2G41A

Crystal structure of the complex of sheep signalling glycoprotein with chitin trimer at 3.0a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL PROCESSING PROTEIN
publication title Carbohydrate binding properties and carbohydrate induced conformational switch in sheep secretory glycoprotein (SPS-40): crystal structures of four complexes of SPS-40 with chitin-like oligosaccharides
pubmed doi rcsb
molecule tags Signaling protein
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2g41A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2g41A01
2VNCA 1R7AA 1NOFA 2J7DA 3ZO9A 4CN6A 3G6MA 1FP9A 2YDSA 1LWHA 4A3YA 4Z2JA 3VDAA 3I3DA 1BLIA 4MDPA 1EDQA 4ATWA 3LPFA 4CD5A 3K46A 4HMCA 4NSBA 3EMCA 4W8AA 2WKLA 2IUZA 3SUVA 1ZBVA 2BV9A 1PX3A 3AIVA 4U3CA 1FOBA 1XSJA 3NIYA 4P7QA 3F4VA 3ARXA 1B3ZA 4AD5A 3W29A 4UFMA 3QHMA 1PEZA 3HJEA 1GOIA 1B3VA 1UWQA 1W32A 2WC3A 1DWGM 1CENA 3W37A 3WKZA 3ZJ8A 1GZJA 3VIMA 3K8KA 4C7GA 4PTWA 1QW9A 3D5HA 3U5YA 2WVUA 4W7UA 4AZHA 2OYLA 3II1A 3UETA 3AHVA 3SCSA 5CJ5A 2VZSA 1BF2A 3VIKA 3U5UA 2WBKA 4CUCA 1VEMA 4JKMA 4BA0A 2G4FA 3PZGA 4AZ6A 3PN8A 2WBGA 5DMYA 1HL9A 1TZ7A 4AEEA 4DM1A 5GPRA 4LGXA 1TG7A 1C7TA 4IPNB 4TUFA 3VGEA 1V6UA 4W88A 4MAZA 3GZAA 3WNLA 3ALGA 5BRPA 5JIPA 2J62A 2WLZA 5DEZA 3CLWA 2WCGA 1ISWA 3VD3A 3A3HA 4UNIA 2DSVA 1DWHM 1WB0A 2QMJA 3GH4A 1B31A 2DSWA 4HOWA 1GOQA 5CLTA 4CKQA 2PF0A 1ITCA 2DQXA 3CH9A 4J3SA 4DUWA 1X6LA 2DGAA 1WZKA 2UWFA 2RGLA 1I1WA 2G3MA 1JZ2A 1OGBA 3W25A 5AY7A 1KXTA 1RP8A 2PB1A 4HA4A 4KRTA 1D2KA 5HDRA 1IZJA 2GVYA 1VAHA 4HU8A 5A69A 3CUGA 1VFUA 3RILA 3POHA 2X1IA 3WEZA 1CTNA 4R5EA 3BAYA 3MV01 4R27A 1CGXA 3WMCA 3S2CA 2PWDA 3WBAA 2W62A 1ZJAA 3UESA 1EQCA 2CIPA 5JBFA 3N18A 2YKKA 1J11A 1XCXA 2W66A 4BCEA 1R86A 1RPKA 1B0IA 1BFNA 4D6EA 1GPFA 1UKTA 1EXPA 1OINA 1LQ0A 1JF6A 4JFUA 2CITA 5A3HA 3B8SA 3N15A 5D9PA 1BPLB 1CLVA 3VM5A 4BQ2A 4EK7A 2J74A 1VBUA 4NRSA 3AHYA 5FOOA 4UQBA 2XFFA 4HP5A 5A6MA 3HMCA 3GH7A 1PBGA 2VQUA 2WXDM 2E4TA 3CZEA 5A2CA 3CZLA 1E3ZA 1B1YA 2CBVA 3ZJ6A 1KR0A 2V5DA 2ZXDA 3WNKA 2FH6A 4UQ9A 3CIVA 2WC4A 1OT1A 4UQAA 4M24A 3AIBA 1Q6GA 1J12A 3PZMA 1HVQA 4RE3A 2WHLA 1PZ2A 4QP0A 3WMSA 2VX6A 3VX1A 2CHOA 3OZOA 3BGAA 1QNRA 2XVNA 1ITXA 4WKHA 3MUZ1 1WCGA 4URIA 4UFJA 1FH7A 2V3GA 5I2UA 3IAQA 2C0HA 4Z2IA 1VJZA 1JXJA 1TE1A 1V3LA 1WDRA 3NSNA 5FL0A 4P7OA 1JD7A 1RP9A 2GFTA 3SCTA 1ZBCA 1JZ8A 2YA1A 3VIJA 3VIIA 3SCVA 4JFVA 4M80A 4PTVA 4RL3A 1ZL1A 1BG9A 5D4YA 1JZ5A 3EDDA 4HMEA 2XSBA 1UOKA 4UZSA 3OLIA 1CLXA 3T2PA 1LL6A 3AMCA 2J78A 1UR9A 3BLKA 5A8OA 1W1TA 3AI0A 4AZ7A 1HX0A 1PPIA 1XRVA 2J7BA 5JIWA 1US3A 1BHGA 3PZNA 4AYSA 1NOWA 4IPLA 3KL3A 4H2CA 1KCKA 4UFHA 8A3HA 3VINA 1W9UA 1HKMA 3L4VA 3U7VA 1VF8A 1MW1A 3ZQ9A 1MQPA 1B90A 2E9MA 2J7EA 5GQBA 4ATLA 1E6SM 2HISA 2W61A 3ZIZA 2YL6A 3BSHA 5CSYA 3CBWA 1HJXA 4EE9A 1BYDA 4GQRA 4KMQA 5CPSA 3VDHA 4W7VA 1RH9A 5JUVA 1QVBA 1JZ7A 4AXNA 4JL2A 5E0CA 1HXJA 2GDUA 3ARYA 2WNWA 5A8MA 4HTYA 4PMOA 5TD4A 3WH9A 2J7GA 3T2OA 5JBDA 1TCMA 2YA0A 3WDRA 2E8ZA 1XSIA 4BQ4A 2ZX7A 3CZGA 3GXDA 1HP4A 3SCWA 4FLOA 2BHZA 1CGWA 3BSGA 4HPGA 2GJPA 2A3CA 3SUUA 2QHAA 1E5NA 2YL5A 2HVMA 4RE2A 2VZTA 3W28A 4IUGA 4H8HA 2WMFA 4PTMA 4HU0A 2OSXA 2XM2A 3NSMA 1TMQA 4DWSB 5BRQA 2WHMA 7CGTA 3ZM8A 1WP6A 3WEMA 3QR3A 4OIFA 3ZR5A 3EMZA 2WANA 3M7SA 1JI1A 1NWSA 1UWIA 1DP0A 3AYSA 1VFMA 3PBGA 2FH8A 2DIJA 2XPKA 2ZWYA 2G8ZA 2FHFA 4OOZA 5AC4A 1UR1A 3SCQA 4HZ8A 3WUEA 2J4GA 1W3JA 1FFQA 4CGTA 5A6BA 3NCOA 3B9EA 1E73M 2V3FA 1WPCA 3VTRA 3PZOA 4PMYA 4E2OA 2PWEA 4X0NA 1V02A 1EH9A 4F9DA 4UOJA 3AHTA 4PMDA 3WH6A 1V3JA 4LQ1A 7TAAA 3CHEA 4FK9A 1R85A 1E4IA 3FN9A 4LX4A 1V02E 4M82A 1DWAM 3RM4A 2C8NA 2QV4A 1E70M 3CUIA 4LPCA 3MMUA 4WJXA 4JCLA 3TP4A 1BQCA 5E6YA 1G9HA 4MB4A 4UFLA 5CGMA 1K6AA 1FH8A 3K8MA 3VU2A 4LXFA 1J01A 3LPPA 2VI0A 4W5ZA 1UD6A 1J10A 1C91A 1UR2A 3F5LA 3VOCA 3GDBA 3AROA 1GHSA 1V0NA 3N13A 1P6WA 3THDA 2TAAA 5HXMA 3NSXA 2CXGA 4CD7A 3OLEA 4J3VA 4N0RA 4JFWA 4CN4A 2FHCA 4L4OA 3MSGA 3WF1A 1CYGA 1HVXA 3L4XA 1UKQA 3M6DA 1GUVA 2OWXA 1V0LA 1K9EA 4AZBA 2W91A 1FHLA 1V6VA 2FHBA 1CIUA 5DF0A 5BXRA 2VRKA 4D6JA 3WQ5A 4L4PA 3CMGA 2XVKA 4X0VA 2NSXA 2DPEA 2YJQA 4A4AA 2E0PA 1KCLA 3WUBA 4KH2A 1XH1A 3UR7A 4WSJA 2Y5EA 3ZSSA 4AZCA 1SR0A 2X8RA 3EDFA 1OGGA 1IV8A 4WKFA 4GZJA 3EYPA 3ARVA 3ARSA 2UY5A 3KE0A 3PTQA 2A3BA 4QCFA 3WN6A 4UZUA 3ALFA 4MJ4A 1KGWA 3GTNA 2WM0A 2XGBA 4LYPA 1KXHA 4PMNA 1GHRA 2WK2A 3WF0A 4ZE4A 2OSYA 4TOQA 5CQ1A 1K9TA 2DH2A 3RO8A 2OYMA 1XH2A 3AOFA 3OZPA 1NWUA 1BGAA 3GH5A 1UHVA 1WKYA 1UD8A 3CHDA 1CGTA 1FFRA 4D6GA 3N11A 3EDJA 4EANA 4J3TA 5FL1A 3GNOA 2MANA 1M03A 3W81A 3VD5A 3AS0A 4D71A 4PN2A 4W93A 5EB8A 3GM8A 2YIHA 1JF5A 2ZUSA 5I6SA 3BCDA 4EKJA 2ZXAA 1MFUA 1D3CA 1ISXA 1I75A 2EPKX 4W5UA 2XFYA 5EFDA 5D9NA 4X9YA 4PTXA 4OKDA 3L4TA 2UY4A 4S3KA 3U57A 1TFVA 4GQQA 1CXLA 2BVTA 3NDYA 1Q4NX 4QLLA 1QI4A 4CD4A 4XB3A 3SUTA 2ZUTA 4OJYA 1JDAA 2VR4A 3QHOA 2X2YA 3VIHA 3WNMA 2CYGA 1LWJA 2BVYA 4KRUA 4U3AA 1MW0A 2O9TA 3U7BA 2JEQA 4H04A 2F61A 3VGHA 5ABGA 3K1DA 1WDQA 4FLSA 3WDPP 1UZ1A 1XV8A 2WC7A 1NP2A 2A3AA 3SURA 2EPLX 4V27A 1H11A 3N17A 3LPOA 1BG4A 1TA3B 4GO8A 1QI5A 3VNZA 1C93A 1OIMA 1MQRA 1E6ZA 3ZJ7A 2DSKA 4DWSC 2J25A 4BQ5A 2X05A 3MMDA 4DM2A 1A3HA 1OT2A 5GNXA 2WKGA 1KGXA 5I5RA 4PRWA 1NARA 5C70A 2WZIA 1QHZA 1EO5A 3CZKA 4D6IA 2WMKA 3L4UA 4PEEA 4Z2LA 3CUFA 3GBDA 3NDZA 1EOMA 3FY1A 1QHOA 3PHAA 5HPOA 1V6YA 1LG2A 1U2YA 3W53A 5BROA 1NWRA 1OD0A 3PTKA 3AIUA 2VCAA 4UFIA 1W1PA 1E0XA 3WQ8A 1KFWA 2V3DA 4GIAA 2JF7A 3DHPA 2XVPA 3MO4A 5HNNA 6TAAA 1KXVA 4QLKA 5BCAA 3CZJA 3WDQA 1H4PA 3WFLA 3VM7A 3QOMA 4CVUA 3EDEA 1LJYA 2V38A 3SCPA 4P8XA 4JL1A 3K4DA 1K9DA 2YL8A 4GI6A 4RE4A 1MW2A 4LYRA 4AY1A 1QBAA 2VZOA 3A47A 3CUJA 1EA9C 2PWFA 3WSUA 3RCNA 1FH9A 2G3JA 2BNJA 4AZGA 2JALA 3ZT5A 1OM0A 2ZUNA 4GO9A 2WZEA 2EJ1A 4H7VA 2WWDA 4J3UA 2G3NA 4MNKA 9CGTA 1WAWA 2AAAA 5A6JA 3OA5A 3TONA 3WENA 3AS1A 1NQ6A 2Q8XA 1KWKA 4QDMA 4ZEPA 4MDOA 4WLCA 5CLWA 1E6XM 1G1YA 4W86A 4B3LA 3M46A 1W9PA 1BYBA 2PWHA 4GI9A 1C3FA 5A95A 1X1NA 4UR9A 3THCA 1O7AA 1HKIA 4K68A 2CBUA 4V28A 1ODUA 2ZOXA 3WELA 4AMCA 1CEOA 2PI6A 2VO5A 1SMAA 1XCWA 2IXVA 2WPGA 4F8XA 4XZBA 5CGTA 2DIEA 1GVIA 4OBRA 3W0KA 5D8WA 2EO7A 2VMFA 4MAVA 4JFTA 3MUIA 3AISA 2ESCA 4PMXA 6CGTA 1DWIM 4TTGA 2DT3A 5BYWA 3TTSA 4J27A 1E5JA 4D6DA 1KR1A 1JZ6A 5D9MA 5LA2A 1E40A 2Z1SA 1C90A 3WD4A 5E70A 1ZS2A 5IHSA 4PUEA 1VEPA 3AIEA 3ZT6A 4D1IA 4F79A 4GZIA 3WDJA 1V6WA 3K4AA 2VZVA 3W24A 4AEFA 1XD0A 1PJ9A 2CPUA 4B9ZA 2VX5A 3OGSA 5LA1A 2CERA 3AHXA 5DT7A 1TA3A 5A6LA 1GNXA 4DWSD 2UY3A 1JXKA 1R87A 4AISA 1UQZA 1CNVA 3BAJA 1GJUA 4ZFMA 1W2VA 3DYOA 2A3EA 2A3HA 2G3IA 3PZTA 1K9FA 3POCA 1TR1A 2W92A 3LMYA 3QHNA 1V08A 1GORA 2BHYA 4D72A 2J75A 1OD8A 4B9YA 5A8QA 3B9AA 4Z2HA 8CGTA 4XZWA 4CD6A 3AMLA 2ZX6A 3DYMA 2WMGA 4UOZA 1H41A 2VX4A 3VMOA 3WNOA 1HF6A 4AD4A 4MADA 2D22A 1UKPA 3IK2A 5E0FA 1M01A 4GXPA 3BAWA 1NH6A 3WD0A 1WE5A 1PZ3A 2ZUUA 3WQ6A 2ZX5A 1BAGA 1XYFA 5ABEA 5FKYA 4YHGA 2XYLA 4HOZA 2XIIA 1UD5A 1V3HA 3DHUA 1MW3A 3ARPA 3IJ9A 3A4AA 2D3NA 4GZEA 4ZXOA 3JUGA 2VTFA 2DT2A 1CXKA 4PCSA 2C7FA 2BY0A 3OGVA 2D24A 1G0CA 4W8LA 1C8YA 2E8YA 2VVNA 5JH8A 5AC5A 2XWEA 4XV0A 4UCFA 4AZCB 1FP8A 2YBTA 2GJRA 1UR4A 5BWFA 4JFSA 1UWRA 3AIWA 4TVCA 3WFZA 4AZIA 4C7FA 5I3DA 3WQWA 1EHNA 1QHPA 4CCDA 1JGIA 3PZVA 3RMEA 5I23A 3SCRA 3S6TA 5EFFA 1UWSA 3VO0A 5LYRA 3OG2A 3AS3A 1CBGA 1V03A 1MXGA 5M17A 3GBEA 2AOSA 1GJWA 2Y4SA 1PX4A 5D9OA 2WVSA 2VCCA 2OYKA 1HN1A 3SEPA 2CBIA 4PUDA 3AXHA 2O92A 3VNYA 1QI3A 2VT0A 2O9PA 3EBVA 1WZAA 3WMBA 4LYQA 1J0YA 2W5FA 1XYZA 3RDKA 1UKOA 3ARUA 2FGLA 2QF8A 1HJWA 3G6LA 4Z2KA 2XHYA 4Y7EA 1WZMA 5AYBA 4CCCA 1NOUA 2WVVA 1X6NA 3VMPA 1DWJM 4Q22A 2GK1A 1UUQA 4PMZA 5BXPA 2BXYA 1GOWA 2VOTA 1W9DM 3O6AA 5A94A 3VPLA 3AQUA 4S3JA 3W82A 1GQKA 1HL8A 2WSKA 1E1FA 5IXEA 3AMKA 3PZIA 2J47A 2CBJA 3ARTA 3AIRA 2OLHA 4ML4A 5DO8A 3CZ8A 1V3IA 4FMVA 2EEXA 4HZ6A 4MTVA 3W26A 1YQ2A 1KWGA 1JYNA 2VR5A 3VKKA 1C8QA 1DTUA 2VRJA 2AMGA 1W9XA 2XJ7A 3AIQA 1HJQA 3DECA 4CVWA 2BHUA 1N82A 3CO4A 1WDPA 3BCFA 1VIWA 2V5CA 5E09A 1IZKA 4CU8A 4D1JA 3BMWA 4GINA 4MB5A 3UG5A 4AWEA 1E6QM 3AJ7A 1ESWA 1HT6A 3ZOAA 3WH8A 1CECA 4CU6A 1QI0A 4KWUA 1LL7A 4J7RA 4UTFA 1NP0A 2ZX9A 1HJUA 2Y8KA 3DC0A 4QLJA 2D2OA 3WF3A 4FLRA 3MU7A 2CCRA 3SCOA 1UQYA 1V6XA 3AICA 3UR8A 1ZBKA 2WAGA 1HJSA 4TX8A 5CXPA 3W6LA 4B15A 4NRRA 2X09A 4NZCA 4D6HA 3VILA 1E6RA 7A3HA 5DT5A 3VDCA 1A47A 1GW1A 1ZU8A 1EDTA 5A8NA 3BC9A 2VQTA 3ARWA 5JBEA 1HIZA 4AZ5A 1PX8A 5A6KA 4F66A 1UH4A 1AQMA 2NT0A 1TUXA 4KGLA 1ZJBA 3E1F1 5D8ZA 3CMJA 1H1NA 1W3KA 3MS8A 3ARRA 4HMDA 4XX6A 2Z1KA 4P8WA 2PC8A 2O9RA 3FAWA 5A6AA 3GXMA 5M03A 1GQIA 3N9KA 1JAEA 4TX6A 3L4ZA 4CN1A 1O6IA 2EPOA 4CU7A 4JHZA 3WH7A 1XH0A 4Z2GA 4MJ2A 2W67A 5IDIA 1ISYA 3BLPX 4M8UA 3PZQA 4M1RA 2BY3A 2WWCA 1V3KA 3WEOA 5A6SA 1ISVA 3HN3A 3WDIA 1UWUA 3GYCA 3SUSA 4AD2A 3VGBA 2QPUA 4U33A 3FAXA 3SCNA 1M7XA 4NI3A 1Y7VA 3NUKA 5HOSA 3ARQA 1KBKA 1VJSA 3MMWA 2EXOA 1R8LA 2ZUVA 2WMHA 3OBAA 1ZBWA 3N1AA 4AC1X 3KWXA 2QMKA 6A3HA 3AS2A 4MB1A 1B3XA 1E71M 2DT1A 5E6ZA 4JHOA 1Q6FA 4TXEA 1UD2A 4MNMA 3AZRA 1MXDA 1U33A 3OLDA 1ODZA 2J8GA 1UD4A 1BGGA 1JYXA 3A4XA 4U31A 1E0WA 3IANA 4DUVA 1E56A 4AD3A 4AIUA 1YHTA 1XSKA 3O9NA 4MB3A 2NT1A 4OBSA 1UH2A 1V0KA 4UOQA 5CPTA 5CPQA 2PBGA 5C8BB 2J8FA 1OWQA 1UG6A 2WCAA 2ZWZA 1IT0A 2D0GA 1Q6EA 3ZT7A 1V3MA 5A8PA 1FA2A 3VGDA 1PIGA 1UH3A 1GOMA 2FGZA 3IAPA 4J28A 2WHJA 2VVSA 2WMIB 1HKJA 1UZ4A 1HJVA 2V3EA 3RM9A 4UQDA 1H0IA 3LPGA 3VGFA 3A6OA 4W87A 1QNOA 2DDXA 3TA9A 1JFXA 1TVPA 3FHAA 4E8DA 4AW7A 4PYSA 5F7UA 4WSKA 4JAWA 1F4HA 2X0HA 4GPNA 4XUYA 3BAXA 1LLOA 1UA7A 5A6BD 1MFVA 1UR0A 4PMQA 3MUAA 1QI2A 1UR8A 2JEPA 3J7HA 3VIPA 2BS9A 1J9YA 1AQ0A 1VEOA 2JIEA 1QNSA 5ABHA 1UA3A 4ATDA 3WDHA 4QAWA 5HPCA 4PSRA 1JYVA 3RJXA 1V0MA 2WYSA 1U30A 1OB0A 1JFHA 3OB8A 1KXQA 3PTMA 4CCEA 4YN5A 4UQCA 1JIBA 2WLYA 4PBGA 1CGVA 3D3AA 1ZB5A 3TOPA 1GVYA 1W9VA 5I0DA 1DWFM 1BSIA 3SCUA 1GQLA 1D7FA 4D6FA 2GJXA 4PMUA 2YDRA 3SIMA 3M07A 4UFKA 4BQ3A 1H5VA 4E8CA 3WF4A 2EPNA 1EIBA 2XIBA 5KEZA 3WUGA 3WD3A 2OWCA 3KEHA 4AD0A 3VDBA 3AXIA 1HKKA 1F4AA 3F5KA 1H09A 4HZ7A 1B2YA 1CGUA 1NM9A 1HP5A 5EMYA 4NF7A 1RD6A 3N04A 4FF5A 4PSPA 3VD7A 2VJXA 3IJ7A 3IJ8A 1B9ZA 2WVVB 1E0VA 2D3LA 2EPMX 1SYTA 2GK1B 1W9BM 4C7DA 1H3GA 2DSZA 3MKKA 5M5DA 3MANA 1JG9A 3WQ4A 1G94A 3HU7A 1CPUA 2WMJA 3T0AA 2G41A 4M29A 3ZMRA 2OSWA 3WH5A 2XVGA 2NW0A 2VUYA 2XFRA 2J79A 2ZXBA 4TVUA 1AMYA 4A3HA 3FXYA 3QOKA 2E40A 1VFFA 4MNJA 2GDVA 1CXFA 3WIJA 4U5IA 2BXZA 1W1VA 1OCQA 1B3YA 2YDQA 1E72M 2XG9A 1DHKA 2J7CA 3MSDA 4DUXA 1JNEA 1E4NA 2XVLA 1QNQA 5EBAA 4HOXA 3BAIA 3TTYA 2XWDA 5E9AA 3AMGA 4MPKA 3CTTA 3CGTA 2WMIA 3T2QA 4B3KA 4PMVA 1W3HA 1CGYA 2CNCA 2BVDA 3OIHA 3I3BA 3GXIA 2VURA 5A2AA 1JDCA 2YLLA 3FW6A 1OGSA 3QGVA 1VRXA 5M3WA 2CESA 5ABFB 4JKLA 4GI8A 3VIOA 3K8LA 2ZUWA 2CKSA 1JZ3A 1ISZA 1FHDA 3TTQA 1JI2A 2FDMA 4WKAA 2VRQA 1HNYA 1JNDA 4B16A 5IFTA 1CXHA 2VCBA 3EDKA 3CUHA 1EHAA 2YL9A 3ECQA 1US2A 4ACYA 1QOXA 1TVNA 4W85A 1BTCA 1GONA 1E55A 1UD3A 4OZOA 4ZENA 2PBOA 3L4YA 1MVYA 1VFOA 1JDDA 2PWGA 2WZHA 4BS0A 2D23A 3AFBA 1W91A 3UEQA 1H2JA 1G01A 4KGJA 2W4XA 2D1ZA 1BVZA 2RGMA 5DFAA 2X0YA 1E6NA 3AMDA 3SUWA 3VGGA 3O2LA 4P7RA 2QLYA 1G5AA 3AXXA 1CZ1A 1WDSA 2ZICA 5HBFA 3AHZA 1QPKA 1XD1A 3ZJKA 1JD9A 2GUYA 3PZ9A 1PAMA 5KZ6A 1W2PA 1AVAA 3OGRA 5IHRA 1WZLA 2DT0A 5ECUA 3VD9A 4JKKA 2JIWA 3CHCA 1XC6A 1J0IA 1GOKA 1VENA 3EMQA 2J77A 1KGUA 1EOKA 3L2LA 4W7WA 3UG3A 1BVNP 4ACZB 3BAKA 4AIEA 1E6PA 3UCQA 4HA3A 1JAKA 1KQZA 2XTKA 2D0HA 3BH4A 3RPMA 4CD8A 2GSJA 2CHNA 1B3WA 1H0GA 3UERA 5BXTA 1CWYA 3WNPA 4ZXLA 3FHQA 4MNLA 5CSUA 3WL1A 5IFPA 1XHGA 1C92A 1QBBA 2WB5A 4EAMA 3KL0A 3B9DA 3AYRA 3DYPA 1CXEA 3I3EA 2VX7A 3RJYA 1UWTA 1OBAA 1BYAA 2Y2WA 2IXUA 2CETA 1MYRA 2F2HA 4OOUA 1J0HA 5AYIA 2JF6A 3W4RA 3RM8A 4YHEA 4WF7A 5GNZA 4U2ZA 1W3LA 1E15A 3GNRA 2ZE0A 1WO2A 2YLAA 1LL4A 4N42A 1E4LA 1L0PA 3VUPA 3WY1A 4Q7NA 2WCSA 3GNPA 1B30A 1QW8A 4BF7A 1EGZA 2YBUA 3NYDA 3T0BA 4OUEA 1Z32X 3F5JA 1VBRA 2BY1A 1E4MM 5GNYA 4H8VA 1QNPA 2E3ZA 3T08A 3VVGA 4YPJA 4U5KA 4JIEA 4F9JA 5I77A 4UQEA 3ZSTA 3FNDA 1LG1A 2DSUA 1CDGA 1S46A 4W89A 1KQYA 1LF1A 3WF2A 2XUCA 2J7HA 1E1EA 3W38A 2J7FA 1I1XA 1XGZA 2DH3A 2WW5A 5I79A 3TTOA 3L2MA 3KZSA 2D0FA 4ZE5A 2EBNA 2WSPA 2F8QA 4M56A 1Q6DA 1E9LA 5ABFA 4FLQA 3A4WA 4W8BA 2YOCA 3WD1A 4J3WA 3OLGA 5A1AA 2VZUA 3ARZA 1R7OA 1GCYA 3KL5A 3ZR6A 1MWOA 3T09A 4HA1A 5BXSA 2CEQA 1KB3A 2W63A 2ZUMA 1H49A 2WVTA 5I78A 3WQVA 2O9OA 1EDGA 3MUY1 2EQDA 4IM4A 1C8XA 3MV11 4H41A 2JFEX 1M04A 1OSEA 2E9LA 1EQPA 2Y24A 1EO7A 5FD0A 4TVDA 1ECEA 2UY2A 2XM1A 3VD4A 4WK9A 3AZSA 3WL0A 2BY2A 2ZXQA 2DEPA 4JZ5A 1J0KA 3WNNA 1OIFA 4IISA 2XSAA 5FIPA 3WBEA 2YA2A 5C71A 4QCEA 3VMNA 1M53A 1W1YA 4E4PA 3WD2A 1UKSA 3BMVA 3L4WA 1UYQA 3T0DA 3W6MA 1CXIA 5FCZA 3UG4A 2GJXB 1KBBA 2E9BA 2BFGA 5CG0A 1E43A 3N12A 5I24A 2XGIA 5LA0A 2CKRA 1GQJA 3CPUA 4HPHA 2VC9A 4AIOA 5A2BA 1SMDA 4U2YA 3GXFA 4ACZA 4V2XA 4BZYA 4W84A 4PCTA 4PMRA 3NJ3A 3APGA 1JL8A 1JZ4A 1MQQA 3PZUA 1C7SA 1VB9A 2OWWA 4P8UA 1BYCA 1DEDA 1NWTA 4AD1A 1J18A 4P8VA 2Y8VA 1Q6CA 1PIFA 4WIWA 2ZX8A 4DWSA 1J0ZA 3RIKA 3VIFA 2WHKA 1AQHA 4D6CA 3AZTA 4P7LA 4TTUA 3VX0A 2D20A 3WUFA 2B31A 3CHFA 1JYWA 2VL4A 4JCMA 4P7NA 3BXWA 2QPSA 4H8UA 1E3XA 2ZIDA 1SFSA 4J3XA 4M81A 4GKLA 2JE8A 4QFUA 1WNOA 3W27A 1L8NA 1J0JA 5CZKA 1GOOA 3VIGA
chains in the Genus database with same CATH superfamily
3THUA 4ZO7A 2JKEA 1XPYA 3DGRA 3G6MA 3MTWA 3H4WA 4MDPA 4RZ5A 3VCNA 1TREA 3R7MA 1IEWA 1X1ZA 4ATWA 3EA3A 2VKZG 3DG3A 4NSBA 1JJKA 2J9XA 4W8AA 2JK2A 4FXRA 3PVFA 3CUXA 4PR4A 2BV9A 3AIVA 1FOBA 3NL3A 3HQPA 4UB9A 4KW2A 3O7UA 4HCDA 3P14A 2WJEA 3GIQA 1XDJA 3N2XA 2Y61A 3W29A 3S9IA 1BRLB 5HUOA 4Z1AA 1GOIA 1LBFA 4MZ1A 3TN4A 5C7VA 2WC3A 2HE5A 3WKZA 4CQBA 2NVAA 3L23A 3ZJ8A 2PEVA 3VIMA 1QW7A 4C7GA 2PDWA 4W7UA 2OYLA 1SW3A 3SCSA 5CJ5A 1BF2A 4ZOBA 4KEVA 5DXXA 1YXCA 4ZSUA 2XIMA 3IGUA 1DBTA 4CEUC 1TG7A 4LGXA 1C7TA 1A5KC 3R6IA 1Q2SA 2HTMA 4DI8A 4ODNA 4H00A 4E38A 1SSGA 3CLWA 4KIEA 1ISWA 3ABZA 3A3HA 4LV9A 3W7PA 3ZFHA 3DXIA 3TA6A 2QMJA 3GH4A 1B31A 4AU0A 1RJPA 3QFEA 3NTYA 1GOQA 4B3ZA 4CKQA 3IEBA 4I90A 3CH9A 4J3SA 3BLEA 3ZXWA 1IWBA 2QEZA 3PJXA 1B54A 1WZKA 2G3MA 1JZ2A 3W1XA 3W25A 3NNTA 1KXTA 1RP8A 2PS2A 1D2KA 1OEPA 3OPSA 4QRNA 3LTPA 3LCGA 4A2RA 5A69A 4J2PA 3HQ1A 4JTQA 3OHMB 4LNCA 4F48A 1VFUA 5K9CA 5A6TC 1EFZA 4R9OA 4N02A 3BAYA 2IW0A 3MV01 3TOYA 4DLMA 4ZGYA 2XFWA 4MWAA 4GLEA 2W62A 2E7FA 1R9XA 3LBMA 5D37A 1JQXA 4IQEA 1XCXA 2OXNA 5D75A 1KM1A 3LDVA 1GPFA 1EXPA 2VM8A 4POCA 3MCNA 3T44A 1LQ0A 1RVKA 3GNDA 1JF6A 4J9JA 2CITA 5A3HA 2XP3A 3RU8X 2I16A 4MZYA 2DW7A 3BJSA 4GYJA 4EK7A 3TW9A 4IICA 3AHYA 2PDKA 1AJ2A 3GH7A 1F05A 1PBGA 4ORIA 3S4TA 2WXDM 4N19A 1UMLA 3CZEA 3CZLA 3M43A 1E3ZA 2D9FA 3ZJ6A 4JTDA 3WNKA 1LWIA 1Q7MA 4UQ9A 1T5AA 4BWLA 6XIMA 3JYJA 4UQAA 2QJNA 2NXHA 3EWYA 3U6WA 4KS0A 1M41A 1UB3A 4QP0A 4FXJA 1N8FA 1M7PA 4AF0A 2CHOA 1QNRA 4UNLA 1SSDA 1S5VA 3TWAA 3AALA 2V3GA 1QOQA 3P8IA 4GNKB 2C0HA 2AQWA 1U5HA 3TMLA 4IGSA 1VJZA 3H9RB 4FOUA 1TE1A 4FNTA 1XWYA 1TRIA 5FL0A 4P7OA 3C0LA 2Q01A 4XAZA 2GFTA 4KBXA 3LQLA 3V5CA 2YA1A 3XISA 2OGYA 1ZL1A 3RX3A 1BG9A 2XSBA 1UOKA 3T07A 1VPXA 3SQMA 1LL6A 3AMCA 2W79A 1UR9A 4J4NA 3GDTA 1HX0A 1PPIA 4YTSA 1NOWA 2PAJA 4UFHA 3L4VA 3ANUA 3ZQ9A 4YYCA 8RUCA 2E9MA 1LORA 2KAUC 4ATLA 3BE7A 3MUXA 3ZIZA 2YL6A 3NOEA 3CBWA 4GVHA 1VFTA 4DJDD 4GQRA 4DROA 4KMQA 3C52A 4LVBA 4NP7A 2PDIA 1OX4A 4IIGA 1JZ7A 4AXNA 1R3WA 1XLEA 5FI8A 3JR2A 3LV6A 1XBXA 2J7GA 3T2OA 2DV0A 4O8AA 4ZO6A 5JBDA 4DBWA 2YA0A 3WDRA 4BQ4A 1YLVA 3H8AA 2AQVA 1FKLA 3SCWA 2TRSA 2IQ0A 2YL5A 4C65A 4A2SA 1AG1O 2HVMA 3S2MA 5DCEA 3S1VA 2ZBTA 4H8HA 2L5HA 4HU0A 2OSXA 1YIXA 1TMQA 4HA0A 4DWSB 5BRQA 1FDZA 4Q4RA 4GNJA 3U48A 4Y90A 4OIFA 4FF7A 5HJLA 4A8IA 3ZR5A 3EMZA 2Q8LA 2B0MA 3PPHA 1JI1A 1UWIA 2ZTJA 2NX9A 3FV9A 4S23A 2CLEA 3O5RA 5C2XA 2ZWYA 4FR1A 2FHFA 1PKNA 4HZ8A 4RDZA 1W3JA 1AH4A 2PTWA 3PJWA 5T26A 3JU2A 3NVDA 4PMYA 2FJKA 4DJEA 5HK4A 3UQAA 1Y5VA 4F9DA 1SQ7A 4C6DA 1I45A 4K1GA 4JY8A 4R88A 4ZTXA 4B5TA 1V3JA 4FAPA 4EF9A 2YR1A 1S5MA 3CHEA 4FK9A 1V79A 2Y89A 4LX4A 2VGGA 1G4PA 4ODOA 4O1BA 4HYWA 1O1HA 1RBLA 3MMUA 5G2IA 1Y0OA 2GPTA 2WNQA 1FWHC 1EX5A 3UG8A 4MB4A 3A3WA 4UFLA 5CGMA 2OEKA 2PDFA 4HHPA 3K8MA 3IIOA 3E02A 5IM51 2AWGA 3H55A 4KCVA 2ZRWA 1C91A 1YPXA 1NAL1 2HK1A 4A35A 5FEWA 3KBJA 3O0FA 3QKEA 1NELA 5AHMA 3KOXA 4CD7A 4N0RA 3GC4A 4G1NA 3MSGA 3S47A 3WF1A 1HVXA 1UKQA 4FOKA 1KM2A 1KT0A 1V0LA 1K9EA 1A53A 4DRSA 3IGSA 2WSQA 1EP2A 4D6JA 4XBJA 2E68A 3LXBA 2NSXA 3ZLFA 1ZSXA 2DPEA 1Z8AA 4K7VA 1KCLA 1XH1A 4WSJA 2Y5EA 3BV7A 1SR0A 1Z69A 1F8MA 2ADAA 4GZJA 3IRDA 3VA8A 3ARVA 3UZZA 5XIMA 1JPHA 4JPGA 2QXWA 4UZUA 4MJ4A 2WO5A 1VFHA 4DHGA 4GIYA 3WF0A 1XKJA 3W6YA 1S2AA 3IS4A 4MUPA 2DORA 1BGAA 1PZ0A 4LRSA 2RDWA 3WQCA 3GUWA 3CHDA 3U2ZA 3O3RA 3BPWA 3N19B 4D6GA 5I02A 3N11A 3EDJA 4EANA 2MANA 3VOFA 3VD5A 4D9PA 1NSGA 3CM4A 5EB8A 3M0HA 2Y78A 1JF5A 4L64A 4QIUA 5D2TA 4AIBA 5I6SA 3NAVA 2ABBA 1DJHA 2LLEA 1D3CA 5JH2A 1M1BA 1I75A 4UWMA 3N2MA 4X9YA 2GJLA 2PRMA 3ITVA 2EULA 3UCDA 4GQQA 1KM3A 4GGQA 1M5YA 1GTHA 2BVTA 3EAUA 1QI4A 3CH0A 3OP2A 2QCNA 3KX6A 3WNMA 3APTA 3G1RA 1LWJA 2BVYA 4KRUA 3KS5A 4TW7A 4HU3A 2VC5A 3R0DA 3WBYA 1WDQA 3NQFA 3KTSA 4FLSA 1XV8A 2WC7A 1PB0A 4JX5A 1R38A 3LPOA 4LFYA 3BVJA 3VUSA 1VCVA 3W7MA 4LBUA 1FWBC 3D46A 3ZJ7A 4DWSC 2J25A 4HMNA 2BVWA 3EPNA 1UBSA 4GBDA 1KGXA 1NARA 5G2HA 3WLKX 1Z44A 1D7HA 3GG1A 4H6RA 1QHZA 4H2HA 2V5JA 3N4AA 4Z2LA 1LOLA 1OC7A 1VS1A 3PHAA 2WJFA 1U2YA 4DJFD 1RV8A 3AIUA 1PO9A 3TN5A 2YW4A 3WQ8A 1KFWA 6ENLA 3E2SA 2V3DA 4DRIA 1WV2A 3V4BA 3ISIX 1QOPA 3NM3A 1JUEA 5EYWA 3TQPA 3NYZA 3EEGA 3QGAC 5KTLA 2O4MA 2HXTA 2YCLB 1TUFA 3CZJA 2PDGA 3EDEA 4GY7A 2H8XA 3KS6A 1K9DA 2YL8A 4GI6A 1QBAA 2VZOA 3A47A 3CUJA 3PUGA 1ITUA 4QZVB 4WDTA 3WSUA 1FWAC 1LM1A 2ZUNA 2J8TA 2OO0A 2PU0A 2IPJA 2X1RA 1EL3A 2VFFA 4LCQA 9CGTA 2BASA 3TK7A 1F3EA 1NQ6A 3KZPA 2Q8XA 4YCOA 4GIRA 3EEZA 4UTJA 1E1CB 1QPRA 1G1YA 2P8BA 2QCGA 4W86A 4QJ1A 4RW3A 4M3PA 1H1ZA 4GI9A 4ZTYA 4U86A 1KFBA 3IIPA 3FYPA 4Z1DA 4K68A 4HT3A 5LNRA 1YBQA 2ZOXA 3O6YX 3E2VA 1CEOA 1SMAA 1XCWA 1XJBA 4XZBA 2DIEA 1KRMA 5G1MA 4H9ZA 3GIPA 2YBVA 2EO7A 3GVQA 1DJXA 4TTGA 5BYWA 2NQ5A 3TTSA 1ICSA 1E5JA 4AAJA 1R2RA 1ONXA 2PU1A 4GD0A 5LA2A 1C90A 3I68A 2FFIA 4ADTA 2UZ5A 1SFTA 4W9OA 1WOBA 5IHSA 4JTCA 3Q65A 1S2VA 3TQVA 4UTTA 3ME3A 5AHIA 3AIEA 3ZT6A 1LZOA 2ATMA 3BOXA 3U3HA 3OA3A 1XQKA 1Z48A 3N34A 4I9AA 4B9ZA 1XI3A 4Q8VA 2PTXA 1UBPC 4C6IA 4ICMA 1ZRQA 5A6LA 1GNXA 3WLRA 3SSJA 5HMEA 3FDKA 3E0LA 1JXKA 4JN6A 3BSMA 1KC7A 3B3DA 1GJUA 3ZVHB 4JTIA 3RR4A 4JQ1A 1H60A 2PGWA 2G3IA 3G18A 3PZTA 3EWWA 5I03A 2W92A 3LMYA 3F2BA 3UWWA 1V08A 1XDLA 3FA5A 4D72A 1PCWA 3FVDA 1OD8A 5HT1A 2A7PA 3QV6A 1A5LC 4CD6A 1XFCA 2QUTA 1G4EA 1FWNA 3VMOA 3L21A 2D22A 5E0FA 3BAWA 3H26A 3EWXA 1NH6A 2QCMA 3WD0A 1IR2A 3UXIA 2ZUUA 5FJUA 2LJ4A 1AZ1A 1XYFA 3LK6A 5FKYA 2INFA 3BANA 4Q8PA 1XLCA 4HNNA 3UJFA 4GZEA 5HQEA 1IWAA 3JUGA 2NQ9A 3Q4DA 3BJTA 5ENLA 1EJVC 5LZLA 4M1BA 3A12A 4NIRA 3TSBA 1VPYA 2YBTA 5HW7A 1QATA 2FPYA 1QRQA 2NXIA 2Q3RA 3W88A 1RCOB 1EC7A 4WXZA 4JFKA 1SZRA 3DOPA 1EHNA 1QHPA 4D8LA 4IPPA 4XVDA 1ZCNA 5EFFA 2J9ZA 3NQBA 2HVNA 3OBKA 3CHVA 3VOHA 4V33A 1Q8AA 3AS3A 3W7OA 4B5VA 4ZA0A 3G3MA 1J2BA 2AOSA 3VK5A 1RJQA 1FWSA 2GGHA 2WVSA 2VCCA 4PA8A 4E5TA 4PUDA 4REQB 1TRDA 3VNYA 1QI3A 2VT0A 1BF6A 2H9AB 3EBVA 1WZAA 2FVKA 3EIPA 3FCPA 4C1LA 1R3SA 2QF8A 1K02A 3G6LA 2R24A 3M0MA 2BWGA 2WVVA 3OG3A 2HJPA 1QJWA 2EG7A 5BXPA 4WJ8A 1W9DM 5LIYX 3AQUA 1GQKA 1LCOA 2FZ9A 5CC5A 3GQYA 5AVNA 1ZQ5A 3WQOA 4HARA 2CBJA 2VXNA 2R6OA 3LGDA 3AIRA 4FA3A 4FMVA 4HZ6A 3VXGA 2EEXA 3AU6A 4QBXA 4BF8A 1JYNA 2QUUA 4LB3A 2VR5A 3TH6A 1VHNA 5C0QA 2Y7EA 1W9XA 3AIQA 1G67A 2WQPA 2BHUA 1N82A 3CO4A 2DIKA 5E09A 3ZVHA 4CU8A 4MB5A 5SWUA 1E6QM 1MDRA 3WLMA 2NQHA 3ZOAA 4C90A 4AB4A 1CB2A 1FKHA 3NQAA 1QI0A 3UA3A 1S1PA 4UTFA 4EXQA 1NP0A 2Y7GA 1P43A 3SN4A 3NXLA 2O4QA 3DFOA 4Q33A 1HJSA 3W6LA 1N8IA 2Z28A 2XPAA 4D6HA 4HHMA 3UI5A 3VILA 3QRHA 1E6RA 4UUIA 7A3HA 5CKSA 4LV4A 2ZVRA 2QR6A 3INPA 1A4MA 3CWNA 1ZU8A 3TJLA 2V2CA 5HMSA 3BC9A 5C9XA 1H7RA 2QZRA 2VQTA 2PURA 3ARWA 1OZMA 1HIZA 1ZAIA 3LGEA 4FXSA 3W1LA 4KGLA 4AHOA 3E1F1 3YPIA 1UCWA 5FEZA 1I2PA 1OYAA 2ONEA 3QMTA 3H4GA 2PC8A 4IUOA 2O9RA 3FAWA 4XAFA 1Q6RA 1M6JA 4TX6A 3L4ZA 5AYXA 1YNPA 4IMAA 2ACSA 5CC6A 2OMAA 1F3XA 4CU7A 2GWNA 4JHZA 1XH0A 4Z2GA 3GTHA 3JRKA 2BLEA 5FJJA 4KCUA 5IDIA 2GDQA 4DXVA 1LRNA 1WXJA 3S9YA 2YCJA 1V3KA 3HN3A 2XPBA 4DRQA 3O63A 2P3EA 3PSVA 4AD2A 2QAPA 3OVPA 3IKDA 3I4EA 5K3VA 4O1CA 3NZPA 3AJXA 3P61A 4U33A 2PA6A 1YRRA 3E49A 4R33A 4AC7C 3UT0A 1WYIA 2TSYA 3ARQA 4L9XA 3R8HA 4XISA 4MVAA 3M0KA 3DESA 3N1AA 3EX3A 3AS2A 4MB1A 5A8GA 1B3XA 2VEMA 3PY2A 3TLLA 4B2DD 2D2HA 2DT1A 1LBMA 1U33A 3KCJA 3D0CA 2BOEX 4LAYA 5DIUA 2O7QA 3TE9A 2V5BA 2G96A 4S38A 1BGGA 1YYAA 2C1HA 3A4XA 3IANA 2RUDA 4JYEA 4N6FA 1E56A 1XLLA 1YHTA 4MB3A 4OBSA 4JTKA 2OZ3A 5CPTA 4O1EA 2J8FA 5G1YA 1OWQA 1A0DA 2NUXA 1YATA 2H90A 4XAGA 2D0GA 1V3MA 1N8WA 1V4YA 3VGDA 3ZS4A 1EWEA 1DYSA 5DELA 3IAPA 1HKJA 4QXIA 3VOJA 3A21A 3LPGA 4KT2A 1E9IA 4O1FA 1FXQA 5EMMA 2DDXA 2W27A 1JFXA 4PODA 1P0EA 4RNJA 5U7SA 2OLAA 1FCBA 1XC4A 3UR2A 4TO8A 4GPNA 4XUYA 5A6BD 2PDYA 4K8HA 1TV2A 3MUAA 3WK3A 3M7WA 4RZ4A 3J7HA 4LS0A 4BKNA 3G8RA 4OT7A 3M64A 1H51A 4XIMA 1WKEA 4V1YA 3KVLA 1SJDA 4I5RA 2DUZA 5DY2A 1OABA 3OYZA 3THQA 9RUBA 2JIEA 5FJRA 3AYTA 3HIJA 3UXLA 3NM1A 3HV9A 5H8PA 5HPCA 2J9YA 1SO5A 3RJXA 1B3OA 4J1OA 4A3UA 1V0MA 2AL2B 3M6YA 5C9RA 5MF5A 2C71A 1JFHA 2VFDA 3F03K 4EF8A 3PTMA 4ODPA 4OGZA 4CCEA 5GVJA 1GRJA 2WLYA 1YNYA 1X8FA 4Q6JA 5AHLA 1CGVA 3D3AA 3STGA 2BXVA 3VCCA 1FWDC 1GVYA 5I0DA 1GJPA 4GC3A 2YFOA 1W31A 5HMDA 1WKDA 1GPWA 1GQLA 1TTQA 4DY1A 1FQ0A 3WK1A 2F2DA 4JIHA 4UFKA 4GUFA 3VNIA 1DHPA 1WDWA 3UXAA 3GU9A 2E5CA 5KEZA 3TC7A 4XKYB 2OWCA 3UU0A 1Q6HA 1TPH1 4WSHA 1AH3A 2CLOA 3PJUA 1HKKA 4YTTA 5FF0A 3F5KA 1BWVA 3BV4A 2R82A 1CGUA 3H70A 1HP5A 3BZJA 1RD6A 4Y9MA 4MHBA 2INZA 5F4WA 4F2UA 4L6OA 2V8ZA 1DOSA 4O18A 1PTDA 2D3LA 2HXUA 3LRMA 2GK1B 3MYOA 4C7DA 1H3GA 2DSZA 3EB2A 4QEEA 4WX2A 3MANA 3W22A 4F0RA 1VZWA 3TR2A 4DO6A 3FJLA 3LS9A 1U83A 3FKKA 1BXNA 4GNVA 1JVNA 4M29A 4YWIA 2F4EA 5DRIA 5DANA 4QG6A 4S3FA 3PB2A 1AMYA 2C1GA 1LRQA 3RGCA 1VFFA 3KOFA 2BXZA 2X30A 2XG9A 1DHKA 5HAOA 4LUTA 3MSDA 3IWPA 1I8JA 3MB9A 5EBAA 3BAIA 4RV3A 4JTTA 3W7HA 1TV4A 2DUAA 4JYDA 1T8QA 3CGTA 4AHQA 4C6KA 1B5TA 3TCEA 5DN1A 1XBVA 4Y8EA 5I98A 2CNCA 2BVDA 5H8UA 5A2AA 4ZB0A 3RFAA 1UUOA 3QGVA 1OVDA 4HIBA 6REQB 3GS6A 1OJXA 1TQJA 4JKLA 2OEMA 5EMJA 3TW7A 5G4EA 4F4RA 1AZ2A 3B03A 1JZ3A 3SQLA 1FHDA 5DMNA 1HNYA 2PZNA 4E8GA 4LH8A 3E96A 2AGKA 4O57A 2A6LA 4TYOA 3E9AA 2Y63A 2I1OA 1EHAA 1R3VA 3ECQA 3T4WA 5AZ1A 1OCNA 1R9ZA 1TVNA 3TV8A 1BTCA 1GONA 1UD3A 4QIBA 4QJ5B 3GVGA 2E6YA 1QAPA 1PUDA 3E6EA 3IJDA 4ZBCA 2D23A 1HO4A 3AFBA 4DBUA 1TV8A 2P3ZA 3BG5A 3UEQA 4KGJA 3RAOA 3DDMA 2QJIA 4BEQA 4DRKA 1BVZA 2RGMA 1FBAA 5ABTA 4IQ2A 2X0YA 2AL1A 1ML1A 1EF3A 2R1PA 3DI0A 3NL6A 3B7XA 1PCKA 2ZR4A 4QTGA 1LUCA 3O2LA 1GQNA 4LUIA 4U10A 3H53A 1GGOA 3KOYA 3TWBA 1G5AA 1IXNA 4LAKA 1CZ1A 1GK8A 1WDSA 2ZZ1A 2ZICA 4FNPA 1W1ZA 4YTRA 5E1QA 1XD1A 3ZJKA 2GUYA 3M0ZA 2IQTA 5IHRA 2DT0A 4QNWA 2DG4A 2JIWA 4KWVA 5CAHA 1KV8A 1GOKA 1KW1A 1KGUA 3KXQA 3MP3A 5BNKA 3O5QA 1BXBA 4NUWA 1E6PA 4HA3A 4S2BA 2ON3A 1XW8A 2D0HA 1KRAC 1WUEA 4N7QA 1XGEA 3ES8A 1PWMA 3UWEA 3WNPA 4ZXLA 2YXGA 5HMFA 1BKHA 1LLZA 4HPJA 4XTIA 1BEUA 3AWNA 1GG1A 1BYAA 2IXUA 1NDVA 4MFEA 1F9CA 3RM8A 4WF7A 1O95A 4TV6A 3OW1A 2YLAA 3HPSA 1E4LA 4NZ5A 3V35A 3LM3A 3GNPA 3NYDA 3T0BA 1G6CA 5DO2A 3EZ4A 2MNRA 5BOOA 3MI6A 1ZCCA 1VBRA 3PRDA 4X3ZA 5GNYA 2G4JA 4FXFA 3G1HA 1O5RA 3VVGA 3KVJA 3UBPC 2VYOA 1LG1A 2DSUA 3M0YA 4AUBA 2XUCA 2J7HA 3W38A 1AMKA 2J7FA 1CB7B 2W0UA 4IIHA 1XGZA 4DF0A 2DH3A 2QVNA 5I79A 4J40A 3RUBL 1T0OA 3L2MA 1KLYA 1ICQA 3QM3A 2RQSA 6REQA 3OQEA 1W3IA 4QSFA 4O19A 4FLQA 3R10A 2YOCA 2BX7A 1ELSA 5A1AA 3HPAA 4H01A 1BKFA 1GKQA 3QBUA 1MWOA 1MSSA 3T09A 1T96A 4IQDA 1IWPA 3GW3A 2W63A 2WVTA 1J5SA 1KTNA 4KRZA 1DQXA 2EQDA 4H41A 4KKXA 2A5HA 1M04A 3LU2A 1IR1A 4DZ5A 2E9LA 3LHYA 5FD0A 4TVDA 4AHPA 2R1KA 2XM1A 3LM7A 1VRDA 2DU2A 3WL0A 2ZXQA 2DEPA 1YKWA 2O56A 3WNNA 2ZQTA 3SN1A 2XSAA 3VMNA 1KFCA 2V82A 2CU0A 3TXVA 3SY1A 3V3WA 4S3AA 4GXWA 3KAHA 1SJAA 3GR7A 4YLWA 1DORA 2X7WA 3O5PA 1KBBA 5CG0A 2WSYA 3NQEA 2HPIA 2XGIA 4XD6A 5LA0A 2CKRA 1GQJA 3EWZA 5B7ZA 3TTEA 3GIYA 5A2BA 3CJPA 4MIMA 2Z2AA 3UD6A 4V2XA 4PCNA 3JXVA 4GQ0A 5L6UA 4FB7A 3GXPA 3GXNA 4IP5A 4GI4A 3LCIA 4BFAA 4P8UA 2OZ0A 1UPMB 2CZEA 1Q6CA 1GG0A 4WIWA 4IQJA 1U1HA 2A7RA 1J0ZA 2BB0A 4JQAA 1AQHA 4D6CA 2OR2A 1H63A 3AZTA 3G24A 4Z1CA 1XISA 1JYWA 3M44A 2ACRA 1XM3A 1ZTVA 3L67A 4Z0JA 3TC6A 4TMBA 1TPUA 4H8UA 1SFSA 4M81A 7REQB 2HBVA 1FDYA 2QGYA 1WNOA 1K6WA 3HM7A 1VFSA 2CZVA 3QPYA 9XIMA 2QAFA 3ZO9A 3T0TA 1QPOA 3CTLA 4K37A 5EA9A 3U9IA 4Z2JA 2XIOA 1BLIA 1TPDA 3B04A 1FKJA 1Z6KA 1EDQA 3IIZA 4CD5A 3EMCA 2IUZA 2BMBA 2HS6A 4GY1A 1AL8A 2FB3A 4O8RA 3A5FA 3NIYA 1OYCA 1JCLA 3UP8A 3ARXA 1B3ZA 4E4UA 5CC3A 4GVIA 3QHMA 1PEZA 1K7EA 2Z00A 3WO8A 1VD6A 2ZZ7A 1CENA 2CLMA 3MZ2A 3IIXA 4L72B 4C6PA 5FSEC 1DVJA 1ZGDA 2QIIA 1W1A1 3K8KA 1DTNA 1QW9A 3D5HA 3U5YA 5DY3A 4ML9A 4AZHA 3DGBA 3S9ZA 3UETA 3AHVA 3COTA 1UWAA 5KMYA 4DAFA 3CB8A 1VEMA 4QS5A 4BA0A 2OODA 4RXFA 3NEVA 1UASA 3PN8A 4N9BA 3T1GA 3VKDA 3C5QA 3LXAA 5DMYA 4WGHA 2XN2A 5GPRA 4PTNA 4IPNB 3KUMA 1NFPA 3CYVA 4JYSA 3G22A 3GZAA 4F0HA 3ALGA 5BRPA 5JIPA 4L6HA 2WLZA 5DEZA 5JH1A 1IEQA 4LAXA 1VH7A 2PF0A 3DFPA 1ITCA 2DQXA 4JDYA 1GYNA 3RRAA 4C5ZA 2UWFA 4DJDC 1I1WA 1FWEC 1SR9A 3B0YA 5AY7A 1E51A 3K4WA 2ZC1A 2Y62A 4ZB5A 3MKCA 4JX4A 4DT4A 3SFKA 1Q13A 2GVYA 4HU8A 3ENLA 3CUGA 2HQAA 4DBEA 3RILA 1W54A 2X1IA 3VKCA 3WEZA 4YWSA 3QYSA 3S2CA 4HPXA 5G4WA 4WDWA 4DB7A 1ZJAA 3CAWA 3CYJA 5JBFA 1XIBA 4F3HA 4CNPA 4XVEA 2W66A 4BCEA 5ECVA 5JQ9A 3H2NA 2NWRA 3CK5A 3MI3A 1UKTA 4MY9A 4LAWA 4IIBA 1TMHA 4O0ZA 3KFTA 3LV5A 2OOGA 1P6CA 3E0WA 1UR3M 5D9PA 1D7IA 3NQCA 4ODQA 3QR0A 3VM5A 4BQ2A 1R30A 1VBUA 4OV4A 5FOOA 4UQBA 4RPPA 4M6PA 1QT1A 3KRUA 3UNTA 4QR6A 3KP0A 4KCTA 3KHDA 2FDSA 3H22A 2X1TA 2CBVA 1R2TA 1KR0A 5FJPA 2V5DA 2I7GA 3UNDA 4N9DA 2FH6A 3CIVA 3PPGA 1CLKA 1OT1A 4IFKA 1A80A 4UR7A 3KBVA 2YGYA 1VKFA 3MVTA 3S5NA 1EJXC 2KFWA 1HVQA 2WHLA 4H9XA 1H1YA 2PCQA 2FTWA 1RVGA 3WMSA 3LY0A 3BGAA 5IOBA 4O52A 2XVNA 2Q71A 4Q8WA 1ITXA 2DY3A 4CNTA 4IG2A 4UFJA 1FH7A 3IAQA 2A3LA 2UV8G 4Z2IA 1JXJA 3LERA 1NFGA 4A8RA 2WNNA 1L6WA 3KVMA 4JIPA 1H7XA 4Q4MA 4AY7A 1POJA 4M80A 3Q94A 2Z1BA 1LRTA 1JZ5A 4C91A 1S2CA 1NDWA 1CLXA 3OLIA 3ITOA 4PUUA 1KFJA 2J78A 4AZ7A 1F3WA 2A79A 3LTSA 4AYSA 4IPLA 4MKNA 3KL3A 4I6VA 2BZNA 1B9BA 3U7VA 1VF8A 1MQPA 1P7TA 4CLMA 4R3UA 3LHUA 1U22A 5GJMA 1V77A 2C79A 2W61A 3BSHA 5CSYA 4MY1A 3VZXA 4EE9A 2Z26A 5JUVA 1QVBA 3HPFA 3R0KA 3WX7A 2GDUA 3UZ5A 5A8MA 4JQ4A 4NAFB 1SZGA 3WH9A 3KTCA 1TCMA 4DO4A 3C86A 4PB4A 3ZYZA 2PCEA 1HP4A 1HO1A 1TV7A 3OHIA 4FLOA 2BHZA 3O07A 1CGWA 3BSGA 4HPGA 4R7WA 3SUUA 1E5NA 4RE2A 4IQCA 2VZTA 1AA1B 4AFYA 1VBGA 4IUGA 3F4CA 1XYLA 2REQA 4MSSA 4DUOA 2ITKA 3ZM8A 1WP6A 2I5QA 3ITLA 1QO2A 5AHEA 3W2KA 3LXCA 3C6CA 2WANA 2BDQA 2QGHA 4YU1A 4W9QA 3E38A 2DIJA 1D3HA 2XPKA 5G2WA 3IVSA 2R94A 2HBXA 2G8ZA 1JPIA 1Q63A 2ZADA 7TIMA 1UR1A 2A6NA 3SCQA 3WUEA 3OZMA 1DJNA 4CGTA 3W23A 2V3FA 3VTRA 5HJXA 2VC7A 3GHUA 2DG9A 4X0NA 5I00A 2G5WA 1PWLA 4NZFA 1EH9A 5FF3A 4NKCA 4R34A 3NI6A 3WH6A 4XG1A 4NNAA 7TAAA 2WSRA 3NQDA 1R85A 1C9DA 3UFYA 3UQNA 3FN9A 1B6CA 1V02E 3RM4A 4QT3A 1LT8A 2ASHA 1W0MA 5KZDA 4LPCA 4QDPA 1N7KA 4WJXA 2FAPA 1BQCA 2E1DA 4WOZA 2M2AA 4DZHA 3E5BA 3JVAA 3TYEA 3VZZA 4JQ3A 1K6AA 1FH8A 1VYRA 1EGVA 3HA1A 2XN0A 2VI0A 3FEQA 5H6HA 3MCMA 1SZFA 1TV3A 4LEFA 3G1XA 3VOCA 3GDBA 3AROA 1V0NA 3N13A 2TAAA 5HXMA 2CXGA 4DJFC 4Y9NA 2OG9A 2Z4GA 4J3VA 4KPLA 4NNBA 2FPTA 5HJYA 3ITTA 3NXFA 1KA9F 4B90A 3U2OA 3DH7A 1CYGA 1W5MA 3M6DA 1GUVA 2OWXA 4NU7A 4AZBA 3B8DA 3W1TA 2INEA 2GGJA 1R3YA 2WZMA 5BXRA 1G7VA 4RLIA 3WK2A 4IIFA 1Y8BA 2MLZA 4PCPA 3KWSA 1J93A 3CMGA 4IMDA 4ENLA 4PL1A 1VCFA 1EC8A 1E9YB 4Q8NA 5FF2A 4YIWA 2YJQA 3QYQA 3WUBA 5CG7A 3OU8A 4KH2A 3ITYA 3WCZA 1FJDA 1OGGA 3I6CA 1IV8A 4WKFA 2JBMA 4OQVA 4HPNA 4BHYA 4PUJA 2A3BA 4QCFA 1YMYA 3ITCA 1HFBA 1KGWA 3NO3A 3PFRA 3PR2A 2PC4A 3WMLA 4PMNA 3W1NA 2ZKMX 4KFPA 4F0MA 4ZE4A 2OSYA 3DU0A 1K9TA 2DH2A 2OYMA 2VEGA 1XH2A 1Q2RA 2X16A 3LCLA 4H9YA 2F9RA 3GH5A 1WKYA 1UD8A 1CGTA 1I0DA 3B05A 1FFRA 1EYWA 1M03A 3AS0A 3MMTA 3GM8A 5D09A 2YIHA 3N3MA 3KCEA 3WJSA 2ZXAA 1MFUA 1R3TA 5LNWA 1KM4A 1ISXA 2XFYA 1S38A 1A5BA 5EFDA 5CZSA 1ME7A 3BOFA 4OKDA 3W1AA 4NXKA 1CXLA 3L0KA 4QLLA 1XX1A 3CU2A 2ZUTA 1G69A 1EUAA 1JUBA 1JDAA 2VR4A 2FGBA 2KR7A 3KRZA 2O9TA 2C14A 3DG7A 3U7BA 2F61A 1A0CA 3UJEA 3MWAA 3O1NA 2KE0A 3L5LA 1JUKA 3K1DA 1TO3A 1V6TA 3S6DA 2A85A 5C55A 2A3AA 5DBUA 1H11A 1BG4A 3ITXA 1QU4A 1LROA 1QI5A 1C93A 1ZUAX 1OIMA 1MQRA 2NSOA 3TVAA 1E6ZA 4BQ5A 2FMNA 1A3HA 4GJIA 4MZ8A 1U1JA 1GZGA 4TW8A 3QSTA 5I5RA 2GL5A 2JQXA 1Q7QA 5K7JA 3FGCB 2WZIA 4D6IA 2GJNA 4US5D 2RDXA 2E28A 3L4UA 3CUFA 1MXSA 1XYBA 3RO6A 3VKJA 5HPOA 1XIGA 1V6YA 1UW9A 2EPHA 1NWRA 2IMRA 2FZBA 1L6FA 2WNZA 3HG4A 2PDLA 2ZVIA 1XIJA 1YE6A 3QQWA 5LIXX 1S3TC 1AUSL 2JF7A 2HCVA 5I3GA 3SRDA 3T7VA 6TAAA 1KXVA 4QLKA 1IHIA 2F21A 4G9PA 1NFBA 2PGRA 5L9FA 5E0KA 5FEXA 4CVUA 1R9HA 3LI1A 1LJYA 2V38A 1RUSA 2O0TA 4P8XA 1RCXB 3SCPA 3GWQA 4HK5A 1MW2A 4LYRA 4AY1A 1F5ZA 3N4EA 3NL5A 3RCNA 1FH9A 4AZGA 2WM1A 4CQCA 6TIMA 3UXKA 3ZT5A 1Z89A 1YXYA 4GO9A 2WZEA 4JFMA 3TYBA 1OC5A 2WWDA 4J3UA 2G3NA 4MNKA 1BQGA 4UIOA 1XGDA 3CO8A 3SRHA 4NJIA 3R43A 3G1FA 1W5QA 4QDMA 5DX7A 4ZEPA 2ISDA 5CLWA 3AUJA 2E09A 3IACA 3PJTA 4ZQCA 4L61A 4OU1A 2A1YA 5A95A 1AQFA 1A5UA 3THCA 1O7AA 1HKIA 4C1NB 4NJKA 4V28A 1ODUA 4DNHA 1W8SA 3O6DA 4PB5A 1XYCA 3LEPA 2WPGA 4F8XA 4LRTA 4IT1A 1WX0A 4OBRA 4Z1BA 5D8WA 4JFTA 1NU5A 1T99A 1I4NA 2QJHA 1JVWA 2ESCA 2OX4A 4PMXA 1JPMA 3UZYA 3E2QA 2HK0A 4LJ3A 3FKRA 3NQMA 2V5LA 4KESA 5G1TA 4WQ6A 3FXGA 2ZZ6A 3WLJA 5D9MA 4L5ZA 5HINA 1J96A 3UI4A 2POTA 2Z1SA 3S5YA 4AEOA 2GZXA 1ZS2A 4B5SA 4PUEA 3ZR4A 4G7FA 5AC8A 1CW2A 3VZYA 3UGRA 4D1IA 1V51A 4GZIA 2YXXA 1V6WA 3K4AA 3HJZA 3UJ2A 4JTFA 2GGEA 1NDYA 3E5PA 3LI0A 1U5JA 5DT7A 2KZHA 2O55A 1H7OA 3I10A 5HR6A 3V1HA 4Y2WA 1R87A 4RDYA 3U2CA 3BAJA 1U5VA 4ALDA 4I7VA 3M0LA 3POCA 4K6AA 3QHNA 2ETNA 3QZ6A 4PL2A 4B5WA 4B9YA 3B9AA 3MSYA 3O0KA 2PPOA 2BP1A 2GOKA 1H41A 5DIVA 4E3TA 3IK2A 1M01A 3QPEA 1PZ1A 4WD0A 2VFGA 3WQ6A 1BAGA 5ABEA 4S3CA 4HOZA 1IIGA 2QVHA 3M41A 3LNMA 1T11A 3OTRA 1T6MA 2ZZ4A 4K7YA 4YYFA 1TZ9A 4YCPA 3DIPA 3IJ9A 1F8AB 4NX0A 2VTFA 4HCLA 1CXKA 3EPOA 1G0CA 4W8LA 3O05A 2E8YA 1T7LA 3XINA 4UCFA 4AZCB 1TIMA 5IDZA 4B2DA 1UR4A 1GYMA 4IFOA 3SGUA 1UWRA 2J13A 2Y85A 3MP5A 4RE0A 3P8JA 4LAMA 3QW3A 3PZVA 5I23A 3SCRA 1OG0A 4QX4A 5U4NA 5LNSA 1IQ8A 1UWSA 2Z6IA 1I2NA 4N4QA 3S5OA 1CBGA 3BLLA 2Y8UA 3C2FA 4OHQA 4ONVA 3RR1A 3SZ8A 2NUYA 1V03A 5M17A 1JCMP 3GBEA 2XGZA 3UPMA 5D9OA 3IRSA 4QDWA 3NR0A 1GVRA 4BJHA 5C9UA 2CBIA 2O92A 1JNSA 5TQLA 4AVFA 2FMOA 3WMBA 4LYQA 1XYZA 1MZHA 1LQ2A 1REQB 1UKOA 1EZWA 3NZRA 4RR4A 4PFHA 1HJWA 4Z2KA 2XHYA 2ZA3A 4Y7EA 2VFHA 1TMLA 4C02B 4L3NA 2X40A 5CSSA 1X6NA 3VMPA 1DWJM 4Q22A 1G4TA 4PMZA 3P2VA 2CW6A 3FVMA 1GOWA 3FEMA 4NJJA 4H19A 5A94A 4S3JA 1A5CA 3ICJA 2NV9A 4DX3A 4PULA 1AW2A 5IXEA 3H2EA 2OEJA 3PZIA 4QE1A 2J47A 3ARTA 2XH2A 4MWAD 4NAEB 2OLHA 1P1XA 4FNUA 1VFLA 3L9CA 2W6RA 2OO6A 3W26A 1YQ2A 1EPXA 2GGIA 3D6NA 3IJIA 1XFBA 1DTUA 3RX2A 4ZQPA 5TAOA 3M0JA 2NUWA 5K2ZA 1KFLA 2V5CA 1X39A 2VD8A 5FEPA 1AFSA 1XRSA 3CQKA 4HQVA 4BF5A 5C2CA 1MRQA 3MT1A 1XIHA 4RK8A 4L56A 1TPEA 3V0UA 1QUMA 3DX5A 3HG5A 4O50A 4KWUA 2QJJA 4QJ3B 3TUUA 1YW1A 3DC0A 2PLMA 4QLJA 2D2OA 3WF3A 1TELA 3KBWA 3MU7A 2BGQA 1V6XA 3TDFA 4TX8A 4NRRA 1QPNA 3UJRA 1Y5XA 2ICSA 4C6BA 4G2PA 4JY9A 1UP3A 4UTWC 9XIAA 1A47A 1EDTA 2Y0FA 1PIIA 3T8QA 4DNMA 3LBCA 3GDRA 3A5VA 4ZPTR 2CC0A 3W86A 1OCBA 3VNDA 2NT0A 1TTIA 1QFEA 1TUXA 1EJRC 1RQEA 1H1NA 1W1B1 5I3JA 3NURA 1POKA 1FHVA 4O4VA 3DFNA 2OT1A 4Q32A 3WLOA 3N2BA 1ONWA 4G1KA 2I9UA 4ZS6A 3N9KA 3OOQA 1RBAA 1H5YA 2QDGA 1JAEA 3H21A 1ZK6A 4TQTA 4LY8A 1K03A 1JCNA 4MF4A 3FYYA 3WH7A 2FTYA 3CS2A 4MJ2A 4CQ9A 1VR6A 4GX8A 4MFDA 5AC7A 1ISVA 4QNEA 3WDIA 2HPMA 3BJFA 3SUSA 1DE5A 2QPUA 3O5LA 2HS8A 1A5MC 1I2QA 2IKHA 3U8GA 3NUKA 5HOSA 1WQ5A 3MMWA 1R8LA 2OELA 2ZUVA 3OBAA 1D9EA 1ZBWA 1Q6UA 4AC1X 2P53A 1JEZA 2QMKA 6A3HA 4NHVA 2YDAA 4AVOA 3D47A 1GEHA 4FPSA 3VCRA 4MMWA 4JHOA 4QG9A 4TXEA 1UD2A 3P3BA 1MXDA 1ZENA 1OFDA 3M5ZA 2Y1HA 4QE5A 4M7TA 2J8GA 3BW2A 2V81A 3K2GA 1UD4A 1E0WA 4ZFCA 3L68A 1Q4WA 1XLAA 4AD3A 4AIUA 4C60A 3TYCA 1XSKA 3BL3A 2NT1A 5AB3A 1B4KA 1UH2A 1RY0A 5H8MA 1PSCA 1JRCA 2OU4A 1EJUC 1OX6A 1FA2A 1N55A 3QN3A 5EGRA 3IGHX 4IMGA 2V69A 1HJVA 3RM9A 2Z27A 2R1NA 4UQDA 4P5UA 3BQ6A 3VGFA 4Z42C 4W87A 1QNOA 3EWDA 3MZNA 2PWUA 2DZUA 4AW7A 1FWGC 4WSKA 5HNUA 1F4HA 3LD5A 3BAXA 3M0IA 4M51A 3S46A 5DMLA 1MFVA 2C1IA 2VCDA 2QW5A 4NZJA 1XG3A 1QI2A 3PRAA 1UR8A 1XPGA 2Y70A 3K5XA 1R0MA 2GWGA 4L1XA 1TPFA 3KW3A 3S0CA 4FNSA 4FX7A 3DBPA 3FFSA 4IXXA 1TX2A 3RITA 1TV5A 5ABHA 1UA3A 3WDHA 4QAWA 2DZAA 2NVCA 1U30A 3EX1A 1OB0A 3B0XA 3D3FA 3OB8A 2WJDA 2ZCGA 2Z1XA 3B8VA 4YN5A 3EOLA 3CIXA 2QCDA 3GR4A 3T05A 1JDFA 3HGOA 1DWFM 3EB4A 3B8IA 3SCUA 4HCHA 3R89A 3NPVA 3ZLHA 3REQB 5EU9A 4PMUA 5T8GA 3VNJA 2PGEA 3M07A 4BQ3A 1RQHA 5I3FA 3WF4A 4TU1A 2QNEA 3RF9A 1EIBA 3VC6A 2XIBA 3ONCA 3BLOA 3HF3A 4U84A 5CAKA 3STPA 3VDBA 3B8TA 5EMYA 4NXSA 3NO5A 3NA8A 4NF7A 4LF2A 1PBKA 3KAFA 5LGXA 5AOUA 3PTDA 1SYTA 1W9BM 3WLPA 4GYPC 3MKKA 2BG5A 5M5DA 2B7QA 4JEQA 3RLGA 4CQDA 4YNGA 1DJIA 4LF1A 1MEHA 5CH9A 1I60A 4XAKA 3T0AA 2FIQA 2D2JA 3MHFA 3CL7A 2I9EA 1P0KA 5C5YA 3Q67A 2BOGX 1X38A 3C0QA 1OFPA 4LS1A 3MPGA 5MKGB 2NQJA 4EPKA 4M5PA 1QTWA 4GX9A 3QOKA 1CXFA 4IX0A 3WIJA 2VR2A 1AL7A 2PDBA 1E72M 4CNSA 3T4CA 3QMSA 5G5IA 4RDWA 4DUXA 4HOXA 2YCIX 4MPKA 3UZWA 3TMQA 2PFHA 5D2VA 3T2QA 1QPQA 4PMVA 1S39A 4LC6A 1CGYA 3OIHA 2C3ZA 1BRLA 2VURA 2YLLA 3FW6A 1RA0A 4F2TA 1KO0A 1F7BA 5LXEA 3SN0A 2CESA 4HJFA 4MJMA 3VIOA 3PB0A 3BOLA 5AECA 1ISZA 3TTQA 2FDMA 2VRQA 4AY8A 5LNVA 1JNDA 5AVHA 3RPDA 1W5NA 2VCBA 3EDKA 2PV1A 2YL9A 3TJIA 4Y9PA 5TF0A 1US2A 4IMFA 1Q7ZA 4E6MA 4OZOA 3CQHA 1TCOC 1MVYA 1PKLA 3H2CA 3QQ0A 3GG7A 1QO5A 4DIAA 1KTCA 1W91A 1LTDA 2F6UA 4C6QA 2D1ZA 1R5YA 3GSMA 5K4ZA 1JCTA 5K9XA 3KHJA 3SUWA 4XZNX 3ANVA 3VGGA 3VE7A 4P7RA 1EYEA 3AXXA 1Q45A 4PBFA 4Q4QA 1UP0A 3AHZA 1QPKA 1MUMA 1H7NA 1JD9A 3PZ9A 1AVAA 1WZLA 2VGBA 5ECUA 4L7ZA 2DVXA 4XZIA 1SFLA 1J0IA 1X8CA 4QE4A 3QV7A 3EMQA 2J77A 4LVGA 2I56A 1BVNP 3WQEA 5IBXC 3LCHA 4AIEA 3UCQA 3P0WA 2XTKA 2F84A 1EGMA 3BH4A 2D69A 1TQXA 1B3WA 3KBNA 4UBPC 1FCVA 1CWYA 3GD6A 5LHFA 3CPRA 1XIMA 3S8HA 3FHQA 5FAJA 5CSUA 3WL1A 4MG4A 1OHLA 4EAMA 5AN7A 3MJMA 3DYPA 3B9DA 1CXEA 1KCXA 3R13A 4QM1A 2CETA 2F2HA 3F2DA 1S5TA 4U2ZA 2R9RA 3IJQA 1LL4A 3TAKA 2HDJA 3MDWA 4ZQRA 3BURA 3WY1A 5HR7A 2ZR5A 4O1AA 1QW8A 4BF7A 1EGZA 2E6AA 4OUEA 2MUCA 5MKGA 2BY1A 3GKFA 1E4MM 1SFJA 3FJ4A 5F4SA 5I77A 3ZSTA 3H23A 3FNDA 3WQFA 1US0A 4W89A 1AJZA 1LF1A 3WF2A 4I9JA 3W7RA 4FS9A 3ATYA 1EPVA 3BLDA 4NVTA 5D30A 1XR2A 3A9BA 1Z9AA 1GKRA 3RNDA 1WXYA 3PC0A 3GHRA 2VELA 4ZE5A 2G95A 1KT1A 2EBNA 2WSPA 4M56A 1WBJA 3EXRA 3Q37A 3VABA 1E9LA 3GAKA 2GVJA 2NX1A 3A4WA 4W8BA 4GWEA 3WD1A 3APYA 3GK0A 3IHZA 1IEIA 2VZUA 1R7OA 3UVIA 3ZR6A 4L6DA 1TIWA 5HULA 3TC5A 4HA1A 5BXSA 2ZUMA 3C3UA 3AAMA 2ALDA 1EDGA 3MUY1 2ZC8A 2PDQA 1FWJC 1Q5MA 3KAIA 4I6KA 2JFEX 5FJOA 1O5XA 1KTBA 1ECEA 2GVLA 3RLHA 3TLQA 5BMXA 4INFA 4BI7A 3STFA 3GYEA 1TTPA 3SR7A 3C2VA 4XD5A 3LHTA 5FIPA 3WBEA 3HV8A 2GVEA 4E4PA 2ATSA 3K13A 1A4LA 3KM8A 3WD2A 4XD3A 1IF2A 1UKSA 3URAA 3L4WA 1M65A 3T0DA 3DKLA 3V0TA 1TYGA 3U4AA 2GJXB 2BFGA 3F4DA 4GUHA 5T9CE 3S1UA 1E43A 5I24A 3B0VC 2C0AA 1IEXA 3CPUA 4DXXA 4BEUA 4HPHA 3E3HA 2VC9A 1YPIA 3I6RA 1SMDA 3WJXA 4CNOA 3F4WA 4W84A 4PCTA 4PMRA 3NJ3A 3QZEA 4MM1A 3APGA 4MGVA 1FKRA 1MQQA 3PZUA 1C7SA 4KWOA 1DEDA 3CASA 3GTXA 3EXTA 3LHWA 2Y8VA 5EMLA 3P60A 1PIFA 1ONEA 4DZIA 3K1GA 4DWSA 3PG8A 2Z29A 1F2JA 1W3TA 3CHFA 2XDFA 2VL4A 4JCMA 4P7NA 3BXWA 4O0KA 3GUGA 4QFUA 3PBMA 3W27A 1L8NA 1ADDA 3VIGA 2XP6A 4RJEA 1R7AA 8TIMA 4HBKA 1FP9A 2YDSA 3UWZA 1LWHA 3MP4A 3VDAA 3I3DA 2H6RA 1VQTA 4ZQMA 5HWNA 3K46A 4HMCA 3TCZA 1TPB1 3I7QA 1OY0A 2WKLA 1MUCA 3N6QA 4G7EB 1PX3A 2RSEA 4JOMA 4KEUA 3LNPA 4YXGA 2ZZ5A 3F4VA 2FPVA 4AD5A 3WJYA 3NGFA 4UFMA 1UWQA 1W32A 1UZDA 4F40A 3H2MA 1XCFA 1GZJA 1QR7A 1W56A 4PTWA 3CQIA 3UZJA 3II1A 1SJCA 2ALRA 3GKAA 2GVGA 1EC9A 2CLIA 3NEHA 2VZSA 3N2CA 4H9VA 4JKMA 1LT7A 3S3GA 3AXKA 2UBPC 3MQTA 4HVXA 4NY2A 1EB3A 4AEEA 4BF9A 2QIWA 1DL3A 3LSCA 4TUFA 3VGEA 4FI4A 4W88A 1O60A 4MAZA 3N29A 2KX9A 3DAQA 3WNLA 2GQ9A 2OX1A 2J62A 4EOUA 4E0CA 4IIDA 3C0JA 4H7ZA 2A21A 4UNIA 4KFNA 1UPPA 1DWHM 1WB0A 4JN7A 2DSWA 3TYZA 4HOWA 1ZP4A 4RUBA 1EA0A 4DUWA 4ERAA 4Q7BA 2RUSA 3ZWTA 3AXMA 2I17A 1OGBA 4WVXA 1DIOA 1S3HA 4DWDA 4KRTA 5BOEA 2VWTA 2XIQA 1NVMA 1BWKA 3MSRA 3VNMA 4QJ4B 3DZ1A 1CTNA 4R5EA 1CGXA 1AODA 3S1GA 2PWDA 2Y5SA 4JQ2A 2CIPA 3P80A 1FKKA 1FDJA 2YKKA 3N18A 1J11A 3SIZA 3S2JA 4MWAE 4JTJA 1RPKA 1NEYA 4D6EA 1GW9A 1XLGA 2MLYA 2V30A 3G1DA 2E5DA 5F4XA 3VOIA 3N15A 4CNUA 3NPXA 3QF0A 1CLVA 4DN1A 3LENA 4NRSA 1IX5A 5BOFA 4HP5A 5A6MA 4YTQA 4ZMGA 4LUSB 5DRCA 2E4TA 1R2SA 1L6GA 4MKSA 3CGNA 1KRCC 4W4QA 3S1XA 3QLLA 4WJEA 1KLZA 2ZXDA 1HG3A 2WC4A 3B4YA 3KCOA 3RGTA 2PGFA 2GSHA 4XO6A 2VDIA 1UC5A 4RE3A 4J5NA 5C2GA 8XIMA 3VX1A 5BMWA 2EGZA 4H4IA 4JNZA 4GHRA 1A5NC 3QV8A 3M16A 4GUGA 3TX9A 2OLSA 4WKHA 3MUZ1 1WCGA 4URIA 3CNYA 5I2UA 5I3IA 5GJPA 2RAGA 1EP1A 3NSNA 1WDRA 3DHFA 2PWVA 1YXDA 2PTZA 1XUZA 5CJMA 1TR9A 4E4FA 3SM0A 1FRBA 1XLHA 4S3GA 3H12A 4DRMA 3WLLA 3UWUA 1JCHB 4Q8MA 3HG2A 3VIIA 3SCVA 4I8DA 2J27A 4PTVA 4RL3A 4WDUA 3QVQA 1BWLA 2CLPA 4HMEA 4UZSA 3T2PA 5REQB 3PAOA 4RKAA 1LOQA 3P6LA 1DKWA 3VNKA 7XIMA 3LZ3A 1K8YA 3N4FA 1XRVA 1K77A 4TX9A 4HN4A 4UR8A 1US3A 3WYZA 5JIWA 1TTJA 1EXBA 2QCCA 4H2CA 1KCKA 2PMQA 1W9UA 1D7KA 1HKMA 1NSJA 3DI1A 2YCLA 3URNA 3CV7A 3P84A 1NTHA 3EOEA 4LW7A 5GQBA 1E6SM 2HISA 4JFLA 4NI8A 1BYDA 1FAPA 2OFJA 4G50A 4KIRA 4W7VA 1RH9A 1NIUA 3WH0A 4IP4A 4JL2A 1J5TA 1DXEA 2PRLA 3RCMA 1PHQA 1F74A 4DBDA 5E0CA 4RPQA 4S3EA 4GZ7A 3N9RA 2ISVA 1HXJA 2YSWA 2GSEA 4K2SA 4HTYA 4PMOA 1GOXA 1H7PA 4MPQA 3DHDA 4GC4A 4I3GA 2FZDA 3RMJA 2B81A 2YFNA 4WCJA 4IQLA 5FSDC 1YTDA 1E1CA 4OVXA 1XF0A 4LYKA 3W28A 2WMFA 3VAWA 4M6QA 3NSMA 4IPXA 1EWDA 1O1ZA 2OGJA 3MA8A 1PVNA 2WHMA 5CPOA 7CGTA 2Z25A 1FKFA 1TWWA 3WEMA 4HNOA 3QR3A 3C61A 3G1VA 1EF2A 3S2NA 1K7FA 1RALA 1DP0A 3L7RA 3AYSA 3BLFA 1VFMA 3PBGA 1FX6A 1Q6QA 3ELFA 3GU2A 2CLLA 3TXZA 2PDPA 5LSMA 3BZGA 4KF1A 5KETA 1RSCA 4I9MA 4PUMA 4F0LA 5AC4A 1QZ2A 4ZB2A 4AQLA 2J4GA 1FFQA 3PP7A 1E73M 1S2TA 5TBOA 3PZOA 3I65A 1GVFA 1L2QA 1PYFA 1Q6LA 3C0SA 3EOSA 1ZZMA 1KFEA 4YVVA 4UOJA 4LUJA 3AHTA 1QPLA 2Z1WA 1W3NA 4RDVA 3FX4A 4XBKA 3RLUA 4M82A 3WJWA 3U0HA 1SZNA 2C8NA 2O7SA 3CUIA 4XQ6A 5C54A 2VOMA 2DJXA 4C1KA 1RAKA 3ONBA 4X60A 1YPFA 3W2UA 3MHGA 5E5CA 5DBTA 1XLIA 4LXFA 5I06A 2OKTA 3LPPA 4W5ZA 4W9PA 4YS1A 4QSHA 3AWOA 5AYYA 1EJ7L 3HGRA 3AYVA 5B7YA 1TJ2A 4UCGA 3LLXA 1GHSA 4J4OA 3UZXA 3THDA 5LIWX 3N6HA 4HNTA 2FHCA 1XRFA 3OODA 4GH1A 5AZ0A 1W17A 3I7SA 3V1PA 2W91A 4S1FA 1DQUA 3W00A 2YYTA 1V6VA 2AAMA 3CL6A 3MBDA 3EX4A 5DF0A 4NYUA 3GPKA 2YZ5A 3W7LA 1PV8A 5FJTA 3GNXA 2CWXA 2RDUA 4DRPA 4A4AA 2UZ9A 3MJYA 3QPZA 3ZSSA 2X8RA 3EDFA 3SFWA 3ARSA 2UY5A 2Z2BA 3N2TA 3PTQA 1IYXA 3CQJA 3A13A 4FNQA 3WN6A 3KCLA 2FZ8A 1EJSC 3ALFA 3FJNA 1XBYA 3VFLA 3GTNA 1J8VA 4MWAB 2XGBA 3G1SA 4GQBA 1GHRA 2WK2A 1H62A 1KNWA 1GWJA 4GIEA 4Q4KA 5EPDA 4MOZA 3RO8A 1UOZA 2CLFA 3GB6A 3AOFA 2QDDA 4ECLA 5LHEA 3TN6A 5CPMA 1MRAA 3DFQA 3IJLA 4Q8TA 4J3TA 3RX4A 4REQA 1XBZA 4PN2A 3RK8A 1X98A 4W93A 1XUUA 2H9AA 1UC4A 1TPVA 2W3ZA 2ZUSA 4JTRA 3BCDA 2OQYA 4EKJA 3TZFA 3T40A 3UXDA 4H83A 2EPKX 4W5UA 4PTXA 4P61A 2EG8A 2UY4A 1N1AA 1S5NA 2H8ZA 3HQOA 4M19A 3U57A 1Q4NX 2OZTA 2PPPA 3RG6A 3UGVA 4QAIA 4CD4A 4ODRA 3SRFA 3UJSA 2J6XA 3QHOA 2X2YA 3VIHA 3LCWA 2CYGA 4K3ZA 1XICA 2YCKX 4OTKA 4U3AA 1MW0A 5T91A 4AX6A 1F6YA 1Y5WA 4H04A 1F8IA 2DFAA 4AF0B 3VGHA 5ABGA 3WDPP 4XSMA 1UZ1A 2IS7A 2XP5A 2EPLX 3USBA 4V27A 3N17A 4GVFA 1TA3B 4GO8A 3VNZA 1FCUA 1BXCA 2DSKA 3FJ6A 2X05A 3MMDA 1TWZA 4DM2A 1OT2A 5GNXA 4IOTA 2RJGA 2WKGA 2EKGA 1UIPA 1K4HA 3PWAA 4DIPA 3KOZA 4PRWA 1SPQA 1HTIA 4EWJA 5C70A 1EO5A 2WMKA 2ACQA 3R11A 3B0PA 4X63A 3CEUA 4KR0B 5AHNA 3GBDA 3NDZA 4PGLA 1EOMA 3FY1A 4UTUA 2PE4A 3MWCA 1DJZA 2E6DA 3Q2DA 3M47A 3TC3A 4O4WA 4ZO9A 1LG2A 3W53A 3SJ3A 3TNOA 1OD0A 2VCAA 2QCFA 4UFIA 4EAYA 2SFPA 1O66A 1E0XA 5M2FX 1RLDA 3EGJA 1F6PA 1B4EA 1W37A 2XVPA 3MO4A 4PUKA 1EP3A 3TZNA 5HNNA 5CBJA 3KP1A 5BCAA 2OVLA 1X6UA 3VM7A 5CCZA 3QOMA 3TYDA 4KCWA 4JL1A 1Z42A 3W2JA 3LOTA 4S3DA 4U4MA 1L6SA 4X2RA 4DXKA 1OX4B 3TYUA 4CEXC 4G8TA 2BNJA 4O1DA 2ZZ3A 2DZVA 3LLDA 4TR9A 1M9HA 1UIOA 4FR6A 2ISSA 4DPQA 5LXXA 2AAAA 3TONA 3WENA 4UMBA 3AS1A 2BGSA 1XLKA 5LIKX 1KWKA 1OQFA 1OZQA 3PM6A 1E44A 1ZLPA 1K3UA 4LALA 2QF7A 3FAPA 4IJRA 2Z24A 3O16A 4UNKA 3S42A 2PWHA 1RJRA 1C3FA 3C2RA 1X1NA 2R1LA 3WBWA 4D8ZA 4UR9A 3GR8A 3NTPA 3C2OA 5CZ0A 4GVGA 1CX9A 1PL9A 3W1QA 3LLFA 2IXVA 4L9YA 2PD5A 1GVIA 1MUWA 3PPFA 3W0KA 3GFXA 1ZPTA 2DP3A 4H8NA 2Q5AA 4MAVA 4DZ3A 3AISA 1DWIM 2YB1A 3O5FA 4J27A 3KZ7A 2M1IA 3HOJA 1JZ6A 3SAZA 3V5OA 4DELA 1E40A 1PYMA 3VC5A 3SADA 3WD4A 4DO5A 5E70A 4DAIA 2CFFA 3MW7A 1VEPA 3LZ5A