4DRNA

Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with {3-[(1r)-3-(3,4-dimethoxyphenyl)-1-({[(2s)-1-{[(1s,2r)-2-ethyl-1-hydroxycyclohexyl](oxo)acetyl}piperidin-2-yl]carbonyl}oxy)propyl]phenoxy}acetic acid
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 39
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drnA00
1ZCNA 5GPGA 4JFLA 1Q1CA 3I6CA 1F8AB 4JYSA 4ODRA 4LAVA 4R0XA 4C02B 5HTGA 2XP9A 3O5FA 4W9QA 4QIBA 4DRMA 1FKKA 2ZR4A 2L2SA 3FAPA 2ZR6A 4ODOA 1KT0A 4JFIA 3VAWA 2ZR5A 4IQ2A 4DRKA 2RQSA 3H9RB 4JFMA 2PBCA 2DG3A 4FN2A 4MGVA 3KABA 3O5LA 2UZ5A 4U84A 3O5DA 3KAFA 4G50A 4TW7A 4QT2A 5J6EA 3O5MA 3O5JA 4N19A 4DRIA 2MLXA 1FKIA 3O5EA 4W9PA 1D7IA 1PINA 2OFNA 3CGMA 1F40A 4ODLA 5BXJA 3UI6A 4LAXA 2MNTA 3O5RA 4ITZA 1BKFA 1ROUA 1FKLA 3IKDA 4MSPA 2XP8A 1FKHA 2LKNA 3OOBA 5HWCA 1EQ3A 3KADA 5DIVA 1T11A 1A7XA 3LUOA 5HWBA 1Q6UA 5HW8A 4TX0A 5DITA 4TW6A 2LGOA 1FJDA 4IQCA 2XP5A 3IK8A 2XP4A 3CGNA 5DIUA 4LAWA 5I98A 1YW5A 1U79A 5HKGA 4DRPA 2M1IA 4JFKA 1M5YA 2FAPA 3KCEA 3NRKA 1QZ2A 1Y0OA 3IHZA 1FKGA 3RFWA 3EY6A 1FKSA 1PBKA 2F4EA 2XPBA 5HT1A 3B7XA 4DT4A 4JFJA 3PA7A 3IKGA 4J4OA 4O2TA 4QT3A 1D6OA 4DH0A 4GGQA 4W9OA 2KE0A 2MLYA 4DROA 1W26A 3RGCA 3TCZA 3KAGA 2PV3A 2KR7A 2MLZA 1Q6HA 2XPAA 3KACA 2VN1A 3KAHA 4ODMA 4TW8A 4BF8A 2MF9A 3UI4A 2ITKA 4IPXA 3UI5A 3O5OA 1FKJA 1FKTA 2F2DA 2JZVA 2RUCA 4ODPA 1J6YA 2ZQTA 4DRHA 2DG4A 3JYMA 2D9FA 1J4RA 4LAYA 3TDBA 1FKDA 2Q5AA 3UQAA 1KT1A 4U85A 4DRQA 2Y78A 4GIVA 3JXVA 4DIPA 1TCOC 1B6CA 4FAPA 3UQIA 3NI6A 4U86A 2DG9A 2ZQVA 2PPPA 2ZQSA 2VCDA 3O5IA 3ODKA 1JNTA 2KI3A 2K8IA 2LJ4A 2PPNA 4ODQA 5B8IC 1D7HA 2RSEA 2LPVA 1JNSA 2XP6A 1ZK6A 2KO7A 1FKFA 4G2PA 1Q6IA 5HW6A 2XP7A 3JYJA 2KGJA 1NSGA 3O5PA 3TC5A 4DZ2A 1JVWA 3UQBA 3PRBA 3KAIA 1P5QA 2RURA 4ODNA 4TYOA 1NMVA 1ROTA 3O5QA 2ZQUA 1QPLA 1R9HA 3O5GA 4DRJA 4TNSA 1FKBA 2F21A 2MPHA 1J4IA 3GPKA 2M2AA 2RUQA 1FKRA 2M08A 2RUDA 1N1AA 3KZ7A 1QPFA 5HW7A 1FAPA 4NNRA 2FKEA 3WH0A 2KFWA 1HXVA 3NTPA 4ODKA 1FD9A 1YATA 2PV2A 1J4HA 4DZ3A 3MDYB 2PV1A 2AWGA 2XP3A 1EYMA 3O5KA 1D7JA 4J4NA 1NMWA 1L1PA 5HUAA 1C9HA 2IF4A 3PRDA 5D75A 2N87A 4DRNA 1BL4A 3UF8A 2PPOA
chains in the Genus database with same CATH superfamily
1ZB5A 5GPGA 1Q1CA 3I6CA 4ODRA 1ZBKA 3O5FA 4KR0B 2ZR4A 2YBUA 3WD1A 1ZL1A 1NWSA 4IT6A 3W4RA 2DT0A 4FN2A 4MGVA 4G50A 4TW7A 4QT2A 4DRIA 1F40A 2B5UB 1FFRA 3BMBA 3EIPA 4MSPA 1FKLA 3G6MA 3FY1A 5HWBA 5HW8A 4NSBA 2LGOA 2B31A 1JCHB 1YW5A 1U79A 1W9VA 5HKGA 3OA5A 1FKGA 3RFWA 3EY6A 1FKSA 4DT4A 3B7XA 3G6LA 1ZBCA 4QT3A 3IKGA 4O2TA 4W5UA 1D6OA 1UR9A 2KE0A 3BXWA 1W26A 1W1YA 3KAGA 2PV3A 1Q6HA 4TW8A 4HBOA 2MF9A 1XRVA 4IPXA 2PI6A 1FKJA 1FKTA 2JZVA 4DRHA 2DG4A 3JYMA 1JNEA 1VF8A 3WIJA 3UQAA 1E6NA 1FFQA 2Y78A 1GUVA 3WQVA 1E6ZA 2LJ4A 2PPNA 4NZCA 4WIWA 3QOKA 2RSEA 2LPVA 1JNSA 2XP6A 3ARPA 4S3KA 1Q6IA 2XP7A 2KGJA 3O5PA 3B9AA 1JVWA 2DT2A 1NMVA 4P8XA 4QZVB 1NH6A 2ZQUA 4XAKA 1CTNA 1R9HA 4TNSA 4WKFA 3RM9A 4MNKA 3RMEA 1FKRA 4MTVA 5HW7A 1N1AA 1QPFA 3WH0A 2KFWA 1J4HA 3WD2A 2A3BA 4MPKA 2XP3A 4P8UA 1L1PA 5HUAA 1WB0A 1H0GA 4KQZA 3UF8A 3B9EA 4WJXA 2DSUA 2IUZA 4L3NA 4JFLA 3ARUA 5HTGA 4W9QA 4QIBA 4DRMA 2ZR6A 3VAWA 1OGGA 1HKJA 1LL6A 4DRKA 2DSZA 3H9RB 2PBCA 1GOIA 1HJVA 3KABA 3O5LA 3KAFA 4ZPVR 5J6EA 3O5JA 1ZU8A 2MLXA 4DWSD 2DPEA 5DF0A 4ZPWR 1W1TA 3O5RA 4ITZA 3CHEA 2YBTA 3RM4A 3IKDA 4HBEA 1EQ3A 2OLHA 3KADA 1UR8A 3LUOA 1E9LA 4URIA 5JH8A 4TW6A 4IQCA 3AS1A 3IK8A 3CHFA 1W1PA 4DRPA 1Y0OA 4ZPTR 4DWSB 4AY1A 4JFJA 3PA7A 2MLYA 2KR7A 2MLZA 3KACA 4BF8A 2VN1A 5B8IC 3AQUA 1XHGA 3O5OA 2F2DA 4ODPA 1LG2A 4MAVA 2G41A 4LAYA 1J4RA 5GQBA 3ARVA 1D2KA 1H0IA 1KT1A 2WM0A 1X6LA 4DIPA 3NI6A 2DG9A 2VCDA 1JNTA 2KI3A 1RD6A 2K8IA 1EIBA 4Z2HA 2F23A 3TC5A 3UQBA 1ZBWA 2A3AA 4ODNA 1ROTA 1IX5A 2WK2A 3O5GA 1FKBA 2MPHA 1OWQA 3AROA 2PN0A 3RM8A 3KZ7A 1W1VA 1FAPA 4NNRA 1LL4A 4ODKA 4WKHA 1EHNA 4Z2JA 2PV2A 4DZ3A 3WD3A 3O5KA 4Z2KA 1NMWA 1HKIA 3PRDA 4DRNA 3GTYX 1ZCNA 3ARSA 1ZBVA 3PRAA 4JYSA 2O9OA 2L2SA 3ARWA 3FAPA 1KT0A 4JFIA 2ZR5A 4JFMA 3AS2A 4U84A 3O5DA 3ARTA 4MNLA 3O5MA 1E15A 1FKIA 1HJWA 1JNDA 3CGMA 3ARRA 1NWUA 4LAXA 3CZ8A 1BKFA 2XP8A 3OOBA 5HWCA 1A7XA 4TX0A 5DITA 4HARA 2XP4A 4JFKA 1M5YA 1HKKA 3NRKA 3KCEA 1PBKA 1W9PA 2WLYA 4DH0A 4W9OA 4R5EA 3RGCA 1WNOA 1EDQA 3UI4A 3GU0A 3UI5A 2O92A 2RUCA 4WKAA 2ZQTA 4Z2IA 2D9FA 1FKDA 2Q5AA 4DRQA 4PTMA 3JXVA 4FAPA 1B6CA 3UQIA 4U86A 2ZQVA 4Q7NA 2PPPA 4UDMA 4ODQA 1D7HA 4DWSC 3AS3A 1HJXA 1NSGA 3ALGA 3PRBA 3KAIA 1P5QA 2RURA 4TYOA 1QPLA 1SYTA 4DRJA 1LL7A 2F21A 4WK9A 4Z2GA 2M2AA 2RUQA 5DEZA 2M08A 2EULA 2PPOA 3NTPA 2QF8A 1FD9A 1YATA 2ESCA 4ZS6A 1K9TA 3MDYB 2A3EA 2PV1A 2DT3A 3B9DA 1EYMA 1D7JA 1E6RA 1ITXA 5HBFA 2A3CA 3FXYA 5D75A 3WD4A 1E6PA 2P4VA 3ARZA 1E44A 1F8AB 4MNMA 4LAVA 4R0XA 4C02B 2XP9A 2WLZA 1FKKA 2FDMA 4ODOA 5DO2A 2RQSA 2DG3A 4S3JA 1HKMA 1WAWA 3ARQA 2UZ5A 1NWTA 4MNJA 3CHDA 4N19A 1LG1A 3O5EA 4W9PA 1D7IA 1PINA 2OFNA 1GPFA 3PR9A 4ODLA 5BXJA 3UI6A 1X6NA 2MNTA 1ROUA 1FKHA 2DSVA 2LKNA 1TFVA 5DIVA 3AS0A 1T11A 1GRJA 1Q6UA 1FJDA 2XP5A 3WQWA 3CGNA 3WD0A 5DIUA 4LAWA 3WKZA 5I98A 4Z2LA 4L72B 2M1IA 2FAPA 1QZ2A 3IHZA 2XPBA 2F4EA 5HT1A 4J4OA 1SR0A 4GGQA 3ALFA 1LJYA 3WL1A 4DROA 3TCZA 2XPAA 3KAHA 2DSWA 4ODMA 2ITKA 1J6YA 4ML4A 4DWSA 4IT4A 3TDBA 5GPRA 4Q22A 4U85A 4GIVA 3CHCA 1TCOC 1O6IA 3B8SA 3CH9A 2ZQSA 3ODKA 3O5IA 2DT1A 1NWRA 1ZK6A 2KO7A 1FKFA 4G2PA 5HW6A 3JYJA 4DZ2A 1LQ0A 4LGXA 3O5QA 2AOSA 1J4IA 3GPKA 4P8VA 2G8ZA 1W9UA 2RUDA 1HXVA 2FKEA 3ARYA 2AWGA 3ARXA 1OGBA 3WL0A 4J4NA 4P8WA 1C9HA 2ETNA 2IF4A 1KFWA 2N87A 1BL4A 4IQ2A
chains in the Genus database with same CATH topology
1ZB5A 5GPGA 1Q1CA 3I6CA 4ODRA 1ZBKA 3O5FA 4KR0B 2ZR4A 2YBUA 3WD1A 1ZL1A 1NWSA 4IT6A 3W4RA 2DT0A 4FN2A 4MGVA 4G50A 4TW7A 4QT2A 4DRIA 1F40A 1FFRA 4MSPA 1FKLA 3G6MA 3FY1A 5HWBA 5HW8A 4NSBA 2LGOA 2B31A 1YW5A 1U79A 1W9VA 5HKGA 3OA5A 1FKGA 3RFWA 3EY6A 1FKSA 4DT4A 3B7XA 3G6LA 1ZBCA 4QT3A 3IKGA 4O2TA 4W5UA 1D6OA 1UR9A 2KE0A 3BXWA 1W26A 1W1YA 3KAGA 2PV3A 1Q6HA 4TW8A 4HBOA 2MF9A 1XRVA 4IPXA 2PI6A 1FKJA 1FKTA 2JZVA 4DRHA 2DG4A 3JYMA 1JNEA 1VF8A 3WIJA 3UQAA 1E6NA 1FFQA 2Y78A 1GUVA 3WQVA 1E6ZA 2LJ4A 2PPNA 4NZCA 4WIWA 3QOKA 2RSEA 2LPVA 1JNSA 2XP6A 3ARPA 4S3KA 1Q6IA 2XP7A 2KGJA 3O5PA 3B9AA 1JVWA 2DT2A 1NMVA 4P8XA 4QZVB 1NH6A 2ZQUA 4XAKA 1CTNA 1R9HA 4TNSA 4WKFA 3RM9A 4MNKA 3RMEA 1FKRA 4MTVA 5HW7A 1N1AA 1QPFA 3WH0A 2KFWA 1J4HA 3WD2A 2A3BA 4MPKA 2XP3A 4P8UA 1L1PA 5HUAA 1WB0A 1H0GA 4KQZA 3UF8A 3B9EA 4WJXA 2DSUA 2IUZA 4L3NA 4JFLA 3ARUA 5HTGA 4W9QA 4QIBA 4DRMA 2ZR6A 3VAWA 1OGGA 1HKJA 1LL6A 4DRKA 2DSZA 3H9RB 2PBCA 1GOIA 1HJVA 3KABA 3O5LA 3KAFA 4ZPVR 5J6EA 3O5JA 1ZU8A 2MLXA 4DWSD 2DPEA 5DF0A 4ZPWR 1W1TA 3O5RA 4ITZA 3CHEA 2YBTA 3RM4A 3IKDA 4HBEA 1EQ3A 2OLHA 3KADA 1UR8A 3LUOA 1E9LA 4URIA 5JH8A 4TW6A 4IQCA 3AS1A 3IK8A 3CHFA 1W1PA 4DRPA 1Y0OA 4ZPTR 4DWSB 4AY1A 4JFJA 3PA7A 2MLYA 2KR7A 2MLZA 3KACA 4BF8A 2VN1A 5B8IC 3AQUA 1XHGA 3O5OA 2F2DA 4ODPA 1LG2A 4MAVA 2G41A 4LAYA 1J4RA 5GQBA 3ARVA 1D2KA 1H0IA 1KT1A 2WM0A 1X6LA 4DIPA 3NI6A 2DG9A 2VCDA 1JNTA 2KI3A 1RD6A 2K8IA 1EIBA 4Z2HA 3TC5A 3UQBA 1ZBWA 2A3AA 4ODNA 1ROTA 1IX5A 2WK2A 3O5GA 1FKBA 2MPHA 1OWQA 3AROA 3RM8A 3KZ7A 1W1VA 1FAPA 4NNRA 1LL4A 4ODKA 4WKHA 1EHNA 4Z2JA 2PV2A 4DZ3A 3WD3A 3O5KA 4Z2KA 1NMWA 1HKIA 3PRDA 4DRNA 1ZCNA 3ARSA 1ZBVA 3PRAA 4JYSA 2O9OA 2L2SA 3ARWA 3FAPA 1KT0A 4JFIA 2ZR5A 4JFMA 3AS2A 4U84A 3O5DA 3ARTA 4MNLA 3O5MA 1E15A 1FKIA 1HJWA 1JNDA 3CGMA 3ARRA 1NWUA 4LAXA 3CZ8A 1BKFA 2XP8A 3OOBA 5HWCA 1A7XA 4TX0A 5DITA 4HARA 2XP4A 4JFKA 1M5YA 1HKKA 3NRKA 3KCEA 1PBKA 1W9PA 2WLYA 4DH0A 4W9OA 4R5EA 3RGCA 1WNOA 1EDQA 3UI4A 3UI5A 2O92A 2RUCA 4WKAA 2ZQTA 4Z2IA 2D9FA 1FKDA 2Q5AA 4DRQA 4PTMA 3JXVA 4FAPA 1B6CA 3UQIA 4U86A 2ZQVA 4Q7NA 2PPPA 4ODQA 1D7HA 4DWSC 3AS3A 1HJXA 1NSGA 3ALGA 3PRBA 3KAIA 1P5QA 2RURA 4TYOA 1QPLA 1SYTA 4DRJA 1LL7A 2F21A 4WK9A 4Z2GA 2M2AA 2RUQA 5DEZA 2M08A 2PPOA 3NTPA 2QF8A 1FD9A 1YATA 2ESCA 4ZS6A 1K9TA 3MDYB 2A3EA 2PV1A 2DT3A 3B9DA 1EYMA 1D7JA 1E6RA 1ITXA 5HBFA 2A3CA 3FXYA 5D75A 3WD4A 1E6PA 3ARZA 1F8AB 4R0XA 4MNMA 4LAVA 4C02B 2XP9A 2WLZA 1FKKA 2FDMA 4ODOA 5DO2A 2RQSA 2DG3A 4S3JA 1HKMA 1WAWA 3ARQA 2UZ5A 1NWTA 4MNJA 3CHDA 4N19A 1LG1A 3O5EA 4W9PA 1D7IA 1PINA 2OFNA 1GPFA 3PR9A 4ODLA 5BXJA 3UI6A 1X6NA 2MNTA 1ROUA 1FKHA 2DSVA 2LKNA 1TFVA 5DIVA 3AS0A 1T11A 1Q6UA 1FJDA 2XP5A 3WQWA 3CGNA 3WD0A 5DIUA 4LAWA 3WKZA 5I98A 4Z2LA 4L72B 2M1IA 2FAPA 1QZ2A 3IHZA 2XPBA 2F4EA 5HT1A 4J4OA 1SR0A 4GGQA 3ALFA 1LJYA 3WL1A 4DROA 3TCZA 2XPAA 3KAHA 2DSWA 4ODMA 2ITKA 1J6YA 4ML4A 4DWSA 4IT4A 3TDBA 5GPRA 4Q22A 4U85A 4GIVA 3CHCA 1TCOC 1O6IA 3B8SA 3CH9A 2ZQSA 3ODKA 3O5IA 2DT1A 1NWRA 1ZK6A 2KO7A 1FKFA 4G2PA 5HW6A 3JYJA 4DZ2A 1LQ0A 4LGXA 3O5QA 2AOSA 1J4IA 3GPKA 4P8VA 2G8ZA 1W9UA 2RUDA 1HXVA 2FKEA 3ARYA 2AWGA 3ARXA 1OGBA 3WL0A 4J4NA 4P8WA 1C9HA 2IF4A 1KFWA 2N87A 1BL4A 4IQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZCN A;  5GPG A;  4JFL A;  1Q1C A;  3I6C A;  1F8A B;  4JYS A;  4ODR A;  4LAV A;  4R0X A;  4C02 B;  5HTG A;  2XP9 A;  3O5F A;  4W9Q A;  4QIB A;  4DRM A;  1FKK A;  2ZR4 A;  2L2S A;  3FAP A;  2ZR6 A;  4ODO A;  1KT0 A;  4JFI A;  3VAW A;  2ZR5 A;  4IQ2 A;  4DRK A;  2RQS A;  3H9R B;  4JFM A;  2PBC A;  2DG3 A;  4FN2 A;  4MGV A;  3KAB A;  3O5L A;  2UZ5 A;  4U84 A;  3O5D A;  3KAF A;  4G50 A;  4TW7 A;  4QT2 A;  5J6E A;  3O5M A;  3O5J A;  4N19 A;  4DRI A;  2MLX A;  1FKI A;  3O5E A;  4W9P A;  1D7I A;  1PIN A;  2OFN A;  3CGM A;  1F40 A;  4ODL A;  5BXJ A;  3UI6 A;  4LAX A;  2MNT A;  3O5R A;  4ITZ A;  1BKF A;  1ROU A;  1FKL A;  3IKD A;  4MSP A;  2XP8 A;  1FKH A;  2LKN A;  3OOB A;  5HWC A;  1EQ3 A;  3KAD A;  5DIV A;  1T11 A;  1A7X A;  3LUO A;  5HWB A;  1Q6U A;  5HW8 A;  4TX0 A;  5DIT A;  4TW6 A;  2LGO A;  1FJD A;  4IQC A;  2XP5 A;  3IK8 A;  2XP4 A;  3CGN A;  5DIU A;  4LAW A;  5I98 A;  1YW5 A;  1U79 A;  5HKG A;  4DRP A;  2M1I A;  4JFK A;  1M5Y A;  2FAP A;  3KCE A;  3NRK A;  1QZ2 A;  1Y0O A;  3IHZ A;  1FKG A;  3RFW A;  3EY6 A;  1FKS A;  1PBK A;  2F4E A;  2XPB A;  5HT1 A;  3B7X A;  4DT4 A;  4JFJ A;  3PA7 A;  3IKG A;  4J4O A;  4O2T A;  4QT3 A;  1D6O A;  4DH0 A;  4GGQ A;  4W9O A;  2KE0 A;  2MLY A;  4DRO A;  1W26 A;  3RGC A;  3TCZ A;  3KAG A;  2PV3 A;  2KR7 A;  2MLZ A;  1Q6H A;  2XPA A;  3KAC A;  2VN1 A;  3KAH A;  4ODM A;  4TW8 A;  4BF8 A;  2MF9 A;  3UI4 A;  2ITK A;  4IPX A;  3UI5 A;  3O5O A;  1FKJ A;  1FKT A;  2F2D A;  2JZV A;  2RUC A;  4ODP A;  1J6Y A;  2ZQT A;  4DRH A;  2DG4 A;  3JYM A;  2D9F A;  1J4R A;  4LAY A;  3TDB A;  1FKD A;  2Q5A A;  3UQA A;  1KT1 A;  4U85 A;  4DRQ A;  2Y78 A;  4GIV A;  3JXV A;  4DIP A;  1TCO C;  1B6C A;  4FAP A;  3UQI A;  3NI6 A;  4U86 A;  2DG9 A;  2ZQV A;  2PPP A;  2ZQS A;  2VCD A;  3O5I A;  3ODK A;  1JNT A;  2KI3 A;  2K8I A;  2LJ4 A;  2PPN A;  4ODQ A;  5B8I C;  1D7H A;  2RSE A;  2LPV A;  1JNS A;  2XP6 A;  1ZK6 A;  2KO7 A;  1FKF A;  4G2P A;  1Q6I A;  5HW6 A;  2XP7 A;  3JYJ A;  2KGJ A;  1NSG A;  3O5P A;  3TC5 A;  4DZ2 A;  1JVW A;  3UQB A;  3PRB A;  3KAI A;  1P5Q A;  2RUR A;  4ODN A;  4TYO A;  1NMV A;  1ROT A;  3O5Q A;  2ZQU A;  1QPL A;  1R9H A;  3O5G A;  4DRJ A;  4TNS A;  1FKB A;  2F21 A;  2MPH A;  1J4I A;  3GPK A;  2M2A A;  2RUQ A;  1FKR A;  2M08 A;  2RUD A;  1N1A A;  3KZ7 A;  1QPF A;  5HW7 A;  1FAP A;  4NNR A;  2FKE A;  3WH0 A;  2KFW A;  1HXV A;  3NTP A;  4ODK A;  1FD9 A;  1YAT A;  2PV2 A;  1J4H A;  4DZ3 A;  3MDY B;  2PV1 A;  2AWG A;  2XP3 A;  1EYM A;  3O5K A;  1D7J A;  4J4N A;  1NMW A;  1L1P A;  5HUA A;  1C9H A;  2IF4 A;  3PRD A;  5D75 A;  2N87 A;  4DRN A;  1BL4 A;  3UF8 A;  2PPO A; 
#chains in the Genus database with same CATH topology
 1ZB5 A;  5GPG A;  1Q1C A;  3I6C A;  4ODR A;  1ZBK A;  3O5F A;  4KR0 B;  2ZR4 A;  2YBU A;  3WD1 A;  1ZL1 A;  1NWS A;  4IT6 A;  3W4R A;  2DT0 A;  4FN2 A;  4MGV A;  4G50 A;  4TW7 A;  4QT2 A;  4DRI A;  1F40 A;  2B5U B;  1FFR A;  3BMB A;  3EIP A;  4MSP A;  1FKL A;  3G6M A;  3FY1 A;  5HWB A;  5HW8 A;  4NSB A;  2LGO A;  2B31 A;  1JCH B;  1YW5 A;  1U79 A;  1W9V A;  5HKG A;  3OA5 A;  1FKG A;  3RFW A;  3EY6 A;  1FKS A;  4DT4 A;  3B7X A;  3G6L A;  1ZBC A;  4QT3 A;  3IKG A;  4O2T A;  4W5U A;  1D6O A;  1UR9 A;  2KE0 A;  3BXW A;  1W26 A;  1W1Y A;  3KAG A;  2PV3 A;  1Q6H A;  4TW8 A;  4HBO A;  2MF9 A;  1XRV A;  4IPX A;  2PI6 A;  1FKJ A;  1FKT A;  2JZV A;  4DRH A;  2DG4 A;  3JYM A;  1JNE A;  1VF8 A;  3WIJ A;  3UQA A;  1E6N A;  1FFQ A;  2Y78 A;  1GUV A;  3WQV A;  1E6Z A;  2LJ4 A;  2PPN A;  4NZC A;  4WIW A;  3QOK A;  2RSE A;  2LPV A;  1JNS A;  2XP6 A;  3ARP A;  4S3K A;  1Q6I A;  2XP7 A;  2KGJ A;  3O5P A;  3B9A A;  1JVW A;  2DT2 A;  1NMV A;  4P8X A;  4QZV B;  1NH6 A;  2ZQU A;  4XAK A;  1CTN A;  1R9H A;  4TNS A;  4WKF A;  3RM9 A;  4MNK A;  3RME A;  1FKR A;  4MTV A;  5HW7 A;  1N1A A;  1QPF A;  3WH0 A;  2KFW A;  1J4H A;  3WD2 A;  2A3B A;  4MPK A;  2XP3 A;  4P8U A;  1L1P A;  5HUA A;  1WB0 A;  1H0G A;  4KQZ A;  3UF8 A;  3B9E A;  4WJX A;  2DSU A;  2IUZ A;  4L3N A;  4JFL A;  3ARU A;  5HTG A;  4W9Q A;  4QIB A;  4DRM A;  2ZR6 A;  3VAW A;  1OGG A;  1HKJ A;  1LL6 A;  4DRK A;  2DSZ A;  3H9R B;  2PBC A;  1GOI A;  1HJV A;  3KAB A;  3O5L A;  3KAF A;  4ZPV R;  5J6E A;  3O5J A;  1ZU8 A;  2MLX A;  4DWS D;  2DPE A;  5DF0 A;  4ZPW R;  1W1T A;  3O5R A;  4ITZ A;  3CHE A;  2YBT A;  3RM4 A;  3IKD A;  4HBE A;  1EQ3 A;  2OLH A;  3KAD A;  1UR8 A;  3LUO A;  1E9L A;  4URI A;  5JH8 A;  4TW6 A;  4IQC A;  3AS1 A;  3IK8 A;  3CHF A;  1W1P A;  4DRP A;  1Y0O A;  4ZPT R;  4DWS B;  4AY1 A;  4JFJ A;  3PA7 A;  2MLY A;  2KR7 A;  2MLZ A;  3KAC A;  4BF8 A;  2VN1 A;  5B8I C;  3AQU A;  1XHG A;  3O5O A;  2F2D A;  4ODP A;  1LG2 A;  4MAV A;  2G41 A;  4LAY A;  1J4R A;  5GQB A;  3ARV A;  1D2K A;  1H0I A;  1KT1 A;  2WM0 A;  1X6L A;  4DIP A;  3NI6 A;  2DG9 A;  2VCD A;  1JNT A;  2KI3 A;  1RD6 A;  2K8I A;  1EIB A;  4Z2H A;  2F23 A;  3TC5 A;  3UQB A;  1ZBW A;  2A3A A;  4ODN A;  1ROT A;  1IX5 A;  2WK2 A;  3O5G A;  1FKB A;  2MPH A;  1OWQ A;  3ARO A;  2PN0 A;  3RM8 A;  3KZ7 A;  1W1V A;  1FAP A;  4NNR A;  1LL4 A;  4ODK A;  4WKH A;  1EHN A;  4Z2J A;  2PV2 A;  4DZ3 A;  3WD3 A;  3O5K A;  4Z2K A;  1NMW A;  1HKI A;  3PRD A;  4DRN A;  3GTY X;  1ZCN A;  3ARS A;  1ZBV A;  3PRA A;  4JYS A;  2O9O A;  2L2S A;  3ARW A;  3FAP A;  1KT0 A;  4JFI A;  2ZR5 A;  4JFM A;  3AS2 A;  4U84 A;  3O5D A;  3ART A;  4MNL A;  3O5M A;  1E15 A;  1FKI A;  1HJW A;  1JND A;  3CGM A;  3ARR A;  1NWU A;  4LAX A;  3CZ8 A;  1BKF A;  2XP8 A;  3OOB A;  5HWC A;  1A7X A;  4TX0 A;  5DIT A;  4HAR A;  2XP4 A;  4JFK A;  1M5Y A;  1HKK A;  3NRK A;  3KCE A;  1PBK A;  1W9P A;  2WLY A;  4DH0 A;  4W9O A;  4R5E A;  3RGC A;  1WNO A;  1EDQ A;  3UI4 A;  3GU0 A;  3UI5 A;  2O92 A;  2RUC A;  4WKA A;  2ZQT A;  4Z2I A;  2D9F A;  1FKD A;  2Q5A A;  4DRQ A;  4PTM A;  3JXV A;  4FAP A;  1B6C A;  3UQI A;  4U86 A;  2ZQV A;  4Q7N A;  2PPP A;  4UDM A;  4ODQ A;  1D7H A;  4DWS C;  3AS3 A;  1HJX A;  1NSG A;  3ALG A;  3PRB A;  3KAI A;  1P5Q A;  2RUR A;  4TYO A;  1QPL A;  1SYT A;  4DRJ A;  1LL7 A;  2F21 A;  4WK9 A;  4Z2G A;  2M2A A;  2RUQ A;  5DEZ A;  2M08 A;  2EUL A;  2PPO A;  3NTP A;  2QF8 A;  1FD9 A;  1YAT A;  2ESC A;  4ZS6 A;  1K9T A;  3MDY B;  2A3E A;  2PV1 A;  2DT3 A;  3B9D A;  1EYM A;  1D7J A;  1E6R A;  1ITX A;  5HBF A;  2A3C A;  3FXY A;  5D75 A;  3WD4 A;  1E6P A;  2P4V A;  3ARZ A;  1E44 A;  1F8A B;  4MNM A;  4LAV A;  4R0X A;  4C02 B;  2XP9 A;  2WLZ A;  1FKK A;  2FDM A;  4ODO A;  5DO2 A;  2RQS A;  2DG3 A;  4S3J A;  1HKM A;  1WAW A;  3ARQ A;  2UZ5 A;  1NWT A;  4MNJ A;  3CHD A;  4N19 A;  1LG1 A;  3O5E A;  4W9P A;  1D7I A;  1PIN A;  2OFN A;  1GPF A;  3PR9 A;  4ODL A;  5BXJ A;  3UI6 A;  1X6N A;  2MNT A;  1ROU A;  1FKH A;  2DSV A;  2LKN A;  1TFV A;  5DIV A;  3AS0 A;  1T11 A;  1GRJ A;  1Q6U A;  1FJD A;  2XP5 A;  3WQW A;  3CGN A;  3WD0 A;  5DIU A;  4LAW A;  3WKZ A;  5I98 A;  4Z2L A;  4L72 B;  2M1I A;  2FAP A;  1QZ2 A;  3IHZ A;  2XPB A;  2F4E A;  5HT1 A;  4J4O A;  1SR0 A;  4GGQ A;  3ALF A;  1LJY A;  3WL1 A;  4DRO A;  3TCZ A;  2XPA A;  3KAH A;  2DSW A;  4ODM A;  2ITK A;  1J6Y A;  4ML4 A;  4DWS A;  4IT4 A;  3TDB A;  5GPR A;  4Q22 A;  4U85 A;  4GIV A;  3CHC A;  1TCO C;  1O6I A;  3B8S A;  3CH9 A;  2ZQS A;  3ODK A;  3O5I A;  2DT1 A;  1NWR A;  1ZK6 A;  2KO7 A;  1FKF A;  4G2P A;  5HW6 A;  3JYJ A;  4DZ2 A;  1LQ0 A;  4LGX A;  3O5Q A;  2AOS A;  1J4I A;  3GPK A;  4P8V A;  2G8Z A;  1W9U A;  2RUD A;  1HXV A;  2FKE A;  3ARY A;  2AWG A;  3ARX A;  1OGB A;  3WL0 A;  4J4N A;  4P8W A;  1C9H A;  2ETN A;  2IF4 A;  1KFW A;  2N87 A;  1BL4 A;  4IQ2 A; 
#chains in the Genus database with same CATH homology
 1ZB5 A;  5GPG A;  1Q1C A;  3I6C A;  4ODR A;  1ZBK A;  3O5F A;  4KR0 B;  2ZR4 A;  2YBU A;  3WD1 A;  1ZL1 A;  1NWS A;  4IT6 A;  3W4R A;  2DT0 A;  4FN2 A;  4MGV A;  4G50 A;  4TW7 A;  4QT2 A;  4DRI A;  1F40 A;  1FFR A;  4MSP A;  1FKL A;  3G6M A;  3FY1 A;  5HWB A;  5HW8 A;  4NSB A;  2LGO A;  2B31 A;  1YW5 A;  1U79 A;  1W9V A;  5HKG A;  3OA5 A;  1FKG A;  3RFW A;  3EY6 A;  1FKS A;  4DT4 A;  3B7X A;  3G6L A;  1ZBC A;  4QT3 A;  3IKG A;  4O2T A;  4W5U A;  1D6O A;  1UR9 A;  2KE0 A;  3BXW A;  1W26 A;  1W1Y A;  3KAG A;  2PV3 A;  1Q6H A;  4TW8 A;  4HBO A;  2MF9 A;  1XRV A;  4IPX A;  2PI6 A;  1FKJ A;  1FKT A;  2JZV A;  4DRH A;  2DG4 A;  3JYM A;  1JNE A;  1VF8 A;  3WIJ A;  3UQA A;  1E6N A;  1FFQ A;  2Y78 A;  1GUV A;  3WQV A;  1E6Z A;  2LJ4 A;  2PPN A;  4NZC A;  4WIW A;  3QOK A;  2RSE A;  2LPV A;  1JNS A;  2XP6 A;  3ARP A;  4S3K A;  1Q6I A;  2XP7 A;  2KGJ A;  3O5P A;  3B9A A;  1JVW A;  2DT2 A;  1NMV A;  4P8X A;  4QZV B;  1NH6 A;  2ZQU A;  4XAK A;  1CTN A;  1R9H A;  4TNS A;  4WKF A;  3RM9 A;  4MNK A;  3RME A;  1FKR A;  4MTV A;  5HW7 A;  1N1A A;  1QPF A;  3WH0 A;  2KFW A;  1J4H A;  3WD2 A;  2A3B A;  4MPK A;  2XP3 A;  4P8U A;  1L1P A;  5HUA A;  1WB0 A;  1H0G A;  4KQZ A;  3UF8 A;  3B9E A;  4WJX A;  2DSU A;  2IUZ A;  4L3N A;  4JFL A;  3ARU A;  5HTG A;  4W9Q A;  4QIB A;  4DRM A;  2ZR6 A;  3VAW A;  1OGG A;  1HKJ A;  1LL6 A;  4DRK A;  2DSZ A;  3H9R B;  2PBC A;  1GOI A;  1HJV A;  3KAB A;  3O5L A;  3KAF A;  4ZPV R;  5J6E A;  3O5J A;  1ZU8 A;  2MLX A;  4DWS D;  2DPE A;  5DF0 A;  4ZPW R;  1W1T A;  3O5R A;  4ITZ A;  3CHE A;  2YBT A;  3RM4 A;  3IKD A;  4HBE A;  1EQ3 A;  2OLH A;  3KAD A;  1UR8 A;  3LUO A;  1E9L A;  4URI A;  5JH8 A;  4TW6 A;  4IQC A;  3AS1 A;  3IK8 A;  3CHF A;  1W1P A;  4DRP A;  1Y0O A;  4ZPT R;  4DWS B;  4AY1 A;  4JFJ A;  3PA7 A;  2MLY A;  2KR7 A;  2MLZ A;  3KAC A;  4BF8 A;  2VN1 A;  5B8I C;  3AQU A;  1XHG A;  3O5O A;  2F2D A;  4ODP A;  1LG2 A;  4MAV A;  2G41 A;  4LAY A;  1J4R A;  5GQB A;  3ARV A;  1D2K A;  1H0I A;  1KT1 A;  2WM0 A;  1X6L A;  4DIP A;  3NI6 A;  2DG9 A;  2VCD A;  1JNT A;  2KI3 A;  1RD6 A;  2K8I A;  1EIB A;  4Z2H A;  3TC5 A;  3UQB A;  1ZBW A;  2A3A A;  4ODN A;  1ROT A;  1IX5 A;  2WK2 A;  3O5G A;  1FKB A;  2MPH A;  1OWQ A;  3ARO A;  3RM8 A;  3KZ7 A;  1W1V A;  1FAP A;  4NNR A;  1LL4 A;  4ODK A;  4WKH A;  1EHN A;  4Z2J A;  2PV2 A;  4DZ3 A;  3WD3 A;  3O5K A;  4Z2K A;  1NMW A;  1HKI A;  3PRD A;  4DRN A;  1ZCN A;  3ARS A;  1ZBV A;  3PRA A;  4JYS A;  2O9O A;  2L2S A;  3ARW A;  3FAP A;  1KT0 A;  4JFI A;  2ZR5 A;  4JFM A;  3AS2 A;  4U84 A;  3O5D A;  3ART A;  4MNL A;  3O5M A;  1E15 A;  1FKI A;  1HJW A;  1JND A;  3CGM A;  3ARR A;  1NWU A;  4LAX A;  3CZ8 A;  1BKF A;  2XP8 A;  3OOB A;  5HWC A;  1A7X A;  4TX0 A;  5DIT A;  4HAR A;  2XP4 A;  4JFK A;  1M5Y A;  1HKK A;  3NRK A;  3KCE A;  1PBK A;  1W9P A;  2WLY A;  4DH0 A;  4W9O A;  4R5E A;  3RGC A;  1WNO A;  1EDQ A;  3UI4 A;  3UI5 A;  2O92 A;  2RUC A;  4WKA A;  2ZQT A;  4Z2I A;  2D9F A;  1FKD A;  2Q5A A;  4DRQ A;  4PTM A;  3JXV A;  4FAP A;  1B6C A;  3UQI A;  4U86 A;  2ZQV A;  4Q7N A;  2PPP A;  4ODQ A;  1D7H A;  4DWS C;  3AS3 A;  1HJX A;  1NSG A;  3ALG A;  3PRB A;  3KAI A;  1P5Q A;  2RUR A;  4TYO A;  1QPL A;  1SYT A;  4DRJ A;  1LL7 A;  2F21 A;  4WK9 A;  4Z2G A;  2M2A A;  2RUQ A;  5DEZ A;  2M08 A;  2PPO A;  3NTP A;  2QF8 A;  1FD9 A;  1YAT A;  2ESC A;  4ZS6 A;  1K9T A;  3MDY B;  2A3E A;  2PV1 A;  2DT3 A;  3B9D A;  1EYM A;  1D7J A;  1E6R A;  1ITX A;  5HBF A;  2A3C A;  3FXY A;  5D75 A;  3WD4 A;  1E6P A;  3ARZ A;  1F8A B;  4R0X A;  4MNM A;  4LAV A;  4C02 B;  2XP9 A;  2WLZ A;  1FKK A;  2FDM A;  4ODO A;  5DO2 A;  2RQS A;  2DG3 A;  4S3J A;  1HKM A;  1WAW A;  3ARQ A;  2UZ5 A;  1NWT A;  4MNJ A;  3CHD A;  4N19 A;  1LG1 A;  3O5E A;  4W9P A;  1D7I A;  1PIN A;  2OFN A;  1GPF A;  3PR9 A;  4ODL A;  5BXJ A;  3UI6 A;  1X6N A;  2MNT A;  1ROU A;  1FKH A;  2DSV A;  2LKN A;  1TFV A;  5DIV A;  3AS0 A;  1T11 A;  1Q6U A;  1FJD A;  2XP5 A;  3WQW A;  3CGN A;  3WD0 A;  5DIU A;  4LAW A;  3WKZ A;  5I98 A;  4Z2L A;  4L72 B;  2M1I A;  2FAP A;  1QZ2 A;  3IHZ A;  2XPB A;  2F4E A;  5HT1 A;  4J4O A;  1SR0 A;  4GGQ A;  3ALF A;  1LJY A;  3WL1 A;  4DRO A;  3TCZ A;  2XPA A;  3KAH A;  2DSW A;  4ODM A;  2ITK A;  1J6Y A;  4ML4 A;  4DWS A;  4IT4 A;  3TDB A;  5GPR A;  4Q22 A;  4U85 A;  4GIV A;  3CHC A;  1TCO C;  1O6I A;  3B8S A;  3CH9 A;  2ZQS A;  3ODK A;  3O5I A;  2DT1 A;  1NWR A;  1ZK6 A;  2KO7 A;  1FKF A;  4G2P A;  5HW6 A;  3JYJ A;  4DZ2 A;  1LQ0 A;  4LGX A;  3O5Q A;  2AOS A;  1J4I A;  3GPK A;  4P8V A;  2G8Z A;  1W9U A;  2RUD A;  1HXV A;  2FKE A;  3ARY A;  2AWG A;  3ARX A;  1OGB A;  3WL0 A;  4J4N A;  4P8W A;  1C9H A;  2IF4 A;  1KFW A;  2N87 A;  1BL4 A;  4IQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...