2G41A

Crystal structure of the complex of sheep signalling glycoprotein with chitin trimer at 3.0a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbohydrate binding properties and carbohydrate induced conformational switch in sheep secretory glycoprotein (SPS-40): crystal structures of four complexes of SPS-40 with chitin-like oligosaccharides
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords SIGNAL PROCESSING PROTEIN
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2g41A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2g41A01
3SCNA 1G94A 2VL4A 1EHAA 3K8KA 4JFVA 4IM4A 4W5ZA 4MNJA 1UWRA 1J9YA 1MW3A 2D3LA 1YHTA 1GOQA 2ZXBA 1UD5A 3W4RA 3LPPA 4ATLA 4XV0A 4EANA 2J7FA 3W81A 2BY0A 3WFZA 5A8OA 4J3SA 3ZT5A 2ESCA 1M04A 1R87A 4CD5A 5E6ZA 5EMYA 4CN4A 4BQ3A 1JZ5A 1W9UA 4AZGA 3N15A 2E9LA 3WNKA 1CLVA 2G41A 1E4LA 1M53A 3AIEA 3WEOA 2EPOA 3OLEA 4PMVA 1CPUA 2XTKA 3MMWA 3BAWA 2VQUA 4OJYA 5GQBA 4OZOA 2Y8VA 4MJ2A 1TE1A 4PSPA 2QPSA 3MU7A 3HJEA 1XH0A 1RH9A 5I5RA 3EMQA 3SCRA 2OYLA 3VKKA 4TXEA 1OM0A 4U2YA 1GVYA 3VGDA 1B90A 3VIOA 5C71A 4AWEA 2Z1KA 4AZ6A 4U33A 1HJWA 5I23A 2D20A 2PC8A 2VJXA 1CIUA 4AZIA 1GJUA 3AOFA 3PTKA 2ZX5A 2RGLA 3WY1A 1G01A 3T08A 1S46A 2W62A 3TONA 2WMIA 1BSIA 3HN3A 1MW1A 1SFSA 5I2UA 1NWSA 4NI3A 4QLLA 3ARXA 4DWSB 1UR2A 5I79A 1BVNP 2W91A 1V6XA 3WH6A 2QPUA 4TVDA 3IAQA 2EPMX 3SCPA 1UR8A 1GORA 3QHOA 1HNYA 1QVBA 3K8MA 1E43A 1LG2A 1OGBA 1V6WA 2PWEA 5HPOA 1V3LA 3MANA 2VX4A 4E4PA 1E6RA 1LG1A 1UD8A 3W27A 1OIFA 3GDBA 4F79A 1GOOA 3AFBA 3VD5A 2IUZA 2G3JA 4AD3A 3M6DA 1WZKA 3VIKA 3WL1A 2J7BA 2YKKA 4TTUA 3MS8A 1LL4A 1H2JA 2F2HA 4C7GA 4Z2JA 1VBUA 4QCFA 3MMDA 2WVTA 5AYIA 1I1XA 3OGSA 4F9JA 1JAKA 4PMXA 2X8RA 1WZAA 2XFRA 4CD4A 3DYPA 4J7RA 5E6YA 4D6JA 2GJPA 5JH8A 2ZUTA 1DEDA 4J3XA 4J3WA 1VFFA 2DSWA 2BY3A 4UOQA 4CKQA 1XH1A 1BYBA 3VGFA 1VENA 1GONA 2BHUA 4D6DA 1U30A 5GNYA 3KL5A 2VI0A 2OYMA 4HZ6A 2JALA 2WCGA 1X6LA 1AQMA 1KWKA 3AIWA 1PPIA 1TVNA 3T0DA 5AC5A 3ALFA 2ZWYA 1UWTA 4ACZB 1UQYA 4KRUA 2DEPA 4XZBA 2OWCA 4BQ4A 2Y4SA 2JIWA 1W2VA 1WZLA 1GNXA 2QLYA 3BAXA 3AHTA 3FW6A 4D6HA 3WELA 3WDPP 3OLDA 3VDBA 1LJYA 4W87A 1GOMA 3EDJA 3GXIA 1UKPA 4WKAA 2HVMA 2ZX9A 3VILA 1K9DA 5IHRA 1NOWA 1ZBWA 1CXIA 4CUCA 3K46A 1VEOA 2WCSA 4W7UA 4R27A 1AQ0A 4PN2A 1B31A 1TZ7A 4FLSA 1WNOA 3LPFA 1JDDA 1Q6EA 4H04A 3O6AA 3WD1A 3FAXA 4WLCA 2W4XA 4UOJA 2WHLA 2GJXA 4HTYA 2J8FA 5A6AA 2WMGA 3M07A 4MB1A 4P7QA 1UZ4A 4JKMA 2UY4A 1J0IA 5FD0A 2BV9A 4U31A 4PMRA 1HJUA 2X0YA 2YA2A 1QW8A 4NSBA 1RP8A 1VJSA 4MAZA 2V5DA 2VX7A 3DYMA 4LYPA 1V6YA 3AMGA 2FGZA 2BXZA 3NSXA 3WQ4A 1E0XA 4OBRA 1TA3A 1LLOA 4IPNB 5AYBA 1HX0A 1CYGA 3JUGA 2PBOA 1UR1A 2Y24A 2VNCA 2IXUA 2VOTA 3CZJA 1HXJA 1BYCA 4GQQA 4CU7A 3VMOA 1EOKA 1WP6A 1TUXA 1Z32X 5HNNA 4XB3A 2O9RA 3AZTA 3AZSA 4CCEA 1MWOA 2RGMA 1NQ6A 1VFOA 4AZ5A 1NWUA 1XH2A 4M56A 3UG4A 4ACYA 3WBEA 2CIPA 1OINA 1FH7A 3AISA 5IDIA 3VIIA 3MKKA 2A3EA 1UH3A 5F7UA 3VGHA 1CZ1A 2AMGA 5D9OA 2YL5A 3WD0A 3IK2A 5D9NA 1W32A 5FIPA 3VD7A 2BVYA 1JAEA 4ZXLA 1V3IA 3QR3A 4PTMA 4GO9A 1ZBCA 4AC1X 3HU7A 3ZR5A 1V6UA 1H0IA 3PTQA 1WDQA 3AHYA 1KQYA 4AZCA 1G9HA 1XSJA 2F8QA 3U5YA 1E6PA 3T2OA 1D3CA 1BF2A 3VX0A 1EHNA 4OKDA 3ZQ9A 1J10A 2ZX8A 2BS9A 1SMAA 3VTRA 5A8PA 2XUCA 1L8NA 2JEQA 4AD0A 4AEFA 1D2KA 1TCMA 3WH7A 1ISYA 4TVCA 2EXOA 3WDJA 4AZHA 3RJXA 4EE9A 4BA0A 4PMOA 3OGVA 4CD6A 2FH8A 4LXFA 3AZRA 3OB8A 1HP5A 1JYXA 3VVGA 1KBBA 1B3ZA 1C92A 5I0DA 3WDQA 3W82A 3MMUA 4IUGA 1HT6A 1V0KA 3PZIA 1UH2A 1WAWA 3VIGA 2XYLA 2E0PA 4D72A 4MDOA 1BPLB 1QBBA 5JBFA 1ITCA 4UQ9A 5I6SA 3L4YA 5HBFA 4QCEA 3N04A 1Q6DA 4UR9A 3MUIA 5D4YA 3AQUA 1VEPA 5JIWA 2BXYA 3CUIA 4M8UA 3NIYA 3T09A 4TOQA 2OSXA 3ZOAA 1EIBA 4AZBA 4HPHA 4P7RA 3CZLA 2YDRA 2WVVA 5AC4A 2FHCA 4AIEA 1UYQA 4JHZA 1JDCA 3WD4A 4RE2A 2G8ZA 3F5JA 1VEMA 1OCQA 4HZ8A 2J47A 4CGTA 1PAMA 2E8YA 4P7NA 4D1JA 5KZ6A 3U57A 3WF1A 4E2OA 4HPGA 3WQ6A 2FH6A 2E4TA 5GNXA 2WC7A 3L2LA 3NUKA 2GJRA 1UA7A 2DIEA 1W9DM 2DT3A 2O9PA 1C8XA 5CSYA 2PB1A 2WXDM 2GSJA 4Z2LA 2CBVA 2VQTA 3POCA 1E5NA 2ZXDA 3BMVA 1LF1A 3LPGA 3ZJ6A 3U7VA 4PMDA 1E6SM 1E73M 2WZIA 2EEXA 4W7WA 2OSYA 1PIGA 2ZUWA 1HL9A 3CLWA 3D3AA 4HA3A 5JUVA 3K4DA 4ZE4A 3EDEA 3GXMA 3ARUA 3PZUA 1WPCA 2D0GA 2VZTA 4X9YA 2PWDA 4LYQA 2YL6A 3I3BA 3VO0A 4NF7A 4PBGA 4B9YA 4D71A 1J0JA 2HISA 3VDAA 2G3MA 2YBUA 1W9BM 4UFHA 3FHQA 3T2PA 3AHXA 5DEZA 1EDTA 3WKZA 2Y5EA 3AXHA 3AHZA 4PMUA 3ZO9A 3S2CA 1KQZA 3VDHA 2UY5A 2V5CA 1CGWA 3WNLA 2JIEA 1BAGA 1GQIA 1JNEA 4CN1A 3VMNA 3N18A 2BFGA 9CGTA 3A6OA 3RILA 1WE5A 1GCYA 1DHKA 3BH4A 1QI4A 2CKRA 1OIMA 3ARYA 2V3DA 1UKQA 3CUJA 3FAWA 1XHGA 2PWFA 4F8XA 4UFKA 1JD7A 2CBIA 2ZUNA 1XCXA 2XIIA 4B15A 3UG5A 4UNIA 5HPCA 4LX4A 4XZWA 3WQ8A 1O7AA 4YN5A 1NH6A 1GZJA 4Z2GA 3AS2A 4CD7A 5A6MA 1QI5A 1A3HA 1E72M 1FFQA 4GI6A 2CBUA 4YHEA 5CPSA 4OBSA 1PZ2A 2J7DA 4CVUA 3WF4A 4JZ5A 1I1WA 4FLOA 3EYPA 1W3HA 2CESA 4V28A 1C93A 5HOSA 4JFTA 3RM4A 1D7FA 2DSZA 3HMCA 1XV8A 4X0VA 2UY2A 1H0GA 5CLWA 2C8NA 3GNOA 1BYAA 2EPLX 2VC9A 3SUWA 4JL1A 1QOXA 4A4AA 3POHA 3OLGA 1VAHA 1N82A 4Q7NA 4DUXA 1DWHM 4PCSA 3WEZA 1J0YA 1UOKA 1GHRA 2XHYA 1XRVA 4BZYA 2PWHA 5EFDA 3B9AA 1FHDA 4YPJA 3TTOA 2J7HA 5CGMA 2JEPA 1G5AA 2WMKA 2O92A 1WDRA 2JE8A 1KFWA 4HA1A 2JF7A 1QI0A 3RDKA 2ZXQA 1RPKA 1K9EA 2V38A 5CJ5A 1FH8A 1WDPA 2CHNA 2J7EA 1K9TA 5DMYA 3ZIZA 3WIJA 2VTFA 4HU0A 3OZPA 1E6XM 4JAWA 5FL1A 3CIVA 4MTVA 1V08A 4H41A 1XD1A 2ZUMA 3VMPA 3DECA 2DT0A 1VB9A 3CZEA 5E70A 4MADA 1B3WA 2CPUA 1BGAA 8CGTA 5IFTA 2X09A 4HOXA 1TVPA 3WDIA 4UZSA 3BAIA 3NJ3A 5CZKA 3L4WA 3DHPA 3EDKA 5DFAA 3WDRA 4UFMA 3I3DA 4DWSC 4PMZA 4CD8A 2GK1A 1PZ3A 5BRQA 5A8MA 1JIBA 4B16A 1C7TA 1JZ8A 1CBGA 1EDGA 1V02E 3L4XA 2VR4A 2QF8A 1Q6GA 3ARSA 4TTGA 3ZSSA 6TAAA 1GUVA 4L4OA 3WF0A 1JD9A 1F4AA 2WANA 1C8QA 1CENA 2BVDA 4V27A 2YL8A 3M7SA 4H8UA 4NZCA 3SCOA 2J7GA 3QOMA 5A6LA 1EGZA 1VBRA 3PZGA 3ZT7A 3UCQA 3CHFA 1M7XA 5I78A 3ARPA 2C0HA 3NDYA 1ISXA 2XWEA 4P8XA 5ABFB 1E6ZA 1GW1A 5LA2A 2IXVA 1H49A 4UCFA 4ZFMA 4B3LA 1ZU8A 2NT0A 4HMEA 1H11A 3AI0A 4HA4A 2XVGA 1OBAA 4C7DA 1ZJBA 4U5IA 2DT2A 2WBGA 2D1ZA 3GBDA 4IISA 3VDCA 2WMHA 1NP0A 2WAGA 3N12A 4D6FA 3VD9A 1P6WA 2OSWA 2DSUA 1QNSA 4GPNA 4MNMA 1OT2A 2YLLA 2VZUA 2V3FA 4UQCA 3SCQA 1FA2A 4JIEA 3J7HA 2J78A 2X1IA 3VIFA 1GOWA 1HP4A 3W24A 4KMQA 2CKSA 4J3VA 4GINA 4JKKA 4U5KA 1JXKA 3LPOA 4MNLA 4H7VA 1KBKA 3WSUA 1E1FA 1WCGA 1MW2A 4MB3A 4TX8A 3FN9A 3IJ7A 1WB0A 4CCDA 4Z2IA 3W6LA 2YJQA 3OIHA 1C91A 2XFYA 3BAKA 3MSGA 2PWGA 2WB5A 1UHVA 3UESA 1US2A 2A3AA 1HKMA 1GQLA 4UTFA 1KR0A 2EO7A 4AZCB 1CNVA 3RCNA 1HIZA 4KRTA 5IFPA 3IJ9A 5CGTA 4AEEA 1BFNA 3K1DA 1WZMA 2EQDA 2VRKA 4HZ7A 1V3JA 3D5HA 3ZSTA 1NWRA 3RMEA 4ML4A 1EQPA 1W3KA 3GNPA 2XSAA 4D1IA 1ZL1A 2VT0A 2E9BA 1QNOA 3VIPA 3GZAA 1OD0A 2J74A 4BCEA 1CECA 1KB3A 3L4ZA 1OSEA 2VUYA 2QV4A 3GH5A 4UFLA 1E3XA 4FMVA 2W67A 5BXSA 3BAYA 3VPLA 3WMBA 3W6MA 5HDRA 1BTCA 3AXIA 4LGXA 1IT0A 5TD4A 3T0AA 1X6NA 1KGWA 2VZSA 5CSUA 2WWDA 1HJQA 5LYRA 1JNDA 4A3YA 1M01A 1JI1A 1XYFA 1KCKA 1HF6A 4JFUA 4S3KA 1JYWA 1MW0A 1W3LA 1J11A 1RP9A 2ZICA 3KE0A 1UR0A 3W29A 4EKJA 3UG3A 4AD1A 5FCZA 1XCWA 1E5JA 3BAJA 2YBTA 2CITA 3QOKA 1C7SA 1H3GA 2V3GA 3N11A 2PBGA 4BS0A 1UA3A 3AMDA 2D0FA 3CZGA 4GIAA 2A3BA 3VM5A 3EMZA 1V3HA 2XM2A 3MSDA 3WQ5A 2WNWA 3PZMA 3WUGA 3EBVA 2ZOXA 2VO5A 4W88A 3VNZA 1OGSA 3WH9A 2A3CA 5A6JA 1JG9A 5GPRA 1QW9A 2VX5A 4Z2KA 4WIWA 2VZOA 5GNZA 3L2MA 1OD8A 2Z1SA 4GZIA 1H41A 3VIMA 4YHGA 4AD5A 1JZ7A 5JBEA 1C3FA 2ZXAA 3K8LA 1FHLA 2WPGA 1XSKA 1OGGA 2OYKA 5E09A 4WJXA 4FLRA 2EJ1A 1QNRA 2XVKA 3A47A 3PZVA 2WM0A 1HKKA 3PZQA 2J7CA 1HJSA 1GOIA 3U5UA 1EOMA 1BVZA 1J0HA 4JKLA 2WZHA 4RL3A 3MV01 1DWAM 3WL0A 4GZEA 1LWJA 2ZUVA 1V0LA 2FDMA 2J79A 5LA1A 3DYOA 3ARTA 3AMCA 1GVIA 1XD0A 3RPMA 5IXEA 3OZOA 1J0KA 2DIJA 3G6MA 2DSKA 4JHOA 1LQ0A 3L4UA 3N17A 3T2QA 2XVPA 2ZUUA 4OUEA 1RD6A 4D6CA 3ZR6A 4CU6A 4ZENA 2AOSA 2QMJA 3WF3A 1QBAA 4CU8A 3FY1A 1CLXA 3CHEA 1FOBA 4X0NA 4LPCA 1EDQA 3WUBA 2QMKA 4E8DA 1CDGA 1R86A 1AMYA 1OT1A 1HJXA 3PZNA 4AY1A 1DP0A 5D9PA 2ZIDA 2FHBA 1B9ZA 3F5LA 3OLIA 2NSXA 1UD3A 4V2XA 4PMYA 1KXQA 4QFUA 3CZKA 4UZUA 4JFWA 4L4PA 4N42A 3PTMA 5ABEA 3QHNA 2DGAA 1IZJA 1UD4A 3NDZA 4P8UA 3E1F1 4W84A 1XC6A 3NCOA 1QI3A 3OBAA 4JFSA 1BQCA 1ISZA 2ZX7A 3WQWA 1SMDA 3AS1A 1CXFA 2WHJA 5D8ZA 1E71M 2PF0A 1K6AA 4M24A 2WHMA 4LYRA 1JDAA 2J8GA 4NRRA 3AS3A 3AIQA 1UWSA 1V02A 1GQJA 1UD2A 3U7BA 3WH8A 1ZB5A 5A3HA 1DWIM 3ECQA 3BLKA 4LQ1A 3PZTA 3DC0A 4RE4A 4K68A 4AISA 3I3EA 5DO8A 5E9AA 4WK9A 1CGTA 3A4WA 1UD6A 3WH5A 3MV11 4PTVA 3O2LA 1MXGA 5CXPA 1MFVA 1KCLA 5BCAA 4KGJA 1W9XA 2YA1A 2CETA 1E9LA 4OOZA 1WKYA 4AD2A 4DM2A 4DM1A 3SCVA 3APGA 2Q8XA 2DDXA 4P7LA 2J4GA 1U33A 4DUVA 4H8VA 4UQBA 3OA5A 1FP9A 1CGUA 2BHYA 4ATDA 2GDVA 3CPUA 4HOZA 5A69A 3W0KA 1BHGA 2GVYA 4PRWA 1CGYA 1TA3B 4HU8A 3UEQA 1QHZA 2EPKX 2BY2A 3ZJKA 4AMCA 1X1NA 3AYSA 3WUEA 3CTTA 2DQXA 3VU2A 2WLZA 1E15A 1V3KA 3VM7A 1E4NA 2E9MA 1SYTA 5M17A 1EO7A 4U2ZA 1PX4A 2VR5A 2WK2A 3SCWA 2JFEX 3NSNA 3CH9A 5ABGA 1JGIA 1BG9A 5HXMA 4WKHA 3WEMA 1UH4A 3BC9A 1B30A 3AIUA 5BRPA 4BQ5A 4Q22A 3VNYA 3WF2A 5A95A 4U3AA 5I3DA 3PZ9A 2D23A 2ZX6A 3RM9A 4HMCA 3WMCA 1CWYA 4PMNA 1DTUA 4XX6A 1JFHA 3GXFA 2VVSA 2XFFA 3SEPA 1MQQA 2C7FA 4PMQA 1B1YA 1KXHA 4M29A 5ABHA 1C90A 4J28A 1JYNA 1ISVA 5DT5A 1Q6CA 3WD2A 4JL2A 4IPLA 1QNPA 1VF8A 1Q6FA 5IHSA 1R7AA 5AY7A 4D6EA 2XVLA 1ODUA 4WF7A 3UR8A 2O9TA 2CBJA 2EPNA 2X0HA 1KXVA 2O9OA 1ZS2A 2YDSA 4RE3A 3GBEA 1OWQA 4CN6A 4GKLA 2BHZA 4J3TA 3CZ8A 1XYZA 1E1EA 2VVNA 5LA0A 5CG0A 4W93A 3ARWA 1IZKA 1V03A 1PBGA 5A1AA 1GJWA 2XGIA 3W26A 1B3XA 1GPFA 4AW7A 1E0WA 1E0VA 4C7FA 4PSRA 1V6VA 3A4XA 1KWGA 1CXHA 3L4VA 2JF6A 1HKIA 3SURA 4UOZA 1E4MM 1J01A 1LL7A 2D2OA 4MJ4A 4TUFA 4F66A 2PI6A 4KWUA 1GQKA 2EBNA 2UY3A 4MB5A 2XJ7A 3GH4A 3KZSA 1YQ2A 3GM8A 5JIPA 1QNQA 1HJVA 2AAAA 4DWSA 3SUVA 2DPEA 4S3JA 5FKYA 1ZBKA 4TVUA 4AD4A 3OGRA 1B3YA 1JXJA 2CCRA 2J75A 4UFJA 4P8WA 3FNDA 3CGTA 2CEQA 1VFMA 3B9DA 1B3VA 1EO5A 4ATWA 3SUTA 4A3HA 1E55A 2ZUSA 2E3ZA 1JI2A 3L4TA 4B3KA 2WC3A 2WKGA 2MANA 4W8BA 2VCCA 3SIMA 3WENA 4TX6A 2CERA 4W7VA 2VURA 3CO4A 2BVTA 1O6IA 3ARQA 3CMGA 5A8NA 3O9NA 1JYVA 4CVWA 3IANA 3K4AA 4DWSD 1BGGA 2DH2A 1KXTA 1E56A 1CGXA 2V3EA 5CPQA 3S6TA 2WZEA 5JBDA 1ISWA 1FFRA 1US3A 3CUFA 5E0CA 3BCFA 2VMFA 3TOPA 2CNCA 1MQRA 3CHCA 3SCTA 3ALGA 1I75A 2W61A 3VIHA 4FK9A 3RO8A 3THCA 1JZ4A 1UKOA 1W1TA 2ZWZA 1UKSA 1QI2A 3WNNA 2GUYA 8A3HA 5KEZA 1W91A 5EB8A 2W63A 2WBKA 1ECEA 3DHUA 3WFLA 3WNOA 2A3HA 4P7OA 3VINA 2G3NA 3VD4A 3A3HA 2CXGA 3ARVA 1A47A 3W53A 2VZVA 3PN8A 1IV8A 1E6NA 5DF0A 1QHOA 5A8QA 1QPKA 3TA9A 1B0IA 3AS0A 2ZE0A 3VUPA 3TTYA 1CXLA 2XM1A 2WWCA 2VRQA 1BYDA 1DWJM 5CLTA 1LL6A 1JZ2A 1AQHA 1XSIA 4B9ZA 3BLPX 3ZMRA 2W92A 3ZJ8A 2CYGA 6A3HA 1PJ9A 4ZEPA 2YL9A 3CMJA 4N0RA 4W5UA 5A2BA 1H5VA 3WUFA 1WDSA 4HMDA 1CXKA 1EA9C 3F4VA 4AZ7A 3B9EA 2YOCA 5I24A 4GXPA 3W37A 3AJ7A 1W2PA 3GYCA 2XSBA 3TTSA 2GK1B 3A4AA 3WMSA 4M82A 2YA0A 5C70A 4H8HA 4UFIA 4FF5A 1JF6A 4OOUA 2XVNA 4GQRA 2J77A 1UG6A 5A94A 1DWGM 1DWFM 2UWFA 3QGVA 3PBGA 5BROA 7TAAA 2DH3A 1J12A 4M80A 1UWUA 4PTWA 1E3ZA 2XPKA 4MAVA 3NSMA 1G0CA 2WMIB 2XG9A 4WKFA 1UWQA 1MVYA 3BCDA 3CUGA 2X05A 4JCLA 3SCUA 3TP4A 1J0ZA 2J62A 4M1RA 3BMWA 1KGUA 3IAPA 2Y2WA 2WC4A 1NWTA 2BNJA 5DT7A 1JF5A 1AVAA 3AXXA 4F9DA 3OG2A 2VCBA 2WYSA 2WW5A 3NYDA 1UR9A 4GO8A 1MQPA 4CCCA 1SR0A 2YLAA 4W89A 3T0BA 7CGTA 3AROA 4QP0A 5ABFA 1V3MA 3RIKA 1JFXA 4PYSA 3GXDA 4KH2A 3M46A 3GH7A 4GZJA 4NRSA 2WVVB 4UQEA 2WLYA 1EXPA 3SCSA 3PHAA 1CGVA 2E40A 1J18A 4MB4A 3AMKA 4P8VA 6CGTA 3GTNA 1WO2A 2WVSA 4HP5A 1TR1A 3PZOA 1ESWA 5BXTA 1W1PA 4AIUA 4QDMA 1K9FA 3F5KA 4R5EA 1BLIA 1E4IA 2YDQA 2G3IA 2WCAA 3UETA 3WNMA 2BY1A 1R7OA 2W66A 5A6BD 1GHSA 1ZJAA 2B31A 3KL0A 3N9KA 3VGGA 2XIBA 3II1A 4UQDA 3W38A 5D8WA 3WDHA 3WQVA 3CHDA 2VCAA 2X2YA 2VX6A 3VOCA 1HL8A 3BSHA 2WHKA 1CXEA 3EDFA 1HKJA 3BXWA 3W25A 2D24A 4ACZA 5C8BB 1JZ6A 1G1YA 2W5FA 4J3UA 4MDPA 5A2AA 4QLKA 4W8AA 5CPTA 4H2CA 2GDUA 2E8ZA 3MUZ1 2G4FA 1JL8A 4PUEA 5A6SA 1C8YA 1MFUA 3SUSA 1ODZA 1Q4NX 5EBAA 1EQCA 4QLJA 5A2CA 1HN1A 1TG7A 2OWXA 3MUAA 2NT1A 5EFFA 3AYRA 2XGBA 3MO4A 1B2YA 3BSGA 3WN6A 1TFVA 1CEOA 1E70M 1PIFA 3CBWA 7A3HA 3CUHA 1H09A 2WSPA 1V0MA 5A6BA 1VIWA 4HOWA 2J25A 2Y8KA 3VD3A 1R8LA 2CHOA 1FP8A 2TAAA 5BXRA 3THDA 2D0HA 3G6LA 2WVUA 4ZXOA 1LWHA 3GNRA 5A6KA 1MXDA 1UWIA 2FGLA 2GFTA 4QAWA 1MYRA 1TMQA 2D22A 5E0FA 2XWDA 3N1AA 4J27A 1KR1A 1HVQA 3AIRA 3FXYA 1VRXA 2WMJA 1UUQA 5BWFA 1CTNA 4D6IA 5BXPA 1EH9A 1NOFA 1PX3A 4WSJA 3UERA 4AIOA 5M5DA 4PUDA 4BQ2A 3AIVA 4GI9A 5M3WA 5I77A 1BG4A 3AHVA 3VX1A 1W3JA 3QHMA 4MPKA 3RM8A 1UKTA 1GOKA 4WSKA 3IJ8A 3AIBA 1PEZA 1UR4A 4JCMA 2FHFA 4GI8A 4EAMA 4FLQA 4AXNA 3ZT6A 3EDDA 4XUYA 4Y7EA 2OLHA 3KL3A 3EMCA 2WSKA 1XGZA 1M03A 2YIHA 3VGBA 1W1YA 4Z2HA 5FL0A 5BYWA 1R85A 4W85A 4W86A 3VGEA 1Y7VA 3TTQA 1ITXA 3WD3A 3AICA 5FOOA 3ARRA 1OB0A 4OIFA 4E8CA 1FH9A 2DT1A 4URIA 4MNKA 1HVXA 1QHPA 1U2YA 3FHAA 1ZBVA 2NW0A 4ZE5A 1NP2A 2QHAA 3WNPA 3ZJ7A 1L0PA 1UQZA 3W28A 5CQ1A 3N13A 3SUUA 1H4PA 3B8SA 2WKLA 4KGLA 2F61A 3BGAA 3LMYA 1W9PA 4PCTA 4PTXA 5D9MA 2VRJA 1VFUA 4BF7A 3KEHA 4PEEA 2D3NA 3RJYA 4AYSA 3ZM8A 4D6GA 3AMLA 1PX8A 1NARA 4M81A 3MUY1 4U3CA 3WBAA 5ECUA 2GJXB 3KWXA 1V0NA 1VJZA 4UQAA 1JZ3A 1F4HA 2WMFA 1E40A 1KGXA 4EK7A 2OWWA 1W9VA 5M03A 1E6QM 1NM9A 1H1NA 4DUWA 3UR7A 3ARZA 1UZ1A 1W1VA 3VIJA 4W8LA 2DSVA 1NOUA
chains in the Genus database with same CATH superfamily
1G94A 1AMKA 2IPGA 3T05A 4BWLC 3LLDA 1FDJA 4TW7A 4BJHA 1UD5A 3N25A 3R11A 3W4RA 1IEWA 1ZJHA 1O68A 4EANA 2J7FA 1JCHB 5A8OA 3ITVA 3ZT5A 1M04A 4HCLA 5EMYA 2Z4GA 3TFXA 1W9UA 2JQXA 2WSRA 4AZGA 3N15A 1F3XA 2N87A 2GQ9A 3AIEA 3WEOA 1OG0A 4R7JA 3WMLA 1PL9A 3HG4A 3SN0A 1CPUA 3KBNA 1OFBA 4MJ2A 4LAYA 1GPWA 4KFOA 4JX6A 3RX3A 4JYEA 3W7GA 4GIRA 1RH9A 3BG5A 4FB7A 3VKKA 4PTNA 1T96A 2QCGA 2VKZG 3CGMA 5TF0A 1D8WA 3RFWA 3WQOA 2F23A 5LNUA 3XINA 2YZ5A 3IJQA 1TPH1 2MNTA 4U33A 4ZOAA 1P0DA 2D20A 2DU2A 1CIUA 2G4JA 3AOFA 4GUFA 2ZX5A 1XIDA 5CC7A 3UZXA 1Q8AA 2YYTA 3NZQA 4KF1A 1UW9A 3TONA 3VYLA 2NXHA 5I2UA 2YCLA 4MFDA 4NI3A 3WQGA 3TSDA 1MEWA 5I79A 1BVNP 4A21A 3WH6A 2ICSA 5AZ1A 1M7OA 4EWND 1UR8A 3A9BA 1FKTA 1HNYA 1T41A 1QVBA 3K8MA 3QC3A 3TWAA 2OZ8A 5HPOA 2ISSA 1UB3A 2NQ5A 2Y1HA 4E4PA 1E6RA 2G3FA 1L6YA 3RFAA 2IUZA 1V7AA 4AD3A 4XKYB 3QR0A 1YATA 4O0KA 4US6A 1RQBA 4F9JA 4DAFA 4PMXA 4IMFA 4Y9OA 4FF7A 1WZAA 3F2BA 3BGJA 5DELA 1KT0A 1OG6A 3Q58A 1P0KA 5JH8A 1DEDA 1FDZA 3IK4A 4OT7A 1BXCA 3LU2A 4LF2A 2YXXA 1GONA 1FWEC 2BHUA 3U4FA 2AGKA 1RVGA 1U30A 5GNYA 1B9BA 3KL5A 2OYMA 2JALA 1KWKA 4IGHA 4LBSA 5AC5A 1EC8A 2ZR6A 3W3OA 1UWTA 4A8LA 1UQYA 1VBJA 1KM2A 2XP4A 1HO1A 3BLIA 3I7QA 2JIWA 3W87A 1AA1B 2DG9A 2QLYA 4JTEA 4ZQOA 1ITUA 5D2WA 3WDPP 4RPPA 3WG6A 1XDMA 1IT8A 2BOEX 1OFOA 3URAA 1LJYA 3FA5A 1GOMA 3GXIA 2JK2A 2HVMA 2ZX9A 1K1DA 4K7VA 3N6HA 1K9DA 5IHRA 4GCXA 1LLWA 2O0TA 1CXIA 1HKWA 4CUCA 3K46A 4WDTA 1OX4A 3CPGA 2PDUA 2QCNA 3S47A 1V8EA 3LA4A 1B31A 4FLSA 3QW3A 3LPFA 1JDDA 2FTYA 4HN8A 4IG2A 3KTCA 2YCLB 4WLCA 1A50A 2DUZA 5DMNA 3OVRA 2PZ0A 4NKCA 2PEVA 5LGZA 1XLKA 1PBKA 2XH2A 3KFTA 4U31A 1IR1A 2X0YA 2YA2A 3E02A 4NILA 4ZZ9A 4NSBA 1VJSA 3TYAA 2I5QA 2VX7A 4LYPA 3AMGA 2B4GA 2ZA1A 4KRZA 3TR9A 2FGZA 5I3IA 4KERA 4UTKA 2UZ9A 5AYBA 4TR9A 1HX0A 4RZBA 2E25A 1PIIA 4GUHA 3VNJA 1LBFA 1BYCA 2FIQA 4CU7A 1RXOB 4RNJA 2XZ9A 2FQIA 1Z32X 5HNNA 3NO3A 3BG9A 3AZTA 3T4WA 3EWZA 3AZSA 3C0JA 1MWOA 3OW1A 1VFOA 4R7OA 1XH2A 3OBEA 4JY8A 3GAYA 2RH9A 3OTRA 1OINA 3NURA 4W9OA 3AISA 4LCRA 3MKKA 4CNPA 1VC4A 4Q4OA 1UH3A 3TN3A 3VGHA 3KAIA 2AMGA 3WD0A 1Z89A 2R94A 2WOQA 1W32A 2F7FA 3SRFA 4H9TA 2B0MA 1V3IA 4JFLA 4PTMA 3GSMA 2CLHA 3A5FA 3HGRA 1H0IA 3AHYA 4L1XA 2A6LA 5K9DA 4AZCA 1G9HA 1XSJA 4GNKB 3B40A 4HT3A 3U5YA 4QTGA 4OV9A 3VNMA 1YDNA 4C1KA 2ZX8A 2GL5A 5A8PA 3EX6A 4JD4A 2JEQA 1D2KA 2ZTKA 3GVVA 3WH7A 1ISYA 3R8HA 3RJXA 5C2CA 1RQHA 4NJKA 1JQVA 4LXFA 3AZRA 1LBLA 1HP5A 4H19A 1KBBA 1C92A 5I0DA 3CQHA 3L0KA 2I7GA 2HXTA 4D72A 3QZ6A 4MDOA 3I4EA 3RX4A 3I10A 3MKVA 2BLEA 4QCEA 3RU6A 3VK5A 3N04A 4JYSA 4UR9A 5D4YA 1VEPA 4F2TA 2Y0FA 3T09A 4F2BA 3ZOAA 2V9DA 4S23A 1PWLA 3W1MA 4MY8A 4N9EA 2WVVA 3PB0A 4AIEA 4JHZA 1Q4WA 1JDCA 4AUBA 1QPFA 4C5ZA 4CGTA 4P7NA 5KZ6A 2VN1A 4DUOA 5BXJA 4HPGA 3TK7A 4KWOA 2FH6A 3GXTA 3CYVA 2P3EA 3L2LA 1O1ZA 1S5NA 5HTGA 1W9DM 5CSYA 1Y8BA 4DN1A 4Z2LA 3THQA 1RK6A 4JY9A 1E5NA 2ZXDA 2PDNA 1LF1A 2B7PA 2ETNA 4PMDA 4DRSA 3ATYA 4O54A 1E6SM 3OEXA 2A7RA 2WZIA 4NYUA 3V35A 5BW6A 3B7XA 3D3AA 4C6IA 3K4DA 1BWLA 4R88A 2IW0A 2J9XA 4NNAA 2INEA 4N7QA 1WPCA 2VZTA 1G6CA 3I7SA 2PE4A 4LYQA 2YL6A 4O53A 4B9YA 1P7TB 4ZODA 5EMMA 2G3MA 1SZGA 3MP3A 3H7RA 3UVAA 4X60A 4UFHA 2G95A 2ZR4A 3T2PA 2MF9A 1B4KA 1AZ2A 1JNSA 5F2LA 1EDTA 3G8EA 1XG4A 2Y5EA 1N8FA 1UUOA 4JTRA 4PMUA 3PK7A 1AQFA 5J5DA 3VDHA 1M41A 2QUUA 3NL3A 2OQLA 4CLMA 4S39A 2QDEA 2ZQUA 9CGTA 2ZADA 2Y7EA 3RILA 4HTBA 1WE5A 2HS6A 3L68A 1GCYA 1DHKA 3C5QA 5HULA 3P14A 4JN8A 3QGKC 4DPPA 4KR0B 1UKQA 2I16A 3BK0A 2PWFA 4F8XA 2XIIA 4B15A 6REQB 2OODA 2QXWA 3WQCA 3SN1A 1O7AA 4YN5A 4H1ZA 4A3UA 4CD7A 3S2MA 3UP8A 3W1NA 3ITTA 1RV8A 1I1WA 2GVGA 5K9CA 1W3HA 5DANA 4V28A 5HOSA 1FWNA 4NXSA 5CPLA 1D7FA 2DSZA 3HMCA 3R58A 5CLWA 2B7OA 2C8NA 2KE0A 3MCNA 2EPLX 2VC9A 3SUWA 4A4AA 3OLGA 1N82A 2OVLA 3CB3A 4PCSA 3V5FA 4DO5A 1UOKA 3GZ3A 2Z6JA 5EFDA 4WSHA 4YPJA 2J7HA 1IIHA 1H7WA 2JEPA 3PY2A 3U8GA 4NZFA 1Z44A 2O92A 1WDRA 1KFWA 4HA1A 2JF7A 2PLMA 4LOCA 3ES7A 1EFZA 2ZXQA 1RPKA 1M5WA 2CHNA 4MJMA 4IGSA 3DESA 5DMYA 3ZIZA 2VTFA 3CMFA 4ORMA 3RNDA 1E6XM 5L9FA 1FWRA 5FL1A 3KAFA 4MTVA 1V08A 1RK5A 1EP2A 3MVIA 3MP5A 1G67A 1YPFA 3DBPA 3OG3A 4DZ2A 3W7MA 4IMCA 2DT0A 1VB9A 3R79A 1DE5A 2ZR5A 3DFQA 1YTEA 8CGTA 3E2RA 1W5NA 1EYWA 4XG1A 3BAIA 5CZKA 3CH0A 5LNWA 1QAPA 3DHPA 4L72B 3EDKA 4GCAA 4PMZA 3KBSA 4ML9A 4CD8A 1IQ8A 5CBJA 2POZA 4UB9A 3DFPA 4GWEA 3TZFA 2ON3A 1CBGA 3IHZA 3MA8A 2VC6A 1Z8AA 2QF8A 1Q6GA 3ARSA 3W7RA 2ZBTA 1RPXA 4R53A 4EOUA 3WF0A 1JD9A 2WANA 3RCYA 2PPPA 3WCZA 4C6KA 4NG3A 4H8UA 3SCOA 1VBRA 4O18A 3ZT7A 3OU8A 3UCQA 3ARPA 1TKKA 4ASTA 1E6ZA 1GW1A 3KRBA 2DZWA 2IXVA 3GY1A 4GMEA 1ZU8A 1DJQA 4HMEA 4UUIA 5TNVA 1ME7A 2ZE3A 1EJSC 5BOEA 1ZJBA 3AAMA 3PTDA 3TC3A 3GBDA 4IISA 2FLIA 4PMJA 2YFOA 3W74A 1ALDA 1B54A 2VZUA 3DUGA 1KLYA 3E9AA 1EP3A 3B8VA 1UZDA 1I2OA 2J78A 2OMAA 2X1IA 4LANA 4TO8A 4O28A 3G1YA 2BBFA 4KMQA 3HZ3A 2FMNA 3UZ5A 3DG6A 3KOYA 4GINA 3R5EA 2M1IA 3LPOA 1KBKA 2WNQA 4D8AA 2LPVA 1MW2A 4MB3A 4L3NA 4TX8A 2ZZ7A 4QDPA 4MYXA 3GFZA 2YJQA 5DXYA 1QWGA 3RLVA 3NYZA 5I3FA 2WB5A 3NFUA 3W1UA 2VD9A 1FKRA 1CLKA 1HKMA 3SSZA 4UTFA 5HW7A 3RCNA 1D7HA 3CPRA 3KM8A 4J3ZA 4WR3A 2EG6A 1V3JA 3D5HA 3ZSTA 1NWRA 2MUCA 2PPGA 3B9OA 4LT9A 4FPSA 2XPAA 1VGAA 1FXPA 2VT0A 3MQTA 2E9BA 4Z1BA 4BCEA 1A5NC 1OSEA 3NQEA 2QV4A 1OC7A 2X42A 4JTUA 1Y5XA 4BI5A 2ZZ2A 4UTJA 5BXSA 3BAYA 3W85A 4JIPA 1EIXA 1F8IA 3HG5A 5HDRA 4LAKA 3AXIA 3NTPA 1ZSXA 1KTNA 2VGGA 1W31A 5TD4A 1BEUA 2Y85A 5AOUA 2OO6A 2VZSA 1HJQA 3W2UA 5LYRA 4A3YA 3N2OA 5F1UA 4IQEA 4G7EA 2NQZA 3RLGA 1JYWA 1MW0A 1A5CA 1W3LA 1KD0A 1RP9A 3TC7A 3MDWA 4DH0A 1ZNNA 1GW9A 2NQ9A 1F61A 4XVEA 3QOKA 2V3GA 1W3NA 2V8ZA 2HE8A 1CB7B 1XLJA 4Z42C 2D0FA 4MUZA 3T07A 5ENLA 4GIAA 1KO0A 3GD6A 3VM5A 3MSDA 4YTRA 5G4HC 2P8BA 4NJGA 1SZRA 1N8IA 4Z1AA 2C14A 5GPRA 5BWAA 4IQJA 3P7YA 4Z2KA 4Q4QA 5DCDA 1H41A 2PDJA 3VIMA 3G5EA 2E77A 4NYYA 2Z2UA 1K8ZA 3QW4B 3K8LA 3QSTA 1XSKA 2PFHA 1OGGA 4ICMA 1VHNA 3CJPA 4FNTA 1AZ1A 2ZRWA 3N9SA 2PURA 4WXZA 1QNRA 3KADA 4M1BA 2XVKA 3NPUA 3A47A 1VFSA 3GIQA 1UPMB 2VFIA 1ZTVA 3NQAA 4HKPA 1HJSA 3DHFA 3MW7A 5H6HA 1AW2A 3D3FA 1DWAM 3D0CA 9XIAA 4MWAC 1Q7ZA 2FDMA 5C9ZA 1ZQ5A 5LA1A 2EKGA 2WNZA 3DYOA 1GVIA 2GPTA 3F1QA 1OFQA 3DHDA 3O5MA 1C9WA 2TODA 5LHFA 1DIEA 3V0UA 2XPBA 3T2QA 2R6OA 1Q63A 2HVNA 4OUEA 4HU4A 4OBTA 1EA0A 2YGYA 3LENA 4U10A 1S2WA 3WF3A 2VUNA 4IIGA 3JS3A 4QEEA 2PGEA 3H2EA 3M5YA 3ZVHB 3WUBA 3L67A 3SFKA 1QPNA 3SGGA 2Y8UA 1HJXA 4EPKA 5IRPA 3PZNA 1WUFA 5AHEA 4O13A 2ZIDA 1YPIA 1B9ZA 3F5LA 1UD3A 2RAGA 5FF3A 1XBVA 3CZKA 3CAWA 3QHNA 4P8UA 7ENLA 4MG4A 3V5OA 4W84A 4JFSA 4QITA 5K3VA 4NNBA 3TFCA 4JQ3A 5H8UA 5DX7A 2IKGA 4LYRA 4GNVA 4XAGA 1I2PA 3UXKA 2H90A 1VCVA 3DXIA 5DMMA 1H5YA 4EF8A 3WH8A 1ZB5A 1YE6A 2OX1A 4MIMA 4XBSA 5TAOA 3BLKA 2P8CA 4O0QA 3I3EA 5EU9A 1SJBA 4WK9A 3O6CA 3LY0A 3GQYA 1W56A 4Q6XA 4PR4A 3TXZA 4TV5A 1RLCL 3IUHA 5BCAA 2CETA 3NPVA 4I7UA 4OOZA 1AL8A 4DM1A 3SCVA 3APGA 2Q8XA 3GRIA 4ZGYA 2PPNA 3HPXA 2J4GA 4L9XA 4XZIA 1JRCA 4K39A 1R3YA 4H8VA 4YLWA 3STPA 3B8DA 1CGUA 4M6UA 4QS5A 2GDVA 2PDBA 4YXGA 3CPUA 5U4NA 2EAWA 4PRWA 1TA3B 2EPKX 4R9XA 3ZJKA 4BI7A 2Z26A 1XLGA 3KOXA 3TV8A 3TMQA 2BOFX 1V3KA 1LT7A 1Q6QA 2OQHA 2OEJA 4K6AA 4Q8TA 5IOBA 3SN4A 4O2TA 5LIXX 2KZHA 4QJ4B 1PDYA 3AALA 4AU0A 2PDIA 3KABA 3OQ8A 3QFWA 3SCWA 5JH2A 2JFEX 3ABRA 2YXGA 1KTCA 4TIMA 4AHQA 3KXQA 3LUOA 4F0SA 2HE5A 3LBOA 5HA7A 1BTMA 1XINA 2Y5SA 3LI0A 4PH6A 3H9RB 3RX2A 1TVLA 5A95A 4U3AA 2XU2A 1L6WA 1D7IA 3EX2A 2D23A 3RM9A 3WMCA 1CWYA 3DC8A 3LRMA 3LI1A 3BVJA 1PO9A 3MHFA 3UQBA 2PD5A 4US5A 3QF0A 1ISVA 1ONEA 3WD2A 4A22A 3LCWA 4IPLA 1H7XA 5BRBA 1ODUA 4WF7A 4XAYA 2HVOA 3CASA 1LRNA 2EPNA 2X0HA 3D46A 1KXVA 2O9OA 1ZS2A 3FDKA 1XRTA 3GBEA 3UPBA 3W7LA 3S2JA 4J3TA 3CZ8A 1T7LA 3TVAA 1XBYA 1PYMA 2VEIA 3B97A 3NRKA 3BO9A 3KVKA 2GLKA 3G3MA 3F7JA 3WK2A 1X1ZA 1IZKA 2QJJA 3S8HA 3E2VA 4DF1A 2XGIA 1VPYA 4HNUA 1JPDX 1S5MA 1EX5A 3VA8A 1E0VA 1DXEA 2JKPA 4MLRA 4WOZA 2BSLA 3UU0A 4DRKA 1OC6A 4S3AA 4UOZA 1J01A 1LL7A 3PRAA 5BU9A 4IMAA 4C1LA 3JRKA 4GYFA 2ONEA 3UNTA 3GUGA 4G8TA 5DXXA 1HJVA 3O6DA 3W2NA 6REQA 1NFGA 3DEQA 2Y70A 1BXNA 1ZBKA 2XP9A 4NNRA 4ZB5A 1IE7C 4GG9A 3TCEA 5G1TA 4RKAA 1WQ5A 3S6OA 4WY0F 3CGTA 3B9DA 4AWUA 1VYRA 4DRIA 3BURA 4A3HA 5AN7A 2ZUSA 4FO4A 1XLCA 1JI2A 2WKGA 3ZLHA 4OQVA 4W8BA 2Z6IA 3QY6A 2CXEA 3W71A 1BKFA 3O9NA 4IIFA 4DRMA 1HXVA 2Z1XA 4RW3A 3K4AA 4DWSD 3G1XA 4OVXA 2YCIX 4GE8A 1CGXA 4HSHA 5CPQA 1FFRA 4DROA 1US3A 4KWWA 2ZTJA 3GG1A 5GJMA 2PLKA 3ABSA 3BCFA 2VMFA 4IQDA 1GK8A 4NUWA 3TOPA 2CNCA 1TCOC 3QY7A 5G2HA 3T40A 3VDGA 4AH7A 3FGCB 3RO8A 4KFPA 3PANA 1QXLA 2QUNA 4GY0A 3B3DA 2F38A 3R1ZA 4AVFA 1R2TA 2ZVIA 2WBKA 1ECEA 1I9CB 3WFLA 4S3BA 3V75A 5H8MA 4XO7A 2G3NA 4QEHA 2CXGA 2VZVA 3PN8A 1G7VA 2V69A 2HK0A 3HQ1A 4Z1DA 4ZS6A 3WX7A 1B0IA 1Q5MA 3Q94A 2XM1A 3H24A 4GVGA 2WWCA 4JX4A 2VRQA 2ISWA 3VAWA 1EJUC 4HNTA 1LL6A 1JZ2A 1OCNA 3SB0A 3ZS4A 3M47A 3FJLA 4IG2B 1V93A 5LXEA 3SI9A 3BLPX 3ZMRA 2JGQA 3ZJ8A 4QQ3A 1A7XA 2CYGA 2H8XA 4V15A 1PJ9A 3CMJA 1W54A 3W9ZA 3IIPA 1IGSA 4Y6GA 1EA9C 2C16A 3B9EA 1L6GA 4GXPA 5D04C 3GYCA 2XSBA 4I9TA 2GK1B 3WMSA 3LN3A 4FF5A 4JDYA 3RPDA 5AYXA 3HF3A 3PNZA 1UG6A 4GYJA 3PBGA 1MI3A 1XW8A 2WNNA 4YTSA 7TAAA 2DH3A 2W0UA 1FD9A 4O1BA 4JQAA 1ELSA 2VP8A 3CQJA 3QYSA 2WMIB 4R0XA 2IF4A 2QJGA 4ODOA 4MPQA 3WBXA 3LXCA 1J0ZA 5FA5A 1U79A 2J62A 3BG3A 5FJTA 4TX0A 2BNJA 5U7SA 5DT7A 4EXAA 4HIBA 4PB4A 3AXXA 3OG2A 3R6IA 2VCBA 4L61A 2WYSA 4GO8A 4R34A 4N4QA 4H83A 1DIOA 4ZR8A 4W9PA 1HL2A 2HNHA 4KCWA 3LXBA 1V3MA 4IQ2A 4E0CA 2OKOA 4C91A 3R8GA 3M46A 5JVLA 2WVVB 2Y62A 3PHAA 2XP7A 2E40A 3GK0A 3P84A 1J18A 2AL2A 4EVZA 3HJZA 3ITLA 4IUOA 4ZBCA 3GTNA 3NQMA 1WO2A 1ONXA 5EYWA 3PZOA 1PE1A 1XF0A 2ZRZA 4FEZA 5BXTA 3HB9A 1FWAC 4K37A 4QDMA 2J88A 3AJXA 3BW2A 3EX3A 2WCAA 3P62A 3UETA 2EPHA 4YJ5A 4DYEA 4A8IA 1R7OA 4S3FA 1LOSA 1KCXA 3NO5A 4D9PA 4L4MA 7REQB 2ZA3A 3ABXA 4UQDA 3W38A 2QZRA 4Q8NA 4LAVA 2Q09A 2VCAA 2X2YA 3IIVA 4IPXA 3VOCA 5AHNA 3EZ4A 1HL8A 1FWHC 1CXEA 3M0VA 3B06A 3EDFA 3T44A 1JCLA 3W25A 3LNMA 1OFPA 3DG3A 3WFAA 4ZO8A 2HDJA 1J4HA 2PP0A 3BW3A 5C9RA 3JXVA 4MDPA 4RLIA 1F6KA 1NFPA 4U84A 1MUCA 2GDUA 2E8ZA 3DKJA 3FSTA 4PUEA 3NDOA 1C8YA 2DUAA 4LVDA 1AK5A 4CQBA 1Y0OA 2RDWA 1QMLA 4ZO9A 1FVPA 2NT1A 2O56A 3AYRA 3OO2A 4C6MA 1U83A 3GR4A 4DXKA 4WQ6A 4TW6A 1AUSL 4DJFA 3LG3A 3UJSA 2PLCA 3TMLA 1H09A 2WSPA 3NQ6A 1V0MA 2ZFAA 1VIWA 1TPB1 4GH3A 2J25A 1Q6LA 1FWWA 1L1PA 2CHOA 4ZQMA 1F9CA 2E7FA 4Q8WA 3VI2A 1LWHA 1HKVA 3PWIA 1TV7A 1UWIA 2GFTA 4DJEA 4O1FA 3M41A 3QMTA 2X1SA 3NOEA 3RHGA 5E0FA 1L6FA 3HPAA 5HJYA 4CCZA 3FIGA 1KR1A 3AIRA 1VRXA 1UUQA 4A2SA 2RUQA 3GC5A 3B8IA 2FVMA 4PB5A 3QFEA 2VGFA 4DBDA 1Y0EA 4GI9A 4AYGA 2M2AA 1OJXA 3H70A 1YW1A 2CLKA 3WJWA 4WHBA 1PB0A 1PEZA 3AIBA 2OZ3A 4EAMA 1D6OA 1TJ0A 5GJNA 2QAPA 2J24A 1FHUA 4J35A 3M43A 5D03A 3SAZA 1SZFA 3KP1A 1XFBA 3WLOA 5CBBA 3ME3A 4K38A 3GIPA 4IGMA 1F76A 4HPNA 4C6QA 2H3DA 1Y7VA 1ITXA 4Q4KA 1RQEA 1R3SA 4Q33A 4V1XA 1TWWA 4Y90A 2W27A 1OB0A 3WJZA 3FK4A 1Q1CA 3CTLA 2VM8A 2ISDA 4EACA 4RPQA 3CHVA 2NW0A 3QKZA 5G1YA 1NU5A 3ZJ7A 3E12A 1L0PA 3MZNA 1Z6KA 1S2AA 4RJEA 2PDQA 3MUXA 3ID7A 1YMYA 3MJYA 3GDMA 4X63A 5D9MA 2VRJA 3WK0A 1VFUA 4FSAA 4XUGA 3L21A 3TYZA 4Q4PA 1KW1A 3AMLA 1PX8A 3UBPC 3N2XA 2GJNA 4CNSA 3WBAA 2P5NA 1TV3A 1DQUA 1V0NA 1VJZA 4UQAA 4DZIA 3NR0A 1Q6HA 4WJEA 4QISA 2D69A 2WMFA 1M7PA 4AEOA 1E40A 1KGXA 3QGAC 4EK7A 3NTYA 1W9VA 3PBWA 2CFFA 1NM9A 3GG0A 4DUWA 3UR7A 4WX2A 3BL3A 5D2XA 2PP1A 1O5QA 4DNMA 1KRAC 1UBSA 3K8KA 3APYA 4IM4A 4N4PA 2NVDA 2I5IA 3PFRA 2D3LA 1YHTA 4JTHA 4GD0A 1GWJA 3A23A 1Q7QA 4LS0A 1JNTA 1GRJA 3VNIA 4J3SA 5LIKX 4BEUA 2ESCA 3L5LA 3VNLA 4MFEA 4C6JA 5AYYA 4GY7A 1JZ5A 1H51A 2FFIA 2XP3A 4JIQA 3TEVA 2RDUA 2G41A 1E4LA 5BMXA 1B3OA 4XSMA 2XTKA 4ZTYA 4IL0A 3SRKA 4JTSA 2QPSA 4DBEA 1S1RA 4HA0A 2W79A 5FJUA 1O94A 3EMQA 1KC7A 2HROA 3UQNA 3USZA 2TSYA 2QJNA 3NQFA 1W6TA 1YBQA 4TXEA 1Q6UA 1OM0A 4LEQA 1ZPTA 4Q8VA 3U2EA 3VGDA 1T8QA 3FYOA 5CSSA 5J8LA 3LGGA 3MJMA 3VIOA 3C0LA 4AZ6A 2WJDA 4M3PA 2OFJA 3IKGA 4AZIA 1GJUA 2FPVA 3H2AA 1FWJC 1U1HA 3WJXA 1RJPA 2RGLA 4DIAA 1PZ1A 2BVWA 3UQIA 3UR5A 4QROA 1BSIA 3HN3A 2WSQA 5F2GA 4QLLA 4DWSB 1XR2A 2ALRA 1REQA 2TPSA 1XLFA 4KEMA 2NQHA 4TVDA 3BOLA 4O4WA 4UTWC 5HMDA 3SCPA 2V67A 2NZLA 3RK8A 3V7PA 4DY1A 1Y5WA 4WDUA 3UZYA 1LG2A 1QO5A 1OGBA 1V6WA 1WDWA 1V3LA 3MANA 1T11A 2VX4A 1LG1A 3FSUA 4LAXA 1MXSA 1OIFA 3GDBA 3TE9A 4F79A 4YIWA 1GOOA 3AFBA 5DRIA 3T7VA 3VD5A 2PU0A 2G3JA 3M6DA 2OT1A 3WL1A 1BWVA 4EP8C 2YKKA 4KS0A 1ME8A 2GSEA 3KACA 1WBHA 4Z2JA 1VBUA 4FX7A 1NMWA 1BL4A 5AYIA 3GHUA 1PXGA 2CZVA 3PJWA 2PDKA 1R3WA 2NUXA 3DYPA 4WD0A 1FCVA 4JICA 4D6JA 2ZUTA 3UW6A 2Y78A 4J3XA 1XYAA 4ONVA 3M9YA 4QDWA 4UOQA 1BYBA 1VENA 2P0IA 2E28A 3PUDA 1IEXA 4D6DA 5DCBA 4HZ6A 3H2OA 5KSWA 3AIWA 4J1OA 4I5XA 3Q4DA 1DV7A 4AHOA 4Q7BA 3ALFA 3B8WA 2DEPA 2OWCA 3Q65A 3H54A 3B04A 4DF2A 1GNXA 3TZNA 4EXBA 3HQOA 3BJSA 3WLQA 3M0KA 2HBXA 4O52A 3W75A 4W87A 3KLKA 3QEZA 2XGZA 3S4TA 4NX5A 5DY2A 1KFCA 2I9EA 1ADDA 1K02A 1ADOA 1AG1O 4AVNA 3C6CA 5C7HA 4W7UA 2NVAA 1OYAA 4R27A 1O60A 1YNQA 2VGIA 1TZ7A 3MMTA 3GVWA 1ZENA 1Q6EA 3O6AA 3UZZA 3WD1A 4KIRA 1QASA 5G5IA 2ABBA 2WHLA 3G1RA 2X7VA 2J8FA 3LS9A 5A6AA 2WMGA 2R1LA 2Q8ZA 4IF2A 4B5NA 1THFD 3VKCA 3JZUA 1DXFA 2UY4A 1TIMA 4RNHA 5FD0A 4REQA 5CGQA 2BV9A 2HEJA 3BLLA 3PR9A 1V6YA 4H00A 4YL2A 3M16A 4XIMA 2BXZA 1PWMA 2PV1A 3BJTA 3WQ4A 2P3ZA 1TA3A 2OX4A 4LEFA 3KHJA 1I60A 4PL2A 3O5LA 1UR1A 2Y24A 2VNCA 4Q4RA 4XAZA 1WOBA 3CZJA 1HXJA 4Q8QA 4GQQA 4DJED 1VS1A 5SWUA 1XYBA 3UNDA 4XB3A 2O9RA 2J9YA 3QBUA 4CCEA 3DGRA 3OYZA 2ZC8A 3WBEA 5DN1A 2CIPA 4FIQA 1JR1A 4NAEB 3GLCA 4ODRA 4ITZA 3RYSA 1ZLPA 2V5JA 4GOAA 3VD7A 1S5VA 2BVYA 1R47A 3WLIA 1JAEA 3WYZA 1GKQA 4QIUA 2VXNA 2BGNE 1V6UA 3PTQA 1MUMA 4CEXC 3B0XA 5I7GA 3Q2DA 3SJNA 6TIMA 4P61A 1E6PA 3T2OA 2NXIA 1D3CA 2YCJA 1OY0A 1WKDA 3MWCA 4I9JA 2BS9A 3W7PA 1SMAA 3VTRA 3U0HA 3G8RA 3NGJA 1PTAA 4AD0A 1TELA 1TPWA 3XIMA 3G24A 3O0FA 2PAJA 3PPFA 2FB2A 1J8VA 4JOMA 4EE9A 3OGVA 1TB3A 1QPRA 1A3WA 2I57A 3HM7A 2Z24A 1R46A 4LF1A 1B3ZA 4B5UA 4IFRA 1TQJA 3A64A 1VIZA 2PDHA 1HT6A 5EMLA 1UH2A 3PZIA 4I90A 2XYLA 4LRTA 3MHUA 4NZ5A 2Y88A 5JBFA 1ITCA 7ODCA 5HBFA 2FGBA 3MUIA 3MKCA 3AQUA 3TOYA 3T78A 2BXYA 3CUIA 4M8UA 1RY0A 4JN7A 2A3LA 1EIBA 4HPHA 3ODKA 3CZLA 3D47A 2FHCA 3GKFA 2PF8A 2QR6A 4ZVJA 3S9YA 2VDGA 4MMWA 4C6FA 3F5JA 1D7JA 1PAMA 3KBJA 1OFDA 5HAOA 3WF1A 3WK1A 2LGOA 5LNVA 3WQ6A 1P6BA 3LCLA 4JXCA 3UQAA 3LGEA 3EXRA 1DQWA 5HJLA 3TQPA 1RLDA 2DV0A 1C8XA 1Z41A 3NEVA 5D38A 3IUDA 2WXDM 1IEIA 3CT2A 2R1KA 2RUCA 1IEQA 2ANUA 3LPGA 3U7VA 5AECA 4JDBA 1UOZA 1ZP4A 3O63A 2EEXA 3OODA 2OSYA 2ZUWA 1FKHA 5JUVA 4PRRA 5D09A 1PKLA 1V4YA 2PDPA 3RRAA 1VCFA 4NNCA 3BLEA 3GXMA 4O4VA 3WH0A 5CEWA 4X2PA 4DO7A 4X9YA 3REQA 3I3BA 3WLTA 3HBLA 1FHVA 1J0JA 2B5UB 1PINA 3PWAA 1R30A 3AHXA 1J6YA 1SVDA 1VH7A 3C2YA 4FHAA 3WKZA 1FCQA 2FVLA 1S3TC 2P10A 4M7TA 1TO3A 3NL5A 3AHZA 2NVCA 1EUNA 2H9AB 3GDRA 3MBFA 4M0XA 3OIXA 4CNTA 2VFHA 3S2CA 1F3TA 3VOGA 1X39A 4D8ZA 4P2VA 1MO0A 4O8RA 3WNLA 5HQMA 3HGJA 1EGVA 4CN1A 4IIHA 4LUTB 3QVQA 1XLEA 3BQ5A 1YADA 2RURA 3RXZA 4UFKA 1JD7A 1YBQB 5HWNA 3MSRA 4UNIA 1NEYA 3PJTA 1YE4A 3AUJA 4HHMA 4MWAA 4XZWA 4ILSA 1QK0A 4Z2GA 1QI5A 4GI6A 4NU7A 2CBUA 4YHEA 4H6KA 1EBGA 2J7DA 3IPWA 3WF4A 1TIWA 3TAKA 4FLOA 3EYPA 3H12A 2TYSA 1QW7A 3EEZA 1FKIA 3DBNA 4JFTA 4DAIA 1J6PA 3BTNA 3RM4A 3BLOA 3THUA 1KFKA 3HGOA 1VAHA 4Q7NA 4DUXA 5IDZA 1DWHM 2FZMA 3OVGA 2V68A 2E68A 1N1AA 4IP5A 5HR6A 1AW5A 3V0SA 2XHYA 2QCHA 4BZYA 2PWHA 4A6GA 1FHDA 2X7WA 4ZOCA 3O0KA 1OX6A 2R1NA 2F21A 3PBYA 3EWYA 3UXAA 2WMKA 1OQFA 4B4HA 4X22A 1JVNA 2PCQA 3KRZA 5C2GA 2Z29A 3SY8A 3K2GA 1VBHA 2F6UA 1AW1A 3QV9A 5HMEA 3OZPA 1K7FA 1LQ2A 1A5MC 1U1UA 3H7UA 4PGLA 4F40A 1IYXA 1Z69A 1QK2A 3FFSA 3DECA 4XD4A 3GFXA 4ERAA 3F4NA 4WEVX 4MADA 1EF3A 1ZCNA 1B3WA 1JUKA 4C6NA 3MDYB 2PMQA 5HNRA 2DZBA 3IK8A 1XISA 1VYPX 4HOXA 1TVPA 1WBJA 4UZSA 3NJ3A 2H8ZA 1QPLA 1DQXA 3PUEA 3C8FA 3WDRA 3PG8A 1EJTC 2QCLA 4J4KA 3I3DA 4IP7A 1WKFA 4ZB0A 3GNNA 1C7TA 1JZ8A 1V02E 3RPTA 1XWYA 3GPKA 3EA2A 4IP4A 4XK2A 4UMBA 1F4AA 2GVEA 3UWQA 1C8QA 1CENA 2BVDA 5D32A 3UF9A 4E8GA 3KBWA 4HD5A 3GIYA 5A6LA 1OADA 4GIYA 3KHDA 3PZGA 2FZ8A 4BF5A 3U3HA 4XSLA 1M7XA 5I78A 3R0UA 4JTQA 4ZSUA 3BW4A 4ZQRA 3AI0A 1H63A 3C4UA 4YTQA 3SGZA 4BF9A 4B5XA 3BQ6A 2XVGA 2C18A 2VDIA 2AMXA 4U5IA 2DT2A 3SO7A 1A5LC 3V18A 1SSDA 4GJJA 5JMUA 4GGBA 3FKRA 3QV7A 3NZPA 3N12A 1KFLA 5CG7A 4RNFA 2YLLA 2V3FA 4UQCA 3W7NA 3C3UA 5I3GA 2A5HA 2A4AA 3VIFA 4C6BA 1GOWA 3L5AA 2AKZA 4B91A 1XRSA 3P5YA 3DGBA 1ZALA 3V1PA 3NG3A 4DLFA 1S2UA 3N14A 4XZMX 1WB0A 4H7ZA 4KQZA 3W6LA 3TNOA 3O5FA 2BXVA 5E9XA 2ATMA 2XFYA 3BAKA 1OX5A 2PWGA 3TNBA 4DJDA 1WUEA 3SM0A 4I7VA 4LALA 5JXQA 1US2A 2X0SA 4K1WA 1OHLA 4G56A 3M44A 1J4RA 2EO7A 4AZCB 3NEHA 5D05A 5CGTA 1GYMA 1IXQA 4R85A 5HJXA 1EQPA 4Q4MA 1W3KA 3TR2A 3I68A 3BCJA 1T40A 3F4CA 1LP6A 4C60A 4O1EA 3VIPA 3IVSA 5HWMA 1UC4A 1FWSA 2Q3OA 3L4ZA 3OQEA 2F9RA 3LCGA 4HK7A 1M9HA 4ECLA 3T81A 3W02A 4B5VA 4FMVA 5EA9A 4I5UA 1XUUA 4Q8UA 2ZZ5A 2CHRA 3A24A 4O10A 2XINA 4QE1A 2MNRA 1W1ZA 4OUIA 3T0AA 4AWTA 4DJDD 2WWDA 1FX6A 2Y61A 1XYFA 4PUWA 3EA1A 5REQA 1DTNA 1LTDA 1J11A 3KE0A 1UR0A 4EKJA 5FCZA 4JEQA 1XCWA 4IGNA 3BAJA 2CITA 4NT0A 3QM3A 1C7SA 1UROA 3UXLA 3N11A 1WA3A 2PBGA 4K1GA 4IOTA 1Q66A 3AMDA 3W7CA 3EMZA 1V3HA 2XM2A 3U2ZA 1P5BA 3WQ5A 1DL3A 2V5KA 4XTIA 5DIVA 2QGHA 5CPOA 3VNZA 3TN5A 1WOAA 1H61A 1JG9A 4L6DA 4LU0A 3AO0A 1DKWA 3UJRA 2VX5A 3TKFA 2VZOA 3UZJA 3L2MA 3ISIX 4YHGA 1JZ7A 2ZXAA 2WQDA 4S1FA 1A0EA 5FF0A 3EGJA 2OYKA 4WJXA 1I8JA 3BOXA 1J96A 1OYBA 4ALDA 5HK4A 4GVHA 1I45A 2WM0A 3DERA 1HKKA 3U5UA 4ZCWA 1BVZA 3UXDA 3MV01 1EJRC 3ERPA 4UTUA 4GZEA 2ZUVA 3C2OA 3ARTA 3Q37A 1C8VA 2J6XA 2BASA 1XD0A 2DUXA 3RPMA 3OZOA 2E1DA 1J0KA 2DIJA 3N17A 4JFIA 4ODLA 3T42A 1RJQA 3W2LA 1RD6A 4G2PA 1K3UA 4G1NA 4V33A 4QT2A 2NWSA 4RUBA 4B4FA 3EKGA 4GLEA 4CU8A 3FY1A 2XN0A 1TR9A 3NAVA 1VZWA 3MZ2A 1ZHAA 4ODQA 4UTIA 1R86A 4HBOA 2CWXA 3NM3A 1X98A 1VRDA 4I5RA 2BOGX 2FHBA 3CC1A 4V2XA 3IJIA 4O17A 4QFUA 4JFWA 4L4PA 3MYOA 4N42A 3AC0A 3PTMA 4B3ZA 3KRSA 5I03A 3T1GA 1R2RA 2ZRUA 3O5JA 4HCHA 1QI3A 3AWNA 3OBAA 4RV8A 2QNEA 1ISZA 2ZX7A 3SDOA 5LKYA 3AS1A 6ENLA 1MRAA 2P88A 1CXFA 1K6AA 2WHMA 4EXQA 3KAOA 2J8GA 2NX3A 3AS3A 1UWSA 3LRKA 2OFNA 1JPHA 1TX2A 1JPIA 2YXOA 4C65A 5A3HA 1DWIM 4M6PA 4U86A 3DC0A 4RE4A 4K68A 4AISA 3ZZ1A 5PTDA 5DO8A 1DJZA 3M64A 1CGTA 3KP0A 1EGMA 1UD6A 2D73A 4LUSB 1N7KA 4PTVA 3VFCA 5CXPA 3LLXA 4KGJA 3E0VA 6ALDA 2YA1A 1W1IE 1D3GA 1WKYA 3LHYA 4AD2A 4C6CA 1NDYA 1EJ7L 1PKMA 2DDXA 2Q5AA 1XIFA 2ZRXA 3CT7A 1U33A 3JZEA 2A1YA 3LSBA 3W0KA 4RDYA 1BHGA 2PV2A 2GVYA 1A49A 3SY1A 1CGYA 3UEQA 1QHZA 3CTTA 4K7YA 1YXDA 2PGRA 2WLZA 3VU2A 3PF3A 2O55A 1E4NA 3TCZA 1SYTA 3TYBA 2V6AA 3W7IA 3U9IA 3A3XA 5HQEA 4QJ3B 4UR7A 5T9CE 1VLIA 3F4DA 3NSNA 2QCDB 4KWSA 4DI8A 5DRCA 1BG9A 1ENUA 2YPIA 3STFA 4NQ1A 4JPGA 1UH4A 4E38A 1B30A 1EZWA 2DG4A 1TJPA 1FQ0A 4U28A 3WF2A 3IEBA 2RDXA 4DZ5A 4GC4A 2O4MA 4NP7A 3EKLA 4AX6A 3H53A 3LTPA 4HMCA 5LGXA 1AODA 2HTMA 5DIUA 3SEPA 5KINA 1MQQA 4PMQA 4M29A 3P82A 4S2BA 3T0CA 1R7AA 5BU6A 4D6EA 2VOMA 1VFLA 4AWSA 4N9BA 4IMEA 4ZPTR 4BWLA 2YSWA 2YB1A 1G4SA 2RDTA 1T99A 1SM9A 2GSHA 3KVJA 4CN6A 4GKLA 2P1FA 4HBEA 2BTMA 2VHLA 1KM5A 2MLZA 1WDDA 2FTWA 4YU1A 1F7BA 2VVNA 2LJ4A 3ARWA 1YKWA 3P80A 1DJXA 1Z7AA 4FR6A 4L80A 4JNZA 3EEGA 3R43A 1B3XA 2QEZA 3ORWA 3VNKA 2PGWA 1V6VA 1KWGA 2QIIA 3O5RA 3SBFA 4XBJA 1HKIA 4WDXA 1LOLA 1A4MA 4MJ4A 3VE7A 3HPZA 2PTYA 4F66A 7PTDA 5A5WA 2EBNA 3MC5A 1NAL1 2UY3A 4GACA 1YQ2A 3GM8A 1QNQA 4B5WA 5FESA 4XAFA 1VYSX 4IFOA 4DWSA 3UF8A 1NDVA 2OLAA 4K8EA 1RBOB 4S3JA 5FKYA 1V5XA 3TCSA 1I2QA 4JQ2A 1GZGA 3OGRA 3IJDA 2J75A 3FNDA 3STGA 1VFMA 3TXVA 4MSPA 4ATWA 1A5UA 1E55A 1KCZA 2G50A 3P60A 3NA8A 1XGDA 3SIMA 4TX6A 1A0CA 4C6OA 5FJJA 4DBWA 3L5MA 4J2PA 4IXHA 1UP0A 5BOFA 3H4XA 1KT1A 1GEHA 1H50A 1E56A 3IGXA 4K8GA 2V3EA 3S6TA 1M68A 2FB3A 4O1DA 1ISWA 3S1XA 4XAPA 1C29A 2E6YA 5E0CA 2C15A 1FKLA 4LH8A 2PDFA 1J2WA 2QULA 3DN5A 3CHCA 3SCTA 4UBPC 4W4QA 1I75A 1LROA 4HBKA 3VIHA 1XDJA 4FK9A 1JZ4A 4HJFA 4HHPA 3U2OA 5C9WA 3W00A 3VABA 4DWDA 1MUWA 2JZVA 1H60A 2W63A 1EEPA 3DI1A 3WNOA 5HNUA 3B0PA 2A3HA 3NOYA 4P7OA 3SQMA 3VINA 4QNWA 3O5OA 4RZ6A 5KTLA 1OZQA 4QAIA 3VD4A 3A3HA 3PRBA 2V81A 4J4NA 3G77A 3M0JA 3NXFA 3N4AA 4HU3A 1YDOA 3TA9A 3AS0A 4IPPA 4N9CA 4ZTXA 5MKGA 3TC5A 3L2IA 1ML1A 2DY3A 1BYDA 1D9EA 4JGDA 1DWJM 3ITXA 2V63A 4FS9A 3S1GA 1OFAA 4IIDA 3E0FA 4L6HA 2GWGA 4ZEPA 2YL9A 5A2BA 1F2JA 4JNMA 1WDSA 1CXKA 3F4VA 4AZ7A 2QS8A 3W37A 1W2PA 4PULA 1FTXA 1I6NA 1XBZA 3TTSA 4FXJA 4FAMA 5BOOA 2IKIA 4OHQA 1ECQA 2OOFA 1R9ZA 1P4CA 3LV5A 1N2VA 1PSCA 1XP3A 4UTTA 4U4MA 4GQRA 1L2UA 5D2TA 3ZVIA 2EGZA 2UWFA 3PS7A 2QKFA 1DYSA 3PPGA 1Q8JA 1B6CA 3O5EA 4LAOA 1PHWA 2C6QA 1E3ZA 3W07A 2XPKA 4QR6A 4R9OA 3CAVA 1MVYA 5H2ZA 3LQLA 4XVDA 2X05A 4IFKB 1YXCA 2G97A 4J40A 4M1RA 1KGUA 3IAPA 2Y2WA 4LAZA 1NWTA 5HR7A 2WM1A 1RALA 5CPMA 1NQKA 3VCNA 2WW5A 5HWBA 3WLNA 4HK5A 4W89A 4O57A 3T0BA 4O50A 4DZAA 3O6YX 2Y7DA 4HVXA 3C86A 4MZYA 2PDLA 3HQPA 1JFXA 4PYSA 3UWUA 5FSEC 4UMCA 1HTIA 2DVXA 4NRSA 4JFJA 4H7CA 1EXPA 3SCSA 1GEQA 3ZVHA 1CW2A 1S2VA 2DG3A 3LMZA 5GPGA 3DZ1A 4X61A 3AMKA 3M0MA 4P8VA 4TV6A 1W5PA 1JCTA 4ZL1A 2ZZ6A 1J5SA 5DLCA 4QE5A 1FUYA 1TR1A 1ESWA 1EYEA 5AVNA 4AIUA 2R24A 1K9FA 1S5TA 4GIVA 2RQSA 3F5KA 1HG3A 1Q6OA 3SR7A 1W0MA 2BY1A 3M5VA 4N19A 3CAQA 5A6BD 1GHSA 1XG3A 4GQBA 2B31A 4R7WA 3UI4A 3OOQA 2PBCA 1UJQA 3W7QA 2VC5A 3U6WA 2XIBA 1O1HA 1Q2RA 4GHRA 3W83A 5D8WA 3M0IA 3WDHA 3FS2A 3WQVA 3CHDA 1OABA 3UA4A 2POTA 1TV2A 4DYJA 1FKGA 3KAGA 3PR2A 4ENLA 3SY5A 2D24A 4ACZA 5C8BB 1G1YA 2OQYA 1R3VA 3LGDA 3CQKA 2F84A 5A6SA 1MFUA 3SUSA 1Q4NX 4S38A 4QLJA 2CLIA 3B0UX 3IVUA 3GU9A 1Q2SA 4UIOA 5EFFA 1B2YA 5EGRA 3DFTA 3BSGA 2R1MA 1CEOA 4LY4A 1W37A 3CBWA 4ADUA 4GXWA 2P50A 3CUHA 4LV4A 1GG0A 4HN4A 4KIEA 3VD3A 1ZP3A 5BXRA 3G6LA 3KTSA 1TJ2A 4ZXOA 3BANA 3GNRA 7REQA 3GTHA 4HNOA 3PVFA 1MYRA 1TMQA 4JYFA 2D22A 5CZJA 2QDDA 2I9UA 1LQAA 4H6EA 1IXOA 2ABAA 3QRHA 1UASA 3YPIA 3O1NA 5BWFA 1CTNA 4L5ZA 1NOFA 4IMGA 3EA3A 2V2HA 4NY2A 4PUDA 5M5DA 5CKSA 5M3WA 3WLLA 4C90A 3FCPA 1EEXA 5C6MA 3AHVA 1FKJA 3R8RA 1W3JA 1EB3A 3QHMA 4DRHA 1F3EA 1UKTA 2M08A 4WSKA 2B7QA 3O07A 3H4GA 5DO2A 3IJ8A 4JCMA 4KETA 3KVMA 3P8JA 1UR4A 3QSRA 2OU4A 1UUMA 3OYXA 4KCUA 4XUYA 3IGUA 4E2BA 3GE7A 3NVTA 2V2DA 1M03A 2YIHA 3TQKA 1W1YA 4Z2HA 4LYKA 1HQTA 3GG7A 5BYWA 2XDFA 3MCOA 4W85A 5BZAA 3BZGA 3VGEA 3KRUA 2GDQA 3W73A 3VOHA 5FEZA 4JTDA 1TTIA 2GQ3A 3RO6A 3IJLA 1FH9A 1PZ0A 4F3HA 1WKEA 3UCCA 4HGXA 3ONBA 4MNKA 1QHPA 1FWIC 3D6NA 4ZE5A 3WNPA 3ZXWA 1KRCC 1UQZA 1GVOA 2P76A 5CQ1A 3MPGA 1JUBA 4EPEC 3DFSA 3SUUA 2WKLA 3CUXA 3BMXA 4KGLA 1DXIA 2H3BA 1SO5A 3PSWA 1EP1A 2I14A 3KEHA 4Q8OA 2D3NA 4AYSA 3UWZA 3ZM8A 2IKJA 4D6GA 1W17A 4ZO6A 4H9XA 4M81A 4U3CA 1JZ3A 4AHPA 1P1MA 2YW4A 1VHCA 4Q32A 3R94A 5M03A 2Q8LA 1EZ2A 4D2JA 1UZ1A 1I4NA 3PAJA 1W1VA 3BUVA 1EHAA 3P0XA 4JFVA 4W5ZA 4MNJA 1UWRA 1J9YA 3CNYA 4GUGA 2X2GA 1GOQA 3JR2A 2CLOA 4ATLA 3H7VA 1B5TA 4XV0A 1X96A 3KS6A 4Y96A 1XRFA 3WFZA 1MEHA 1LOQA 1R87A 3KCOA 4BQ3A 2VEMA 3LHVA 5FACA 1H62A 2FFCA 4FNRA 3W2JA 3WNKA 1CLVA 1IR2A 2EG8A 3PRDA 3G22A 3OLEA 4AX7A 1BXBA 4YCPA 2VQUA 3GWQA 4C1NA 3M0XA 2E5BA 2Y8VA 1AJZA 2CZ5A 4KEUA 3WQFA 1EBHA 1NSJA 1XH0A 3ZLGA 3CO8A 2E5CA 3QLDA 5I5RA 3SCRA 1OEPA 2WJFA 2OYLA 2P4VA 3N29A 3SSJA 2PTDA 1OK4A 1B90A 3GXNA 1FWDC 1WV2A 2BP1A 2X1RA 3EOLA 4AWEA 4D8LA 2C71A 1RD5A 3GTFA 1MEIA 2NLYA 5I23A 2PC8A 3LHUA 4GQ0A 1IWAA 3PTKA 3CQIA 4F0RA 2GWNA 3WY1A 4OWGA 4YCOA 2QDGA 3T08A 1S46A 3DH7A 3RMJA 2VFFA 4HPXA 2FTPA 1G4TA 1SFSA 1NWSA 3V1HA 3ARXA 1WXZA 1X1OA 2Z2BA 3MHGA 2W91A 3AYVA 3IAQA 4LVGA 2EPMX 1J6OA 3ZYZA 1GORA 3N2CA 2QYGA 3L66A 3MY9A 1SFTA 2PWEA 2Z27A 3G3DA 3GG8A 1TV5A 3WBYA 1UD8A 1DJWA 3W2MA 3LUTA 2XIJA 4S3EA 4XD5A 3URQA 3TROA 2J7BA 3MS8A 1LL4A 2VCDA 2F2HA 3H23A 3SJ3A 3PBVA 4C7GA 2WV8A 2J27A 5AC8A 4FNPA 3P2VA 1I1XA 3OGSA 3O05A 3S1VA 4J7RA 1E9IA 1KFJA 4HQVA 5E6YA 3C61A 1XUZA 4KWVA 4J3WA 4IMDA 4NXKA 4CKQA 3VGFA 3RUBL 2A0NA 1KFBA 4S2CA 1F07A 2VI0A 5REQB 2WCGA 1X6LA 1AQMA 1F8AB 5IM51 1PPIA 2OR2A 4GYKA 3T0DA 3V16A 1VP5A 1OZMA 3IV8A 4KRUA 2PV3A 1GVRA 4XZBA 2YX0A 1QNVA 4OV4A 1W2VA 1B57A 3AXKA 3AHTA 3WLSA 4H9UA 1OCBA 2CLPA 4D6HA 3SIZA 1NF7A 2Z7KA 2O7SA 3IARA 3OLDA 3W1XA 3VDBA 3H21A 1ME9A 3WO8A 3B9NA 4BKNA 1UKPA 1GT8A 3VILA 2XFWA 3UPWA 3N4EA 1VEOA 1NMVA 2WCSA 4DF0A 1YIXA 1TPDA 3R2GA 3KS5A 4QHRA 2OGJA 1I0BA 1OK6A 4BF8A 1WNOA 1R9XA 3FEMA 4H04A 2CZEA 1Q45A 3FAXA 5D2YA 2W4XA 2GJXA 1T8XA 3KOFA 4HTYA 1IF2A 4XO6A 1XPYA 5I09A 3M07A 3KVLA 4MB1A 4P7QA 1UZ4A 3H26A 2WPBA 4CQ8A 5H8PA 1O5RA 3PC0A 2DZPA 4WY0B 4C6LA 3A22A 4PMRA 5M2FX 1HJUA 2FZNA 1RP8A 4B5TA 2QV5A 2Q02A 4DQWA 1XIGA 3DYMA 2CLMA 3S1UA 3NSXA 1GKPA 1Q6IA 1S5WA 1SW3A 4OBRA 1F05A 1X6UA 3U4AA 3JUGA 4O14A 3I4KA 2P53A 2JKEA 2IQ0A 4O19A 2VOTA 4FNSA 1EOKA 1WP6A 1JJKA 5XIMA 4F0MA 3AWOA 5T8GA 5GJPA 2QJHA 1MZRA 3UG4A 4YMZA 2KR7A 5IDIA 1F3WA 2YFNA 1A4LA 1R6WA 5G4EA 3K30A 5HW6A 3E2QA 5F7UA 1CZ1A 1Y65A 5D9OA 2YL5A 3IK2A 5D9NA 3O5IA 1AFSA 2Y63A 1TJRA 1TRIA 1ZK6A 4ZXLA 4BHYA 4HNNA 4AC1X 3XISA 3R12A 1WDQA 2F8QA 1J2BA 3VX0A 1EHNA 3QC0A 5F2IA 4OKDA 3G18A 1J4IA 1SFJA 5AFDA 3RR4A 3TX9A 4KEZA 2XUCA 3W1TA 1HFBA 4AEFA 3QTPA 2OLSA 2NV2A 2V82A 3C8NA 4AZHA 3KAHA 2EKCA 4CD6A 2HXUA 1LDCA 4N02A 3UGRA 1X8CA 1UMYA 3FGCA 2ALDA 3VVGA 4GBDA 1UP3A 4BR1A 1U22A 1QR7A 3LZ3A 3MMUA 3W86A 1TTPA 2FAPA 2R9RA 1QBBA 4UQ9A 1BRLB 2RKXA 2XP8A 5HWCA 4W9TA 4GIEA 1F6YA 2OSXA 1SU5A 3NNTA 4P7RA 1GZ1A 4HZMA 4ZO7A 3TH6A 1IXNA 5HANA 4LSBA 4JTIA 3WD4A 4RE2A 2IPWA 4DXVA 4KCVA 1VEMA 1OCQA 1SJCA 2DZXA 3U57A 4HCDA 4Q7IA 1M3UA 3C0SA 5GNXA 2WC7A 3UI5A 3NUKA 4Y9AA 2GJRA 1UA7A 2DIEA 4TYOA 1LCOA 2DT3A 2O9PA 1W8SA 2PB1A 3P61A 1FKSA 3EOUA 2DZVA 5C7VA 2GSJA 2CBVA 2VQTA 3GHSA 3POCA 1DOSA 1F40A 2XISA 3QPZA 3BMVA 3W7DA 3ZJ6A 1ZCOA 3NQ8A 2ZKMX 4ZQPA 5C9UA 2W3ZA 1HL9A 2IQDA 3F03K 1Z42A 5D75A 4HA3A 4IIBA 1L9WA 3ZWTA 4QJ5B 4OFCA 2WQPA 2X1TA 4WGXA 2NX9A 2DFAA 2PWDA 3SECA 2OB3A 3LERA 4EAYA 2FYMA 4NF7A 1FCUA 4PBGA 2DZUA 4A3RA 3FVMA 1HGYA 2HISA 3OHMB 2G96A 2QPXA 3CL8A 2YW3A 2YBUA 4HNLA 2INZA 3G0XA 1W5OA 2R14A 3LCHA 5EKYA 4I8DA 4ROPA 3AUOA 1P5QA 1UBPC 2HNEA 3ANUA 2O4QA 3RRXA 2JIEA 4LWWA 3UR2A 5FAJA 1J93A 1X7IA 5FJIA 1GQIA 2LLEA 1JNEA 2KGJA 1RZMA 3VMNA 3NQCA 3N18A 3P6LA 4PODA 2BFGA 4UCGA 1ZFJA 3A6OA 4IZGA 2DVUA 1YW5A 2VEFA 3BDKA 1NELA 2AQWA 3QXBA 2E09A 3BH4A 2CKRA 3ARYA 1RCOB 5MF5A 5IBXC 3FAWA 2NQLA 4JQ4A 3DG7A 2CBIA 2FKPA 4NZ3A 1XCXA 3LCIA 4LX4A 1DJGA 1VKFA 2FMOA 3WQ8A 3QH2A 1NH6A 2R8WA 4GUJA 1GZJA 4O1CA 2PCEA 3QQ1A 1A3HA 1E72M 3OHIA 2PPOA 4TW8A 4CQCA 2PODA 4JYDA 1VJIA 5J04A 1C93A 4QX4A 5B7ZA 2UY2A 1H0GA 4LAWA 1BYAA 5CC5A 4LUJA 3GU0A 4JL1A 3POHA 3EY6A 4H2HA 3MI6A 1JVWA 3ELFA 2WO5A 3WEZA 2RFGA 2ZQ0A 5AHIA 5G1MA 1GHRA 3KUMA 3G1HA 1SW7A 3HA1A 2PDYA 5CGMA 1YLVA 1G5AA 4AVOA 1POJA 2ISVA 3F2CA 1OFRA 1QI0A 1L6SA 3RDKA 3NVDA 4YWIA 1FH8A 1ZRQA 1TSIA 2J7EA 3W84A 4KCTA 4NZJA 3RGTA 1K9TA 2YCEA 1V7YA 3WIJA 2Y6ZA 1MSSA 3MCMA 1BWKA 1YTKA 3UJEA 2OXNA 2FKEA 3W7HA 4JAWA 3CIVA 4H41A 3CB8A 1XD1A 2ZUMA 3VMPA 1DBTA 3ZFHA 1BKSA 1GVFA 2CPUA 2GQAA 1EPVA 1EJVC 2X09A 2EJAA 5GVJA 4A35A 3UGVA 3GU1A 3NPWA 3OJGA 2QCMA 3CV6A 2PTXA 4LB3A 1PZ3A 4MKNA 1PVNA 4MZ8A 5A8MA 4GUIA 1JIBA 1JULA 3H2MA 3L4XA 4PUNA 3BGGA 2E1WA 2JGYA 4IWWA 4DIPA 3HURA 2OOGA 6TAAA 1GUVA 4CNUA 5EY5A 3EWWA 1EYMA 2H6RA 3EB3A 3MI2A 3OZYA 4IJBA 4GJIA 4O1AA 2YL8A 3L0NA 4IL2A 4NZCA 1TMHA 3WBWA 5K7JA 3QOMA 1EGZA 4H6RA 4F2UA 1BF6A 3NDYA 4IIEA 1ISXA 2XWEA 4P8XA 1XYMA 3DCPA 1TREA 4JX5A 4UCFA 4ZFMA 3LK6A 4ZOBA 2NT0A 1XIJA 2XH4A 1XFCA 3ATZA 4FALA 4DELA 4XKYA 3FJ6A 4X3ZA 2CU0A 2WBGA 4F0LA 4XBKA 4WCJA 2PWUA 1EWDA 1XM3A 4GFSA 3VDCA 2Q71A 4A8RA 4QG6A 2WAGA 3NWRA 3R7MA 4CNNA 3GHRA 4D6FA 3VD9A 2OSWA 1RBLA 3KCJA 4IPIA 4QT3A 4K2SA 4TMCA 1A5OC 4GPNA 4O12A 4LS1A 1OT2A 2V0TA 3HMJG 2GGHA 4GZ7A 3SCQA 4GX9A 1JDFA 1FA2A 4JIEA 3J7HA 2R91A </