4DRNA

Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with {3-[(1r)-3-(3,4-dimethoxyphenyl)-1-({[(2s)-1-{[(1s,2r)-2-ethyl-1-hydroxycyclohexyl](oxo)acetyl}piperidin-2-yl]carbonyl}oxy)propyl]phenoxy}acetic acid
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 39
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drnA00
4W9QA 3KACA 1QPFA 4J4OA 1YW5A 1A7XA 1PBKA 2MLXA 2KR7A 2RUQA 2ITKA 3O5MA 1FKIA 4LAYA 2LJ4A 1BL4A 4ODNA 3RFWA 1F8AB 2VCDA 3I6CA 3O5DA 5HKGA 5DIVA 4ODLA 2XPBA 2XP7A 3O5FA 5B8IC 3MDYB 3OOBA 3IKDA 1EYMA 2PPOA 4O2TA 2Q5AA 3KAIA 2ZQVA 4U86A 5HT1A 1FKGA 4DZ3A 4FAPA 3CGMA 4DRNA 1FKRA 1FAPA 4JFJA 4U84A 2PPPA 1D6OA 1M5YA 3O5LA 1FKBA 2N87A 5HW7A 2Y78A 4DT4A 2RUDA 4DRMA 4JFIA 1J6YA 1FD9A 3JYJA 1TCOC 2XP6A 3GPKA 3O5GA 1F40A 2ZR5A 1B6CA 3KADA 1Q6IA 3O5OA 1FKHA 5HUAA 1ZK6A 1R9HA 3UQBA 2L2SA 3O5IA 4BF8A 2M1IA 2KFWA 1J4IA 2LKNA 2M08A 1FKKA 5HTGA 3KAHA 4G50A 4DH0A 3NRKA 3O5JA 3PA7A 2RSEA 4C02B 4W9OA 4TW8A 3UI5A 1JNTA 1Q6UA 1T11A 4DIPA 1ROUA 2DG3A 1NMVA 1N1AA 3FAPA 4G2PA 5HW8A 4JFKA 3IK8A 3UQIA 3O5RA 2VN1A 4DRIA 4TW7A 4DRKA 3O5EA 2MNTA 2F21A 2FAPA 1FJDA 1Q6HA 3KZ7A 2JZVA 2LGOA 3KCEA 2XP4A 5J6EA 1NSGA 3PRDA 1Q1CA 2M2AA 1J4HA 2ZQUA 3LUOA 1Y0OA 1ROTA 3O5KA 4IQCA 4ITZA 2RQSA 4MSPA 3UQAA 5BXJA 2ZR4A 4R0XA 3RGCA 2ZQSA 4FN2A 2ZR6A 4JFLA 4DRJA 2PV1A 2KI3A 2K8IA 2PV2A 4DRQA 4U85A 4DZ2A 1HXVA 4ODKA 1JNSA 1L1PA 1QPLA 3UI6A 1D7JA 2PPNA 4ODRA 1FKLA 2MPHA 2XP3A 3EY6A 3TCZA 3JXVA 3KABA 2MLZA 4NNRA 3WH0A 5I98A 3TDBA 3IHZA 1ZCNA 4JYSA 5HWCA 1FKSA 5DITA 2XPAA 1YATA 4QT3A 2ZQTA 4ODMA 1W26A 2KE0A 1J4RA 2DG9A 4N19A 1QZ2A 5D75A 5HW6A 1FKTA 3NI6A 3ODKA 3H9RB 3UI4A 2OFNA 5HWBA 4TYOA 5GPGA 2FKEA 4LAVA 3IKGA 1P5QA 2KO7A 2XP8A 2RURA 1PINA 2PV3A 3CGNA 3VAWA 3UF8A 3B7XA 2UZ5A 4GGQA 2DG4A 1FKFA 4IPXA 2PBCA 4QIBA 5DIUA 2KGJA 1KT0A 3TC5A 4GIVA 4TW6A 4W9PA 3NTPA 4TX0A 2XP9A 4LAWA 1FKJA 1D7HA 3O5PA 3KAFA 1D7IA 1C9HA 1FKDA 1NMWA 4DRPA 4QT2A 1EQ3A 1JVWA 2AWGA 3O5QA 3JYMA 4DRHA 4MGVA 2F2DA 2MF9A 3PRBA 2LPVA 4J4NA 1BKFA 4ODPA 2MLYA 4ODOA 1KT1A 3KAGA 4JFMA 2IF4A 4IQ2A 2XP5A 1U79A 4TNSA 4DROA 2D9FA 4ODQA 2RUCA 4LAXA 2F4EA
chains in the Genus database with same CATH superfamily
4W9QA 1HJXA 3O5MA 1FKIA 1BL4A 3ALGA 5HKGA 4ZS6A 4ODLA 1FKRA 2Q5AA 3KAIA 4U86A 4DRNA 3FXYA 2O92A 2PPPA 1D2KA 1K9TA 1LG2A 3O5LA 1FKBA 1E6ZA 2RUDA 1OWQA 1FD9A 1ZBWA 1TCOC 2XP6A 3GPKA 3O5GA 4KQZA 1B6CA 4IT6A 5HUAA 1CTNA 1ZL1A 1HKJA 4G50A 2G8ZA 4P8UA 3NRKA 1T11A 3ALFA 1NMVA 1N1AA 1XHGA 4MNJA 4G2PA 4WK9A 2VN1A 3RM9A 3O5EA 2MNTA 2FAPA 1IX5A 2DT0A 1NSGA 1Q1CA 1J4HA 2ZQUA 3LUOA 3O5KA 2WK2A 4ITZA 4Z2GA 5DEZA 3WIJA 3UQAA 5BXJA 2ZR4A 3RGCA 1X6NA 4DRJA 2KI3A 2K8IA 2PV2A 4DRQA 1L1PA 1QPLA 4MNKA 1FKLA 2B5UB 4Z2LA 1LL6A 3JXVA 4NNRA 3WH0A 1ZCNA 5HWCA 5DITA 1SYTA 2DT1A 2ZQTA 4ODMA 1UR8A 1J4RA 3GTYX 2DG9A 2A3CA 5HBFA 3H9RB 3UI4A 2OFNA 2XP8A 2PN0A 2RURA 2PV3A 3VAWA 1E9LA 5DF0A 4GGQA 2PBCA 2KGJA 4W9PA 1ITXA 4AY1A 4WKFA 1D7HA 1X6LA 1NMWA 1JVWA 4XAKA 3CHDA 4MAVA 2DSZA 2MF9A 4P8XA 4DWSD 4DWSB 1BKFA 3FY1A 2YBTA 3ARWA 1KT1A 3KAGA 2IF4A 4WKHA 4DROA 1U79A 3ARQA 2D9FA 4LAXA 3ARUA 3KACA 4HBOA 1EDQA 1LQ0A 2F23A 1GPFA 2KR7A 2ITKA 2VCDA 3I6CA 3O5DA 5DIVA 5B8IC 3IKDA 1EYMA 2PPOA 2B31A 1VF8A 1FKGA 4FAPA 4MNLA 1FAPA 4JFJA 3CHEA 1D6OA 1M5YA 2N87A 1SR0A 4DRMA 4HBEA 1HKKA 1ZBCA 1FFQA 3O5OA 1NWUA 2L2SA 4BF8A 2KFWA 4Q7NA 1FKKA 1GUVA 4DH0A 4ZPVR 1OGGA 4C02B 4W9OA 1WAWA 4TW8A 4DIPA 1ROUA 2DG3A 1W1PA 5HW8A 2DT3A 3IK8A 4DRIA 4MNMA 2F21A 1FJDA 2LGOA 3AS3A 3KCEA 3PRDA 2RQSA 3B8SA 1XRVA 4JFLA 2ZR6A 3B9EA 2PV1A 2ETNA 4ODKA 1JNSA 3UI6A 1D7JA 3WD0A 2XP3A 2DT2A 3IHZA 3ARXA 1FKSA 4IT4A 3WD2A 2KE0A 3ARVA 1QZ2A 3NI6A 3AQUA 3BMBA 4TYOA 5GPGA 3CGNA 5DO2A 3UF8A 2IUZA 3RMEA 3TC5A 4TW6A 2XP9A 4LAWA 4KR0B 4ML4A 2A3AA 2A3EA 1C9HA 1FKDA 3OA5A 4DRPA 3JYMA 1E15A 3ARTA 3WD3A 3B9AA 2MLYA 4ODOA 1JNEA 1W1TA 3ARYA 1QPFA 4J4OA 1YW5A 1A7XA 3G6LA 1PBKA 3AS0A 1WNOA 3WD1A 4ODNA 2LJ4A 1EHNA 2XPBA 3O5FA 3OOBA 3TCZA 2DSVA 2DSUA 2ZQVA 5HT1A 3CGMA 1LL7A 4U84A 3CHFA 4S3JA 1E6NA 1JNDA 4QZVB 2Y78A 1ZBKA 4S3KA 3JYJA 1GRJA 2QF8A 2ZR5A 3KADA 2OLHA 1ZB5A 1R9HA 1ZK6A 3O5IA 2LKNA 2M08A 1NWRA 3KAHA 1OGBA 5JH8A 3PA7A 2RSEA 4MPKA 1LG1A 4Z2JA 3WD4A 1JNTA 1Q6UA 4P8WA 4R5EA 3WL1A 3FAPA 4JFKA 2FDMA 4DRKA 4P8VA 2WLYA 4NZCA 1WB0A 3ARRA 1Q6HA 2PI6A 2JZVA 1HJWA 2XP4A 1HKMA 1O6IA 2YBUA 1NWTA 1Y0OA 1ROTA 4IQCA 4WJXA 1E6PA 4R0XA 2EULA 4L3NA 4WIWA 3B9DA 4DZ2A 2ESCA 1HXVA 1HJVA 3AS2A 4NSBA 2G41A 2MPHA 3EY6A 2MLZA 3TDBA 1NWSA 4JYSA 4QT3A 1H0IA 4N19A 1FKTA 1H0GA 1LJYA 5HWBA 3WKZA 2FKEA 3IKGA 1P5QA 2KO7A 1FFRA 1PINA 4DWSA 3WQVA 3B7XA 2UZ5A 2DG4A 1KT0A 5GQBA 3NTPA 4TX0A 1ZBVA 5GPRA 3KAFA 1D7IA 4QT2A 1EQ3A 3O5QA 2AWGA 4DRHA 4MGVA 2WM0A 2LPVA 4J4NA 2DPEA 1TFVA 4UDMA 4TNSA 2RUCA 3GU0A 3G6MA 3CHCA 4PTMA 2MLXA 3ARSA 2RUQA 4LAYA 3RFWA 1F8AB 2XP7A 2A3BA 3MDYB 3AROA 1E6RA 4O2TA 4DZ3A 1UR9A 5HW7A 4DT4A 3ARZA 1LL4A 4JFIA 1J6YA 1NH6A 1W1VA 1W1YA 1F40A 1Q6IA 1FKHA 3UQBA 2M1IA 4MTVA 1J4IA 5HTGA 4Z2IA 3O5JA 3UI5A 1ZU8A 3RM4A 3UQIA 3O5RA 4TW7A 3CH9A 3EIPA 3PRAA 4ZPTR 2WLZA 3KZ7A 5J6EA 2M2AA 3ARPA 4W5UA 1KFWA 4MSPA 4L72B 2ZQSA 4FN2A 3WL0A 4U85A 4HARA 3BXWA 2DSWA 2PPNA 4ODRA 1RD6A 4DWSC 3KABA 5I98A 3AS1A 1W9VA 1GOIA 2P4VA 2XPAA 1YATA 1W26A 1W9UA 1JCHB 5HW6A 1E44A 5D75A 2AOSA 4ZPWR 3ODKA 4LAVA 4Z2KA 4Q22A 4IPXA 2O9OA 4Z2HA 1FKFA 4QIBA 5DIUA 4GIVA 1EIBA 3RM8A 1FKJA 3W4RA 3O5PA 1W9PA 3PR9A 4LGXA 1HKIA 2F2DA 3PRBA 4WKAA 3QOKA 3WQWA 4ODPA 4JFMA 3CZ8A 4IQ2A 2XP5A 4URIA 4ODQA 2F4EA
chains in the Genus database with same CATH topology
4W9QA 1HJXA 3O5MA 1FKIA 1BL4A 3ALGA 5HKGA 4ZS6A 4ODLA 1FKRA 2Q5AA 3KAIA 4U86A 4DRNA 3FXYA 2O92A 2PPPA 1D2KA 1K9TA 1LG2A 3O5LA 1FKBA 1E6ZA 2RUDA 1OWQA 1FD9A 1ZBWA 1TCOC 2XP6A 3GPKA 3O5GA 4KQZA 1B6CA 4IT6A 5HUAA 1CTNA 1ZL1A 1HKJA 4G50A 2G8ZA 4P8UA 3NRKA 1T11A 3ALFA 1NMVA 1N1AA 1XHGA 4MNJA 4G2PA 4WK9A 2VN1A 3RM9A 3O5EA 2MNTA 2FAPA 1IX5A 2DT0A 1NSGA 1Q1CA 1J4HA 2ZQUA 3LUOA 3O5KA 2WK2A 4ITZA 4Z2GA 5DEZA 3WIJA 3UQAA 5BXJA 2ZR4A 3RGCA 1X6NA 4DRJA 2KI3A 2K8IA 2PV2A 4DRQA 1L1PA 1QPLA 4MNKA 1FKLA 4Z2LA 1LL6A 3JXVA 4NNRA 3WH0A 1ZCNA 5HWCA 5DITA 1SYTA 2DT1A 2ZQTA 4ODMA 1UR8A 1J4RA 2DG9A 2A3CA 5HBFA 3H9RB 3UI4A 2OFNA 2XP8A 2RURA 2PV3A 3VAWA 1E9LA 5DF0A 4GGQA 2PBCA 2KGJA 4W9PA 1ITXA 4AY1A 4WKFA 1D7HA 1X6LA 1NMWA 1JVWA 4XAKA 3CHDA 4MAVA 2DSZA 2MF9A 4P8XA 4DWSD 4DWSB 1BKFA 3FY1A 2YBTA 3ARWA 1KT1A 3KAGA 2IF4A 4WKHA 4DROA 1U79A 3ARQA 2D9FA 4LAXA 3ARUA 3KACA 4HBOA 1EDQA 1LQ0A 1GPFA 2KR7A 2ITKA 2VCDA 3I6CA 3O5DA 5DIVA 5B8IC 3IKDA 1EYMA 2PPOA 2B31A 1VF8A 1FKGA 4FAPA 4MNLA 1FAPA 4JFJA 3CHEA 1D6OA 1M5YA 2N87A 1SR0A 4DRMA 4HBEA 1HKKA 1ZBCA 1FFQA 3O5OA 1NWUA 2L2SA 4BF8A 2KFWA 4Q7NA 1FKKA 1GUVA 4DH0A 4ZPVR 1OGGA 4C02B 4W9OA 1WAWA 4TW8A 4DIPA 1ROUA 2DG3A 1W1PA 5HW8A 2DT3A 3IK8A 4DRIA 4MNMA 2F21A 1FJDA 2LGOA 3AS3A 3KCEA 3PRDA 2RQSA 3B8SA 1XRVA 4JFLA 2ZR6A 3B9EA 2PV1A 4ODKA 1JNSA 3UI6A 1D7JA 3WD0A 2XP3A 2DT2A 3IHZA 3ARXA 1FKSA 4IT4A 3WD2A 2KE0A 3ARVA 1QZ2A 3NI6A 3AQUA 4TYOA 5GPGA 3CGNA 5DO2A 3UF8A 2IUZA 3RMEA 3TC5A 4TW6A 2XP9A 4LAWA 4KR0B 4ML4A 2A3AA 2A3EA 1C9HA 1FKDA 3OA5A 4DRPA 3JYMA 1E15A 3ARTA 3WD3A 3B9AA 2MLYA 4ODOA 1JNEA 1W1TA 3ARYA 1QPFA 4J4OA 1YW5A 1A7XA 3G6LA 1PBKA 3AS0A 1WNOA 3WD1A 4ODNA 2LJ4A 1EHNA 2XPBA 3O5FA 3OOBA 3TCZA 2DSVA 2DSUA 2ZQVA 5HT1A 3CGMA 1LL7A 4U84A 3CHFA 4S3JA 1E6NA 1JNDA 4QZVB 2Y78A 1ZBKA 4S3KA 3JYJA 2QF8A 2ZR5A 3KADA 2OLHA 1ZB5A 1R9HA 1ZK6A 3O5IA 2LKNA 2M08A 1NWRA 3KAHA 1OGBA 5JH8A 3PA7A 2RSEA 4MPKA 1LG1A 4Z2JA 3WD4A 1JNTA 1Q6UA 4P8WA 4R5EA 3WL1A 3FAPA 4JFKA 2FDMA 4DRKA 4P8VA 2WLYA 4NZCA 1WB0A 3ARRA 1Q6HA 2PI6A 2JZVA 1HJWA 2XP4A 1HKMA 1O6IA 2YBUA 1NWTA 1Y0OA 1ROTA 4IQCA 4WJXA 1E6PA 4R0XA 4L3NA 4WIWA 3B9DA 4DZ2A 2ESCA 1HXVA 1HJVA 3AS2A 4NSBA 2G41A 2MPHA 3EY6A 2MLZA 3TDBA 1NWSA 4JYSA 4QT3A 1H0IA 4N19A 1FKTA 1H0GA 1LJYA 5HWBA 3WKZA 2FKEA 3IKGA 1P5QA 2KO7A 1FFRA 1PINA 4DWSA 3WQVA 3B7XA 2UZ5A 2DG4A 1KT0A 5GQBA 3NTPA 4TX0A 1ZBVA 5GPRA 3KAFA 1D7IA 4QT2A 1EQ3A 3O5QA 2AWGA 4DRHA 4MGVA 2WM0A 2LPVA 4J4NA 2DPEA 1TFVA 4TNSA 2RUCA 3G6MA 3CHCA 4PTMA 2MLXA 3ARSA 2RUQA 4LAYA 3RFWA 1F8AB 2XP7A 2A3BA 3MDYB 3AROA 1E6RA 4O2TA 4DZ3A 1UR9A 5HW7A 4DT4A 3ARZA 1LL4A 4JFIA 1J6YA 1NH6A 1W1VA 1W1YA 1F40A 1Q6IA 1FKHA 3UQBA 2M1IA 4MTVA 1J4IA 5HTGA 4Z2IA 3O5JA 3UI5A 1ZU8A 3RM4A 3UQIA 3O5RA 4TW7A 3CH9A 3PRAA 4ZPTR 2WLZA 3KZ7A 5J6EA 2M2AA 3ARPA 4W5UA 1KFWA 4MSPA 4L72B 2ZQSA 4FN2A 3WL0A 4U85A 4HARA 3BXWA 2DSWA 2PPNA 4ODRA 1RD6A 4DWSC 3KABA 5I98A 3AS1A 1W9VA 1GOIA 2XPAA 1YATA 1W26A 1W9UA 5HW6A 5D75A 2AOSA 4ZPWR 3ODKA 4LAVA 4Z2KA 4Q22A 4IPXA 2O9OA 4Z2HA 1FKFA 4QIBA 5DIUA 4GIVA 1EIBA 3RM8A 1FKJA 3W4RA 3O5PA 1W9PA 3PR9A 4LGXA 1HKIA 2F2DA 3PRBA 4WKAA 3QOKA 3WQWA 4ODPA 4JFMA 3CZ8A 4IQ2A 2XP5A 4URIA 4ODQA 2F4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9Q A;  3KAC A;  1QPF A;  4J4O A;  1YW5 A;  1A7X A;  1PBK A;  2MLX A;  2KR7 A;  2RUQ A;  2ITK A;  3O5M A;  1FKI A;  4LAY A;  2LJ4 A;  1BL4 A;  4ODN A;  3RFW A;  1F8A B;  2VCD A;  3I6C A;  3O5D A;  5HKG A;  5DIV A;  4ODL A;  2XPB A;  2XP7 A;  3O5F A;  5B8I C;  3MDY B;  3OOB A;  3IKD A;  1EYM A;  2PPO A;  4O2T A;  2Q5A A;  3KAI A;  2ZQV A;  4U86 A;  5HT1 A;  1FKG A;  4DZ3 A;  4FAP A;  3CGM A;  4DRN A;  1FKR A;  1FAP A;  4JFJ A;  4U84 A;  2PPP A;  1D6O A;  1M5Y A;  3O5L A;  1FKB A;  2N87 A;  5HW7 A;  2Y78 A;  4DT4 A;  2RUD A;  4DRM A;  4JFI A;  1J6Y A;  1FD9 A;  3JYJ A;  1TCO C;  2XP6 A;  3GPK A;  3O5G A;  1F40 A;  2ZR5 A;  1B6C A;  3KAD A;  1Q6I A;  3O5O A;  1FKH A;  5HUA A;  1ZK6 A;  1R9H A;  3UQB A;  2L2S A;  3O5I A;  4BF8 A;  2M1I A;  2KFW A;  1J4I A;  2LKN A;  2M08 A;  1FKK A;  5HTG A;  3KAH A;  4G50 A;  4DH0 A;  3NRK A;  3O5J A;  3PA7 A;  2RSE A;  4C02 B;  4W9O A;  4TW8 A;  3UI5 A;  1JNT A;  1Q6U A;  1T11 A;  4DIP A;  1ROU A;  2DG3 A;  1NMV A;  1N1A A;  3FAP A;  4G2P A;  5HW8 A;  4JFK A;  3IK8 A;  3UQI A;  3O5R A;  2VN1 A;  4DRI A;  4TW7 A;  4DRK A;  3O5E A;  2MNT A;  2F21 A;  2FAP A;  1FJD A;  1Q6H A;  3KZ7 A;  2JZV A;  2LGO A;  3KCE A;  2XP4 A;  5J6E A;  1NSG A;  3PRD A;  1Q1C A;  2M2A A;  1J4H A;  2ZQU A;  3LUO A;  1Y0O A;  1ROT A;  3O5K A;  4IQC A;  4ITZ A;  2RQS A;  4MSP A;  3UQA A;  5BXJ A;  2ZR4 A;  4R0X A;  3RGC A;  2ZQS A;  4FN2 A;  2ZR6 A;  4JFL A;  4DRJ A;  2PV1 A;  2KI3 A;  2K8I A;  2PV2 A;  4DRQ A;  4U85 A;  4DZ2 A;  1HXV A;  4ODK A;  1JNS A;  1L1P A;  1QPL A;  3UI6 A;  1D7J A;  2PPN A;  4ODR A;  1FKL A;  2MPH A;  2XP3 A;  3EY6 A;  3TCZ A;  3JXV A;  3KAB A;  2MLZ A;  4NNR A;  3WH0 A;  5I98 A;  3TDB A;  3IHZ A;  1ZCN A;  4JYS A;  5HWC A;  1FKS A;  5DIT A;  2XPA A;  1YAT A;  4QT3 A;  2ZQT A;  4ODM A;  1W26 A;  2KE0 A;  1J4R A;  2DG9 A;  4N19 A;  1QZ2 A;  5D75 A;  5HW6 A;  1FKT A;  3NI6 A;  3ODK A;  3H9R B;  3UI4 A;  2OFN A;  5HWB A;  4TYO A;  5GPG A;  2FKE A;  4LAV A;  3IKG A;  1P5Q A;  2KO7 A;  2XP8 A;  2RUR A;  1PIN A;  2PV3 A;  3CGN A;  3VAW A;  3UF8 A;  3B7X A;  2UZ5 A;  4GGQ A;  2DG4 A;  1FKF A;  4IPX A;  2PBC A;  4QIB A;  5DIU A;  2KGJ A;  1KT0 A;  3TC5 A;  4GIV A;  4TW6 A;  4W9P A;  3NTP A;  4TX0 A;  2XP9 A;  4LAW A;  1FKJ A;  1D7H A;  3O5P A;  3KAF A;  1D7I A;  1C9H A;  1FKD A;  1NMW A;  4DRP A;  4QT2 A;  1EQ3 A;  1JVW A;  2AWG A;  3O5Q A;  3JYM A;  4DRH A;  4MGV A;  2F2D A;  2MF9 A;  3PRB A;  2LPV A;  4J4N A;  1BKF A;  4ODP A;  2MLY A;  4ODO A;  1KT1 A;  3KAG A;  4JFM A;  2IF4 A;  4IQ2 A;  2XP5 A;  1U79 A;  4TNS A;  4DRO A;  2D9F A;  4ODQ A;  2RUC A;  4LAX A;  2F4E A; 
#chains in the Genus database with same CATH topology
 4W9Q A;  1HJX A;  3O5M A;  1FKI A;  1BL4 A;  3ALG A;  5HKG A;  4ZS6 A;  4ODL A;  1FKR A;  2Q5A A;  3KAI A;  4U86 A;  4DRN A;  3FXY A;  2O92 A;  2PPP A;  1D2K A;  1K9T A;  1LG2 A;  3O5L A;  1FKB A;  1E6Z A;  2RUD A;  1OWQ A;  1FD9 A;  1ZBW A;  1TCO C;  2XP6 A;  3GPK A;  3O5G A;  4KQZ A;  1B6C A;  4IT6 A;  5HUA A;  1CTN A;  1ZL1 A;  1HKJ A;  4G50 A;  2G8Z A;  4P8U A;  3NRK A;  1T11 A;  3ALF A;  1NMV A;  1N1A A;  1XHG A;  4MNJ A;  4G2P A;  4WK9 A;  2VN1 A;  3RM9 A;  3O5E A;  2MNT A;  2FAP A;  1IX5 A;  2DT0 A;  1NSG A;  1Q1C A;  1J4H A;  2ZQU A;  3LUO A;  3O5K A;  2WK2 A;  4ITZ A;  4Z2G A;  5DEZ A;  3WIJ A;  3UQA A;  5BXJ A;  2ZR4 A;  3RGC A;  1X6N A;  4DRJ A;  2KI3 A;  2K8I A;  2PV2 A;  4DRQ A;  1L1P A;  1QPL A;  4MNK A;  1FKL A;  2B5U B;  4Z2L A;  1LL6 A;  3JXV A;  4NNR A;  3WH0 A;  1ZCN A;  5HWC A;  5DIT A;  1SYT A;  2DT1 A;  2ZQT A;  4ODM A;  1UR8 A;  1J4R A;  3GTY X;  2DG9 A;  2A3C A;  5HBF A;  3H9R B;  3UI4 A;  2OFN A;  2XP8 A;  2PN0 A;  2RUR A;  2PV3 A;  3VAW A;  1E9L A;  5DF0 A;  4GGQ A;  2PBC A;  2KGJ A;  4W9P A;  1ITX A;  4AY1 A;  4WKF A;  1D7H A;  1X6L A;  1NMW A;  1JVW A;  4XAK A;  3CHD A;  4MAV A;  2DSZ A;  2MF9 A;  4P8X A;  4DWS D;  4DWS B;  1BKF A;  3FY1 A;  2YBT A;  3ARW A;  1KT1 A;  3KAG A;  2IF4 A;  4WKH A;  4DRO A;  1U79 A;  3ARQ A;  2D9F A;  4LAX A;  3ARU A;  3KAC A;  4HBO A;  1EDQ A;  1LQ0 A;  2F23 A;  1GPF A;  2KR7 A;  2ITK A;  2VCD A;  3I6C A;  3O5D A;  5DIV A;  5B8I C;  3IKD A;  1EYM A;  2PPO A;  2B31 A;  1VF8 A;  1FKG A;  4FAP A;  4MNL A;  1FAP A;  4JFJ A;  3CHE A;  1D6O A;  1M5Y A;  2N87 A;  1SR0 A;  4DRM A;  4HBE A;  1HKK A;  1ZBC A;  1FFQ A;  3O5O A;  1NWU A;  2L2S A;  4BF8 A;  2KFW A;  4Q7N A;  1FKK A;  1GUV A;  4DH0 A;  4ZPV R;  1OGG A;  4C02 B;  4W9O A;  1WAW A;  4TW8 A;  4DIP A;  1ROU A;  2DG3 A;  1W1P A;  5HW8 A;  2DT3 A;  3IK8 A;  4DRI A;  4MNM A;  2F21 A;  1FJD A;  2LGO A;  3AS3 A;  3KCE A;  3PRD A;  2RQS A;  3B8S A;  1XRV A;  4JFL A;  2ZR6 A;  3B9E A;  2PV1 A;  2ETN A;  4ODK A;  1JNS A;  3UI6 A;  1D7J A;  3WD0 A;  2XP3 A;  2DT2 A;  3IHZ A;  3ARX A;  1FKS A;  4IT4 A;  3WD2 A;  2KE0 A;  3ARV A;  1QZ2 A;  3NI6 A;  3AQU A;  3BMB A;  4TYO A;  5GPG A;  3CGN A;  5DO2 A;  3UF8 A;  2IUZ A;  3RME A;  3TC5 A;  4TW6 A;  2XP9 A;  4LAW A;  4KR0 B;  4ML4 A;  2A3A A;  2A3E A;  1C9H A;  1FKD A;  3OA5 A;  4DRP A;  3JYM A;  1E15 A;  3ART A;  3WD3 A;  3B9A A;  2MLY A;  4ODO A;  1JNE A;  1W1T A;  3ARY A;  1QPF A;  4J4O A;  1YW5 A;  1A7X A;  3G6L A;  1PBK A;  3AS0 A;  1WNO A;  3WD1 A;  4ODN A;  2LJ4 A;  1EHN A;  2XPB A;  3O5F A;  3OOB A;  3TCZ A;  2DSV A;  2DSU A;  2ZQV A;  5HT1 A;  3CGM A;  1LL7 A;  4U84 A;  3CHF A;  4S3J A;  1E6N A;  1JND A;  4QZV B;  2Y78 A;  1ZBK A;  4S3K A;  3JYJ A;  1GRJ A;  2QF8 A;  2ZR5 A;  3KAD A;  2OLH A;  1ZB5 A;  1R9H A;  1ZK6 A;  3O5I A;  2LKN A;  2M08 A;  1NWR A;  3KAH A;  1OGB A;  5JH8 A;  3PA7 A;  2RSE A;  4MPK A;  1LG1 A;  4Z2J A;  3WD4 A;  1JNT A;  1Q6U A;  4P8W A;  4R5E A;  3WL1 A;  3FAP A;  4JFK A;  2FDM A;  4DRK A;  4P8V A;  2WLY A;  4NZC A;  1WB0 A;  3ARR A;  1Q6H A;  2PI6 A;  2JZV A;  1HJW A;  2XP4 A;  1HKM A;  1O6I A;  2YBU A;  1NWT A;  1Y0O A;  1ROT A;  4IQC A;  4WJX A;  1E6P A;  4R0X A;  2EUL A;  4L3N A;  4WIW A;  3B9D A;  4DZ2 A;  2ESC A;  1HXV A;  1HJV A;  3AS2 A;  4NSB A;  2G41 A;  2MPH A;  3EY6 A;  2MLZ A;  3TDB A;  1NWS A;  4JYS A;  4QT3 A;  1H0I A;  4N19 A;  1FKT A;  1H0G A;  1LJY A;  5HWB A;  3WKZ A;  2FKE A;  3IKG A;  1P5Q A;  2KO7 A;  1FFR A;  1PIN A;  4DWS A;  3WQV A;  3B7X A;  2UZ5 A;  2DG4 A;  1KT0 A;  5GQB A;  3NTP A;  4TX0 A;  1ZBV A;  5GPR A;  3KAF A;  1D7I A;  4QT2 A;  1EQ3 A;  3O5Q A;  2AWG A;  4DRH A;  4MGV A;  2WM0 A;  2LPV A;  4J4N A;  2DPE A;  1TFV A;  4UDM A;  4TNS A;  2RUC A;  3GU0 A;  3G6M A;  3CHC A;  4PTM A;  2MLX A;  3ARS A;  2RUQ A;  4LAY A;  3RFW A;  1F8A B;  2XP7 A;  2A3B A;  3MDY B;  3ARO A;  1E6R A;  4O2T A;  4DZ3 A;  1UR9 A;  5HW7 A;  4DT4 A;  3ARZ A;  1LL4 A;  4JFI A;  1J6Y A;  1NH6 A;  1W1V A;  1W1Y A;  1F40 A;  1Q6I A;  1FKH A;  3UQB A;  2M1I A;  4MTV A;  1J4I A;  5HTG A;  4Z2I A;  3O5J A;  3UI5 A;  1ZU8 A;  3RM4 A;  3UQI A;  3O5R A;  4TW7 A;  3CH9 A;  3EIP A;  3PRA A;  4ZPT R;  2WLZ A;  3KZ7 A;  5J6E A;  2M2A A;  3ARP A;  4W5U A;  1KFW A;  4MSP A;  4L72 B;  2ZQS A;  4FN2 A;  3WL0 A;  4U85 A;  4HAR A;  3BXW A;  2DSW A;  2PPN A;  4ODR A;  1RD6 A;  4DWS C;  3KAB A;  5I98 A;  3AS1 A;  1W9V A;  1GOI A;  2P4V A;  2XPA A;  1YAT A;  1W26 A;  1W9U A;  1JCH B;  5HW6 A;  1E44 A;  5D75 A;  2AOS A;  4ZPW R;  3ODK A;  4LAV A;  4Z2K A;  4Q22 A;  4IPX A;  2O9O A;  4Z2H A;  1FKF A;  4QIB A;  5DIU A;  4GIV A;  1EIB A;  3RM8 A;  1FKJ A;  3W4R A;  3O5P A;  1W9P A;  3PR9 A;  4LGX A;  1HKI A;  2F2D A;  3PRB A;  4WKA A;  3QOK A;  3WQW A;  4ODP A;  4JFM A;  3CZ8 A;  4IQ2 A;  2XP5 A;  4URI A;  4ODQ A;  2F4E A; 
#chains in the Genus database with same CATH homology
 4W9Q A;  1HJX A;  3O5M A;  1FKI A;  1BL4 A;  3ALG A;  5HKG A;  4ZS6 A;  4ODL A;  1FKR A;  2Q5A A;  3KAI A;  4U86 A;  4DRN A;  3FXY A;  2O92 A;  2PPP A;  1D2K A;  1K9T A;  1LG2 A;  3O5L A;  1FKB A;  1E6Z A;  2RUD A;  1OWQ A;  1FD9 A;  1ZBW A;  1TCO C;  2XP6 A;  3GPK A;  3O5G A;  4KQZ A;  1B6C A;  4IT6 A;  5HUA A;  1CTN A;  1ZL1 A;  1HKJ A;  4G50 A;  2G8Z A;  4P8U A;  3NRK A;  1T11 A;  3ALF A;  1NMV A;  1N1A A;  1XHG A;  4MNJ A;  4G2P A;  4WK9 A;  2VN1 A;  3RM9 A;  3O5E A;  2MNT A;  2FAP A;  1IX5 A;  2DT0 A;  1NSG A;  1Q1C A;  1J4H A;  2ZQU A;  3LUO A;  3O5K A;  2WK2 A;  4ITZ A;  4Z2G A;  5DEZ A;  3WIJ A;  3UQA A;  5BXJ A;  2ZR4 A;  3RGC A;  1X6N A;  4DRJ A;  2KI3 A;  2K8I A;  2PV2 A;  4DRQ A;  1L1P A;  1QPL A;  4MNK A;  1FKL A;  4Z2L A;  1LL6 A;  3JXV A;  4NNR A;  3WH0 A;  1ZCN A;  5HWC A;  5DIT A;  1SYT A;  2DT1 A;  2ZQT A;  4ODM A;  1UR8 A;  1J4R A;  2DG9 A;  2A3C A;  5HBF A;  3H9R B;  3UI4 A;  2OFN A;  2XP8 A;  2RUR A;  2PV3 A;  3VAW A;  1E9L A;  5DF0 A;  4GGQ A;  2PBC A;  2KGJ A;  4W9P A;  1ITX A;  4AY1 A;  4WKF A;  1D7H A;  1X6L A;  1NMW A;  1JVW A;  4XAK A;  3CHD A;  4MAV A;  2DSZ A;  2MF9 A;  4P8X A;  4DWS D;  4DWS B;  1BKF A;  3FY1 A;  2YBT A;  3ARW A;  1KT1 A;  3KAG A;  2IF4 A;  4WKH A;  4DRO A;  1U79 A;  3ARQ A;  2D9F A;  4LAX A;  3ARU A;  3KAC A;  4HBO A;  1EDQ A;  1LQ0 A;  1GPF A;  2KR7 A;  2ITK A;  2VCD A;  3I6C A;  3O5D A;  5DIV A;  5B8I C;  3IKD A;  1EYM A;  2PPO A;  2B31 A;  1VF8 A;  1FKG A;  4FAP A;  4MNL A;  1FAP A;  4JFJ A;  3CHE A;  1D6O A;  1M5Y A;  2N87 A;  1SR0 A;  4DRM A;  4HBE A;  1HKK A;  1ZBC A;  1FFQ A;  3O5O A;  1NWU A;  2L2S A;  4BF8 A;  2KFW A;  4Q7N A;  1FKK A;  1GUV A;  4DH0 A;  4ZPV R;  1OGG A;  4C02 B;  4W9O A;  1WAW A;  4TW8 A;  4DIP A;  1ROU A;  2DG3 A;  1W1P A;  5HW8 A;  2DT3 A;  3IK8 A;  4DRI A;  4MNM A;  2F21 A;  1FJD A;  2LGO A;  3AS3 A;  3KCE A;  3PRD A;  2RQS A;  3B8S A;  1XRV A;  4JFL A;  2ZR6 A;  3B9E A;  2PV1 A;  4ODK A;  1JNS A;  3UI6 A;  1D7J A;  3WD0 A;  2XP3 A;  2DT2 A;  3IHZ A;  3ARX A;  1FKS A;  4IT4 A;  3WD2 A;  2KE0 A;  3ARV A;  1QZ2 A;  3NI6 A;  3AQU A;  4TYO A;  5GPG A;  3CGN A;  5DO2 A;  3UF8 A;  2IUZ A;  3RME A;  3TC5 A;  4TW6 A;  2XP9 A;  4LAW A;  4KR0 B;  4ML4 A;  2A3A A;  2A3E A;  1C9H A;  1FKD A;  3OA5 A;  4DRP A;  3JYM A;  1E15 A;  3ART A;  3WD3 A;  3B9A A;  2MLY A;  4ODO A;  1JNE A;  1W1T A;  3ARY A;  1QPF A;  4J4O A;  1YW5 A;  1A7X A;  3G6L A;  1PBK A;  3AS0 A;  1WNO A;  3WD1 A;  4ODN A;  2LJ4 A;  1EHN A;  2XPB A;  3O5F A;  3OOB A;  3TCZ A;  2DSV A;  2DSU A;  2ZQV A;  5HT1 A;  3CGM A;  1LL7 A;  4U84 A;  3CHF A;  4S3J A;  1E6N A;  1JND A;  4QZV B;  2Y78 A;  1ZBK A;  4S3K A;  3JYJ A;  2QF8 A;  2ZR5 A;  3KAD A;  2OLH A;  1ZB5 A;  1R9H A;  1ZK6 A;  3O5I A;  2LKN A;  2M08 A;  1NWR A;  3KAH A;  1OGB A;  5JH8 A;  3PA7 A;  2RSE A;  4MPK A;  1LG1 A;  4Z2J A;  3WD4 A;  1JNT A;  1Q6U A;  4P8W A;  4R5E A;  3WL1 A;  3FAP A;  4JFK A;  2FDM A;  4DRK A;  4P8V A;  2WLY A;  4NZC A;  1WB0 A;  3ARR A;  1Q6H A;  2PI6 A;  2JZV A;  1HJW A;  2XP4 A;  1HKM A;  1O6I A;  2YBU A;  1NWT A;  1Y0O A;  1ROT A;  4IQC A;  4WJX A;  1E6P A;  4R0X A;  4L3N A;  4WIW A;  3B9D A;  4DZ2 A;  2ESC A;  1HXV A;  1HJV A;  3AS2 A;  4NSB A;  2G41 A;  2MPH A;  3EY6 A;  2MLZ A;  3TDB A;  1NWS A;  4JYS A;  4QT3 A;  1H0I A;  4N19 A;  1FKT A;  1H0G A;  1LJY A;  5HWB A;  3WKZ A;  2FKE A;  3IKG A;  1P5Q A;  2KO7 A;  1FFR A;  1PIN A;  4DWS A;  3WQV A;  3B7X A;  2UZ5 A;  2DG4 A;  1KT0 A;  5GQB A;  3NTP A;  4TX0 A;  1ZBV A;  5GPR A;  3KAF A;  1D7I A;  4QT2 A;  1EQ3 A;  3O5Q A;  2AWG A;  4DRH A;  4MGV A;  2WM0 A;  2LPV A;  4J4N A;  2DPE A;  1TFV A;  4TNS A;  2RUC A;  3G6M A;  3CHC A;  4PTM A;  2MLX A;  3ARS A;  2RUQ A;  4LAY A;  3RFW A;  1F8A B;  2XP7 A;  2A3B A;  3MDY B;  3ARO A;  1E6R A;  4O2T A;  4DZ3 A;  1UR9 A;  5HW7 A;  4DT4 A;  3ARZ A;  1LL4 A;  4JFI A;  1J6Y A;  1NH6 A;  1W1V A;  1W1Y A;  1F40 A;  1Q6I A;  1FKH A;  3UQB A;  2M1I A;  4MTV A;  1J4I A;  5HTG A;  4Z2I A;  3O5J A;  3UI5 A;  1ZU8 A;  3RM4 A;  3UQI A;  3O5R A;  4TW7 A;  3CH9 A;  3PRA A;  4ZPT R;  2WLZ A;  3KZ7 A;  5J6E A;  2M2A A;  3ARP A;  4W5U A;  1KFW A;  4MSP A;  4L72 B;  2ZQS A;  4FN2 A;  3WL0 A;  4U85 A;  4HAR A;  3BXW A;  2DSW A;  2PPN A;  4ODR A;  1RD6 A;  4DWS C;  3KAB A;  5I98 A;  3AS1 A;  1W9V A;  1GOI A;  2XPA A;  1YAT A;  1W26 A;  1W9U A;  5HW6 A;  5D75 A;  2AOS A;  4ZPW R;  3ODK A;  4LAV A;  4Z2K A;  4Q22 A;  4IPX A;  2O9O A;  4Z2H A;  1FKF A;  4QIB A;  5DIU A;  4GIV A;  1EIB A;  3RM8 A;  1FKJ A;  3W4R A;  3O5P A;  1W9P A;  3PR9 A;  4LGX A;  1HKI A;  2F2D A;  3PRB A;  4WKA A;  3QOK A;  3WQW A;  4ODP A;  4JFM A;  3CZ8 A;  4IQ2 A;  2XP5 A;  4URI A;  4ODQ A;  2F4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...