1FKSA

Solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 AND RAPAMYCIN-BINDING PROTEIN
publication title Solution structure of FKBP, a rotamase enzyme and receptor for FK506 and rapamycin.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
total genus 12
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fksA00
3UI4A 1FKTA 2MLXA 1TCOC 1FKSA 4QIBA 3UQIA 4LAYA 2XPBA 4MSPA 4ODQA 4MGVA 4DRIA 1FKHA 2OFNA 4ODKA 4DRHA 1FAPA 2KR7A 5HKGA 1NSGA 2Q5AA 5D75A 3KAHA 1QPLA 3NTPA 3ODKA 3UQBA 1ROTA 2MLYA 3UI5A 1C9HA 4TX0A 4DRQA 4GGQA 3RGCA 3KAFA 3KAGA 2M1IA 4DZ2A 4ODNA 1ZK6A 3LUOA 3MDYB 5GPGA 4TNSA 3IKGA 3NRKA 1FKJA 4DRNA 3KADA 4JFKA 2RUCA 1FKIA 5BXJA 5J6EA 3PA7A 5HW8A 4JFMA 4DRMA 2ZQVA 4DIPA 4BF8A 2XPAA 3NI6A 4G2PA 2PBCA 2IF4A 4LAXA 2ZQTA 4QT2A 4FAPA 2XP7A 2XP3A 2XP5A 2FAPA 3CGNA 2ZQUA 2ZR5A 3PRDA 5B8IC 3O5KA 3IHZA 4J4NA 5HT1A 1NMVA 1J6YA 2PPOA 1F8AB 2XP4A 2D9FA 2JZVA 3O5DA 4N19A 4W9QA 4DT4A 3O5IA 4NNRA 1JNSA 4QT3A 4ODOA 4U86A 2ZR4A 5HUAA 2LKNA 3PRBA 1D7HA 2MNTA 4IQ2A 2K8IA 4DROA 3O5RA 4DRJA 2DG3A 2LPVA 4DH0A 5HTGA 1A7XA 1L1PA 2MLZA 1Q6UA 1FKBA 2DG4A 3FAPA 4DRKA 1FJDA 3O5OA 1KT1A 4LAVA 4ODMA 1F40A 2ZQSA 2PV1A 1D6OA 2FKEA 2KO7A 1QZ2A 1B6CA 1Q6IA 4LAWA 1Q6HA 4DRPA 1YATA 4TW8A 2LJ4A 2N87A 1EQ3A 2DG9A 3UF8A 2RQSA 1PBKA 4C02B 3EY6A 1BKFA 5DITA 1U79A 4GIVA 2KE0A 4IQCA 1HXVA 3TDBA 3VAWA 1M5YA 1KT0A 3TCZA 4ODPA 3WH0A 2XP8A 3KABA 2ZR6A 2RUDA 4IPXA 3GPKA 3O5FA 4ODLA 4TYOA 3IKDA 2KFWA 5I98A 3KACA 3OOBA 2M2AA 2L2SA 3KCEA 3JXVA 1PINA 4ITZA 4JFJA 1J4IA 1FKRA 2LGOA 4TW6A 4JFLA 2ITKA 2F21A 2PPNA 1FKDA 3TC5A 1Q1CA 3JYJA 5HW6A 3O5GA 2Y78A 4JYSA 4W9OA 5DIUA 2VCDA 2XP6A 1J4HA 1ZCNA 2AWGA 1BL4A 1N1AA 1D7JA 2MPHA 4O2TA 2M08A 2PV2A 1T11A 1JNTA 1QPFA 1FKFA 2F2DA 2KI3A 2F4EA 2PPPA 2VN1A 3H9RB 4DZ3A 1ROUA 1FD9A 4U84A 3UQAA 2KGJA 1EYMA 1FKGA 4R0XA 1Y0OA 4FN2A 3O5MA 2MF9A 1YW5A 3KAIA 3IK8A 5HW7A 4W9PA 3O5EA 4ODRA 4U85A 3I6CA 1NMWA 1D7IA 2RSEA 2RURA 3B7XA 1W26A 3CGMA 3KZ7A 5DIVA 2RUQA 1JVWA 4G50A 4TW7A 5HWBA 3O5JA 2UZ5A 2PV3A 1J4RA 1P5QA 3O5PA 3O5QA 1R9HA 4JFIA 3RFWA 2XP9A 3UI6A 5HWCA 1FKKA 4J4OA 1FKLA 3O5LA 3JYMA
chains in the Genus database with same CATH superfamily
1TCOC 3ARTA 4LAYA 4MSPA 4ODQA 2OFNA 4ODKA 5DO2A 1FAPA 1NSGA 1XRVA 3CZ8A 3UQBA 1ROTA 2MLYA 3UI5A 1C9HA 4DRQA 4Z2GA 1X6LA 1EHNA 4DZ2A 2WM0A 1HJVA 4TNSA 4DRNA 3KADA 3PR9A 4JFKA 2RUCA 3B9EA 3RM4A 4ZPTR 4R5EA 3FY1A 3PA7A 3WQVA 3ARWA 1GOIA 5GPRA 2YBUA 3CGNA 3B9DA 3PRDA 5HBFA 4L3NA 5B8IC 3AROA 1J6YA 2PPOA 2JZVA 4NNRA 3BMBA 4QT3A 2ZR4A 2LKNA 1D7HA 1LJYA 2K8IA 1FKBA 1Q6IA 2PN0A 1LL4A 3UF8A 1PBKA 5DITA 4ZPVR 4GIVA 4IQCA 3CHDA 3WD3A 3TCZA 1UR9A 1GRJA 2ZR6A 3ARYA 1NWSA 2DT2A 4TYOA 3QOKA 4DWSA 2L2SA 3KCEA 2A3AA 3JXVA 4ITZA 4JFJA 1J4IA 1FKRA 2LGOA 3G6LA 2PPNA 1GPFA 2P4VA 3ARXA 1J4HA 2AWGA 3ARRA 1BL4A 4O2TA 4L72B 3AQUA 2PV2A 3H9RB 2DT0A 4U84A 1EYMA 1K9TA 4UDMA 1Y0OA 4FN2A 3O5MA 3KAIA 3ARVA 3IK8A 1HJWA 1NMWA 3B7XA 1JNEA 3CGMA 1WNOA 5DIVA 4XAKA 1FFQA 3WIJA 2B5UB 4Q22A 3RM9A 4Q7NA 4JFIA 3UI6A 2XP9A 5HWCA 3O5LA 3JYMA 1FKTA 4QIBA 1FKHA 5HKGA 2Q5AA 5D75A 1QPLA 2B31A 1E9LA 4HBOA 2M1IA 4KQZA 3IKGA 1WAWA 2G8ZA 4ZPWR 5BXJA 1ZBCA 3WL0A 4DRMA 2ZQVA 4DIPA 2XPAA 4QT2A 2DSUA 3BXWA 2WLYA 2ZQUA 3O5KA 4J4NA 5HT1A 1NMVA 2D9FA 4W9QA 1OGGA 4ODOA 5HUAA 4IQ2A 1SR0A 2DG3A 4MPKA 1L1PA 5HTGA 2MLZA 2IUZA 4MAVA 3O5OA 4LAVA 4IT6A 1W9VA 2DSVA 3W4RA 1QZ2A 1Q6HA 5GQBA 3ARQA 4MNMA 2RQSA 2DSWA 2O9OA 4C02B 2DSZA 1KFWA 3CHCA 1U79A 4HBEA 3ARPA 4PTMA 3TDBA 1EIBA 4ODPA 4WIWA 4IPXA 1ZBVA 3IKDA 4P8WA 5I98A 3ARUA 2M2AA 1UR8A 3EIPA 4JFLA 2ITKA 3GTYX 1NWUA 1OGBA 5DIUA 4P8UA 1N1AA 3ALFA 1ZL1A 1E6NA 1T11A 2KI3A 2PPPA 1FKFA 4DZ3A 2KGJA 1NH6A 4R0XA 1FFRA 1CTNA 4W9PA 4U85A 2DT1A 1NWRA 1W26A 1JVWA 1JCHB 2YBTA 3O5JA 1E6PA 2UZ5A 2ETNA 4WJXA 1P5QA 3O5PA 4J4OA 1FKLA 3UI4A 4WKHA 1FKSA 3UQIA 1XHGA 4MTVA 4DRIA 4ZS6A 3WQWA 1GUVA 1W1YA 3KAHA 4AY1A 4Z2KA 4DWSC 4GGQA 4S3JA 3RGCA 3KAFA 4ODNA 1ZK6A 5GPGA 3NRKA 1FKJA 4MNLA 5J6EA 5HW8A 4JFMA 1W9UA 3ARZA 4BF8A 1RD6A 4G2PA 3GU0A 2ZQTA 1HJXA 2XP7A 2XP5A 2FAPA 3RMEA 2ZR5A 4LGXA 3IHZA 4Z2IA 1F8AB 3AS1A 2OLHA 2A3BA 3O5DA 1E6RA 3O5IA 4DWSD 1LL7A 3PRBA 2MNTA 2A3EA 4DRJA 4DH0A 2DG4A 3FAPA 1ZBWA 4DRKA 3B9AA 1NWTA 1FJDA 4ODMA 1KT1A 2F23A 3WKZA 1F40A 2PV1A 2FKEA 4P8XA 1B6CA 4LAWA 3FXYA 1EQ3A 3EY6A 3CHFA 1BKFA 2ESCA 1E44A 2KE0A 1HXVA 1M5YA 4KR0B 2A3CA 1EDQA 3WH0A 2WLZA 2DT3A 2RUDA 4WKAA 3GPKA 3O5FA 5DEZA 3KACA 4IT4A 1IX5A 4TW6A 4MNKA 4MNJA 2F21A 3RM8A 1FKDA 1LQ0A 1Q1CA 4W9OA 4JYSA 1HKJA 2VCDA 2XP6A 1D7JA 3B8SA 2M08A 1ROUA 1FD9A 4NZCA 3UQAA 1FKGA 2G41A 5HW7A 3PRAA 3AS2A 3O5EA 4Z2JA 1D7IA 2RSEA 4Z2LA 2AOSA 5HWBA 1J4RA 3RFWA 1D2KA 3O5QA 3WD1A 2MLXA 1X6NA 2EULA 2XPBA 4MGVA 4DRHA 2KR7A 2PI6A 3NTPA 3ODKA 4TX0A 3ALGA 1ZB5A 3KAGA 1HKMA 4QZVB 3LUOA 3MDYB 4Z2HA 3AS0A 2DPEA 1ITXA 3CH9A 1FKIA 2FDMA 1TFVA 3NI6A 2PBCA 2IF4A 4LAXA 4FAPA 2XP3A 2XP4A 4N19A 4DT4A 1LL6A 1H0IA 1JNSA 4U86A 1HKKA 1O6IA 4DROA 3O5RA 1VF8A 1OWQA 2LPVA 1A7XA 1Q6UA 3WD2A 3CHEA 1W1VA 1ZBKA 2ZQSA 1ZU8A 1D6OA 1WB0A 2O92A 2KO7A 4DRPA 1E15A 3AS3A 5DF0A 1YATA 4TW8A 3WD4A 2LJ4A 2N87A 1HKIA 2DG9A 1W1PA 3VAWA 1KT0A 4S3KA 4NSBA 2XP8A 3KABA 1W1TA 1LG2A 4ML4A 4ODLA 2KFWA 3OA5A 1SYTA 3OOBA 4DWSB 1PINA 4URIA 3TC5A 3JYJA 5HW6A 3O5GA 2Y78A 4W5UA 1ZCNA 2WK2A 5JH8A 2MPHA 3G6MA 4P8VA 4WK9A 2F2DA 1JNTA 1QPFA 2VN1A 2F4EA 1E6ZA 1W9PA 4WKFA 2MF9A 1YW5A 4ODRA 3I6CA 1LG1A 1H0GA 2RURA 1JNDA 3WL1A 3WD0A 3KZ7A 2RUQA 4G50A 4TW7A 2QF8A 3ARSA 2PV3A 4HARA 1R9HA 1FKKA
chains in the Genus database with same CATH topology
1TCOC 3ARTA 4LAYA 4MSPA 4ODQA 2OFNA 4ODKA 5DO2A 1FAPA 1NSGA 1XRVA 3CZ8A 3UQBA 1ROTA 2MLYA 3UI5A 1C9HA 4DRQA 4Z2GA 1X6LA 1EHNA 4DZ2A 2WM0A 1HJVA 4TNSA 4DRNA 3KADA 3PR9A 4JFKA 2RUCA 3B9EA 3RM4A 4ZPTR 4R5EA 3FY1A 3PA7A 3WQVA 3ARWA 1GOIA 5GPRA 2YBUA 3CGNA 3B9DA 3PRDA 5HBFA 4L3NA 5B8IC 3AROA 1J6YA 2PPOA 2JZVA 4NNRA 4QT3A 2ZR4A 2LKNA 1D7HA 1LJYA 2K8IA 1FKBA 1Q6IA 1LL4A 3UF8A 1PBKA 5DITA 4ZPVR 4GIVA 4IQCA 3CHDA 3WD3A 3TCZA 1UR9A 2ZR6A 3ARYA 1NWSA 2DT2A 4TYOA 3QOKA 4DWSA 2L2SA 3KCEA 2A3AA 3JXVA 4ITZA 4JFJA 1J4IA 1FKRA 2LGOA 3G6LA 2PPNA 1GPFA 3ARXA 1J4HA 2AWGA 3ARRA 1BL4A 4O2TA 4L72B 3AQUA 2PV2A 3H9RB 2DT0A 4U84A 1EYMA 1K9TA 1Y0OA 4FN2A 3O5MA 3KAIA 3ARVA 3IK8A 1HJWA 1NMWA 3B7XA 1JNEA 3CGMA 1WNOA 5DIVA 4XAKA 1FFQA 3WIJA 4Q22A 3RM9A 4Q7NA 4JFIA 3UI6A 2XP9A 5HWCA 3O5LA 3JYMA 1FKTA 4QIBA 1FKHA 5HKGA 2Q5AA 5D75A 1QPLA 2B31A 1E9LA 4HBOA 2M1IA 4KQZA 3IKGA 1WAWA 2G8ZA 4ZPWR 5BXJA 1ZBCA 3WL0A 4DRMA 2ZQVA 4DIPA 2XPAA 4QT2A 2DSUA 3BXWA 2WLYA 2ZQUA 3O5KA 4J4NA 5HT1A 1NMVA 2D9FA 4W9QA 1OGGA 4ODOA 5HUAA 4IQ2A 1SR0A 2DG3A 4MPKA 1L1PA 5HTGA 2MLZA 2IUZA 4MAVA 3O5OA 4LAVA 4IT6A 1W9VA 2DSVA 3W4RA 1QZ2A 1Q6HA 5GQBA 3ARQA 4MNMA 2RQSA 2DSWA 2O9OA 4C02B 2DSZA 1KFWA 3CHCA 1U79A 4HBEA 3ARPA 4PTMA 3TDBA 1EIBA 4ODPA 4WIWA 4IPXA 1ZBVA 3IKDA 4P8WA 5I98A 3ARUA 2M2AA 1UR8A 4JFLA 2ITKA 1NWUA 1OGBA 5DIUA 4P8UA 1N1AA 3ALFA 1ZL1A 1E6NA 1T11A 2KI3A 2PPPA 1FKFA 4DZ3A 2KGJA 1NH6A 4R0XA 1FFRA 1CTNA 4W9PA 4U85A 2DT1A 1NWRA 1W26A 1JVWA 2YBTA 3O5JA 1E6PA 2UZ5A 4WJXA 1P5QA 3O5PA 4J4OA 1FKLA 3UI4A 4WKHA 1FKSA 3UQIA 1XHGA 4MTVA 4DRIA 4ZS6A 3WQWA 1GUVA 1W1YA 3KAHA 4AY1A 4Z2KA 4DWSC 4GGQA 4S3JA 3RGCA 3KAFA 4ODNA 1ZK6A 5GPGA 3NRKA 1FKJA 4MNLA 5J6EA 5HW8A 4JFMA 1W9UA 3ARZA 4BF8A 1RD6A 4G2PA 2ZQTA 1HJXA 2XP7A 2XP5A 2FAPA 3RMEA 2ZR5A 4LGXA 3IHZA 4Z2IA 1F8AB 3AS1A 2OLHA 2A3BA 3O5DA 1E6RA 3O5IA 4DWSD 1LL7A 3PRBA 2MNTA 2A3EA 4DRJA 4DH0A 2DG4A 3FAPA 1ZBWA 4DRKA 3B9AA 1NWTA 1FJDA 4ODMA 1KT1A 3WKZA 1F40A 2PV1A 2FKEA 4P8XA 1B6CA 4LAWA 3FXYA 1EQ3A 3EY6A 3CHFA 1BKFA 2ESCA 2KE0A 1HXVA 1M5YA 4KR0B 2A3CA 1EDQA 3WH0A 2WLZA 2DT3A 2RUDA 4WKAA 3GPKA 3O5FA 5DEZA 3KACA 4IT4A 1IX5A 4TW6A 4MNKA 4MNJA 2F21A 3RM8A 1FKDA 1LQ0A 1Q1CA 4W9OA 4JYSA 1HKJA 2VCDA 2XP6A 1D7JA 3B8SA 2M08A 1ROUA 1FD9A 4NZCA 3UQAA 1FKGA 2G41A 5HW7A 3PRAA 3AS2A 3O5EA 4Z2JA 1D7IA 2RSEA 4Z2LA 2AOSA 5HWBA 1J4RA 3RFWA 1D2KA 3O5QA 3WD1A 2MLXA 1X6NA 2XPBA 4MGVA 4DRHA 2KR7A 2PI6A 3NTPA 3ODKA 4TX0A 3ALGA 1ZB5A 3KAGA 1HKMA 4QZVB 3LUOA 3MDYB 4Z2HA 3AS0A 2DPEA 1ITXA 3CH9A 1FKIA 2FDMA 1TFVA 3NI6A 2PBCA 2IF4A 4LAXA 4FAPA 2XP3A 2XP4A 4N19A 4DT4A 1LL6A 1H0IA 1JNSA 4U86A 1HKKA 1O6IA 4DROA 3O5RA 1VF8A 1OWQA 2LPVA 1A7XA 1Q6UA 3WD2A 3CHEA 1W1VA 1ZBKA 2ZQSA 1ZU8A 1D6OA 1WB0A 2O92A 2KO7A 4DRPA 1E15A 3AS3A 5DF0A 1YATA 4TW8A 3WD4A 2LJ4A 2N87A 1HKIA 2DG9A 1W1PA 3VAWA 1KT0A 4S3KA 4NSBA 2XP8A 3KABA 1W1TA 1LG2A 4ML4A 4ODLA 2KFWA 3OA5A 1SYTA 3OOBA 4DWSB 1PINA 4URIA 3TC5A 3JYJA 5HW6A 3O5GA 2Y78A 4W5UA 1ZCNA 2WK2A 5JH8A 2MPHA 3G6MA 4P8VA 4WK9A 2F2DA 1JNTA 1QPFA 2VN1A 2F4EA 1E6ZA 1W9PA 4WKFA 2MF9A 1YW5A 4ODRA 3I6CA 1LG1A 1H0GA 2RURA 1JNDA 3WL1A 3WD0A 3KZ7A 2RUQA 4G50A 4TW7A 2QF8A 3ARSA 2PV3A 4HARA 1R9HA 1FKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UI4 A;  1FKT A;  2MLX A;  1TCO C;  1FKS A;  4QIB A;  3UQI A;  4LAY A;  2XPB A;  4MSP A;  4ODQ A;  4MGV A;  4DRI A;  1FKH A;  2OFN A;  4ODK A;  4DRH A;  1FAP A;  2KR7 A;  5HKG A;  1NSG A;  2Q5A A;  5D75 A;  3KAH A;  1QPL A;  3NTP A;  3ODK A;  3UQB A;  1ROT A;  2MLY A;  3UI5 A;  1C9H A;  4TX0 A;  4DRQ A;  4GGQ A;  3RGC A;  3KAF A;  3KAG A;  2M1I A;  4DZ2 A;  4ODN A;  1ZK6 A;  3LUO A;  3MDY B;  5GPG A;  4TNS A;  3IKG A;  3NRK A;  1FKJ A;  4DRN A;  3KAD A;  4JFK A;  2RUC A;  1FKI A;  5BXJ A;  5J6E A;  3PA7 A;  5HW8 A;  4JFM A;  4DRM A;  2ZQV A;  4DIP A;  4BF8 A;  2XPA A;  3NI6 A;  4G2P A;  2PBC A;  2IF4 A;  4LAX A;  2ZQT A;  4QT2 A;  4FAP A;  2XP7 A;  2XP3 A;  2XP5 A;  2FAP A;  3CGN A;  2ZQU A;  2ZR5 A;  3PRD A;  5B8I C;  3O5K A;  3IHZ A;  4J4N A;  5HT1 A;  1NMV A;  1J6Y A;  2PPO A;  1F8A B;  2XP4 A;  2D9F A;  2JZV A;  3O5D A;  4N19 A;  4W9Q A;  4DT4 A;  3O5I A;  4NNR A;  1JNS A;  4QT3 A;  4ODO A;  4U86 A;  2ZR4 A;  5HUA A;  2LKN A;  3PRB A;  1D7H A;  2MNT A;  4IQ2 A;  2K8I A;  4DRO A;  3O5R A;  4DRJ A;  2DG3 A;  2LPV A;  4DH0 A;  5HTG A;  1A7X A;  1L1P A;  2MLZ A;  1Q6U A;  1FKB A;  2DG4 A;  3FAP A;  4DRK A;  1FJD A;  3O5O A;  1KT1 A;  4LAV A;  4ODM A;  1F40 A;  2ZQS A;  2PV1 A;  1D6O A;  2FKE A;  2KO7 A;  1QZ2 A;  1B6C A;  1Q6I A;  4LAW A;  1Q6H A;  4DRP A;  1YAT A;  4TW8 A;  2LJ4 A;  2N87 A;  1EQ3 A;  2DG9 A;  3UF8 A;  2RQS A;  1PBK A;  4C02 B;  3EY6 A;  1BKF A;  5DIT A;  1U79 A;  4GIV A;  2KE0 A;  4IQC A;  1HXV A;  3TDB A;  3VAW A;  1M5Y A;  1KT0 A;  3TCZ A;  4ODP A;  3WH0 A;  2XP8 A;  3KAB A;  2ZR6 A;  2RUD A;  4IPX A;  3GPK A;  3O5F A;  4ODL A;  4TYO A;  3IKD A;  2KFW A;  5I98 A;  3KAC A;  3OOB A;  2M2A A;  2L2S A;  3KCE A;  3JXV A;  1PIN A;  4ITZ A;  4JFJ A;  1J4I A;  1FKR A;  2LGO A;  4TW6 A;  4JFL A;  2ITK A;  2F21 A;  2PPN A;  1FKD A;  3TC5 A;  1Q1C A;  3JYJ A;  5HW6 A;  3O5G A;  2Y78 A;  4JYS A;  4W9O A;  5DIU A;  2VCD A;  2XP6 A;  1J4H A;  1ZCN A;  2AWG A;  1BL4 A;  1N1A A;  1D7J A;  2MPH A;  4O2T A;  2M08 A;  2PV2 A;  1T11 A;  1JNT A;  1QPF A;  1FKF A;  2F2D A;  2KI3 A;  2F4E A;  2PPP A;  2VN1 A;  3H9R B;  4DZ3 A;  1ROU A;  1FD9 A;  4U84 A;  3UQA A;  2KGJ A;  1EYM A;  1FKG A;  4R0X A;  1Y0O A;  4FN2 A;  3O5M A;  2MF9 A;  1YW5 A;  3KAI A;  3IK8 A;  5HW7 A;  4W9P A;  3O5E A;  4ODR A;  4U85 A;  3I6C A;  1NMW A;  1D7I A;  2RSE A;  2RUR A;  3B7X A;  1W26 A;  3CGM A;  3KZ7 A;  5DIV A;  2RUQ A;  1JVW A;  4G50 A;  4TW7 A;  5HWB A;  3O5J A;  2UZ5 A;  2PV3 A;  1J4R A;  1P5Q A;  3O5P A;  3O5Q A;  1R9H A;  4JFI A;  3RFW A;  2XP9 A;  3UI6 A;  5HWC A;  1FKK A;  4J4O A;  1FKL A;  3O5L A;  3JYM A; 
#chains in the Genus database with same CATH topology
 1TCO C;  3ART A;  4LAY A;  4MSP A;  4ODQ A;  2OFN A;  4ODK A;  5DO2 A;  1FAP A;  1NSG A;  1XRV A;  3CZ8 A;  3UQB A;  1ROT A;  2MLY A;  3UI5 A;  1C9H A;  4DRQ A;  4Z2G A;  1X6L A;  1EHN A;  4DZ2 A;  2WM0 A;  1HJV A;  4TNS A;  4DRN A;  3KAD A;  3PR9 A;  4JFK A;  2RUC A;  3B9E A;  3RM4 A;  4ZPT R;  4R5E A;  3FY1 A;  3PA7 A;  3WQV A;  3ARW A;  1GOI A;  5GPR A;  2YBU A;  3CGN A;  3B9D A;  3PRD A;  5HBF A;  4L3N A;  5B8I C;  3ARO A;  1J6Y A;  2PPO A;  2JZV A;  4NNR A;  3BMB A;  4QT3 A;  2ZR4 A;  2LKN A;  1D7H A;  1LJY A;  2K8I A;  1FKB A;  1Q6I A;  2PN0 A;  1LL4 A;  3UF8 A;  1PBK A;  5DIT A;  4ZPV R;  4GIV A;  4IQC A;  3CHD A;  3WD3 A;  3TCZ A;  1UR9 A;  1GRJ A;  2ZR6 A;  3ARY A;  1NWS A;  2DT2 A;  4TYO A;  3QOK A;  4DWS A;  2L2S A;  3KCE A;  2A3A A;  3JXV A;  4ITZ A;  4JFJ A;  1J4I A;  1FKR A;  2LGO A;  3G6L A;  2PPN A;  1GPF A;  2P4V A;  3ARX A;  1J4H A;  2AWG A;  3ARR A;  1BL4 A;  4O2T A;  4L72 B;  3AQU A;  2PV2 A;  3H9R B;  2DT0 A;  4U84 A;  1EYM A;  1K9T A;  4UDM A;  1Y0O A;  4FN2 A;  3O5M A;  3KAI A;  3ARV A;  3IK8 A;  1HJW A;  1NMW A;  3B7X A;  1JNE A;  3CGM A;  1WNO A;  5DIV A;  4XAK A;  1FFQ A;  3WIJ A;  2B5U B;  4Q22 A;  3RM9 A;  4Q7N A;  4JFI A;  3UI6 A;  2XP9 A;  5HWC A;  3O5L A;  3JYM A;  1FKT A;  4QIB A;  1FKH A;  5HKG A;  2Q5A A;  5D75 A;  1QPL A;  2B31 A;  1E9L A;  4HBO A;  2M1I A;  4KQZ A;  3IKG A;  1WAW A;  2G8Z A;  4ZPW R;  5BXJ A;  1ZBC A;  3WL0 A;  4DRM A;  2ZQV A;  4DIP A;  2XPA A;  4QT2 A;  2DSU A;  3BXW A;  2WLY A;  2ZQU A;  3O5K A;  4J4N A;  5HT1 A;  1NMV A;  2D9F A;  4W9Q A;  1OGG A;  4ODO A;  5HUA A;  4IQ2 A;  1SR0 A;  2DG3 A;  4MPK A;  1L1P A;  5HTG A;  2MLZ A;  2IUZ A;  4MAV A;  3O5O A;  4LAV A;  4IT6 A;  1W9V A;  2DSV A;  3W4R A;  1QZ2 A;  1Q6H A;  5GQB A;  3ARQ A;  4MNM A;  2RQS A;  2DSW A;  2O9O A;  4C02 B;  2DSZ A;  1KFW A;  3CHC A;  1U79 A;  4HBE A;  3ARP A;  4PTM A;  3TDB A;  1EIB A;  4ODP A;  4WIW A;  4IPX A;  1ZBV A;  3IKD A;  4P8W A;  5I98 A;  3ARU A;  2M2A A;  1UR8 A;  3EIP A;  4JFL A;  2ITK A;  3GTY X;  1NWU A;  1OGB A;  5DIU A;  4P8U A;  1N1A A;  3ALF A;  1ZL1 A;  1E6N A;  1T11 A;  2KI3 A;  2PPP A;  1FKF A;  4DZ3 A;  2KGJ A;  1NH6 A;  4R0X A;  1FFR A;  1CTN A;  4W9P A;  4U85 A;  2DT1 A;  1NWR A;  1W26 A;  1JVW A;  1JCH B;  2YBT A;  3O5J A;  1E6P A;  2UZ5 A;  2ETN A;  4WJX A;  1P5Q A;  3O5P A;  4J4O A;  1FKL A;  3UI4 A;  4WKH A;  1FKS A;  3UQI A;  1XHG A;  4MTV A;  4DRI A;  4ZS6 A;  3WQW A;  1GUV A;  1W1Y A;  3KAH A;  4AY1 A;  4Z2K A;  4DWS C;  4GGQ A;  4S3J A;  3RGC A;  3KAF A;  4ODN A;  1ZK6 A;  5GPG A;  3NRK A;  1FKJ A;  4MNL A;  5J6E A;  5HW8 A;  4JFM A;  1W9U A;  3ARZ A;  4BF8 A;  1RD6 A;  4G2P A;  3GU0 A;  2ZQT A;  1HJX A;  2XP7 A;  2XP5 A;  2FAP A;  3RME A;  2ZR5 A;  4LGX A;  3IHZ A;  4Z2I A;  1F8A B;  3AS1 A;  2OLH A;  2A3B A;  3O5D A;  1E6R A;  3O5I A;  4DWS D;  1LL7 A;  3PRB A;  2MNT A;  2A3E A;  4DRJ A;  4DH0 A;  2DG4 A;  3FAP A;  1ZBW A;  4DRK A;  3B9A A;  1NWT A;  1FJD A;  4ODM A;  1KT1 A;  2F23 A;  3WKZ A;  1F40 A;  2PV1 A;  2FKE A;  4P8X A;  1B6C A;  4LAW A;  3FXY A;  1EQ3 A;  3EY6 A;  3CHF A;  1BKF A;  2ESC A;  1E44 A;  2KE0 A;  1HXV A;  1M5Y A;  4KR0 B;  2A3C A;  1EDQ A;  3WH0 A;  2WLZ A;  2DT3 A;  2RUD A;  4WKA A;  3GPK A;  3O5F A;  5DEZ A;  3KAC A;  4IT4 A;  1IX5 A;  4TW6 A;  4MNK A;  4MNJ A;  2F21 A;  3RM8 A;  1FKD A;  1LQ0 A;  1Q1C A;  4W9O A;  4JYS A;  1HKJ A;  2VCD A;  2XP6 A;  1D7J A;  3B8S A;  2M08 A;  1ROU A;  1FD9 A;  4NZC A;  3UQA A;  1FKG A;  2G41 A;  5HW7 A;  3PRA A;  3AS2 A;  3O5E A;  4Z2J A;  1D7I A;  2RSE A;  4Z2L A;  2AOS A;  5HWB A;  1J4R A;  3RFW A;  1D2K A;  3O5Q A;  3WD1 A;  2MLX A;  1X6N A;  2EUL A;  2XPB A;  4MGV A;  4DRH A;  2KR7 A;  2PI6 A;  3NTP A;  3ODK A;  4TX0 A;  3ALG A;  1ZB5 A;  3KAG A;  1HKM A;  4QZV B;  3LUO A;  3MDY B;  4Z2H A;  3AS0 A;  2DPE A;  1ITX A;  3CH9 A;  1FKI A;  2FDM A;  1TFV A;  3NI6 A;  2PBC A;  2IF4 A;  4LAX A;  4FAP A;  2XP3 A;  2XP4 A;  4N19 A;  4DT4 A;  1LL6 A;  1H0I A;  1JNS A;  4U86 A;  1HKK A;  1O6I A;  4DRO A;  3O5R A;  1VF8 A;  1OWQ A;  2LPV A;  1A7X A;  1Q6U A;  3WD2 A;  3CHE A;  1W1V A;  1ZBK A;  2ZQS A;  1ZU8 A;  1D6O A;  1WB0 A;  2O92 A;  2KO7 A;  4DRP A;  1E15 A;  3AS3 A;  5DF0 A;  1YAT A;  4TW8 A;  3WD4 A;  2LJ4 A;  2N87 A;  1HKI A;  2DG9 A;  1W1P A;  3VAW A;  1KT0 A;  4S3K A;  4NSB A;  2XP8 A;  3KAB A;  1W1T A;  1LG2 A;  4ML4 A;  4ODL A;  2KFW A;  3OA5 A;  1SYT A;  3OOB A;  4DWS B;  1PIN A;  4URI A;  3TC5 A;  3JYJ A;  5HW6 A;  3O5G A;  2Y78 A;  4W5U A;  1ZCN A;  2WK2 A;  5JH8 A;  2MPH A;  3G6M A;  4P8V A;  4WK9 A;  2F2D A;  1JNT A;  1QPF A;  2VN1 A;  2F4E A;  1E6Z A;  1W9P A;  4WKF A;  2MF9 A;  1YW5 A;  4ODR A;  3I6C A;  1LG1 A;  1H0G A;  2RUR A;  1JND A;  3WL1 A;  3WD0 A;  3KZ7 A;  2RUQ A;  4G50 A;  4TW7 A;  2QF8 A;  3ARS A;  2PV3 A;  4HAR A;  1R9H A;  1FKK A; 
#chains in the Genus database with same CATH homology
 1TCO C;  3ART A;  4LAY A;  4MSP A;  4ODQ A;  2OFN A;  4ODK A;  5DO2 A;  1FAP A;  1NSG A;  1XRV A;  3CZ8 A;  3UQB A;  1ROT A;  2MLY A;  3UI5 A;  1C9H A;  4DRQ A;  4Z2G A;  1X6L A;  1EHN A;  4DZ2 A;  2WM0 A;  1HJV A;  4TNS A;  4DRN A;  3KAD A;  3PR9 A;  4JFK A;  2RUC A;  3B9E A;  3RM4 A;  4ZPT R;  4R5E A;  3FY1 A;  3PA7 A;  3WQV A;  3ARW A;  1GOI A;  5GPR A;  2YBU A;  3CGN A;  3B9D A;  3PRD A;  5HBF A;  4L3N A;  5B8I C;  3ARO A;  1J6Y A;  2PPO A;  2JZV A;  4NNR A;  4QT3 A;  2ZR4 A;  2LKN A;  1D7H A;  1LJY A;  2K8I A;  1FKB A;  1Q6I A;  1LL4 A;  3UF8 A;  1PBK A;  5DIT A;  4ZPV R;  4GIV A;  4IQC A;  3CHD A;  3WD3 A;  3TCZ A;  1UR9 A;  2ZR6 A;  3ARY A;  1NWS A;  2DT2 A;  4TYO A;  3QOK A;  4DWS A;  2L2S A;  3KCE A;  2A3A A;  3JXV A;  4ITZ A;  4JFJ A;  1J4I A;  1FKR A;  2LGO A;  3G6L A;  2PPN A;  1GPF A;  3ARX A;  1J4H A;  2AWG A;  3ARR A;  1BL4 A;  4O2T A;  4L72 B;  3AQU A;  2PV2 A;  3H9R B;  2DT0 A;  4U84 A;  1EYM A;  1K9T A;  1Y0O A;  4FN2 A;  3O5M A;  3KAI A;  3ARV A;  3IK8 A;  1HJW A;  1NMW A;  3B7X A;  1JNE A;  3CGM A;  1WNO A;  5DIV A;  4XAK A;  1FFQ A;  3WIJ A;  4Q22 A;  3RM9 A;  4Q7N A;  4JFI A;  3UI6 A;  2XP9 A;  5HWC A;  3O5L A;  3JYM A;  1FKT A;  4QIB A;  1FKH A;  5HKG A;  2Q5A A;  5D75 A;  1QPL A;  2B31 A;  1E9L A;  4HBO A;  2M1I A;  4KQZ A;  3IKG A;  1WAW A;  2G8Z A;  4ZPW R;  5BXJ A;  1ZBC A;  3WL0 A;  4DRM A;  2ZQV A;  4DIP A;  2XPA A;  4QT2 A;  2DSU A;  3BXW A;  2WLY A;  2ZQU A;  3O5K A;  4J4N A;  5HT1 A;  1NMV A;  2D9F A;  4W9Q A;  1OGG A;  4ODO A;  5HUA A;  4IQ2 A;  1SR0 A;  2DG3 A;  4MPK A;  1L1P A;  5HTG A;  2MLZ A;  2IUZ A;  4MAV A;  3O5O A;  4LAV A;  4IT6 A;  1W9V A;  2DSV A;  3W4R A;  1QZ2 A;  1Q6H A;  5GQB A;  3ARQ A;  4MNM A;  2RQS A;  2DSW A;  2O9O A;  4C02 B;  2DSZ A;  1KFW A;  3CHC A;  1U79 A;  4HBE A;  3ARP A;  4PTM A;  3TDB A;  1EIB A;  4ODP A;  4WIW A;  4IPX A;  1ZBV A;  3IKD A;  4P8W A;  5I98 A;  3ARU A;  2M2A A;  1UR8 A;  4JFL A;  2ITK A;  1NWU A;  1OGB A;  5DIU A;  4P8U A;  1N1A A;  3ALF A;  1ZL1 A;  1E6N A;  1T11 A;  2KI3 A;  2PPP A;  1FKF A;  4DZ3 A;  2KGJ A;  1NH6 A;  4R0X A;  1FFR A;  1CTN A;  4W9P A;  4U85 A;  2DT1 A;  1NWR A;  1W26 A;  1JVW A;  2YBT A;  3O5J A;  1E6P A;  2UZ5 A;  4WJX A;  1P5Q A;  3O5P A;  4J4O A;  1FKL A;  3UI4 A;  4WKH A;  1FKS A;  3UQI A;  1XHG A;  4MTV A;  4DRI A;  4ZS6 A;  3WQW A;  1GUV A;  1W1Y A;  3KAH A;  4AY1 A;  4Z2K A;  4DWS C;  4GGQ A;  4S3J A;  3RGC A;  3KAF A;  4ODN A;  1ZK6 A;  5GPG A;  3NRK A;  1FKJ A;  4MNL A;  5J6E A;  5HW8 A;  4JFM A;  1W9U A;  3ARZ A;  4BF8 A;  1RD6 A;  4G2P A;  2ZQT A;  1HJX A;  2XP7 A;  2XP5 A;  2FAP A;  3RME A;  2ZR5 A;  4LGX A;  3IHZ A;  4Z2I A;  1F8A B;  3AS1 A;  2OLH A;  2A3B A;  3O5D A;  1E6R A;  3O5I A;  4DWS D;  1LL7 A;  3PRB A;  2MNT A;  2A3E A;  4DRJ A;  4DH0 A;  2DG4 A;  3FAP A;  1ZBW A;  4DRK A;  3B9A A;  1NWT A;  1FJD A;  4ODM A;  1KT1 A;  3WKZ A;  1F40 A;  2PV1 A;  2FKE A;  4P8X A;  1B6C A;  4LAW A;  3FXY A;  1EQ3 A;  3EY6 A;  3CHF A;  1BKF A;  2ESC A;  2KE0 A;  1HXV A;  1M5Y A;  4KR0 B;  2A3C A;  1EDQ A;  3WH0 A;  2WLZ A;  2DT3 A;  2RUD A;  4WKA A;  3GPK A;  3O5F A;  5DEZ A;  3KAC A;  4IT4 A;  1IX5 A;  4TW6 A;  4MNK A;  4MNJ A;  2F21 A;  3RM8 A;  1FKD A;  1LQ0 A;  1Q1C A;  4W9O A;  4JYS A;  1HKJ A;  2VCD A;  2XP6 A;  1D7J A;  3B8S A;  2M08 A;  1ROU A;  1FD9 A;  4NZC A;  3UQA A;  1FKG A;  2G41 A;  5HW7 A;  3PRA A;  3AS2 A;  3O5E A;  4Z2J A;  1D7I A;  2RSE A;  4Z2L A;  2AOS A;  5HWB A;  1J4R A;  3RFW A;  1D2K A;  3O5Q A;  3WD1 A;  2MLX A;  1X6N A;  2XPB A;  4MGV A;  4DRH A;  2KR7 A;  2PI6 A;  3NTP A;  3ODK A;  4TX0 A;  3ALG A;  1ZB5 A;  3KAG A;  1HKM A;  4QZV B;  3LUO A;  3MDY B;  4Z2H A;  3AS0 A;  2DPE A;  1ITX A;  3CH9 A;  1FKI A;  2FDM A;  1TFV A;  3NI6 A;  2PBC A;  2IF4 A;  4LAX A;  4FAP A;  2XP3 A;  2XP4 A;  4N19 A;  4DT4 A;  1LL6 A;  1H0I A;  1JNS A;  4U86 A;  1HKK A;  1O6I A;  4DRO A;  3O5R A;  1VF8 A;  1OWQ A;  2LPV A;  1A7X A;  1Q6U A;  3WD2 A;  3CHE A;  1W1V A;  1ZBK A;  2ZQS A;  1ZU8 A;  1D6O A;  1WB0 A;  2O92 A;  2KO7 A;  4DRP A;  1E15 A;  3AS3 A;  5DF0 A;  1YAT A;  4TW8 A;  3WD4 A;  2LJ4 A;  2N87 A;  1HKI A;  2DG9 A;  1W1P A;  3VAW A;  1KT0 A;  4S3K A;  4NSB A;  2XP8 A;  3KAB A;  1W1T A;  1LG2 A;  4ML4 A;  4ODL A;  2KFW A;  3OA5 A;  1SYT A;  3OOB A;  4DWS B;  1PIN A;  4URI A;  3TC5 A;  3JYJ A;  5HW6 A;  3O5G A;  2Y78 A;  4W5U A;  1ZCN A;  2WK2 A;  5JH8 A;  2MPH A;  3G6M A;  4P8V A;  4WK9 A;  2F2D A;  1JNT A;  1QPF A;  2VN1 A;  2F4E A;  1E6Z A;  1W9P A;  4WKF A;  2MF9 A;  1YW5 A;  4ODR A;  3I6C A;  1LG1 A;  1H0G A;  2RUR A;  1JND A;  3WL1 A;  3WD0 A;  3KZ7 A;  2RUQ A;  4G50 A;  4TW7 A;  2QF8 A;  3ARS A;  2PV3 A;  4HAR A;  1R9H A;  1FKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...