4DRNA

Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with {3-[(1r)-3-(3,4-dimethoxyphenyl)-1-({[(2s)-1-{[(1s,2r)-2-ethyl-1-hydroxycyclohexyl](oxo)acetyl}piperidin-2-yl]carbonyl}oxy)propyl]phenoxy}acetic acid
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drnA00
2RQSA 2Q5AA 1F40A 4TW8A 2DG3A 2KE0A 4DRNA 2AWGA 3O5OA 2XP6A 3RFWA 4DRMA 4DH0A 3JYJA 2IF4A 3OOBA 4JFIA 1FKRA 3IKDA 2N87A 1NMVA 4QIBA 3KAHA 4DT4A 5HW6A 4IQCA 3KACA 4LAXA 2MLYA 5HWBA 4DRJA 4JFKA 1J4RA 5HTGA 4U84A 1FKBA 2VCDA 4LAYA 4DRKA 3O5JA 4ODPA 1YATA 2ZQTA 4ODOA 1ROTA 2KO7A 1N1AA 2XP5A 4DRPA 1KT1A 1Q6IA 3LUOA 3O5MA 1J6YA 2MLXA 1FKLA 1T11A 3KADA 3PRDA 4J4NA 1Q6UA 4MGVA 1P5QA 3H9RB 1JNSA 1FKJA 4ODLA 2LGOA 4G50A 2PBCA 4GGQA 3TCZA 1J4IA 2FAPA 3NI6A 3UQBA 4W9OA 4DZ3A 3WH0A 2UZ5A 4ODNA 4JFJA 4ITZA 1NMWA 3O5GA 5J6EA 2XP3A 4W9PA 3O5QA 4DRQA 3O5PA 4U85A 3IK8A 2VN1A 5HW7A 2MNTA 3CGNA 3IHZA 4TNSA 2D9FA 1Q6HA 2LKNA 2MPHA 5HKGA 5DIVA 5HT1A 4IQ2A 5HW8A 3KAIA 1HXVA 4DZ2A 3KCEA 2XPAA 1L1PA 2PV2A 1FKHA 1J4HA 3VAWA 4FAPA 2F4EA 2L2SA 4J4OA 4N19A 4O2TA 1D7JA 5D75A 2XP9A 1D7HA 3FAPA 3O5KA 1U79A 3PA7A 4BF8A 5I98A 4NNRA 3UF8A 1FKFA 3CGMA 2KFWA 3NRKA 1FKKA 2MLZA 1A7XA 3O5EA 3PRBA 3O5IA 5HUAA 4IPXA 4GIVA 2PPNA 4LAVA 2M2AA 4G2PA 3KAGA 1Q1CA 1NSGA 1C9HA 4ODRA 3KABA 1ROUA 3I6CA 2LJ4A 1JVWA 3UI4A 2F21A 3JXVA 2DG9A 5DIUA 2XPBA 2DG4A 2M1IA 2RURA 2F2DA 4ODQA 2KGJA 3EY6A 3GPKA 4R0XA 5B8IC 4DRIA 4LAWA 3NTPA 1ZK6A 4TW6A 3O5FA 4QT3A 5HWCA 1PINA 5DITA 2ZR4A 1FKIA 2XP8A 3JYMA 1BL4A 4JYSA 1EYMA 3UQIA 5BXJA 1ZCNA 1EQ3A 4TYOA 4QT2A 1PBKA 3KZ7A 3O5DA 4U86A 3UI5A 1FKDA 3UI6A 1JNTA 2RUDA 2XP7A 3O5RA 3MDYB 4JFMA 2JZVA 4DRHA 1FAPA 2PPOA 1F8AB 2PV3A 1FKGA 1QZ2A 4JFLA 1FJDA 4W9QA 4DROA 3RGCA 5GPGA 1D6OA 2OFNA 2PPPA 2ZR5A 1QPLA 1BKFA 2ZQSA 3O5LA 2RUQA 1FKSA 2FKEA 1Y0OA 1B6CA 3IKGA 4C02B 1QPFA 1R9HA 1D7IA 4MSPA 4TX0A 1KT0A 2M08A 2KI3A 4DIPA 2LPVA 2RSEA 2KR7A 2ZQUA 2Y78A 2K8IA 2ZR6A 4ODKA 3TC5A 1YW5A 3ODKA 4ODMA 1TCOC 1W26A 3UQAA 2ZQVA 1FKTA 1FD9A 1M5YA 4FN2A 2XP4A 2RUCA 4TW7A 3TDBA 2PV1A 2ITKA 3KAFA 3B7XA 2MF9A
chains in the Genus database with same CATH superfamily
2Q5AA 2FDMA 3ARQA 4TW8A 1W1VA 2XP6A 2IUZA 1W1TA 3OOBA 3IKDA 4DT4A 3KAHA 4IQCA 4JFKA 3EIPA 4W5UA 1FKBA 1KFWA 3CHEA 1ROTA 2YBTA 3ARPA 4ZPVR 3LUOA 1T11A 4J4NA 1FKJA 4ODLA 1SYTA 3UQBA 4DZ3A 2DT0A 2WLYA 4JFJA 2ESCA 4ITZA 4Z2KA 2XP3A 4DRQA 1ZBCA 1VF8A 3CGNA 3IHZA 4DWSB 4Z2JA 4IQ2A 1HJVA 1L1PA 2PV2A 4UDMA 1J4HA 3PR9A 2B5UB 3RM9A 4URIA 1D7JA 4P8WA 2F23A 3O5KA 3CGMA 1LL4A 3PRBA 3WD4A 2MLZA 1A7XA 3O5IA 1NSGA 2WLZA 3WD3A 1W9PA 1LQ0A 2F21A 5GQBA 1UR8A 2XPBA 2DG4A 2M1IA 4R0XA 1EDQA 3WQVA 4NZCA 3CHFA 3O5FA 4QT3A 2ZR4A 1BL4A 1EYMA 1E15A 1IX5A 1H0IA 4MNKA 4QT2A 3O5DA 1FKDA 3O5RA 3CZ8A 4JFMA 2JZVA 1JCHB 2PV3A 4MTVA 4W9QA 5DF0A 2P4VA 4DROA 1D6OA 1ZBVA 1QPLA 1W9VA 3AROA 1FKSA 3RM8A 4MSPA 4DIPA 4ODKA 4Z2IA 2ZQVA 3B9EA 1K9TA 3TDBA 2ITKA 1NWRA 4GIVA 2RQSA 1F40A 2KE0A 2AWGA 2WK2A 4JFIA 4LAXA 1J4RA 5HTGA 4U84A 4IT4A 4WKFA 1Q6IA 1UR9A 1Q6UA 3H9RB 1X6NA 4G50A 3TCZA 3NI6A 4W9OA 2B31A 3WH0A 1W1YA 2PN0A 3O5GA 5J6EA 3O5QA 4U85A 3BXWA 2VN1A 5HW7A 2MNTA 1XRVA 4P8VA 4WIWA 4Z2LA 2MPHA 4HBEA 5HKGA 3G6LA 3AQUA 5DIVA 1FKHA 3PRAA 2F4EA 2XP9A 1D7HA 2OLHA 4WJXA 5HBFA 2KFWA 2PPNA 1Q1CA 3I6CA 2LJ4A 2DG9A 1NH6A 2DT2A 2QF8A 4ODQA 2KGJA 3GPKA 4DRIA 1ZK6A 5HWCA 1PINA 1ITXA 5DITA 1HKIA 3UQIA 1JNEA 1EQ3A 4TYOA 1PBKA 3KZ7A 3QOKA 3ARSA 4XAKA 3G6MA 2A3EA 1FFRA 1JNTA 4DRHA 2XP7A 3MDYB 1WAWA 2A3CA 1W9UA 1NWUA 1FKGA 1QZ2A 3ARRA 3RGCA 1X6LA 2PPPA 1HKKA 3O5LA 4DWSD 1B6CA 3IKGA 1QPFA 4TX0A 2WM0A 3TC5A 2ZR6A 3VAWA 2K8IA 4FAPA 3OA5A 3ODKA 3UQAA 1FD9A 1O6IA 2PV1A 2DT1A 2DG3A 1OGBA 4DRNA 3ARXA 4MAVA 3RFWA 4DH0A 2IF4A 1GUVA 1FKRA 4L72B 4QIBA 3KACA 2MLYA 1HJWA 5GPRA 2VCDA 4ODPA 1YATA 4ODOA 4PTMA 1GRJA 2KO7A 4DRPA 1KT1A 4LGXA 3O5MA 2MLXA 1FKLA 3PRDA 1JNSA 2PBCA 4ML4A 1J4IA 1LL7A 1D2KA 2AOSA 1NMWA 4W9PA 1ZB5A 3CHCA 2LKNA 3WD1A 5HT1A 5HW8A 3KAIA 1NWTA 2XPAA 4J4OA 4N19A 2DSWA 5D75A 4L3NA 3FAPA 4BF8A 1TFVA 1RD6A 1FKFA 1HKJA 5HUAA 3WQWA 2M2AA 4KR0B 1ROUA 2DT3A 3UI4A 4AY1A 3JXVA 5DIUA 2RURA 2F2DA 1ZU8A 1WB0A 3EY6A 3ARTA 5B8IC 5DO2A 4LAWA 3NTPA 4TW6A 4WK9A 3B9DA 1FKIA 2XP8A 3JYMA 3WD0A 5BXJA 1JNDA 1W1PA 1ZCNA 4ZPWR 1LG2A 4MNJA 3ARYA 4Q22A 3UI5A 3WL1A 1ZL1A 3GU0A 4Z2HA 3UI6A 1CTNA 4ZS6A 1FAPA 2PPOA 1FJDA 1HJXA 4Z2GA 3B8SA 3AS2A 3CH9A 2RUQA 2FKEA 1Y0OA 2ETNA 4MPKA 2KI3A 2LPVA 2KR7A 4DRMA 1FFQA 1YW5A 3ALFA 3ARWA 4FN2A 1ZBWA 2RUCA 3O5OA 3AS1A 1EIBA 3JYJA 4Q7NA 2N87A 1NMVA 5HW6A 5HWBA 1NWSA 4DRJA 4DRKA 4LAYA 3O5JA 2O92A 2ZQTA 4DWSC 3WKZA 1N1AA 2XP5A 1E6PA 2DSUA 4R5EA 1J6YA 3KADA 3BMBA 4MGVA 1P5QA 1E6RA 2LGOA 4GGQA 4WKAA 2FAPA 3RM4A 2UZ5A 4ODNA 1E6NA 3O5PA 3IK8A 2G8ZA 4NSBA 4TNSA 2D9FA 1Q6HA 3FXYA 1HXVA 4DZ2A 3KCEA 4S3JA 3ARZA 4MNLA 2L2SA 2YBUA 3AS0A 4O2TA 4HBOA 4WKHA 1E6ZA 5DEZA 1E44A 3PA7A 3ALGA 1U79A 3FY1A 5I98A 4NNRA 3RMEA 3UF8A 3NRKA 3O5EA 1FKKA 3ARVA 4IPXA 2G41A 4DWSA 4LAVA 1H0GA 4G2PA 3KAGA 1C9HA 2DSVA 2DPEA 4ODRA 3KABA 1E9LA 4S3KA 1JVWA 3ARUA 3WL0A 3AS3A 4QZVB 1LG1A 3WIJA 1LJYA 3WD2A 1LL6A 4P8UA 4JYSA 4ZPTR 2O9OA 4P8XA 1SR0A 4MNMA 1XHGA 3B9AA 4U86A 1ZBKA 2A3AA 1GPFA 2RUDA 1GOIA 2DSZA 3CHDA 1F8AB 4JFLA 1HKMA 2A3BA 3GTYX 5GPGA 1WNOA 2OFNA 2ZR5A 4IT6A 1BKFA 2ZQSA 4C02B 4HARA 1R9HA 1D7IA 1KT0A 2M08A 5JH8A 2RSEA 2ZQUA 4KQZA 2Y78A 3W4RA 1OGGA 4ODMA 1TCOC 1W26A 1FKTA 1M5YA 2EULA 2PI6A 2XP4A 4TW7A 1EHNA 3KAFA 3B7XA 2MF9A 1OWQA
chains in the Genus database with same CATH topology
2Q5AA 2FDMA 3ARQA 4TW8A 1W1VA 2XP6A 2IUZA 1W1TA 3OOBA 3IKDA 4DT4A 3KAHA 4IQCA 4JFKA 4W5UA 1FKBA 1KFWA 3CHEA 1ROTA 2YBTA 3ARPA 4ZPVR 3LUOA 1T11A 4J4NA 1FKJA 4ODLA 1SYTA 3UQBA 4DZ3A 2DT0A 2WLYA 4JFJA 2ESCA 4ITZA 4Z2KA 2XP3A 4DRQA 1ZBCA 1VF8A 3CGNA 3IHZA 4DWSB 4Z2JA 4IQ2A 1HJVA 1L1PA 2PV2A 1J4HA 3PR9A 3RM9A 4URIA 1D7JA 4P8WA 3O5KA 3CGMA 1LL4A 3PRBA 3WD4A 2MLZA 1A7XA 3O5IA 1NSGA 2WLZA 3WD3A 1W9PA 1LQ0A 2F21A 5GQBA 1UR8A 2XPBA 2DG4A 2M1IA 4R0XA 1EDQA 3WQVA 4NZCA 3CHFA 3O5FA 4QT3A 2ZR4A 1BL4A 1EYMA 1E15A 1IX5A 1H0IA 4MNKA 4QT2A 3O5DA 1FKDA 3O5RA 3CZ8A 4JFMA 2JZVA 2PV3A 4MTVA 4W9QA 5DF0A 4DROA 1D6OA 1ZBVA 1QPLA 1W9VA 3AROA 1FKSA 3RM8A 4MSPA 4DIPA 4ODKA 4Z2IA 2ZQVA 3B9EA 1K9TA 3TDBA 2ITKA 1NWRA 4GIVA 2RQSA 1F40A 2KE0A 2AWGA 2WK2A 4JFIA 4LAXA 1J4RA 5HTGA 4U84A 4IT4A 4WKFA 1Q6IA 1UR9A 1Q6UA 3H9RB 1X6NA 4G50A 3TCZA 3NI6A 4W9OA 2B31A 3WH0A 1W1YA 3O5GA 5J6EA 3O5QA 4U85A 3BXWA 2VN1A 5HW7A 2MNTA 1XRVA 4P8VA 4WIWA 4Z2LA 2MPHA 4HBEA 5HKGA 3G6LA 3AQUA 5DIVA 1FKHA 3PRAA 2F4EA 2XP9A 1D7HA 2OLHA 4WJXA 5HBFA 2KFWA 2PPNA 1Q1CA 3I6CA 2LJ4A 2DG9A 1NH6A 2DT2A 2QF8A 4ODQA 2KGJA 3GPKA 4DRIA 1ZK6A 5HWCA 1PINA 1ITXA 5DITA 1HKIA 3UQIA 1JNEA 1EQ3A 4TYOA 1PBKA 3KZ7A 3QOKA 3ARSA 4XAKA 3G6MA 2A3EA 1FFRA 1JNTA 4DRHA 2XP7A 3MDYB 1WAWA 2A3CA 1W9UA 1NWUA 1FKGA 1QZ2A 3ARRA 3RGCA 1X6LA 2PPPA 1HKKA 3O5LA 4DWSD 1B6CA 3IKGA 1QPFA 4TX0A 2WM0A 3TC5A 2ZR6A 3VAWA 2K8IA 4FAPA 3OA5A 3ODKA 3UQAA 1FD9A 1O6IA 2PV1A 2DT1A 2DG3A 1OGBA 4DRNA 3ARXA 4MAVA 3RFWA 4DH0A 2IF4A 1GUVA 1FKRA 4L72B 4QIBA 3KACA 2MLYA 1HJWA 5GPRA 2VCDA 4ODPA 1YATA 4ODOA 4PTMA 2KO7A 4DRPA 1KT1A 4LGXA 3O5MA 2MLXA 1FKLA 3PRDA 1JNSA 2PBCA 4ML4A 1J4IA 1LL7A 1D2KA 2AOSA 1NMWA 4W9PA 1ZB5A 3CHCA 2LKNA 3WD1A 5HT1A 5HW8A 3KAIA 1NWTA 2XPAA 4J4OA 4N19A 2DSWA 5D75A 4L3NA 3FAPA 4BF8A 1TFVA 1RD6A 1FKFA 1HKJA 5HUAA 3WQWA 2M2AA 4KR0B 1ROUA 2DT3A 3UI4A 4AY1A 3JXVA 5DIUA 2RURA 2F2DA 1ZU8A 1WB0A 3EY6A 3ARTA 5B8IC 5DO2A 4LAWA 3NTPA 4TW6A 4WK9A 3B9DA 1FKIA 2XP8A 3JYMA 3WD0A 5BXJA 1JNDA 1W1PA 1ZCNA 4ZPWR 1LG2A 4MNJA 3ARYA 4Q22A 3UI5A 3WL1A 1ZL1A 4Z2HA 3UI6A 1CTNA 4ZS6A 1FAPA 2PPOA 1FJDA 1HJXA 4Z2GA 3B8SA 3AS2A 3CH9A 2RUQA 2FKEA 1Y0OA 4MPKA 2KI3A 2LPVA 2KR7A 4DRMA 1FFQA 1YW5A 3ALFA 3ARWA 4FN2A 1ZBWA 2RUCA 3O5OA 3AS1A 1EIBA 3JYJA 4Q7NA 2N87A 1NMVA 5HW6A 5HWBA 1NWSA 4DRJA 4DRKA 4LAYA 3O5JA 2O92A 2ZQTA 4DWSC 3WKZA 1N1AA 2XP5A 1E6PA 2DSUA 4R5EA 1J6YA 3KADA 4MGVA 1P5QA 1E6RA 2LGOA 4GGQA 4WKAA 2FAPA 3RM4A 2UZ5A 4ODNA 1E6NA 3O5PA 3IK8A 2G8ZA 4NSBA 4TNSA 2D9FA 1Q6HA 3FXYA 1HXVA 4DZ2A 3KCEA 4S3JA 3ARZA 4MNLA 2L2SA 2YBUA 3AS0A 4O2TA 4HBOA 4WKHA 1E6ZA 5DEZA 3PA7A 3ALGA 1U79A 3FY1A 5I98A 4NNRA 3RMEA 3UF8A 3NRKA 3O5EA 1FKKA 3ARVA 4IPXA 2G41A 4DWSA 4LAVA 1H0GA 4G2PA 3KAGA 1C9HA 2DSVA 2DPEA 4ODRA 3KABA 1E9LA 4S3KA 1JVWA 3ARUA 3WL0A 3AS3A 4QZVB 1LG1A 3WIJA 1LJYA 3WD2A 1LL6A 4P8UA 4JYSA 4ZPTR 2O9OA 4P8XA 1SR0A 4MNMA 1XHGA 3B9AA 4U86A 1ZBKA 2A3AA 1GPFA 2RUDA 1GOIA 2DSZA 3CHDA 1F8AB 4JFLA 1HKMA 2A3BA 5GPGA 1WNOA 2OFNA 2ZR5A 4IT6A 1BKFA 2ZQSA 4C02B 4HARA 1R9HA 1D7IA 1KT0A 2M08A 5JH8A 2RSEA 2ZQUA 4KQZA 2Y78A 3W4RA 1OGGA 4ODMA 1TCOC 1W26A 1FKTA 1M5YA 2PI6A 2XP4A 4TW7A 1EHNA 3KAFA 3B7XA 2MF9A 1OWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQS A;  2Q5A A;  1F40 A;  4TW8 A;  2DG3 A;  2KE0 A;  4DRN A;  2AWG A;  3O5O A;  2XP6 A;  3RFW A;  4DRM A;  4DH0 A;  3JYJ A;  2IF4 A;  3OOB A;  4JFI A;  1FKR A;  3IKD A;  2N87 A;  1NMV A;  4QIB A;  3KAH A;  4DT4 A;  5HW6 A;  4IQC A;  3KAC A;  4LAX A;  2MLY A;  5HWB A;  4DRJ A;  4JFK A;  1J4R A;  5HTG A;  4U84 A;  1FKB A;  2VCD A;  4LAY A;  4DRK A;  3O5J A;  4ODP A;  1YAT A;  2ZQT A;  4ODO A;  1ROT A;  2KO7 A;  1N1A A;  2XP5 A;  4DRP A;  1KT1 A;  1Q6I A;  3LUO A;  3O5M A;  1J6Y A;  2MLX A;  1FKL A;  1T11 A;  3KAD A;  3PRD A;  4J4N A;  1Q6U A;  4MGV A;  1P5Q A;  3H9R B;  1JNS A;  1FKJ A;  4ODL A;  2LGO A;  4G50 A;  2PBC A;  4GGQ A;  3TCZ A;  1J4I A;  2FAP A;  3NI6 A;  3UQB A;  4W9O A;  4DZ3 A;  3WH0 A;  2UZ5 A;  4ODN A;  4JFJ A;  4ITZ A;  1NMW A;  3O5G A;  5J6E A;  2XP3 A;  4W9P A;  3O5Q A;  4DRQ A;  3O5P A;  4U85 A;  3IK8 A;  2VN1 A;  5HW7 A;  2MNT A;  3CGN A;  3IHZ A;  4TNS A;  2D9F A;  1Q6H A;  2LKN A;  2MPH A;  5HKG A;  5DIV A;  5HT1 A;  4IQ2 A;  5HW8 A;  3KAI A;  1HXV A;  4DZ2 A;  3KCE A;  2XPA A;  1L1P A;  2PV2 A;  1FKH A;  1J4H A;  3VAW A;  4FAP A;  2F4E A;  2L2S A;  4J4O A;  4N19 A;  4O2T A;  1D7J A;  5D75 A;  2XP9 A;  1D7H A;  3FAP A;  3O5K A;  1U79 A;  3PA7 A;  4BF8 A;  5I98 A;  4NNR A;  3UF8 A;  1FKF A;  3CGM A;  2KFW A;  3NRK A;  1FKK A;  2MLZ A;  1A7X A;  3O5E A;  3PRB A;  3O5I A;  5HUA A;  4IPX A;  4GIV A;  2PPN A;  4LAV A;  2M2A A;  4G2P A;  3KAG A;  1Q1C A;  1NSG A;  1C9H A;  4ODR A;  3KAB A;  1ROU A;  3I6C A;  2LJ4 A;  1JVW A;  3UI4 A;  2F21 A;  3JXV A;  2DG9 A;  5DIU A;  2XPB A;  2DG4 A;  2M1I A;  2RUR A;  2F2D A;  4ODQ A;  2KGJ A;  3EY6 A;  3GPK A;  4R0X A;  5B8I C;  4DRI A;  4LAW A;  3NTP A;  1ZK6 A;  4TW6 A;  3O5F A;  4QT3 A;  5HWC A;  1PIN A;  5DIT A;  2ZR4 A;  1FKI A;  2XP8 A;  3JYM A;  1BL4 A;  4JYS A;  1EYM A;  3UQI A;  5BXJ A;  1ZCN A;  1EQ3 A;  4TYO A;  4QT2 A;  1PBK A;  3KZ7 A;  3O5D A;  4U86 A;  3UI5 A;  1FKD A;  3UI6 A;  1JNT A;  2RUD A;  2XP7 A;  3O5R A;  3MDY B;  4JFM A;  2JZV A;  4DRH A;  1FAP A;  2PPO A;  1F8A B;  2PV3 A;  1FKG A;  1QZ2 A;  4JFL A;  1FJD A;  4W9Q A;  4DRO A;  3RGC A;  5GPG A;  1D6O A;  2OFN A;  2PPP A;  2ZR5 A;  1QPL A;  1BKF A;  2ZQS A;  3O5L A;  2RUQ A;  1FKS A;  2FKE A;  1Y0O A;  1B6C A;  3IKG A;  4C02 B;  1QPF A;  1R9H A;  1D7I A;  4MSP A;  4TX0 A;  1KT0 A;  2M08 A;  2KI3 A;  4DIP A;  2LPV A;  2RSE A;  2KR7 A;  2ZQU A;  2Y78 A;  2K8I A;  2ZR6 A;  4ODK A;  3TC5 A;  1YW5 A;  3ODK A;  4ODM A;  1TCO C;  1W26 A;  3UQA A;  2ZQV A;  1FKT A;  1FD9 A;  1M5Y A;  4FN2 A;  2XP4 A;  2RUC A;  4TW7 A;  3TDB A;  2PV1 A;  2ITK A;  3KAF A;  3B7X A;  2MF9 A; 
#chains in the Genus database with same CATH topology
 2Q5A A;  2FDM A;  3ARQ A;  4TW8 A;  1W1V A;  2XP6 A;  2IUZ A;  1W1T A;  3OOB A;  3IKD A;  4DT4 A;  3KAH A;  4IQC A;  4JFK A;  3EIP A;  4W5U A;  1FKB A;  1KFW A;  3CHE A;  1ROT A;  2YBT A;  3ARP A;  4ZPV R;  3LUO A;  1T11 A;  4J4N A;  1FKJ A;  4ODL A;  1SYT A;  3UQB A;  4DZ3 A;  2DT0 A;  2WLY A;  4JFJ A;  2ESC A;  4ITZ A;  4Z2K A;  2XP3 A;  4DRQ A;  1ZBC A;  1VF8 A;  3CGN A;  3IHZ A;  4DWS B;  4Z2J A;  4IQ2 A;  1HJV A;  1L1P A;  2PV2 A;  4UDM A;  1J4H A;  3PR9 A;  2B5U B;  3RM9 A;  4URI A;  1D7J A;  4P8W A;  2F23 A;  3O5K A;  3CGM A;  1LL4 A;  3PRB A;  3WD4 A;  2MLZ A;  1A7X A;  3O5I A;  1NSG A;  2WLZ A;  3WD3 A;  1W9P A;  1LQ0 A;  2F21 A;  5GQB A;  1UR8 A;  2XPB A;  2DG4 A;  2M1I A;  4R0X A;  1EDQ A;  3WQV A;  4NZC A;  3CHF A;  3O5F A;  4QT3 A;  2ZR4 A;  1BL4 A;  1EYM A;  1E15 A;  1IX5 A;  1H0I A;  4MNK A;  4QT2 A;  3O5D A;  1FKD A;  3O5R A;  3CZ8 A;  4JFM A;  2JZV A;  1JCH B;  2PV3 A;  4MTV A;  4W9Q A;  5DF0 A;  2P4V A;  4DRO A;  1D6O A;  1ZBV A;  1QPL A;  1W9V A;  3ARO A;  1FKS A;  3RM8 A;  4MSP A;  4DIP A;  4ODK A;  4Z2I A;  2ZQV A;  3B9E A;  1K9T A;  3TDB A;  2ITK A;  1NWR A;  4GIV A;  2RQS A;  1F40 A;  2KE0 A;  2AWG A;  2WK2 A;  4JFI A;  4LAX A;  1J4R A;  5HTG A;  4U84 A;  4IT4 A;  4WKF A;  1Q6I A;  1UR9 A;  1Q6U A;  3H9R B;  1X6N A;  4G50 A;  3TCZ A;  3NI6 A;  4W9O A;  2B31 A;  3WH0 A;  1W1Y A;  2PN0 A;  3O5G A;  5J6E A;  3O5Q A;  4U85 A;  3BXW A;  2VN1 A;  5HW7 A;  2MNT A;  1XRV A;  4P8V A;  4WIW A;  4Z2L A;  2MPH A;  4HBE A;  5HKG A;  3G6L A;  3AQU A;  5DIV A;  1FKH A;  3PRA A;  2F4E A;  2XP9 A;  1D7H A;  2OLH A;  4WJX A;  5HBF A;  2KFW A;  2PPN A;  1Q1C A;  3I6C A;  2LJ4 A;  2DG9 A;  1NH6 A;  2DT2 A;  2QF8 A;  4ODQ A;  2KGJ A;  3GPK A;  4DRI A;  1ZK6 A;  5HWC A;  1PIN A;  1ITX A;  5DIT A;  1HKI A;  3UQI A;  1JNE A;  1EQ3 A;  4TYO A;  1PBK A;  3KZ7 A;  3QOK A;  3ARS A;  4XAK A;  3G6M A;  2A3E A;  1FFR A;  1JNT A;  4DRH A;  2XP7 A;  3MDY B;  1WAW A;  2A3C A;  1W9U A;  1NWU A;  1FKG A;  1QZ2 A;  3ARR A;  3RGC A;  1X6L A;  2PPP A;  1HKK A;  3O5L A;  4DWS D;  1B6C A;  3IKG A;  1QPF A;  4TX0 A;  2WM0 A;  3TC5 A;  2ZR6 A;  3VAW A;  2K8I A;  4FAP A;  3OA5 A;  3ODK A;  3UQA A;  1FD9 A;  1O6I A;  2PV1 A;  2DT1 A;  2DG3 A;  1OGB A;  4DRN A;  3ARX A;  4MAV A;  3RFW A;  4DH0 A;  2IF4 A;  1GUV A;  1FKR A;  4L72 B;  4QIB A;  3KAC A;  2MLY A;  1HJW A;  5GPR A;  2VCD A;  4ODP A;  1YAT A;  4ODO A;  4PTM A;  1GRJ A;  2KO7 A;  4DRP A;  1KT1 A;  4LGX A;  3O5M A;  2MLX A;  1FKL A;  3PRD A;  1JNS A;  2PBC A;  4ML4 A;  1J4I A;  1LL7 A;  1D2K A;  2AOS A;  1NMW A;  4W9P A;  1ZB5 A;  3CHC A;  2LKN A;  3WD1 A;  5HT1 A;  5HW8 A;  3KAI A;  1NWT A;  2XPA A;  4J4O A;  4N19 A;  2DSW A;  5D75 A;  4L3N A;  3FAP A;  4BF8 A;  1TFV A;  1RD6 A;  1FKF A;  1HKJ A;  5HUA A;  3WQW A;  2M2A A;  4KR0 B;  1ROU A;  2DT3 A;  3UI4 A;  4AY1 A;  3JXV A;  5DIU A;  2RUR A;  2F2D A;  1ZU8 A;  1WB0 A;  3EY6 A;  3ART A;  5B8I C;  5DO2 A;  4LAW A;  3NTP A;  4TW6 A;  4WK9 A;  3B9D A;  1FKI A;  2XP8 A;  3JYM A;  3WD0 A;  5BXJ A;  1JND A;  1W1P A;  1ZCN A;  4ZPW R;  1LG2 A;  4MNJ A;  3ARY A;  4Q22 A;  3UI5 A;  3WL1 A;  1ZL1 A;  3GU0 A;  4Z2H A;  3UI6 A;  1CTN A;  4ZS6 A;  1FAP A;  2PPO A;  1FJD A;  1HJX A;  4Z2G A;  3B8S A;  3AS2 A;  3CH9 A;  2RUQ A;  2FKE A;  1Y0O A;  2ETN A;  4MPK A;  2KI3 A;  2LPV A;  2KR7 A;  4DRM A;  1FFQ A;  1YW5 A;  3ALF A;  3ARW A;  4FN2 A;  1ZBW A;  2RUC A;  3O5O A;  3AS1 A;  1EIB A;  3JYJ A;  4Q7N A;  2N87 A;  1NMV A;  5HW6 A;  5HWB A;  1NWS A;  4DRJ A;  4DRK A;  4LAY A;  3O5J A;  2O92 A;  2ZQT A;  4DWS C;  3WKZ A;  1N1A A;  2XP5 A;  1E6P A;  2DSU A;  4R5E A;  1J6Y A;  3KAD A;  3BMB A;  4MGV A;  1P5Q A;  1E6R A;  2LGO A;  4GGQ A;  4WKA A;  2FAP A;  3RM4 A;  2UZ5 A;  4ODN A;  1E6N A;  3O5P A;  3IK8 A;  2G8Z A;  4NSB A;  4TNS A;  2D9F A;  1Q6H A;  3FXY A;  1HXV A;  4DZ2 A;  3KCE A;  4S3J A;  3ARZ A;  4MNL A;  2L2S A;  2YBU A;  3AS0 A;  4O2T A;  4HBO A;  4WKH A;  1E6Z A;  5DEZ A;  1E44 A;  3PA7 A;  3ALG A;  1U79 A;  3FY1 A;  5I98 A;  4NNR A;  3RME A;  3UF8 A;  3NRK A;  3O5E A;  1FKK A;  3ARV A;  4IPX A;  2G41 A;  4DWS A;  4LAV A;  1H0G A;  4G2P A;  3KAG A;  1C9H A;  2DSV A;  2DPE A;  4ODR A;  3KAB A;  1E9L A;  4S3K A;  1JVW A;  3ARU A;  3WL0 A;  3AS3 A;  4QZV B;  1LG1 A;  3WIJ A;  1LJY A;  3WD2 A;  1LL6 A;  4P8U A;  4JYS A;  4ZPT R;  2O9O A;  4P8X A;  1SR0 A;  4MNM A;  1XHG A;  3B9A A;  4U86 A;  1ZBK A;  2A3A A;  1GPF A;  2RUD A;  1GOI A;  2DSZ A;  3CHD A;  1F8A B;  4JFL A;  1HKM A;  2A3B A;  3GTY X;  5GPG A;  1WNO A;  2OFN A;  2ZR5 A;  4IT6 A;  1BKF A;  2ZQS A;  4C02 B;  4HAR A;  1R9H A;  1D7I A;  1KT0 A;  2M08 A;  5JH8 A;  2RSE A;  2ZQU A;  4KQZ A;  2Y78 A;  3W4R A;  1OGG A;  4ODM A;  1TCO C;  1W26 A;  1FKT A;  1M5Y A;  2EUL A;  2PI6 A;  2XP4 A;  4TW7 A;  1EHN A;  3KAF A;  3B7X A;  2MF9 A;  1OWQ A; 
#chains in the Genus database with same CATH homology
 2Q5A A;  2FDM A;  3ARQ A;  4TW8 A;  1W1V A;  2XP6 A;  2IUZ A;  1W1T A;  3OOB A;  3IKD A;  4DT4 A;  3KAH A;  4IQC A;  4JFK A;  4W5U A;  1FKB A;  1KFW A;  3CHE A;  1ROT A;  2YBT A;  3ARP A;  4ZPV R;  3LUO A;  1T11 A;  4J4N A;  1FKJ A;  4ODL A;  1SYT A;  3UQB A;  4DZ3 A;  2DT0 A;  2WLY A;  4JFJ A;  2ESC A;  4ITZ A;  4Z2K A;  2XP3 A;  4DRQ A;  1ZBC A;  1VF8 A;  3CGN A;  3IHZ A;  4DWS B;  4Z2J A;  4IQ2 A;  1HJV A;  1L1P A;  2PV2 A;  1J4H A;  3PR9 A;  3RM9 A;  4URI A;  1D7J A;  4P8W A;  3O5K A;  3CGM A;  1LL4 A;  3PRB A;  3WD4 A;  2MLZ A;  1A7X A;  3O5I A;  1NSG A;  2WLZ A;  3WD3 A;  1W9P A;  1LQ0 A;  2F21 A;  5GQB A;  1UR8 A;  2XPB A;  2DG4 A;  2M1I A;  4R0X A;  1EDQ A;  3WQV A;  4NZC A;  3CHF A;  3O5F A;  4QT3 A;  2ZR4 A;  1BL4 A;  1EYM A;  1E15 A;  1IX5 A;  1H0I A;  4MNK A;  4QT2 A;  3O5D A;  1FKD A;  3O5R A;  3CZ8 A;  4JFM A;  2JZV A;  2PV3 A;  4MTV A;  4W9Q A;  5DF0 A;  4DRO A;  1D6O A;  1ZBV A;  1QPL A;  1W9V A;  3ARO A;  1FKS A;  3RM8 A;  4MSP A;  4DIP A;  4ODK A;  4Z2I A;  2ZQV A;  3B9E A;  1K9T A;  3TDB A;  2ITK A;  1NWR A;  4GIV A;  2RQS A;  1F40 A;  2KE0 A;  2AWG A;  2WK2 A;  4JFI A;  4LAX A;  1J4R A;  5HTG A;  4U84 A;  4IT4 A;  4WKF A;  1Q6I A;  1UR9 A;  1Q6U A;  3H9R B;  1X6N A;  4G50 A;  3TCZ A;  3NI6 A;  4W9O A;  2B31 A;  3WH0 A;  1W1Y A;  3O5G A;  5J6E A;  3O5Q A;  4U85 A;  3BXW A;  2VN1 A;  5HW7 A;  2MNT A;  1XRV A;  4P8V A;  4WIW A;  4Z2L A;  2MPH A;  4HBE A;  5HKG A;  3G6L A;  3AQU A;  5DIV A;  1FKH A;  3PRA A;  2F4E A;  2XP9 A;  1D7H A;  2OLH A;  4WJX A;  5HBF A;  2KFW A;  2PPN A;  1Q1C A;  3I6C A;  2LJ4 A;  2DG9 A;  1NH6 A;  2DT2 A;  2QF8 A;  4ODQ A;  2KGJ A;  3GPK A;  4DRI A;  1ZK6 A;  5HWC A;  1PIN A;  1ITX A;  5DIT A;  1HKI A;  3UQI A;  1JNE A;  1EQ3 A;  4TYO A;  1PBK A;  3KZ7 A;  3QOK A;  3ARS A;  4XAK A;  3G6M A;  2A3E A;  1FFR A;  1JNT A;  4DRH A;  2XP7 A;  3MDY B;  1WAW A;  2A3C A;  1W9U A;  1NWU A;  1FKG A;  1QZ2 A;  3ARR A;  3RGC A;  1X6L A;  2PPP A;  1HKK A;  3O5L A;  4DWS D;  1B6C A;  3IKG A;  1QPF A;  4TX0 A;  2WM0 A;  3TC5 A;  2ZR6 A;  3VAW A;  2K8I A;  4FAP A;  3OA5 A;  3ODK A;  3UQA A;  1FD9 A;  1O6I A;  2PV1 A;  2DT1 A;  2DG3 A;  1OGB A;  4DRN A;  3ARX A;  4MAV A;  3RFW A;  4DH0 A;  2IF4 A;  1GUV A;  1FKR A;  4L72 B;  4QIB A;  3KAC A;  2MLY A;  1HJW A;  5GPR A;  2VCD A;  4ODP A;  1YAT A;  4ODO A;  4PTM A;  2KO7 A;  4DRP A;  1KT1 A;  4LGX A;  3O5M A;  2MLX A;  1FKL A;  3PRD A;  1JNS A;  2PBC A;  4ML4 A;  1J4I A;  1LL7 A;  1D2K A;  2AOS A;  1NMW A;  4W9P A;  1ZB5 A;  3CHC A;  2LKN A;  3WD1 A;  5HT1 A;  5HW8 A;  3KAI A;  1NWT A;  2XPA A;  4J4O A;  4N19 A;  2DSW A;  5D75 A;  4L3N A;  3FAP A;  4BF8 A;  1TFV A;  1RD6 A;  1FKF A;  1HKJ A;  5HUA A;  3WQW A;  2M2A A;  4KR0 B;  1ROU A;  2DT3 A;  3UI4 A;  4AY1 A;  3JXV A;  5DIU A;  2RUR A;  2F2D A;  1ZU8 A;  1WB0 A;  3EY6 A;  3ART A;  5B8I C;  5DO2 A;  4LAW A;  3NTP A;  4TW6 A;  4WK9 A;  3B9D A;  1FKI A;  2XP8 A;  3JYM A;  3WD0 A;  5BXJ A;  1JND A;  1W1P A;  1ZCN A;  4ZPW R;  1LG2 A;  4MNJ A;  3ARY A;  4Q22 A;  3UI5 A;  3WL1 A;  1ZL1 A;  4Z2H A;  3UI6 A;  1CTN A;  4ZS6 A;  1FAP A;  2PPO A;  1FJD A;  1HJX A;  4Z2G A;  3B8S A;  3AS2 A;  3CH9 A;  2RUQ A;  2FKE A;  1Y0O A;  4MPK A;  2KI3 A;  2LPV A;  2KR7 A;  4DRM A;  1FFQ A;  1YW5 A;  3ALF A;  3ARW A;  4FN2 A;  1ZBW A;  2RUC A;  3O5O A;  3AS1 A;  1EIB A;  3JYJ A;  4Q7N A;  2N87 A;  1NMV A;  5HW6 A;  5HWB A;  1NWS A;  4DRJ A;  4DRK A;  4LAY A;  3O5J A;  2O92 A;  2ZQT A;  4DWS C;  3WKZ A;  1N1A A;  2XP5 A;  1E6P A;  2DSU A;  4R5E A;  1J6Y A;  3KAD A;  4MGV A;  1P5Q A;  1E6R A;  2LGO A;  4GGQ A;  4WKA A;  2FAP A;  3RM4 A;  2UZ5 A;  4ODN A;  1E6N A;  3O5P A;  3IK8 A;  2G8Z A;  4NSB A;  4TNS A;  2D9F A;  1Q6H A;  3FXY A;  1HXV A;  4DZ2 A;  3KCE A;  4S3J A;  3ARZ A;  4MNL A;  2L2S A;  2YBU A;  3AS0 A;  4O2T A;  4HBO A;  4WKH A;  1E6Z A;  5DEZ A;  3PA7 A;  3ALG A;  1U79 A;  3FY1 A;  5I98 A;  4NNR A;  3RME A;  3UF8 A;  3NRK A;  3O5E A;  1FKK A;  3ARV A;  4IPX A;  2G41 A;  4DWS A;  4LAV A;  1H0G A;  4G2P A;  3KAG A;  1C9H A;  2DSV A;  2DPE A;  4ODR A;  3KAB A;  1E9L A;  4S3K A;  1JVW A;  3ARU A;  3WL0 A;  3AS3 A;  4QZV B;  1LG1 A;  3WIJ A;  1LJY A;  3WD2 A;  1LL6 A;  4P8U A;  4JYS A;  4ZPT R;  2O9O A;  4P8X A;  1SR0 A;  4MNM A;  1XHG A;  3B9A A;  4U86 A;  1ZBK A;  2A3A A;  1GPF A;  2RUD A;  1GOI A;  2DSZ A;  3CHD A;  1F8A B;  4JFL A;  1HKM A;  2A3B A;  5GPG A;  1WNO A;  2OFN A;  2ZR5 A;  4IT6 A;  1BKF A;  2ZQS A;  4C02 B;  4HAR A;  1R9H A;  1D7I A;  1KT0 A;  2M08 A;  5JH8 A;  2RSE A;  2ZQU A;  4KQZ A;  2Y78 A;  3W4R A;  1OGG A;  4ODM A;  1TCO C;  1W26 A;  1FKT A;  1M5Y A;  2PI6 A;  2XP4 A;  4TW7 A;  1EHN A;  3KAF A;  3B7X A;  2MF9 A;  1OWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...