2G41A

Crystal structure of the complex of sheep signalling glycoprotein with chitin trimer at 3.0a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbohydrate binding properties and carbohydrate induced conformational switch in sheep secretory glycoprotein (SPS-40): crystal structures of four complexes of SPS-40 with chitin-like oligosaccharides
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords SIGNAL PROCESSING PROTEIN
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2g41A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2g41A01
3IJ9A 4PMOA 1KXQA 4UOJA 1UQYA 4PBGA 4U31A 1XHGA 3T2OA 3IAPA 4LXFA 4WKHA 3KL0A 1CLVA 4PMYA 3MUIA 1RP9A 4GXPA 1BLIA 1BSIA 3CZJA 2O92A 4MNJA 1CGYA 1OCQA 2ZICA 4W7VA 3RMEA 4CCDA 3OBAA 4N0RA 3UR8A 8CGTA 2XM2A 2V5CA 2J7DA 2PC8A 2J7HA 4W88A 2DH2A 2J79A 3UR7A 1V6VA 3N13A 1G01A 1Q6GA 4UZSA 1HVXA 2NSXA 3VU2A 1KGWA 2VT0A 4A4AA 2ZX7A 3BAIA 1C7TA 4CD6A 5FL0A 5DMYA 4PYSA 1LJYA 2WMIB 1W1PA 3CUGA 3GNPA 1F4AA 5E0FA 4F9DA 1XV8A 1LWHA 3BXWA 3FXYA 5D9MA 4A3HA 1W3LA 2O9RA 1UR2A 5JBDA 1B3VA 1JNEA 3PZIA 5TD4A 2JF7A 1E40A 1BYDA 1J9YA 3WDIA 4GZEA 3WDRA 4J3VA 1SMDA 2XVPA 4PRWA 3WD3A 3WQ6A 1C93A 2BVTA 2VL4A 5CSUA 4E2OA 4PMDA 3WNNA 1GVIA 1B9ZA 5E09A 1MFVA 1HXJA 2CCRA 3W24A 4OBSA 1VBRA 1E6ZA 1BG4A 4MNLA 2E9BA 1W32A 4BQ2A 2E0PA 2W92A 2GDUA 1BTCA 2WPGA 3GH7A 4D72A 4TXEA 1NOUA 1UH2A 3U5UA 4HMEA 4KMQA 3OLGA 5I6SA 1UWUA 4AZBA 4NF7A 5DF0A 2VX6A 1GNXA 4W87A 3RJYA 3SCPA 3TONA 2WLYA 4P8WA 3T0AA 1TMQA 1VB9A 1JL8A 1J0ZA 2ZXDA 4AZ5A 1A3HA 1M7XA 2PWHA 4NRRA 2W61A 3W27A 1MQQA 3F5LA 2X0YA 3W28A 1GZJA 2F8QA 2Y5EA 2CHNA 1P6WA 2CYGA 1BQCA 3W6MA 3RIKA 4ATWA 4PTXA 3ARVA 1KXTA 1MFUA 1Q6EA 4Z2JA 1G94A 1UYQA 4CD5A 4UQBA 3ARZA 5A69A 1WAWA 2UY3A 5ABFB 1AQ0A 4H41A 3OGSA 2F2HA 1KBKA 4J28A 3D3AA 3U57A 1FP8A 1TZ7A 3ZJKA 2VX4A 3UG5A 4DWSA 3MU7A 2EPLX 3AROA 1GQLA 1WZKA 1IT0A 1EH9A 4JCMA 3VKKA 3AHXA 3PHAA 1UKOA 3WEOA 3OIHA 4PMZA 3FHAA 1V3IA 3CZ8A 1R86A 1UHVA 4JIEA 4AIUA 2X0HA 1XYFA 3QR3A 3MO4A 1RH9A 1RD6A 3I3BA 2TAAA 3ALFA 1ZJAA 1TG7A 1XD1A 3QHMA 3AS0A 1SFSA 3JUGA 2WHKA 4HOXA 3NSNA 2BS9A 1V3KA 3SUVA 1XD0A 2J7GA 2WKLA 3SCVA 2D0FA 1JYXA 3MV11 1XC6A 2VR4A 1J10A 1QI4A 1AMYA 2GJPA 2WC3A 1WZAA 2E9LA 1LL6A 1HJSA 4Z2GA 3S2CA 3WH7A 2BY0A 2BHZA 3AIWA 3QGVA 1WCGA 2A3HA 3HU7A 2XGBA 5BRPA 2WAGA 1C8YA 3NYDA 4WSJA 3BC9A 3SCTA 3L4YA 4M1RA 1TE1A 4ZEPA 1HJWA 1BPLB 3BCFA 2IUZA 1NM9A 2ZX9A 3QOMA 3ARXA 3W4RA 2WANA 5KEZA 1WDRA 1AQMA 1UD4A 1US2A 5CZKA 1NWUA 2O9PA 2YA0A 2JE8A 3WQ5A 3L2LA 4MNMA 1OB0A 2YA2A 3VIPA 3AIVA 4J3TA 3WL1A 5A3HA 4E8CA 1KFWA 4HTYA 2BHUA 1E9LA 1MQPA 3ECQA 3AICA 5HOSA 1E3XA 2OSXA 2V5DA 2EPMX 2JALA 1EGZA 1M04A 2BVDA 4HOWA 1C90A 1I1XA 3N18A 3U7VA 2GUYA 1UKPA 3T0DA 4JZ5A 3WH9A 1E72M 2CERA 1CLXA 4GIAA 2ZWYA 2WMKA 4P7RA 1CXLA 5HBFA 2ZUVA 3GM8A 1CXEA 2WW5A 4MAZA 4BS0A 3L4VA 1UWQA 4GZJA 1A47A 4CCEA 4AMCA 2BVYA 4JHOA 5BXPA 4QLJA 2Z1SA 4N42A 1JD7A 2G3IA 4IISA 3HMCA 4UR9A 4P8UA 1E0XA 2VRJA 4KWUA 4GINA 3BH4A 3L4ZA 2J78A 5D9NA 1MW1A 2OSYA 3WF0A 4HU0A 3ARWA 2GDVA 4Q7NA 2EEXA 5M5DA 1QVBA 2WVVA 1FH8A 3AMKA 2VRQA 2W66A 3GTNA 6A3HA 1M01A 4J7RA 1E6NA 4LYPA 3ZJ8A 2FHFA 2WC4A 1FHLA 2Z1KA 2W4XA 4GO8A 1NARA 1JNDA 5IXEA 2WZEA 4QCFA 3VD4A 1DWFM 3ZO9A 2CBUA 4CD8A 1H49A 3IJ8A 3VM7A 1XSIA 4MDOA 1XH1A 4U5IA 5C70A 2WSKA 3CO4A 4M82A 4Z2IA 3AISA 2GK1B 1E71M 1N82A 3HJEA 4WF7A 3CHDA 1E55A 1ZB5A 3UEQA 1C7SA 3UETA 1JG9A 1WKYA 2E4TA 4BA0A 1VAHA 5JH8A 5BWFA 5M17A 4PMQA 1V3LA 4XX6A 5CXPA 1VENA 5I5RA 4TX8A 3VIKA 2PI6A 3W82A 5A1AA 2XFFA 4LX4A 4H04A 4FLSA 4DUXA 4MJ4A 3CMGA 3PBGA 2PBOA 1HKIA 3BGAA 3LMYA 5LYRA 2ZUUA 1U30A 1WE5A 2J25A 3A4WA 4UNIA 1B2YA 5CPQA 3ZQ9A 4TVUA 2ZUWA 2CNCA 2V38A 3L4TA 4UQCA 3W38A 1XRVA 1PX4A 4PUDA 3NJ3A 1E6PA 2J7FA 3B8SA 1V3MA 3ZOAA 5EMYA 1EHAA 4UZUA 3VMOA 2PB1A 3ARYA 1H5VA 3WH6A 3MSDA 1BYCA 1DTUA 2WWCA 2CXGA 1UUQA 1J0KA 3WNOA 1OBAA 1NWSA 2CBVA 3AIBA 1ESWA 2UY5A 2D20A 2HISA 3T2PA 1UR9A 4PMNA 2EQDA 5FL1A 3PZQA 4GI9A 4W8BA 3K8MA 1CXIA 3CUIA 2GJRA 4CVUA 1CGXA 5E9AA 1E3ZA 1MW3A 1EDTA 3VD3A 3IJ7A 1VJZA 2VCBA 4D6IA 2G4FA 3A6OA 3QOKA 4AW7A 2XFRA 1OD0A 1JFHA 1MYRA 2E3ZA 1JDAA 1ISVA 2Y4SA 3VUPA 3DHPA 4W93A 3F5JA 2RGMA 3SURA 1L8NA 3AS2A 4EE9A 3CZLA 2DT1A 3IAQA 1W9BM 1GOWA 1W9VA 4B16A 5CSYA 3W29A 3GZAA 1W9DM 3PTMA 2BFGA 3MUZ1 4V2XA 4U2ZA 4U3AA 3APGA 4JCLA 4D6DA 4MTVA 4FF5A 4AD3A 2WCSA 1V08A 3GNRA 3VNYA 3NIYA 5CGMA 4OUEA 3GBEA 1UG6A 1LWJA 2WHLA 2XM1A 4XZBA 4YN5A 1QNPA 4UFJA 1UKQA 4PSPA 4PMXA 1E6XM 3AXHA 4HZ8A 4YPJA 4V27A 3WNMA 3WL0A 5D8ZA 1ODUA 3AMLA 4MAVA 2OWCA 3VMPA 1LG1A 4UQ9A 2G3MA 1DP0A 3VD7A 3VM5A 4WK9A 2C8NA 3UERA 3KWXA 4P8XA 3GH4A 3RJXA 3EDKA 3ZT6A 1DWGM 2CBIA 3WSUA 1WZLA 1WPCA 3NSXA 1GOMA 4FLQA 1J0YA 5BXTA 1NWRA 4DM2A 4DWSC 4W5UA 4P7OA 2FHBA 3CTTA 1CXFA 2W91A 2GJXA 3NSMA 3VDCA 3A47A 4FLOA 3AMDA 2X2YA 1HX0A 1OGBA 3CZEA 2XYLA 2WVSA 3SUUA 1UD3A 1JYVA 2WB5A 3W25A 3VVGA 1W3HA 3CHCA 1CYGA 1O7AA 3WNPA 5AYIA 1UA7A 3OLDA 1OGGA 3AS3A 1C3FA 4PEEA 4BZYA 4CUCA 4OOZA 3VIIA 5A8NA 1CGUA 2MANA 4DWSB 1OT2A 1J0IA 1FA2A 1GONA 1US3A 4P7NA 2VQTA 5I79A 3SCWA 3IK2A 3CUJA 1FHDA 4C7GA 1UR4A 2DT0A 1E4MM 3WEZA 2CHOA 2EBNA 1UA3A 4KGLA 2QF8A 3K8LA 1XSJA 3DYOA 5IDIA 2FH8A 2OYMA 2GFTA 1HT6A 3SCNA 4K68A 2OLHA 1NH6A 5IHRA 2BY3A 4H8UA 2NW0A 4X0VA 1M53A 5BXRA 1F4HA 4D1JA 2WSPA 3EYPA 3BLPX 1LL4A 1KXHA 3VOCA 3BSHA 1QI0A 8A3HA 1E6SM 1JXJA 4W8LA 3VGDA 2ZOXA 1HJUA 4AD2A 4D71A 2PWFA 4JKKA 1DWHM 5JIPA 4ML4A 4IPNB 2AOSA 1V02A 3CZGA 3SCRA 3ZR6A 4OIFA 1EOKA 3WIJA 1G9HA 3WMCA 5I24A 4OBRA 1AQHA 4NI3A 1JGIA 3F4VA 2ZWZA 4LPCA 2G8ZA 1GUVA 3DYMA 1H11A 1I1WA 4PCSA 1W3JA 4AXNA 1K6AA 1GVYA 5JBEA 3T09A 4WKFA 5ABGA 2YDRA 1VEOA 1OD8A 1UD2A 4HU8A 1OGSA 4NRSA 4WJXA 5AYBA 3WENA 2YBUA 4S3KA 1BYBA 2G3NA 1V0LA 1PEZA 3SEPA 4AC1X 1QI3A 5A8PA 3CHFA 4C7FA 3CIVA 1WZMA 4GI8A 2VI0A 3NDYA 5E70A 1NOFA 2O9TA 1E1FA 3M6DA 4BQ3A 3J7HA 2VX7A 3S6TA 2OWWA 4ATLA 3BAJA 3OG2A 1ISYA 1QNRA 2DT3A 5EBAA 3ARSA 3EMQA 1MWOA 3ZSTA 3NCOA 4QLLA 2VZTA 1HIZA 3I3DA 4ACYA 2XVKA 3AYSA 1VEPA 4RE3A 4CU6A 2VX5A 3WBEA 2CKSA 1UH4A 2D0GA 3VX1A 4CGTA 1KCKA 4M80A 1C91A 2YLLA 4UOQA 3FY1A 1UWTA 4XUYA 3VGHA 1MW0A 1LLOA 1TVNA 4ACZB 1J12A 3OGRA 1IZKA 4PTMA 1B31A 4FK9A 3TTSA 2C7FA 2XWDA 1AVAA 3VO0A 3WF3A 1ODZA 3VPLA 4OJYA 4AISA 2YL8A 2ZUNA 1E6RA 1V0KA 1GW1A 5I3DA 3ALGA 2V3DA 7CGTA 1QI2A 2EPNA 1ZBWA 1Q6CA 5A6MA 5A6BA 3ZIZA 1GCYA 2F61A 1UZ4A 1BGGA 1QHOA 1V3HA 3PZOA 3VTRA 4UQDA 5D4YA 3CBWA 3U7BA 3PN8A 4CU8A 1HKKA 1HN1A 2YL5A 1GHRA 2CITA 4CN6A 4BQ4A 4E8DA 1HVQA 4MDPA 3IANA 2WYSA 3VIJA 4B15A 4WLCA 3EDFA 3ZT5A 4UFKA 5D9OA 2BY1A 2FDMA 3QHNA 4JFVA 2D3NA 3FW6A 4AZ6A 2XVNA 2E8ZA 4QFUA 2ZE0A 3EDEA 3WUFA 3BAYA 1U33A 2D23A 2E40A 3BMWA 4GI6A 3FAXA 4AYSA 1TA3B 5E0CA 3N9KA 5A8QA 5AY7A 2J8GA 3WDHA 3VIHA 2QV4A 3DECA 3E1F1 3TA9A 1EO5A 1CIUA 2BY2A 4OZOA 1PIFA 3FNDA 3WMBA 2ZUMA 3AMCA 3SUSA 1YQ2A 2YDQA 2EPKX 4QP0A 2A3BA 4JL2A 4GKLA 4WKAA 3MKKA 1CBGA 2CESA 3PTQA 1VEMA 4AD1A 1CGVA 3KEHA 1E4LA 4YHEA 4Z2KA 1DWJM 2PWDA 1OSEA 5HXMA 3B9DA 4OKDA 1MVYA 3OZOA 1I75A 3VDBA 4BCEA 4L4OA 3K46A 5A2AA 1VIWA 4UTFA 3LPOA 2BV9A 2DEPA 1W2PA 4ZXLA 3VGGA 1DEDA 2WNWA 2BHYA 2G41A 2D3LA 2Y24A 2CIPA 1FFRA 1CDGA 2XTKA 7TAAA 2DIJA 4J3XA 5HDRA 2E8YA 2WMFA 1RP8A 4GQQA 3CUHA 2VTFA 4XB3A 1WDQA 1GOIA 4B9YA 4HOZA 5CPSA 3WQ4A 1UR0A 3RILA 1V0NA 4QLKA 1KWKA 2XSAA 5A6LA 1ZS2A 3W26A 4AZGA 3AZRA 1PZ2A 3UESA 4MB1A 4W84A 2X05A 4QCEA 2XUCA 3RCNA 1H0GA 3TOPA 1JI1A 5IFPA 3F5KA 3MS8A 1JZ6A 3WD4A 4NZCA 2Y8VA 1HJVA 5BXSA 2J74A 2YLAA 1XCXA 2DH3A 3AHZA 3A4AA 5CG0A 4P8VA 1H41A 2W62A 3A3HA 3FN9A 1GPFA 3GXMA 1GOQA 3CZKA 4HPGA 3GXDA 2W67A 1W2VA 1LG2A 4C7DA 1VFFA 1EIBA 3VIGA 3ZM8A 4KH2A 4F79A 1JAKA 3WELA 2XSBA 1ECEA 3W37A 3RM9A 1E73M 3AZTA 2XVLA 4JHZA 4WSKA 5LA0A 2YIHA 1W91A 3AXIA 5BYWA 3B9EA 3BAWA 1B3WA 2E9MA 3O2LA 1SYTA 3N15A 2W5FA 4J27A 4HA4A 1CNVA 5FCZA 5HNNA 1QBAA 1QBBA 1CWYA 1E1EA 4XZWA 3W53A 2FHCA 3THDA 1JFXA 4W8AA 3AMGA 1EQCA 1D2KA 4UFHA 5A6BD 3M7SA 1VBUA 1SMAA 3ARQA 3CLWA 3LPPA 1XSKA 3I3EA 4IUGA 1M03A 2C0HA 1NWTA 2WHJA 3EMZA 2DDXA 1QHPA 3MUY1 2VZVA 1CXHA 1DHKA 2PWEA 2WVVB 4UQAA 4JAWA 4HA3A 2XHYA 4CN4A 1KGUA 1UOKA 2WM0A 1J11A 3G6LA 1JZ3A 1G5AA 1K9TA 1H4PA 2D2OA 3K4DA 4X0NA 4A3YA 3AIRA 4FLRA 1WNOA 4U5KA 3AHVA 2VQUA 5M03A 1ITCA 1DWAM 4MB3A 3EDDA 2D22A 1UH3A 3ZJ7A 2VCAA 4AD0A 3WQWA 1CZ1A 3POHA 1B30A 1ZBCA 1WP6A 2D1ZA 5A94A 3MMDA 1ITXA 2EXOA 3AOFA 1GJUA 1V03A 4M8UA 4AZCA 6CGTA 1XCWA 1E6QM 2YBTA 1PJ9A 2DPEA 4W7WA 2DSZA 2WZIA 2WBKA 2PBGA 4MB4A 1PBGA 1W1TA 4AZIA 1BG9A 4W86A 4YHGA 1D3CA 1J01A 5DT5A 3L4UA 2AAAA 4CCCA 5A8MA 3AFBA 4DUWA 2FGLA 4PTVA 3AZSA 1TCMA 1XYZA 3G6MA 4CVWA 3VGBA 1X6NA 2EJ1A 1Z32X 1VFUA 2XWEA 1JZ4A 2YL9A 1EDQA 5BCAA 5I77A 4F8XA 4MPKA 3ARTA 4AY1A 1EHNA 4MADA 1Q4NX 1WB0A 2FH6A 5ABHA 5A2BA 1ZJBA 1V3JA 1X1NA 1JAEA 1R87A 4AZHA 1G0CA 1FH9A 4TVDA 1HP4A 3N1AA 4MB5A 5ECUA 1VFMA 5CGTA 2J7EA 4X9YA 2A3AA 5AC5A 4PMVA 1J0HA 3WFLA 3SCQA 4EK7A 5D8WA 2WMIA 3VD9A 5GQBA 3WKZA 1QHZA 1CXKA 2OYKA 4AEEA 4EANA 1GQJA 1Y7VA 1WDSA 3VIFA 2YKKA 3W0KA 3W81A 5LA2A 1UR1A 2V3FA 1GQKA 2CBJA 2QPSA 2V3GA 2DSUA 4RE2A 1JZ2A 5ABEA 4QAWA 4RE4A 3L2MA 2Y8KA 4NSBA 3WEMA 4DWSD 1E43A 4V28A 5IHSA 4PTWA 1W1YA 1G1YA 5I78A 3PZUA 3U5YA 5DO8A 1LQ0A 4MNKA 2OWXA 3BCDA 4AEFA 1J0JA 4S3JA 3VD5A 3VILA 1O6IA 2ZX5A 3PZNA 1FH7A 3K1DA 4JFTA 1QW8A 1PPIA 3WQVA 1FOBA 9CGTA 2VJXA 1V6XA 3OLEA 2WZHA 1E0WA 2BNJA 1MXDA 4CKQA 1UR8A 2UWFA 2WC7A 3VX0A 4AWEA 5HPOA 2VO5A 1OM0A 5M3WA 1NP2A 3DYPA 4M24A 1W1VA 2GK1A 2WXDM 2DSVA 2VR5A 3NDZA 5CQ1A 2VVSA 4U2YA 4KGJA 4PN2A 2XG9A 4D1IA 2G3JA 1KQYA 2JIEA 5FKYA 3AXXA 5GNYA 5C71A 3EMCA 1EDGA 2D0HA 4TTGA 1GJWA 2VZUA 4AZCB 1LF1A 1OIFA 3PTKA 4BF7A 5DFAA 5I23A 1QOXA 1KR0A 5I2UA 1BFNA 1BAGA 4U33A 4FMVA 2X8RA 3GNOA 2ZXAA 4HPHA 3RPMA 3N11A 3W6LA 1PX3A 3SUTA 5JUVA 5EFDA 4HA1A 4JL1A 1BVZA 2ZX8A 3ZJ6A 4D6HA 2VURA 3II1A 4TOQA 4UFIA 2Q8XA 2YDSA 3WBAA 2VZSA 3FAWA 4M29A 2YA1A 3WH5A 5A6JA 2DQXA 3BLKA 3CPUA 2VVNA 5A6SA 4LGXA 3OA5A 1X6LA 4B3KA 1FFQA 5AC4A 4CN1A 5KZ6A 2XIBA 4UFLA 3WUEA 3D5HA 4J3SA 3MUAA 3CGTA 1E70M 1KQZA 3ARPA 1E5NA 1L0PA 2J62A 4CD7A 1UZ1A 1IV8A 1GHSA 3OGVA 3VGEA 3AHYA 2X09A 3KL5A 3THCA 3GBDA 3OLIA 4IPLA 4TTUA 2JIWA 3T2QA 2WLZA 3MV01 3BAKA 3AIEA 1CENA 4ATDA 5A95A 1LL7A 2DGAA 3AYRA 4WIWA 2J4GA 4PCTA 1HNYA 2VMFA 3L4XA 3VMNA 5A2CA 1B3ZA 3RM8A 3CHEA 3ZR5A 3GXFA 3K8KA 3ZSSA 3N04A 5GNZA 5DEZA 2D24A 4GQRA 2XVGA 4EKJA 5GNXA 4KRTA 4PUEA 1HP5A 1K9DA 4PSRA 1UKSA 3QHOA 2B31A 3O6AA 1K9FA 3MMUA 1E4NA 4J3WA 2XIIA 1JF5A 1XH0A 3AIUA 2VC9A 3TTYA 4M56A 1MQRA 2J77A 4B9ZA 1JIBA 4F9JA 2VZOA 1CGWA 2WMJA 1E4IA 4TVCA 3T08A 3AI0A 4D6EA 1DWIM 2WMHA 1ZBVA 1KCLA 2UY4A 3AQUA 3SUWA 1HL8A 2CEQA 3M46A 3OB8A 4XV0A 4R27A 3RO8A 4JKLA 5D9PA 5CLTA 1VF8A 3K4AA 3PZTA 5JIWA 4D6GA 3RDKA 3CMJA 1R8LA 1JI2A 3UCQA 3WMSA 4QDMA 4H7VA 4ZFMA 2ESCA 3VDAA 4TX6A 3WD0A 2XJ7A 3GDBA 5FOOA 1VFOA 1HL9A 2ZUSA 4AIOA 2VRKA 3EDJA 4Y7EA 2QPUA 3AS1A 1CPUA 1HJQA 1GOOA 3OZPA 2XPKA 3VIMA 1SR0A 5BRQA 1BYAA 2DSWA 4AD4A 3UG3A 3EBVA 5IFTA 3UG4A 2WCAA 5I0DA 3WH8A 4W85A 2QMKA 3WDQA 1PIGA 4LYRA 1H3GA 2W63A 1H09A 4Z2HA 1JDDA 1JZ8A 3WQ8A 4UOZA 4Q22A 3WDPP 3TP4A 2ZIDA 1CECA 1TFVA 2YL6A 4OOUA 1W9XA 4DM1A 1C8QA 3GYCA 2X1IA 4P7QA 1ZL1A 3ZMRA 4GZIA 1B3YA 3A4XA 3GH5A 1JD9A 1Q6DA 5C8BB 1ISWA 1B0IA 2WWDA 2VOTA 1UWRA 2WK2A 1BGAA 1E56A 3AHTA 1B3XA 4H2CA 4AIEA 3N17A 1VJSA 5EB8A 3PZ9A 2A3EA 2O9OA 1FP9A 3MSGA 1UD6A 1JZ7A 2CPUA 1QI5A 1W9PA 1KGXA 1ZBKA 3RM4A 5FD0A 5JBFA 1R85A 1V0MA 5BROA 3LPGA 2Y2WA 3SCOA 4AZ7A 1K9EA 1OWQA 1B90A 2J75A 2BXZA 5A6AA 2JEPA 4UCFA 1CTNA 2CKRA 2QMJA 3L4WA 4Z2LA 5E6ZA 1JYWA 2WVUA 1KR1A 4B3LA 6TAAA 3WF4A 4JFSA 4JFUA 1JF6A 2EO7A 4D6CA 4TUFA 1OINA 1J18A 1BHGA 2OSWA 3WF2A 5F7UA 1QNQA 2BXYA 3VIOA 3WUGA 1BVNP 2JFEX 1EOMA 4CU7A 2PWGA 2WHMA 5CJ5A 2JEQA 2IXUA 1HKJA 1PZ3A 4RL3A 1U2YA 4CD4A 2GSJA 1NP0A 3TTOA 1R7AA 1S46A 1KB3A 4KRUA 3WN6A 1KXVA 4PMRA 1V6WA 2J47A 4H8HA 4W89A 2EPOA 4JFWA 3VGFA 4LYQA 1KWGA 5CPTA 5LA1A 1EA9C 2J8FA 3MMWA 1EO7A 4M81A 3WDJA 4D6JA 3NUKA 4ZE5A 1B1YA 3WY1A 4ZENA 2V3EA 5DT7A 3PZVA 3KL3A 2VNCA 1Q6FA 2GVYA 2A3CA 3WNLA 4HZ6A 5A8OA 4HZ7A 2DT2A 3TTQA 1D7FA 2DIEA 2ZX6A 1UWIA 1W3KA 1R7OA 1RPKA 1C8XA 2QHAA 3WF1A 4D6FA 4H8VA 1OIMA 1QNSA 1H0IA 5E6YA 4URIA 4W7UA 1TA3A 4UFMA 2VCCA 3DC0A 2ZUTA 1UWSA 1YHTA 1NOWA 1HF6A 2PF0A 1PAMA 1JXKA 2YOCA 3T0BA 4DUVA 3ARRA 4E4PA 3MANA 1H2JA 4IM4A 3CH9A 1CEOA 4ZE4A 3BAXA 3KZSA 3SIMA 1UQZA 4LQ1A 1MXGA 1WDPA 3WD2A 1GQIA 1QW9A 5A6KA 1KBBA 3KE0A 1UD5A 4MJ2A 1GOKA 1EXPA 1H1NA 1VRXA 1PX8A 1XGZA 3WNKA 2WVTA 3PZMA 3M07A 4BQ5A 3O9NA 3BMVA 3HN3A 4J3UA 5CLWA 3ZT7A 1ISXA 2DSKA 4L4PA 3SCSA 3WD1A 1V02E 5EFFA 1XH2A 4EAMA 4GO9A 1E0VA 2CETA 3ARUA 3WUBA 2WBGA 5HPCA 2XFYA 3DHUA 2RGLA 2NT0A 2J7BA 2ZXBA 4P7LA 2VUYA 2WKGA 1BF2A 1QPKA 2WMGA 4U3CA 2IXVA 1IZJA 1WO2A 1V6UA 1HJXA 4HP5A 2J7CA 4UQEA 4W5ZA 5ABFA 1JDCA 3AJ7A 1E15A 5GPRA 4ACZA 1NQ6A 1TUXA 4HMCA 3FHQA 2YJQA 4PMUA 2WCGA 3PZGA 1JZ5A 1MW2A 4ZXOA 1TR1A 1HKMA 1ISZA 2QLYA 1ZU8A 1QNOA 3SCUA 5FIPA 1EQPA 1UD8A 4AD5A 2AMGA 1GORA 2OYLA 3POCA 3WFZA 3GXIA 2JF6A 4JKMA 2GJXB 2XGIA 1CGTA 4GPNA 2FGZA 2ZXQA 1W9UA 3VNZA 1TVPA 1OT1A 3BSGA 1UKTA 2NT1A 2HVMA 4F66A 3B9AA 4R5EA 3LPFA 3VDHA 3AIQA 3VINA 7A3HA 1C92A 3CUFA 1V6YA 3N12A 4HMDA 1JYNA 1E5JA 2UY2A
chains in the Genus database with same CATH superfamily
4PMOA 1UQYA 1H1ZA 2B4GA 5D09A 1R9YA 4IMDA 9RUBA 5LXEA 3SRHA 3MUIA 4QT3A 4O18A 3IS4A 5B80A 1EJSC 1GZ1A 4MNJA 4W7VA 3SSZA 4LAOA 1XC4A 3RMEA 3OBAA 4JR5A 1PE1A 4M1BA 8CGTA 3PSVA 3P5YA 2J7HA 4W88A 4A8NA 2W3ZA 2WQPA 4H7CA 5AN7A 2ZX7A 4DJFC 1C7TA 3FK4A 4W4QA 2RDUA 5DMYA 5J04A 3FIGA 3CUGA 2AL2A 4M6UA 4F9DA 5AHMA 3CWNA 1TJRA 2PDYA 1QWKA 1TCOC 4O10A 3SY5A 1JNEA 5TD4A 1J9YA 3WDRA 4K7VA 1EJWC 2J6XA 1SMDA 2Y7FA 2VL4A 5BNKA 2HK1A 4E2OA 4PMDA 3WNNA 1GVIA 2GUBA 3B4YA 3DGBA 1EEPA 1B9ZA 5E09A 4U28A 3WZ0E 1VBRA 4FNPA 3V0UA 4MNLA 3ITGA 1X39A 2WJFA 3S5YA 1SZGA 3IRDA 4DJDC 3GH7A 1NAL1 3JZUA 1UH2A 3O3RA 3TJXA 3VE9A 5I6SA 1UWUA 4AZBA 4NF7A 1H61A 2VX6A 1GNXA 3SDOA 1XDLA 4MUPA 3S0CA 4NUWA 4O13A 4H6EA 1H1YA 1J0ZA 2R1PA 2ZXDA 1M7XA 5JH2A 1LM1A 3H24A 1SU5A 7ENLA 1E9IA 3LMZA 3EIPA 1MQQA 4WZHA 1FD9A 1UB3A 3UVIA 2Y5EA 4JTSA 1LRTA 1H7NA 2CYGA 4ODLA 1BQCA 4GJ1A 3W86A 4HYRA 4LB3A 1QASA 2Z28A 1MFUA 1GW9A 1UYQA 3PC0A 1ONWA 2D9FA 3W00A 1JULA 4BF8A 3ARZA 1WAWA 3MYOA 2TMDA 2UY3A 4UC5A 3Q94A 1A5LC 1W1B1 1CB7B 1PWMA 3QYQA 1SSDA 2QJJA 2RJHA 1TZ7A 3QTGA 1GQLA 3MCMA 2QUNA 4JCMA 1F8MA 3AHXA 4B4HA 1UKOA 1ZP3A 3IRSA 4K2SA 4NT0A 1VR6A 3FHAA 2XFWA 1V3IA 1XUZA 1R86A 2L2SA 1F8IA 4JIEA 4R9OA 3TN6A 3R12A 5CPOA 2P3EA 1RH9A 1D3GA 3NQ2A 4FPSA 3QHMA 3VABA 4EPDC 1H7PA 2HDJA 4D8ZA 1XLBA 3C2EA 3O5DA 4UXDA 2J7GA 2WKLA 2D0FA 5EU9A 3CEPA 3UYCA 1SJCA 3KOYA 3SI9A 1KLYA 2D73A 1R3SA 2GJPA 4N9DA 4LJ3A 3S2CA 1W5MA 2F38A 3W83A 2BHZA 1R2TA 4YTUA 2VDIA 3EPOA 1WCGA 1R30A 4C1LA 2GQ3A 3SCTA 3NO5A 5C9UA 4LUIA 5DMNA 1WDRA 4DPQA 3STEA 1AD1A 4AHQA 2G0WA 3TK7A 2PA6A 5CZKA 1NWUA 2YA0A 2JE8A 3UXIA 1WAUA 2RDXA 4QJ3B 3ANVA 4J3TA 5G1TA 3O7UA 2NXGA 1MQPA 5I00A 4GXWA 2BZNA 2EPMX 2JALA 1EGZA 2Z29A 2BVDA 3H6OA 3RX2A 2CLFA 3NRKA 4AH7A 1N7KA 4GA8A 5DMLA 2WSRA 3TN5A 4GIAA 3TCSA 2WMKA 2PDBA 3PWGA 1SO3A 2A3LA 1CXEA 1QWGA 4CCEA 4AMCA 5BXPA 4KBXA 4IISA 3E49A 1E0XA 1BD0A 2TPSA 2GOUA 4E3TA 4MZ8A 1YX1A 4NAEA 3UJFA 3F7JA 3FKRA 3DCPA 4G1KA 2GDVA 1XP3A 4EPKA 4AAJA 3W7OA 3GTNA 4K36A 1E6NA 1VPXA 3KADA 1YXYA 2FHFA 1TX2A 4P5UA 2HE5A 2AAMA 3PAOA 3CQKA 1F2JA 1JNDA 4GGQA 2ZZ7A 2WZEA 1HGYA 1WXZA 4F0LA 3VD4A 3UJRA 1DWFM 3ZO9A 4MY9A 4FHAA 4XVDA 1QPFA 3OYZA 2RHGA 4K39A 2PE4A 2PGWA 4TX0A 1N82A 4H1ZA 3MMTA 2YXXA 1KTNA 5HW7A 2CZ5A 1Z48A 4MM1A 4RE0A 1WUFA 3F4WA 1ZB5A 1P1MA 5G4HC 1C7SA 2Y78A 3UETA 4BI7A 4BA0A 1EF3A 5M17A 4PMQA 3BOFA 1VENA 1JCHB 4TX8A 4E4FA 4N6EA 4B90A 2XFFA 2FZDA 2ONEA 2GZXA 3STPA 3CMGA 1TVLA 3PBGA 4G50A 3IVSA 5LYRA 3R13A 3NPWA 3KDOA 1FWTA 1EYEA 3U48A 1L1PA 1AZ1A 2J25A 1B2YA 5CPQA 4QXIA 3ZQ9A 3L0GA 3EB4A 2WOQA 2V38A 3W38A 3T4CA 3EX1A 2PP1A 2RDTA 3P8JA 3H4GA 3B8SA 4UZUA 3WLQA 1H5VA 2V2HA 1OX5A 1DTUA 1W5PA 4JX4A 2PLCA 3WYZA 2CXGA 4GVFA 1J0KA 4YJ5A 1P0DA 4O8AA 8XIAA 4LYKA 1TMHA 4JN7A 3NZ1A 2EQDA 3DZ1A 4W8BA 1GK8A 4C6LA 1CXIA 3CASA 4GIVA 2YSWA 2ISFA 2HROA 1PIIA 3IJ7A 3ABOA 4DF0A 4ZQPA 4AW7A 3GVQA 2IPGA 2O0TA 1EKOA 2E3ZA 1PSCA 3LD5A 1S5VA 1ISVA 1J79A 1ONRA 4UR7A 1L8NA 3H8AA 1ME8A 2W79A 3CZLA 3M9YA 1S5MA 3IAQA 1WKFA 4B2DD 5IOBA 3T44A 1GOWA 2XIOA 1W9VA 1OFAA 3OHIA 1FUYA 3E6EA 3DGRA 1R46A 3V0TA 5I3FA 3EXSA 4CQDA 3NWRA 3MUZ1 4U2ZA 4HJWA 1WA3A 1K8XA 2YCJA 4FF5A 3OEXA 4JGDA 4LAKA 2WCSA 3R43A 1MNSA 1NDWA 4OUEA 1F5ZA 3MDWA 1LWJA 3HPAA 1L6FA 2ZDRA 3GKFA 4YN5A 3BZJA 2Y5SA 4UFJA 4ICCX 4PMXA 1E6XM 3AXHA 4V27A 1X8CA 2OQYA 4JTCA 4WY0A 3LOTA 4M7TA 5CZ0A 5D8ZA 1Q65A 3W3OA 3WNMA 4KQZA 4JFKA 2A0NA 2QKFA 3ITLA 4GY7A 4JTKA 2IPJA 6XIMA 4WDUA 4MFDA 4WK9A 4NHVA 3SN1A 3E2RA 4LV9A 1EX1A 3GH4A 3IV3A 3RJXA 3EDKA 3I4EA 3WSUA 4DEFA 1R9HA 2IPFA 4O57A 2ZQSA 4N2YA 3W1AA 3KOZA 5BXTA 1NWRA 1JPIA 4DWSC 4W5UA 2FB2A 2OTDA 1QXLA 3W1XA 2W91A 1E44A 3A47A 4FLOA 5H6HA 3LQGA 3STGA 3PUOA 1DJYA 3WQPA 4O54A 1LOQA 2WVSA 4JS3A 4WGHA 2IW0A 5C55A 2RKXA 5ECVA 4C6QA 4DY1A 4HBKA 2WB5A 5K7JA 5M2FX 5AYIA 4Y9NA 4DYEA 4S39A 5D30A 4MUZA 2J13A 5AYXA 1OZMA 2VHLA 4BZYA 4O1DA 1CGUA 1BEUA 2QVHA 1WKEA 4LAXA 1OT2A 1J0IA 4G7EA 2VQTA 4CEUC 4BFAA 1UR4A 2DT0A 4EACA 1GG0A 2CHOA 2QF8A 2E6FA 3K8LA 3ZLFA 2P0IA 3DYOA 4GJIA 3U6WA 2JZVA 2FH8A 4LUJA 2BGQA 4MG4A 3W01A 4K68A 1NH6A 4CCZA 2BY3A 4H8UA 5D02A 1M53A 2MUCA 1W56A 1D9EA 1NDYA 3BLPX 3HG4A 4FI4A 1KXHA 3R4IA 3TW9A 2DZAA 1QI0A 3PSWA 4O11A 1LT7A 1HJUA 3O15A 3W7QA 3VNJA 4JKKA 4AX7A 5JIPA 2DG4A 2AOSA 3ZR6A 3SCRA 3LHYA 4GGBA 4Q6XA 4F0SA 3SN4A 2ZZ3A 4JIRA 5DCBA 3MB9A 4LPCA 3N29A 1GUVA 3BO9A 3CT7A 4GNJA 1GVYA 1LROA 7XIMA 4LANA 4K7YA 1Z6KA 4DAFA 3O5QA 1OGSA 2A79A 4WJXA 2XN2A 4FXJA 3W71A 4XQ6A 3WENA 2YBUA 1FDJA 1V0LA 3WJZA 4WY0B 3VFLA 3TR9A 3PG8A 3CHFA 4LS0A 1O5RA 3ISIX 3F4NA 5KETA 3SR7A 4F0KA 3KOXA 1NOFA 2GVEA 2O9TA 3DHFA 3IWPA 1F6YA 2OZTA 3J7HA 2VX7A 4HNUA 3S6TA 1NU5A 3KBVA 2MLZA 1NJJA 1R0MA 2DT3A 1K03A 3EKLA 5EBAA 4GFSA 7REQA 2EF9A 3ARSA 3ODKA 1G67A 1MWOA 5D03A 3ZSTA 7PTDA 1HIZA 1CX9A 3V1PA 3I3DA 1L2QA 2A2IA 4JTAA 1L8PA 4WDXA 2VX5A 2Y61A 1M9HA 1TPFA 2GVJA 2CKSA 3KVKA 3VX1A 1KCKA 1R9XA 5K2ZA 1TCDA 3W1NA 4ILSA 5CSSA 4JEJA 4JXCA 4YU1A 4U85A 4XTDA 3RMJA 1J12A 3OGRA 1IZKA 4PTMA 5A6TC 2R91A 3N2MA 5CAKA 1VFLA 3NDOA 4MY8A 3TTSA 2VEIA 3NQVA 1QR7A 4S2BA 5H8MA 3WF3A 1F3TA 3FS2A 4OJYA 4AISA 1JRBA 1TUFA 4XSMA 4GY1A 3SRKA 2OVLA 3EB2A 2V3DA 1YNQA 2CXEA 1GVQA 3GWQA 5HANA 3BVJA 5A6MA 4HBOA 5A6BA 2VFGA 4I8YA 3T81A 3P6LA 1Y5XA 1QHOA 3VTRA 2WNNA 3PN8A 3EA3A 2GOKA 4RNJA 1KFEA 2CHRA 1GHRA 4CN6A 5DCDA 1ADOA 3BK0A 3NURA 3TJIA 3QY6A 4B15A 3PBYA 1DORA 5D9OA 2BY1A 3DENA 3WBYA 3C2RA 4CQ8A 4JFVA 2H9AB 2RH9A 4NILA 2XVNA 3EWBX 2R14A 1K4GA 1H50A 4GJJA 2RFGA 1TA3B 3N2XA 1I0BA 4LTSA 5A8QA 5AY7A 4DZAA 4Z1DA 2DZVA 2J8GA 1KTBA 3QY8A 1VCGA 4Y96A 3P60A 3LQLA 1EO5A 1CIUA 4EF8A 4KFOA 2ICSA 4LNYA 1OFEA 3SUSA 3P7YA 2YDQA 2EPKX 2HV5A 1JUBA 3IIOA 3TCEA 1CBGA 3H70A 1VEMA 1UBPC 4AD1A 4GVIA 4YHEA 5HXMA 2YZRA 3LGEA 3PJWA 4HSHA 2A85A 3V4BA 4HYVA 1MVYA 4J4KA 1WOAA 4WY0F 2BWGA 4DH0A 4ZS6A 5T91A 3FEMA 5I02A 3QY7A 2DEPA 1W2PA 3V18A 2M2AA 1AJ2A 2WNWA 4LAVA 2D3LA 4MF4A 4DO7A 3MVTA 3VOGA 1JRCA 3NFUA 3W1MA 2XTKA 3R25A 4IMFA 3ES8A 5HDRA 5FJIA 4GQQA 4XB3A 4B9YA 2BASA 1UR0A 2R1NA 2QCHA 4QLKA 2ACRA 2XSAA 4GIYA 1ZS2A 3AZRA 1L6SA 3LGGA 1GVOA 2DZTA 4GUFA 3RCNA 3F5KA 4YXGA 3WD4A 4NZCA 2Y8VA 1XCXA 3WH0A 4UMAA 1XLGA 3A4AA 1DTNA 3MI3A 3W76A 3A3HA 4C6NA 1WDWA 1XM3A 3GXMA 1GOQA 3WLOA 1EBHA 1TJ2A 1FCQA 4HCDA 4LT9A 1W5QA 1SO6A 3W7EA 3DESA 2XSBA 4I9TA 3R2GA 3VUSA 3W37A 1NQKA 3AZTA 1I2NA 2GJNA 1W91A 2OJPA 2BOEX 1Q6HA 3ABZA 4S2CA 5BYWA 3B9EA 1XKYA 2QJNA 2W5FA 2QUMA 4XZIA 5HNNA 3M0IA 4O12A 1DJIA 4XZWA 3W1LA 1B4EA 1WQ5A 1YXDA 4W8AA 3ATZA 1EQCA 1UBSA 4UFHA 1XFCA 1EYWA 4R33A 1BKFA 3HGJA 4QGCA 1GVRA 4LU0A 2DDXA 1QHPA 1XS2A 5C5YA 3VKDA 1DHKA 3RN6A 4BK9A 5SWUA 2WVVB 1GOXA 3VI2A 4O15A 1UOKA 2ISVA 4KCWA 1I6NA 2Z2UA 3M1ZA 2WM1A 1QPNA 3GDLA 3M0ZA 2D2OA 3GUGA 4X0NA 3UNTA 4ORIA 1WNOA 3CLMA 4AVOA 2XH0A 4NNBA 3W6YA 2HBXA 3R79A 4AD0A 1ZBCA 1WP6A 3OODA 4EWJA 1W26A 3W1UA 2QCCA 3CT2A 2EXOA 3ITTA 3WQCA 4IGHA 4A22A 2DIKA 1E6QM 1PJ9A 3S5OA 4TW8A 3H2OA 2E1DA 3P0WA 4M6PA 2WBKA 2PBGA 4TV5A 4ZTXA 1PBGA 1W1TA 4J1OA 4YHGA 3T6CA 3ONCA 1A7XA 1B5TA 3N34A 1KA9F 1I2RA 2ADAA 3AFBA 2C18A 3GXNA 3QPYA 3AZSA 1Q45A 2PGFA 3K5XA 2EJ1A 1AH0A 2XWEA 4BEUA 1IEVA 4L56A 4ITZA 3Q4DA 4REQA 1V8EA 3ARTA 5HKGA 4AY1A 1EHNA 4MADA 1NFBA 1WB0A 5TNVA 5MKGA 2XSXA 1ZJBA 4JTGA 1IT8A 3TE9A 1R87A 3P3BA 4C6MA 4TVDA 1HP4A 2R8WA 1WDDA 2G97A 3UI5A 3N1AA 5HMDA 4ODMA 1TZZA 4XD3A 4IPJA 2CZEA 1VFMA 4QSFA 4DAIA 4YVPA 1UC5A 3KFTA 2V8ZA 3VC5A 3B3DA 2PTDA 4EK7A 3T9PA 4Q4QA 3OVGA 4HMNA 1LOLA 1P6BA 1GQJA 3KS6A 4GXMA 3MP3A 5K9XA 3GX9A 1GQKA 2CBJA 3KX6A 3C3NA 4DRKA 4QAWA 4RE4A 2Y8KA 5IHSA 2GGEA 3A24A 3EY6A 3OZMA 1G1YA 4ZPVR 5I78A 1TV7A 5I7GA 4HNNA 2C15A 3T4WA 4MNKA 1X7IA 3NQCA 1TJ1A 3G1XA 2WZTA 4S3JA 1M5YA 3VILA 1TO3A 2HZGA 1FH7A 5B8IC 2P76A 3IJLA 4JPGA 4Q4SA 1IHIA 2MLXA 9CGTA 3O1NA 1V6XA 4QQUA 3DX5A 3GK0A 4HD5A 3AUOA 4AWEA 3HPXA 2PD5A 3VKCA 3HM7A 3PJXA 2OMAA 5LZLA 2DZBA 3DYPA 4M24A 2G4JA 4MVAA 2NSOA 5CQ1A 4DZIA 2CZFA 5E93A 2HMCA 1NMWA 3PNUA 4H9MA 4U2YA 3UPWA 4QDPA 3QZ6A 3M64A 4XAPA 2XGZA 5KZMA 3BLDA 2GYIA 3R8HA 2D0HA 5HR7A 1GJWA 3I68A 2FTPA 4X63A 1FKWA 5B7ZA 3PTKA 2PDWA 3AXKA 5I23A 1QOXA 3FA3A 5I2UA 4DZHA 1KFKA 5HUOA 1XYAA 3M0KA 3B9NA 3BLEA 3GC5A 5HW6A 1XLMA 4Z1CA 4RDZA 1D7JA 1U5JA 3SGUA 4FMVA 2X8RA 4HPHA 2ZXAA 3RPMA 3K2GA 1KM5A 5T8GA 3FVDA 3QC3A 3W6LA 2INZA 4RNHA 1Q85A 1BVZA 4XISA 2VC5A 5CPNA 3WBAA 4M29A 4R3UA 3NAVA 4H6KA 5EGRA 3HQOA 3QKEA 3DBNA 3WK1A 3W73A 4UCGA 1HXVA 1U22A 3VKAA 3USZA 4CN1A 2XIBA 4POCA 3WUEA 3D5HA 4J3SA 4RKAA 4OT7A 3TQ0A 3I6CA 3CGTA 1U1HA 1E5NA 1IV8A 1GHSA 3OGVA 3AHYA 1F7BA 3GBDA 3L2IA 4ZR8A 4IPLA 1QW7A 1TRIA 3CO8A 2JIWA 4IMCA 1XGEA 3DKLA 3H54A 3QFWA 4ATDA 1OZQA 2DGAA 3GTXA 1HKWA 4RZ4A 2HQAA 3L4XA 4FOUA 4I7VA 5A2CA 3E9AA 3CHEA 3K8KA 4ZB0A 4ZMGA 4JY8A 4F2TA 5AC7A 3BPWA 3TYBA 1PTDA 4GBDA 3ITOA 4F2UA 3QHOA 1TELA 1K9FA 4WX2A 1OABA 4UTHA 1E4NA 4L6HA 4BWLC 1E1CA 1REQB 1XH0A 4DZ5A 3GFXA 2Y63A 3TTYA 4B9ZA 3S1UA 1E4IA 3NQMA 4RPQA 3ZLGA 3CYVA 4NAFA 4GBUA 3M5XA 3NQAA 3OIXA 4XZ9A 3WLIA 2PF8A 3M46A 3URBA 3URAA 1BXBA 2EPHA 4PEKA 1IXOA 3LHUA 4IMEA 1D8CA 3K4AA 3PZTA 2ZRYA 3JZEA 3UCQA 1H5YA 4QDMA 4K6AA 4ZFMA 2ATSA 2ESCA 3VDAA 3GB6A 1ZALA 1QFEA 2VR2A 2PGEA 4MKNA 3VA8A 2G95A 4H6QA 3FJ6A 2PZNA 5CGQA 1UWAA 2QPUA 1J2BA 3OZPA 2XPKA 3VIMA 2XIJA 3CNYA 3AU6A 5FJUA 1V77A 4NZ4A 1ENUA 3UG3A 1Q6UA 2IQTA 3WK0A 2WCAA 4LY4A 3WH8A 3EX4A 1NSJA 3NVTA 1Q3NA 1YW5A 2L5HA 2VFEA 3E2SA 4UTWA 4Z2HA 3MSYA 1JZ8A 3WQ8A 4UOZA 3TP4A 2VGGA 1J5TA 5CPLA 1KM0A 1M41A 2HK0A 1DOSA 4LUTA 3W1QA 1FWBC 3SAZA 5C8BB 1ISWA 4IJRA 1VRDA 2R82A 4A2SA 3JVAA 2VELA 2YCEA 1BGAA 3CV6A 5HUPA 3OHMB 1DPMA 3UXDA 1B3XA 3GVWA 3SW6A 3TXZA 2NQZA 4AIEA 3IVTA 1FWNA 3PZ9A 5F4SA 3QRHA 1JZ7A 1UD6A 3NO1A 2CPUA 4L6DA 4C6IA 1YDVA 4QS5A 1DIDA 3GAYA 1R85A 3BQ5A 3PF3A 3NO3A 2Y2WA 4AZ7A 1TPDA 1UOZA 1FWJC 3H21A 1N55A 2BXZA 2X7WA 4LEQA 2JEPA 1JPHA 1CTNA 2R9RA 1L6GA 1HO1A 3TA6A 2QMJA 4I5XA 4L9YA 1V7AA 2PPOA 4B5VA 4CQCA 3B40A 1KR1A 4XBJA 2ZCGA 4XIAA 4F0MA 3HO8A 4L64A 3VDGA 4JFSA 1DE5A 3M0YA 1SFJA 1J93A 1J4RA 4IQDA 1S5WA 4KWOA 3HBLA 1BRLA 1Q6OA 3GE7A 2OSWA 5F7UA 3VIOA 1BVNP 3GR7A 1EOMA 1ZSXA 3HZ3A 2IXUA 1HKJA 4BJHA 5BOFA 1PZ3A 4RL3A 1U2YA 4R85A 1GKRA 1W3NA 3W7LA 4KRUA 1H7WA 1IZCA 3PTDA 2Y85A 2QULA 1LDCA 2EPOA 4DVOA 1FWIC 3OBEA 2J8FA 4M81A 2OLAA 4D6JA 2XP8A 3DFPA 4N4PA 3BJFA 3WY1A 2FGBA 1XCFA 1Q6RA 3E5PA 5FF3A 2QCLA 3WNLA 4HZ6A 4HZ7A 5AVHA 4QEEA 3TTQA 1J4IA 4RW5A 1A5NC 3FFSA 5CCZA 4Z1BA 1C8XA 2GQ8A 4D6FA 2ASHA 3QKZA 3O0KA 4H8VA 3SECA 4US5A 5E6YA 1M7PA 4URIA 4W7UA 1TA3A 4XWUA 2QVNA 9XIMA 1QZ2A 3CHVA 2JBMA 4YCOA 1NOWA 2QPXA 4RW3A 2VEFA 1PAMA 2C71A 3M44A 3MANA 4IM4A 3GKAA 4ZE4A 4A3RA 4EXBA 4XAKA 1UQZA 1FWDC 1I4NA 1MXGA 3UQNA 4JNYA 4NAEB 3WD2A 4LVAA 2AKZA 1J4EA 4F4RA 2QAFA 4DJEC 2WVTA 4BQ5A 3O9NA 3BMVA 3HN3A 4DZ3A 4HPNA 1VGAA 2DSKA 4JIPA 2QIIA 3C52A 3TTEA 3GNDA 2OOGA 4XO7A 3WUBA 2WBGA 2AQOA 3DHUA 3BGJA 2NT0A 3V5CA 2J7BA 1PDZA 4XO6A 4GACA 4D8AA 1K02A 1LTDA 2IXVA 1RK5A 1WO2A 2HEJA 1LP6A 2E28A 3FA5A 4RJEA 4UQEA 4W5ZA 4ADUA 1SZEA 1JDCA 1XGDA 1QAPA 4AY8A 1SO4A 5I98A 1I2PA 1KCZA 1TUXA 5LNSA 2GUUA 4HMCA 4ZA0A 3ANYA 4I5RA 1JZ5A 3M43A 4FOKA 4ZXOA 1AW2A 1HKMA 3RU8X 1ZU8A 1SUXA 2OEKA 3L21A 1UD8A 2OYLA 3POCA 3AC0A 3GXIA 1XINA 3TCZA 4HNVA 3GS6A 2YYTA 3RXZA 4O50A 1OC5A 2HVMA 3B06A 4LAUA 3RFWA 1XLLA 6TIMA 3VINA 3DG7A 2PDLA 3VK5A 3OW1A 4K8EA 2K8IA 3CUFA 2NV2A 2NXIA 1DJGA 5CJMA 1KRBC 3C2OA 3N9RA 1KXQA 1QJWA 4XK2A 3QV7A 1GKPA 3T2OA 3IAPA 4LXFA 1CLVA 4PMYA 3LTSA 1Z3NA 3LRLA 1BLIA 1BSIA 4K8HA 1P48A 3CZJA 1OEPA 3EPMA 2ZICA 1CGYA 1W17A 3W7GA 2G3FA 2C1HA 4GVGA 2XM2A 2V5CA 2J7DA 3SZ8A 2PC8A 3N13A 4WCJA 2Y7EA 2NX3A 4UZSA 4UTUA 1TREA 5EPDA 1GVFA 1SGJA 3S2JA 1KGWA 3W88A 3CM4A 3BAIA 4CD6A 5FL0A 4QJ4B 1LJYA 2H90A 4U10A 1P6CA 3GNPA 5E0FA 1LWHA 3BXWA 3FXYA 3W07A 3GTIA 3OPSA 5JBDA 1XUUA 1BYDA 4GZEA 3GFZA 4IGNA 2A7RA 4F48A 3WD3A 3URNA 4JNMA 4OQVA 3W2MA 1AMKA 3CWHA 1R5YA 4NJKA 1BG4A 1RVGA 3IGUA 4BEQA 4BQ2A 1D7KA 1ME9A 3WCZA 1TTIA 2WPGA 2H3DA 7ODCA 4D72A 4TXEA 4PR4A 4HPJA 4MLRA 3IPWA 1OYAA 1QRQA 4HMEA 2ZZ1A 1FQ0A 4ZO7A 4KMQA 3OLGA 3NTYA 3N73A 1E51A 1KCXA 3MHGA 5DF0A 4Z0JA 4W87A 5EA9A 4JTHA 1YTDA 1LORA 1FDYA 4P8WA 3VZYA 1TMQA 1VB9A 4GYFA 5DMMA 3G22A 3V36A 1BWKA 1XW8A 2PWHA 4NRRA 2W61A 4L1XA 1EXBA 3WLKX 3F5LA 2VOMA 1XWYA 3KRBA 2F8QA 3T07A 4E38A 1P6WA 4PBEA 3HV9A 4O28A 3HV8A 1R2RA 4JQ3A 4ATWA 1ICPA 4PTXA 5CC7A 3H4WA 1XRTA 1F07A 2ZQVA 4I7UA 4JTLA 1DJZA 1Z44A 3P2VA 5A69A 1S2WA 2F4EA 3HF3A 1PO9A 4M0XA 2B7QA 3G24A 4H9ZA 5FA5A 3ZYZA 5G2IA 5HK4A 1XIHA 1ZQ5A 5TBOA 1SSGA 3CV2A 3RPTA 2F2HA 4LVFA 4E2VA 1KV8A 4I9AA 1FWWA 4OUIA 1YEYA 5EL1A 3THQA 1TPC1 1IT0A 1EH9A 3PHAA 4W9OA 4U86A 2VFHA 3P93A 3WEOA 4ERGA 2I1OA 2YYUA 3CZ8A 1H63A 4JYFA 1XIFA 4AIUA 2X0HA 2BOGX 3MHFA 4A21A 1K6WA 3QR3A 2AGTA 3KAHA 3BW3A 5U7SA 1TG7A 4KT2A 3D3FA 5KSWA 3AO0A 4FXRA 4DJED 3JUGA 2DVXA 2WHKA 4ZFCA 3NSNA 2BS9A 1V3KA 3SCVA 3U3HA 1W6TA 2CW6A 5LNRA 4F3HA 1J10A 1QI4A 4LWWA 3D6NA 3NOYA 3SBFA 3V5FA 5HULA 3AIWA 3QGVA 1VKFA 4NZ5A 1VHCA 3BC9A 3BOLA 3ATYA 4NY2A 5J8LA 2IUZA 4S3BA 4C90A 2OT0A 4Q4RA 1RSCA 3ITYA 2WANA 3P62A 3SIZA 2KFWA 5FF4A 5FF0A 3GR4A 3E2VA 3LI1A 3LBOA 1O5QA 3O5MA 4M19A 3GUWA 4MNMA 1OB0A 1DHPA 1FAPA 1XICA 4E8CA 2BHUA 1E9LA 3CUZA 3AICA 1E3XA 3IIVA 4FOJA 4JTTA 1XPYA 3H23A 3F1QA 3H22A 4HOWA 2OU4A 1BF6A 4DRIA 1I1XA 2YX0A 4FS9A 3N18A 3T0DA 5CG7A 4JZ5A 4P7RA 4LVGA 3QBUA 1OVDA 1EGMA 3L4VA 2DW6A 1UWQA 2BVYA 2Y7DA 4QLJA 2CLHA 1PCWA 3K30A 3U9IA 4XKYB 2VRJA 4KWUA 3KTCA 4GINA 2J78A 4N9EA 2QCFA 4Q32A 3P81A 1MW1A 1GPWA 3O5FA 2PTXA 3RFAA 2R1MA 4HU0A 3EKZA 1LRNA 2EEXA 3C0SA 1FH8A 5CZSA 1DV7A 2NLYA 1PYMA 3L66A 3EB3A 4FNUA 1VQTA 2CZDA 1WXJA 2Z1KA 2W4XA 4HBEA 3ZZ1A 1PB0A 1M65A 1OYBA 5HMEA 5IXEA 5LKYA 3UZJA 2BSLA 3EOEA 1D3HA 3TJLA 1H49A 4MDOA 1KFLA 3FX4A 2WSKA 3P80A 1QO2A 2GK1B 4GUGA 3HJEA 1FKHA 3IEBA 2PS2A 1E55A 3OP2A 2P88A 3WLMA 4H4IA 4PTDA 3HA1A 3EWWA 2KGJA 1VAHA 3H7RA 1QK0A 5BWFA 3ZS4A 1Y8BA 5BXJA 4XX6A 5CXPA 3AWNA 2PI6A 1VCFA 5A1AA 2WJDA 1IWBA 1YE6A 4MJ4A 4CNUA 2PBOA 3BGAA 5HJXA 3LMYA 2GVGA 4BF9A 2ZUUA 4PCNA 4NP7A 1U30A 3UJEA 4B91A 1RLDA 4NXKA 1YE4A 1KRMA 3S2LA 3S46A 9XIAA 3MW7A 4J3ZA 4TVUA 2ZUWA 2CNCA 4JOMA 2E5DA 1XRVA 3IJ6A 4PUDA 4ADSA 3ZOAA 3RLUA 1EHAA 2PB1A 3TLLA 4FB7A 1ROTA 2J24A 3R0DA 3UXLA 1PKYA 3WNOA 1OBAA 2F2KA 1NWSA 1B54A 2CBVA 2JGQA 1ESWA 3W2LA 2UY5A 3WLRA 1DXFA 3IV8A 3PZQA 3ICJA 4LUYA 4RX0A 3K8MA 4ZB5A 2FQIA 3CUIA 4L7ZA 5C2XA 4CVUA 1ECQA 1E3ZA 1R2SA 1Q6IA 3C2YA 3SFKA 1EDTA 5I3JA 2WNQA 3VD3A 1FX6A 2VCBA 4BF5A 2G4FA 3A6OA 3UPMA 2XFRA 3LK6A 1JFHA 1XI3A 1ZCOA 1TIMA 3B03A 5CZTA 4W93A 1ZENA 3LXCA 2DUZA 4IP7A 1QU4A 2FDSA 1YADA 4A35A 3T8QA 4EX4A 3GU1A 3PTMA 2BFGA 1DYSA 4V2XA 4DI8A 3NQFA 4FXFA 3APGA 1R3RA 1ALDA 4MTVA 3CK5A 1HUVA 3GNRA 1ITUA 4G5DA 3NIYA 1ZY9A 5AFDA 5CGMA 4PB4A 1XIBA 4C6EA 3GBEA 3V16A 2D69A 4HB7A 3KXQA 1JCYA 3HPZA 2H8ZA 4AHOA 4O17A 1EP2A 4XZBA 4HPXA 1FTXA 4IGSA 1LBLA 4G9PA 4HZ8A 4YPJA 2Q8LA 3WL0A 4ERIA 2VCDA 3MC5A 5I06A 4DO4A 3O5GA 5CBBA 1HFBA 1DP0A 4IF2A 1GTHA 4Y9AA 4NNCA 3UERA 3KWXA 1T40A 3M4HA 3S5ZA 5D04C 3W75A 3LCXA 2CBIA 5CKSA 1D6OA 2QCGA 3GZ3A 3C2FA 4FA3A 4R9XA 2ABBA 1JCLA 4FLQA 1GOMA 1RJPA 4NI8A 1SPQA 4DM2A 3CTTA 2GJXA 5E0KA 3VDCA 3U2ZA 4IJCA 1HX0A 4YS1A 4Q8PA 3VYLA 4NNRA 4PFMA 2RQSA 3PUDA 3SUUA 1UD3A 1JYVA 3W25A 4WEVX 3VVGA 4YWSA 3LCWA 2DU2A 1RJQA 3IHZA 4ASTA 4BI6A 1OGGA 1C3FA 4CUCA 4OOZA 3VIIA 2MANA 2ZA3A 1UP3A 5LIUX 4QJ5B 1US3A 4P7NA 2E6YA 3FSUA 3JYMA 3IK2A 3ZFHA 2GGJA 2CC0A 4JD4A 2Y70A 1Y0EA 3SY1A 4C7GA 4HARA 2EBNA 2EKCA 2CZVA 4KGLA 3LM7A 4AF0A 3A5FA 2VWSA 3GLCA 4IIHA 1UCWA 2OYMA 4FSAA 1HT6A 2PTZA 7TIMA 3AXMA 4QEHA 4QROA 3UJSA 2E67A 3F2BA 3O6YX 1H7XA 4JYEA 4O0ZA 4X0VA 2CWXA 2V5LA 3TC3A 3VOCA 4QG9A 2EG8A 3EA1A 3PBVA 3RAOA 1ROUA 2LGOA 3VGDA 3P0XA 3A22A 1XIMA 1DWHM 4GUIA 2OT1A 4ML4A 3BANA 4OIFA 4YVVA 3WIJA 2FJUB 2XH4A 1G9HA 1QT1A 4CQ9A 1AQHA 3BV7A 2BVWA 1T8QA 4IP5A 3MSRA 2ZYFA 2G8ZA 2DW7A 3NL3A 1QPOA 1JCNA 4KS0A 5JBEA 4FAMA 4QQ3A 4WKFA 3WK2A 4PA8A 4HU8A 3KAIA 1BWVA 1XXXA 4NRSA 3LHZA 5L6UA 5C9RA 1Q2SA 1PKLA 2ZA2A 1NELA 1BYBA 2G3NA 3L9CA 1VS1A 1KBLA 3UXAA 3IIXA 5A8PA 1FWEC 2PU0A 4GI8A 4FALA 3NDYA 2WZMA 4KW2A 5HMFA 4IG2A 3B8UA 3NQ7A 1EP1A 1QNVA 2ZRUA 5K4XA 1VFTA 2OX1A 3HPFA 4DBUA 2PRLA 2D2HA 3JXVA 3VOHA 2MPHA 3EMQA 4EVZA 1O94A 3NCOA 1MEIA 3NEHA 1RBAA 3G2GA 1K7EA 3EA2A 2REQB 5DY3A 4ROQA 4JTJA 3PJTA 3PPFA 1UH4A 3WBXA 2ODOA 2QYGA 4CGTA 4M80A 3B0XA 4UOQA 4M51A 3AYVA 1AQFA 3VGHA 1LLOA 2OOFA 4DRHA 4IPXA 4GQBA 1Z89A 3UW6A 3GU2A 1G7UA 3FAPA 3VO0A 3VPLA 2ZADA 3NQDA 4Y90A 3DAQA 3ALGA 4J5NA 7CGTA 3N4EA 2V9DA 4PB3A 4XTIA 1ZBWA 4B92A 3CB8A 4Y9MA 4XBSA 3ZIZA 1GCYA 1L9WA 2F61A 2ZBTA 1UZ4A 5H8UA 3BCJA 3S2MA 2DJXA 4QRNA 4Y9PA 2FKPA 1SW3A 5JU6A 3DI0A 3U7BA 4CU8A 1HN1A 2YL5A 4GNVA 5BOOA 4BQ4A 4MDPA 4R7WA 1SFLA 2NQLA 1KM6A 6REQB 2FIQA 3L7RA 4RV3A 1TPEA 2ZZ4A 2D3NA 4IMGA 3UJ2A 4GCAA 4GCXA 4QFUA 2ZE0A 3BAYA 1U33A 4GI6A 2E40A 4OTKA 1JCJA 4WOQA 1GZGA 5E9XA 5E0CA 1JNTA 3N9KA 2VENA 5REQA 3FA4A 1IF2A 1HL2A 3H2MA 3E1F1 3TA9A 1PIFA 3FNDA 5I3HA 4AUBA 3WMBA 1WOBA 3RYSA 1LZOA 5FESA 1WKDA 3DFYA 2A3BA 2PPNA 4JL2A 4EP8C 4GKLA 1FKXA 1OFOA 1F3XA 2CESA 3CUXA 4KKXA 1XLKA 4GI4A 2J88A 4Z2KA 3RLVA 4Q8WA 1XIEA 2QJIA 3TSMA 4H00A 4YTRA 4QNWA 3VDBA 2PLJA 1ZCNA 4UTFA 1TJPA 4HK7A 3LPOA 2BV9A 3DC8A 1FWRA 1DEDA 2PZ0A 3TWBA 3PB0A 1WYIA 3VGGA 4KFNA 4FNRA 2LLEA 2RURA 4FR1A 3LXAA 5IRPA 1P0NA 1FFRA 1CDGA 7TAAA 4J3XA 3C0QA 4NJHA 3TZNA 1OFPA 2Q09A 1ONXA 2E8YA 4ZSTA 2WMFA 1RP8A 3CUHA 4G56A 2VTFA 2IQDA 5EMUA 1FJDA 4MJMA 1GOIA 2FVKA 3ZVIA 4HQVA 1EJUC 3GG7A 5A6LA 2FJKA 3W26A 3UESA 2X05A 4QCEA 1JR1A 1H0GA 3TOPA 3ES7A 5IFPA 2DY3A 3AHZA 3I4KA 5CG0A 4ZPWR 2W62A 1EUAA 3RCYA 3UG8A 4LALA 1GPFA 3CZKA 1SZRA 1W2VA 4F79A 1JAKA 3G0XA 5JVLA 3RM9A 2ETNA 2NQJA 3S2NA 2YIHA 5U4NA 3PBUA 3W7NA 1SW0A 1B3WA 2VGFA 1K70A 3R7MA 4J27A 4HA4A 2OEJA 2PDMA 3I6TA 4E2DA 5HR6A 2EGZA 2XIQA 1E1EA 2FHCA 2INFA 1JFXA 1D2KA 5A6BD 5D37A 4DO5A 3BJSA 1VBUA 2NV1A 1SMAA 2ATMA 3JW7A 3I7SA 3W84A 3M41A 4IUGA 1TZ9A 3VAVA 2HXUA 2OQHA 3O8AA 4O8RA 1NWTA 2WHJA 4IQ2A 1LRQA 2VZVA 3GIPA 4QIBA 4IIBA 4UQAA 4JAWA 1RQBA 2WM0A 1JUKA 1G5AA 1CCWB 1CI1A 1TB3A 1K9TA 1IE7C 5K9CA 1H4PA 1DBTA 3TC7A 2PSNA 1ITCA 4MB3A 1IR2A 1UH3A 1A5KC 4PMJA 4KEMA 1VCVA 4EWND 1B30A 2F6UA 2D1ZA 4MPQA 3QM3A 3S4TA 3THUA 1ITXA 3MI6A 3PRBA 3GDRA 3TEVA 1FKLA 4FXSA 2V69A 4Q8QA 4MJZA 1S1RA 4TMCA 4M8UA 4L80A 6CGTA 3OQEA 1QTWA 4ZOCA 4WDWA 3I7QA 2PEVA 4W7WA 2QUTA 3NL5A 4NIRA 4AZIA 1HG3A 1NEYA 1D3CA 1EB3A 4WOZA 2Y0FA 3L4UA 3B9OA 4GUJA 3K1GA 2FGLA 4PTVA 1TCMA 3LM3A 1YPXA 4Z0SA 3E74A 3VGBA 2V67A 3V7PA 4TW7A 1Z69A 2AL1A 1ZCCA 2NUXA 3T7VA 3B8TA 5BCAA 4AG0A 4S3CA 1SJDA 4F8XA 1ZP4A 1M7JA 3U2EA 4ENLA 2ZRVA 5LNWA 5F4WA 3LCFA 1EQ3A 4GC3A 4IX0A 5HQMA 4GX8A 3SQLA 5ABHA 5CAHA 2BB0A 3KTXA 1RAKA 1V3JA 3E3HA 1H7OA 2HXTA 4AVFA 4FX6M 1ZK6A 2ISWA 4DBSA 1FH9A 2PDKA 3B04A 5HNTA 4Z1YA 1MZHA 3W72A 1UPMB 3GDKA 3PBWA 4KPLA 2J7EA 2P1FA 5AC5A 3SGGA 1X6UA 4BI5A 3W70A 4NZFA 4PMVA 4B5XA 2OXNA 2PLKA 3A4JA 1SR9A 5GQBA 3WKZA 1OX4A 4IFKB 3LDVA 2I9UA 1Y7VA 4EANA 3C3UA 2YKKA 1XDJA 5JXQA 3IIZA 4A8LA 1TQXA 5LA2A 1UR1A 2V3FA 3FLUA 2V3GA 2Z26A 2DSUA 3WJSA 5AHLA 1JZ2A 1RCOB 2HWGA 2B81A 4FP1A 3CAQA 4V28A 4LF1A 3WO8A 3W7JA 4GY0A 5DO8A 1BVWA 1FCBA 2G96A 5TF0A 3BCDA 4DBDA 5T26A 1MMFA 5M1TA 1IEXA 4W9TA 1PPIA 4I7WA 1FOBA 2PGRA 3OLEA 2WZHA 1E0WA 2BNJA 1MXDA 4CKQA 1TWSA 1SZFA 3VX0A 2ISDA 3LHTA 4MKVA 1OM0A 2BTMA 4WJEA 5M3WA 1LBFA 1NP2A 4DXXA 1OFRA 3B7XA 4K1GA 3RX3A 4S38A 2XG9A 2XPAA 4DN1A 4DT4A 2JIEA 1O5KA 3EMCA 1EDGA 2FFIA 4N9CA 3RR1A 1V5XA 2YB4A 1KC7A 3ZXWA 1G4EA 4XD4A 4YLWA 1TV8A 3TWAA 3DDMA 3HGRA 4G2DA 4U33A 4FNTA 3S47A 1PX3A 2DFAA 3UR2A 1ADSA 5JUVA 1NTHA 3W02A 4GWEA 3ZJ6A 5F2GA 1JGMA 2VZSA 3FAWA 2PV1A 5FF7A 2DQXA 3WFAA 3CPUA 2XINA 2PP0A 2OR2A 4TV6A 1X6LA 1FFQA 1DJNA 5KZ6A 3RRXA 4FF7A 1OCJA 3B0VC 2DV0A 6REQA 1KQZA 3BQ6A 2D2JA 3DERA 3F2CA 3QW4B 3VZXA 1DJQA 3IJIA 3TYEA 2G50A 2X09A 3QV9A 5IBXC 2E09A 2NVCA 3LCLA 3T2QA 3MV01 5EMKA 1UIOA 4I9JA 2Q3RA 1I0DA 3QZEA 1UC4A 5KTLA 3AYRA 4ZOAA 2J4GA 4PCTA 2VMFA 4D2JA 3T40A 4WQ6A 3RM8A 4V33A 3IK8A 5E1QA 1YATA 2Q5AA 4ODRA 3N04A 2POZA 2CFFA 5DEZA 1VBHA 2XVGA 3C2VA 4PUEA 4GYPC 4KRTA 5GNXA 1HP5A 4PSRA 2YCLA 2B31A 3KCOA 1Q7ZA 3M0XA 5GVJA 1RVKA 2XIIA 2Y7GA 2VC9A 1MQRA 3NQGA 3SQSA 2J77A 4IGMA 3UQBA 2VZOA 2WMJA 1RQHA 4N9BA 3T08A 1DWIM 2V5BA 2WMHA 3SM0A 1KNWA 3TIMA 2NQ5A 3AQUA 3QR1A 5DIVA 3SUWA 3G77A 3C4UA 3OB8A 2GSEA 3C61A 2A6NA 4R27A 1C9DA 3VNLA 3UT0A 1LWIA 3KVMA 4DRJA 2TSYA 3R0UA 5JIWA 3RDKA 4S1FA 1ADDA 2E5BA 1JI2A 3NG3A 2HE8A 3LZ5A 4O52A 4H7VA 5CBJA 2ZR4A 4I8DA 1RR2A 2XJ7A 1GTEA 5FAGA 5FOOA 2CLOA 1GRJA 4AIOA 2VRKA 3E0FA 4ZCWA 1V93A 1VZWA 1HJQA 2OGYA 3ZR4A 3NTPA 3PB2A 1SR0A 1BYAA 1MZRA 1HW6A 3NQEA 2PN0A 2VWTA 5I0DA 3CYJA 2DP3A 4Q4MA 4ZOEA 4PUJA 5C9WA 2W63A 3RLHA 4ZO9A 4KIEA 1JDDA 2H8XA 2BGSA 4WSHA 4Q22A 5FEPA 3UP8A 3WDPP 1YNPA 4M7SA 2NZLA 1TFVA 4C02B 1W9XA 4IUOA 4Q7IA 4ODPA 2YR1A 3W1PA 1ZL1A 2I16A 2YFNA 3UA4A 1I2OA 4F0RA 4IL2A 1E56A 2C79A 3IGHX 1Q1CA 3AHTA 3KUMA 4QAIA 1U5HA 1NDVA 2XP5A 5HWJA 3DEQA 3M5VA 4HA0A 1B4KA 4ADTA 3OVPA 2XDFA 4W9PA 5D75A 3FVMA 1QI5A 4S3GA 1KGXA 1ZBKA 3WG6A 3RM4A 5JBFA 1V0MA 3LPGA 3N14A 4JIHA 5KINA 4BWLA 3K4WA 1OWQA 4IQCA 1B90A 5A6AA 4UCFA 2YW3A 2CKRA 3L4WA 1IXQA 3RCMA 1NY1A 5F1UA 2WVUA 4LRSA 3B0YA 4H9UA 3TYZA 2V68A 6TAAA 1PV8A 3S5NA 3OVQA 1JQXA 1TWWA 2DVUA 2AKMA 4JFUA 3HOJA 2FYMA 5A5WA 4TUFA 1A5MC 1OINA 1MRAA 2YPIA 5T9CE 3KHDA 1BHGA 3O5PA 3MDUA 3VE7A 5L9FA 4R53A 3WUGA 3MBFA 2QR6A 3NGFA 4FR6A 1U1UA 3O5IA 3UQIA 2JEQA 3HG5A 3LZ3A 1OC7A 4J40A 1PDYA 5EKYA 3TTOA 1S46A 1V6WA 2GLKA 3BMXA 4LYQA 1KWGA 1FKDA 1EA9C 3WLSA 1FBAA 3WDJA 2X2GA 5XIAA 1Y5WA 1FXPA 4DHGA 1LT8A 4ZENA 4NZ3A 3LY0A 3TAOA 3GIYA 3G1VA 3KL3A 2VNCA 2C1IA 3O63A 3JU2A 2DT2A 2I9EA 3N6HA 5DIUA 1UWIA 3AUJA 1RPKA 2W0UA 3W1TA 3BW2A 1RA0A 3IKGA 4AB4A 3QGAC 2QDHA 4DJDD 5DBTA 4QBXA 2ZUTA 4C6KA 4ZO6A 1EBGA 1UP2A 3APTA 4Q8TA 5C6MA 1V51A 1JXKA 4B5UA 3ARRA 1H2JA 4XKYA 3CH9A 3LV6A 4GH1A 2QGHA 3BAXA 3UBPC 3Q37A 4CLMA 1WDPA 4XG1A 1QW9A 3GXPA 3KE0A 3PWAA 1R9ZA 1Q13A 5H1WA 1YRRA 3AJXA 2FZNA 1EXPA 1H1NA 3QPZA 1IEIA 1PX8A 3UGRA 3PZMA 1IEWA 3M07A 5DX7A 4AFYA 4V1XA 4J3UA 3ZT7A 2O7QA 4L4PA 3SCSA 3O6CA 4IXXA 2E77A 1OX4B 4TO8A 3ARUA 1M68A 2A21A 4INFA 1TKKA 4WUIA 3FYOA 2ZXBA 3LRMA 4LW7A 1PHQA 2WKGA 1QPKA 4FNQA 1LOSA 3QSRA 5ABFA 3SN0A 1R3WA 2PRHA 3BTNA 1E15A 4YTTA 5GPRA 4ACZA 3W85A 1XISA 4WDTA 3G8RA 3BWWA 2FZMA 3FHQA 5HJYA 2YJQA 3TW7A 1RCXB 5FEZA 2NVAA 2FZ8A 1MW2A 1TR1A 5ENLA 2QLYA 2GDQA 3SCUA 5H8PA 2P8CA 2R94A 4LF2A 1GORA 3WFZA 4IPIA 3RX4A 1E9ZB 1OHLA 2W27A 4JKMA 2FZBA 1EL3A 2XGIA 4D8LA 3HFTA 4GPNA 1W9UA 3VNZA 4XD5A 1OT1A 3HGOA 1R3VA 1UKTA 2A7NA 2NT1A 5LNUA 4F66A 3B9AA 2CWNA 2QEZA 3LPFA 2FPTA 3DFSA 4MGGA 3AIQA 4GGHA 4XBKA 1F3WA 4DNHA 3NXLA 1F6KA 1K8ZA 3G1YA 1FKGA 4DBWA 3N12A 2V6AA 4HMDA 3KBMA 2C1GA 3UZZA 3IJ9A 4X2RA 4UOJA 3GW0A 4PBGA 1XHGA 1XBVA 3KL0A 1XR2A 1IR1A 4ZBCA 4PRRA 3O5LA 5RUBA 2BOFX 4GX9A 4N0RA 3UR8A 4C6PA 3THAA 4IQEA 3UWEA 2J79A 1G01A 4TW6A 1Q6GA 2C19A 1EJTC 2NSXA 1V79A 2ZZ2A 4A4AA 4R7JA 3TROA 1IXPA 1N8FA 2WMIB 4HHLA 1W1PA 3INPA 1F4AA 1AA1B 1JPKA 1J5SA 1LQ2A 1XV8A 5LGZA 5FJJA 5D9MA 4A3HA 1W3LA 2O9RA 1RLCL 2PV3A 1UR2A 3E2QA 1FKBA 3A13A 3A21A 2PDNA 2JF7A 1E40A 3WDIA 3MUXA 1XYCA 3TUUA 5C7HA 2RSEA 4PRWA 4JQ1A 1QO5A 2BVTA 2X40A 3O06A 3R10A 4O16A 3KACA 5TQLA 1MFVA 1TV2A 4RDYA 3S1WA 1OQFA 1JPMA 1UROA 1KTCA 2E0PA 4OBTA 1FRBA 2W92A 2GDUA 1Q7QA 3PR2A 4DROA 1Z42A 1LCOA 2PDIA 1X8FA 3MQTA 2UZ9A 4YIWA 4GZ7A 3RJYA 3SCPA 2AQVA 1FKIA 2C14A 3RU6A 2A7PA 2FTWA 1A3HA 3TYCA 3W27A 4C6OA 1KV5A 3W28A 3KOWA 1RUSA 2HCVA 1GZJA 3SSJA 2J9ZA 4S3DA 2CHNA 5CJNA 3A3WA 1U83A 2QIWA 3BMBA 3GAKA 3FGCB 1EJRC 1KXTA 3C0LA 2REQA 1AL7A 5ABTA 1G94A 3TQVA 1ZAJA 3G8EA 4DIAA 1XRFA 3OJGA 3B4UA 4Y6GA 1TPH1 3GVGA 5FAJA 2B7PA 1AQ0A 1VD6A 4H41A 3KAGA 3M0JA 4K1WA 3D3AA 1FP8A 1PTAA 4PFHA 1TV3A 2VX4A 3D46A 3UG5A 3MU7A 2EPLX 3AROA 1WZKA 1IEQA 2QF7A 1JCTA 2J8TA 4ZO8A 2F23A 4K38A 4PMZA 3KVLA 1UHVA 1P1XA 3LGDA 1XYFA 3EWDA 3F4DA 2Z2BA 3W2NA 3UA3A 3I3BA 3O05A 2PP3A 3ALFA 1ZJAA 3KCLA 1SFSA 1Y5VA 3IACA 4HOXA 2KO7A 1XD0A 4L4LA 2TRSA 3UF9A 3MV11 4HHMA 4J35A 1AMYA 1WZAA 2E9LA 1OK6A 3TYDA 1TTJA 5FEWA 2A3HA 3LYEA 3O16A 4M5PA 3VKJA 3NYDA 4LFYA 5MHBA 4WSJA 1AJZA 3L4YA 4M1RA 1OF8A 1TE1A 3FSTA 4PL1A 4XZMX 3L65A 4F2BA 2ZX9A 3QOMA 3ARXA 3VAWA 3OOQA 3NZPA 5KEZA 1AQMA 3LB0A 3CIXA 2HPIA 1US2A 4C1NA 4H9VA 5JMUA 2FVMA 2O9PA 4KRZA 2AL2B 2XISA 1W54A 4IFOA 3VIPA 4L72B 3WL1A 3OQ8A 5A3HA 4NVTA 2ANUA 4RNFA 2GL5A 2PDQA 4HTYA 2OSXA 2V5DA 5F2LA 3UI6A 4IPPA 1JVWA 3V35A 5G1YA 1ZUAX 3U7VA 2GUYA 1D7IA 2OQLA 3AALA 4DX3A 3WH9A 4K37A 1E72M 2CERA 1CLXA 1GEQA 2ZWYA 4IH3A 1CXLA 2ZUVA 2DZPA 3GM8A 2WW5A 2OO6A 3R94A 3LHVA 3M0MA 3LTPA 1JD7A 2IKJA 3HMCA 4UR9A 3KM8A 4P8UA 3A9IA 3EWYA 3H4XA 2GPTA 3UZ5A 4YVXA 1IT7A 2EHHA 2GJLA 2PFHA 1SVDA 2OSYA 3WF0A 1YIXA 3ME3A 2BBFA 4NX5A 5M5DA 2WVVA 3PS7A 3AMKA 4S3AA 3B0PA 2W66A 6A3HA 3B05A 4LYPA 1TIWA 4XSLA 4KF1A 1EC9A 5I3GA 4KR0B 1EGVA 4UTJA 3EOUA 3IJ8A 3VM7A 2QT3A 1PHWA 1XH1A 4U5IA 5C70A 1ZFJA 2CLKA 2VFIA 3CO4A 4JNZA 4Z2IA 3AISA 4B5SA 2PDUA 1FY6A 4IOTA 1E71M 4WF7A 5HMSA 3CHDA 2JGYA 1YPFA 5DY2A 3JYJA 1F9CA 1W3IA 1WKYA 2E4TA 3FJ4A 1RZMA 4MWAC 2D2GA 5I5RA 3W82A 4UR8A 4LX4A 1UUOA 2TODA 4H04A 4DUXA 2Z7GA 1G69A 1ZPTA 1UMYA 4C6CA 5TAOA 3CH0A 3OVRA 2O56A 3A4WA 4UNIA 2VFFA 1BKSA 1K7XA 3H26A 1HTIA 3L4TA 4UQCA 1J96A 5FJTA 1PX4A 3NQBA 1J8VA 2J7FA 1E6PA 3NJ3A 1V3MA 1EZ2A 5EMYA 3VMOA 3DBPA 3KZPA 1NF0A 2QDEA 3LEPA 1DVJA 3MSDA 1BYCA 1XL9A 2WWCA 1UUQA 1W5NA 3GC4A 4C1NB 3PG9A 2Z00A 1TQJA 1FKKA 1SFTA 2D20A 2HISA 3PPCA 4PMNA 4GI9A 1T41A 2E6AA 2GJRA 2ZZ6A 1CGXA 5E9AA 5G2WA 3NA8A 2PDHA 1VJZA 4DWDA 4WXZA 3QOKA 2XP6A 1AH4A 3DU0A 4JIIX 1OD0A 3DFOA 3E0LA 4I5UA 5AYZA 4AWUA 3W7KA 1AJ0A 3BG9A 3PK7A 2Y4SA 3VUPA 2KAUC 5F2IA 3SURA 4KCUA 1DIEA 1AW1A 2E68A 4EE9A 1W1IE 1LQAA 2DT1A 1W9BM 4MOZA 3VOJA 2OLSA 5EMJA 2FVLA 4ZZ9A 4EPBC 4NJGA 4QE4A 5CSYA 3W7IA 3KWSA 3GZAA 3MWCA 2Z6JA 2I56A 5C2GA 1TX0A 4H19A 1C9HA 5XINA 3A9BA 3QQ0A 1A5BA 1RBOB 4D6DA 3NR0A 3NEVA 4AD3A 3PA7A 1XIJA 2PDCA 3C56A 4OU1A 3LTYA 3ZWTA 4JICA 2WHLA 5G5IA 2VC7A 3TR2A 1FWAC 1L6WA 2CLPA 4HHHA 3DIPA 4HCLA 4JX6A 1ODUA 4M6QA 5AZ0A 4MAVA 2J6VA 5DXYA 1PZ0A 3VD7A 2QGYA 3VM5A 4ZOBA 3GRIA 2QCDB 5HWCA 3N6QA 1EEXA 4IWWA 3ZT6A 1DWGM 3ITVA 3N3TA 3ABXA 2PMQA 2IQ0A 1WZLA 4C60A 4Q8OA 3FCPA 1KM4A 5CH9A 5CC6A 1WPCA 1J0YA 2JKPA 2AWGA 3TYUA 4IFKA 4NASA 3CAKA 3NSMA 2MNTA 3AMDA 2X2YA 1DQXA 5DRCA 5FJPA 2XYLA 3O5RA 4AX6A 4MWAE 1YPIA 4ZVJA 1D8WA 1W8SA 3RGCA 2CLEA 2VN1A 1J6OA 1W3HA 2PDJA 3UVAA 3CHCA 4ZGYA 1O7AA 4PC8A 4RR4A 3WNPA 4K3ZA 4RXFA 1UA7A 4JBRA 3S42A 3M47A 3AS3A 3BGGA 4PEEA 3CEUA 4NAFB 4FIQA 5A8NA 5C9XA 4ERAA 2IS7A 4DWSB 4OFCA 4DUOA 2BX7A 1C29A 1FA2A 2BMBA 4ZQRA 1YLVA 3XISA 4E2BA 5FJRA 3LLFA 5HW8A 4B5TA 3WEZA 2KX9A 1CW2A 2YBVA 3C5QA 3MTWA 4UTTA 4RPPA 4QG8A 3LRKA 4B3ZA 2GFTA 4E0CA 2Y89A 3SCNA 3WLHA 3G18A 2HNEA 2OLHA 4L9XA 5IHRA 4E4UA 1H62A 2VKZG 2FMOA 1F4HA 4X22A 2WSPA 3EYPA 2GGGA 1LL4A 3MKVA 3N2OA 3BSHA 3HB9A 1P5QA 8A3HA 3DUGA 3QXBA 1N1AA 4MZ1A 1E6SM 3E12A 2ZOXA 4AD2A 3BLOA 4JDYA 1PZ1A 3CZGA 1EOKA 3WMCA 5I24A 4QE1A 2ZWZA 4ZODA 1QUMA 1I1WA 1W3JA 3UWZA 3LU2A 5ABGA 2YDRA 1VEOA 1OD8A 3WQFA 4J2MA 2ZR5A 2VEPA 4DRNA 4Y8EA 5AYBA 3VNDA 4JN6A 4S3KA 1PEZA 1K1DA 2WSQA 3MBDA 1DL3A 3ZVHB 3SEPA 4AC1X 1F05A 3C8NA 3CIVA 1WZMA 3AYTA 3GNNA 4HVXA 3N2TA 2NLIA 4N19A 5E70A 4IIDA 3A5VA 3M6DA 3T0TA 1J6YA 2V2DA 2XN1A 3V0SA 4ATLA 3VCRA 1QNRA 3W7DA 4I6VA 3GG0A 3FYYA 2KZHA 4JX5A 2OGJA 2VZTA 3E0WA 3KAOA 3VZZA 4HZMA 2XVKA 3EGJA 1XJBA 3P82A 4RE3A 4NYYA 4LVBA 1XBXA 4RLIA 1L6YA 3R8GA 5F1VA 4MMWA 3EOLA 1JNSA 3N2BA 1UWTA 3NM1A 1GG1A 4XUGA 3PPHA 1MW0A 1ZAIA 1Z8AA 4ACZB 3BUVA 1AH3A 1YMYA 5I3IA 2X1RA </