4DRNA

Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with {3-[(1r)-3-(3,4-dimethoxyphenyl)-1-({[(2s)-1-{[(1s,2r)-2-ethyl-1-hydroxycyclohexyl](oxo)acetyl}piperidin-2-yl]carbonyl}oxy)propyl]phenoxy}acetic acid
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 39
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drnA00
1J4IA 3PRDA 1TCOC 4QT2A 1PINA 1A7XA 3MDYB 3IKDA 4R0XA 1HXVA 3O5DA 4DRPA 3IKGA 3O5EA 4DRKA 3UI5A 1D6OA 2LGOA 3UI4A 1BKFA 4DIPA 2RURA 2XPAA 3KAHA 1J4RA 3KAFA 3VAWA 2LJ4A 4MSPA 1QPFA 5HWCA 4JFIA 1ROUA 1QPLA 4JFLA 2FAPA 4U86A 1M5YA 1T11A 2Q5AA 5I98A 2XP7A 3O5OA 4W9QA 2F2DA 3I6CA 3JXVA 1F40A 4C02B 2PV2A 4DRMA 5B8IC 4JFJA 2MLXA 2ZR5A 4ODOA 5HW8A 2MLYA 2KO7A 4LAVA 3IHZA 4ODMA 2ZQSA 1KT1A 2DG9A 4LAWA 4QT3A 4TNSA 3FAPA 5GPGA 3IK8A 2D9FA 3CGNA 3NRKA 4GGQA 1R9HA 2N87A 1C9HA 1W26A 1ZCNA 2DG4A 1KT0A 2FKEA 2JZVA 1NSGA 2KFWA 2KGJA 2M1IA 3O5IA 3UQBA 3O5FA 1Q1CA 2L2SA 3O5JA 1J6YA 2PPPA 1F8AB 1FKDA 5HW7A 2ZQTA 4J4OA 4TW8A 1FKIA 3RGCA 2RSEA 4TW7A 1P5QA 4DROA 2PPNA 4JFMA 5DIUA 3TC5A 3O5KA 4DRQA 4ODNA 3UQIA 4TW6A 4DH0A 3PRBA 5DITA 1FKHA 2LPVA 4GIVA 2DG3A 1FAPA 4ODLA 3O5PA 3O5MA 1D7IA 3LUOA 2PV1A 2RUCA 1JNTA 2ZR4A 1BL4A 4LAXA 4ODPA 4FN2A 4W9OA 1N1AA 4ODQA 3KADA 3O5RA 2VCDA 2ZQUA 2XP8A 2M08A 3O5GA 4MGVA 2XP9A 1ZK6A 5HKGA 1FD9A 1D7JA 3NI6A 3EY6A 4DZ3A 4LAYA 2OFNA 4FAPA 4BF8A 1NMVA 3GPKA 3RFWA 1FKGA 4JFKA 2LKNA 1U79A 4G2PA 2MNTA 2PPOA 4DRHA 2UZ5A 4QIBA 3H9RB 5D75A 5HT1A 1FJDA 1EQ3A 1JNSA 2PBCA 5DIVA 1FKJA 3PA7A 1NMWA 2RQSA 4TX0A 2M2AA 3TDBA 1YATA 3KABA 1JVWA 4IQ2A 2MF9A 5HUAA 1EYMA 4IPXA 2ZR6A 3KCEA 3KZ7A 4DT4A 4ODRA 4O2TA 2AWGA 5HW6A 1ROTA 4N19A 4G50A 1L1PA 1PBKA 2XP3A 1FKKA 1D7HA 2MLZA 4U85A 4DRIA 5HWBA 3O5QA 2PV3A 3CGMA 1FKFA 4ITZA 1B6CA 1FKTA 2KR7A 2Y78A 1FKRA 1QZ2A 1J4HA 3KACA 2XP6A 2ZQVA 4U84A 4DRJA 3UF8A 2F4EA 2XP5A 2KE0A 2KI3A 3ODKA 2K8IA 1FKSA 2RUDA 3JYJA 1YW5A 1FKLA 3KAGA 3OOBA 4NNRA 3UQAA 2XP4A 3JYMA 1Q6HA 4DZ2A 5J6EA 2VN1A 3B7XA 4J4NA 5BXJA 2MPHA 2XPBA 1Y0OA 4ODKA 3TCZA 3WH0A 4DRNA 2IF4A 1Q6UA 1FKBA 5HTGA 4TYOA 2RUQA 4JYSA 3O5LA 3NTPA 3KAIA 4IQCA 4W9PA 2F21A 3UI6A 1Q6IA 2ITKA
chains in the Genus database with same CATH superfamily
1J4IA 3PRDA 3CHCA 1H0GA 4R0XA 4Z2JA 1W9PA 2LGOA 3RM9A 2XPAA 1XHGA 4MSPA 4AY1A 1ROUA 1QPLA 4JFLA 2F23A 4IT4A 1W1VA 1E6NA 3ARZA 1F40A 3CHFA 1XRVA 1ZU8A 4URIA 4ODOA 4P8UA 1WNOA 2KO7A 4ODMA 2ZQSA 2DG9A 4LAWA 3FAPA 4GGQA 1R9HA 2FKEA 2DG4A 3BMBA 4ZS6A 2L2SA 1J6YA 2DT1A 2PPPA 1CTNA 3WD1A 5HW7A 4ZPVR 2A3BA 4TW7A 1P5QA 3O5KA 4ODNA 2IUZA 5DITA 1FAPA 3O5MA 1BL4A 4FN2A 3KADA 3O5RA 4WKHA 2VCDA 2PN0A 4MGVA 2XP9A 4MPKA 3EY6A 4DZ3A 4LAYA 2OFNA 1NMVA 4L72B 3AQUA 3RM8A 1VF8A 1ITXA 2OLHA 1NH6A 4MNJA 3H9RB 5D75A 1FJDA 1ZBVA 5DIVA 1RD6A 3WL1A 4PTMA 1YATA 1JVWA 4S3JA 5HUAA 4IPXA 3ARYA 1FFQA 3W4RA 4N19A 1PBKA 3O5QA 2PV3A 3CGMA 1FKTA 4XAKA 1FKRA 1QZ2A 4IT6A 2XP6A 1KFWA 3CHDA 2KI3A 2RUDA 1E6PA 3OOBA 3KAGA 3WL0A 3ARRA 4DZ2A 1Q6HA 1LG1A 3B7XA 4J4NA 1IX5A 2XPBA 5HBFA 5HTGA 1FFRA 1JCHB 3KAIA 4W9PA 2DT0A 1PINA 4MNMA 3IKDA 4DRKA 5GPRA 1SYTA 1BKFA 2RURA 1J4RA 4NZCA 4JFIA 4WK9A 1LQ0A 5I98A 1E15A 4HARA 2O92A 2F2DA 4DWSC 5B8IC 2MLXA 2ZR5A 2PI6A 1EHNA 4LAVA 3IHZA 4QT3A 1E6RA 4Q7NA 5GPGA 2N87A 1C9HA 2KGJA 1K9TA 2JZVA 1KT0A 1NSGA 3UQBA 1JNDA 2WLYA 1E6ZA 1FKDA 2B5UB 4ZPTR 3WKZA 1UR8A 5DIUA 3TC5A 4DH0A 1FKHA 2DG3A 2YBTA 4ODLA 1D7IA 2ZR4A 5GQBA 1NWUA 4LAXA 4HBOA 3ARUA 3QOKA 4S3KA 1ZK6A 5HKGA 1D7JA 4ZPWR 4BF8A 3AS1A 3GPKA 4JFKA 2LKNA 3ALGA 4WJXA 2MNTA 4QZVB 2UZ5A 2QF8A 1NWSA 4DWSB 1JNSA 4LGXA 3PA7A 1NMWA 4TX0A 4IQ2A 2B31A 2WM0A 2ZR6A 3ARSA 3KCEA 3KZ7A 4WKAA 3WIJA 4DT4A 3ARPA 1ROTA 1ZB5A 2XP3A 3WQWA 1OWQA 4DRIA 2YBUA 4ITZA 1J4HA 2DT2A 1LL6A 1E9LA 3G6MA 2XP5A 4QT2A 3ODKA 5HWBA 1JNEA 4NNRA 1X6LA 1H0IA 5J6EA 2VN1A 5BXJA 1OGBA 4ODKA 4DRNA 1Y0OA 2P4VA 4P8VA 2ESCA 2F21A 3UI6A 1Q6IA 5JH8A 3FXYA 1TCOC 2A3AA 1SR0A 1A7XA 1HKKA 3PRAA 5DF0A 1HXVA 3O5DA 3O5EA 1GUVA 3UI4A 4DIPA 3KAHA 3KAFA 2LJ4A 4Q22A 1QPFA 1ZL1A 5HWCA 1GRJA 4U86A 3B9EA 2FAPA 3GU0A 1NWTA 2Q5AA 2XP7A 3O5OA 1W1YA 3JXVA 1W9VA 3ALFA 2O9OA 3PR9A 1UR9A 1HJWA 2MLYA 4TNSA 3CZ8A 3AS0A 2D9FA 3CGNA 2KFWA 2M1IA 3O5IA 4DWSA 4WKFA 3WD2A 1ZBWA 2ZQTA 3FY1A 3RGCA 2PPNA 3B8SA 1LL4A 4DRQA 3PRBA 4GIVA 3O5PA 4P8XA 2DSWA 4HBEA 4ODPA 2RUCA 1JNTA 1N1AA 4ODQA 2ZQUA 1GPFA 2XP8A 3O5GA 1FD9A 1D2KA 1U79A 1HKIA 4DRHA 4QIBA 1E44A 1EQ3A 1FKJA 4MTVA 1EIBA 1ZBKA 5DO2A 2G41A 1O6IA 3ARXA 3RM4A 4Z2GA 1L1PA 1W1PA 1FKKA 1D7HA 2MLZA 4MAVA 1HKJA 3AS2A 4Z2IA 2WLZA 1B6CA 1NWRA 2Y78A 3KACA 2WK2A 1HKMA 4U84A 3ARTA 2A3CA 2KE0A 2K8IA 1YW5A 2XP4A 3JYMA 3OA5A 2FDMA 3CHEA 2MPHA 2IF4A 3B9DA 2DSVA 1LG2A 4TYOA 2RUQA 3NTPA 4KQZA 3WD3A 4IQCA 1LL7A 1FKFA 1W1TA 3MDYB 4MNKA 4DRPA 3IKGA 2G8ZA 3UI5A 1D6OA 4R5EA 1OGGA 3VAWA 1M5YA 1T11A 2AOSA 3I6CA 4L3NA 4W9QA 1HJXA 4C02B 2PV2A 4DRMA 4NSBA 1W9UA 4JFJA 4P8WA 4UDMA 5HW8A 1KT1A 2DPEA 3IK8A 3NRKA 4Z2HA 1W26A 1ZCNA 1LJYA 3O5FA 4O2TA 1TFVA 1Q1CA 3O5JA 2DSUA 4ML4A 3CH9A 1F8AB 4KR0B 4J4OA 4TW8A 1FKIA 3WQVA 2RSEA 4DROA 4JFMA 2EULA 4WIWA 3RMEA 3UQIA 4TW6A 4Z2LA 2LPVA 3AS3A 2A3EA 1EDQA 1HJVA 3EIPA 3LUOA 2PV1A 3ARVA 3GTYX 4W9OA 3ARWA 2M08A 2ETNA 1WB0A 3B9AA 3NI6A 3AROA 4Z2KA 4FAPA 3RFWA 1FKGA 3WD0A 3ARQA 5DEZA 4G2PA 2PPOA 5HT1A 2PBCA 2RQSA 2M2AA 1ZBCA 3TDBA 3KABA 4MNLA 2DT3A 2MF9A 3WD4A 1EYMA 1GOIA 4ODRA 2AWGA 5HW6A 4DWSD 4G50A 4U85A 2KR7A 2ZQVA 4DRJA 2DSZA 3UF8A 2F4EA 4W5UA 3JYJA 1FKSA 1X6NA 1FKLA 3UQAA 3BXWA 3TCZA 3WH0A 1Q6UA 1FKBA 4JYSA 3O5LA 1WAWA 3G6LA 2ITKA
chains in the Genus database with same CATH topology
1J4IA 3PRDA 3CHCA 1H0GA 4R0XA 4Z2JA 1W9PA 2LGOA 3RM9A 2XPAA 1XHGA 4MSPA 4AY1A 1ROUA 1QPLA 4JFLA 4IT4A 1W1VA 1E6NA 3ARZA 1F40A 3CHFA 1XRVA 1ZU8A 4URIA 4ODOA 4P8UA 1WNOA 2KO7A 4ODMA 2ZQSA 2DG9A 4LAWA 3FAPA 4GGQA 1R9HA 2FKEA 2DG4A 4ZS6A 2L2SA 1J6YA 2DT1A 2PPPA 1CTNA 3WD1A 5HW7A 4ZPVR 2A3BA 4TW7A 1P5QA 3O5KA 4ODNA 2IUZA 5DITA 1FAPA 3O5MA 1BL4A 4FN2A 3KADA 3O5RA 4WKHA 2VCDA 4MGVA 2XP9A 4MPKA 3EY6A 4DZ3A 4LAYA 2OFNA 1NMVA 4L72B 3AQUA 3RM8A 1VF8A 1ITXA 2OLHA 1NH6A 4MNJA 3H9RB 5D75A 1FJDA 1ZBVA 5DIVA 1RD6A 3WL1A 4PTMA 1YATA 1JVWA 4S3JA 5HUAA 4IPXA 3ARYA 1FFQA 3W4RA 4N19A 1PBKA 3O5QA 2PV3A 3CGMA 1FKTA 4XAKA 1FKRA 1QZ2A 4IT6A 2XP6A 1KFWA 3CHDA 2KI3A 2RUDA 1E6PA 3OOBA 3KAGA 3WL0A 3ARRA 4DZ2A 1Q6HA 1LG1A 3B7XA 4J4NA 1IX5A 2XPBA 5HBFA 5HTGA 1FFRA 3KAIA 4W9PA 2DT0A 1PINA 4MNMA 3IKDA 4DRKA 5GPRA 1SYTA 1BKFA 2RURA 1J4RA 4NZCA 4JFIA 4WK9A 1LQ0A 5I98A 1E15A 4HARA 2O92A 2F2DA 4DWSC 5B8IC 2MLXA 2ZR5A 2PI6A 1EHNA 4LAVA 3IHZA 4QT3A 1E6RA 4Q7NA 5GPGA 2N87A 1C9HA 2KGJA 1K9TA 2JZVA 1KT0A 1NSGA 3UQBA 1JNDA 2WLYA 1E6ZA 1FKDA 4ZPTR 3WKZA 1UR8A 5DIUA 3TC5A 4DH0A 1FKHA 2DG3A 2YBTA 4ODLA 1D7IA 2ZR4A 5GQBA 1NWUA 4LAXA 4HBOA 3ARUA 3QOKA 4S3KA 1ZK6A 5HKGA 1D7JA 4ZPWR 4BF8A 3AS1A 3GPKA 4JFKA 2LKNA 3ALGA 4WJXA 2MNTA 4QZVB 2UZ5A 2QF8A 1NWSA 4DWSB 1JNSA 4LGXA 3PA7A 1NMWA 4TX0A 4IQ2A 2B31A 2WM0A 2ZR6A 3ARSA 3KCEA 3KZ7A 4WKAA 3WIJA 4DT4A 3ARPA 1ROTA 1ZB5A 2XP3A 3WQWA 1OWQA 4DRIA 2YBUA 4ITZA 1J4HA 2DT2A 1LL6A 1E9LA 3G6MA 2XP5A 4QT2A 3ODKA 5HWBA 1JNEA 4NNRA 1X6LA 1H0IA 5J6EA 2VN1A 5BXJA 1OGBA 4ODKA 4DRNA 1Y0OA 4P8VA 2ESCA 2F21A 3UI6A 1Q6IA 5JH8A 3FXYA 1TCOC 2A3AA 1SR0A 1A7XA 1HKKA 3PRAA 5DF0A 1HXVA 3O5DA 3O5EA 1GUVA 3UI4A 4DIPA 3KAHA 3KAFA 2LJ4A 4Q22A 1QPFA 1ZL1A 5HWCA 4U86A 3B9EA 2FAPA 1NWTA 2Q5AA 2XP7A 3O5OA 1W1YA 3JXVA 1W9VA 3ALFA 2O9OA 3PR9A 1UR9A 1HJWA 2MLYA 4TNSA 3CZ8A 3AS0A 2D9FA 3CGNA 2KFWA 2M1IA 3O5IA 4DWSA 4WKFA 3WD2A 1ZBWA 2ZQTA 3FY1A 3RGCA 2PPNA 3B8SA 1LL4A 4DRQA 3PRBA 4GIVA 3O5PA 4P8XA 2DSWA 4HBEA 4ODPA 2RUCA 1JNTA 1N1AA 4ODQA 2ZQUA 1GPFA 2XP8A 3O5GA 1FD9A 1D2KA 1U79A 1HKIA 4DRHA 4QIBA 1EQ3A 1FKJA 4MTVA 1EIBA 1ZBKA 5DO2A 2G41A 1O6IA 3ARXA 3RM4A 4Z2GA 1L1PA 1W1PA 1FKKA 1D7HA 2MLZA 4MAVA 1HKJA 3AS2A 4Z2IA 2WLZA 1B6CA 1NWRA 2Y78A 3KACA 2WK2A 1HKMA 4U84A 3ARTA 2A3CA 2KE0A 2K8IA 1YW5A 2XP4A 3JYMA 3OA5A 2FDMA 3CHEA 2MPHA 2IF4A 3B9DA 2DSVA 1LG2A 4TYOA 2RUQA 3NTPA 4KQZA 3WD3A 4IQCA 1LL7A 1FKFA 1W1TA 3MDYB 4MNKA 4DRPA 3IKGA 2G8ZA 3UI5A 1D6OA 4R5EA 1OGGA 3VAWA 1M5YA 1T11A 2AOSA 3I6CA 4L3NA 4W9QA 1HJXA 4C02B 2PV2A 4DRMA 4NSBA 1W9UA 4JFJA 4P8WA 5HW8A 1KT1A 2DPEA 3IK8A 3NRKA 4Z2HA 1W26A 1ZCNA 1LJYA 3O5FA 4O2TA 1TFVA 1Q1CA 3O5JA 2DSUA 4ML4A 3CH9A 1F8AB 4KR0B 4J4OA 4TW8A 1FKIA 3WQVA 2RSEA 4DROA 4JFMA 3RMEA 4WIWA 3UQIA 4TW6A 4Z2LA 2LPVA 3AS3A 2A3EA 1EDQA 1HJVA 3LUOA 2PV1A 3ARVA 4W9OA 3ARWA 2M08A 1WB0A 3B9AA 3NI6A 3AROA 4Z2KA 4FAPA 3RFWA 1FKGA 3WD0A 3ARQA 5DEZA 4G2PA 2PPOA 5HT1A 2PBCA 2RQSA 2M2AA 1ZBCA 3TDBA 3KABA 4MNLA 2DT3A 2MF9A 3WD4A 1EYMA 1GOIA 4ODRA 2AWGA 5HW6A 4DWSD 4G50A 4U85A 2KR7A 2ZQVA 4DRJA 2DSZA 3UF8A 2F4EA 4W5UA 3JYJA 1FKSA 1X6NA 1FKLA 3UQAA 3BXWA 3TCZA 3WH0A 1Q6UA 1FKBA 4JYSA 3O5LA 1WAWA 3G6LA 2ITKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J4I A;  3PRD A;  1TCO C;  4QT2 A;  1PIN A;  1A7X A;  3MDY B;  3IKD A;  4R0X A;  1HXV A;  3O5D A;  4DRP A;  3IKG A;  3O5E A;  4DRK A;  3UI5 A;  1D6O A;  2LGO A;  3UI4 A;  1BKF A;  4DIP A;  2RUR A;  2XPA A;  3KAH A;  1J4R A;  3KAF A;  3VAW A;  2LJ4 A;  4MSP A;  1QPF A;  5HWC A;  4JFI A;  1ROU A;  1QPL A;  4JFL A;  2FAP A;  4U86 A;  1M5Y A;  1T11 A;  2Q5A A;  5I98 A;  2XP7 A;  3O5O A;  4W9Q A;  2F2D A;  3I6C A;  3JXV A;  1F40 A;  4C02 B;  2PV2 A;  4DRM A;  5B8I C;  4JFJ A;  2MLX A;  2ZR5 A;  4ODO A;  5HW8 A;  2MLY A;  2KO7 A;  4LAV A;  3IHZ A;  4ODM A;  2ZQS A;  1KT1 A;  2DG9 A;  4LAW A;  4QT3 A;  4TNS A;  3FAP A;  5GPG A;  3IK8 A;  2D9F A;  3CGN A;  3NRK A;  4GGQ A;  1R9H A;  2N87 A;  1C9H A;  1W26 A;  1ZCN A;  2DG4 A;  1KT0 A;  2FKE A;  2JZV A;  1NSG A;  2KFW A;  2KGJ A;  2M1I A;  3O5I A;  3UQB A;  3O5F A;  1Q1C A;  2L2S A;  3O5J A;  1J6Y A;  2PPP A;  1F8A B;  1FKD A;  5HW7 A;  2ZQT A;  4J4O A;  4TW8 A;  1FKI A;  3RGC A;  2RSE A;  4TW7 A;  1P5Q A;  4DRO A;  2PPN A;  4JFM A;  5DIU A;  3TC5 A;  3O5K A;  4DRQ A;  4ODN A;  3UQI A;  4TW6 A;  4DH0 A;  3PRB A;  5DIT A;  1FKH A;  2LPV A;  4GIV A;  2DG3 A;  1FAP A;  4ODL A;  3O5P A;  3O5M A;  1D7I A;  3LUO A;  2PV1 A;  2RUC A;  1JNT A;  2ZR4 A;  1BL4 A;  4LAX A;  4ODP A;  4FN2 A;  4W9O A;  1N1A A;  4ODQ A;  3KAD A;  3O5R A;  2VCD A;  2ZQU A;  2XP8 A;  2M08 A;  3O5G A;  4MGV A;  2XP9 A;  1ZK6 A;  5HKG A;  1FD9 A;  1D7J A;  3NI6 A;  3EY6 A;  4DZ3 A;  4LAY A;  2OFN A;  4FAP A;  4BF8 A;  1NMV A;  3GPK A;  3RFW A;  1FKG A;  4JFK A;  2LKN A;  1U79 A;  4G2P A;  2MNT A;  2PPO A;  4DRH A;  2UZ5 A;  4QIB A;  3H9R B;  5D75 A;  5HT1 A;  1FJD A;  1EQ3 A;  1JNS A;  2PBC A;  5DIV A;  1FKJ A;  3PA7 A;  1NMW A;  2RQS A;  4TX0 A;  2M2A A;  3TDB A;  1YAT A;  3KAB A;  1JVW A;  4IQ2 A;  2MF9 A;  5HUA A;  1EYM A;  4IPX A;  2ZR6 A;  3KCE A;  3KZ7 A;  4DT4 A;  4ODR A;  4O2T A;  2AWG A;  5HW6 A;  1ROT A;  4N19 A;  4G50 A;  1L1P A;  1PBK A;  2XP3 A;  1FKK A;  1D7H A;  2MLZ A;  4U85 A;  4DRI A;  5HWB A;  3O5Q A;  2PV3 A;  3CGM A;  1FKF A;  4ITZ A;  1B6C A;  1FKT A;  2KR7 A;  2Y78 A;  1FKR A;  1QZ2 A;  1J4H A;  3KAC A;  2XP6 A;  2ZQV A;  4U84 A;  4DRJ A;  3UF8 A;  2F4E A;  2XP5 A;  2KE0 A;  2KI3 A;  3ODK A;  2K8I A;  1FKS A;  2RUD A;  3JYJ A;  1YW5 A;  1FKL A;  3KAG A;  3OOB A;  4NNR A;  3UQA A;  2XP4 A;  3JYM A;  1Q6H A;  4DZ2 A;  5J6E A;  2VN1 A;  3B7X A;  4J4N A;  5BXJ A;  2MPH A;  2XPB A;  1Y0O A;  4ODK A;  3TCZ A;  3WH0 A;  4DRN A;  2IF4 A;  1Q6U A;  1FKB A;  5HTG A;  4TYO A;  2RUQ A;  4JYS A;  3O5L A;  3NTP A;  3KAI A;  4IQC A;  4W9P A;  2F21 A;  3UI6 A;  1Q6I A;  2ITK A; 
#chains in the Genus database with same CATH topology
 1J4I A;  3PRD A;  3CHC A;  1H0G A;  4R0X A;  4Z2J A;  1W9P A;  2LGO A;  3RM9 A;  2XPA A;  1XHG A;  4MSP A;  4AY1 A;  1ROU A;  1QPL A;  4JFL A;  2F23 A;  4IT4 A;  1W1V A;  1E6N A;  3ARZ A;  1F40 A;  3CHF A;  1XRV A;  1ZU8 A;  4URI A;  4ODO A;  4P8U A;  1WNO A;  2KO7 A;  4ODM A;  2ZQS A;  2DG9 A;  4LAW A;  3FAP A;  4GGQ A;  1R9H A;  2FKE A;  2DG4 A;  3BMB A;  4ZS6 A;  2L2S A;  1J6Y A;  2DT1 A;  2PPP A;  1CTN A;  3WD1 A;  5HW7 A;  4ZPV R;  2A3B A;  4TW7 A;  1P5Q A;  3O5K A;  4ODN A;  2IUZ A;  5DIT A;  1FAP A;  3O5M A;  1BL4 A;  4FN2 A;  3KAD A;  3O5R A;  4WKH A;  2VCD A;  2PN0 A;  4MGV A;  2XP9 A;  4MPK A;  3EY6 A;  4DZ3 A;  4LAY A;  2OFN A;  1NMV A;  4L72 B;  3AQU A;  3RM8 A;  1VF8 A;  1ITX A;  2OLH A;  1NH6 A;  4MNJ A;  3H9R B;  5D75 A;  1FJD A;  1ZBV A;  5DIV A;  1RD6 A;  3WL1 A;  4PTM A;  1YAT A;  1JVW A;  4S3J A;  5HUA A;  4IPX A;  3ARY A;  1FFQ A;  3W4R A;  4N19 A;  1PBK A;  3O5Q A;  2PV3 A;  3CGM A;  1FKT A;  4XAK A;  1FKR A;  1QZ2 A;  4IT6 A;  2XP6 A;  1KFW A;  3CHD A;  2KI3 A;  2RUD A;  1E6P A;  3OOB A;  3KAG A;  3WL0 A;  3ARR A;  4DZ2 A;  1Q6H A;  1LG1 A;  3B7X A;  4J4N A;  1IX5 A;  2XPB A;  5HBF A;  5HTG A;  1FFR A;  1JCH B;  3KAI A;  4W9P A;  2DT0 A;  1PIN A;  4MNM A;  3IKD A;  4DRK A;  5GPR A;  1SYT A;  1BKF A;  2RUR A;  1J4R A;  4NZC A;  4JFI A;  4WK9 A;  1LQ0 A;  5I98 A;  1E15 A;  4HAR A;  2O92 A;  2F2D A;  4DWS C;  5B8I C;  2MLX A;  2ZR5 A;  2PI6 A;  1EHN A;  4LAV A;  3IHZ A;  4QT3 A;  1E6R A;  4Q7N A;  5GPG A;  2N87 A;  1C9H A;  2KGJ A;  1K9T A;  2JZV A;  1KT0 A;  1NSG A;  3UQB A;  1JND A;  2WLY A;  1E6Z A;  1FKD A;  2B5U B;  4ZPT R;  3WKZ A;  1UR8 A;  5DIU A;  3TC5 A;  4DH0 A;  1FKH A;  2DG3 A;  2YBT A;  4ODL A;  1D7I A;  2ZR4 A;  5GQB A;  1NWU A;  4LAX A;  4HBO A;  3ARU A;  3QOK A;  4S3K A;  1ZK6 A;  5HKG A;  1D7J A;  4ZPW R;  4BF8 A;  3AS1 A;  3GPK A;  4JFK A;  2LKN A;  3ALG A;  4WJX A;  2MNT A;  4QZV B;  2UZ5 A;  2QF8 A;  1NWS A;  4DWS B;  1JNS A;  4LGX A;  3PA7 A;  1NMW A;  4TX0 A;  4IQ2 A;  2B31 A;  2WM0 A;  2ZR6 A;  3ARS A;  3KCE A;  3KZ7 A;  4WKA A;  3WIJ A;  4DT4 A;  3ARP A;  1ROT A;  1ZB5 A;  2XP3 A;  3WQW A;  1OWQ A;  4DRI A;  2YBU A;  4ITZ A;  1J4H A;  2DT2 A;  1LL6 A;  1E9L A;  3G6M A;  2XP5 A;  4QT2 A;  3ODK A;  5HWB A;  1JNE A;  4NNR A;  1X6L A;  1H0I A;  5J6E A;  2VN1 A;  5BXJ A;  1OGB A;  4ODK A;  4DRN A;  1Y0O A;  2P4V A;  4P8V A;  2ESC A;  2F21 A;  3UI6 A;  1Q6I A;  5JH8 A;  3FXY A;  1TCO C;  2A3A A;  1SR0 A;  1A7X A;  1HKK A;  3PRA A;  5DF0 A;  1HXV A;  3O5D A;  3O5E A;  1GUV A;  3UI4 A;  4DIP A;  3KAH A;  3KAF A;  2LJ4 A;  4Q22 A;  1QPF A;  1ZL1 A;  5HWC A;  1GRJ A;  4U86 A;  3B9E A;  2FAP A;  3GU0 A;  1NWT A;  2Q5A A;  2XP7 A;  3O5O A;  1W1Y A;  3JXV A;  1W9V A;  3ALF A;  2O9O A;  3PR9 A;  1UR9 A;  1HJW A;  2MLY A;  4TNS A;  3CZ8 A;  3AS0 A;  2D9F A;  3CGN A;  2KFW A;  2M1I A;  3O5I A;  4DWS A;  4WKF A;  3WD2 A;  1ZBW A;  2ZQT A;  3FY1 A;  3RGC A;  2PPN A;  3B8S A;  1LL4 A;  4DRQ A;  3PRB A;  4GIV A;  3O5P A;  4P8X A;  2DSW A;  4HBE A;  4ODP A;  2RUC A;  1JNT A;  1N1A A;  4ODQ A;  2ZQU A;  1GPF A;  2XP8 A;  3O5G A;  1FD9 A;  1D2K A;  1U79 A;  1HKI A;  4DRH A;  4QIB A;  1E44 A;  1EQ3 A;  1FKJ A;  4MTV A;  1EIB A;  1ZBK A;  5DO2 A;  2G41 A;  1O6I A;  3ARX A;  3RM4 A;  4Z2G A;  1L1P A;  1W1P A;  1FKK A;  1D7H A;  2MLZ A;  4MAV A;  1HKJ A;  3AS2 A;  4Z2I A;  2WLZ A;  1B6C A;  1NWR A;  2Y78 A;  3KAC A;  2WK2 A;  1HKM A;  4U84 A;  3ART A;  2A3C A;  2KE0 A;  2K8I A;  1YW5 A;  2XP4 A;  3JYM A;  3OA5 A;  2FDM A;  3CHE A;  2MPH A;  2IF4 A;  3B9D A;  2DSV A;  1LG2 A;  4TYO A;  2RUQ A;  3NTP A;  4KQZ A;  3WD3 A;  4IQC A;  1LL7 A;  1FKF A;  1W1T A;  3MDY B;  4MNK A;  4DRP A;  3IKG A;  2G8Z A;  3UI5 A;  1D6O A;  4R5E A;  1OGG A;  3VAW A;  1M5Y A;  1T11 A;  2AOS A;  3I6C A;  4L3N A;  4W9Q A;  1HJX A;  4C02 B;  2PV2 A;  4DRM A;  4NSB A;  1W9U A;  4JFJ A;  4P8W A;  4UDM A;  5HW8 A;  1KT1 A;  2DPE A;  3IK8 A;  3NRK A;  4Z2H A;  1W26 A;  1ZCN A;  1LJY A;  3O5F A;  4O2T A;  1TFV A;  1Q1C A;  3O5J A;  2DSU A;  4ML4 A;  3CH9 A;  1F8A B;  4KR0 B;  4J4O A;  4TW8 A;  1FKI A;  3WQV A;  2RSE A;  4DRO A;  4JFM A;  2EUL A;  4WIW A;  3RME A;  3UQI A;  4TW6 A;  4Z2L A;  2LPV A;  3AS3 A;  2A3E A;  1EDQ A;  1HJV A;  3EIP A;  3LUO A;  2PV1 A;  3ARV A;  3GTY X;  4W9O A;  3ARW A;  2M08 A;  2ETN A;  1WB0 A;  3B9A A;  3NI6 A;  3ARO A;  4Z2K A;  4FAP A;  3RFW A;  1FKG A;  3WD0 A;  3ARQ A;  5DEZ A;  4G2P A;  2PPO A;  5HT1 A;  2PBC A;  2RQS A;  2M2A A;  1ZBC A;  3TDB A;  3KAB A;  4MNL A;  2DT3 A;  2MF9 A;  3WD4 A;  1EYM A;  1GOI A;  4ODR A;  2AWG A;  5HW6 A;  4DWS D;  4G50 A;  4U85 A;  2KR7 A;  2ZQV A;  4DRJ A;  2DSZ A;  3UF8 A;  2F4E A;  4W5U A;  3JYJ A;  1FKS A;  1X6N A;  1FKL A;  3UQA A;  3BXW A;  3TCZ A;  3WH0 A;  1Q6U A;  1FKB A;  4JYS A;  3O5L A;  1WAW A;  3G6L A;  2ITK A; 
#chains in the Genus database with same CATH homology
 1J4I A;  3PRD A;  3CHC A;  1H0G A;  4R0X A;  4Z2J A;  1W9P A;  2LGO A;  3RM9 A;  2XPA A;  1XHG A;  4MSP A;  4AY1 A;  1ROU A;  1QPL A;  4JFL A;  4IT4 A;  1W1V A;  1E6N A;  3ARZ A;  1F40 A;  3CHF A;  1XRV A;  1ZU8 A;  4URI A;  4ODO A;  4P8U A;  1WNO A;  2KO7 A;  4ODM A;  2ZQS A;  2DG9 A;  4LAW A;  3FAP A;  4GGQ A;  1R9H A;  2FKE A;  2DG4 A;  4ZS6 A;  2L2S A;  1J6Y A;  2DT1 A;  2PPP A;  1CTN A;  3WD1 A;  5HW7 A;  4ZPV R;  2A3B A;  4TW7 A;  1P5Q A;  3O5K A;  4ODN A;  2IUZ A;  5DIT A;  1FAP A;  3O5M A;  1BL4 A;  4FN2 A;  3KAD A;  3O5R A;  4WKH A;  2VCD A;  4MGV A;  2XP9 A;  4MPK A;  3EY6 A;  4DZ3 A;  4LAY A;  2OFN A;  1NMV A;  4L72 B;  3AQU A;  3RM8 A;  1VF8 A;  1ITX A;  2OLH A;  1NH6 A;  4MNJ A;  3H9R B;  5D75 A;  1FJD A;  1ZBV A;  5DIV A;  1RD6 A;  3WL1 A;  4PTM A;  1YAT A;  1JVW A;  4S3J A;  5HUA A;  4IPX A;  3ARY A;  1FFQ A;  3W4R A;  4N19 A;  1PBK A;  3O5Q A;  2PV3 A;  3CGM A;  1FKT A;  4XAK A;  1FKR A;  1QZ2 A;  4IT6 A;  2XP6 A;  1KFW A;  3CHD A;  2KI3 A;  2RUD A;  1E6P A;  3OOB A;  3KAG A;  3WL0 A;  3ARR A;  4DZ2 A;  1Q6H A;  1LG1 A;  3B7X A;  4J4N A;  1IX5 A;  2XPB A;  5HBF A;  5HTG A;  1FFR A;  3KAI A;  4W9P A;  2DT0 A;  1PIN A;  4MNM A;  3IKD A;  4DRK A;  5GPR A;  1SYT A;  1BKF A;  2RUR A;  1J4R A;  4NZC A;  4JFI A;  4WK9 A;  1LQ0 A;  5I98 A;  1E15 A;  4HAR A;  2O92 A;  2F2D A;  4DWS C;  5B8I C;  2MLX A;  2ZR5 A;  2PI6 A;  1EHN A;  4LAV A;  3IHZ A;  4QT3 A;  1E6R A;  4Q7N A;  5GPG A;  2N87 A;  1C9H A;  2KGJ A;  1K9T A;  2JZV A;  1KT0 A;  1NSG A;  3UQB A;  1JND A;  2WLY A;  1E6Z A;  1FKD A;  4ZPT R;  3WKZ A;  1UR8 A;  5DIU A;  3TC5 A;  4DH0 A;  1FKH A;  2DG3 A;  2YBT A;  4ODL A;  1D7I A;  2ZR4 A;  5GQB A;  1NWU A;  4LAX A;  4HBO A;  3ARU A;  3QOK A;  4S3K A;  1ZK6 A;  5HKG A;  1D7J A;  4ZPW R;  4BF8 A;  3AS1 A;  3GPK A;  4JFK A;  2LKN A;  3ALG A;  4WJX A;  2MNT A;  4QZV B;  2UZ5 A;  2QF8 A;  1NWS A;  4DWS B;  1JNS A;  4LGX A;  3PA7 A;  1NMW A;  4TX0 A;  4IQ2 A;  2B31 A;  2WM0 A;  2ZR6 A;  3ARS A;  3KCE A;  3KZ7 A;  4WKA A;  3WIJ A;  4DT4 A;  3ARP A;  1ROT A;  1ZB5 A;  2XP3 A;  3WQW A;  1OWQ A;  4DRI A;  2YBU A;  4ITZ A;  1J4H A;  2DT2 A;  1LL6 A;  1E9L A;  3G6M A;  2XP5 A;  4QT2 A;  3ODK A;  5HWB A;  1JNE A;  4NNR A;  1X6L A;  1H0I A;  5J6E A;  2VN1 A;  5BXJ A;  1OGB A;  4ODK A;  4DRN A;  1Y0O A;  4P8V A;  2ESC A;  2F21 A;  3UI6 A;  1Q6I A;  5JH8 A;  3FXY A;  1TCO C;  2A3A A;  1SR0 A;  1A7X A;  1HKK A;  3PRA A;  5DF0 A;  1HXV A;  3O5D A;  3O5E A;  1GUV A;  3UI4 A;  4DIP A;  3KAH A;  3KAF A;  2LJ4 A;  4Q22 A;  1QPF A;  1ZL1 A;  5HWC A;  4U86 A;  3B9E A;  2FAP A;  1NWT A;  2Q5A A;  2XP7 A;  3O5O A;  1W1Y A;  3JXV A;  1W9V A;  3ALF A;  2O9O A;  3PR9 A;  1UR9 A;  1HJW A;  2MLY A;  4TNS A;  3CZ8 A;  3AS0 A;  2D9F A;  3CGN A;  2KFW A;  2M1I A;  3O5I A;  4DWS A;  4WKF A;  3WD2 A;  1ZBW A;  2ZQT A;  3FY1 A;  3RGC A;  2PPN A;  3B8S A;  1LL4 A;  4DRQ A;  3PRB A;  4GIV A;  3O5P A;  4P8X A;  2DSW A;  4HBE A;  4ODP A;  2RUC A;  1JNT A;  1N1A A;  4ODQ A;  2ZQU A;  1GPF A;  2XP8 A;  3O5G A;  1FD9 A;  1D2K A;  1U79 A;  1HKI A;  4DRH A;  4QIB A;  1EQ3 A;  1FKJ A;  4MTV A;  1EIB A;  1ZBK A;  5DO2 A;  2G41 A;  1O6I A;  3ARX A;  3RM4 A;  4Z2G A;  1L1P A;  1W1P A;  1FKK A;  1D7H A;  2MLZ A;  4MAV A;  1HKJ A;  3AS2 A;  4Z2I A;  2WLZ A;  1B6C A;  1NWR A;  2Y78 A;  3KAC A;  2WK2 A;  1HKM A;  4U84 A;  3ART A;  2A3C A;  2KE0 A;  2K8I A;  1YW5 A;  2XP4 A;  3JYM A;  3OA5 A;  2FDM A;  3CHE A;  2MPH A;  2IF4 A;  3B9D A;  2DSV A;  1LG2 A;  4TYO A;  2RUQ A;  3NTP A;  4KQZ A;  3WD3 A;  4IQC A;  1LL7 A;  1FKF A;  1W1T A;  3MDY B;  4MNK A;  4DRP A;  3IKG A;  2G8Z A;  3UI5 A;  1D6O A;  4R5E A;  1OGG A;  3VAW A;  1M5Y A;  1T11 A;  2AOS A;  3I6C A;  4L3N A;  4W9Q A;  1HJX A;  4C02 B;  2PV2 A;  4DRM A;  4NSB A;  1W9U A;  4JFJ A;  4P8W A;  5HW8 A;  1KT1 A;  2DPE A;  3IK8 A;  3NRK A;  4Z2H A;  1W26 A;  1ZCN A;  1LJY A;  3O5F A;  4O2T A;  1TFV A;  1Q1C A;  3O5J A;  2DSU A;  4ML4 A;  3CH9 A;  1F8A B;  4KR0 B;  4J4O A;  4TW8 A;  1FKI A;  3WQV A;  2RSE A;  4DRO A;  4JFM A;  3RME A;  4WIW A;  3UQI A;  4TW6 A;  4Z2L A;  2LPV A;  3AS3 A;  2A3E A;  1EDQ A;  1HJV A;  3LUO A;  2PV1 A;  3ARV A;  4W9O A;  3ARW A;  2M08 A;  1WB0 A;  3B9A A;  3NI6 A;  3ARO A;  4Z2K A;  4FAP A;  3RFW A;  1FKG A;  3WD0 A;  3ARQ A;  5DEZ A;  4G2P A;  2PPO A;  5HT1 A;  2PBC A;  2RQS A;  2M2A A;  1ZBC A;  3TDB A;  3KAB A;  4MNL A;  2DT3 A;  2MF9 A;  3WD4 A;  1EYM A;  1GOI A;  4ODR A;  2AWG A;  5HW6 A;  4DWS D;  4G50 A;  4U85 A;  2KR7 A;  2ZQV A;  4DRJ A;  2DSZ A;  3UF8 A;  2F4E A;  4W5U A;  3JYJ A;  1FKS A;  1X6N A;  1FKL A;  3UQA A;  3BXW A;  3TCZ A;  3WH0 A;  1Q6U A;  1FKB A;  4JYS A;  3O5L A;  1WAW A;  3G6L A;  2ITK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...