2G41A

Crystal structure of the complex of sheep signalling glycoprotein with chitin trimer at 3.0a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbohydrate binding properties and carbohydrate induced conformational switch in sheep secretory glycoprotein (SPS-40): crystal structures of four complexes of SPS-40 with chitin-like oligosaccharides
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords SIGNAL PROCESSING PROTEIN
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2g41A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2g41A01
3L2MA 5CGTA 1V3MA 3A47A 1UH4A 2YL6A 1U2YA 3L4VA 4MAVA 1BAGA 3GXMA 3ARSA 2YIHA 4XZBA 1K9TA 1E56A 4K68A 2Z1SA 2YA1A 4FLRA 2YLLA 4UCFA 4U2ZA 3SCOA 1E4NA 1TMQA 1X1NA 1DWFM 5EFFA 3GXDA 2OSXA 4U33A 5I0DA 1HVXA 1VBRA 1J12A 4AXNA 4PMDA 2WVVB 4HPGA 4D6CA 4AEEA 4BQ2A 2D0FA 2BY0A 1CGWA 1KXVA 1NWSA 1UWUA 1W1PA 3BMVA 2CBIA 3B9AA 2YJQA 5AC4A 5D9PA 2DT2A 1ITXA 3FXYA 2VO5A 1JZ2A 3PZQA 1B9ZA 2VL4A 6A3HA 3K1DA 2JIWA 1JDCA 2IXVA 4M82A 3J7HA 1B3VA 1HJWA 2IUZA 3WDJA 4LPCA 2DSKA 2XVPA 7A3HA 2BY3A 3RMEA 1JDDA 2W66A 4HZ7A 4W8LA 4P8XA 1QNRA 1V0LA 2DSUA 2EPKX 1TUXA 3NYDA 4TTGA 3NDZA 3AS1A 2J7HA 3ZJKA 4M1RA 3ALFA 2YDQA 4U2YA 2BVTA 3WL0A 1VJSA 1BYCA 4DUWA 3T2PA 1MW1A 1UWTA 3CH9A 1Y7VA 1H0GA 5M3WA 4HZ6A 3PTMA 3WUEA 5ABFB 3WUGA 4AEFA 1ZBVA 2DIJA 5E0FA 2VTFA 2VURA 4AZBA 3PZOA 1ZS2A 1GOOA 2PBOA 3A4XA 3A3HA 3ARPA 4IISA 4KGLA 2AOSA 4N0RA 3AISA 3ZR5A 1XYFA 3N12A 3WDHA 4S3JA 1JG9A 3ARTA 1DP0A 3WF4A 3WNPA 1TE1A 1WDRA 2G41A 4IPNB 2GSJA 3WF3A 3AIQA 1AQ0A 1ZU8A 1O6IA 4URIA 4HMEA 5DMYA 1F4HA 2DEPA 4B3KA 1US3A 2ZUNA 2JEQA 2BXZA 4D6EA 2CETA 2J78A 1MWOA 3MMUA 3BAJA 4L4PA 3WF0A 2EQDA 1K9FA 5JH8A 3GTNA 1QW9A 1KCKA 1E4MM 3VD7A 1TR1A 1E71M 2G8ZA 3TTOA 1V0MA 2YBTA 4P7LA 3AYRA 3OIHA 3TA9A 3AJ7A 2CKRA 4QLLA 2GVYA 3RCNA 1R7OA 1UR1A 2G4FA 3VIHA 3ZT5A 4NRSA 1J0HA 1GOWA 4IUGA 1GQIA 3WD1A 3D5HA 3IK2A 5AYIA 3T2QA 1GOKA 2OYKA 5M5DA 5GNZA 1PEZA 1UR2A 3AYSA 1V3HA 3MUZ1 4NI3A 3WQ5A 2VRKA 4J3TA 5I2UA 4D6IA 4Z2GA 1VIWA 5C8BB 1KXTA 1CGXA 3GYCA 4AD5A 3E1F1 1JXKA 5IHRA 2WXDM 3AMKA 4H04A 1ISZA 2ZX6A 4DUXA 1HKJA 3NCOA 5JBEA 3SUWA 2CEQA 1XH1A 4MTVA 3VVGA 5LA1A 1LLOA 1W9PA 2YDRA 7CGTA 1CIUA 3POHA 5JIWA 4AW7A 4AD1A 1LG2A 2D1ZA 1PPIA 3FAXA 5BWFA 4C7FA 2WWDA 1KGXA 3OLDA 4PBGA 3SIMA 2ZUVA 4WLCA 1M04A 1GVIA 2FHBA 1QHOA 1CENA 3VGFA 3F5KA 3ARZA 2F61A 3U7BA 1V6VA 2HVMA 2GJRA 1XC6A 1E40A 4WK9A 2WHMA 3GZAA 1UKQA 1OIMA 3WF1A 4OKDA 2YL8A 4H8HA 4BZYA 4AIEA 3CPUA 1UZ4A 3SCPA 3W0KA 5M03A 3AXIA 5CXPA 5GPRA 1QPKA 3SCUA 1KB3A 4BQ4A 4PMOA 4CN6A 1W32A 1W3HA 1QHPA 3DECA 2GJPA 1PAMA 3MO4A 3UCQA 4AC1X 2J7FA 5BXTA 2PWEA 1RPKA 3EDDA 5AYBA 2D22A 3L4WA 3VNYA 3N9KA 4HA4A 1IZJA 3BAXA 2Y8VA 4MB4A 4TVDA 3VGBA 1MW3A 1WNOA 2VX4A 1E6SM 4QDMA 4AY1A 2WKGA 2J7CA 1MVYA 3MUY1 3ARXA 4ACYA 1X6NA 1KBBA 4RE3A 3OZOA 2VC9A 4MB3A 4OOUA 3L4XA 1S46A 1ISYA 3CGTA 1WKYA 2QF8A 4YPJA 4GO8A 3N1AA 5A2CA 3VDHA 3UEQA 1FH7A 1UUQA 1KGUA 1OD0A 3BXWA 4AZIA 4AIUA 2ZXQA 4DWSD 5E09A 3L4ZA 1G1YA 4JL2A 3NSMA 3MUAA 1RH9A 4P7RA 1BFNA 1UZ1A 4EKJA 1EO7A 1PIGA 5BRQA 1VB9A 2A3BA 4P7OA 4W87A 1J9YA 3K4DA 1W2PA 3WQ8A 4W89A 4ZFMA 1WDPA 3RIKA 4J3WA 4LX4A 3NSNA 4UTFA 1HKMA 5I79A 3MSDA 3ARRA 1VRXA 4PCSA 4LXFA 4TTUA 2ZICA 3ZM8A 1H4PA 4QFUA 3WNOA 5FL0A 1V6YA 2JEPA 2DGAA 4MB1A 3ZO9A 3AIUA 4AZHA 3VDCA 4UFIA 1CTNA 1J10A 1IT0A 1OB0A 2JE8A 2QPUA 1ODUA 5BCAA 3MKKA 3QHNA 4OBSA 1E1EA 2W63A 3WD2A 3CBWA 1UR4A 3CLWA 1JZ8A 1EH9A 2O9TA 3O2LA 3AHZA 3CIVA 1XV8A 5FOOA 5CLTA 3OBAA 2VNCA 4AZCA 3K46A 3WL1A 1EXPA 2Y8KA 2F8QA 2DSWA 4UFMA 2WVSA 1XCXA 2CHOA 1IV8A 3VINA 3PHAA 2W5FA 2WHKA 4A3YA 2WB5A 2NSXA 1G0CA 3AQUA 1FHDA 5HPCA 5I6SA 1AQMA 1MXGA 1BGAA 5ABEA 4UZUA 1V3IA 2D20A 1HX0A 3I3EA 2JFEX 4ZE4A 3RO8A 3EDEA 1V6XA 4D6GA 1WDSA 3FNDA 4L4OA 1E0XA 4MAZA 5JBDA 1VEOA 1JF5A 1JYNA 4ZXOA 3OLIA 2A3AA 4W7WA 3VIOA 1GONA 2E3ZA 2PWFA 2CNCA 3CUIA 3KL3A 3ZT6A 4U31A 3K4AA 1ESWA 3L4UA 1E5NA 4HZ8A 2OWXA 1FA2A 5JIPA 4CCCA 1H3GA 1BF2A 2XTKA 3B9EA 2BXYA 4KRUA 1KBKA 1QNSA 4B9YA 1QI4A 2VZSA 2WHJA 1GPFA 4H8VA 4D1IA 1KWGA 3GNOA 3SCTA 2YL9A 1BHGA 2OWWA 2IXUA 3EMZA 1BG9A 1CXFA 1KGWA 1JI1A 2V38A 2QLYA 2WPGA 1GQLA 2TAAA 2O9OA 4AZ7A 4PSPA 3W37A 1ISXA 3VIIA 4JZ5A 1D3CA 2ZUSA 1OGSA 2J4GA 3CZLA 3AZTA 3BCDA 1WB0A 2BY1A 3KL0A 4J7RA 2C0HA 1ODZA 3CZEA 4UQEA 2FHCA 4QAWA 1MQRA 3VX0A 1UWRA 2XFFA 1UWIA 2ESCA 1EOKA 2V5DA 3LPGA 2WLYA 1QBBA 4HOXA 4PMVA 1QI0A 4BS0A 3VX1A 1HJSA 1CYGA 5I77A 3SCNA 3WQWA 2FDMA 2WAGA 1XH0A 3EMQA 2A3EA 3QOMA 3L2LA 5A8QA 5A69A 1M03A 4P8WA 3PZNA 4PUDA 4E4PA 2A3CA 2DDXA 2WMGA 1FHLA 3F5JA 4OJYA 3BCFA 3AMDA 2J75A 1OIFA 5EBAA 1EHAA 3ZIZA 2WM0A 3I3BA 1VF8A 4CCDA 4CU8A 3WMBA 2WMIB 4UQ9A 1NH6A 1G9HA 4EK7A 3VIMA 1C3FA 3S6TA 1WZLA 3WIJA 1UD8A 4PTVA 1UD6A 3WKZA 1WAWA 4BCEA 2EJ1A 1UOKA 2UY5A 2D24A 1OCQA 2VRQA 5D9OA 2EPNA 2F2HA 1EIBA 8A3HA 3VD4A 1P6WA 1QI2A 3F5LA 3AHYA 1D2KA 1O7AA 1WE5A 3MV01 4IM4A 2XFRA 1LL7A 2QMKA 3WN6A 2OSYA 4WF7A 1HP4A 3ZT7A 4BF7A 1VJZA 3SCWA 1H2JA 2ZWYA 3QR3A 2WC3A 4ZEPA 4AD0A 4QP0A 3W6MA 1NP2A 3HU7A 4M24A 1JYVA 3ARVA 2WWCA 3W4RA 4PN2A 3EMCA 1HKIA 1E4IA 4D71A 1V02E 2J62A 3WF2A 4JHZA 1GOIA 1AVAA 2UY3A 3SUUA 5ABGA 2ZXDA 3KZSA 2ZWZA 4M8UA 3W81A 3L4YA 1XH2A 3EBVA 1U30A 3WUBA 3ECQA 1JD7A 3VNZA 2E4TA 3OG2A 1G5AA 5I23A 5KZ6A 1W91A 1CPUA 1JYXA 1KXHA 2WMHA 3HMCA 1DWHM 4DUVA 3AZSA 1PX3A 2AMGA 2Y24A 2PF0A 4X0NA 3IJ9A 5DEZA 2WMJA 1NWUA 2FH6A 3VTRA 1UA7A 4Z2HA 4JIEA 2CBJA 2WHLA 4A4AA 4KH2A 2YBUA 2WVUA 2WZHA 4MNJA 1FOBA 3AIRA 1QBAA 4YHGA 2GJXB 2VVNA 4BQ5A 1BSIA 4TUFA 1EQCA 1V6WA 3TTYA 1CXEA 5CLWA 3TTQA 4V27A 2XWDA 1V03A 4CCEA 1DWJM 4MADA 2VQUA 1BVZA 2BNJA 5DFAA 1GVYA 1XSIA 2J8GA 4DWSA 1JAKA 2ZUWA 3WQ6A 1LQ0A 1NWRA 2ZX7A 2WVVA 3W27A 1UD4A 3L4TA 4ATLA 2DQXA 4H7VA 4CKQA 2ZUUA 5DT7A 3MV11 3AHTA 3THCA 3W6LA 3OB8A 1HJUA 1V6UA 2C8NA 2XHYA 4Z2JA 1I1WA 2EPOA 4RE4A 4Q22A 5IXEA 3MANA 2VR4A 2XVLA 3KL5A 1UQYA 2CXGA 2VX6A 4V2XA 2YA0A 1E1FA 2VMFA 2WC4A 2X0HA 4GZEA 2G3IA 2EBNA 3AICA 3T08A 2W92A 3FY1A 3NJ3A 2VI0A 3RJXA 1J0KA 1K6AA 1H1NA 1IZKA 1JYWA 4B3LA 1C8YA 3AIEA 2XM2A 7TAAA 1HNYA 1W9UA 2Y4SA 4UFLA 1C90A 1BQCA 4HOZA 1E6RA 4FK9A 4AD3A 3DHUA 2GK1B 5I78A 1BGGA 4WJXA 3CZ8A 2JF7A 3GNPA 5A8OA 3MS8A 2CYGA 2VZTA 5A94A 5I3DA 1K9EA 1V0KA 1U33A 4FLOA 1ZJAA 4MNKA 3WBAA 2DIEA 3VDBA 1L0PA 3VIGA 1V3LA 3BC9A 3W24A 1Q6FA 2W91A 4Y7EA 3SUTA 1GUVA 4ML4A 2X2YA 1RP9A 4OBRA 5AY7A 1FP9A 1G94A 1QNQA 4MJ2A 3WEZA 1VEMA 4HA3A 1BG4A 2WCGA 2XJ7A 5A2BA 4P8UA 3RM9A 3AFBA 2E9LA 1E73M 1W3KA 3LPOA 2BHUA 1TA3A 3PBGA 4PMZA 3ARYA 4J3SA 4PMUA 1R85A 4ACZB 3WH5A 1MYRA 4CD5A 4HU8A 3RDKA 1JNEA 3LPPA 4OOZA 1K9DA 3I3DA 1LWJA 1NM9A 4D1JA 4CU6A 4WKAA 2EPMX 1OT2A 3ZQ9A 2X1IA 2WK2A 1F4AA 1WCGA 4TXEA 4JKMA 4S3KA 1FH8A 3PZUA 1DTUA 2W62A 4KRTA 2V3EA 4XUYA 4EANA 5A6KA 2WSPA 1UWQA 2XUCA 2J7EA 5FD0A 3TP4A 1B3WA 1JNDA 1E6QM 1V3JA 4X0VA 1KFWA 2VZUA 3OA5A 1CXLA 3AXXA 5BXSA 4HP5A 3CHDA 2V3FA 1E9LA 3PN8A 3RPMA 1E55A 4F79A 1EDTA 5CZKA 4AZ6A 4GZIA 1J0ZA 4D6DA 1XYZA 1HT6A 1B2YA 2J7DA 3EDJA 1NOUA 3O9NA 3FHQA 4B15A 2O9PA 1NP0A 5IFPA 2BS9A 4U3AA 2J7GA 4M80A 5ECUA 2GFTA 4OZOA 4GINA 3FN9A 1PX4A 2WCAA 1VFUA 3SEPA 1E3XA 1W9DM 1ZBKA 2CHNA 1H09A 1V08A 1NARA 2VZOA 1H0IA 2X09A 3M6DA 4W5UA 4D6FA 4CUCA 3WFLA 2CERA 4FLQA 3MMDA 1HIZA 5IDIA 2XGIA 2FH8A 3U7VA 3W38A 4XB3A 2YA2A 2QV4A 3GH4A 4ATDA 2WYSA 3VIKA 3ZJ7A 4QLKA 1JDAA 2NT0A 2UY4A 1W9VA 4JL1A 4W7VA 5IFTA 1TVNA 3THDA 4ATWA 2VR5A 3ALGA 5A6MA 1XSKA 4LQ1A 4J3XA 2B31A 1E6NA 1C91A 3VUPA 1GNXA 1EA9C 1JZ6A 5F7UA 4W7UA 1VENA 2EXOA 2XSBA 1A3HA 1B30A 2O92A 5A6JA 1AMYA 5HXMA 4PMYA 1MQQA 3G6LA 1VFMA 4UOQA 5D9NA 4E2OA 2OLHA 2WZIA 3BMWA 2EPLX 3RM4A 3WMCA 1J0IA 2V3GA 1XD0A 1HF6A 4W88A 2XYLA 2PB1A 4F66A 1VFFA 3O6AA 3TTSA 3LMYA 1JF6A 1GQJA 1H5VA 1J0YA 4TVUA 1JD9A 3WDQA 5FCZA 1FFQA 4PTMA 1WPCA 3JUGA 3NDYA 4QCFA 4IPLA 1JIBA 4MNMA 4W5ZA 5GNXA 3VD5A 3UG3A 4OIFA 4YN5A 1XCWA 2WLZA 3OZPA 2ZE0A 3CO4A 4AISA 1UWSA 3CTTA 4AZCB 1BYAA 1UQZA 1I1XA 2V3DA 4KGJA 3ZOAA 5HOSA 4J3VA 1H49A 4D6HA 2VQTA 2WZEA 2J47A 3D3AA 3CUGA 4PRWA 1EDQA 2VRJA 3KWXA 1NOWA 1Q6EA 1VEPA 4DM2A 2GK1A 3QOKA 1YQ2A 2YKKA 5A8PA 1GZJA 2UY2A 4UNIA 3DYPA 1E0VA 2WKLA 3T2OA 1JAEA 1BTCA 2VCBA 2X8RA 1XHGA 5EFDA 3VD3A 5CQ1A 2D0HA 4F9DA 3GBEA 1PX8A 1GCYA 1GJWA 4GI9A 3UG5A 5I24A 1EHNA 1PIFA 4H41A 2VZVA 1E0WA 3AMLA 1GHSA 2OYLA 1JFXA 3M07A 3PTKA 3PZ9A 3IAQA 5CPSA 2ZUTA 1FP8A 4WKFA 3BLKA 3HJEA 2Z1KA 4LYPA 4WSKA 1E6XM 3CUJA 3K8MA 4HPHA 1DHKA 2JALA 2XGBA 1Z32X 2QHAA 3BGAA 4ZXLA 5CSYA 5A3HA 1HJXA 3WQVA 2OYMA 1CBGA 1Q4NX 3GBDA 4M29A 3VGEA 2BY2A 4TVCA 1MW2A 4WSJA 3OLEA 2DSVA 1CXKA 5KEZA 2JF6A 3VD9A 4DWSB 3T0BA 1UD5A 1W3JA 3W29A 2YL5A 2WMKA 1W2VA 5A6AA 4XX6A 3UETA 3VKKA 1CXHA 2ZX9A 3VU2A 4JFUA 4NRRA 4JCMA 4M81A 4AZ5A 2J7BA 4FF5A 3U57A 2E0PA 4AWEA 1XSJA 2BVYA 3G6MA 1LJYA 2DT3A 4Z2LA 8CGTA 5AC5A 4JCLA 1CEOA 1CDGA 1OM0A 4W86A 1JL8A 2PWGA 1E70M 1B3ZA 3ZSTA 4W8AA 4J3UA 1TG7A 2WMFA 4YHEA 4JFTA 4Z2IA 3S2CA 2ZOXA 2RGLA 3U5UA 2W4XA 4XV0A 1WO2A 3AS2A 1OT1A 1M53A 1PZ2A 3UG4A 2YLAA 3AMGA 1EGZA 1V02A 1XRVA 4FMVA 3WDPP 4B9ZA 3PZGA 4W85A 3WH8A 1JXJA 1OD8A 5E0CA 1XD1A 3AMCA 4QCEA 4LYQA 1C8XA 3NUKA 2J25A 4CN1A 5HDRA 1UD3A 4HMCA 2E40A 1UKPA 2OWCA 1QI3A 3WEOA 1W1YA 5BYWA 4TX8A 3VILA 9CGTA 4JFWA 4M56A 2WBKA 5DO8A 5CG0A 1DWGM 3T09A 4PYSA 2XG9A 3WH6A 3ARQA 3FHAA 2GDUA 4CD6A 4UQBA 3T0DA 3OLGA 1B0IA 3W26A 4UOJA 2CBUA 2XM1A 2DT1A 3WENA 4NF7A 2XIIA 2DT0A 2WANA 2OSWA 2EO7A 4P7NA 1C93A 1A47A 4GZJA 1B1YA 1VBUA 5JUVA 4X9YA 4CGTA 1TA3B 5JBFA 3A4AA 4MNLA 4PCTA 4UQDA 2ZXAA 1CNVA 4HMDA 2W61A 1VAHA 3GXFA 3N15A 4OUEA 1RP8A 1YHTA 3CMJA 3QHOA 5LA0A 3RJYA 3WD0A 1ISVA 1Q6DA 3IJ7A 2HISA 5CSUA 3M46A 4CU7A 2DH2A 2VCAA 3W82A 1DWAM 2D23A 2J8FA 3GDBA 4W93A 3EDKA 5FKYA 4U5KA 3VMPA 1KR1A 1V0NA 3PTQA 3AS0A 2E8YA 1HP5A 1H11A 4C7DA 3W53A 3ZJ8A 1SMAA 4PTXA 1LWHA 3KE0A 4JAWA 1GORA 3AI0A 3FAWA 4D72A 1PJ9A 5BXPA 4P8VA 3A6OA 4LGXA 4JKLA 3CUFA 1KQYA 3WMSA 1W1VA 5ABFA 5I5RA 2CESA 4V28A 3CZGA 5ABHA 1ITCA 3WBEA 2DSZA 1HKKA 3VIPA 2DPEA 2WW5A 2O9RA 1JI2A 2ZUMA 1OGGA 2VJXA 3AOFA 2Y5EA 3UESA 3CZKA 4KWUA 1ZJBA 2YOCA 1M7XA 4PEEA 5HPOA 3WEMA 2XVKA 3UR8A 3AXHA 1E4LA 5A6BD 1UR9A 1KWKA 4DWSC 4JFVA 3LPFA 4U3CA 3W28A 5A6SA 2EEXA 2MANA 4BA0A 5IHSA 3CHFA 1NQ6A 2CKSA 3A4WA 4UFJA 2NW0A 3DYMA 1QNPA 1ZBWA 1DEDA 2NT1A 1JZ4A 3SCQA 3WSUA 3K8LA 4WKHA 5FL1A 5LYRA 4Z2KA 3TOPA 3DC0A 5LA2A 3VMNA 1CLVA 2G3MA 4UZSA 3SUSA 1QOXA 4WIWA 2YDSA 4R5EA 1CECA 5E6YA 2J77A 1MW0A 1W3LA 1GW1A 1M01A 5A1AA 2VOTA 3BH4A 1KXQA 5HBFA 5C71A 4GIAA 3WNKA 2BVDA 3VM7A 3N13A 1UHVA 1Q6GA 1JZ5A 4MJ4A 1W9XA 3BAIA 5CPQA 1BVNP 3WNLA 1ZL1A 4EAMA 3POCA 4MB5A 2ZIDA 2E9MA 1ZB5A 1MFVA 4PUEA 4PMNA 1B90A 3CHCA 1HL8A 1N82A 4UR9A 1UKOA 4GXPA 1W9BM 4N42A 1BYDA 1E43A 1JZ3A 5A8NA 2WSKA 4GKLA 3UR7A 4UFHA 4H8UA 1GHRA 1KQZA 5CGMA 3CZJA 1QI5A 2FGZA 3MUIA 2WMIA 3PZVA 1AQHA 1DWIM 5E6ZA 3EDFA 3MU7A 2J74A 3PZMA 1MFUA 3APGA 2VX7A 3U5YA 3AROA 2GDVA 4R27A 2ZXBA 3OGVA 1WZMA 1JZ7A 1J0JA 2BV9A 3SCVA 4CN4A 2PC8A 2DH3A 1OWQA 2D3LA 4B16A 4PMRA 3F4VA 4DM1A 2CIPA 1HL9A 3K8KA 1V3KA 1BLIA 1C92A 1BPLB 5A6LA 3ARUA 3VIJA 5A6BA 4GI6A 3OGSA 4GPNA 3FW6A 2VCCA 3II1A 2Y2WA 1H41A 3W25A 1JGIA 4CD7A 3NSXA 2XPKA 3CHEA 1E5JA 3WNMA 3AS3A 4GQQA 4J27A 1B3YA 5GQBA 4NZCA 4CD8A 1ISWA 1KR0A 5GNYA 1SYTA 3SUVA 6TAAA 4BQ3A 2WBGA 4AYSA 2XIBA 1WZAA 1ECEA 1LF1A 1CGUA 3SCRA 3AHVA 4LYRA 4E8CA 2X05A 1VFOA 4HU0A 3VM5A 1B31A 1WDQA 4JHOA 2D3NA 2CPUA 3WH9A 1WP6A 3WQ4A 3IAPA 4AMCA 2D2OA 2PWDA 4E8DA 3ZMRA 1D7FA 1MXDA 1PBGA 5BROA 2D0GA 2BHYA 1ZBCA 1UKTA 1R8LA 4U5IA 1GJUA 1UKSA 4NSBA 1HXJA 3VPLA 2ZX8A 2GUYA 3IANA 3WH7A 2Q8XA 4RL3A 4H2CA 3NIYA 4F9JA 1G01A 1C7SA 4F8XA 1SMDA 4CD4A 5FIPA 3ZR6A 1OSEA 4MPKA 4PMQA 1R7AA 1J18A 1J01A 1RD6A 2CCRA 4AD4A 4UQAA 3RM8A 2GJXA 1EQPA 3GH5A 1LL6A 1R87A 1E15A 3GXIA 3SCSA 3T0AA 3WFZA 3WDRA 1Q6CA 2BFGA 5BRPA 1B3XA 1CGYA 3WY1A 5DF0A 1FFRA 4C7GA 3BSGA 1UR8A 1J11A 3PZTA 1UD2A 3IJ8A 5A95A 4PMXA 4ACZA 1FH9A 1NOFA 2PI6A 4HOWA 2PBGA 4MDPA 3ZSSA 3WDIA 1I75A 1E6PA 1E72M 3ARWA 3AIBA 2VUYA 5D8WA 3SURA 1NWTA 5E70A 3VIFA 2E9BA 5M17A 3VOCA 4D6JA 2WC7A 2WCSA 2G3JA 1TVPA 4W84A 2FGLA 1SFSA 5BXRA 4P7QA 4TOQA 2E8ZA 3RILA 4HTYA 3VGDA 1QNOA 2XVNA 2XFYA 4MDOA 4UFKA 4PSRA 3AZRA 4W8BA 5E9AA 2A3HA 3AHXA 4JFSA 3VGHA 4Q7NA 2ZX5A 5EMYA 3KEHA 5A8MA 3BAYA 4TX6A 5D8ZA 2QMJA 1GOMA 3GH7A 1SR0A 1CGVA 4UQCA 4CVUA 3WD3A 1C8QA 3QHMA 1HJVA 1EO5A 2VX5A 2VT0A 1HJQA 1UG6A 3DYOA 4ZE5A 1CZ1A 5D9MA 3AIWA 2XSAA 3OGRA 2X0YA 4AIOA 3MSGA 2WVTA 1JFHA 1UYQA 4QLJA 1R86A 2QPSA 2FHFA 4CVWA 5A2AA 2XWEA 3VDAA 3BSHA 4GO9A 2PWHA 4XZWA 3VGGA 1US2A 3MMWA 5CPTA 1LL4A 1TFVA 4KMQA 3EYPA 4PTWA 3N11A 1TZ7A 1WZKA 1UH3A 1CGTA 1X6LA 1EDGA 1EOMA 6CGTA 1KCLA 3WNNA 1QVBA 4RE2A 3N18A 3N04A 3B9DA 2JIEA 3WELA 4EE9A 5C70A 4FLSA 2J79A 2WNWA 1QHZA 5D4YA 3TONA 3GNRA 1E3ZA 1OBAA 3BAWA 4ZENA 1PZ3A 3WD4A 2RGMA 4GQRA 2XVGA 1QW8A 1GOQA 2G3NA 3AIVA 2C7FA 1OGBA 1L8NA 2V5CA 3PZIA 1OINA 4AD2A 1HVQA 3BLPX 1XGZA 1LG1A 3HN3A 5DT5A 5EB8A 1C7TA 1UR0A 3DHPA 1GQKA 2BHZA 1E6ZA 3ZJ6A 1UA3A 1TCMA 2W67A 4AZGA 4J28A 4UOZA 2AAAA 2CITA 4HA1A 3UERA 4GI8A 3VMOA 3B8SA 1CXIA 3N17A 3BAKA 4A3HA 2UWFA 2VVSA 1HN1A 3CUHA 3VO0A 3QGVA 3WUFA 1MQPA 1CLXA 4JKKA 5HNNA 3GM8A 5CJ5A 1W1TA 1UH2A 5TD4A 1CWYA 1BYBA 3M7SA 2CBVA 3CMGA
chains in the Genus database with same CATH superfamily
3L2MA 3PVFA 4WD0A 1D7IA 2HEJA 4JFLA 2KE0A 4K8GA 1E56A 2Z1SA 2KR7A 2NV9A 3MP4A 4DLMA 3QPZA 2IKIA 4U2ZA 1GG0A 4ONVA 1KT1A 1Z8AA 4Q4RA 4AHPA 4U33A 1SZRA 1JCHB 2HCVA 2OZ0A 1B6CA 3JU2A 1ZFJA 4HPGA 4IGNA 3UQBA 1YXYA 4O53A 4AH7A 1NWSA 1KBJA 6REQA 3MP5A 2CBIA 4PA8A 4A2RA 2RQSA 3VAVA 1OCNA 3S1UA 2V5JA 2XN0A 2VL4A 4IIHA 3K1DA 2HNEA 4M5PA 3UWVA 1P4CA 3BW3A 2XVPA 2HPIA 5C2CA 4DZ2A 3RMEA 1JDDA 2W66A 2I9EA 3GYEA 4HZ7A 3TCEA 2XGZA 2QJMA 4G2DA 1OFEA 3EPOA 3ZJKA 4MFEA 4AX7A 4HPJA 1JRCA 2OZ8A 2BVTA 4I7UA 3WL0A 1VJSA 4NHVA 4NNAA 4V1XA 3NL6A 3CH9A 1SFTA 1H0GA 1YW5A 1F3XA 3PTMA 4EX4A 1K8YA 5ABFB 3M0XA 5E0FA 4XD6A 5HR7A 1TJPA 3S1XA 1EJRC 1LOSA 2LPVA 3NPWA 3OYZA 3LDVA 3ZR5A 1CB2A 3N12A 3ONCA 4DHGA 4MF4A 1VPQA 2PLMA 4KW2A 3VZYA 3H6OA 1WDRA 2DG4A 4J4KA 3ABOA 3S83A 1S2WA 2ACSA 2GSJA 2V5BA 3EKGA 1N8IA 4URIA 2VHLA 3HPAA 4HMEA 2PDPA 2Y7GA 2Z27A 5DMYA 3WQCA 2V68A 3TIMA 2C6QA 4B3KA 1BXNA 1US3A 3ZVIA 2BXZA 3ES7A 4MFDA 5KZMA 4ICNA 2VEKA 1A5OC 2LGOA 2ZZ4A 3EKZA 2Y85A 4L4PA 2EQDA 2J27A 5LHFA 1XLMA 2JKPA 1BTMA 3LM3A 1QW9A 1KCKA 1TR1A 1E71M 3EA3A 3UPWA 3CL6A 1V0MA 5E93A 1C9HA 3IARA 2V8ZA 1O94A 3EX2A 3GTXA 5I3GA 3VIHA 1R46A 3WBXA 1ONWA 1KV8A 4IUGA 3GAKA 4K8EA 2OYKA 3PFMA 1NSJA 3AYSA 1UR2A 1GTEA 1V3HA 3WQ5A 4NI3A 3VCNA 2PBCA 1M9HA 1DJZA 5AYXA 3UQIA 3GG8A 5HWBA 3BWWA 4O16A 3LN3A 3QEZA 2B81A 4AD5A 5F2GA 3ITYA 1S2AA 3STFA 1JXKA 5IHRA 3GVWA 2QDHA 3AMKA 4H04A 3Q4DA 4HPNA 3V1HA 2QVHA 4Z1YA 2JBMA 4REQA 4ZBCA 1CIUA 1QPOA 2R9RA 3MUCA 4R3UA 4AD1A 1OC7A 4R34A 3TWBA 1QZ2A 5HUAA 2D1ZA 1PPIA 1KRCC 1V51A 1XLLA 4ZQPA 4E38A 3SIMA 2ZUVA 3GKAA 4IUOA 2CHRA 3W1TA 4WDTA 3AWOA 4HN4A 1V6VA 2HVMA 1QASA 3NNTA 1BRLA 1Q13A 2GSHA 3W7HA 4OE7A 4ODQA 4I9MA 4OKDA 3TC5A 2YL8A 2DZTA 3GO2A 4AIEA 2TYSA 3C8NA 3W0KA 4TIMA 5U4NA 1KB3A 3O5FA 4LWWA 4BQ4A 1DJXA 1W32A 1W3HA 3UWYA 3AU6A 1QHPA 1DJYA 1QXLA 1RUSA 1RPKA 3V5FA 3LEPA 1A5MC 1WOAA 3C52A 3N9KA 1PWMA 1EP2A 2Y8VA 3NM1A 4TVDA 4L5ZA 1WNOA 4O8RA 4FO4A 1E6SM 4AY1A 5FJRA 1L9WA 3GVRA 4O1CA 1T7LA 2GGIA 1MVYA 4M6PA 3NQ8A 3EWBX 2QCEA 1PXGA 1X6NA 2ZDSA 3OZOA 3GDRA 4WOZA 3SRHA 4MB3A 3L4XA 1O5XA 4ITZA 2ETNA 1POJA 4YPJA 4GO8A 1AW5A 3N1AA 3R13A 3LSCA 1BRLB 4GKTA 3OO2A 1ZCOA 5EY5A 3UEQA 2Z1VA 4NAEB 1ICSA 1UB3A 4DZ5A 3IGSA 2ZXQA 3S0CA 1DIEA 1YXCA 3PB0A 3L12A 1P7TB 4ZSTA 3VZZA 4F0SA 2G5WA 4EKJA 1EO7A 4ADUA 3WLSA 4P7OA 1QWGA 1VQTA 3W85A 3WQ8A 4LF1A 1OF6A 2OOGA 5G5IA 4ZFMA 4NX0A 3NSNA 1HKMA 5I79A 1HQTA 3P81A 4JIPA 2ZICA 4YTQA 1H4PA 3H2OA 3W1LA 1J5SA 3MBDA 4MB1A 1R3QA 3H2EA 4IOTA 4HHLA 3KOZA 1XLAA 4LUTB 1OB0A 1SJBA 3M0KA 4BI6A 5BCAA 4E5TA 1O5QA 3MKKA 2NQZA 3CBWA 3HQ1A 3S4TA 1VRDA 3EWDA 1F2JA 1EH9A 3O2LA 4Q7IA 1OFPA 2ZRWA 2VP8A 3ZVHB 5FOOA 3K30A 3O5LA 2VNCA 3WL1A 2Y8KA 2GJLA 4LB3A 2BGSA 2F8QA 1REQB 4C6QA 3SSJA 2ZVIA 3VNJA 2GWNA 3NG3A 4P5UA 3VINA 1Z69A 3R79A 6PTDA 2WHKA 4I9TA 2WB5A 4JTQA 1G0CA 3BGJA 3MZ2A 2AL2B 2UBPC 2PDLA 1E9ZB 3DFTA 4PEKA 4FP1A 2FQIA 3A5VA 2A79A 1VKFA 2NV1A 5HW7A 4O1AA 4M6QA 2V82A 3FNDA 4L4OA 4DF0A 2FZNA 1JYNA 3U2CA 4DLFA 4PFHA 5FJIA 3SM0A 4PTDA 3HA1A 3L9CA 4NASA 3MWAA 3GHSA 2J9XA 1FVPA 2GVGA 1GONA 4MSPA 4JTIA 3CUIA 1FCQA 1P0DA 5HR6A 4CEUC 2VD8A 1E5NA 3SY5A 3IGHX 1FWBC 4I9JA 3Q58A 4LW7A 5U7SA 4JFIA 3HB9A 1JDFA 3T9PA 4QAIA 3OPSA 4GRSA 4B5NA 1GPFA 4D1IA 3LHVA 2FZDA 4XZIA 4EVZA 3GNOA 3S2NA 3IRSA 3SCTA 3V7PA 4DO7A 3GUWA 3E02A 2Y5JA 2RFGA 2HXUA 2V38A 3LA4A 2TAAA 2YCJA 1PZ0A 1TSIA 2J24A 3O5OA 4JZ5A 2ZUSA 2P50A 1OGSA 1A5AA 3CZEA 2X30A 2PRLA 4RV8A 3VX0A 4GVIA 2XFFA 1UWIA 1WKEA 3A3WA 2V5DA 3LPGA 2HK0A 1QBBA 1XKJA 1I2RA 8TIMA 4B5TA 1W3NA 5LIUX 1XI3A 3EMQA 4XAYA 3P0WA 1IZCA 4C1KA 4NKCA 3IIVA 2ZZ1A 3C2FA 4U86A 5F1VA 2P88A 1N2VA 3EOOA 3NQAA 1F3TA 3G1FA 1R2SA 3RYSA 2A3CA 2WMGA 3WQGA 5LKYA 1WOBA 3QV7A 4OUIA 3SRDA 5G2WA 3ZIZA 1R5YA 4LUSB 3WMBA 1UC4A 2WMIB 1EGMA 1AG1O 3R4IA 4JX4A 3OVRA 1Y8BA 2DFAA 3HTWA 3TMLA 5J8LA 5CPOA 1KV5A 4WY0B 4UMCA 1OYCA 1UD6A 1AZ1A 2HBXA 1UOKA 2VRQA 4PUNA 2EPNA 1JCYA 1L2UA 3VD4A 5CJMA 1A3WA 4UTJA 3GWQA 1ZY9A 1OY0A 3CB8A 4K7VA 4IM4A 1EJXC 2XFRA 4OGZA 1T11A 4H4IA 5M1TA 4JQ3A 1K7FA 3P60A 1X39A 4BF7A 2DJLA 1VJZA 5G1YA 3SCWA 4DPPA 4C60A 1H2JA 4IPIA 4ZL1A 1IWBA 3W6MA 3R0UA 1A5KC 3ARVA 4UNLA 4I3GA 1A5UA 2EKCA 2J62A 1FWEC 1OEPA 2PPOA 1JDEA 3SUUA 2ZXDA 3KDNA 5E0KA 3O5JA 1XH2A 3L4YA 3VNZA 1PDYA 3OG2A 4MWAA 1G5AA 5E1QA 2V5LA 1XW8A 5C9WA 5I23A 5KZ6A 4RZBA 3HMCA 5G2IA 3ITLA 4GGHA 2AMGA 3WH0A 1Z41A 5DQPA 1R47A 3L2IA 2WMJA 1NWUA 1R3RA 3VTRA 4NNCA 4IIDA 4W9PA 4B92A 2NX3A 1BL4A 2GUUA 1JQXA 3C0JA 2QGYA 4DZAA 2WZHA 3EXRA 1FWGC 4S23A 3V5CA 4TUFA 1LBLA 2PV3A 1EQCA 1V6WA 3MT1A 4GJIA 5CLWA 4BK9A 3SY8A 3MCOA 4FNTA 1V03A 4GYPA 1DWJM 4MADA 4E2DA 3UG8A 2BNJA 3NDOA 5B80A 4DWSA 1JAKA 3WQ6A 1GKQA 1XIDA 5FJJA 3FA4A 3L4TA 4ATLA 3V1PA 3ABZA 1NF0A 5LXEA 1PKYA 1J2WA 1LT8A 4IWWA 2C8NA 3LV6A 2EPOA 2Y7DA 3W23A 2YXXA 2BODX 2VKZG 4ODNA 3FA3A 5G2HA 2NXGA 4V2XA 4D8AA 1KCXA 5HK4A 2OVLA 2XFWA 4RNFA 2X0HA 4ZB0A 2AGKA 3M44A 1XICA 2OMAA 2ZTKA 3VNMA 4J1OA 3TW9A 4DAFA 3ZLGA 3OVPA 4L6OA 4LVBA 1W1B1 4YTTA 1AJZA 1XC4A 3IJIA 1S1RA 1SFJA 3H8AA 2A3LA 3CXOA 4HOZA 4AD3A 2NUWA 3I6RA 2GK1B 4DRHA 5I78A 2WSQA 3CZ8A 1HL2A 3GNPA 4AU0A 4IQEA 2CYGA 4HVXA 2VZTA 2FFIA 3CC1A 5KSWA 2GZXA 1V0KA 3N2BA 2OCZA 4MNKA 3VDBA 1L0PA 4PBEA 3VIGA 1OFAA 4XZLX 3ANVA 1YNPA 4ICMA 3SUTA 1EPVA 1DJGA 2X2YA 1K70A 2GVEA 1G94A 3GFZA 3BGGA 5HATA 3UJRA 4GUGA 1BG4A 2WCGA 3MMTA 3LD5A 1TVLA 3NQGA 3V4BA 1XLFA 1E73M 1W3KA 1XX1A 2R1MA 3PBGA 1F7BA 3G5EA 2XH2A 7REQA 3UY7A 2ISVA 2YFOA 4NAFA 4JQ2A 4LNYA 1P0EA 4CD5A 2P5NA 2P8CA 3KAOA 3UY8A 1JNEA 1K9DA 1I9CB 1NM9A 2PGEA 1RQEA 1EPXA 2Y8UA 4DX3A 2EPMX 2X1IA 4TXEA 4BI7A 4MLRA 4AEOA 1FH8A 4XBSA 3FEQA 2CLHA 1ADSA 4KRTA 4FXJA 3W87A 4XD5A 4G6CA 1FWRA 1UWQA 4B3ZA 5HWJA 4DRNA 4HHHA 1JNDA 1X1OA 1IR1A 2ZQTA 3KHJA 4WXYA 3CGNA 2V3FA 4YU1A 1I45A 1TPEA 1SJCA 4GZIA 4D6DA 3OJGA 1FWNA 3EDJA 2FB3A 2GLKA 3KP0A 1NP0A 3H2FA 5IFPA 2PWVA 1HKVA 4U3AA 2E7FA 4GINA 5HUPA 1EEXA 1FKFA 4XKMA 2A6LA 2A7NA 1KCZA 1Q6LA 1W9DM 1TWIA 1JCTA 1H09A 5BZAA 1NARA 3KBJA 5XINA 4B5VA 2X09A 4W5UA 3GAYA 4MY9A 3TU9A 4HYRA 3U7VA 3V35A 3S9IA 3RLHA 2EHHA 3REQB 1W9VA 3M5ZA 1R38A 4ATWA 1M68A 1H7NA 3HGOA 3ALGA 3UXIA 3H26A 3IUDA 4L61A 5REQA 3UJ2A 2B31A 4LUIA 3HOJA 4Y9PA 3R1ZA 1NVMA 1EA9C 5FEWA 1JZ6A 4QM1A 1FDYA 3UXAA 4IPJA 2O92A 3R43A 4PMYA 5D9NA 3VKBA 2OLHA 3NYZA 4IQJA 3BMWA 1W8SA 4EXQA 1J0IA 1H63A 1ICQA 4MWAB 1S5VA 2OO6A 2XYLA 1IIGA 4YCPA 2PB1A 3RMJA 2V30A 4IQCA 1PYMA 3O6AA 5LHEA 3N2CA 3LLFA 1XPYA 3W1RA 1JD9A 4G50A 3QVQA 5EA9A 2AKZA 4ZVJA 4PTMA 1WPCA 3U8GA 1F07A 4A3UA 2OQLA 5GNXA 4O1FA 2FTPA 3OZPA 3L0NA 2ZYFA 3JS3A 1BYAA 1AUSL 2QT3A 3TE9A 1H49A 4ZO8A 4A8NA 1SM9A 4YMZA 3MKCA 1FKBA 1W3IA 1GKRA 2J47A 4AHOA 4PL1A 3O5GA 1NOWA 1YQ2A 1ZNNA 1VCFA 2UY2A 3KCLA 6ALDA 4PZVA 1BF6A 1ZTVA 3S2MA 3WK3A 3DG6A 3FAPA 1MUWA 2QNEA 2WQDA 3XINA 1XHGA 1WDWA 7REQB 1Q45A 2FPVA 1GCYA 4DBUA 1FKHA 5I24A 1E0WA 1GHSA 3V5OA 3N2TA 3CPRA 1TJRA 3PBMA 3PM6A 1EEPA 5LXXA 3LRKA 2XP4A 2DJXA 3T55A 3OBKA 4XIMA 2ZUTA 3D47A 3W02A 4WKFA 3BLKA 4LYPA 3LB0A 2A5HA 3CUJA 3K8MA 5JXQA 2Y89A 1Z32X 3P62A 3UR2A 2QHAA 3BGAA 3NL2A 1M3UA 3BG3A 4LBSA 4UTLA 1F5ZA 4CNOA 4Z0JA 2OYMA 1CBGA 3GBDA 5CBIA 2BY2A 4TVCA 2XPBA 1MW2A 3H4GA 1V4YA 2JF6A 3GKFA 1C29A 1EJWC 1A5SA 3T0BA 3I4EA 2R82A 1UD5A 4HCHA 4DZHA 1W3JA 2YL5A 3KRBA 1XINA 4O15A 4PC8A 1RK5A 3OOQA 1I0BA 1H50A 4JCMA 3BMXA 4AZ5A 4LCSA 2DG3A 4XBKA 4KWVA 2QCCA 3LUOA 4GH3A 4MWAE 1VBJA 3GVGA 3G6MA 3L5LA 4AX6A 4BEUA 3ERPA 1I60A 3LRMA 2PTDA 1OM0A 2JGQA 2PWGA 4WSHA 1E70M 3ZSTA 4W8AA 3F1QA 3PUGA 1LRNA 3S2CA 3RU6A 2ZOXA 5CZ0A 3U5UA 1IR2A 1EX5A 4XV0A 1OT1A 1M53A 3LHWA 4XZMX 3AMGA 1EGZA 3MC5A 2PU0A 5AHEA 4J2PA 3WLLA 5H8UA 4GVHA 4FMVA 1GTHA 2AAMA 3SW6A 1SZFA 1R2TA 4DEFA 2VFFA 3WH8A 3IACA 2Q5AA 4JTAA 2J25A 2DG9A 2ODOA 1QTWA 4DJFA 4FNSA 2XP8A 4AVOA 3HF3A 2OX1A 1KFLA 5HQEA 3LQLA 3CNYA 3FKRA 2PE4A 4PYSA 3NQMA 2IS7A 2ISFA 3GDTA 2OT1A 3N4AA 3T0DA 2PTWA 2L5HA 3OLGA 1B0IA 3W26A 1ME8A 4UOJA 2DVUA 3WZ0E 2GL5A 3B0YA 4NUWA 4NF7A 2XIIA 2EO7A 4HIBA 2DQWA 6ENLA 4TW7A 2REQB 4GACA 4C1NA 2FMOA 4MNLA 4PCTA 4AY8A 2X41A 3GXFA 1RP8A 1ONXA 2ZQSA 3LXAA 3KLKA 5LA0A 4NXKA 1ISVA 1Q6DA 3JVAA 4Y9MA 2NUYA 3VFCA 4YWIA 3NQBA 4CU7A 3V0UA 3U0HA 4XSLA 2J8FA 3SB0A 3S2LA 3G3DA 3BK0A 4DJFC 3URAA 2Z6JA 4JAWA 3KE0A 3B9OA 4RR4A 1GORA 3MVIA 4D72A 4GYFA 5CC6A 1PJ9A 2WO5A 3W86A 4JKLA 3CUFA 4ZQCA 5HAOA 1RK6A 2Z24A 5ABFA 2PEVA 2H90A 5CGQA 2DZVA 1I2PA 4JTJA 3WBEA 3VIPA 4MY8A 4DVOA 2ZUMA 3WJZA 5LNSA 3S1VA 3AOFA 1SW3A 2H9AA 4V1YA 3D0CA 4FXSA 4PEEA 2XVKA 3T42A 3AXHA 1RCQA 1UR9A 3UGRA 4LUSA 2NX1A 1S5MA 1AA1B 3W2KA 3ABQA 5A6SA 2MANA 4BA0A 1NQ6A 3G1DA 2X40A 4QDPA 2NW0A 1D6OA 1EXBA 1TR9A 4NZ4A 3JR2A 4KESA 3SGUA 2GSEA 8XIMA 1JZ4A 3GXPA 1G4PA 2IPWA 4Z2KA 2W0UA 3TOPA 1XDLA 5LA2A 3VMNA 1CLVA 1QMLA 2CLMA 5DY2A 1CECA 1XIMA 4CEXC 4UTKA 1MW0A 1GW1A 4C02B 2WJFA 2CWNA 2E6DA 2BLEA 1WA3A 1SO4A 4MJZA 5LGZA 5HBFA 1YRRA 3MCNA 1UHVA 3NPXA 1W5QA 1JZ5A 2RDWA 1ALDA 3E2VA 3BAIA 1EJUC 3WNLA 1ZPTA 4EAMA 2XN2A 3POCA 4AG0A 4IXXA 4MB5A 4KQZA 5C2GA 3UVIA 1XBYA 2E9MA 4YTUA 1MFVA 4PUEA 3DEQA 4PMNA 1G69A 3WK2A 1QCWA 1Z89A 4IMFA 1TCOC 1TPB1 4C6OA 3B7XA 2XDFA 5DRCA 4NILA 2PSNA 2WSKA 4GKLA 4UFHA 3OODA 1X8CA 4H8UA 3WX7A 3EEZA 3HMJG 3VCRA 1TPVA 3KAFA 1F05A 2D2GA 3DFOA 4Z1AA 3LBOA 3KBMA 1M7PA 3GS6A 1AQHA 5E6ZA 2E6FA 1MFUA 3U5YA 2GDVA 4G5DA 4O1EA 3OGVA 1SJDA 2BV9A 1LM1A 4V15A 4TX0A 1QATA 4DM1A 2BOGX 3O5MA 1V3KA 1XLKA 1H7PA 2YGYA 5KTLA 3MYPA 3LCFA 1X8FA 2E68A 2VCCA 1TREA 1L6YA 2FIQA 1H41A 4E8GA 3NZGA 3W25A 5AZ0A 3NSXA 1X7IA 4J27A 4NZCA 4LANA 1OJXA 4JHMA 3KAHA 1ISWA 1KR0A 4ZFCA 1J6PA 3HV8A 5GNYA 1VFHA 2WBGA 2PTZA 4KCUA 1LF1A 4L64A 4LYRA 4JDYA 1KRAC 4JHOA 2D3NA 2CPUA 3F4NA 3TYDA 4E8DA 1PBGA 2BHYA 4UBPC 1GJUA 1P0BA 4ZO6A 4OHQA 3H24A 1IEVA 2OO0A 3TH6A 2H3DA 2ZX8A 2GUYA 1H7WA 2QCNA 1G01A 3O16A 7ENLA 2ZQUA 1T6MA 4XD4A 4LV4A 2OU4A 1F76A 2ZRYA 4KQNA 1J18A 1JPKA 2PDFA 2CCRA 3KP1A 4UQAA 5AKQA 2PDXA 3WBWA 1GQNA 3PBVA 1EQPA 3ES8A 1LL6A 1R87A 4ERGA 1E15A 4FAPA 2FFCA 3FYOA 1PKNA 3WFZA 3M0JA 2NQLA 4R53A 5JQ9A 1CGYA 4KFNA 1FFRA 1XIGA 3PZTA 3BLLA 1EUAA 3QF0A 5LIKX 5FI8A 5A95A 3P5YA 2CC0A 4ACZA 1P0NA 6XIAA 3N6QA 3AWNA 3AYVA 1NFGA 5FJTA 4HOWA 2G95A 3QMRA 3O5PA 3ARWA 4H7CA 2VUYA 3SURA 4M6UA 1TPC1 1NWTA 2P10A 5E70A 3TYEA 2WCSA 2G3JA 4XAPA 1F73A 2A4AA 4MLJA 2NQ5A 1NJJA 3L7RA 3A5FA 2QEZA 3VGDA 4FNRA 4ES4A 4PSRA 3W2NA 3BW4A 5KZDA 3RLGA 4JFSA 4Q7NA 3CWOX 5A8MA 1GOMA 1CGVA 3GB6A 1SO3A 1AZ2A 5D09A 4G7EB 2VX5A 2K8IA 2C18A 1JGMA 3DCPA 3NL5A 4Z17A 1XKYA 2VT0A 3DYOA 1CZ1A 3VOIA 4KIEA 3OGRA 1KBLA 3PBUA 8RUCA 1UYQA 4PULA 4QLJA 2V2CA 4CVWA 2QULA 2FKEA 4HNCA 1FKXA 3EOEA 1Q6IA 1OFDA 4XZWA 3VC6A 1US2A 3WFAA 4K1GA 4KRZA 5DITA 3UI4A 1T40A 2NLIA 1TFVA 4KMQA 4MUZA 2ASHA 2EPHA 4J35A 3IV3A 3H9RB 5D2YA 4H2HA 1WZKA 1UH3A 2DP3A 1CGTA 3R0KA 1JCJA 1EDGA 3CLMA 4RE2A 1J79A 4DRSA 2WNWA 2ZZ7A 1QOPA 1VHNA 4I90A 4LAOA 4GBDA 2GOUA 2VD9A 3WD4A 3OIXA 1RLDA 3T0CA 4GQRA 2XVGA 3EWUA 1QW8A 3H70A 1Q85A 2G3NA 1FWIC 4JFMA 1OGBA 2J88A 4PODA 2NZLA 4GFIA 3BQ5A 3PZIA 1D7KA 3WQEA 2QKFA 2RUDA 3TN5A 2QF7A 4HNLA 4D8LA 3QZEA 1GQKA 1KW1A 4RLIA 1E6ZA 2ZFAA 5HQMA 3ITTA 4J28A 4F40A 3PF3A 4LUJA 3NVDA 1SJAA 2Y88A 3M5XA 3VMOA 2PLCA 1VBHA 1EBHA 3BAKA 1YEYA 1R2RA 1EQ3A 1XIFA 3U48A 3QV9A 3QGVA 1MQPA 1CLXA 4JKKA 3P6LA 2NXHA 2X7WA 1UH2A 5CJ5A 3BSMA 1XRTA 3M7SA 1TPFA 4IFKB 4Z08A 1DL3A 1PS9A 4AHQA 2H6RA 2EAWA 3QZAA 3O5QA 2ABAA 1FKDA 4WX2A 1JCLA 3IHZA 2I1OA 2W9MA 1BAGA 3GXMA 3UXKA 2RURA 1XRSA 3DBPA 4K68A 4Y9AA 1V5XA 2YA1A 4GA8A 1H61A 4FXFA 5C6MA 3S2JA 3SCOA 4CCZA 3GXDA 1UR3M 3QPEA 1T41A 4BI5A 4AXNA 2WVVB 5H2ZA 4QE4A 4C90A 5EPDA 2BY0A 1CGWA 4DQWA 5DIUA 3F03K 1NU5A 3BMVA 1FXPA 2Z6IA 5AC4A 2DT2A 2VO5A 1JCXA 5C55A 2VC5A 4JQ1A 3KVKA 3QW3A 3J7HA 2NQJA 3LI1A 4ADTA 3B8DA 1XF0A 3BV4A 1TB3A 1UZDA 4JQ4A 7A3HA 3LXBA 3C56A 3CV7A 1TUXA 1LDCA 2PDQA 3NQ2A 3WLNA 2J9YA 1E9IA 1XR2A 2YDQA 3HG5A 4U2YA 3B3DA 1YTEA 3MSYA 5HTGA 2PDIA 1T99A 3BMBA 5CPNA 2OB3A 3KBVA 4GLEA 4HZ6A 3WUEA 3NPVA 2XP5A 4AEFA 3PUDA 3PZOA 1ZS2A 1GOOA 4DRMA 4F0MA 3A3HA 1NDZA 4GY7A 3E2SA 1FKJA 4O18A 2KX9A 2NV2A 2ABBA 1TE1A 3QFWA 4JNZA 3UNDA 3ATYA 3WF3A 3AIQA 1AQ0A 2WOQA 3QGAC 2RSEA 2ZUNA 1Z6KA 4PMJA 2CETA 1FCVA 3K4WA 4R0XA 2FJUB 1R6WA 3L68A 4DZIA 4YXGA 4LAMA 4RPPA 2ZC8A 3GTNA 3LENA 3VD7A 3C4UA 3TTOA 1A49A 3P80A 2VC7A 2HROA 2W3ZA 3PJTA 3OIHA 3GD6A 2CKRA 4QLLA 2G4FA 1W1ZA 3ZT5A 2QJGA 3T78A 3U3HA 4Y6GA 4DNHA 2PLKA 1GQIA 2GUBA 4HNNA 3T2QA 1PEZA 1VPYA 1FWAC 2XN1A 4D6IA 1SO6A 3FYYA 4L3NA 2WJEA 5IBXC 4JTUA 3M4HA 1TKKA 3EWWA 3WLQA 1O95A 2AQOA 2QCDB 4A3QA 3L21A 4UTWA 4HBEA 3E9AA 2ZX6A 4DUXA 1HKJA 3P8IA 5HUOA 1Q63A 4F2BA 3VVGA 3THAA 5LA1A 1LLOA 2YDRA 3QC0A 4OTKA 4HGXA 2B4GA 3RPDA 4NNRA 5JIWA 4GJJA 4GYPC 1U83A 3FAXA 4G1NA 1KM5A 3VNKA 2YYTA 3Q37A 4PBGA 4XVDA 3UR5A 1M04A 2XU2A 1OZMA 3EPNA 3SN4A 2HK1A 3SQMA 1A7XA 3W9ZA 1VZWA 1QHOA 4LOCA 2FVKA 2F61A 3ICJA 4H9YA 3BICA 3U7BA 3W1UA 3DX5A 1UP0A 3FFSA 3NEHA 4JIIX 2WHMA 4G1KA 4S3FA 4WQ6A 1UKQA 1TJ0A 5A8GA 3GC4A 2GOKA 1TV7A 3MHUA 1NAL1 3CPUA 1XDJA 3ZZ1A 3SCUA 2G3FA 3PNUA 2ON3A 4S3CA 4ENLA 2F2KA 4CN6A 3DECA 3KW3A 3UCQA 2I57A 2POTA 3EDDA 4L1XA 3VNYA 2NXIA 2YR1A 1MW3A 3VZXA 3KTSA 5C54A 4QDMA 3LERA 3AUJA 4JYFA 4EPBC 3MUY1 2W27A 1KBBA 5C9UA 2VC9A 1QO2A 5LNUA 4OOUA 2CLIA 4M1BA 3KCEA 1ISYA 3CGTA 4JTLA 3EX3A 3D6NA 1J96A 3VDHA 3NPUA 5CZJA 4F4RA 1FH7A 1KGUA 5E09A 3L65A 1MNZA 2QGHA 1G1YA 3K1GA 3KOWA 4DO5A 2PPNA 1BFNA 1UZ1A 4EWJA 2VOMA 3JZUA 1GVFA 1PIGA 1VB9A 4IL2A 1J9YA 3BPWA 4Q8UA 3K4DA 4DN1A 1E51A 1MEHA 2WJDA 1W2PA 3O15A 1QPRA 3HIJA 1S2TA 1WDPA 3DERA 4LX4A 3SFKA 1WQ5A 3BURA 3F4CA 1VRXA 3LBCA 4QFUA 3WNOA 4UCGA 2YBVA 5FL0A 1B54A 1Z7AA 4AZHA 3VDCA 4IX2A 1CTNA 1J4EA 5EBUA 2JE8A 2NUXA 2DZWA 1ODUA 4UC5A 3WD2A 1K3UA 4JFKA 5I06A 1JZ8A 1M41A 3AHZA 3CIVA 4UDMA 4O12A 5DRIA 2GGHA 1EXPA 4GIRA 5FSDC 2WSYA 4UFMA 4GUJA 3W7GA 2CHOA 3SN0A 2GQ9A 1IV8A 1XGDA 3TVAA 4W9QA 1FWDC 2HWGA 2NSXA 3H2NA 2OJPA 1TTPA 1FHDA 3WBYA 1AQMA 1JNSA 2OLSA 1MXGA 1Z44A 3MA8A 1CW2A 3G1VA 1BGAA 5ABEA 1UMLA 1LUCA 1V3IA 2D20A 1HX0A 3S5SA 5MHBA 3I3EA 2ZRZA 2PN0A 3PWIA 1AD1A 3RO8A 3EDEA 1WDSA 1J4HA 1RVGA 4HK5A 2VC6A 1JF5A 2DZBA 4OV9A 1OFOA 1OK4A 2HE5A 4ZXOA 3GHUA 3SRKA 2E3ZA 2HZGA 3ZT6A 2CFFA 3L4UA 2RHGA 4HZ8A 3LXCA 1FA2A 3NTYA 1H3GA 2Q09A 1OG6A 2QIWA 3TR9A 1KFCA 3R8HA 4KRUA 1Q6UA 4B9YA 3L5MA 4GGBA 1QI4A 4WCJA 1KWGA 1BVWA 2ZTJA 2YL9A 1BHGA 4ECLA 3F2DA 5F2LA 1YYAA 3UPBA 1YMYA 3DGBA 5MKGB 4MMWA 1YTKA 1X6UA 4ZA0A 3R58A 3JYMA 3AZTA 1KFEA 3BCDA 2BY1A 3KL0A 4J7RA 3TV8A 4QAWA 5H8MA 3STCA 3EWXA 3GTHA 4JYSA 4PMVA 2KO7A 5CZSA 3ZS4A 4MYAA 1H7OA 2ITKA 2PLJA 1WKFA 3UP8A 3RR4A 2WAGA 3P74A 5F4SA 4JEJA 3K2GA 3SJ3A 1EWEA 4MIMA 3QOMA 3MP3A 1SQ7A 5A8QA 4DBEA 3N3TA 1JCNA 1M03A 3HFYA 3OW1A 3PZNA 2PDMA 2X1SA 1EZWA 3I6TA 1RVKA 3KCJA 5HINA 2DDXA 3HQPA 1FHLA 4LV9A 3UZZA 4NJJA 3F5JA 3BCFA 3AMDA 2MNTA 2J75A 4K8HA 5EBAA 1Q7MA 1EHAA 2WM0A 4CCDA 3M0ZA 1M65A 3TNOA 3SRFA 4UQ9A 1NH6A 1NMVA 2Y0FA 4ZOBA 1FWSA 1WUEA 4WUIA 1UD8A 1AQFA 4A35A 3EX6A 4DRPA 1JPHA 4BCEA 5J6EA 2EJ1A 2P76A 4WJ8A 2D24A 3ZXWA 2AL1A 3IRDA 1EIBA 8A3HA 5EU9A 1P6WA 1QI2A 5CZTA 4KT2A 1J5TA 1WV2A 4YNGA 1D2KA 1O7AA 3QRHA 4L9XA 3MV01 2I7GA 3P5ZA 2OSYA 3ZT7A 1P48A 3RAOA 4I6VA 1SPQA 3R12A 2VUNA 1IEQA 2R1LA 3QR3A 2VR2A 4ZEPA 3GVVA 2GQ8A 2F4EA 3HU7A 2WWCA 5BOOA 1SW7A 3B06A 5FACA 4L80A 4C5ZA 1GOIA 5ABGA 4DJDD 2PP3A 2ZWZA 3FK4A 1KNWA 5D38A 3C0QA 4B5XA 3ECQA 3NL3A 3UI6A 2BWGA 3BOLA 1IEXA 1VFLA 3PJXA 1FKIA 1W91A 2QR6A 3RPTA 1D3GA 1JYXA 3NO5A 2D73A 5ABTA 1GZ1A 1DWHM 3AZSA 5I98A 2PF0A 4X0NA 5DEZA 3EKLA 4HNUA 2QYGA 3L67A 3PR9A 1UA7A 4Z2HA 4JIEA 2PF8A 4LVDA 2CBJA 2WHLA 3S5NA 3IGXA 1CI1A 2YBUA 3G1RA 4JX5A 4INFA 1FOBA 1XUUA 3OZYA 3T07A 2GJXB 2RDTA 2VVNA 4HHPA 1NSGA 5PTDA 3TTQA 1WAUA 5LNWA 4C5YA 1P6BA 4CCEA 2VQUA 4UTIA 1TV5A 1AW2A 2FYMA 2Y7EA 2VDGA 4MOZA 1LQ0A 1SSDA 3V36A 1OFQA 3MDYB 1Q7QA 2DQXA 1EX1A 5DT7A 4FX7A 3AHTA 3W6LA 5LIXX 1M1BA 3QTPA 2KZHA 3CWHA 4H9UA 1WXJA 3QZ6A 4AVFA 1UC5A 3ISIX 4Q22A 4RE4A 2XVLA 4K1WA 1LORA 1RBOB 1UQYA 2CXGA 2E5DA 5D05A 4HSOA 3BLFA 3HPZA 3TN3A 2VMFA 2I9UA 2WC4A 4K37A 4ODMA 2G3IA 2EBNA 3AICA 3IJDA 2W92A 1JRBA 1GW9A 3EB4A 1ZSXA 1ZP3A 4B3LA 2Z7GA 2XM2A 1HNYA 2Y4SA 3E0FA 4UFLA 1E1CA 4I9AA 2HPMA 1CX9A 4FK9A 3LHTA 4MHBA 4WJXA 1PVNA 1YX1A 1TV2A 1S5WA 3MS8A 4UNKA 3WO8A 1NMWA 5I3DA 1K9EA 3H21A 3UCDA 4F0HA 4FLOA 1ZJAA 1RJPA 5DXYA 3S8HA 2NWSA 4LALA 3A3XA 1V3LA 2V2HA 3BC9A 4GX9A 4Y7EA 4R7OA 2ACQA 1RLCL 4OBRA 3QR1A 3N9RA 4FR6A 4O52A 4MJ2A 1BWVA 3WEZA 2C15A 2XJ7A 3TYZA 4QJ5B 1FKRA 1RBLA 3AFBA 3NURA 3V0TA 2IKGA 4J3SA 1N1AA 1JVNA 2VYOA 4ACZB 2O4QA 3GXTA 1FKKA 3G0UA 4M19A 4CNPA 4GD0A 3PRAA 1FX6A 4JNMA 3WH5A 3A22A 2DU2A 4MPQA 3BANA 4TW6A 3BW2A 4HU8A 3RDKA 1G6CA 4IIBA 2ISDA 5DBTA 4D1JA 4CU6A 3S9YA 4MGGA 1F4AA 2NQ9A 4OQVA 4GC4A 1DTUA 2W62A 3NXLA 4LUYA 2Z1WA 4ZPWR 3TLLA 3W7RA 4EANA 2WSPA 4XBJA 2J7EA 1EKOA 3TP4A 2VEPA 4YVPA 1E6QM 1X7FA 2DUXA 3KRSA 1QOQA 2HS6A 4US5A 3M0MA 3PN8A 4F79A 1EDTA 5CZKA 4NAEA 1J0ZA 2UZ5A 4O28A 5LIYX 1B2YA 2J7DA 3TLQA 4B15A 4HK6A 1QT1A 2PD5A 4M80A 3DH7A 1PKLA 5ECUA 3NOYA 1OK6A 3OA3A 1PUDA 1PX4A 2WCAA 4PUUA 1TO3A 2WNZA 1F9CA 2VZOA 1PHQA 2EULA 4J9JA 3M6DA 1TCDA 4WY0F 2C1HA 1LCOA 1FKLA 5DN1A 3WFLA 3BZGA 5HNTA 4P2VA 1WYIA 1N7KA 4WR3A 5IDIA 2X1RA 2PZ0A 3GH4A 4NX5A 4ATDA 2WYSA 2H3BA 4ZTYA 1YPXA 2J6XA 3T1GA 3ORWA 4TMBA 1JUEA 5HMFA 1TVNA 1VIZA 2QCHA 3THDA 2VR5A 4ZPVR 2E28A 3NRKA 2PA6A 3QV6A 4LQ1A 4J3XA 2OKTA 3GU2A 2DORA 4ZSUA 3LS9A 4PUKA 3NZ1A 1ML1A 2OXNA 1VENA 1A3HA 3RK8A 1DJHA 1ICPA 1MQQA 2FLIA 4UOQA 2NLYA 5AHLA 2Y5SA 5CSSA 3FXGA 2HRWA 4HU4A 2V3GA 1E44A 1XD0A 4RJEA 3DFSA 1ITUA 2A2IA 1HF6A 2Z2BA 2KFWA 1MZHA 5CAKA 4XAGA 3FOKA 3TTSA 3LMYA 3R7MA 3DHFA 1JF6A 1GQJA 1KM0A 1H5VA 1J0YA 3URBA 4NZJA 5FCZA 1K6WA 3KAGA 4IPLA 3AALA 3DC8A 4L6DA 3UG3A 5L6UA 4YN5A 4MJMA 2WLZA 2ZE0A 4M51A 3T8QA 1UWSA 1N55A 3CTTA 1YADA 3QW4B 4LVFA 4QNWA 1E0UA 4H9TA 4JN6A 4KGJA 5HOSA 3DENA 3KOYA 4DO4A 4TYOA 2PFHA 2VQTA 4N7QA 2XP9A 1Q6EA 3W1PA 3TWAA 3WLTA 2FZ8A 1EA0A 3APTA 1BTCA 2IPJA 2X8RA 4Q8NA 3VD3A 5CQ1A 2D0HA 4HARA 4KEZA 3GBEA 1PX8A 3KTXA 1O5KA 4GI9A 3UG5A 4MZYA 2VZVA 1Q8AA 3EX4A 2P0OA 3M07A 4JYDA 3IAQA 3M0VA 3WLIA 1Y5XA 1F40A 4FIRA 5C9ZA 3HJEA 3TC6A 1E6XM 5B7YA 4HPHA 3KBNA 4O54A 3KZ7A 5CSYA 2AMXA 1Q1CA 4LVGA 3TSBA 2G97A 1GG1A 4M29A 1YDOA 4X63A 4R88A 3GTYX 3FV9A 4WSJA 3OLEA 1BKHA 4K3ZA 4XTDA 5DCBA 3LGEA 2UV8G 4RZ6A 4TU1A 2WMKA 1W2VA 5A6AA 4NU7A 3NO1A 1FY6A 2OKOA 3RRAA 3U2ZA 4NRRA 1EP1A 2J7BA 4FF5A 3U57A 4LEQA 4AWEA 1XSJA 2BVYA 3ITXA 5CC5A 4DIAA 2YCEA 3TQPA 4Z2LA 5AC5A 4JCLA 4MUPA 2XP3A 1CEOA 5FJOA 4LAXA 2MLXA 3O1NA 3W83A 4IGHA 4O0KA 2C1GA 1TG7A 4F48A 3TN4A 4Z2IA 3AS2A 4A22A 1BXBA 4DJED 1TMHA 4LFYA 4Q4PA 4B9ZA 3PZGA 1HG3A 5E0CA 4MKVA 1LLZA 4QCEA 4X61A 3C8FA 1BKSA 4CQ8A 3BLEA 4NXSA 2OWCA 1UKPA 1QI3A 3WEOA 4TX8A 2YFNA 9CGTA 3F4WA 4M56A 1GWJA 4ZB2A 3FJ4A 2PDNA 3T09A 4IGSA 1ZRQA 5K4ZA 3JXVA 3FCPA 2GDUA 5T26A 1J2BA 3OOBA 1OHLA 2YYUA 1TRDA 2CBUA 4FNPA 4ROQA 1MSSA 3WENA 2PD9A 3QBUA 3SY1A 3GLCA 2VGGA 2WANA 1NTHA 1A47A 1BD0A 1Q6OA 4GZJA 2CLOA 1VBUA 2F9RA 3HURA 5JUVA 1VS1A 1XS2A 1G7UA 1TA3B 1ME7A 2R24A 3A4AA 4UQDA 2ZXAA 3GUGA 4HMDA 2AQVA 4KCWA 1PTDA 3P2VA 3R6IA 2OEJA 2O7SA 1Q3NA 3IJ7A 2Z29A 4M6VA 4GZ7A 5LIWX 3HQNA 5F2MA 3QY7A 5CSUA 4GG9A 3IUHA 1DWAM 3OVGA 1TIMA 3BDKA 4W93A 3CQJA 1UUMA 3TYCA 3EDKA 2ATSA 5FKYA 2RUCA 3TFXA 3W53A 3ZJ8A 1LWHA 1UMYA 4KIRA 4JTSA 2RJHA 3STGA 4IIGA 4IIFA 3RCYA 3E12A 4JN7A 3A6OA 4G8TA 1YTDA 2A21A 2NWRA 4E3TA 4GUHA 1FTXA 1W1VA 3VDGA 4EOUA 3DHDA 3KX6A 5ABHA 1F3WA 1LRTA 2DSZA 5F2IA 4JS3A 4LT9A 1ONRA 1JI2A 4C65A 3PPFA 3RITA 1OGGA 2I5QA 3E0IA 4HSNA 2CLFA 5D2WA 4BJHA 3WEMA 3UR8A 5A6BD 4DI9A 1KKRA 1P6CA 3LPFA 4DJEA 3W28A 3W88A 3GG0A 5IHSA 2YDAA 2CKSA 3A4WA 4WOQA 1Q2SA 1B3OA 3DYMA 1QNPA 3BLDA 1XIHA 3DU0A 3SCQA 3UYCA 4WKHA 3VE9A 5LYRA 2QDEA 5HWMA 3KOXA 3E74A 4QS5A 3ANUA 2YDSA 4R5EA 4NP7A 1XFCA 4NZ5A 3BH4A 3PC0A 4FALA 5AECA 1KXQA 3QH2A 3RRXA 5C71A 4GIAA 2VFGA 4ICCX 3WCZA 3VM7A 3N13A 1Q6GA 4HK7A 5I07A 4DJEC 3RU8X 3VA8A 1OFRA 5DLCA 2PV2A 1QRQA 5AHIA 4C6CA 3KCOA 3WYZA 2EG6A 3W70A 1KKOA 5GJMA 3CHCA 1HL8A 2IKJA 1W9BM 1W31A 5A8NA 3CQ0A 4HB7A 3MO7A 4HMNA 3TJ4A 4BR1A 2Y63A 2F21A 3MUIA 2GQ3A 3PZVA 2QDDA 2QDGA 1PYFA 3EDFA 5TQLA 3MU7A 2J74A 3PZMA 3SFWA 3AROA 2ZXBA 1WZMA 1J0JA 3I4KA 4IMDA 2MNRA 3LYEA 2PC8A 1FHVA 3QKZA 3B0UX 4B16A 3F4VA 2ZVRA 2PURA 3S6DA 1HL9A 4DWDA 1BLIA 2VEMA 3IWPA 2QIIA 1WXZA 3GR8A 2V81A 3AO0A 4O2TA 5DIVA 1Z3NA 4S1FA 5FEPA 4C6NA 2HV5A 4TX9A 1PDZA 2PDWA 2Y2WA 3DKJA 4OECA 4N9EA 4XIAA 2OELA 1TZ9A 4GQ0A 3WNMA 2V63A 3TDFA 1Q2RA 3EX1A 1B3YA 5GQBA 1Q4WA 4CD8A 3EWZA 2Q01A 3EGJA 1I2OA 4PUWA 2JGYA 3SUVA 1NFBA 4HPXA 3NWRA 3LOTA 3AHVA 2RH9A 1FD9A 1VFOA 3PR2A 3TTEA 4KPLA 1V93A 1WP6A 3IAPA 2D2OA 2PWDA 1D7FA 3UWUA 3CU2A 2CLEA 2Q6ZA 3GK0A 4POCA 1J93A 1V77A 3PJUA 3MTWA 1UP3A 1HXJA 3SSZA 3HGSA 1OX4B 3ONBA 3G8RA 3IANA 3I7QA 4HBKA 1DXIA 2VXNA 4RL3A 1UOZA 3LY0A 3NIYA 4IMEA 1C7SA 4QNEA 1KM1A 1SMDA 3F2BA 4B5UA 1OX6A 3ITOA 4DNMA 4MPKA 3O5DA 3SIZA 4AD4A 1KTNA 2Y6ZA 4O50A 2FJKA 2GJXA 3H53A 2BSLA 4C6EA 3CO8A 3GHRA 3TKFA 1DIOA 1TELA 3GXIA 3SCSA 5D2TA 3T0AA 2C19A 3DFPA 2R14A 3WDRA 1B3XA 3TC3A 2V0TA 1J8VA 4JQAA 5FAGA 3BSGA 5C9XA 3KVLA 2Y61A 4NAFB 1RD5A 4FHAA 2HXTA 4HD5A 2ZE3A 4PMXA 5TBOA 5IM51 2QW5A 2CW6A 5KZEA 1FH9A 2PDKA 3PPCA 3ZSSA 3URQA 4H1ZA 1RZMA 4CNNA 3W2LA 1M5WA 3GU9A 2E9BA 3VOCA 4D6JA 2WC7A 1B5TA 1I0DA 2X1UA 2FGLA 4FIQA 4P7QA 1O4UA 4IICA 2XIMA 4DF1A 3OHMB 3RILA 4ERAA 2XFYA 4MDOA 3UA4A 4YWSA 1PE1A 4AYGA 1WXYA 3AHXA 5EMYA 3KEHA 1ZJHA 3BAYA 3SAZA 4CNSA 1QW7A 1SR0A 3GH7A 1U79A 4UQCA 5FJPA 4CVUA 2CXEA 4WDWA 1FCBA 2BP1A 1HJVA 3M0YA 2XIJA 4H9XA 2D2HA 4ZE5A 1F8MA 3C0LA 4S39A 3KOFA 1ZAIA 1JPDX 4Y96A 3MSGA 2IF4A 1DHPA 3XIMA 2WVTA 1JFHA 1R86A 4ML9A 4ORIA 1QFEA 3B8IA 1IEIA 4DBSA 3VDAA 4JY9A 1IYXA 2ANUA 1M7OA 2PP1A 3VGGA 3LZ5A 1QNVA 3I6CA 5I3FA 1WBHA 2ZRUA 2CZ5A 4BY3A 1X6LA 1A5BA 1KCLA 1QVBA 3WNNA 3N18A 2RUSA 4LAWA 3B9DA 3EA2A 1QHZA 2E1DA 4UR7A 3TONA 4EWND 1OBAA 1ZCCA 3UZJA 3I6EA 1EYWA 4F0LA 3I65A 1MDRA 1GOQA 2F84A 2C7FA 5EMLA 5HANA 2R91A 4N6FA 3T8LA 4QHRA 1L8NA 2JK2A 1OCJA 2V5CA 4S2BA 4HJFA 3M5VA 1LTDA 1OINA 2ZKMX 2CWXA 2FTWA 1FWWA 3EB2A 1FBAA 3BLPX 1TYGA 1LG1A 3UZWA 2X1TA 3G77A 4UTTC 2DZUA 1UA3A 4XSMA 4H8NA 3VCCA 1ZZMA 5K2ZA 4AZGA 4UOZA 1IGSA 3W84A 3USBA 4F2UA 3UERA 2AL2A 3B8SA 4E2BA 5MKGA 1ECQA 3ABSA 2G37A 4LS0A 5HNRA 2X16A 1K7EA 2EG8A 4IJCA 1E1CB 5D37A 1W1TA 3IIXA 1CWYA 1BYBA 1GVRA 3TFCA 2A85A 4NI8A 2BBFA 1QO5A 3CMGA 3CEPA 3VOHA 4Q33A 4CQCA 4RW5A 1X96A 1HXVA 1V3MA 4RDWA 1UH4A 3EY6A 4MAVA 3INPA 3ARSA 2YIHA 4L6HA 4BF8A 4XZBA 2F6XA 1K9TA 4MKSA 1SU5A 1AH4A 1W6TA 4NYYA 3NQVA 3HG3A 4AB4A 4M7TA 1TMQA 5AYYA 5EFFA 4NJHA 3UNTA 1VBRA 1UBSA 4HU3A 1HGYA 2QCDA 1I8JA 3AYTA 3EOUA 4D6CA 1C8VA 3MWCA 4BQ2A 1GEQA 4ZODA 2D0FA 1B4KA 4ZO7A 4YYFA 1S2UA 3UA3A 3H22A 4XAZA 2YJQA 1I2QA 5D9PA 1ITXA 3FXYA 1JZ2A 1T8QA 3W72A 4TMCA 4MZ1A 3TZFA 3FGCA 1PTAA 2IXVA 4M82A 4O4WA 1HJWA 4LPCA 3LCIA 2DSKA 2INEA 4JTFA 3W2UA 4W8LA 4P8XA 2EPKX 3UVAA 1P1MA 2CLLA 4QT2A 3NYDA 3OHIA 4TTGA 4Z1DA 3CM4A 3GU0A 3AS1A 3QQ1A 3ALFA 4DJDA 2VCDA 1TV4A 2F6KA 2NVAA 4DUWA 1MW1A 4QR6A 1W56A 1L6WA 3MBFA 1Y7VA 3JYJA 1LOLA 2B7OA 3GIPA 5M3WA 2OTDA 1J4RA 1ZBVA 1ITQA 2DIJA 2VTFA 2ZA3A 3NQDA 4JX6A 3H2AA 1NDYA 4IISA 2ONEA 4KGLA 2AOSA 3AISA 2IQ0A 1K1DA 3PSVA 2FKPA 2YCKX 3NFUA 4IG2A 4GCAA 3WDHA 3HGRA 4E4FA 3PSWA 2JKEA 2XH4A 4MWAD 4NJGA 2XIQA 1DP0A 2EGZA 3WNPA 1B57A 2G41A 4IPNB 2B7QA 4ZB5A 3QYSA 2VFEA 3VKAA 4ODPA 2M2AA 3LTSA 2VFDA 5EMUA 2JEQA 2O0TA 3IGUA 2CLPA 2J78A 1EJ7L 4M0XA 3UJEA 3CIWA 4DRKA 1K03A 2GPTA 1VLWA 3WF0A 5HJXA 4MYXA 1K9FA 5JH8A 3UZ5A 1E4MM 2Z2AA 1S39A 2G8ZA 3BE7A 3M6YA 2HVNA 2PGWA 1GZGA 2NSOA 3TN6A 4P7LA 3TA9A 4YVXA 5B8IC 3GW0A 3FDGA 1FDZA 2Q3OA 3WLPA 3O63A 5CPLA 4FPSA 4NRSA 1BXCA 3WD1A 3IK2A 4DH0A 5AYIA 1GOKA 5GNZA 2QCMA 1TWSA 2Z1XA 4JIQA 4J3TA 1EBGA 4PUJA 4FS9A 2LKNA 3DFHA 5C8BB 1KXTA 1CGXA 2C1IA 4GX8A 5DMMA 3PA7A 1S38A 1OF8A 3HGJA 3GNXA 1LRQA 1TRIA 2VFHA 3QN3A 1FQ0A 2HSAA 3C2RA 3C0SA 3GR4A 3NCOA 5FF7A 3VKJA 3UXLA 2CEQA 4MTVA 4XK2A 3LTPA 2XP6A 1BQGA 1W9PA 3QM3A 4QIUA 1IF2A 2QAFA 5T8GA 5MF5A 1P5QA 1RY8A 3CL8A 3NQEA 4IHCA 4LSBA 3GIYA 5BWFA 4C7FA 2WWDA 2A6NA 1KGXA 4WLCA 1VGAA 2YXOA 1A0DA 3VGFA 4LS2A 1G4EA 4RXGA 1OABA 5D04C 3DN5A 1E40A 1QWKA 1XM3A 2BB0A 3GZAA 2ZZ5A 1OIMA 3CV1A 2INZA 3O3RA 4H8HA 4BZYA 4DELA 4RXFA 1UZ4A 5M03A 5CXPA 5GPRA 4XKYB 5AHMA 1A0EA 3N2MA 3WLKX 4IFRA 4ZR8A 3QV8A 4Q7BA 1SVDA 3W01A 3TXZA 1KC7A 4OV4A 3B40A 2GJPA 4GVFA 1J4IA 2PWEA 4CQBA 2ZZ2A 5AYBA 3L4WA 4HA4A 3QGKC 2FAPA 4MB4A 4WZHA 5DCDA 2WKGA 1LT7A 2J7CA 2V67A 5AVNA 3NOEA 4W9TA 3KBSA 3ARXA 2O56A 2PDCA 4EPDC 2Z4GA 5BU9A 3RLVA 4YTRA 4U84A 4PUMA 3RN6A 3QMTA 4S3EA 2PDUA 3WQDA 4ASTA 4DROA 2XZ7A 4JTDA 5A2CA 3PBWA 2CZEA 1C9WA 1UUQA 2MLZA 4IP5A 3W7DA 3BXWA 4Q8TA 4AIUA 1CLKA 2PRHA 3L4ZA 1XIJA 1VCVA 2RDUA 3PNZA 1IE7C 5HJYA 3IKGA 2A3BA 2BGNE 5LSMA 2E1WA 1F6YA 1IWPA 1EJTC 2XIOA 1XLJA 3RIKA 3MSDA 3W75A 3ARRA 4PCSA 4TTUA 3ZM8A 3W7PA 1UBPC 4H7ZA 1MUMA 4O14A 1V6YA 2JEPA 4DB7A 4QSFA 3AIUA 4GIVA 4X9SA 7ODCA 4AFYA 2QPUA 3N9SA 4QISA 3QHNA 4OBSA 3EB3A 1EWDA 1E1EA 2W63A 1XP3A 4IGMA 1RJRA 1DQXA 3R11A 1OC5A 2GGJA 4IT4A 1XV8A 3BTNA 3QSTA 5DMLA 3OBAA 5BW6A 1QR7A 4IQLA 4C6JA 2LLEA 4ZPTR 4A21A 1NQKA 1LQ2A 4UB9A 2MUCA 1XCXA 4L65A 1HO1A 2FZBA 4GH1A 4UXDA 1FUYA 3PHAA 4Q8PA 4A3YA 1L6GA 4H19A 2Q3RA 3AQUA 2GGGA 2D9FA 5HW6A 1YPIA 5HPCA 5I6SA 4GNVA 1NEYA 1EC9A 2TMDA 4LAUA 4HCDA 4ZTXA 4EXBA 3GRIA 4NT0A 2JFEX 3GTFA 4EF9A 4MAZA 3S5OA 1VEOA 4RDZA 3TCSA 4LAZA 3OLIA 2OT0A 1DJWA 1D7HA 4W7WA 2JZVA 5BMWA 3VIOA 4WHBA 3UWZA 2CNCA 4RZ4A 1A4LA 1MEWA 3KL3A 2PWUA 4H6QA 2ALDA 4MGVA 4U31A 3K4AA 1LBMA 3HPFA 3OTRA 3NZQA 3MB9A 5JIPA 3N14A 3TAOA 1KBKA 1QNSA 3CEUA 3KHDA 4O57A 2VZSA 3U4AA 4KWWA 1D9EA 1RALA 3QJAA 1REQA 1XQLA 1ZCNA 2Z25A 2OWWA 3EMZA 4BKNA 2ZRVA 1KGWA 1JI1A 3W1QA 4XD3A 2H8ZA 3B03A 2PODA 2QLYA 1GQLA 4GE8A 2O9OA 4AZ7A 3MCMA 3HM7A 3NGFA 3R10A 1ZAJA 1ISXA 2OGJA 1HO4A 3CZLA 3TR2A 1YKWA 1FKGA 4J4NA 1ODZA 2FHCA 3C3NA 1MQRA 1YIXA 1D7JA 3S6OA 3EEGA 2DW7A 3LX9A 4JOMA 2ESCA 5EL1A 3RR1A 1UPMB 3DG7A 4BS0A 3VX1A 1HJSA 1XJBA 1R9YA 1CYGA 2I14A 3GNNA 3SCNA 4LVAA 4JTHA 1X38A 1U5JA 1OFBA 4LS1A 3TNBA 2Q71A 5A69A 5JU6A 4Z1BA 4P8WA 1X1ZA 3B8TA 3C2OA 1KT0A 4Q4KA 1OX4A 5HNUA 2QS8A 1W17A 4KEVA 3DIPA 4OJYA 3LUTA 4MSSA 1OIFA 1DTNA 1HZYA 1VP5A 1VF8A 1ZJIA 3I68A 3DI0A 1G9HA 4KCTA 4L56A 5TAOA 3GVQA 3H4WA 5K9XA 1DIDA 3S6TA 1JPIA 1R30A 3OQEA 3WIJA 4PTVA 5FSEC 1K02A 3G2GA 5DY3A 2YXGA 2HVOA 5LNRA 2OFNA 2UY5A 4JFJA 4QROA 4K2SA 3W6YA 2ICSA 5JH2A 4DBDA 4OU1A 3VXGA 2J9ZA 1H1ZA 3VKDA 1S3TC 4DPQA 3AHYA 4G7EA 2I17A 1WE5A 3Q94A 4E6MA 1Q6RA 3WN6A 4AMAA 1DKWA 1KTCA 4IP4A 3B05A 3CV6A 3HO8A 3H23A 1RJQA 4BHYA 1Y65A 4GHRA 4OT7A 1TE6A 4UTWC 5KETA 5GVJA 2FDSA 4EXAA 1NP2A 4I5UA 2VFIA 3C61A 2NQHA 4M24A 3T81A 3W4RA 4PN2A 1Q65A 1HKIA 4TQTA 2G96A 1V02E 3M64A 1UIOA 4O1DA 3KZSA 1W1A1 4M8UA 4FA3A 3W81A 4HJWA 3BG5A 2INFA 3QYQA 1U30A 1AL7A 1JD7A 3GDMA 5BWAA 3H55A 1XYLA 4WJEA 4XWUA 1CPUA 2WMHA 1NF7A 3PBYA 1DXFA 3NGJA 2Y24A 3FSTA 3ATZA 3CQKA 4AF0A 3CAKA 2FH6A 1VH7A 5CH9A 4FF7A 1O1HA 3DBNA 3W74A 4IZGA 4TW8A 2WVUA 1DIKA 4PB5A 4ROPA 3AIRA 4MNJA 1TTJA 3CH0A 3DFNA 1AH0A 4GY0A 1BSIA 3IEBA 3TTYA 1SFLA 4S3BA 5DX7A 3S5ZA 2XWDA 3MHFA 4OBTA 5DFAA 1GVYA 1XSIA 4I7VA 2A1YA 3UZXA 2ZUWA 1TTQA 3FA5A 3CK5A 1NWRA 4AXKA 5I09A 2QCLA 2ZX7A 2WVVA 1KFJA 3W27A 1UD4A 4H7VA 4QRNA 4CKQA 3R8GA 3DFYA 3MSRA 2QUTA 3ID7A 3CMFA 1HJUA 1V6UA 2XHYA 4Z2JA 4LF2A 5GJPA 4L4MA 3OZMA 4FB7A 5C9RA 5IXEA 3MANA 2VR4A 3KL5A 1HKWA 4GZEA 5TNVA 1YATA 4W9OA 2BASA 3CQHA 3FY1A 2A0NA 2RKXA 3NQ6A 2VI0A 3RJXA 4JNYA 1L1PA 3T4CA 2J13A 4IFKA 3UXDA 1K6AA 7TAAA 3AIEA 1W9UA 1E6RA 1DOSA 3ENLA 1BGGA 1XLGA 2JF7A 2JKAA 5A8OA 4JY8A 5A94A 1YDVA 1U33A 2IMRA </