2G41A

Crystal structure of the complex of sheep signalling glycoprotein with chitin trimer at 3.0a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL PROCESSING PROTEIN
publication title Carbohydrate binding properties and carbohydrate induced conformational switch in sheep secretory glycoprotein (SPS-40): crystal structures of four complexes of SPS-40 with chitin-like oligosaccharides
pubmed doi rcsb
molecule tags Signaling protein
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2g41A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2g41A01
4Q22A 2WMIA 4XUYA 1LLOA 3DECA 1E72M 1GQLA 2DSKA 1W9BM 3WNLA 1CGWA 1KXVA 3WH7A 1E40A 4TVCA 3UCQA 1V08A 3CH9A 3CUFA 1HVQA 4IPNB 1LL4A 3GH5A 3K1DA 3VD7A 1Q6DA 1DP0A 3TONA 2WMKA 2VL4A 1JF5A 1KQZA 2ZWYA 3D5HA 4H8HA 2MANA 1QHZA 4FK9A 1VENA 2WMJA 1E6NA 4ZFMA 3BAXA 2VUYA 2Y24A 1NP2A 2QF8A 4M29A 5BXSA 3WMSA 2XGIA 3S6TA 1LJYA 2RGLA 2JFEX 2CKSA 3WF2A 1UUQA 2WHMA 1J11A 2VR4A 3W6MA 5JBDA 1J0JA 3PZOA 3I3EA 4FLRA 1UG6A 3AIWA 3ZT6A 3OZOA 3SUTA 4ZXLA 5D8WA 4MDOA 1GZJA 3SCNA 1OGBA 1Q6CA 3UG4A 3BLPX 4H2CA 4AWEA 5CGMA 1XYZA 2BXZA 1C90A 1K9DA 1RPKA 1WDPA 1BF2A 1E6PA 5JH8A 4L4PA 4AMCA 4M81A 1JI1A 2YL5A 1OBAA 1XH0A 4JHZA 2ZUSA 1V0KA 3W24A 3I3BA 3WQ6A 2VX4A 1UQYA 4H41A 4JFVA 1L0PA 1HIZA 5I77A 4QLKA 3TTSA 3WUGA 3M7SA 4JCMA 3SUUA 1S46A 4HZ8A 1V6XA 1OT2A 1V02E 1FOBA 2B31A 1GUVA 5GPRA 2WKLA 5HOSA 4H04A 4UFLA 1UYQA 1PZ3A 4NSBA 2F61A 3VIIA 4TX8A 3VINA 2GJXB 1C8YA 8A3HA 2GSJA 4Q7NA 1H4PA 2VZUA 3GXFA 1XGZA 2XTKA 9CGTA 1CPUA 2YL9A 1G9HA 5HNNA 1NOUA 1W32A 3WDJA 4F66A 2JE8A 5I78A 1EDQA 1GQKA 2V3FA 1L8NA 4IPLA 1JD7A 4J27A 1V6VA 2W63A 3QHOA 3IJ7A 3PZ9A 5EB8A 4C7GA 1YHTA 3WF4A 1B3ZA 1UH4A 2QHAA 1HL9A 1BVNP 1TVNA 1H11A 4F79A 4HA3A 2G3NA 2OLHA 4JFSA 1O6IA 2DT0A 5A8MA 1NP0A 1C92A 2Y8KA 2YA1A 1XD1A 4BS0A 2WM0A 3SCUA 3VILA 2ZX5A 3CHDA 2WB5A 1ZBVA 4S3JA 4MPKA 1HJSA 1PEZA 3VMNA 1NH6A 1UR0A 3BH4A 1BYDA 3CZ8A 2VCAA 1MXGA 4B3KA 5JBFA 1WZMA 2BY1A 1MW0A 5A8QA 2ZUMA 5M17A 3AJ7A 5BRPA 1QI4A 2OSYA 4W5ZA 2W67A 1Q6GA 5M03A 1QI3A 1XD0A 2WCAA 1UWQA 4D6FA 4PRWA 1CBGA 1TUXA 3FAWA 3MMWA 2YLAA 3CHCA 1X6LA 1DWHM 4GPNA 1QBAA 1J0ZA 1V0MA 2VX7A 2QV4A 1GPFA 3OZPA 4NRRA 4W93A 3WNMA 4W88A 5IHSA 1OIFA 4QDMA 1KWKA 1NARA 1QW9A 3RO8A 1ITCA 3WBAA 1FP9A 1JYNA 1HXJA 2YJQA 3WH8A 2IXUA 3GXIA 1PX3A 1HKMA 4UQDA 3PZGA 1VB9A 3EDKA 3CHEA 4P7OA 5E9AA 2ZUNA 5A8NA 1F4AA 3CZGA 3WNOA 2W4XA 2HISA 3BCDA 3WMBA 3CTTA 3WD4A 1WDRA 1JZ4A 4M1RA 3L4ZA 4AYSA 1CXFA 1ZU8A 1CTNA 3AMKA 4CU7A 3N13A 5F7UA 3OBAA 1W1PA 1UWRA 1TE1A 4K68A 5D8ZA 4CKQA 2G3IA 2WC3A 4GINA 1GOQA 1E6QM 2BY0A 2WPGA 1VAHA 1KCLA 2VJXA 1HX0A 3AFBA 5DFAA 2ZX8A 1DWAM 1CGUA 5E09A 3K8LA 4UCFA 1GW1A 1ESWA 2WZHA 1JXJA 4TVDA 4GI9A 2PWEA 1W9DM 3VD3A 4UNIA 2BVDA 5LYRA 4RE2A 4J3VA 4MAVA 2WCGA 1OGSA 4L4OA 1KBKA 3BSHA 3F5LA 3S2CA 2VNCA 1ISVA 1XYFA 1CLVA 3CGTA 4AW7A 4A3YA 2PI6A 5A6BA 4Z2HA 3GNOA 2CBIA 1H49A 4OOUA 2XFRA 3PN8A 4LGXA 2G3JA 4OZOA 3QHNA 2XFFA 3WSUA 2VR5A 1CGXA 1LF1A 2WZIA 3CLWA 3A3HA 3SCOA 2BS9A 3ALGA 3G6LA 1CXKA 4CN4A 2BHYA 3WDIA 3IAQA 5D4YA 2J7GA 2DSUA 2ZX7A 2DSVA 1EA9C 3AXXA 4JCLA 1EOMA 5IFPA 2A3EA 1WZKA 2BVTA 1UD3A 4AD0A 2TAAA 3PZMA 1UR9A 1E3XA 2VRKA 2YL6A 3WH5A 1FH7A 3UERA 2WBKA 2ESCA 4PMRA 4CUCA 3WD3A 1CGTA 3QOMA 4CN6A 2CHOA 4EE9A 4JZ5A 1VFFA 3L4VA 1WPCA 3WH9A 1ITXA 3BAKA 1X6NA 4HOZA 2XPKA 1JYWA 2VZVA 3AHYA 4AZBA 5I23A 4UFMA 4W7UA 1B0IA 5CJ5A 4W8BA 1FA2A 2BXYA 2EPKX 1GQJA 4P7LA 5A6AA 3VGEA 1PPIA 1GOOA 3MANA 2EQDA 1B1YA 3GBEA 3WDPP 1US3A 1UKSA 1XC6A 1JZ5A 3VTRA 2XGBA 2YL8A 5BXRA 4HP5A 2DSZA 1NOWA 1UD2A 2GK1A 4UFHA 4HZ7A 5EBAA 2WMIB 5TD4A 1R85A 3J7HA 3GYCA 3L4UA 1B3YA 1V6UA 1B9ZA 3VGDA 1B3XA 1QVBA 1ZBKA 3KL3A 3B9EA 1UA3A 5IFTA 1EDGA 2JEPA 2WYSA 1US2A 1A47A 1AQMA 3N04A 1QHPA 2X1IA 2VT0A 1J0YA 5A3HA 5CLWA 3WUFA 5D9NA 4U2YA 1WDSA 4P7NA 2VMFA 4LX4A 3K4DA 2WHJA 1I75A 3AHXA 3VUPA 1GONA 1EH9A 5CPQA 1MQRA 3UEQA 2E9BA 1BHGA 5CLTA 1FH8A 3WQ8A 3AISA 5AY7A 2EPNA 5A95A 2WVVB 2X2YA 1EHAA 4M24A 2X8RA 3CO4A 1ISYA 3OB8A 3WH6A 4CGTA 4GZEA 4AD2A 1CWYA 3FY1A 1W9PA 4YHEA 3AS1A 3WNNA 1LWHA 2DPEA 4KH2A 2CIPA 4OUEA 2OWXA 2FH6A 4U3CA 5I24A 4LYRA 4UTFA 1JZ3A 2VI0A 1K6AA 4JKMA 3VD9A 4AD3A 4UOZA 2VQUA 4CU8A 3A4XA 3QHMA 1UKQA 4DUWA 1WDQA 3L2MA 1E4NA 5A6LA 5JIPA 3WQVA 4V28A 2J7BA 3VDBA 3O6AA 3AS2A 3DHPA 1E73M 1CGYA 5D9PA 1E43A 3MV01 1W1VA 1D7FA 2F8QA 2F2HA 5GQBA 3FXYA 1LG1A 4J3XA 1JFHA 2EO7A 4J28A 5A1AA 1VRXA 4WLCA 2XVGA 1ISXA 1V3JA 3M46A 1PZ2A 4CD4A 5LA2A 3AOFA 4NZCA 1MFUA 2WBGA 4P7RA 1J10A 1UOKA 1JZ8A 3AMDA 1K9TA 3BXWA 1F4HA 2J78A 4J3WA 1EO7A 3KEHA 3L4WA 1OT1A 1E6RA 1E4LA 1V3IA 5BRQA 2OYLA 5BXTA 2NW0A 1ODZA 2CPUA 3MUAA 1J9YA 3PTMA 4HTYA 1CIUA 1DTUA 3GNPA 3WBEA 3CZLA 2QLYA 4GO9A 4MJ4A 1V3MA 2JALA 5A8PA 2WW5A 1EHNA 1UD8A 2W62A 5I3DA 4HA1A 4JFUA 5EFFA 1AMYA 3OG2A 4OBSA 3IJ8A 1CXHA 3HU7A 2Y4SA 2FH8A 1E1FA 4FLOA 1J0KA 1G0CA 3M6DA 4OKDA 1EOKA 3VNZA 2W5FA 3THDA 1EO5A 3TTYA 5AC4A 1LQ0A 1PIGA 3TTQA 3WUEA 1J18A 5LA1A 3ZMRA 1NWTA 3W82A 1UZ1A 4IISA 4D6EA 1E6ZA 2UWFA 3WEOA 4QLLA 2YIHA 4LYQA 3N15A 1UWSA 1KXTA 2XVKA 4D6GA 5KZ6A 4UFJA 5JBEA 1E5NA 5ABFA 2V5DA 3ARWA 2VZTA 3U5YA 1CXEA 1QNQA 4QCFA 2J8GA 1W1YA 2DT1A 4PEEA 1CENA 1OD8A 1H41A 2D2OA 1UWUA 1P6WA 2WLYA 3AXIA 1BQCA 1SR0A 5DT7A 3WELA 1V3HA 4JIEA 3ARRA 2BFGA 3VU2A 2XVLA 4U5IA 3A4AA 4GZIA 1M01A 3W6LA 1KXQA 2YDRA 3ZSSA 3KE0A 3MMUA 3ZT7A 4BF7A 3ZJ8A 1TMQA 2CHNA 4R27A 2XG9A 4UR9A 2PWGA 1PX4A 2GUYA 1QI0A 1V3KA 4W5UA 4JL2A 3OA5A 2O9RA 4D6DA 1ZJAA 2A3BA 1W2VA 3SUSA 1GNXA 3WF0A 3ZIZA 1BLIA 3RMEA 4AZGA 4PMVA 3AQUA 3ARZA 3AYRA 1W1TA 1VFOA 1RP9A 3ARXA 4AEFA 2GVYA 2UY4A 2BHZA 1GOWA 4GI6A 2VURA 2D20A 2J77A 4EK7A 1HJXA 3VX0A 3WDHA 2D23A 4XZWA 3T08A 3VD5A 2GJPA 2WC7A 3U7BA 3GH4A 3U5UA 4AZIA 4DM2A 1MVYA 3GBDA 3LPGA 1NM9A 2J47A 1E5JA 3EMCA 3VIOA 1BAGA 3AI0A 1UZ4A 1BVZA 1DWJM 3WNPA 2WANA 1IZKA 3SCSA 3T2QA 2Q8XA 5CGTA 2VRQA 2XUCA 3ZR6A 4PMXA 5AC5A 3G6MA 3NJ3A 4HPGA 1JDDA 1QW8A 1CECA 2IXVA 3PTQA 3AHVA 3W29A 2JF7A 1JIBA 4MNMA 3A6OA 3GTNA 1CGVA 4ML4A 2DSWA 1OINA 3JUGA 1Z32X 4CN1A 3A4WA 5A69A 1XCWA 4TUFA 4PMOA 5AYIA 3RPMA 3WMCA 1OGGA 4GQQA 1G5AA 2DH2A 2C0HA 4DWSB 3MSGA 2VZSA 3B8SA 1Q6EA 3VGGA 3OIHA 4BQ5A 2WMGA 1AVAA 1H09A 1K9FA 4Z2GA 3W37A 4KWUA 3VGFA 1KGUA 2BY2A 1UHVA 3SURA 3BAYA 3AIRA 5IHRA 1W9XA 4X0NA 1E56A 3WEZA 2Y8VA 3MO4A 1NWRA 2A3AA 2VX6A 4QAWA 1QI5A 1C8XA 4ZXOA 1KXHA 1ZBWA 1OM0A 3SCWA 1J0HA 4W7WA 5E0CA 5CSYA 2WHKA 4NRSA 4H8UA 4W86A 2WCSA 5FD0A 2CNCA 2VO5A 4FF5A 3WFLA 1SMAA 4WKFA 2DT2A 4WSKA 3OLDA 4AD4A 3VDAA 3VMOA 2QMKA 4S3KA 2JF6A 2WSPA 2ZX6A 3AIUA 2WVUA 4GQRA 2J7DA 5A2AA 3BAIA 3QGVA 1KR1A 1ISWA 2XYLA 4CU6A 1CXLA 4YPJA 1RH9A 1VJZA 2EEXA 3VDCA 3CZJA 2ZWZA 3WQ5A 4B3LA 4HU8A 2CXGA 4C7FA 3RCNA 2GK1B 3MS8A 8CGTA 2YBUA 1OSEA 3ARSA 1ZB5A 5C71A 2E8ZA 5CZKA 2A3CA 2C7FA 3T0DA 2WMHA 4JHOA 4Y7EA 2FDMA 3LPOA 3UR8A 2W92A 4EANA 4E2OA 1EQPA 2ZUTA 3UG5A 2XVNA 4AIOA 2CESA 4PN2A 4AEEA 4PMDA 2Y5EA 3SUVA 4AXNA 3VOCA 3PBGA 5GNXA 2WNWA 3WDRA 3W28A 3VIFA 1E9LA 4NF7A 1KR0A 2CYGA 4DUXA 2E8YA 4FMVA 1BPLB 1WE5A 2DDXA 3WFZA 2O9OA 4GKLA 2ZXDA 5BCAA 3EDJA 4UFIA 1E0WA 1H0IA 2CERA 5HDRA 1VBRA 3EDEA 4B15A 5IXEA 1WP6A 3WQ4A 4HZ6A 2OWWA 3PZQA 2WVSA 4UQEA 2ZICA 4PTVA 4WKAA 4HA4A 3EYPA 4OBRA 3T2OA 4CD7A 2FGLA 1AQHA 3W25A 5A6JA 3ZSTA 1MFVA 2ZUUA 1DEDA 3WY1A 3T0AA 1QPKA 2FGZA 3VIPA 2PWHA 2XSAA 4PTMA 4KRUA 2WK2A 1OCQA 2BV9A 2DEPA 3PZUA 1A3HA 2EJ1A 2ZXQA 3CUIA 4ZENA 2YA2A 5I2UA 3VIMA 2UY5A 4RE4A 3T2PA 4DUVA 3DYOA 4UQAA 3E1F1 5BYWA 1XSIA 3AHZA 1GOKA 2GFTA 3VIHA 4MNLA 1ECEA 1H3GA 4MNJA 4XZBA 1VEOA 1TVPA 1W3JA 3WUBA 4GIAA 2V3DA 4UFKA 4F9JA 1R7AA 1TR1A 2WXDM 1LWJA 3AZTA 1GVYA 4OOZA 2D0FA 3WD1A 1DWGM 1R7OA 5E70A 4E8DA 1HVXA 2YLLA 1GHSA 4WSJA 5FL0A 2V3GA 4MB3A 4PTWA 1E1EA 4P7QA 1XCXA 4GI8A 4EKJA 1HNYA 1FFQA 1GQIA 3ZJ7A 2J7CA 2OYKA 1NQ6A 1D2KA 1JZ2A 1U33A 4P8VA 4CD8A 2V5CA 3HMCA 4D6JA 1G01A 2XM1A 1M04A 1UKOA 1K9EA 4PMNA 5ABGA 4BQ4A 6TAAA 2J7HA 4BCEA 2D1ZA 5HPCA 3ALFA 3PTKA 1PAMA 3RDKA 3SCRA 4IUGA 3MUZ1 4AZCA 2Z1SA 4ATWA 1O7AA 2J75A 5HXMA 1UR8A 3F4VA 3K8MA 1MQPA 1XHGA 1E0VA 1GCYA 1XSKA 4P8WA 4HMCA 1WO2A 5ABFB 3IJ9A 3L2LA 1JNDA 5A94A 3BAWA 3VIKA 4ACZA 3VX1A 4F8XA 4Z2KA 3CZEA 3FAXA 4TXEA 1UD4A 5D9MA 1UQZA 4W84A 4BQ2A 1U30A 2BHUA 3MV11 3MU7A 3NSNA 3CMGA 4HPHA 2QPUA 4TTUA 2J74A 4D72A 2BNJA 4BQ3A 3WL0A 3AS0A 1C8QA 5EMYA 1C91A 1KFWA 3FW6A 4H8VA 4DM1A 2EPOA 2NT0A 3OLEA 3QR3A 3AIEA 4Z2JA 4HOXA 3ARUA 3K4AA 3TA9A 4MJ2A 1SMDA 4D1IA 4UQCA 1CLXA 4A3HA 1BTCA 3IK2A 4PMYA 2DGAA 4E4PA 3IANA 4V27A 1W91A 2DIJA 7TAAA 2J25A 4D6CA 4MTVA 1QNPA 1V0LA 3MUY1 2AAAA 1HKJA 3GXDA 3RM4A 5I0DA 1JD9A 4U5KA 1VIWA 1JDCA 2CKRA 3EDDA 1E4IA 1B3WA 4D6HA 4PUDA 2CEQA 4AY1A 2OSWA 2WVTA 3WEMA 4CCCA 4GXPA 1CNVA 3AHTA 2G41A 1W3KA 2YKKA 4ACYA 4B16A 4Z2IA 1FHLA 4IM4A 3CHFA 3ARTA 2WSKA 3AIVA 3BGAA 5A6KA 2W91A 1V03A 4YN5A 3BMWA 3N12A 1OD0A 2PBGA 1E4MM 3L4XA 2HVMA 1HKKA 3RM8A 1BFNA 4JKKA 1W9VA 5C70A 2ZE0A 3BMVA 3K8KA 3UESA 5GNZA 3CPUA 4M82A 3ZQ9A 2E4TA 4R5EA 4W7VA 3L4YA 1C7TA 2VX5A 4JFWA 2J7EA 1UKPA 3DYPA 3AS3A 5DT5A 4W8LA 1WNOA 1V0NA 3ZOAA 3DHUA 3OLIA 3ZJ6A 2XHYA 4MAZA 1PJ9A 1X1NA 2G3MA 3VD4A 1BGAA 3EMZA 3VNYA 4AZ6A 2XM2A 1UKTA 2XSBA 2G4FA 5E0FA 3BCFA 2GDVA 4FLQA 3U7VA 5A6BD 2ZUVA 3PZVA 5FL1A 1RP8A 2CITA 3POHA 4LQ1A 2PB1A 4WKHA 1BYAA 3WL1A 1QI2A 1WKYA 4AIEA 4U2ZA 4TTGA 3ZT5A 2NT1A 1JG9A 2CBJA 1JGIA 1MW1A 3K46A 4DWSD 1HL8A 3WF1A 1G94A 2XIBA 2OWCA 4QP0A 1M7XA 3TTOA 3KWXA 6CGTA 1VJSA 2FHBA 1GVIA 1HJUA 1QHOA 2J79A 1VEPA 1UH3A 3OGRA 2WVVA 4LPCA 3VMPA 1CYGA 7CGTA 2O9PA 2YDSA 4WF7A 3CUGA 4HMDA 4LYPA 3VM5A 4AZ5A 1J12A 2PWDA 5CPSA 1UR2A 2EPLX 3U57A 1R8LA 3CIVA 5DMYA 5JIWA 3ARQA 1CXIA 3I3DA 2DIEA 5AYBA 1E0XA 2VZOA 4LXFA 4URIA 1UR4A 5M3WA 2E9MA 4PCSA 1V3LA 4N42A 1WB0A 1BGGA 1C93A 1ZS2A 3VDHA 4B9YA 4CD6A 2YDQA 3VPLA 1PX8A 1CDGA 3NSXA 1SFSA 1D3CA 1WZLA 2ZOXA 2XFYA 2J8FA 1MWOA 2VVNA 2VOTA 3BLKA 1EGZA 2WWDA 1V6WA 3ZR5A 2XWDA 2D0GA 2FHFA 3THCA 2AOSA 2JIEA 3MSDA 4OJYA 4W8AA 3WD0A 3HJEA 1E15A 1VEMA 3VGBA 1MXDA 3TOPA 1NWUA 2O92A 5KEZA 2E0PA 2PC8A 4AD5A 3VKKA 4EAMA 6A3HA 1HP4A 1FHDA 4PYSA 5BWFA 2WC4A 4CCEA 4UQBA 2QMJA 2DH3A 4YHGA 3PZTA 2XWEA 5DEZA 2GJRA 4W85A 4X0VA 3W4RA 1LL7A 4U33A 1JFXA 1HT6A 3VIGA 3W38A 3O2LA 1TA3A 1GOIA 4X9YA 1XH2A 1KWGA 2VRJA 1I1WA 5HBFA 5A6SA 3WF3A 1IV8A 2VCCA 1UWIA 1V02A 2W66A 3F5KA 1OWQA 1ZL1A 3WN6A 3SCPA 2CCRA 3MUIA 1UD6A 3AXHA 2E3ZA 1GORA 4MB5A 3OGSA 2G8ZA 5D9OA 1OIMA 1M53A 2BVYA 1DHKA 2UY2A 2X09A 2UY3A 5CSUA 4BA0A 4KGJA 2W61A 1JF6A 5DO8A 3RJXA 1TG7A 4KRTA 4PUEA 1JZ6A 4AD1A 4Z2LA 1RD6A 1AQ0A 2XJ7A 1JI2A 1UH2A 5M5DA 1KBBA 3SEPA 3W81A 2IUZA 5FOOA 2A3HA 3KL5A 4UZUA 1HN1A 3FHAA 3W26A 3OLGA 3T0BA 1JL8A 1OB0A 3II1A 2YA0A 4MB1A 3RM9A 3D3AA 3GDBA 5IDIA 5I5RA 5ECUA 1B90A 2JEQA 4KGLA 1XSJA 3OGVA 1LG2A 3QOKA 2VC9A 4J3TA 1JDAA 4FLSA 5CG0A 2OYMA 3W27A 1ISZA 1JAKA 4QCEA 2WMFA 4PSPA 5GNYA 3KZSA 2CBUA 1N82A 3NCOA 5FCZA 2E9LA 4AZCB 3KL0A 4V2XA 1E70M 3AMGA 2V38A 4TX6A 1G1YA 3AYSA 4D6IA 3AROA 4U31A 4JAWA 4M8UA 3PZIA 1PBGA 1Y7VA 1BG9A 3F5JA 3ARPA 1W9UA 3SIMA 1QNRA 3CUHA 3ARYA 1QOXA 1E71M 1E6XM 1J0IA 3NDYA 4P8UA 5CQ1A 4ATDA 4ACZB 3SUWA 2QPSA 5ABHA 2EBNA 1BYCA 4HOWA 1WZAA 2VTFA 2GJXA 1U2YA 1EDTA 5C8BB 1TCMA 3AIBA 1VFMA 5A2CA 1ZJBA 2D24A 2O9TA 2DT3A 2Z1KA 1JZ7A 4TVUA 3EBVA 4B9ZA 1VF8A 1B2YA 1BYBA 2BY3A 1YQ2A 4W87A 4AISA 3FNDA 1HJVA 2PF0A 2ZXBA 3UR7A 1KCKA 4PSRA 3VVGA 4WK9A 2J62A 1DWIM 5I6SA 1BSIA 5JUVA 4P8XA 3W0KA 1WAWA 4D1JA 3VIJA 5EFDA 4AC1X 1VFUA 1WCGA 4N0RA 4PMQA 3MMDA 1E6SM 1B31A 4J3SA 4UZSA 3IAPA 4AIUA 3WENA 3T09A 2X0YA 3LMYA 3LPPA 4CVWA 5FIPA 1UD5A 4GO8A 2VCBA 2E40A 3CUJA 2NSXA 1Q6FA 1H1NA 5ABEA 1QBBA 4DWSA 4E8CA 1ODUA 1W3LA 5I79A 4ZE5A 3SCVA 1KGWA 4XV0A 5A6MA 2YOCA 2CBVA 1KQYA 3SCQA 3N9KA 2VQTA 2WKGA 3BSGA 2FHCA 1CEOA 3AZSA 4M80A 3FHQA 4UOQA 3RJYA 3L4TA 4OIFA 4MNKA 1J01A 3GZAA 3TP4A 3NIYA 3RIKA 3N1AA 1HJQA 3BC9A 1H0GA 4W89A 2DQXA 1B30A 3WD2A 5DF0A 4JKLA 1HJWA 4ZEPA 3AICA 4RE3A 4GZJA 3VO0A 4ZE4A 4MDPA 1UWTA 1JNEA 2PWFA 3NSMA 1BG4A 1GJUA 2VVSA 1UA7A 4CVUA 1PIFA 3ZM8A 2V3EA 4RL3A 3NYDA 3CBWA 3N11A 2WAGA 3NUKA 1TFVA 4J3UA 4PTXA 1KGXA 4NI3A 4PCTA 1GJWA 2EXOA 3W53A 5A8OA 3GNRA 2Y2WA 1V6YA 3AMCA 4H7VA 4AZHA 4QFUA 1FH9A 1MQQA 4JL1A 3VGHA 4J7RA 2ZX9A 1JYXA 3UG3A 2X05A 5A2BA 4ATLA 1IT0A 1NOFA 1DWFM 3WIJA 1JAEA 2WLZA 3WDQA 3POCA 3DC0A 1UR1A 3GH7A 1SYTA 7A3HA 3LPFA 4XX6A 3AMLA 1NWSA 1FFRA 1JXKA 3N18A 4F9DA 1GHRA 3ZJKA 4XB3A 5LA0A 2PBOA 1XH1A 3WKZA 1C3FA 3DYMA 1EQCA 3ECQA 5E6ZA 3B9AA 5CXPA 3EMQA 3FN9A 4TOQA 2WWCA 1H5VA 3B9DA 2CETA 3WQWA 4MADA 1QNOA 4PMZA 1HF6A 1TZ7A 1XRVA 1B3VA 2YBTA 4M56A 3SCTA 5HPOA 2ZUWA 1FP8A 3N17A 4U3AA 2J7FA 2ZXAA 5E6YA 3AZRA 2J4GA 5BXPA 4A4AA 1ZBCA 3O9NA 3WNKA 1JYVA 2JIWA 1QNSA 2GDUA 5FKYA 5BROA 3AIQA 4CD5A 1E3ZA 1LL6A 1IZJA 2EPMX 3PZNA 1E55A 4DWSC 1CZ1A 3GXMA 1C7SA 4BZYA 3HN3A 4MB4A 2D22A 1Q4NX 2XVPA 1GOMA 3NDZA 4KMQA 1XV8A 4WIWA 2ZIDA 4WJXA 2WHLA 1W3HA 1R86A 4HMEA 3APGA 4UOJA 1R87A 1H2JA 4C7DA 1HKIA 1VBUA 3M07A 2AMGA 2XIIA 3A47A 3UETA 3ZO9A 2RGMA 4QLJA 1MYRA 1HP5A 3CMJA 2D3LA 3PHAA 1MW3A 4UQ9A 4CCDA 3RILA 3VM7A 2X0HA 4PBGA 3BAJA 4PMUA 4HU0A 3GM8A 3CZKA 2D0HA 1EXPA 1TA3B 3EDFA 3ARVA 2C8NA 1MW2A 4D71A 2WZEA 1KB3A 4JFTA 1M03A 2D3NA 2OSXA 1I1XA 1EIBA 4AZ7A 1W2PA 3MKKA 5CPTA
chains in the Genus database with same CATH superfamily
2WMIA 3OHIA 1LLOA 5TQLA 3UWEA 2AQWA 2XSXA 1GQLA 1XLAA 1IGWA 1CGWA 2QDDA 3WNLA 2A1YA 1N55A 2C6QA 2X0SA 3UCQA 1V08A 5D04C 1HVQA 3I4EA 1VFLA 3GH5A 4X2PA 3TKFA 3NPUA 3G1XA 1YLVA 3LRLA 3MHFA 4D8LA 1EWDA 1M3UA 1JF5A 4HA0A 3W7OA 3W87A 3ERPA 5H8MA 3UZWA 1QHZA 4FK9A 4ZODA 5CCZA 4U28A 4ZFMA 2Y24A 3F4DA 1LBMA 3WMSA 4M6PA 4ZFCA 2FTPA 2VR4A 2Z1BA 1J0JA 1EBHA 3I3EA 4K8HA 3HV9A 1UG6A 3AIWA 1R0MA 4GYKA 2ZTJA 3CYJA 3M5VA 2NWRA 3B97A 1GZJA 4TQTA 4R85A 3G1FA 3SCNA 1SUXA 1ZK6A 2CLHA 3ZR4A 1SVDA 3UG4A 3BLPX 1XYZA 1XDMA 4YXGA 2NVCA 1BF2A 1E6PA 4Q7IA 1MDRA 1TWZA 4L56A 4M81A 1JI1A 5FJUA 2DZWA 1T6MA 2ZUSA 4I6VA 2VX4A 1W17A 4JFVA 2OTDA 2VR2A 5I77A 1FJDA 3M7SA 4JCMA 1V6XA 3E0WA 2ALDA 2Y78A 5GPRA 2WKLA 1LCOA 2I56A 1YATA 4X60A 3I4KA 2GJXB 4JQ3A 1F40A 1ONWA 1ZAIA 1PE1A 2XTKA 1OYCA 2C18A 2VD8A 3NFUA 1TKKA 5IBXA 1W32A 1NDYA 1JCJA 4Z0JA 4GUFA 4IPLA 4J27A 2UZ5A 3IJ7A 2NQHA 5EB8A 4C7GA 3WF4A 2YX0A 1BVNP 1TVNA 3NO3A 3EWDA 4F79A 4JFSA 1O6IA 2DT0A 1PHWA 2VGIA 1NP0A 3IIVA 4UTIA 3E3HA 3M1ZA 4BEUA 3NPVA 1UROA 4BS0A 5T26A 2WM0A 3ABOA 4HSNA 3VILA 2WB5A 4ZO9A 4S3JA 4MPKA 3HJZA 1DORA 2QVNA 5KETA 3GS6A 1BYDA 3CZ8A 3QXBA 3UGRA 1REQB 1EXBA 5JBFA 1H7WA 5CGQA 3QZEA 4LAWA 4ZQNA 4DBEA 4KWWA 3TYZA 2P53A 4J2PA 1K77A 3RFAA 1QI4A 1EJXC 5HK4A 4RW5A 3PVFA 3EIPA 1XD0A 2WCAA 4D6FA 1EUNA 3NR0A 3FAWA 1LTDA 4R0XA 2HE8A 3MP5A 1W54A 4LTSA 4Q8QA 3FSUA 1EP1A 2VX7A 2QV4A 1GPFA 4NRRA 5EYWA 5F2LA 4AUBA 4AVFA 3P84A 2DW6A 3W2KA 3O06A 4N9CA 3ITGA 1OIFA 5ENLA 1D8WA 3G3MA 3WBAA 1PTAA 2C13A 1AW5A 4A6GA 3VYLA 3LHZA 1U5HA 1PX3A 5K2ZA 2V82A 3PG8A 2PRMA 4B5NA 4YWIA 2HS6A 3SI9A 3CZGA 3S8HA 3WNOA 1IIGA 1YKWA 3BCDA 1BXNA 1LDCA 1WDRA 1JZ4A 5CAHA 3R1ZA 1EGVA 5DCDA 3UI6A 2Y1HA 2ABBA 4HK7A 3N13A 4LAKA 4GVIA 5C9XA 5F7UA 1BXBA 2ZZ4A 4AB4A 4CKQA 1BEUA 4GINA 3R58A 1OCJA 4DBSA 4JNZA 1OC5A 1UC4A 3OYXA 4GG9A 3M7WA 1TSIA 2K8IA 2A5HA 3UZ5A 2QJNA 1E1CA 4LVAA 4US6A 2PTWA 3N9RA 2YFOA 2H6RA 4MOZA 2BODX 4QX4A 3W1LA 2VYOA 3PPFA 3PY2A 5HUOA 5G2WA 5LYRA 4MJZA 3BL3A 2WCGA 3O05A 1OGSA 3KP0A 1S5NA 3BQ5A 3S2CA 1XYFA 4ECLA 1CLVA 1VYRA 3CGTA 2PI6A 3BJTA 4RPQA 4QNEA 3U4FA 4BK9A 4IMCA 1JCXA 1H49A 5J6EA 2XFRA 1WKDA 3PN8A 4GQBA 1FVPA 4OVXA 1P6CA 3QHNA 1XQKA 2XFFA 1CGXA 1LF1A 5F2IA 4XSLA 4PUNA 2WZIA 3G1RA 4HQVA 1UCWA 4GUJA 3SCOA 2EG7A 4HPXA 3DAQA 3G6LA 5F4SA 3WDIA 5D4YA 2J7GA 2DSUA 2ZX7A 1EA9C 4N9BA 4JCLA 3BVJA 4WOZA 1RAKA 1VGAA 3AJXA 1HG3A 2ZQTA 1WZKA 3LLXA 2E1WA 2FGBA 4ROPA 2TAAA 3ODKA 2VRKA 3PFRA 3L0NA 4JTJA 4PMRA 4CUCA 1CGTA 4FB7A 4CN6A 4GGBA 4JZ5A 1VFFA 2DW7A 1WPCA 1ITXA 5MKGA 5LGZA 7REQB 2XPKA 4W7UA 1B0IA 4W8BA 1FA2A 2PLCA 2BXYA 1TYGA 2QKFA 1RCOB 4NJKA 3MANA 4MWAA 4REQB 2ZE3A 4NX0A 1UKSA 3YPIA 4FSAA 3FLUA 3VTRA 2YL8A 4HP5A 4I5XA 1K70A 2J9YA 2FZDA 4FNSA 3NZQA 3J7HA 2NV2A 3A5FA 1K8XA 1FKKA 4YVPA 3FEQA 1B9ZA 3D47A 3VGDA 2QGYA 1L8PA 2QCDA 1UA3A 5I3IA 5IFTA 2AWGA 2WYSA 1C29A 1A47A 3SQLA 3W2JA 2OR2A 2X1IA 1J0YA 2C1IA 3N04A 5F2GA 1OC7A 1QASA 3KXQA 2ZRZA 3WUFA 3JZUA 1I8JA 4U2YA 4GXMA 1WDSA 4ZQMA 3P0XA 3AALA 4IT4A 4AHOA 3NPWA 1FKXA 1DXFA 5CPQA 1MQRA 5FEXA 1YW1A 3DHDA 4TNSA 3RUBL 5I06A 1EC7A 1N8FA 1Q66A 2WVVB 4YLWA 4BR1A 4M24A 1XLFA 4IXXA 4S3EA 5TNVA 4GCAA 4Q4KA 2KZHA 4Q8PA 3KVKA 1JCMP 4QE4A 3FY1A 2FVLA 1XFBA 3P2VA 1F3EA 3HPFA 1LWHA 2DPEA 2CIPA 4PUWA 4DRJA 1SPQA 4U3CA 5I24A 2DZBA 1RQBA 4LYRA 1JZ3A 3PJXA 1K6AA 2PGRA 4UOZA 3RU8X 1UKQA 4GYJA 1KKOA 2OT0A 4NP7A 3WQVA 4NAEB 1O4UA 2J7BA 3VDBA 2PDHA 3EX4A 3O6AA 5FSDC 5F1VA 3V1PA 1E73M 4DLMA 2F8QA 2QUNA 2F2HA 4S3AA 3OPSA 3TLQA 1LG1A 1JFHA 5A1AA 4J28A 1VRXA 4WLCA 1FKWA 4L3NA 3MVTA 3QQ0A 4IIFA 3PS7A 1TQJA 1S5VA 5MF5A 1J79A 3GB6A 3QN3A 3UZJA 3NPXA 1UOKA 3UR5A 4QTGA 2GJNA 4LAYA 2ACRA 1AW2A 1XYAA 4BKNA 2OYLA 1XBYA 3A5VA 1J9YA 4RNJA 2BSLA 2CW6A 3GNPA 5HULA 4R33A 3TN3A 2HNEA 3HO8A 2IPWA 4HTBA 3BGGA 2VHLA 3LQGA 2HDJA 2RJGA 4MWAC 3QTGA 4CQBA 2RURA 3UW6A 3BZGA 3BWWA 1OVDA 2PDPA 4O1AA 1CXHA 3HU7A 1G0CA 1UUMA 4IPPA 3NM1A 5FF7A 1TPDA 2V63A 4OKDA 4L6DA 5HNUA 1EOKA 2CXEA 1EPXA 3KFTA 3VNDA 3E2QA 4IG2A 4GK8A 1EZ2A 1EO5A 4EPEC 1LQ0A 2O7SA 3I10A 4O19A 3CAQA 4O17A 2EPHA 2AGTA 4RNFA 2RFGA 3UYIA 1D7HA 2Y5SA 2A21A 2GDQA 3FJLA 3WEOA 3U8GA 1XLLA 3LLFA 4LYQA 1RD5A 3M0KA 3S5OA 3S4TA 3WLHA 4HN8A 2DT1A 3GVGA 4NI8A 1OD8A 3W1MA 1XG3A 4LS1A 1R47A 4M6QA 2BXVA 4DF1A 2I5GA 3R4IA 4DLFA 4OBTA 3AXIA 3WELA 3Q2DA 4JIEA 3ARRA 1K7XA 2F9RA 3NQ8A 3KE0A 1I6NA 4UNKA 4YTTA 4GZ7A 4GYPA 4XIMA 5G1MA 2CHNA 4R27A 3FKRA 3KX6A 3CS2A 4GABA 4ZPVR 4GBUA 2IPFA 1W2VA 1GNXA 2C1GA 3NQVA 5DY3A 2Z26A 3LD5A 4PMVA 1JULA 3AQUA 3AYRA 3GRIA 1RP9A 2GVYA 2UY4A 3PJTA 1HKWA 2KAUC 3SQMA 2Z2AA 3L0KA 4GI6A 1UJQA 2VURA 4XO6A 2J8TA 1R38A 3AYVA 2D23A 1S5TA 4ICCX 3VD5A 1P0BA 3N2CA 1KTCA 2GJPA 2FPYA 3U5UA 4AZIA 1H5YA 1NM9A 1EX1A 1UZ4A 2WANA 3T40A 2R8WA 3VCCA 4PBFA 5CGTA 3A24A 2XUCA 3NM3A 3O6YX 3ZR6A 2ABAA 2LGOA 3G6MA 3NJ3A 1JDDA 1YNYA 1QW8A 3FAPA 4ZA0A 4HNLA 1S2UA 3C52A 1PKMA 4RUBA 3GTNA 5I3GA 4UBPC 1OY0A 3MWAA 1LRTA 4HGXA 1TCOC 4C6IA 3E0IA 1XW8A 3N3TA 4CN1A 4J3ZA 4H83A 2ZFAA 3EXTA 1XYBA 1YPIA 1A5KC 5AYYA 1UMYA 3RPMA 4GOAA 2QUMA 3GDMA 1F3TA 1G5AA 4NJHA 4MYXA 3MSGA 4MG4A 2TODA 2VGFA 1TZ9A 3VGGA 1WBHA 3M41A 1BWLA 1K9FA 4C6EA 5D2XA 3UXKA 2GL5A 2PGFA 2Y7FA 1Q6IA 1XIFA 3U0HA 5IHRA 1HGWA 2QUVA 1FWSA 4X0NA 1E56A 3U9IA 4RDYA 3MO4A 1NWRA 1QI5A 1ZBWA 3L23A 3OOQA 3TEVA 1J0HA 4W7WA 1JRBA 4NRSA 4GBDA 1W26A 3V36A 3GUGA 5HNTA 2ATMA 4GYPC 4W86A 1EFZA 4QITA 2CNCA 2VO5A 4FF5A 2RSEA 3KBVA 1U1JA 3NEHA 1SMAA 1EKOA 1RJPA 2OCZA 4G2DA 2QMKA 2ZX6A 2GVEA 3G0XA 1RSCA 3I7SA 1BKSA 4JY8A 2J7DA 2YZ5A 3BG9A 1DJQA 3GDTA 3CV6A 4L9ZA 5DMNA 1CXLA 2ODOA 1RH9A 2AQVA 1FRBA 4C7FA 1BKHA 2GQ8A 1JNTA 2GK1B 3MHGA 1OSEA 4M1BA 3LMZA 5CZKA 2Z25A 4FHAA 4DJEC 3HM7A 2HE5A 2WMHA 4US5D 2IPJA 3BJFA 3SO7A 3OU8A 2W92A 1P7TA 5FEWA 1MEIA 4R9OA 4OT7A 2XVNA 3H2AA 3UJRA 4AIOA 3KAIA 4IPJA 1ICPA 4AEEA 4GD0A 4LUYA 3W28A 1KR0A 4DUXA 3GG0A 3GD6A 2DG9A 2HQAA 3RFWA 1P0NA 1WE5A 3LV6A 1TV2A 2O9OA 2E5CA 3FYPA 2HROA 2OZ8A 4HBKA 4Y9AA 5BCAA 2DY3A 4I90A 1E0WA 2CERA 4H7ZA 3IGUA 4GWEA 5AC6A 2A0NA 1QWKA 4JHMA 2DORA 1CW2A 4HZ6A 2YDAA 2OWWA 1AH4A 2WVSA 2YXOA 2ZICA 4PTVA 2ZQVA 1NMWA 3B03A 2H3BA 4HJFA 1O5QA 2V6AA 4OBRA 1AQHA 3GW0A 1C9DA 4LRTA 3UWZA 2ZRXA 2WJFA 3PWGA 1DJGA 2G97A 2RUDA 2PWHA 1YXDA 3FKKA 4IGHA 4KRUA 4B92A 3GTXA 1OCQA 2DEPA 3WCZA 3JR2A 4DB7A 1Q3NA 2YA2A 4JTFA 3PAOA 6ENLA 3BW2A 1BWKA 2UY5A 4RE4A 1SFTA 2OVLA 1AH3A 4ODRA 3E1F1 1LORA 4J35A 1F76A 2GOUA 4M6VA 3W3OA 3UBPC 4MNLA 3RX2A 1DPMA 1VEOA 1ZJIA 1W3JA 4GIAA 1SJCA 4C6QA 4JTDA 1TR1A 2OODA 1RBLA 3AZTA 1DWGM 5E70A 3PPCA 1F8MA 3GFXA 3S6DA 1UPPA 2YLLA 4IQEA 4IFKA 3BARA 3LS9A 4PTWA 1E1EA 4P7QA 1S38A 4HU4A 3QKEA 1NQ6A 4P8VA 2QCMA 1GVQA 4I9AA 4D6JA 2OQYA 3GSMA 1K9EA 4PMNA 1KCZA 2J7HA 1OFOA 3DI0A 2R1NA 3LI0A 4EXBA 3ALFA 2OEJA 1RJQA 3CV7A 2ZZ6A 3MUZ1 1H7NA 1PZ0A 2PDYA 3NI6A 1XHGA 1E0VA 1GCYA 1SZRA 2PC4A 1XSKA 2VEKA 4ZMGA 1TJPA 3RITA 4KFPA 3MUXA 4ACZA 4F8XA 2HMCA 2VDHA 3A22A 1X96A 4TXEA 4B5UA 1WXZA 1XLGA 5D9MA 4PL1A 1UQZA 4ICMA 4LUIA 3BQ6A 1A5CA 3DGRA 4DZ5A 3QYSA 4PUJA 4HPHA 4NNCA 2QPUA 2TSYA 4DNMA 4ERGA 4O1CA 1DOSA 1VR6A 3T8QA 1X1ZA 4DM1A 5G1YA 4JTCA 4GMEA 3OLEA 3QR3A 2ZKMX 1YNPA 3AIEA 4C6LA 4HOXA 3MCNA 3TA9A 3TSMA 3QSRA 1IX5A 1O66A 1LQAA 4KCVA 3RXZA 3EX1A 1BTCA 4PL2A 4Q4OA 3IANA 3FVMA 1W91A 2DIJA 3P81A 1DL3A 1WOBA 5BWAA 3DG3A 1P1XA 3GXDA 4Z08A 2PD9A 3ATYA 4C6JA 1VIWA 1KT0A 4MZ1A 1Q13A 3EDDA 1N2VA 1M6JA 2Q09A 4FO4A 1U5JA 1VIZA 2CEQA 1UZDA 4LUTA 3KRUA 2WVTA 1S1RA 4GXPA 1YW5A 3AHTA 2OLAA 4ACYA 1W56A 3M4HA 1I2RA 4B16A 1SFJA 4IM4A 4YJ5A 3BGAA 5A6KA 4E4FA 1DJZA 3N12A 4ENLA 1OD0A 1EEPA 4Y9OA 3EWYA 1E4MM 3ICJA 3L4XA 1HKKA 1YDOA 4ODNA 5I02A 1BFNA 1JPKA 4RW3A 2ZE0A 3UI5A 1W31A 2OB3A 3GAKA 3KBNA 3ZQ9A 4W7VA 3BLEA 3L4YA 1V77A 4O0QA 3TR2A 2VX5A 3RGCA 3G77A 3DYPA 2PS2A 4Q6JA 5BXJA 2JK2A 2HXTA 3OLIA 2XHYA 5FESA 8XIAA 3VNYA 4AZ6A 1LLZA 3GNXA 1Q6UA 5HMDA 3GQYA 2GDVA 5A6BD 2ALRA 1DJHA 1MNZA 2ZRVA 4K8GA 4LQ1A 3ABRA 1W5MA 2FZ8A 2XN2A 3RX4A 3ZT5A 3QGAC 1UWAA 1VHNA 4KEZA 3WK0A 2CBJA 1JGIA 4O18A 3KAGA 4DWSD 1HL8A 2WKJA 1G94A 3CTLA 3SJ3A 1HQTA 1KO0A 3TTOA 3CL8A 1RK5A 3LHYA 1QHOA 3L5AA 1VEPA 3C3NA 1TWIA 4HNOA 4JXCA 4JTHA 2YW3A 2WVVA 3VMPA 4GIVA 2YDSA 4UCGA 3TDFA 4H00A 4LYPA 5U7SA 3VM5A 1J12A 1S2CA 3ZFHA 4C60A 1UR2A 4L6OA 3REQB 4QDPA 3UXAA 2P1FA 3OODA 5FF2A 5DMYA 5JIWA 2E6FA 4IH3A 3R11A 3UWWA 2ZBTA 3NQ2A 2QZRA 5AYBA 3BG5A 2VZOA 1H1ZA 3M0HA 4LXFA 2C71A 4FS9A 1VFHA 4PCSA 1V3LA 3LTPA 2RAGA 1BGGA 1GGOA 3B05A 1PX8A 1SFSA 4NAEA 3MKCA 2VVNA 4NAFA 1K8CA 1EGZA 1NFPA 2WWDA 1V6WA 3BLFA 5LNSA 2D0GA 3CXOA 3TNBA 2JIEA 3IS4A 4K6AA 3WD0A 3HJEA 5LNWA 1Q7MA 4DIPA 1E15A 3R94A 2FIQA 3O5GA 1NWUA 1NY1A 3ENLA 4PYSA 3QR0A 5BWFA 3GU0A 4XZHA 4CCEA 1G4EA 1AJ0A 4WCJA 1HUVA 4EWJA 3PZTA 5EBUA 5DEZA 4W85A 4X0VA 4HCLA 4QEEA 1HT6A 3W38A 4X9YA 4HNUA 4LAMA 2XP4A 3PBUA 2VRJA 1I1WA 4GC3A 1XQLA 2E28A 2OFJA 2RHGA 4RDZA 2VCCA 1UWIA 2J9ZA 4ROQA 4WY0B 5G4HC 1OZMA 2Z1WA 3AXHA 1QPFA 4ODQA 4A2SA 2E3ZA 4QSFA 1DE6A 2AKMA 4INFA 3M0ZA 1W0MA 2YYTA 2NUYA 1OIMA 3GO2A 3MI6A 1XICA 3PRAA 4CQ8A 1DHKA 4RZ5A 2UY3A 2Z6IA 5HUAA 1TPFA 4BA0A 2PLKA 4KGJA 2W61A 2PDLA 4DXKA 2ZA2A 4F48A 2NQ5A 5JQ9A 5DO8A 3RJXA 3EWBX 4NYYA 2PSNA 1RD6A 1AQ0A 5A5WA 2XJ7A 1JI2A 2OGJA 4C1NA 2E68A 3W7NA 1S1PA 3SEPA 4LANA 2DJLA 3KL5A 2MPHA 1R9XA 3II1A 2YA0A 3RM9A 3GDBA 3EXSA 3TR9A 4N9EA 2EKGA 4X63A 4AF0B 1XSJA 2HTMA 5M1TA 4DAIA 4DYKA 3WBWA 1QATA 3CL6A 1XYCA 1O5XA 2F38A 2WMFA 3QQWA 4QQUA 4KEMA 3SIZA 4J9JA 4MLRA 3G1DA 3BJSA 1A5MC 1E70M 3AMGA 2MNRA 1MEHA 1PHQA 2IQTA 2A7PA 4U31A 3T9PA 1X8FA 4JAWA 1TUFA 3PZIA 3L68A 2TYSA 1QNRA 5CBIA 1ZAHA 3G1SA 2XN0A 3EWZA 4ATDA 3UNTA 4YVVA 1EB3A 4HNVA 2KI3A 4HOWA 4P5UA 4DQWA 1ZY9A 1FWFC 5C5YA 1RR2A 1I2QA 1U2YA 2ON3A 3COTA 3R12A 1ZJBA 2D24A 1B57A 2DT3A 2Z1KA 2ZYFA 1M41A 4TVUA 2PGWA 1EP2A 4QXIA 1ZCCA 3LBOA 4PUKA 1YQ2A 4W87A 3KW3A 4AISA 1YDVA 3JZEA 3BO9A 3TAOA 1IF2A 1GG0A 2ZXBA 3VVGA 1ONEA 3PUOA 2MNTA 2OEMA 3S1VA 3DG7A 3SW6A 4JEQA 2GWNA 4GLEA 2Z7GA 3MW7A 3W0KA 3VIJA 4AC1X 1JNSA 4JFKA 1XIJA 3HG3A 4N0RA 4PMQA 1OX4B 1B31A 4HHHA 3WENA 5A6TC 1HTIA 3T09A 3GIYA 4F0SA 3LBCA 1K7EA 4HK5A 4DF2A 3CUJA 2NSXA 1RUSA 3LYEA 4RZ4A 4MWAE 4HARA 1Q6FA 5ABEA 1QBBA 3TAKA 1GVRA 1A5UA 5I79A 4ZE5A 1KGWA 2V8ZA 4XV0A 3O5JA 3IV8A 3TSBA 2A6NA 4UOQA 3RJYA 4OIFA 4MNKA 1J01A 4E8GA 3VKAA 4C5YA 4JTIA 3TP4A 3C3UA 2P5NA 4TU1A 2NQ9A 2YCLA 2MUCA 1H0GA 4TYOA 4W89A 1OJXA 1B30A 5DF0A 1XLMA 4ZEPA 5CPMA 2REQA 2Y88A 3TYCA 3VOFA 1UWTA 2ZCGA 1VCGA 2Y62A 1KA9F 3NSMA 2VVSA 1UA7A 4I7VA 4CVUA 4JTUA 3DI1A 3ZM8A 3NYDA 3CBWA 3NUKA 4K37A 4PTXA 2M2AA 3W53A 2CWNA 3ITOA 4NXSA 3B4YA 1V6YA 4NUWA 4BFAA 2DG4A 1H50A 3O5OA 2ZX9A 2VC5A 3UG3A 3WLIA 3DBNA 4UTTA 1IT0A 3IKGA 4C6DA 1R5YA 5LHEA 4Z1CA 4ZS6A 4BF5A 1SR9A 2V2HA 2ISSA 4R7OA 3LPFA 1FFRA 3CO8A 8RUCA 5D05A 1GHRA 4XB3A 3KBWA 3WKZA 2QV5A 4FR6A 1TREA 3DERA 3LLDA 2G50A 4AMAA 5REQA 5CXPA 3FN9A 3KOZA 4CNSA 4YCOA 4AQLA 4MADA 1YPFA 4RPPA 1CI1A 1HF6A 1ONXA 3OQ8A 4DBDA 1TR9A 3W7DA 1VLIA 3N17A 3KABA 1RBAA 2J4GA 2JKAA 2M1IA 3ELFA 4HYVA 2IKGA 1IZJA 1OFAA 3QMSA 4KW2A 1ROUA 2A79A 1R2SA 1A5BA 4CCZA 1C7SA 1N1AA 1CCWB 3BMXA 4XBSA 1XJBA 1YTKA 2PLJA 3TROA 3IJIA 1BRLA 3H2OA 4IIGA 4HMEA 1P6BA 4HN4A 4L1GA 1EF2A 3KOFA 2FB3A 3A64A 3W07A 3L66A 2AMGA 2XIIA 3KTCA 3LB0A 3DZ1A 2WM1A 3I7RA 3G1HA 3PM6A 1UW9A 3PHAA 2VELA 2NX1A 1FKIA 1ONRA 1FWWA 1TPWA 1BQGA 4IL2A 1XBVA 4A3RA 4NNRA 1QT1A 4PMUA 4PRRA 4HU0A 3GM8A 1W6TA 3W1RA 4MUPA 3KOWA 4JFTA 3R6IA 2IKIA 3FV9A 2O56A 3CQHA 3TSDA 3MKKA 3F2CA 1P0DA 1OF6A 3KTXA 4UTTC 1EX5A 4RNHA 4Q22A 1IXOA 4QZVB 3T7VA 4XUYA 2ZA3A 3DECA 4C5ZA 4XK2A 1ZQ5A 2DSKA 1JEZA 3NDOA 1KXVA 4CQ9A 3WH7A 1C8VA 5C9WA 1EC9A 3EOLA 5AZ0A 5GJNA 1LL4A 3VD7A 2I5QA 2A85A 4MY1A 3KWSA 3VZXA 4NVTA 2OG9A 3DKJA 3N9SA 3O7UA 5EMLA 1VENA 4EIVA 1E6NA 3BAXA 4M29A 3S6TA 2ZC8A 2JGYA 1LJYA 1YYAA 3CM4A 2CKSA 3WF2A 2FPVA 4XZLX 3NOYA 4O54A 2BWGA 4FA3A 3R0KA 2CHRA 3ZT6A 3C2YA 2BGQA 1A4MA 4Z0SA 1R3VA 5LZLA 2OX4A 2BOEX 1ZPTA 1Q6CA 5CGMA 1WDDA 3W7MA 1RPKA 5C7HA 3RN6A 1Q2SA 5JH8A 4D2JA 3MYPA 2JGQA 3SJNA 2QAPA 4MWAD 3CWOX 4I5UA 2FDSA 5I3HA 3UF8A 3CPGA 3I3BA 1WDWA 4H41A 2YCKX 1TPUA 4QLKA 4QHRA 2JZVA 2E67A 1V02E 3KHDA 4XAYA 1GUVA 1A5NC 5HOSA 3M0LA 4H04A 4UFLA 4Z1BA 2ZR5A 1PZ3A 3PULA 4TX8A 2IPGA 2GSJA 4QE5A 1R30A 3KVLA 3W74A 1KV8A 1LUCA 1YXCA 1OYBA 2XDFA 1CPUA 2YL9A 5HNNA 2JE8A 5I78A 1ECQA 4YL2A 1JD7A 2QCHA 4YYFA 1V6VA 4HU3A 5EMKA 1YHTA 5K3VA 1KM1A 4F40A 3UZZA 2J6VA 2QVHA 1GTHA 5A8MA 2YR1A 3CYVA 1U1HA 3OBKA 1XD1A 1K8ZA 3WLSA 3SCUA 2ZX5A 2E5DA 2ZADA 3CHDA 5KSWA 3BMBA 4GUGA 3VXGA 4DF0A 4GCXA 1ZCOA 3LY0A 1HJSA 1PEZA 3VMNA 3UPWA 4FOUA 3BH4A 3NGFA 2VDIA 2E6DA 1T41A 4B3KA 4BEQA 3LZ3A 4L72B 2CWXA 2QCEA 3H4XA 1WA3A 1NIUA 1B54A 1I9CB 3UXIA 2BY1A 3S2LA 3M6YA 4RZ6A 5BRPA 4M5PA 3GLCA 3BOFA 1RLCL 2GGGA 3PBVA 4AX7A 2W67A 4GC4A 1Q6GA 3GDRA 4PRWA 3MMWA 3KCJA 4C1LA 3LUOA 3CHCA 3N4AA 1DWHM 4K3ZA 2WZTA 4PEKA 2CFFA 2VGGA 1R9ZA 3MPGA 4PULA 1KFKA 1KM3A 4ORIA 4FIQA 3FK4A 3OZPA 3C61A 1E9ZB 4W88A 3AU6A 2GQAA 3W1UA 4QDMA 1QW9A 1ITCA 2QT3A 1FWJC 1JYNA 5KZEA 1I2NA 2YJQA 1OK6A 1HKMA 4L9XA 4UQDA 3PZGA 2I16A 4DZAA 2GLKA 1VB9A 4P7OA 2DVUA 1EC8A 1F4AA 2PDWA 2OXNA 3K30A 4WR3A 3KZPA 4QIUA 2W0UA 1CTNA 1PWMA 3CGMA 4DNHA 5D8ZA 1UWRA 1MSSA 1O95A 3W1TA 4HNNA 1GOQA 1A80A 4MYAA 3DFOA 1V79A 1VAHA 1PKLA 1HX0A 5DFAA 3R0DA 1DWAM 5E09A 5J5DA 2OO6A 4JN7A 3PRBA 1US0A 3QBUA 3HOJA 2DU2A 1PDZA 4UWMA 3NURA 2CZ5A 4EP8C 3KUMA 4DI8A 1KV5A 3LGGA 4LUJA 3EOOA 2PWEA 4J1OA 2VWSA 3S47A 3VD3A 4UNIA 3GIPA 4HNTA 4RE2A 4J3VA 4POCA 3O5MA 3T05A 3GIQA 4L4OA 1KBKA 3LCFA 3E74A 3F5LA 3BSHA 4A21A 4A3YA 1OQFA 3RLUA 4GH3A 4B5VA 1VFSA 3CV1A 2P8CA 3ZWSA 1NF7A 5MHBA 4GACA 3HPXA 4OOUA 3GU2A 3CJPA 1JQVA 1IGSA 1FY6A 5D03A 2XP5A 2VR5A 1QU4A 4U10A 1NSJA 3MKVA 4KEVA 3B0PA 3ALGA 1CXKA 2DVXA 2R6OA 3IAQA 1UP0A 3PK7A 2DSVA 3AXXA 4EWND 3VZZA 2VXNA 3GHUA 4GGQA 2RDTA 1EOMA 3PUEA 2A3EA 4B4FA 3S1WA 2ONEA 1UD3A 4AD0A 3W2NA 2YCEA 4LVDA 2NX9A 4JFMA 3PZMA 1UR9A 2YL6A 4O2TA 2BASA 2HWGA 4XD4A 3IJQA 4DJED 2ESCA 4QG6A 3WD3A 4JYSA 3QOMA 4JFJA 4WDXA 3LENA 3WH9A 4WHBA 2PU0A 3BAKA 4HOZA 1JYWA 1IZCA 3AHYA 1IT7A 1DYSA 5CJ5A 1NTHA 4TX9A 4GUHA 1GQJA 3RU6A 1IYXA 5A6AA 3VGEA 4PA8A 4AF0A 3GTIA 3PAJA 1GG1A 5BXRA 2XGBA 2ZVRA 5DRCA 4ASTA 1DIOA 2BVWA 2RH9A 3MWCA 5FJPA 4NHVA 5EBAA 2WMIB 1XBXA 5TD4A 5I09A 3L4UA 4Q8OA 1ZBKA 4CQCA 3ANUA 3URBA 3KL3A 2WV8A 4NT0A 1EDGA 2NUXA 1OK4A 1US2A 1AQMA 1QHPA 1ADDA 1TTPA 3UWVA 2VMFA 1XISA 2Z0IA 4GE8A 2E9BA 3L2IA 3AISA 3W1XA 4L7ZA 2Z1XA 5XIAA 2ASHA 4JR5A 3OO2A 2X2YA 1EHAA 3CO4A 4CGTA 5CC6A 3ITYA 1V93A 4WGHA 4YHEA 3AS1A 3WNNA 4KH2A 3LUTA 5DN1A 2Q8LA 2X30A 2VI0A 3VD9A 1TV7A 1JCYA 2LLEA 4QROA 1GK8A 3A4XA 2XIOA 1QMLA 1WDQA 5JIPA 3H9RB 3AS2A 3WQFA 1E43A 1DJNA 1ZENA 1D7FA 3FXYA 2EO7A 1D3GA 3RYSA 4KWSA 1V3JA 3M46A 1RVKA 4S23A 4OECA 4A8RA 3VFCA 3AOFA 2H8XA 1NEYA 3TWBA 3URNA 4NZCA 1W37A 1MFUA 4PB5A 3WQOA 1J10A 1JZ8A 3AMDA 1HXVA 2P4VA 1Z89A 1J4EA 3JYJA 3KOXA 1GYNA 1OT1A 3UXDA 1E4LA 2WSYA 4HSOA 5BRQA 3VKBA 3OHMB 3CEUA 3PTMA 1CIUA 3H2FA 2C16A 3WBEA 1OFDA 1LRNA 4DRIA 3ITCA 9XIAA 1L2UA 5D75A 1D7KA 1JRCA 4LBUA 3RK8A 5A8PA 1EHNA 3TMQA 1W5OA 1AMYA 3AC0A 4IMGA 4IPXA 2FKPA 2XP7A 2FH8A 1E1FA 4C1KA 2C19A 3BW3A 7PTDA 3E0FA 1YIXA 4O50A 4UTJA 3VNZA 2W5FA 5D38A 3TTYA 3W72A 1EA0A 3QEZA 4R7WA 3T55A 3N2BA 1XIHA 2YB1A 3W82A 3H2NA 1UZ1A 4WX2A 4LBRA 1H7RA 4EF9A 4IISA 2UWFA 4QLLA 1VJIA 3H23A 2ZZ3A 4ODOA 3PBWA 3S0CA 1OX5A 5JBEA 5ABFA 1FQ0A 3G24A 1CXEA 2J8GA 2YXGA 2ATSA 3FXGA 2EAWA 3NL6A 1Q45A 1H41A 2PA6A 2D2OA 1UWUA 1YTEA 1IEVA 1EWEA 3GX9A 3N4FA 1SR0A 5DT7A 4I9MA 2ETNA 2BFGA 4O8AA 2AL1A 1PYFA 3A4AA 1KXQA 1KLZA 3KAOA 3MMUA 4F2TA 4H2HA 3ZJ8A 1N8WA 1TMQA 5LNRA 2KR7A 2QPXA 4HHPA 2VP8A 4PBEA 2XG9A 1TZZA 1PX4A 1ZALA 5LXXA 1V3KA 2O9RA 3PP7A 4D6DA 4RV3A 4DJDA 3SUSA 3WF0A 3S2JA 1BLIA 1LQ2A 4AZGA 2FFIA 3FJ4A 1Y5VA 2OGYA 1VFOA 4AEFA 1KM6A 2BHZA 5IDZA 1KKRA 3KVJA 1HJXA 3VX0A 1YPXA 4O0ZA 4DIAA 1H62A 2G0WA 3T08A 3WLPA 3BK0A 1VPXA 2HS8A 2PDCA 4PCPA 2WC7A 1DQUA 4LU0A 1LOLA 1MVYA 4WDTA 4CEUC 4C65A 1FDJA 3H24A 4X9SA 3UU0A 1E5JA 3N6JA 3RNDA 1J96A 3VIOA 3RMJA 4C6MA 1F3WA 5C6MA 3WNPA 2Y61A 4S2BA 3SCSA 1XUUA 3T2QA 3UY7A 2Q8XA 2VRQA 5LKYA 1E1CB 2QCFA 1YRRA 3DFYA 1ZUAX 4F0RA 2OLSA 3PTQA 2QJJA 3MCMA 3O5IA 4PRTA 1ME8A 4A29A 1OINA 2VFEA 1NSGA 4G1KA 4JTEA 3SQSA 3KS5A 1RZMA 3A4WA 5EMMA 4UIOA 4TUFA 3CWNA 4UMCA 4YMZA 2DH2A 2C0HA 4IMEA 2VZSA 3TN4A 1Q6EA 2P88A 3KOYA 1PWLA 2WMGA 1H09A 4Z2GA 3TJXA 3VGFA 1KGUA 1KBIA 1UHVA 3H6OA 5HQMA 2GPTA 4IIBA 5CC7A 1C8XA 1RQEA 4ZXOA 1KXHA 1OM0A 4OGZA 3OJGA 3SCWA 3QQ1A 5AOUA 2E77A 2MF9A 2P8BA 1F6PA 3MDYB 5T9BG 3GHTA 2GSEA 2WPBA 3LHWA 3TN5A 4PUUA 3THAA 4C6KA 4WKFA 2GJLA 5MKGB 2Z29A 1GVFA 3E49A 4S3KA 2WSPA 3VAVA 4IMFA 3EKLA 3E38A 1MRQA 3P0WA 2AGKA 3FJ6A 2PD5A 4GQRA 1UJPA 3QGVA 2WOQA 1P4CA 1ISWA 3QW4B 4IZGA 2EEXA 3CZJA 4NZ5A 1QR7A 3WQ5A 2CXGA 3M0IA 2AMXA 5EA9A 3MS8A 8CGTA 2POZA 4L61A 1ZB5A 5C71A 4O8RA 4JTQA 5C2XA 2BGSA 2XFWA 2FDMA 4OQVA 4ODKA 4DH0A 2QCDB 3OTRA 4YU1A 4IJRA 1PUDA 1EQPA 4E2OA 2ZUTA 1YXYA 3VA8A 3W73A 2CESA 4DO7A 4PMDA 3AO0A 4LAUA 4Q32A 4E3TA 3SUVA 1PB0A 1VBJA 3VOCA 3K13A 2WNWA 2EG8A 4NF7A 2FB2A 3NOEA 4FMVA 3WLLA 2YFNA 2VEIA 1DTNA 3P7YA 3LV5A 2VEGA 3S9IA 5GJMA 3D6NA 3H7RA 4E38A 2Z4GA 4JEJA 4IHCA 3PWAA 3V1HA 3H53A 5CZTA 1Q1CA 2KX9A 4DO6A 3LGEA 4HA4A 3EYPA 2DUXA 4YVXA 4CD7A 2FGLA 4O14A 5A6JA 1XLIA 3O5EA 1FKRA 1DEDA 3EOUA 3MJYA 1AH0A 3VIPA 3UGVA 3KAFA 4WOQA 3QJAA 2WSQA 3PR9A 1OEPA 1XS2A 3P6LA 1A3HA 2DZXA 3CUIA 4ZENA 4K36A 2ZR4A 1ZTVA 3VIMA 1NQKA 3IJDA 4IQLA 5FA5A 3DYOA 1FKBA 3HGJA 3T07A 1P5BA 3RAOA 5HWNA 1VQTA 3NQMA 5AYXA 1ECEA 1L6YA 5FJRA 7XIMA 1TVPA 3WUBA 2FTYA 2V3DA 2CC0A 1R7AA 3KHJA 1XIBA 1LWJA 3C0QA 1R7OA 5AHNA 1HVXA 4DRSA 5C2CA 1X97A 1GHSA 3IGHX 1IWPA 5FL0A 2V3GA 1PO9A 4MB3A 3UP8A 1K02A 1J93A 3UQNA 3DENA 3N2XA 3OVQA 1XCXA 4GI8A 4EKJA 3KACA 1ZJHA 1FFQA 2O4QA 3IEBA 4I6KA 2XZ9A 3G2GA 3DC8A 2WJZA 3N6QA 3VDGA 5DX7A 4O16A 3HMCA 1G01A 2XM1A 1M04A 3W7KA 4IG2B 4BQ4A 1BD0A 2D1ZA 1PAMA 3EA2A 1SZFA 3SCRA 4AZCA 2Z1SA 2J75A 3B8WA 3TOYA 1G7VA 1S39A 1MQPA 3DKLA 4HYRA 4NZ4A 3UJFA 3TYAA 1F7BA 4P8WA 1H60A 4C6PA 3RG6A 2P0IA 2VM8A 1WO2A 3IJ9A 3L2LA 3IIPA 3BAWA 4Z2KA 3NA8A 2INFA 3CZEA 1EBGA 4J2MA 2XINA 4LVGA 2E7FA 4W9QA 1VH7A 3UPMA 3WK1A 1U30A 2BHUA 4Q8MA 4BQ2A 5K4ZA 4PC8A 5JU6A 3I7QA 4M3PA 1PINA 1KFCA 3RCYA 3QR1A 4ZPTR 2GGHA 3WJZA 3TXZA 4LF1A 3AS0A 3LCWA 5EMYA 3M5ZA 2Z2UA 1I60A 3TYEA 2DZSA 3BURA 3M64A 2PN0A 1TIWA 3TW7A 4BY3A 1XLJA 1EYWA 1SMDA 4IWWA 3STCA 4DJFA 3VOIA 4A3HA 4PMYA 2DGAA 1MMFA 1SO4A 5FI8A 3UWQA 1UOZA 7TAAA 1UPMB 4D6CA 1V0LA 1PTGA 2YBVA 2QJGA 4A2RA 3RM4A 2ZZ2A 4IIEA 4LALA 3RO6A 1OCNA 1E4IA 3E2SA 1VPYA 4JOMA 3G8EA 3GVWA 1U5VA 3C86A 4PUDA 4B5TA 1ZRQA 2Q01A 1VBHA 4CNOA 3I6CA 4WD0A 1CNVA 3MVIA 2GGIA 3CUZA 4Z2IA 1FHLA 3EWUA 4UB9A 4JDYA 1V03A 3FA3A 3BMWA 2EGZA 1RLDA 3FDKA 1W9VA 4KWVA 3BMVA 4M82A 2E4TA 1B5TA 3W23A 5BOOA 1WQ5A 5DXYA 3P14A 4JFWA 3SN0A 1TB3A 3GVVA 3ZYZA 1UKPA 3WZ0E 3GR7A 4XKMA 1P48A 4W8LA 1WNOA 2PUZA 1T5AA 4EPKA 1LOSA 3TQVA 1XLBA 3U2CA 4MAZA 1JGMA 1PJ9A 1BGAA 2ZR6A 4DPPA 4ODPA 2ACSA 4XBKA 2G4FA 1O68A 1K4HA 3U7VA 3N14A 3PZVA 4OU1A 1RHCA 1AJ2A 2CITA 4KCTA 2YSWA 5AVHA 1J6PA 2PLMA 2HV5A 1RCQA 4LCSA 4KETA 3OZMA 1WKYA 3M0VA 1P0EA 4TTGA 2FKEA 4FALA 3WF1A 1WX0A 2XIBA 2J6XA 1LZOA 4GA8A 1LLWA 3E2RA 2BOGX 3PPHA 1M7XA 3G8RA 2FHBA 3UZXA 1X7IA 5LIWX 3UCCA 4C6CA 4HKPA 2Y70A 7CGTA 3DGBA 1FKLA 3CUGA 4DJFC 1NDWA 3DUGA 3U57A 3TC5A 1R8LA 3APYA 3KLLA 3ONCA 1K6WA 4LNCA 2Q8ZA 4ZL1A 4TW7A 4A8IA 3U2EA 2NQJA 1QK0A 3NL5A 2SFPA 4E2VA 2E9MA 4N42A 1WB0A 4B9YA 3VDHA 1NAL1 3CIWA 4CD6A 5JXQA 3XIMA 3LSBA 4EX4A 1ADSA 4KIRA 1P7TB 2XFYA 3O5LA 4O4WA 1MWOA 3BLKA 3HFTA 4MIMA 3T4CA 1TRIA 3I68A 2Q02A 1HO4A 1QOPA 1R3QA 3HQOA 3NXLA 4Q4MA 3Q65A 4DWDA 3E12A 3DBPA 4KEUA 3EOEA 4RKAA 4ZB5A 4H9ZA 3CAVA 3DFNA 4OE7A 2E0PA 3B0VC 4IUOA 3IARA 4AD5A 4EAMA 6A3HA 3UNDA 3EWWA 3HG4A 3GDLA 1QPRA 2ITKA 4YHGA 2C14A 1QXLA 2XWEA 3V5OA 5CC5A 1KRCC 2BLEA 2R82A 3ZLHA 1T40A 1GOIA 3K5XA 1FWCC 1CB7B 1FKDA 2VFFA 4MGGA 5HBFA 5A6SA 2V68A 2RDWA 5DCBA 1TPH1 4AIBA 4RE0A 1UD6A 5XINA 3FFSA 4HHMA 2PV1A 1GORA 3KM8A 1AD1A 2G8ZA 4FZIA 5HMFA 2V67A 1M53A 2BVYA 6REQB 3DFHA 2UY2A 4JIHA 5CSUA 1JF6A 3EWCA 3B0YA 4B5WA 2BOFX 3NO1A 4Z2LA 3R5EA 1XLKA 1A5OC 3RLGA 1YBQA 5K7JA 4LB3A 3V0UA 1SJAA 1EJRC 4RX0A 1HN1A 4IFKB 4LUSA 1OB0A 3D3AA 2V69A 2DUZA 3IUIA 4X3ZA 5I5RA 4NILA 3GPKA 3IK4A 4KGLA 3ITTA 3KRBA 3S1XA 4H8NA 1QUMA 2QJMA 3OGVA 3SRKA 1RA0A 1L6WA 3MQTA 2VC9A 4PH6A 5CJNA 3UPBA 4CEXC 3W27A 4OV9A 4JX6A 3OZYA 1JAKA 1F3XA 4QCEA 5GNYA 1M7PA 3N6HA 3KZSA 1TJ0A 2CBUA 2H90A 2M08A 1ENUA 3NCOA 4O4VA 4ICNA 1EZWA 3KL0A 4TV5A 5K9XA 3VAWA 3V75A 2GSHA 4TX6A 4AVNA 2PCEA 5HJYA 3NVTA 3HBLA 3UVIA 1QOXA 1E6XM 1AJZA 4P8UA 1HO1A 3LNPA 4EACA 4ACZB 1NJJA 5B7YA 1KTBA 4EAYA 1OADA 1BYCA 2YB4A 5DBTA 4I8YA 4U84A 1E0UA 1EDTA 3T4WA 1KCXA 5IBXC 3CT2A 5TF0A 1TIMA 3WBXA 4K7YA 1CB2A 2IKJA 1B2YA 2HK1A 1ITUA 2H3DA 3E5PA 5FEPA 4K8EA 3LU2A 3P82A 2VCDA 4WK9A 1DWIM 2AKZA 4RDVA 5HNRA 4P8XA 3TQKA 1F05A 4D1JA 5EFDA 3N73A 3KRZA 2Y5JA 1NELA 2OO0A 3MMDA 5TAOA 1KNWA 5KZMA 2HBXA 3BLIA 5CG7A 1Z3NA 3LPPA 2TRSA 1UD5A 4LC8A 2E40A 3MHUA 4ZO7A 1H1NA 4ZCWA 4LUTB 4JNYA 3SCVA 3O6DA 1KQYA 3CQ0A 3V35A 4Z1DA 4M80A 2I14A 4Y9NA 4Y8FA 2F84A 3NIYA 4JIQA 3CC1A 4OFCA 5DO2A 5BU6A 4MFDA 4W9OA 1A0EA 3WD2A 3FA4A 2PDUA 1RXOB 3EPOA 4MF4A 4GZJA 3BCJA 3VO0A 3DCPA 1QPQA 1RA5A 3KBJA 2PP0A 2PWFA 1XKYA 1BG4A 1QO2A 4EPBC 1L9WA 3UY8A 2IKHA 3TCSA 2V3EA 5B80A 1KGXA 4PCTA 1GJWA 2EXOA 3GNRA 2Y2WA 1NF0A 1Z69A 1JCNA 3AMCA 4H7VA 5BRBA 3N19B 5DELA 2RUSA 3GNDA 1TWDA 4XVEA 4AHQA 4A35A 3MP3A 3SRDA 3FGCB 5H2ZA 1JCTA 3WIJA 1JAEA 3WDQA 1UR1A 7A3HA 2V5KA 4ALDA 3AMLA 2A6LA 1IEXA 2Q3OA 3ZJKA 5LA0A 4PFMA 3DYMA 5LIKX 3SY1A 1B4EA 4O28A 2Y6ZA 1UP3A 3B9AA 3PF3A 3H2MA 2ISVA 2XP9A 1EEXA 1KBJA 4G56A 4GIYA 2INZA 2CETA 1U1UA 2IW0A 3ZVIA 3KADA 1TZ7A 2V0TA 3NZPA 3NQFA 4F2UA 1B3VA 3EWXA 3NAVA 4ZQCA 4CNUA 4M56A 3SCTA 5HPOA 1RCXB 4U3AA 2J7FA 5BXPA 1ZBCA 3O9NA 1QNSA 2GDUA 3PJUA 3FYOA 4GJ1A 5BROA 3SAZA 3S9YA 4CD5A 5CPOA 1E3ZA 3APTA 4E0CA 2VC6A 5FAGA 1E55A 4DELA 1PTDA 3GXMA 4WEVX 1VZWA 4G5DA 3T0TA 1V4YA 1RV8A 1XYLA 3FS2A 1Q4NX 2XVPA 1MXSA 4S3FA 1GOMA 2ISFA 1W1B1 2I5IA 1UC5A 4NAFB 3NDZA 4KMQA 1XV8A 5CZSA 4WIWA 3ABQA 1W3HA 1TJ2A 3APGA 2VGBA 1R87A 3PB0A 5C7VA 4ML9A 4DXXA 4DRHA 3UETA 5CC3A 4NX5A 4BI5A 3LCGA 3VK5A 2RGMA 2C3ZA 3LERA 4F3HA 4Z1YA 4LS2A 4XZ9A 3K1GA 1EJWC 4S1FA 1HP5A 3D46A 2QULA 4UTWA 1YDYA 2Q71A 1XX1A 3NEVA 4FXFA 4LB4A 3RILA 3VNKA 4U4MA 3VM7A 3BAJA 1MI3A 1Q4WA 2PP1A 3WX7A 3CZKA 4N9DA 4L6HA 3EDFA 3GTHA 3ARVA 1W1ZA 2F6KA 3IPWA 5I07A 2WZEA 4NJGA 3WFAA 4M7TA 4MSPA 3N2OA 3WK3A 1R6WA 2A2IA 4AZ7A 3IVUA 1TQXA 4XSMA 1X6UA 1KTNA 1Z48A 3P62A 3LHTA 4ZO8A 1CLKA 1OG0A 1QPNA 2OU4A 9XIMA 2X7VA 2NVDA 1FHUA 4HCHA 4B2DD 4TVCA 3CH9A 4R9XA 4IPNB 4IFRA 3CQJA 3K1DA 2IF4A 1DP0A 3LRKA 3LGDA 3TONA 4NL1A 4GVHA 4LH8A 2WMKA 5DXXA 3GU9A 4C1NB 4S2CA 3P67A 1KQZA 2ZWYA 4GNVA 3D5HA 1GPWA 4H8HA 3SADA 4JNMA 4LEQA 1AZ2A 2VUYA 4MKNA 3HURA 3W6YA 2XGIA 4WDUA 4ADTA 2RGLA 3O63A 2X16A 4DO4A 3GVRA 3R8RA 5JBDA 1UB3A 1RJRA 3O0FA 4EXQA 4G50A 3OZOA 2NUWA 5IM51 4ZXLA 4C6BA 2P3EA 4MDOA 1I2OA 1J6YA 3H2EA 3VFLA 5C55A 4CNPA 3H4GA 3C0JA 4Q8VA 3H26A 4XZIA 2Z6JA 3NWRA 2ZRUA 3KDOA 4GY0A 4AWEA 1JPHA 1GZ1A 1K9DA 3G1YA 1WDPA 1UR3M 3NNTA 4L4PA 4J4OA 3WQ6A 2QCCA 1UQYA 1L0PA 4IMAA 1HIZA 1FKJA 3F4NA 4DO5A 4GQGA 4HZ8A 5HMEA 1OT2A 3AAMA 4J4NA 1FOBA 2B31A 3VC5A 4AX6A 3ORWA 3S46A 1W3TA 3MCOA 3VIIA 1C8YA 3HG2A 3SRFA 4Q7NA 2XIJA 3RLVA 1H4PA 2VZUA 2NSOA 3MYOA 3V5CA 1XGZA 5E9XA 1NMVA 1Y8BA 4H4IA 3F03K 2CZVA 3W86A 1G9HA 2E6YA 3B8IA 1NOUA 4K39A 3WDJA 1RPXA 4XKYB 1XBZA 1EDQA 4Q3MA 3UI4A 3NQBA 1XLDA 3PZ9A 5XIMA 2Q5AA 3DX5A 3FJNA 4JN8A 3ANYA 2FTWA 3TH6A 4HA3A 2OLHA 1XIMA 3Q37A 2Y8KA 1AODA 1AA1B 4DZIA 4QS6A 1R3SA 3BOXA 2PPPA 4C90A 2QJHA 3TQPA 1CT5A 2O7QA 3H70A 3C2VA 1SJDA 4O1DA 5I03A 3PA7A 1UR0A 4W9PA 4DAFA 1H63A 3IIZA 1MXGA 2BMBA 1WZMA 4JPGA 5A8QA 5M17A 4JBRA 1NVMA 1TELA 2WQDA 5M03A 5IOBA 4O52A 1QI3A 1UWQA 1X7FA 3N34A 1VLWA 2HK0A 3UA3A 1TUXA 2YCLB 4GNJA 3V0SA 3GYEA 3DH7A 1FCVA 4GPNA 1J0ZA 1V0MA 4HBEA 4FX7A 2DZAA 2REQB 4AFYA 3NZRA 3SDOA 4H9TA 3R13A 1IXNA 4BI7A 1T8XA 1NARA 3AYTA 5LNUA 3QZAA 1HXJA 4KF1A 3UQBA 4CNTA 1OZQA 3IRSA 4IT1A 3EDKA 4XZMX 4ZVJA 1F9CA 5E9AA 2ZUNA 3S83A 2KO7A 3W76A 3OQEA 3WD4A 3L4ZA 4AYSA 3MMTA 3TJ4A 1ZU8A 4FF7A 3AMKA 4GX9A 5D2WA 2FQIA 1OFEA 1W1PA 4K68A 1TE1A 2G3IA 2WC3A 4GI4A 5I7GA 3USBA 3NL3A 1E6QM 3WLTA 1OFRA 3M16A 4J4KA 1K7FA 4LFYA 2VJXA 1RVGA 3H21A 1UIPA 4FXJA 3AFBA 2ZX8A 3PSWA 2QGHA 1FX6A 2W6RA 5REQB 2UBPC 1IQ8A 5A8GA 1GW1A 1ESWA 4Q8NA 4TVDA 4GI9A 2Y7DA 1KFEA 1W9DM 1QK2A 1E9YB 3A23A 2I9EA 5JH1A 3S42A 4G8TA 1T8QA 4DRNA 3NRKA 3ISIX 3PPGA 2VNCA 1ISVA 2WZMA 3B40A 4AW7A 5A6BA 2PDBA 4Z2HA 3A13A 4GNKB 1TPVA 2RDXA 1TJRA 1TX2A 3W2MA 4LGXA 3WSUA 1G4SA 3NQ7A 2J27A 4Q7BA 4IQ2A 4Y8EA 4XG1A 3QRHA 3WJXA 2BS9A 4NNAA 1BRLB 4CN4A 1JCHB 4FNRA 6REQA 3F2BA 3H7UA 4ZB0A 2H9AA 4IF2A 1G69A 1F61A 2FVKA 5L9FA 4XAGA 5IFPA 1XI3A 3NZ1A 2BVTA 3O3RA 1E3XA 4PB4A 2NLYA 1BF6A 3UERA 2WBKA 5AHIA 4GRSA 2CHOA 1R3RA 3KLKA 4EE9A 2ZVIA 3QTPA 3W7IA 4G1NA 3L4VA 2X2GA 3A4JA 1SU5A 3BANA 3A9IA 2R91A 2QIIA 3R8HA 5I23A 4FX8A 4WJ8A 3TDBA 3SR7A 2EPKX 1ZNNA 3LNMA 3TJLA 5HMSA 1S5WA 3LCIA 2EQDA 3GBEA 1PCWA 3WDPP 1LYXA 1US3A 3O5QA 5LSMA 3W7GA 3O07A 1GEQA 1J6OA 2ZQUA 2DSZA 1W3NA 1P5QA 1NOWA 1UD2A 4UFHA 2PFHA 3LX9A 4WXZA 2RQSA 3B3DA 1R85A 3GYCA 4QM1A 4FR1A 1V6UA 4O15A 1EF3A 1QVBA 3B9EA 4S3DA 3DESA 3IJ6A 2VT0A 5CLWA 5U4NA 9RUBA 5D9NA 1A0CA 4P7NA 2DJXA 3O6CA 2WHJA 3P8JA 2J13A 2DZUA 3GDKA 3AHXA 3LTYA 3VUPA 1GONA 3QV8A 1PSCA 3UEQA 3HTWA 2J66A 1BHGA 1FH8A 2F2DA 2OZ3A 3WQ8A 1D8CA 1V7YA 2EPNA 2HCVA 1RY0A 2NZLA 2FZMA 3GG8A 3QV7A 3KCEA 1ISYA 3OB8A 3WH6A 4AY8A 2NXGA 4KRZA 4GZEA 4AD2A 3OOBA 1Q5MA 2O0TA 4LC6A 5CSRA 1W9PA 3NQAA 4OUEA 2OWXA 4UTFA 1ME9A 4Q4SA 3W1NA 3JS3A 4IQJA 1UUOA 2Q6ZA 3QHMA 3HB9A 4DUWA 3L2MA 1E4NA 4V28A 4L80A 5GVJA 4DROA 1XRTA 3DHPA 3PWIA 5D37A 1CGYA 1GWJA 3MV01 5GQBA 4NKCA 8XIMA 2BB0A 1FKTA 1BVWA 1PZ2A 5LA2A 1XINA 1VFTA 3UR2A 3C2OA 3PNZA 3EKGA 1FXPA 2WO5A 1S2VA 2Y85A 1Q8JA 5DIVA 1K9TA 3BXWA 3LCXA 1EO7A 4O1BA 3L4WA 4Y2WA 1E6RA 1V3IA 1J2BA 4S38A 3BTNA 3NTYA 5BXTA 1XIEA 3STPA 2NW0A 4JQ1A 2CPUA 3MUAA 2IS7A 1OYAA 3NXFA 1LUCB 1W3IA 5JVLA 2ANUA 4AEOA 5LHFA 2QLYA 3W7CA 4MJ4A 2VOMA 2X1SA 2JALA 3QGKC 4V33A 4LY4A 2WW5A 3IACA 1PXGA 1UD8A 3TFCA 1Q6RA 5I3DA 5EFFA 4OBSA 2LKNA 3IJ8A 2X42A 4FLOA 1EPVA 5AFDA 3M6DA 2OFNA 4O53A 1GW9A 1Q65A 3THDA 3JYMA 2V81A 2P76A 1KRBC 4YIWA 3WUEA 1KRAC 1QW7A 3ZMRA 1NWTA 3OBEA 4S3BA 4QJ5B 2P3ZA 3TV8A 4D6EA 3RLHA 2WQPA 1H7XA 3N15A 3NZGA 1KXTA 2XVKA 3OVGA 2BDQA 2QCNA 1E5NA 1LM1A 3ARWA 1O12A 3FGCA 3U5YA 4QCFA 1Q6OA 2GQ3A 2D9FA 1D6OA 3T78A 3WJYA 3EKZA 1BXCA 3W02A 1P6WA 3L7RA 2WLYA 4QJ1A 1C9HA 2JQXA 4XBJA 5AYZA 3A12A 2CLPA 3VU2A 2XVLA 3QLDA 4U5IA 1M01A 2QJIA 2YDRA 3C5QA 3ZT7A 5HW7A 1TJ1A 3TCEA 4KCWA 3P3BA 5CZJA 5HJLA 1HZYA 3VNIA 3VABA 2PWGA 3C2EA 4H3DA 2I57A 3KCOA 4HD5A 2CZFA 3XISA 1ZJAA 2A3BA 5DIUA 1A5LC 3ZIZA 3A3WA 3ARZA 1GYMA 1M7JA 1W1TA 4TW6A 1BL4A 1V6TA 1YTDA 3HQ1A 1TV4A 3ARXA 4ERAA 1GOWA 2A3LA 2D20A 3DXIA 4EK7A 3VC6A 1H7PA 3DFPA 1LROA 4XZWA 2GYIA 4RXGA 3U7BA 3UF9A 2G3FA 1JUKA 4KCUA 3GH4A 4DM2A 2XPAA 1ME7A 1MO0A 3LPGA 1XG4A 4U85A 4RCXA 2FLIA 1XIDA 2J47A 1W5PA 4H9VA 2A7RA 2PDKA 4FNPA 3EMCA 4NZ3A 2H8ZA 1BVZA 1DWJM 2DG3A 2YPIA 1IZKA 1I4NA 2OEKA 2VD9A 1Q6QA 2BTMA 2B0MA 4Q8WA 4QDWA 4R88A 3SZ8A 2DFAA 1CECA 3AHVA 2JF7A 1JIBA 2PDMA 3VOJA 1L2QA 2VFDA 3PBYA 4PTNA 4ODLA 1FWNA 3VKCA 4DT4A 1Z32X 3UA4A 3VCNA 4GIEA 4DBUA 3C56A 3H4WA 3PTDA 1XCWA 3Q58A 4KPLA 3WLOA 5AYIA 2O55A 3U2ZA 4GQQA 3AUJA 3NQEA 2VUNA 3OVPA 5TIMA 2VEFA 3B8SA 3NTPA 3NGJA 4PB3A 1L6SA 4DJFD 3OIHA 3CASA 1AVAA 3HMJG 4KWUA 1ZLPA 2BY2A 3AIRA 5CBB