1FKSA

Solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 AND RAPAMYCIN-BINDING PROTEIN
publication title Solution structure of FKBP, a rotamase enzyme and receptor for FK506 and rapamycin.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
total genus 12
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fksA00
2F4EA 2DG3A 1Q1CA 4JFIA 2RUQA 2XP6A 3KADA 4IPXA 2M2AA 4ODLA 5HW7A 1W26A 4DRHA 4J4NA 4MGVA 2RUDA 2PV2A 3KAFA 2LGOA 3UQBA 4J4OA 1J4RA 1D6OA 3B7XA 3UQIA 1D7IA 4DRMA 2D9FA 2MLYA 2IF4A 4IQCA 1FKKA 3ODKA 3O5GA 4LAYA 3VAWA 3O5FA 3O5JA 1U79A 1F40A 2MNTA 4DIPA 4ODPA 1P5QA 5HWCA 4QIBA 2ITKA 2PPOA 4JFJA 5HW8A 2Q5AA 2FAPA 4TW8A 3RGCA 4TW7A 3CGMA 4TW6A 1J6YA 1FKDA 3O5MA 4JFLA 2XPAA 4W9OA 1EYMA 3IHZA 1F8AB 1FKIA 2ZR4A 2XP4A 1B6CA 2RQSA 1T11A 2KE0A 3OOBA 4N19A 4O2TA 1L1PA 4LAWA 2VN1A 2KR7A 2LJ4A 3MDYB 3PRBA 2MPHA 2ZQSA 1C9HA 3O5LA 2M08A 3O5DA 4FN2A 1JNTA 1NMWA 1R9HA 1ROUA 4G50A 3CGNA 1NSGA 4ODMA 5HWBA 1YATA 3KZ7A 4TNSA 2Y78A 5DIVA 3WH0A 4C02B 2XP3A 4QT2A 2DG4A 3KABA 4DH0A 3LUOA 5HKGA 5B8IC 5J6EA 3TCZA 4DRPA 2ZQUA 1FKGA 2ZR6A 3IKDA 3JYMA 1QPFA 3O5RA 1JNSA 3KAIA 3KAGA 5D75A 1A7XA 2RURA 4GIVA 4BF8A 4JFMA 1Y0OA 3JXVA 2KO7A 4DT4A 4DZ2A 4R0XA 2ZQTA 2VCDA 3TC5A 5DIUA 3JYJA 1FKHA 3H9RB 2M1IA 2KFWA 3IK8A 4ODQA 2ZR5A 4DRNA 2DG9A 1FKSA 3KCEA 4JFKA 4ODNA 4DRIA 2N87A 5HUAA 1KT1A 2MLXA 3O5KA 4TX0A 2PBCA 3I6CA 1ZK6A 2XP5A 4U85A 4MSPA 5DITA 3O5QA 2PV3A 1ROTA 2MF9A 1D7JA 1FKLA 4DRQA 1FKJA 1FD9A 1FKTA 4QT3A 4DRKA 4FAPA 3NTPA 4DROA 2LPVA 3O5PA 1FKBA 2KGJA 1YW5A 1BKFA 2UZ5A 2JZVA 4TYOA 4LAXA 2MLZA 2XP9A 3GPKA 1PINA 2XP8A 4ITZA 3IKGA 1QPLA 3PRDA 1FJDA 1N1AA 5GPGA 1HXVA 2PV1A 4JYSA 2RSEA 4DZ3A 1J4HA 3FAPA 3KACA 2L2SA 5HT1A 2FKEA 1JVWA 2KI3A 1J4IA 3KAHA 3UI5A 1NMVA 3EY6A 4U86A 1EQ3A 2F21A 2XPBA 3PA7A 4ODKA 4W9QA 2K8IA 3RFWA 2PPPA 3NI6A 5HTGA 1Q6UA 4DRJA 1KT0A 1D7HA 2RUCA 4W9PA 5BXJA 3O5EA 2XP7A 2LKNA 1FKRA 1Q6IA 3UF8A 3UI4A 4NNRA 1QZ2A 2PPNA 4G2PA 4ODRA 1FAPA 4GGQA 4IQ2A 4U84A 3TDBA 3O5OA 1PBKA 2F2DA 2AWGA 3O5IA 3UQAA 1M5YA 1BL4A 1FKFA 2OFNA 4LAVA 4ODOA 1Q6HA 1ZCNA 2ZQVA 3UI6A 1TCOC 3NRKA 5HW6A 5I98A
chains in the Genus database with same CATH superfamily
1D2KA 2DG3A 1Q1CA 1HJXA 2RUQA 2YBTA 4MNJA 3ARZA 4IPXA 2M2AA 4ODLA 1WNOA 1W26A 3RM8A 2RUDA 3KAFA 4MPKA 2DPEA 1J4RA 1WAWA 3B7XA 3BXWA 3RM9A 1EIBA 4R5EA 4Z2IA 4IQCA 3VAWA 4DIPA 2B31A 1E15A 2PPOA 3G6LA 2Q5AA 2FAPA 4TW7A 3CGMA 1J6YA 4WK9A 4KQZA 1W9PA 3FXYA 4O2TA 2VN1A 4WKFA 2LJ4A 3MDYB 3O5DA 2IUZA 1E6PA 3AQUA 5HKGA 4DRPA 2ZR6A 3KAIA 5D75A 4BF8A 1Y0OA 2A3BA 2ZQTA 3OA5A 4ZPTR 3TC5A 3JYJA 1FKHA 3H9RB 1FKSA 1LG2A 4NSBA 3FY1A 4JFKA 4ODNA 2MLXA 3O5KA 1ZK6A 2XP5A 5DITA 1X6LA 2DT0A 1FKLA 4DRQA 1FD9A 2LPVA 2JZVA 2EULA 2O92A 5GQBA 2DT2A 2XP9A 3EIPA 3IKGA 2ETNA 1W9UA 3FAPA 1ZBCA 1NMVA 3EY6A 4U86A 3RFWA 2PPPA 4DWSA 4DRJA 2XP7A 3WQWA 1HKKA 2PPNA 3ARQA 2WLYA 3B9AA 4MTVA 1PBKA 2AWGA 2OFNA 4Z2LA 1W9VA 1GOIA 4MNLA 4JFIA 3ARSA 1E6ZA 1E6RA 1UR9A 5HW7A 4J4NA 2PV2A 2LGOA 3ARPA 1D6OA 4Z2KA 1D7IA 3UQIA 2DSWA 3O5GA 3ARUA 3O5JA 1U79A 1F40A 5DF0A 1P5QA 4Z2HA 2YBUA 4QIBA 2ITKA 1OGBA 4JFJA 4TW8A 4WIWA 3CHFA 3RGCA 1FFQA 3PRAA 1JCHB 1FKIA 1RD6A 4P8WA 4IT6A 1HKJA 2KE0A 2A3AA 4ZS6A 2KR7A 3B9EA 1ZBVA 3B9DA 2M08A 1NMWA 4ODMA 2Y78A 5DIVA 3WIJA 1FFRA 1XRVA 4S3JA 3TCZA 1W1YA 4GIVA 2DT3A 3JXVA 2KO7A 2QF8A 4R0XA 2KFWA 3IK8A 4ODQA 1NWRA 4DRIA 5HUAA 2PBCA 4U85A 3O5QA 2MF9A 1D7JA 3BMBA 3WD1A 3ALGA 4DRKA 4QT3A 3NTPA 4DROA 1K9TA 4ITZA 1FJDA 2PV1A 4DZ3A 5HT1A 1JVWA 1EQ3A 1J4IA 4PTMA 2XPBA 3CHDA 5HTGA 1Q6UA 4Z2JA 1D7HA 1XHGA 2RUCA 3ARTA 3WL1A 3WQVA 3O5EA 1W1PA 2LKNA 2PN0A 3AROA 4G2PA 3TDBA 4IQ2A 2ZQVA 4IT4A 3NRKA 2F4EA 4P8VA 1W1TA 2XP6A 4HBEA 4DRHA 4MGVA 1LJYA 2G41A 3UQBA 4J4OA 4DRMA 2D9FA 1IX5A 3RM4A 4P8XA 1FKKA 4LAYA 1CTNA 4ODPA 1GPFA 5HW8A 1H0IA 4TW6A 4DWSD 3O5MA 4JFLA 1GUVA 3WD4A 1LL7A 4W9OA 1EYMA 1X6NA 1F8AB 2ZR4A 1ITXA 1B6CA 1EDQA 1T11A 4Z2GA 1UR8A 1TFVA 2DT1A 1HKMA 2A3CA 3GU0A 2WK2A 1R9HA 4MAVA 1SR0A 3WKZA 1NSGA 3AS1A 1YATA 3KZ7A 1NH6A 4TNSA 3WH0A 4W5UA 3WL0A 3QOKA 4DH0A 5J6EA 3O5RA 3KAGA 4JFMA 4DT4A 2DSVA 3ARVA 2M1IA 2DG9A 3KCEA 2A3EA 4L72B 1KT1A 4TX0A 1SYTA 3RMEA 3I6CA 4MSPA 4MNKA 2PV3A 1ROTA 4WKAA 5HBFA 5DEZA 1FKJA 2P4VA 4WKHA 1YW5A 3WD2A 4TYOA 4LAXA 4Q22A 1QPLA 1ZL1A 1N1AA 5GPGA 2RSEA 1J4HA 3KACA 2L2SA 3WD3A 1LL4A 3W4RA 2F21A 3PA7A 4UDMA 4W9QA 1WB0A 4W9PA 5BXJA 3AS3A 1Q6IA 3UI4A 1E9LA 4NNRA 3GTYX 1QZ2A 4ODRA 4GGQA 1H0GA 4U84A 1LQ0A 1LL6A 3O5OA 4XAKA 3O5IA 2DSUA 3CHCA 1M5YA 1BL4A 1OWQA 4LAVA 3UQAA 1ZCNA 3G6MA 1EHNA 5GPRA 5HW6A 5I98A 1HKIA 4ZPWR 1ZBKA 1JNEA 1OGGA 3KADA 3ARRA 2MLYA 2IF4A 3PR9A 4S3KA 3ODKA 2O9OA 3O5FA 2MNTA 5HWCA 2AOSA 2F23A 3AS2A 1FKDA 2XPAA 3ARWA 3IHZA 4Q7NA 4NZCA 2XP4A 5JH8A 1O6IA 2RQSA 1L1PA 3OOBA 4N19A 4LAWA 3ARYA 4L3NA 1VF8A 1JNDA 3PRBA 2MPHA 2PI6A 1C9HA 2ZQSA 3O5LA 4FN2A 4G50A 1JNTA 4URIA 1ROUA 1ZB5A 3CZ8A 3CGNA 5HWBA 4C02B 1W1VA 2XP3A 2WM0A 2DG4A 4QT2A 3ALFA 3KABA 3LUOA 5B8IC 2ZQUA 1FKGA 3JYMA 3IKDA 1JNSA 1QPFA 1NWUA 1A7XA 2RURA 4WJXA 4LGXA 4DZ2A 2VCDA 4DWSB 5DIUA 4DRNA 3ARXA 1ZBWA 2ZR5A 2G8ZA 4HARA 2N87A 3AS0A 4ZPVR 4MNMA 2B5UB 4FAPA 1FKTA 4ML4A 3B8SA 3O5PA 1FKBA 1HJVA 2KGJA 5DO2A 4AY1A 4DWSC 1BKFA 2UZ5A 2MLZA 3GPKA 1PINA 2XP8A 2DSZA 3PRDA 1GRJA 1HJWA 1NWTA 1HXVA 4KR0B 4JYSA 2FDMA 3CHEA 2FKEA 4HBOA 2KI3A 3UI5A 3KAHA 2OLHA 4ODKA 1ZU8A 2K8IA 3NI6A 1KT0A 2WLZA 1E44A 2ESCA 1FKRA 3UF8A 4P8UA 1LG1A 1FAPA 1KFWA 2F2DA 3CH9A 1FKFA 4ODOA 1Q6HA 3WD0A 3UI6A 4QZVB 1TCOC 1NWSA 1E6NA
chains in the Genus database with same CATH topology
1D2KA 2DG3A 1Q1CA 1HJXA 2RUQA 2YBTA 4MNJA 3ARZA 4IPXA 2M2AA 4ODLA 1WNOA 1W26A 3RM8A 2RUDA 3KAFA 4MPKA 2DPEA 1J4RA 1WAWA 3B7XA 3BXWA 3RM9A 1EIBA 4R5EA 4Z2IA 4IQCA 3VAWA 4DIPA 2B31A 1E15A 2PPOA 3G6LA 2Q5AA 2FAPA 4TW7A 3CGMA 1J6YA 4WK9A 4KQZA 1W9PA 3FXYA 4O2TA 2VN1A 4WKFA 2LJ4A 3MDYB 3O5DA 2IUZA 1E6PA 3AQUA 5HKGA 4DRPA 2ZR6A 3KAIA 5D75A 4BF8A 1Y0OA 2A3BA 2ZQTA 3OA5A 4ZPTR 3TC5A 3JYJA 1FKHA 3H9RB 1FKSA 1LG2A 4NSBA 3FY1A 4JFKA 4ODNA 2MLXA 3O5KA 1ZK6A 2XP5A 5DITA 1X6LA 2DT0A 1FKLA 4DRQA 1FD9A 2LPVA 2JZVA 2O92A 5GQBA 2DT2A 2XP9A 3IKGA 1W9UA 3FAPA 1ZBCA 1NMVA 3EY6A 4U86A 3RFWA 2PPPA 4DWSA 4DRJA 2XP7A 3WQWA 1HKKA 2PPNA 3ARQA 2WLYA 3B9AA 4MTVA 1PBKA 2AWGA 2OFNA 4Z2LA 1W9VA 1GOIA 4MNLA 4JFIA 3ARSA 1E6ZA 1E6RA 1UR9A 5HW7A 4J4NA 2PV2A 2LGOA 3ARPA 1D6OA 4Z2KA 1D7IA 3UQIA 2DSWA 3O5GA 3ARUA 3O5JA 1U79A 1F40A 5DF0A 1P5QA 4Z2HA 2YBUA 4QIBA 2ITKA 1OGBA 4JFJA 4TW8A 4WIWA 3CHFA 3RGCA 1FFQA 3PRAA 1FKIA 1RD6A 4P8WA 4IT6A 1HKJA 2KE0A 2A3AA 4ZS6A 2KR7A 3B9EA 1ZBVA 3B9DA 2M08A 1NMWA 4ODMA 2Y78A 5DIVA 3WIJA 1FFRA 1XRVA 4S3JA 3TCZA 1W1YA 4GIVA 2DT3A 3JXVA 2KO7A 2QF8A 4R0XA 2KFWA 3IK8A 4ODQA 1NWRA 4DRIA 5HUAA 2PBCA 4U85A 3O5QA 2MF9A 1D7JA 3WD1A 3ALGA 4DRKA 4QT3A 3NTPA 4DROA 1K9TA 4ITZA 1FJDA 2PV1A 4DZ3A 5HT1A 1JVWA 1EQ3A 1J4IA 4PTMA 2XPBA 3CHDA 5HTGA 1Q6UA 4Z2JA 1D7HA 1XHGA 2RUCA 3ARTA 3WL1A 3WQVA 3O5EA 1W1PA 2LKNA 3AROA 4G2PA 3TDBA 4IQ2A 2ZQVA 4IT4A 3NRKA 2F4EA 4P8VA 1W1TA 2XP6A 4HBEA 4DRHA 4MGVA 1LJYA 2G41A 3UQBA 4J4OA 4DRMA 2D9FA 1IX5A 3RM4A 4P8XA 1FKKA 4LAYA 1CTNA 4ODPA 1GPFA 5HW8A 1H0IA 4TW6A 4DWSD 3O5MA 4JFLA 1GUVA 3WD4A 1LL7A 4W9OA 1EYMA 1X6NA 1F8AB 2ZR4A 1ITXA 1B6CA 1EDQA 1T11A 4Z2GA 1UR8A 1TFVA 2DT1A 1HKMA 2A3CA 2WK2A 1R9HA 4MAVA 1SR0A 3WKZA 1NSGA 3AS1A 1YATA 3KZ7A 1NH6A 4TNSA 3WH0A 4W5UA 3WL0A 3QOKA 4DH0A 5J6EA 3O5RA 3KAGA 4JFMA 4DT4A 2DSVA 3ARVA 2M1IA 2DG9A 3KCEA 2A3EA 4L72B 1KT1A 4TX0A 1SYTA 3RMEA 3I6CA 4MSPA 4MNKA 2PV3A 1ROTA 4WKAA 5HBFA 5DEZA 1FKJA 4WKHA 1YW5A 3WD2A 4TYOA 4LAXA 4Q22A 1QPLA 1ZL1A 1N1AA 5GPGA 2RSEA 1J4HA 3KACA 2L2SA 3WD3A 1LL4A 3W4RA 2F21A 3PA7A 4W9QA 1WB0A 4W9PA 5BXJA 3AS3A 1Q6IA 3UI4A 1E9LA 4NNRA 1QZ2A 4ODRA 4GGQA 1H0GA 4U84A 1LQ0A 1LL6A 3O5OA 4XAKA 3O5IA 2DSUA 3CHCA 1M5YA 1BL4A 1OWQA 4LAVA 3UQAA 1ZCNA 3G6MA 1EHNA 5GPRA 5HW6A 5I98A 1HKIA 4ZPWR 1ZBKA 1JNEA 1OGGA 3KADA 3ARRA 2MLYA 2IF4A 3PR9A 4S3KA 3ODKA 2O9OA 3O5FA 2MNTA 5HWCA 2AOSA 3AS2A 1FKDA 2XPAA 3ARWA 3IHZA 4Q7NA 4NZCA 2XP4A 5JH8A 1O6IA 2RQSA 1L1PA 3OOBA 4N19A 4LAWA 3ARYA 4L3NA 1VF8A 1JNDA 3PRBA 2MPHA 2PI6A 1C9HA 2ZQSA 3O5LA 4FN2A 4G50A 1JNTA 4URIA 1ROUA 1ZB5A 3CZ8A 3CGNA 5HWBA 4C02B 1W1VA 2XP3A 2WM0A 2DG4A 4QT2A 3ALFA 3KABA 3LUOA 5B8IC 2ZQUA 1FKGA 3JYMA 3IKDA 1JNSA 1QPFA 1NWUA 1A7XA 2RURA 4WJXA 4LGXA 4DZ2A 2VCDA 4DWSB 5DIUA 4DRNA 3ARXA 1ZBWA 2ZR5A 2G8ZA 4HARA 2N87A 3AS0A 4ZPVR 4MNMA 4FAPA 1FKTA 4ML4A 3B8SA 3O5PA 1FKBA 1HJVA 2KGJA 5DO2A 4AY1A 4DWSC 1BKFA 2UZ5A 2MLZA 3GPKA 1PINA 2XP8A 2DSZA 3PRDA 1HJWA 1NWTA 1HXVA 4KR0B 4JYSA 2FDMA 3CHEA 2FKEA 4HBOA 2KI3A 3UI5A 3KAHA 2OLHA 4ODKA 1ZU8A 2K8IA 3NI6A 1KT0A 2WLZA 2ESCA 1FKRA 3UF8A 4P8UA 1LG1A 1FAPA 1KFWA 2F2DA 3CH9A 1FKFA 4ODOA 1Q6HA 3WD0A 3UI6A 4QZVB 1TCOC 1NWSA 1E6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4E A;  2DG3 A;  1Q1C A;  4JFI A;  2RUQ A;  2XP6 A;  3KAD A;  4IPX A;  2M2A A;  4ODL A;  5HW7 A;  1W26 A;  4DRH A;  4J4N A;  4MGV A;  2RUD A;  2PV2 A;  3KAF A;  2LGO A;  3UQB A;  4J4O A;  1J4R A;  1D6O A;  3B7X A;  3UQI A;  1D7I A;  4DRM A;  2D9F A;  2MLY A;  2IF4 A;  4IQC A;  1FKK A;  3ODK A;  3O5G A;  4LAY A;  3VAW A;  3O5F A;  3O5J A;  1U79 A;  1F40 A;  2MNT A;  4DIP A;  4ODP A;  1P5Q A;  5HWC A;  4QIB A;  2ITK A;  2PPO A;  4JFJ A;  5HW8 A;  2Q5A A;  2FAP A;  4TW8 A;  3RGC A;  4TW7 A;  3CGM A;  4TW6 A;  1J6Y A;  1FKD A;  3O5M A;  4JFL A;  2XPA A;  4W9O A;  1EYM A;  3IHZ A;  1F8A B;  1FKI A;  2ZR4 A;  2XP4 A;  1B6C A;  2RQS A;  1T11 A;  2KE0 A;  3OOB A;  4N19 A;  4O2T A;  1L1P A;  4LAW A;  2VN1 A;  2KR7 A;  2LJ4 A;  3MDY B;  3PRB A;  2MPH A;  2ZQS A;  1C9H A;  3O5L A;  2M08 A;  3O5D A;  4FN2 A;  1JNT A;  1NMW A;  1R9H A;  1ROU A;  4G50 A;  3CGN A;  1NSG A;  4ODM A;  5HWB A;  1YAT A;  3KZ7 A;  4TNS A;  2Y78 A;  5DIV A;  3WH0 A;  4C02 B;  2XP3 A;  4QT2 A;  2DG4 A;  3KAB A;  4DH0 A;  3LUO A;  5HKG A;  5B8I C;  5J6E A;  3TCZ A;  4DRP A;  2ZQU A;  1FKG A;  2ZR6 A;  3IKD A;  3JYM A;  1QPF A;  3O5R A;  1JNS A;  3KAI A;  3KAG A;  5D75 A;  1A7X A;  2RUR A;  4GIV A;  4BF8 A;  4JFM A;  1Y0O A;  3JXV A;  2KO7 A;  4DT4 A;  4DZ2 A;  4R0X A;  2ZQT A;  2VCD A;  3TC5 A;  5DIU A;  3JYJ A;  1FKH A;  3H9R B;  2M1I A;  2KFW A;  3IK8 A;  4ODQ A;  2ZR5 A;  4DRN A;  2DG9 A;  1FKS A;  3KCE A;  4JFK A;  4ODN A;  4DRI A;  2N87 A;  5HUA A;  1KT1 A;  2MLX A;  3O5K A;  4TX0 A;  2PBC A;  3I6C A;  1ZK6 A;  2XP5 A;  4U85 A;  4MSP A;  5DIT A;  3O5Q A;  2PV3 A;  1ROT A;  2MF9 A;  1D7J A;  1FKL A;  4DRQ A;  1FKJ A;  1FD9 A;  1FKT A;  4QT3 A;  4DRK A;  4FAP A;  3NTP A;  4DRO A;  2LPV A;  3O5P A;  1FKB A;  2KGJ A;  1YW5 A;  1BKF A;  2UZ5 A;  2JZV A;  4TYO A;  4LAX A;  2MLZ A;  2XP9 A;  3GPK A;  1PIN A;  2XP8 A;  4ITZ A;  3IKG A;  1QPL A;  3PRD A;  1FJD A;  1N1A A;  5GPG A;  1HXV A;  2PV1 A;  4JYS A;  2RSE A;  4DZ3 A;  1J4H A;  3FAP A;  3KAC A;  2L2S A;  5HT1 A;  2FKE A;  1JVW A;  2KI3 A;  1J4I A;  3KAH A;  3UI5 A;  1NMV A;  3EY6 A;  4U86 A;  1EQ3 A;  2F21 A;  2XPB A;  3PA7 A;  4ODK A;  4W9Q A;  2K8I A;  3RFW A;  2PPP A;  3NI6 A;  5HTG A;  1Q6U A;  4DRJ A;  1KT0 A;  1D7H A;  2RUC A;  4W9P A;  5BXJ A;  3O5E A;  2XP7 A;  2LKN A;  1FKR A;  1Q6I A;  3UF8 A;  3UI4 A;  4NNR A;  1QZ2 A;  2PPN A;  4G2P A;  4ODR A;  1FAP A;  4GGQ A;  4IQ2 A;  4U84 A;  3TDB A;  3O5O A;  1PBK A;  2F2D A;  2AWG A;  3O5I A;  3UQA A;  1M5Y A;  1BL4 A;  1FKF A;  2OFN A;  4LAV A;  4ODO A;  1Q6H A;  1ZCN A;  2ZQV A;  3UI6 A;  1TCO C;  3NRK A;  5HW6 A;  5I98 A; 
#chains in the Genus database with same CATH topology
 1D2K A;  2DG3 A;  1Q1C A;  1HJX A;  2RUQ A;  2YBT A;  4MNJ A;  3ARZ A;  4IPX A;  2M2A A;  4ODL A;  1WNO A;  1W26 A;  3RM8 A;  2RUD A;  3KAF A;  4MPK A;  2DPE A;  1J4R A;  1WAW A;  3B7X A;  3BXW A;  3RM9 A;  1EIB A;  4R5E A;  4Z2I A;  4IQC A;  3VAW A;  4DIP A;  2B31 A;  1E15 A;  2PPO A;  3G6L A;  2Q5A A;  2FAP A;  4TW7 A;  3CGM A;  1J6Y A;  4WK9 A;  4KQZ A;  1W9P A;  3FXY A;  4O2T A;  2VN1 A;  4WKF A;  2LJ4 A;  3MDY B;  3O5D A;  2IUZ A;  1E6P A;  3AQU A;  5HKG A;  4DRP A;  2ZR6 A;  3KAI A;  5D75 A;  4BF8 A;  1Y0O A;  2A3B A;  2ZQT A;  3OA5 A;  4ZPT R;  3TC5 A;  3JYJ A;  1FKH A;  3H9R B;  1FKS A;  1LG2 A;  4NSB A;  3FY1 A;  4JFK A;  4ODN A;  2MLX A;  3O5K A;  1ZK6 A;  2XP5 A;  5DIT A;  1X6L A;  2DT0 A;  1FKL A;  4DRQ A;  1FD9 A;  2LPV A;  2JZV A;  2EUL A;  2O92 A;  5GQB A;  2DT2 A;  2XP9 A;  3EIP A;  3IKG A;  2ETN A;  1W9U A;  3FAP A;  1ZBC A;  1NMV A;  3EY6 A;  4U86 A;  3RFW A;  2PPP A;  4DWS A;  4DRJ A;  2XP7 A;  3WQW A;  1HKK A;  2PPN A;  3ARQ A;  2WLY A;  3B9A A;  4MTV A;  1PBK A;  2AWG A;  2OFN A;  4Z2L A;  1W9V A;  1GOI A;  4MNL A;  4JFI A;  3ARS A;  1E6Z A;  1E6R A;  1UR9 A;  5HW7 A;  4J4N A;  2PV2 A;  2LGO A;  3ARP A;  1D6O A;  4Z2K A;  1D7I A;  3UQI A;  2DSW A;  3O5G A;  3ARU A;  3O5J A;  1U79 A;  1F40 A;  5DF0 A;  1P5Q A;  4Z2H A;  2YBU A;  4QIB A;  2ITK A;  1OGB A;  4JFJ A;  4TW8 A;  4WIW A;  3CHF A;  3RGC A;  1FFQ A;  3PRA A;  1JCH B;  1FKI A;  1RD6 A;  4P8W A;  4IT6 A;  1HKJ A;  2KE0 A;  2A3A A;  4ZS6 A;  2KR7 A;  3B9E A;  1ZBV A;  3B9D A;  2M08 A;  1NMW A;  4ODM A;  2Y78 A;  5DIV A;  3WIJ A;  1FFR A;  1XRV A;  4S3J A;  3TCZ A;  1W1Y A;  4GIV A;  2DT3 A;  3JXV A;  2KO7 A;  2QF8 A;  4R0X A;  2KFW A;  3IK8 A;  4ODQ A;  1NWR A;  4DRI A;  5HUA A;  2PBC A;  4U85 A;  3O5Q A;  2MF9 A;  1D7J A;  3BMB A;  3WD1 A;  3ALG A;  4DRK A;  4QT3 A;  3NTP A;  4DRO A;  1K9T A;  4ITZ A;  1FJD A;  2PV1 A;  4DZ3 A;  5HT1 A;  1JVW A;  1EQ3 A;  1J4I A;  4PTM A;  2XPB A;  3CHD A;  5HTG A;  1Q6U A;  4Z2J A;  1D7H A;  1XHG A;  2RUC A;  3ART A;  3WL1 A;  3WQV A;  3O5E A;  1W1P A;  2LKN A;  2PN0 A;  3ARO A;  4G2P A;  3TDB A;  4IQ2 A;  2ZQV A;  4IT4 A;  3NRK A;  2F4E A;  4P8V A;  1W1T A;  2XP6 A;  4HBE A;  4DRH A;  4MGV A;  1LJY A;  2G41 A;  3UQB A;  4J4O A;  4DRM A;  2D9F A;  1IX5 A;  3RM4 A;  4P8X A;  1FKK A;  4LAY A;  1CTN A;  4ODP A;  1GPF A;  5HW8 A;  1H0I A;  4TW6 A;  4DWS D;  3O5M A;  4JFL A;  1GUV A;  3WD4 A;  1LL7 A;  4W9O A;  1EYM A;  1X6N A;  1F8A B;  2ZR4 A;  1ITX A;  1B6C A;  1EDQ A;  1T11 A;  4Z2G A;  1UR8 A;  1TFV A;  2DT1 A;  1HKM A;  2A3C A;  3GU0 A;  2WK2 A;  1R9H A;  4MAV A;  1SR0 A;  3WKZ A;  1NSG A;  3AS1 A;  1YAT A;  3KZ7 A;  1NH6 A;  4TNS A;  3WH0 A;  4W5U A;  3WL0 A;  3QOK A;  4DH0 A;  5J6E A;  3O5R A;  3KAG A;  4JFM A;  4DT4 A;  2DSV A;  3ARV A;  2M1I A;  2DG9 A;  3KCE A;  2A3E A;  4L72 B;  1KT1 A;  4TX0 A;  1SYT A;  3RME A;  3I6C A;  4MSP A;  4MNK A;  2PV3 A;  1ROT A;  4WKA A;  5HBF A;  5DEZ A;  1FKJ A;  2P4V A;  4WKH A;  1YW5 A;  3WD2 A;  4TYO A;  4LAX A;  4Q22 A;  1QPL A;  1ZL1 A;  1N1A A;  5GPG A;  2RSE A;  1J4H A;  3KAC A;  2L2S A;  3WD3 A;  1LL4 A;  3W4R A;  2F21 A;  3PA7 A;  4UDM A;  4W9Q A;  1WB0 A;  4W9P A;  5BXJ A;  3AS3 A;  1Q6I A;  3UI4 A;  1E9L A;  4NNR A;  3GTY X;  1QZ2 A;  4ODR A;  4GGQ A;  1H0G A;  4U84 A;  1LQ0 A;  1LL6 A;  3O5O A;  4XAK A;  3O5I A;  2DSU A;  3CHC A;  1M5Y A;  1BL4 A;  1OWQ A;  4LAV A;  3UQA A;  1ZCN A;  3G6M A;  1EHN A;  5GPR A;  5HW6 A;  5I98 A;  1HKI A;  4ZPW R;  1ZBK A;  1JNE A;  1OGG A;  3KAD A;  3ARR A;  2MLY A;  2IF4 A;  3PR9 A;  4S3K A;  3ODK A;  2O9O A;  3O5F A;  2MNT A;  5HWC A;  2AOS A;  2F23 A;  3AS2 A;  1FKD A;  2XPA A;  3ARW A;  3IHZ A;  4Q7N A;  4NZC A;  2XP4 A;  5JH8 A;  1O6I A;  2RQS A;  1L1P A;  3OOB A;  4N19 A;  4LAW A;  3ARY A;  4L3N A;  1VF8 A;  1JND A;  3PRB A;  2MPH A;  2PI6 A;  1C9H A;  2ZQS A;  3O5L A;  4FN2 A;  4G50 A;  1JNT A;  4URI A;  1ROU A;  1ZB5 A;  3CZ8 A;  3CGN A;  5HWB A;  4C02 B;  1W1V A;  2XP3 A;  2WM0 A;  2DG4 A;  4QT2 A;  3ALF A;  3KAB A;  3LUO A;  5B8I C;  2ZQU A;  1FKG A;  3JYM A;  3IKD A;  1JNS A;  1QPF A;  1NWU A;  1A7X A;  2RUR A;  4WJX A;  4LGX A;  4DZ2 A;  2VCD A;  4DWS B;  5DIU A;  4DRN A;  3ARX A;  1ZBW A;  2ZR5 A;  2G8Z A;  4HAR A;  2N87 A;  3AS0 A;  4ZPV R;  4MNM A;  2B5U B;  4FAP A;  1FKT A;  4ML4 A;  3B8S A;  3O5P A;  1FKB A;  1HJV A;  2KGJ A;  5DO2 A;  4AY1 A;  4DWS C;  1BKF A;  2UZ5 A;  2MLZ A;  3GPK A;  1PIN A;  2XP8 A;  2DSZ A;  3PRD A;  1GRJ A;  1HJW A;  1NWT A;  1HXV A;  4KR0 B;  4JYS A;  2FDM A;  3CHE A;  2FKE A;  4HBO A;  2KI3 A;  3UI5 A;  3KAH A;  2OLH A;  4ODK A;  1ZU8 A;  2K8I A;  3NI6 A;  1KT0 A;  2WLZ A;  1E44 A;  2ESC A;  1FKR A;  3UF8 A;  4P8U A;  1LG1 A;  1FAP A;  1KFW A;  2F2D A;  3CH9 A;  1FKF A;  4ODO A;  1Q6H A;  3WD0 A;  3UI6 A;  4QZV B;  1TCO C;  1NWS A;  1E6N A; 
#chains in the Genus database with same CATH homology
 1D2K A;  2DG3 A;  1Q1C A;  1HJX A;  2RUQ A;  2YBT A;  4MNJ A;  3ARZ A;  4IPX A;  2M2A A;  4ODL A;  1WNO A;  1W26 A;  3RM8 A;  2RUD A;  3KAF A;  4MPK A;  2DPE A;  1J4R A;  1WAW A;  3B7X A;  3BXW A;  3RM9 A;  1EIB A;  4R5E A;  4Z2I A;  4IQC A;  3VAW A;  4DIP A;  2B31 A;  1E15 A;  2PPO A;  3G6L A;  2Q5A A;  2FAP A;  4TW7 A;  3CGM A;  1J6Y A;  4WK9 A;  4KQZ A;  1W9P A;  3FXY A;  4O2T A;  2VN1 A;  4WKF A;  2LJ4 A;  3MDY B;  3O5D A;  2IUZ A;  1E6P A;  3AQU A;  5HKG A;  4DRP A;  2ZR6 A;  3KAI A;  5D75 A;  4BF8 A;  1Y0O A;  2A3B A;  2ZQT A;  3OA5 A;  4ZPT R;  3TC5 A;  3JYJ A;  1FKH A;  3H9R B;  1FKS A;  1LG2 A;  4NSB A;  3FY1 A;  4JFK A;  4ODN A;  2MLX A;  3O5K A;  1ZK6 A;  2XP5 A;  5DIT A;  1X6L A;  2DT0 A;  1FKL A;  4DRQ A;  1FD9 A;  2LPV A;  2JZV A;  2O92 A;  5GQB A;  2DT2 A;  2XP9 A;  3IKG A;  1W9U A;  3FAP A;  1ZBC A;  1NMV A;  3EY6 A;  4U86 A;  3RFW A;  2PPP A;  4DWS A;  4DRJ A;  2XP7 A;  3WQW A;  1HKK A;  2PPN A;  3ARQ A;  2WLY A;  3B9A A;  4MTV A;  1PBK A;  2AWG A;  2OFN A;  4Z2L A;  1W9V A;  1GOI A;  4MNL A;  4JFI A;  3ARS A;  1E6Z A;  1E6R A;  1UR9 A;  5HW7 A;  4J4N A;  2PV2 A;  2LGO A;  3ARP A;  1D6O A;  4Z2K A;  1D7I A;  3UQI A;  2DSW A;  3O5G A;  3ARU A;  3O5J A;  1U79 A;  1F40 A;  5DF0 A;  1P5Q A;  4Z2H A;  2YBU A;  4QIB A;  2ITK A;  1OGB A;  4JFJ A;  4TW8 A;  4WIW A;  3CHF A;  3RGC A;  1FFQ A;  3PRA A;  1FKI A;  1RD6 A;  4P8W A;  4IT6 A;  1HKJ A;  2KE0 A;  2A3A A;  4ZS6 A;  2KR7 A;  3B9E A;  1ZBV A;  3B9D A;  2M08 A;  1NMW A;  4ODM A;  2Y78 A;  5DIV A;  3WIJ A;  1FFR A;  1XRV A;  4S3J A;  3TCZ A;  1W1Y A;  4GIV A;  2DT3 A;  3JXV A;  2KO7 A;  2QF8 A;  4R0X A;  2KFW A;  3IK8 A;  4ODQ A;  1NWR A;  4DRI A;  5HUA A;  2PBC A;  4U85 A;  3O5Q A;  2MF9 A;  1D7J A;  3WD1 A;  3ALG A;  4DRK A;  4QT3 A;  3NTP A;  4DRO A;  1K9T A;  4ITZ A;  1FJD A;  2PV1 A;  4DZ3 A;  5HT1 A;  1JVW A;  1EQ3 A;  1J4I A;  4PTM A;  2XPB A;  3CHD A;  5HTG A;  1Q6U A;  4Z2J A;  1D7H A;  1XHG A;  2RUC A;  3ART A;  3WL1 A;  3WQV A;  3O5E A;  1W1P A;  2LKN A;  3ARO A;  4G2P A;  3TDB A;  4IQ2 A;  2ZQV A;  4IT4 A;  3NRK A;  2F4E A;  4P8V A;  1W1T A;  2XP6 A;  4HBE A;  4DRH A;  4MGV A;  1LJY A;  2G41 A;  3UQB A;  4J4O A;  4DRM A;  2D9F A;  1IX5 A;  3RM4 A;  4P8X A;  1FKK A;  4LAY A;  1CTN A;  4ODP A;  1GPF A;  5HW8 A;  1H0I A;  4TW6 A;  4DWS D;  3O5M A;  4JFL A;  1GUV A;  3WD4 A;  1LL7 A;  4W9O A;  1EYM A;  1X6N A;  1F8A B;  2ZR4 A;  1ITX A;  1B6C A;  1EDQ A;  1T11 A;  4Z2G A;  1UR8 A;  1TFV A;  2DT1 A;  1HKM A;  2A3C A;  2WK2 A;  1R9H A;  4MAV A;  1SR0 A;  3WKZ A;  1NSG A;  3AS1 A;  1YAT A;  3KZ7 A;  1NH6 A;  4TNS A;  3WH0 A;  4W5U A;  3WL0 A;  3QOK A;  4DH0 A;  5J6E A;  3O5R A;  3KAG A;  4JFM A;  4DT4 A;  2DSV A;  3ARV A;  2M1I A;  2DG9 A;  3KCE A;  2A3E A;  4L72 B;  1KT1 A;  4TX0 A;  1SYT A;  3RME A;  3I6C A;  4MSP A;  4MNK A;  2PV3 A;  1ROT A;  4WKA A;  5HBF A;  5DEZ A;  1FKJ A;  4WKH A;  1YW5 A;  3WD2 A;  4TYO A;  4LAX A;  4Q22 A;  1QPL A;  1ZL1 A;  1N1A A;  5GPG A;  2RSE A;  1J4H A;  3KAC A;  2L2S A;  3WD3 A;  1LL4 A;  3W4R A;  2F21 A;  3PA7 A;  4W9Q A;  1WB0 A;  4W9P A;  5BXJ A;  3AS3 A;  1Q6I A;  3UI4 A;  1E9L A;  4NNR A;  1QZ2 A;  4ODR A;  4GGQ A;  1H0G A;  4U84 A;  1LQ0 A;  1LL6 A;  3O5O A;  4XAK A;  3O5I A;  2DSU A;  3CHC A;  1M5Y A;  1BL4 A;  1OWQ A;  4LAV A;  3UQA A;  1ZCN A;  3G6M A;  1EHN A;  5GPR A;  5HW6 A;  5I98 A;  1HKI A;  4ZPW R;  1ZBK A;  1JNE A;  1OGG A;  3KAD A;  3ARR A;  2MLY A;  2IF4 A;  3PR9 A;  4S3K A;  3ODK A;  2O9O A;  3O5F A;  2MNT A;  5HWC A;  2AOS A;  3AS2 A;  1FKD A;  2XPA A;  3ARW A;  3IHZ A;  4Q7N A;  4NZC A;  2XP4 A;  5JH8 A;  1O6I A;  2RQS A;  1L1P A;  3OOB A;  4N19 A;  4LAW A;  3ARY A;  4L3N A;  1VF8 A;  1JND A;  3PRB A;  2MPH A;  2PI6 A;  1C9H A;  2ZQS A;  3O5L A;  4FN2 A;  4G50 A;  1JNT A;  4URI A;  1ROU A;  1ZB5 A;  3CZ8 A;  3CGN A;  5HWB A;  4C02 B;  1W1V A;  2XP3 A;  2WM0 A;  2DG4 A;  4QT2 A;  3ALF A;  3KAB A;  3LUO A;  5B8I C;  2ZQU A;  1FKG A;  3JYM A;  3IKD A;  1JNS A;  1QPF A;  1NWU A;  1A7X A;  2RUR A;  4WJX A;  4LGX A;  4DZ2 A;  2VCD A;  4DWS B;  5DIU A;  4DRN A;  3ARX A;  1ZBW A;  2ZR5 A;  2G8Z A;  4HAR A;  2N87 A;  3AS0 A;  4ZPV R;  4MNM A;  4FAP A;  1FKT A;  4ML4 A;  3B8S A;  3O5P A;  1FKB A;  1HJV A;  2KGJ A;  5DO2 A;  4AY1 A;  4DWS C;  1BKF A;  2UZ5 A;  2MLZ A;  3GPK A;  1PIN A;  2XP8 A;  2DSZ A;  3PRD A;  1HJW A;  1NWT A;  1HXV A;  4KR0 B;  4JYS A;  2FDM A;  3CHE A;  2FKE A;  4HBO A;  2KI3 A;  3UI5 A;  3KAH A;  2OLH A;  4ODK A;  1ZU8 A;  2K8I A;  3NI6 A;  1KT0 A;  2WLZ A;  2ESC A;  1FKR A;  3UF8 A;  4P8U A;  1LG1 A;  1FAP A;  1KFW A;  2F2D A;  3CH9 A;  1FKF A;  4ODO A;  1Q6H A;  3WD0 A;  3UI6 A;  4QZV B;  1TCO C;  1NWS A;  1E6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...