  2DT3 A;  3RME A;  1FKB A;  3WQV A;  4PTM A;  4DRN A;  4Z2L A;  4DZ3 A;  1UR8 A;  1NWR A;  1FKS A;  3B9D A;  3O5Q A;  2PPO A;  3CH9 A;  2PPP A;  3WKZ A;  4W9P A;  1YAT A;  2YBU A;  3I6C A;  2DG9 A;  1GOI A;  2OFN A;  3PRB A;  1FKF A;  3EY6 A;  2XPB A;  1FKH A;  1X6L A;  3ARS A;  3CGM A;  4JFI A;  2DSW A;  2WK2 A;  4Q22 A;  2QF8 A;  4MNL A;  3O5E A;  3CHE A;  3RFW A;  3ALF A;  1E6R A;  1LQ0 A;  1JNT A;  2MLZ A;  1ZBK A;  1W26 A;  1J4I A;  1NMV A;  2RUQ A;  2YBT A;  1FKR A;  4W9O A;  4DIP A;  4P8X A;  1D7I A;  2RQS A;  1SR0 A;  3CHD A;  1FFQ A;  1F8A B;  3WD3 A;  1BL4 A;  3JXV A;  4ODO A;  3ODK A;  4QT2 A;  4P8V A;  2RUD A;  4L72 B;  1W1P A;  2XP3 A;  1Y0O A;  2OLH A;  3FAP A;  2KO7 A;  2WLY A;  1Q1C A;  3WQW A;  4IT4 A;  4DRM A;  5HT1 A;  4G2P A;  1U79 A;  2O92 A;  1E6Z A;  2WM0 A;  4BF8 A;  4JYS A;  3ARR A;  2PV2 A;  5DIV A;  4QZV B;  2F2D A;  2PBC A;  1WAW A;  4S3J A;  4S3K A;  1ZK6 A;  5HTG A;  1KFW A;  4DH0 A;  2FKE A;  1LL4 A;  4Z2K A;  3RM8 A;  3WIJ A;  1PIN A;  2IUZ A;  4ZPT R;  1W1T A;  2LJ4 A;  1SYT A;  1H0I A;  2RUR A;  4DZ2 A;  4WK9 A;  3FY1 A;  4TW8 A;  1LJY A;  2MNT A;  1OWQ A;  3O5P A;  4DRJ A;  1A7X A;  3WL0 A;  3ARY A;  2WLZ A;  4MPK A;  1UR9 A;  3CZ8 A;  3UQA A;  1ROT A;  4ML4 A;  5DEZ A;  2UZ5 A;  1ZL1 A;  2ZQT A;  4IQC A;  1D6O A;  4JFK A;  5HW8 A;  3OA5 A;  2KR7 A;  5B8I C;  3IKD A;  3GPK A;  1HJV A;  3B7X A;  2PI6 A;  1D2K A;  3TCZ A;  4MGV A;  1FJD A;  5JH8 A;  2PPN A;  3WD2 A;  1VF8 A;  2XP8 A;  2PV1 A;  4TYO A;  1FAP A;  1QZ2 A;  2LGO A;  4DWS B;  3G6L A;  3ARV A;  2DG3 A;  2ESC A;  1EQ3 A;  3UI4 A;  2AWG A;  4DRO A;  4DRI A;  3KAF A;  3O5O A;  1T11 A;  4WKF A;  4U85 A;  4XAK A;  2MPH A;  2KI3 A;  1W9V A;  4DRQ A;  1WB0 A;  2PV3 A;  4P8U A;  4ODN A;  1IX5 A;  4R5E A;  2MF9 A;  4Z2J A;  4MSP A;  1EHN A;  3RM9 A;  1JND A;  4ODP A;  1ZU8 A;  1D7J A;  2M08 A;  3UQI A;  1W9P A;  4Z2I A;  1LG1 A;  4ODL A;  1HXV A;  1FKJ A;  3AS0 A;  1HKK A;  2DSV A;  2XP4 A;  4DWS A;  3WD4 A;  3PRA A;  1E15 A;  3NI6 A;  2XP9 A;  1ZBW A;  2FAP A;  3QOK A;  1NWT A;  4N19 A;  3B9A A;  2K8I A;  4GIV A;  1CTN A;  3IK8 A;  1HKM A;  1HKJ A;  4DRH A;  1HKI A;  4HBO A;  4J4O A;  4LAX A;  2KFW A;  4ZPW R;  1Q6I A;  1QPF A;  3O5J A;  5D75 A;  3MDY B;  1KT1 A;  4LAV A;  1ZBC A;  3ARP A;  1FKK A;  2DSU A;  2FDM A;  1E9L A;  2B31 A;  4QT3 A;  4R0X A;  5DIU A;  3ARZ A;  1ZBV A;  1HJX A;  4QIB A;  3FXY A;  3ART A;  2ZR5 A;  3RM4 A;  4URI A;  4JFJ A;  2ZQU A;  1ROU A;  3RGC A;  4HBE A;  5HW6 A;  4MNM A;  4MNK A;  4HAR A;  3W4R A;  2F4E A;  4DRK A;  1F40 A;  5DF0 A;  1W9U A;  2KE0 A;  4ODM A;  1E6N A;  2AOS A;  1HJW A;  1L1P A;  3KAB A;  2ZQV A;  2IF4 A;  2L2S A;  4Z2G A;  2ITK A;  4KR0 B;  1O6I A;  3ARO A;  1J4R A;  3UQB A;  1TCO C;  4O2T A;  4U84 A;  1FKI A;  3UI6 A;  1ZB5 A;  3LUO A;  1WNO A;  4P8W A;  3NTP A;  2Y78 A;  4LAY A;  3O5I A;  2DT1 A;  4GGQ A;  1X6N A;  1PBK A;  1EDQ A;  2ZR6 A;  2DSZ A;  1GUV A;  2O9O A;  2ZQS A;  3KCE A;  2XP5 A;  4L3N A;  4G50 A;  2DT0 A;  2VCD A;  2ZR4 A;  1OGB A;  1YW5 A;  2A3E A;  4AY1 A;  3ARW A;  2MLX A;  2XP6 A;  1EYM A;  3B9E A;  4TNS A;  5GQB A;  4ITZ A;  3AQU A;  3JYM A;  1QPL A;  4ODK A;  3KAG A;  3WD1 A;  3IKG A;  4MTV A;  1LL7 A;  4Z2H A;  1RD6 A;  3ARU A;  3JYJ A;  2VN1 A;  1JNS A;  4TW7 A;  3PR9 A;  5DIT A;  4IQ2 A;  1ZCN A;  4WKH A;  4MNJ A;  2RUC A;  5HBF A;  2A3B A;  4FN2 A;  3NRK A;  5HW7 A;  3AS3 A;  4LGX A;  2M2A A;  1BKF A;  1LG2 A;  1P5Q A;  1OGG A;  1TFV A;  3KAH A;  4DRP A;  4W5U A;  3IHZ A;  4TW6 A;  5HWB A;  5HUA A;  3ALG A;  3AS1 A;  2MLY A;  2F21 A;  1NWS A;  2G8Z A;  2N87 A;  3H9R B;  3OOB A;  1XRV A;  4WIW A;  5J6E A;  1J4H A;  3KAD A;  5HWC A;  2XPA A;  1FKD A;  5GPR A;  4DT4 A;  4ZPV R;  4U86 A;  1FFR A;  3O5M A;  4WKA A;  5I98 A;  3O5L A;  3O5D A;  3G6M A;  1K9T A;  3O5F A;  1NMW A;  2LPV A;  3WD0 A;  3CGN A;  1NH6 A;  1W1V A;  4ODR A;  4DWS C;  1D7H A;  1W1Y A;  3WL1 A;  3KZ7 A;  2G41 A;  1M5Y A;  4C02 B;  2A3A A;  3BXW A;  4MAV A;  3PRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...