2G41A

Crystal structure of the complex of sheep signalling glycoprotein with chitin trimer at 3.0a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SIGNAL PROCESSING PROTEIN
publication title Carbohydrate binding properties and carbohydrate induced conformational switch in sheep secretory glycoprotein (SPS-40): crystal structures of four complexes of SPS-40 with chitin-like oligosaccharides
pubmed doi rcsb
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2g41A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2g41A01
2OYLA 1K9TA 4UFLA 3G6MA 2DGAA 4ZE5A 4CVWA 1OGBA 4CD6A 3TA9A 2E8ZA 4PEEA 3G6LA 5CQ1A 4D6HA 3OLDA 3BAJA 4WK9A 2WMFA 1V3JA 1QNPA 2ZX6A 4AD5A 2WWDA 3AIEA 3ZJ8A 5C71A 4PUDA 3MMUA 1ISXA 3ZJ6A 3N15A 4J3XA 5DEZA 2Y8VA 2GK1B 2BY3A 2IXUA 5M5DA 1V02E 2D20A 4PMYA 1G0CA 1KFWA 3TOPA 4ZE4A 2ZXAA 1TMQA 3A6OA 1ZJBA 2BV9A 1B31A 2GJXB 3U7VA 1JZ2A 1V6XA 2WW5A 4Q22A 4OKDA 3WELA 1W9VA 1LQ0A 1FP8A 2MANA 2Y5EA 3PTMA 1O6IA 1CZ1A 4UZUA 2GK1A 3SCNA 4U31A 1OIFA 2VZTA 1TVPA 2VL4A 4BQ3A 1JZ7A 3WL0A 3MSGA 3PZTA 3WEMA 3SUUA 5ABFA 1Q6CA 5ECUA 3CMGA 1W3JA 1UUQA 1AQHA 5I78A 3AMDA 3BAWA 4H41A 2J62A 4BZYA 2J77A 1MXDA 5LA1A 3OLEA 4S3JA 3ZJ7A 1E6ZA 5GPRA 2X2YA 2JALA 3EDDA 8CGTA 1E55A 3CUHA 3IK2A 4PTVA 4M81A 1W2PA 3VOCA 3WUGA 4HOZA 4UQCA 2WZEA 4EE9A 4OIFA 1VJZA 1EO5A 4OBSA 1XHGA 4W7WA 3GNPA 2XM1A 4J3VA 5IXEA 3CZKA 1E70M 4FK9A 4ATDA 4C7DA 3VIJA 4CKQA 5HXMA 3T08A 4KMQA 5A8QA 4DWSD 4Z2GA 4AYSA 2EPLX 3PBGA 2YKKA 2B31A 1AMYA 1FA2A 5IFPA 4BA0A 3NYDA 1NP2A 2YLAA 4DUVA 2O9OA 3VX1A 1B3VA 2FH6A 4JHOA 1U33A 1QVBA 4UQ9A 5A95A 4U3AA 5EFFA 4GO8A 3WDPP 1UD6A 3M07A 3WNMA 1GOKA 1VBUA 1WP6A 2VZSA 1H11A 2VUYA 1KCKA 3OBAA 1SR0A 1R86A 2W91A 1WPCA 2WM0A 3BAKA 4N0RA 1MW1A 2VR4A 3OIHA 1MYRA 1W9PA 4JKLA 3W82A 2XM2A 3I3BA 1I75A 4MNJA 3CZJA 1MVYA 3T2QA 2C0HA 5I5RA 2UWFA 1LF1A 4PSRA 2G3IA 1XGZA 3ARSA 1HT6A 4PCSA 1YQ2A 4P8UA 4WLCA 2DH2A 1QW9A 2PWGA 3TTQA 3W0KA 5ABGA 4D6FA 3OGRA 1WNOA 3AIVA 4L4PA 5DO8A 1BVZA 2IUZA 3VD5A 1HX0A 5E0FA 1VFFA 1OD0A 1C7SA 4FLRA 1QOXA 1UH4A 1VRXA 9CGTA 1BFNA 4HPHA 1UR2A 1U30A 5GNXA 2WBGA 5CPTA 2VOTA 4D1JA 3K46A 2D0FA 1JFXA 4H04A 3ZMRA 3WUEA 4AY1A 1O7AA 3SCOA 3VM7A 2D24A 1E73M 1JI2A 4D6IA 4M56A 4H8UA 3OLGA 2ZIDA 1G1YA 5AYIA 1JFHA 3MUIA 3VIGA 2NT1A 1BVNP 3WD3A 2WPGA 3D5HA 2FGZA 2J7DA 1JYXA 1F4AA 2QMJA 2PBGA 1H0IA 1CGWA 4HMCA 4WKFA 4HMDA 1VEOA 3VIOA 1LJYA 4AD4A 1EOKA 4IUGA 2YL9A 4V2XA 4GI9A 3B8SA 1W91A 2E0PA 5F7UA 3W25A 2GFTA 3FHQA 1EQCA 4PMUA 2DEPA 3SCRA 1JI1A 1V03A 2DSZA 1XSKA 1E4NA 1ZBWA 3HJEA 3T0DA 4MB4A 3WQ8A 3CZ8A 1UH3A 6TAAA 5I6SA 2BHUA 1ODZA 3ZSSA 1V6YA 1J11A 4D6CA 1PZ2A 4PSPA 1XD1A 1TVNA 3WDRA 1E56A 3CPUA 3SCSA 2G41A 3POCA 1B2YA 1ZL1A 3PN8A 3OA5A 4DUXA 3AOFA 3F5JA 5GNYA 3EMQA 2FGLA 2J75A 4Z2LA 1PEZA 1AQMA 3CUIA 2W62A 5DT5A 1V3HA 4MB1A 4MDOA 1H2JA 4GXPA 2XIBA 3IAPA 1BYBA 2CKRA 3AZRA 1KR1A 1UR8A 4TVUA 4XZWA 3OB8A 3WN6A 1DTUA 2UY5A 1V0LA 2OYKA 2WC7A 2Z1KA 4HOXA 4D6GA 4MPKA 1K9FA 2YL5A 2BXYA 3ARYA 1N82A 3PHAA 2PB1A 1R85A 3GXMA 1SFSA 2WSKA 4HOWA 5A8PA 3MUAA 1CLVA 2CETA 4TXEA 2X0YA 1NWUA 4W84A 2J7FA 2J7CA 3L4TA 3VDHA 1GPFA 1KBKA 1UYQA 1BQCA 4EANA 3POHA 3ZT7A 1DWIM 5BXSA 5HBFA 1Z32X 3UEQA 1JL8A 1GNXA 4W86A 1BAGA 2JEQA 1OCQA 4AIEA 2A3EA 5GQBA 3CO4A 3MS8A 1BF2A 3DYOA 2ZXBA 2DDXA 5BXRA 4CCDA 3FHAA 4LGXA 4PBGA 1J0KA 1OINA 3EDEA 2CNCA 2ZE0A 3N04A 1E6RA 1OGGA 4AEFA 5JIPA 1Q6FA 1JXKA 2GDUA 1PIGA 3WEOA 1XSIA 4AD1A 1GOWA 3B9AA 1XYZA 4B3LA 2X09A 2X05A 4WSKA 4MNMA 3WD0A 4PTMA 4D6EA 1GORA 1GJWA 2VX4A 3JUGA 3WNKA 4M29A 1PX8A 1UQYA 4F9JA 2WCGA 1HIZA 5I79A 5FOOA 2EBNA 5IDIA 2DIJA 2WMKA 1S46A 1EO7A 1E0XA 3O2LA 3PZGA 2ZOXA 4KGLA 1B3ZA 1BYDA 3WD4A 1UD5A 4LX4A 4U3CA 3HMCA 4ZEPA 2DT0A 4PMRA 2UY2A 1W1VA 2WC4A 4CD8A 1JZ8A 2ZWZA 3CHDA 4MTVA 3SCQA 2VQTA 1WZLA 2EPNA 1UWTA 1E5NA 5HOSA 2ZXDA 3SCPA 4Z2KA 2G4FA 3OZPA 3RCNA 1QI5A 1B30A 1EOMA 4QCFA 1QHOA 2D3LA 3ALFA 3I3DA 1IT0A 2YOCA 3MKKA 2O9TA 3CTTA 4D71A 3WUBA 3NSMA 2YA1A 2JF7A 4A4AA 1V02A 5E09A 4ML4A 4W8LA 1CGUA 1LLOA 3CHFA 5M17A 4A3YA 5A6AA 4AD2A 1MW3A 4TTUA 3N9KA 2VX6A 4W5UA 2WMGA 1HP4A 3NDZA 4B9YA 2VURA 3AMGA 5JIWA 3ZT5A 2WC3A 4Z2JA 4JCLA 1AVAA 3PTKA 3WDQA 5BYWA 3F4VA 4ZXLA 4ZXOA 2VZOA 4GQRA 2C7FA 3ARQA 4ATLA 4WKAA 2ZX8A 4X0VA 3WF3A 1CWYA 3ZM8A 4M24A 1HJWA 5AYBA 5CPQA 2EO7A 1BPLB 3WQVA 2ZX7A 3VIIA 3AJ7A 1KXHA 1OSEA 2ZX5A 3NJ3A 4QCEA 1JD7A 1B3WA 1GHRA 3CLWA 1F4HA 3SUWA 3VUPA 3VINA 3LPGA 1TE1A 4F66A 2BY1A 1BG4A 1E1EA 1TCMA 1NQ6A 2XFRA 3J7HA 4LYRA 1QPKA 3WDIA 5ABHA 1DWHM 3N17A 1V6WA 1QI3A 3AIBA 2BVYA 2X8RA 5DMYA 4JFUA 2OWXA 1ISZA 1E3ZA 3CZLA 4UOJA 2D22A 4LXFA 1W3LA 1TA3B 2XUCA 5BRPA 1CNVA 1RP8A 3IJ8A 1CBGA 3ECQA 1JAKA 2WKLA 1ODUA 3NIYA 3TTSA 3WMBA 2G3NA 1DHKA 3AIQA 2YDQA 3FNDA 3UG4A 1OB0A 2V38A 3AIUA 4B15A 1WE5A 4GI8A 4V28A 2VMFA 3AMCA 1UKSA 1BHGA 4MAZA 3TTYA 2OYMA 3RO8A 1TA3A 3KL3A 4GINA 1UA3A 2V3GA 1V0NA 2XFFA 4B16A 2AOSA 1ZBCA 1E6NA 2BHZA 1E6SM 3GXDA 3RILA 1VEPA 3UETA 4W88A 1KGWA 2EEXA 1M53A 2J8FA 4Y7EA 1JIBA 2ZUUA 3TP4A 3BLKA 2JIWA 5E70A 1JZ3A 3WMSA 3ZQ9A 5FL0A 3ZO9A 1LL6A 4AW7A 1H09A 3VDBA 4DUWA 4TVCA 2D0HA 4MAVA 4H2CA 4WJXA 1V3LA 2PF0A 1ZU8A 3EMCA 4J3TA 4ACZB 5A6LA 3ARUA 1JGIA 1GQKA 3AHTA 1UD3A 2GJXA 4DM1A 2JE8A 1NWTA 1E4LA 2NSXA 2DSKA 3BMWA 4ACYA 3BLPX 4KGJA 1E6XM 3W81A 1CYGA 2VX7A 1LG1A 1PZ3A 1ISYA 3AYSA 5ABEA 3SEPA 1PAMA 4ACZA 3T09A 3GNOA 1C8YA 3THDA 3NDYA 5CG0A 4J3UA 2CKSA 2XPKA 4P7NA 2J74A 2J7GA 3RIKA 1ZBVA 2BNJA 3GBEA 7CGTA 2EQDA 2XSAA 4LQ1A 3WDHA 4GKLA 1E6PA 2V3DA 2J25A 3WENA 5A8MA 3O6AA 3QR3A 2E9MA 3GDBA 4OJYA 5BRQA 1B0IA 2PBOA 3EBVA 5HDRA 4TVDA 2Q8XA 3AHZA 2WVSA 4F8XA 1WO2A 1IZJA 2VRQA 5EBAA 3K1DA 5I24A 1K6AA 2WMHA 1E15A 3EYPA 3WMCA 3WQ4A 3L4ZA 2C8NA 2UY4A 4F79A 1TG7A 1R8LA 3OZOA 5KZ6A 3WH7A 2Z1SA 1BGAA 1ISVA 3KWXA 3MUY1 1P6WA 2XVNA 2VCAA 3PZIA 4E4PA 2WZIA 2GSJA 4TX8A 2J4GA 3VNZA 1EDQA 2WLZA 3IJ7A 1XH2A 3VD3A 1IZKA 1H5VA 2XTKA 1OBAA 1XCXA 2DT2A 4BF7A 4BCEA 1IV8A 4FLQA 1J0IA 3WFLA 2GJRA 2VRJA 5BCAA 1UD2A 1VBRA 3QHNA 4LYPA 2CHNA 1KXQA 3TTOA 4WF7A 2XVGA 1MW2A 1PX3A 3ARZA 3UESA 4PCTA 2DT1A 1CLXA 4URIA 1ZJAA 1HKMA 1WDPA 2TAAA 5JUVA 2V5CA 4S3KA 1MXGA 4XX6A 1L0PA 3SUSA 3ARVA 3WIJA 1CGVA 1GZJA 3AXIA 3QHMA 4AMCA 2WWCA 3WH6A 1CEOA 1Q6EA 3T0AA 1Q6GA 3ZJKA 1E40A 4AD3A 4P7QA 3II1A 2JEPA 4QDMA 5FIPA 5JBDA 1QHZA 5BWFA 4HPGA 3IANA 2FHBA 4HZ8A 2WKGA 3AROA 4U5KA 3SCUA 1NP0A 1A47A 3WQ5A 4MB3A 1E0VA 2DIEA 2WB5A 3CUGA 5D9MA 5AY7A 3O9NA 4BQ2A 4IISA 4YPJA 5A6KA 1MQQA 2YDSA 3VU2A 1R87A 4AZBA 2XVLA 3MMDA 3ARWA 2BY0A 4JZ5A 2J7EA 1UKQA 2XVKA 4ZFMA 4IPNB 1UG6A 4W8BA 5A6BD 3VILA 4UFKA 1DWAM 1W1PA 5D9OA 4J27A 1U2YA 5D8WA 5I23A 1FH9A 4UQAA 3L2MA 2OWCA 2W63A 2EXOA 4OUEA 2XG9A 3HU7A 2YL6A 1EQPA 3PZVA 4Z2HA 3NSNA 4W85A 1GCYA 4HA1A 3MUZ1 5C8BB 2ZUMA 5CGMA 4GZEA 5JBEA 2X0HA 1OGSA 1EIBA 3BH4A 4HU0A 3ALGA 1DWFM 4GI6A 3PZQA 3U5UA 2F61A 1JYWA 1J12A 3F5LA 3GM8A 4W87A 1CXEA 1JG9A 3AS0A 4P7OA 1C8XA 3W6MA 1DEDA 1PPIA 3VDAA 2J7HA 2IXVA 4GO9A 1UWIA 4U33A 3VD7A 3PZUA 1XYFA 4JIEA 3AQUA 4FLSA 5KEZA 2OLHA 1W9XA 3RM9A 1CDGA 3VGEA 2QV4A 2ESCA 4MJ4A 4AIUA 2EPOA 3FXYA 2WANA 1JYNA 1EH9A 4D1IA 1KR0A 1JZ5A 1UWUA 4CUCA 3BGAA 4QLKA 2OSWA 1OIMA 2RGMA 2E9BA 1VFOA 1HJUA 3OLIA 5A2CA 1QI2A 3BC9A 3M6DA 2QMKA 3CHEA 3N1AA 3AHYA 4PTXA 4P7LA 1NM9A 1VEMA 1W1YA 3LPOA 1KGUA 2ZICA 2DQXA 4H7VA 4UQDA 1BGGA 1V3MA 4D6JA 3VKKA 1B1YA 1GHSA 1B3XA 1KGXA 3UERA 1OD8A 1C92A 4UTFA 4AIOA 2E4TA 2FH8A 1PIFA 2ZUSA 3CZEA 2AAAA 1CPUA 1UZ4A 2YIHA 4PMZA 4QLLA 1CIUA 3AYRA 3WBEA 1HJVA 3AI0A 3QOMA 1DWGM 2VX5A 1LG2A 2YBUA 1RP9A 2VVSA 5I3DA 4J28A 2FHFA 1J18A 2A3HA 5A6BA 5JH8A 5A6JA 2E8YA 3W24A 4AZCB 1W9BM 3VIHA 1FP9A 5LA2A 4W7UA 1C93A 3L2LA 3SCWA 1MFUA 4FLOA 1J01A 2YA0A 1XD0A 4UFMA 4B3KA 1MWOA 1FH7A 3K8MA 1E0WA 1K9EA 3VGHA 2VCCA 4HTYA 1WZKA 3WNPA 5A8NA 4UNIA 4UCFA 5CSYA 3CMJA 4AZCA 3PZOA 3W27A 4M8UA 2ZWYA 2J47A 3VTRA 5E9AA 2XFYA 4AZ7A 4AXNA 3ZR6A 3VIPA 6A3HA 1M7XA 3BAYA 5A8OA 3W38A 4PTWA 2O92A 3AFBA 4R27A 4YHEA 2WHJA 1V3IA 3AXXA 3SCTA 1H1NA 1KB3A 1C91A 1EXPA 5A6MA 3VIKA 1R7OA 1MQRA 3MSDA 1CXHA 1ZS2A 1QW8A 4JAWA 4MNKA 2QHAA 5FCZA 2DH3A 4AD0A 1BTCA 1GQLA 4J3SA 1M01A 4ZENA 1VB9A 2OSXA 1UZ1A 3BMVA 1K9DA 2ZUNA 3S6TA 4MB5A 3QHOA 4YN5A 1Q4NX 3U57A 4XZBA 4UOZA 3WF0A 1E4MM 1FHLA 4MADA 3WF4A 3ZIZA 4NRRA 2PWHA 3K4DA 1TUXA 3VIFA 4CN4A 1TFVA 3HN3A 3CHCA 3THCA 1GONA 2GUYA 4UOQA 1ESWA 2PI6A 2WVTA 2WBKA 1NWSA 1X6NA 1SMDA 3AHXA 1KWKA 2UY3A 2J79A 4JFSA 4NSBA 1EHAA 2J7BA 1D3CA 3A47A 5BXPA 3W4RA 3LPFA 4GZJA 2GJPA 3WQWA 4AISA 5D4YA 1E1FA 4HZ6A 3WNOA 4C7GA 2ZUVA 5E0CA 3WEZA 4D72A 1HVQA 4B9ZA 3SURA 3GTNA 3AMKA 3BCDA 3AHVA 4PRWA 1KQYA 2JFEX 1D2KA 1GOMA 2E3ZA 3KL0A 3WUFA 1GQJA 2EJ1A 3VPLA 4EKJA 4W93A 1RD6A 3T2OA 1G5AA 3L4YA 1KQZA 3FN9A 1EDTA 3DYPA 3D3AA 2VI0A 2VC9A 4JL1A 1EGZA 1EHNA 2CBJA 3ARRA 5A6SA 4CU6A 2WHLA 3GXFA 1J0ZA 3OG2A 1YHTA 1HKKA 2DSVA 3B9DA 1G01A 1OM0A 4UFHA 4F9DA 1RPKA 2NT0A 1VAHA 2A3AA 3U7BA 3PTQA 2D23A 1E5JA 3WKZA 1US3A 5A2AA 2V5DA 4H8HA 4FMVA 4CCCA 2BVDA 3FAXA 1RH9A 4V27A 4PYSA 4U5IA 1TR1A 1NH6A 1UQZA 1CGXA 5CJ5A 1WKYA 3T0BA 5I0DA 3A4AA 3LPPA 1NOUA 1PBGA 1FFRA 1WAWA 4JFTA 1QHPA 5FL1A 4MJ2A 3VIMA 1MW0A 2CBUA 2PWFA 4OZOA 1EDGA 2WXDM 5CXPA 4NF7A 1NWRA 1UHVA 1GOOA 1WB0A 1G9HA 4AZIA 2YDRA 1SYTA 1GVIA 3PZNA 5A69A 2V3EA 3PZMA 3GZAA 1GOIA 1NOWA 1XRVA 1B3YA 2BHYA 3K4AA 1HJXA 5ABFB 3GH4A 4AZ6A 4NZCA 3ARTA 3BAXA 2G3MA 2J78A 1M03A 2BS9A 4Z2IA 1QNSA 1V0KA 2WCSA 7A3HA 4BS0A 1JNEA 3AZSA 3K8KA 3RJYA 1UWSA 3AZTA 3APGA 1HNYA 4IM4A 1D7FA 3GYCA 1CXKA 4UR9A 1JNDA 3KL5A 1MFVA 2VTFA 1H41A 2E40A 1CECA 4JKMA 4ATWA 2VQUA 3BAIA 2W5FA 1UR9A 1CXLA 1JF6A 4NRSA 3CUFA 3BXWA 1VF8A 1LWJA 4MDPA 1FOBA 1QBBA 1B9ZA 1JD9A 1GJUA 1HL8A 3WD2A 3EDKA 4U2ZA 2VCBA 3EMZA 3FY1A 2WCAA 4LYQA 2O9RA 2W67A 4HA4A 4J7RA 1LWHA 2WHKA 1H3GA 2Y4SA 2CXGA 3FAWA 2CBIA 4KRTA 5LA0A 4HMEA 2XSBA 4PMXA 1OT2A 2YLLA 4QFUA 5I2UA 4XUYA 1VFUA 2W61A 5DT7A 1ITXA 2WMIB 3CUJA 2NW0A 3AS1A 5TD4A 4UQBA 1UR4A 4W8AA 2PC8A 1ITCA 1VFMA 5IHRA 3CIVA 1Q6DA 4CN1A 2VVNA 1BSIA 3AXHA 1J0YA 4JFWA 1W1TA 1J10A 1Y7VA 1UKOA 3SUVA 3AS2A 5EB8A 3GNRA 1MQPA 2WMIA 1KBBA 3VMOA 2Y8KA 3NCOA 4JL2A 3WNLA 2VT0A 2WVVB 1C7TA 5D9NA 4TX6A 1E3XA 4CCEA 1E72M 2ZXQA 2BY2A 1WDQA 4HP5A 1UR0A 4OOUA 3AIRA 3CZGA 5CZKA 1UD8A 5BROA 2WNWA 2WYSA 1BG9A 3UG5A 4GQQA 3FW6A 4K68A 3W26A 3MMWA 2G8ZA 4Q7NA 5C70A 2CCRA 1X6LA 2QPUA 4U2YA 4YHGA 5A94A 2O9PA 3VGDA 1WZMA 1FFQA 1PJ9A 2WVVA 3WQ6A 1J0JA 1QNOA 2VJXA 3WBAA 4LPCA 1CTNA 4CU8A 1B90A 2OWWA 1DWJM 1JDAA 2VRKA 4PMDA 3N12A 1C8QA 5JBFA 1A3HA 1J0HA 2XVPA 5FD0A 2QLYA 3L4VA 3NUKA 1H4PA 2CEQA 1DP0A 3GH5A 2BVTA 3BCFA 4J3WA 1HN1A 5CLTA 3VX0A 1AQ0A 3EDFA 3N18A 2V3FA 1WZAA 2XHYA 4OBRA 3MU7A 2E9LA 2WK2A 5HNNA 4RE2A 1I1WA 3BSGA 4KH2A 2XGBA 3SUTA 1GOQA 1HXJA 3WL1A 4XV0A 1E43A 2GDVA 3WH5A 1BLIA 4TOQA 1CGTA 2EPMX 1X1NA 4AZGA 1W3KA 3WF2A 3T2PA 3W28A 2FHCA 4AC1X 4DWSB 2AMGA 5D8ZA 4H8VA 3ZR5A 4CGTA 3A4XA 1GW1A 3AIWA 4W89A 3UCQA 1HVXA 1W32A 5A3HA 4W5ZA 2Y24A 1XH1A 5EFDA 5DFAA 3AS3A 3WY1A 1E6QM 4XB3A 1ISWA 2EPKX 3ZOAA 4KRUA 1XCWA 3RM4A 3VMPA 1QNQA 4DWSA 8A3HA 2D2OA 4M80A 3VM5A 1G94A 1HJQA 2PWEA 5D9PA 3N11A 1JDDA 2F8QA 2F2HA 3E1F1 1UR1A 1US2A 4RE4A 4P8XA 4RL3A 3WH9A 3W29A 3N13A 3VVGA 2G3JA 2JIEA 4GIAA 4AWEA 4CU7A 1I1XA 1PX4A 3CH9A 3VDCA 1BYAA 2W92A 3DC0A 2VZUA 2ZX9A 4P8WA 3GBDA 2VZVA 1EA9C 4KWUA 1NARA 2VO5A 1OT1A 2WSPA 1KXTA 1QI0A 3MANA 4TUFA 4P8VA 1JYVA 4IPLA 1V3KA 3CGTA 3AISA 5CLWA 5IHSA 3MV11 5M3WA 1XH0A 3IAQA 4UZSA 1J9YA 4E8DA 2D3NA 5CSUA 4DWSC 2XJ7A 2WZHA 2CESA 5AC5A 3QGVA 1FHDA 2GVYA 3L4UA 4GZIA 1E71M 1JXJA 3GH7A 2WHMA 3DHUA 5IFTA 1CXIA 1W9UA 2CHOA 3WDJA 3ZSTA 3VD4A 3DHPA 4RE3A 1V08A 1SMAA 3TONA 1NOFA 5E6ZA 5A2BA 3QOKA 4M1RA 4TTGA 1H0GA 3ARPA 2CERA 4WIWA 3DECA 1GVYA 1V6UA 1CENA 1W3HA 2CIPA 3ZT6A 4JFVA 4JKKA 1VENA 5FKYA 3KE0A 7TAAA 3EDJA 1UKTA 4HA3A 1HKIA 2WLYA 4CVUA 1CGYA 2BXZA 3ARXA 3WD1A 1JDCA 5CPSA 2J8GA 2A3CA 3RJXA 1ZB5A 3IJ9A 1V0MA 3NSXA 1XSJA 3MV01 3F5KA 1WDRA 5A1AA 4PMNA 3WF1A 2JF6A 2DPEA 1QBAA 3AICA 5GNZA 2QF8A 3L4WA 1CXFA 4CD4A 4P7RA 4BQ4A 2XIIA 1C90A 3OGSA 2D0GA 3KEHA 2DSWA 2DSUA 2DT3A 1TZ7A 1BYCA 4JCMA 5I77A 1ZBKA 3B9EA 1KCLA 3K8LA 2HISA 4OOZA 4QAWA 1WCGA 3A3HA 3U5YA 1M04A 2FDMA 3A4WA 5CGTA 1GQIA 3PZ9A 2WAGA 1GUVA 4N42A 3WSUA 4AZHA 3VGBA 3W37A 4JHZA 3W6LA 4X9YA 3RM8A 4CD7A 3M46A 5E6YA 2XGIA 1UD4A 3CBWA 4UQEA 3RDKA 1R7AA 1OWQA 5HPOA 4HZ7A 2D1ZA 2XYLA 1C3FA 4WKHA 1JAEA 3LMYA 3SCVA 4NI3A 4UFJA 2A3BA 3GXIA 3UG3A 2HVMA 4L4OA 2X1IA 5AC4A 1VIWA 1HJSA 3W53A 2RGLA 3AMLA 5EMYA 3RPMA 1QI4A 4CD5A 4EK7A 3VD9A 1UA7A 2ZUWA 3VGGA 2WMJA 1UWRA 4BQ5A 3WNNA 4HU8A 1W9DM 4DM2A 1HKJA 2XWDA 5LYRA 4A3HA 4PMOA 4QLJA 1VJSA 4AEEA 3VMNA 1JF5A 1V6VA 1WDSA 1HP5A 2CPUA 2BFGA 2XWEA 1UWQA 3M7SA 4WSJA 1QNRA 5BXTA 1H49A 4E2OA 2OSYA 1LL7A 2CYGA 3WFZA 4R5EA 1XV8A 1ECEA 3DYMA 3SIMA 3RMEA 1UH2A 4X0NA 2W4XA 1UKPA 2WVUA 3UR7A 1XC6A 4PMVA 3VO0A 3BSHA 4MNLA 1E4IA 4M82A 4D6DA 4AZ5A 2W66A 3MO4A 4FF5A 1JZ4A 6CGTA 4PN2A 5DF0A 3I3EA 2CBVA 4QP0A 2ZUTA 1JZ6A 4GPNA 3VNYA 2YBTA 4E8CA 3KZSA 5M03A 1UOKA 3VGFA 2CITA 4UFIA 4CN6A 2Y2WA 2QPSA 1HF6A 3L4XA 2YA2A 3OGVA 2PWDA 3S2CA 2VNCA 4PMQA 1E9LA 3WH8A 3UR8A 1W2VA 5HPCA 1HL9A 2YJQA 4PUEA 1KXVA 1FH8A 2VR5A 4W7VA 4C7FA 1KWGA 1L8NA 1LL4A 2YL8A 4EAMA
chains in the Genus database with same CATH superfamily
1KFCA 3MHUA 2OYLA 2YB4A 3KS5A 2DGAA 3CV7A 3PSVA 2G3FA 3UI4A 3VAWA 2OZ0A 3G6LA 4R0XA 4D6HA 1IT7A 3BAJA 1QNPA 4GD0A 3N2TA 3AIEA 4KEVA 2F6KA 4PUDA 1ISXA 5DEZA 5D04C 1A5NC 4LRTA 1G0CA 4B2DA 3LUTA 4IX0A 1KFWA 3TOPA 1XBZA 1V6XA 4ADSA 4Q22A 1U5JA 3HPFA 3BK0A 1FP8A 3M41A 3PTMA 3BW4A 1FKFA 1CZ1A 4QE4A 2GK1A 4U4MA 1FJDA 3KOWA 2VZTA 3UI6A 1TVPA 5FF4A 4WDUA 2ZZ5A 3MSGA 3PZTA 3GY1A 1F3XA 4KESA 3BOXA 3B8UA 1FD9A 1UUQA 4P2VA 3VKBA 4Y9OA 3AMDA 3BAWA 1OFPA 2DJXA 3S1VA 3EAUA 4G5DA 2LJ4A 4ZTXA 5G5IA 4TW8A 4O14A 1S2CA 2R94A 1JPKA 3ZJ7A 2ZYFA 4K8HA 5F4SA 5GPRA 2NX3A 1UP3A 5AHMA 3IVSA 4AY8A 1XICA 2JALA 4ADUA 2A7NA 4GGHA 3AUJA 3N9SA 3VOCA 4AVNA 4NZFA 2HS8A 4FXJA 4ZQPA 1RQHA 3LY0A 4EE9A 3DC8A 1JNSA 4ILSA 4UNLA 4GUGA 1KCZA 3TKFA 2XM1A 3VZXA 2P1FA 3ES7A 3T07A 3CZKA 4FK9A 3LV5A 4M51A 4LBUA 3PFRA 4A3QA 1NF0A 1GYLA 4LY8A 3C0JA 4DWSD 2PDMA 1BKSA 4Z2GA 2EPLX 3GPKA 4JTIA 2YDAA 4H8NA 5IFPA 4S3CA 3NYDA 4RKAA 2O9OA 4D8ZA 3VX1A 1B3VA 2FH6A 1J2WA 3LTYA 4AH7A 1QVBA 5A95A 1Z3NA 3W7DA 4GO8A 1HGWA 3WNMA 4IOTA 1WP6A 3OBAA 4NAEA 4BI6A 3QLLA 3O5PA 2W91A 3MYOA 1YTEA 3LI1A 1JCXA 1V5XA 1MYRA 3M44A 1GZ1A 1T99A 2KI3A 2XM2A 4MIMA 1POJA 3KRSA 1I75A 3QZ6A 1K3UA 4JDYA 3CZJA 3LSBA 4GZ7A 3T2QA 2BSLA 1LF1A 4ZQRA 3T4CA 1F2JA 3W7QA 3ARSA 4M1BA 2PPPA 2PWGA 3KP1A 3TTQA 4D6FA 3W85A 2I14A 5DO8A 1PBKA 5E0FA 4PB3A 4PFHA 1IGWA 4LUSA 1UH4A 3WQPA 1UR2A 4L4LA 1R6WA 3K46A 4H04A 4HHMA 4ZQMA 3USBA 3DAQA 1YXDA 4RCXA 3T8LA 3ZMRA 2C71A 3SCOA 3VM7A 1EL3A 1E73M 5D75A 4H8UA 2PRLA 3UWQA 3ZVHB 3TN4A 4DRIA 4QXIA 4UDMA 3UQIA 1SJDA 3VIGA 1LCOA 4H4IA 1H50A 3DFPA 1TV3A 5F2GA 3GR4A 5TNVA 3NWRA 1VEOA 2ACUA 2PDCA 1T8QA 1N1AA 4O54A 4E2VA 4H9VA 3GB6A 2YL9A 4V2XA 3B8SA 1UWAA 3H4WA 4C6LA 5BXJA 3FHQA 1Z8AA 4HCHA 3MP5A 2YXOA 4D8AA 1XSKA 1ZBWA 3HJEA 1K6WA 2GUBA 4MB4A 1F07A 1UH3A 1M41A 2GVEA 1ODZA 3ZSSA 4LAXA 1V6YA 3T7VA 1PZ2A 3OBKA 3EWYA 3SCSA 1Z89A 2FZMA 3UXIA 2Z29A 3LXCA 2Z1BA 3POCA 1ZL1A 1QK2A 2DZWA 3OA5A 1RBOB 2EG8A 4DUXA 3AOFA 5GNYA 3A5FA 4Z0JA 4KBXA 3KRZA 3S2NA 1KW1A 4CEUC 2WQPA 1SVDA 4FX8A 5I06A 1ZCNA 1ZJIA 1GGOA 4AAJA 1XF0A 1BYBA 3KUMA 4TVUA 1KR1A 3IPWA 4XZWA 1XYMA 4IQDA 2Z1KA 1K9FA 1GKRA 5K9CA 4YCOA 3APYA 2BXYA 2HNEA 2OG9A 3PHAA 4PL1A 3M16A 4RDYA 4NJJA 1F76A 2DQWA 2X0YA 2J7FA 3VDHA 1M5YA 1QAPA 3S42A 1YMYA 2FMNA 4JTHA 1W6TA 4LFYA 3KADA 4DPQA 5AZ0A 3UPBA 4AIEA 2QPXA 3RFWA 3MS8A 2DDXA 1U1JA 3FOKA 4CCDA 2VFIA 8XIAA 4UMBA 2R8WA 1VYSX 4LBRA 4H2HA 1OGGA 1FY6A 1R38A 4DRSA 2V2HA 1Q6FA 1W26A 4GK8A 5T26A 5C54A 1TCOC 1PIGA 4LCRA 4DLFA 1JDFA 2F7FA 1XX1A 4BF8A 1O66A 1EP1A 4PL2A 3U2ZA 4B3LA 3BLLA 3LGDA 2ZBTA 2X09A 2X05A 4KCTA 3MTWA 3WD0A 3PWIA 3DX5A 1FWCC 1LRQA 2NSOA 2VX4A 1G69A 3C2FA 2ZRYA 4PE8A 1TWSA 2WCGA 1HIZA 4QHRA 1F8IA 1PB0A 3EOEA 3INPA 1E0XA 3O2LA 3HQ1A 1JPMA 3W7MA 3WMLA 1B3ZA 3S1UA 4LX4A 1N55A 4TU1A 4U85A 3DEQA 3HMCA 4DJEC 3O5MA 4IJBA 2WOQA 2PGWA 3HFYA 1K8YA 3E3HA 1W1VA 4HNCA 4CD8A 5C5YA 1JZ8A 1KLYA 4Q8UA 4JTEA 2QDHA 2EPNA 4S3BA 3R79A 1W17A 3O5EA 4B2DD 4POCA 1QI5A 1PUDA 4JFMA 4ZL1A 1J5SA 1YTDA 1QHOA 4JXCA 3I3DA 1IT0A 4FNRA 4D71A 4I5RA 5E09A 3STFA 5DIUA 4W8LA 5HNTA 1Q7ZA 3SN0A 1ZNNA 5FEWA 2F6XA 4O53A 2B7PA 3DDMA 4P5UA 3UGRA 1SM9A 1TELA 1MMFA 3TFXA 4RDZA 3UQNA 4Z2JA 1AVAA 3HGRA 4BI5A 4H7ZA 4ZXOA 2C7FA 3CO8A 3ARQA 3AALA 3NQMA 4HHPA 1EZWA 4WKAA 3ZR4A 4X0VA 1A5BA 3O5GA 2AQOA 3ZM8A 2INEA 2I16A 1B9BA 1HJWA 4EP8C 2FDSA 2PV1A 3CHVA 7XIMA 1BPLB 2RUSA 3UZJA 5CH9A 1UZHA 2DZBA 2IKHA 1I4NA 1JD7A 4EPDC 1GHRA 3SUWA 2FGBA 2G0WA 1N8WA 3VUPA 3IJQA 2POTA 1BG4A 3Q58A 3WDIA 4EVZA 1P5QA 5ABHA 2RHGA 1QI3A 2BVYA 5DMYA 4HHLA 3DENA 3NOYA 2OWXA 2XH0A 3ENLA 2A6NA 2VM8A 2DG4A 1KTBA 3CZLA 2D22A 1W3IA 3EX3A 1W3LA 3KRUA 5HANA 1C8VA 4DF0A 4NZ3A 2XN2A 3FYYA 1CBGA 2Y70A 3GG0A 1ODUA 3EXRA 5AHNA 3AIQA 3FNDA 1M68A 3BE7A 2AL2A 1FHUA 4QT2A 3ABSA 3P0WA 2BLEA 1K7EA 3F4NA 1UA3A 4WDTA 2AOSA 1ZBCA 1AA1B 4FR6A 4L80A 1E6NA 3GFYA 4HNTA 1FWGC 3RILA 4IPXA 3MSRA 1FUYA 3UETA 1R3TA 1ICQA 1O68A 4G56A 4R7WA 1KGWA 2EEXA 1XDJA 2VP8A 1KTCA 1XDLA 4Y7EA 2QJHA 3VNDA 3TSMA 4PB5A 4LUTB 3E12A 5E70A 3U48A 2HQAA 4AQLA 1TWZA 3B06A 4AF0B 3ZO9A 1TJRA 2RUDA 4TVCA 3TCSA 5REQA 1EX5A 2NZLA 1V3LA 5K4XA 4Y9AA 2PTYA 1SGJA 3AHTA 1UD3A 1P43A 2JE8A 3QBUA 1E4LA 2DSKA 4BHYA 3B8DA 3A5VA 1SZFA 1UC5A 3IEBA 4UTJA 1AMKA 3LLXA 4KGJA 3GNNA 4WD0A 2V0TA 1FCVA 1ITUA 1IEXA 4Q4RA 3W81A 3B97A 2Z27A 1CYGA 1PZ3A 2WSYA 3AYSA 2VGGA 3P74A 5HMSA 4ACZA 3GNOA 3THDA 5CG0A 3TYDA 2XPKA 2C16A 1DQXA 3S3GA 4AHQA 4YU1A 2VFGA 2BNJA 4G2DA 4LQ1A 3WDHA 1BXNA 3UJEA 3S0CA 3WENA 5F4WA 5A8MA 1VPQA 3UWUA 4M6PA 1NAL1 4JTSA 1MUMA 2O7SA 3W1XA 2WVSA 4F8XA 3HZ3A 4XAGA 1IZJA 2VRQA 1K6AA 2FPYA 3S47A 2QJJA 1FKLA 3WQ4A 3W7RA 7PTDA 5DQPA 1XYBA 2C8NA 2UY4A 4IQCA 3SSJA 3CL7A 2Z1SA 1BGAA 3SQSA 1DHPA 1ISVA 4KQZA 3BGJA 4G1KA 1J4IA 1P6WA 3MUY1 4PUMA 4GYPC 3RRXA 3PZIA 1FRBA 4YTUA 4D9PA 2KZHA 1TV7A 4HYWA 1XH2A 2OZ3A 4L9XA 3CMFA 4G2PA 3MDWA 4DB7A 1OCBA 2XTKA 1OBAA 3L68A 1G4PA 1RCOB 2DT2A 1TPC1 1EZ2A 2ZDSA 1FKGA 4ZQNA 5TQLA 1X1ZA 1OZQA 5EBUA 3W7GA 3GWQA 2GQ9A 1FWJC 3ARZA 2I56A 1CLXA 2RJGA 5JUVA 5DCBA 2XPBA 4Y6GA 4XX6A 4M6QA 3DKLA 4QM1A 1LUCB 4DPPA 1GZJA 2DU2A 5DMMA 3IS4A 2D2GA 5IOBA 3R8RA 3LXAA 1AZ1A 3BMBA 3UR5A 3I7SA 1Q6GA 1E40A 3BOFA 4P7QA 3II1A 1IHIA 5M1TA 1V8EA 1AZ2A 5LNWA 2A7PA 1EYMA 1M7OA 3AROA 4O50A 3F1QA 3QPYA 2WV8A 3SCUA 3BOLA 3WQ5A 3IKDA 2WB5A 1W1A1 3CUGA 3N73A 3SBFA 3O9NA 4IISA 4YPJA 3S46A 2GWGA 3NL3A 1R87A 3MMDA 2BY0A 2J7EA 1FWNA 1UG6A 2K8IA 1W37A 4UFKA 1FWHC 3L7RA 1DWAM 2Q5AA 4HK5A 5D9OA 4J27A 4HYRA 4WDWA 2J66A 5FI8A 5GVJA 2FKPA 1KM0A 1OK6A 5MF5A 4GC4A 2YYUA 5GJMA 4D2JA 3V7PA 3O6YX 4FPSA 4L1XA 2EXOA 4LRSA 4XTDA 4US5A 5H8PA 4GKTA 4JN7A 3DFTA 4Z2HA 1RAKA 2Z25A 3OQEA 1UUMA 5G4EA 2ZUMA 3M47A 4O2TA 1R3SA 1UMLA 2XIOA 1Y0EA 3U5UA 2F61A 4G7EB 4N9BA 3GM8A 3LB0A 5FF0A 1P6BA 2D2HA 4P7OA 2DZVA 2J7HA 2FYMA 3IJDA 4WJ8A 2P50A 4WOZA 4AX7A 1SU5A 2B7OA 3SY5A 2CZDA 2QCDB 1W9XA 3UVIA 5C55A 4DN1A 2V5JA 4AWTA 3KCEA 2QV4A 4MJ4A 4IIDA 5B80A 4MLJA 4UC5A 1TPWA 4D1IA 1X38A 3BGAA 2CLKA 2OSWA 1OIMA 2TMDA 3S6OA 3HQPA 1HJUA 5A2CA 3BC9A 3NZQA 3T05A 3AHYA 5CBBA 4P7LA 1NM9A 2C79A 4MSSA 4MFEA 5HWBA 3LPOA 5IM51 1FDJA 2DQXA 4GUFA 1UPPA 4H7VA 4CNTA 1L6SA 4D6JA 1ROUA 3GU1A 3VKKA 4IP5A 1GHSA 1O1ZA 3UERA 1C92A 3EWUA 4UTFA 2ZTKA 3RGCA 5K3VA 1IXQA 4S39A 1TIMA 1CPUA 1UZ4A 2PDPA 4DXVA 5BZAA 1CIUA 3AI0A 2IKIA 3QOMA 3DOPA 2QAPA 3W86A 4MG4A 4J28A 2FHFA 4LT9A 1OYBA 5A6JA 2R14A 2XIQA 2ZZ4A 4JYEA 1R2TA 2QUUA 3GW0A 3D6NA 1C93A 1L8PA 5FJOA 1GG0A 3SCWA 1J01A 2YA0A 1XD0A 4B3KA 1FH7A 1Z44A 1E0WA 1Y65A 3FA4A 4HTYA 1QTWA 1S1PA 4XKMA 4XZIA 4E38A 5CSYA 2QUNA 2QULA 3PZOA 1XLBA 3W27A 5JH1A 4LYKA 5RUBA 4GG9A 4AZ7A 5A8OA 3W38A 5AYYA 4WSHA 4DBUA 4K3ZA 3P3BA 1V3IA 2OX1A 1C91A 4BI7A 1GT8A 3VIKA 3MSDA 4KFNA 4I9TA 3BG9A 2ZRWA 5FCZA 2DH3A 2VN1A 4J3SA 4ZSUA 2ASHA 1AW5A 3HG4A 1K9DA 2ZUNA 5C2GA 3M0KA 3GTFA 3WF0A 1E4MM 3B9NA 3ZIZA 1QOQA 5C7VA 4NRRA 4JICA 3GFZA 3CAKA 1TUXA 3G77A 2E1WA 4YLWA 3A24A 3THCA 4QIUA 3KCOA 2GUYA 1ESWA 2PI6A 4NYUA 2WBKA 2HROA 4JNMA 2UY3A 5LHEA 4GE8A 2VHLA 4GZJA 1Q6IA 2GJPA 4NVTA 1D3GA 1WUEA 3WQWA 3TW6A 3R6IA 4HZ6A 3O5OA 4D72A 3SURA 3BCDA 1S39A 3AHVA 2P3EA 4AX6A 5FEPA 2XPAA 1D2KA 1RLDA 2E3ZA 3P0XA 3OO2A 2X1SA 3WUFA 3RLUA 4TW7A 4KEZA 4AC7C 1N8FA 1U79A 3B4UA 4YIWA 4FA3A 3CV1A 2Q8ZA 3LXBA 4QNEA 5A6SA 1TTIA 4CU6A 1J0ZA 4C6CA 3OG2A 2F4EA 2I5GA 4F9DA 1VAHA 2A3AA 3U7BA 3PTQA 4LAWA 1PXGA 3PR9A 4FMVA 3TTEA 1KM2A 3FAXA 1NQKA 3IVUA 3G8EA 5H8MA 1O5RA 4C6PA 5J6EA 4ZBCA 4A2RA 1JNTA 1WKYA 1RQBA 3SFKA 3LPPA 1NOUA 4KWSA 1PBGA 4LAZA 4JFTA 5FL1A 4MJ2A 4ODMA 2QNEA 2WXDM 1DBTA 4NX5A 4OZOA 4WUIA 4ZOAA 1JPIA 4XZ9A 1W56A 1G9HA 4I9JA 1F3WA 3GE7A 1VCGA 3HV9A 3HQOA 1KBJA 1F3EA 2B0MA 4NU7A 1M03A 1DXFA 3B4YA 4QRNA 4XO6A 1L9WA 1QNSA 1V0KA 4DF1A 3V4BA 1H7XA 3SAZA 1HUVA 3RJYA 2PPNA 3APGA 5FACA 1HNYA 4IM4A 4HSNA 2MNRA 2PGEA 2X42A 3R2GA 1TPDA 3L65A 1TV8A 1L6WA 1CECA 2F21A 5AHFA 2VQUA 3BAIA 2W5FA 3BARA 3C2VA 1CXLA 1JF6A 3KHJA 3ONBA 1JCMP 4JNZA 3ANUA 1FX6A 1LWJA 1ELSA 4GBUA 3F7JA 3WLPA 1JD9A 4F0LA 3IIPA 4J3ZA 3WD2A 4U2ZA 3FY1A 5C9WA 2W67A 4JYDA 3P81A 1TWDA 5HW7A 4REQA 4US5D 3O5FA 3M0VA 2W6RA 2V2DA 3FGCB 4O52A 2YLLA 1MNSA 1OEPA 4QFUA 1CW2A 2A3LA 4FXFA 3KOYA 3WO8A 3IGSA 1AD4A 2WMIB 3GU0A 1KKRA 4H6RA 4RNFA 3TVAA 1RHCA 4W8AA 5IHRA 1Q6DA 2FTPA 1J10A 2RKXA 3AS2A 3MHFA 5EB8A 5MKGB 3GNRA 2QIWA 3BPWA 4JX4A 4LAOA 5I00A 2GYIA 1DJIA 4A8LA 2Y8KA 3GKFA 4C6EA 4JL2A 2ZTJA 1H51A 2VT0A 2WVVB 1C7TA 4TX6A 4LBSA 1IEQA 4ADTA 2E67A 1R46A 4HP5A 1BVWA 4X22A 3NXLA 2W0UA 1G4TA 3UG5A 2FFIA 3UY7A 4TYOA 1I0DA 3PWGA 1S3TC 1JCTA 3LHVA 3MMWA 1XRSA 3W26A 4CQBA 3OODA 5D2VA 4S3DA 2CCRA 2PA6A 3HJZA 5A94A 4INFA 1PJ9A 2PF8A 4K37A 1J0JA 5DBTA 1MO0A 3SJNA 4I6KA 1YPIA 1CTNA 4CU8A 2R1LA 3BTNA 3RRAA 4DRPA 4YTSA 1H7OA 1LBLA 4H83A 3GXTA 3IVTA 2A4AA 5FD0A 2QLYA 4C90A 4X60A 1Z41A 1DP0A 3KAIA 2BVTA 3W7NA 1IYXA 4NXSA 3URNA 5E0KA 2DW6A 2JK2A 3RU6A 3N18A 2V3FA 4WR3A 3LHZA 2DORA 2AKZA 3MU7A 3QQ0A 2E9LA 2WK2A 3RITA 4RE2A 2XGBA 1GOQA 3R0DA 4XV0A 3W7CA 2Z2UA 4QDWA 4UR7A 4UXDA 3WH5A 4EPKA 1TV5A 4JS3A 3QMRA 3W7OA 3LRMA 2X0SA 4AZGA 1RVGA 4H00A 5J5DA 3T2PA 1ICSA 4F0HA 9XIAA 5DBUA 4ITZA 3IUHA 1SZRA 4Q8VA 4DNHA 3NPWA 4GFIA 1P0EA 1GW1A 3AIWA 3PBVA 1HVXA 1W32A 1UOZA 4W5ZA 1EEPA 1LOSA 3E5PA 3P80A 5TBOA 1JDEA 3UWVA 4KRUA 3PVFA 1XCWA 3FCPA 4S3FA 3RM4A 4H19A 3R58A 3CPGA 3O5IA 1R9HA 4DRJA 2FPTA 4JEQA 2V8ZA 1QPOA 3E1F1 4P8XA 1XLAA 2VXNA 4CU7A 1PX4A 3VDCA 2W92A 5K9DA 5C2CA 4FAMA 1QK0A 3W1NA 3KBJA 4KWUA 2NQJA 1NARA 3B40A 4W9TA 4AUBA 1KXTA 1QI0A 3LM7A 2V6AA 2JKPA 4JN6A 1BXCA 3CGTA 2GUUA 4GIEA 5CLWA 3MV11 1XH0A 4GNKB 1O94A 1RV8A 4WY0A 2ZR6A 2XJ7A 4HYVA 1KT1A 3WQOA 2CESA 3CTLA 1E51A 4GZIA 3L4UA 3XISA 4KPLA 3N9RA 2P5NA 1Q1CA 2V68A 1NDVA 2CHOA 3WDJA 2F2DA 2NUYA 4RE3A 1V08A 3TONA 2A21A 3FVDA 5E6ZA 2ZKMX 2FZ9A 4WIWA 2D2JA 1W3HA 3W7IA 3TV8A 3W22A 4JFVA 4ZOCA 4J5NA 4FOJA 4DYEA 1FKXA 2NX9A 2WLYA 1CGYA 2YCLB 3DG6A 3WLQA 1AUSL 1JCLA 2W79A 3BJTA 2A3CA 3RJXA 2XFWA 2HS6A 3OOQA 5CC6A 4PMNA 5A6TC 3WF1A 3TJXA 3P67A 5JVLA 5LIKX 3BO9A 2QF8A 1VS1A 2V63A 3L4WA 4MPQA 1CXFA 3R5EA 3L2IA 5CPMA 4E4UA 5F1VA 1NU5A 4F48A 2FFCA 3S2LA 3KEHA 2A0NA 4I9MA 3I65A 3QSRA 1BYCA 5I77A 3B9EA 1KCLA 2HISA 1IR2A 7TIMA 4NQ1A 2FDMA 1R2SA 4N42A 1J96A 4O8RA 3W37A 3PRBA 2H9AA 2HBVA 4IIBA 4G9PA 2HK1A 3BVJA 2PUZA 3SN1A 4UQEA 3CBWA 3O0KA 1R7AA 1XM3A 4OTKA 2DFAA 4DJFD 1G4EA 1H60A 4K1GA 3C3NA 1UROA 2QEZA 2X1TA 1V6TA 2XYLA 4GC3A 4XD6A 1ROTA 3EB2A 3ITXA 4UFJA 2A3BA 1OFOA 3UG3A 5I3HA 2HVMA 2TSYA 4L4OA 5BOOA 2HBXA 1VIWA 2E1DA 1ZJHA 3AMLA 3SI9A 1W31A 4IGSA 5FSEC 1QPLA 2DUXA 1D7JA 1UW9A 3QY7A 1Z42A 4UTMA 2HVOA 1V7AA 4RV8A 3N25A 2A7RA 2ZUWA 3N4AA 3UCDA 3WK0A 4DM2A 4JX6A 4RZ5A 4CNOA 1JRCA 4AEEA 1A5AA 4K8EA 2CPUA 3NVTA 3AWOA 4PUKA 4AWSA 2PDLA 4Q4KA 4HA0A 4PEKA 2MNTA 1ECEA 1VYPX 5LNVA 2QCLA 2YW4A 5J04A 1GKQA 1H1ZA 2C3ZA 4IIGA 2WVUA 4U84A 1TTJA 3VO0A 4ZB5A 3W2UA 1OFRA 4XTIA 9XIMA 1N8IA 1CB2A 4M82A 3MO4A 4CQCA 5H6HA 4G1NA 1YLVA 4WJEA 5EPDA 1XDMA 4OV9A 3I4KA 2ZUTA 3TFCA 3VNYA 4E8CA 3KZSA 2Q8LA 2ZZ1A 3RF9A 4YYCA 3VKJA 3B0VC 1QFEA 1TSIA 2ICSA 3T8QA 4H9YA 3VGFA 3U3HA 3LNMA 5EL1A 3AYVA 1U1UA 3L4XA 4F40A 1EWDA 3UR8A 3W2LA 4PUEA 3GAYA 1SSGA 1KXVA 3MZ2A 4Q8QA 2E6FA 2QS8A 3GNXA 4HK7A 1TQXA 2XH2A 1W5MA 3W7HA 5FF7A 2Z2AA 3TA9A 2Q3RA 3WLMA 4HB7A 5AECA 2W3ZA 4PEEA 4B5WA 2WMFA 4RV3A 4UTLA 1TPB1 3WJSA 1P7TB 4LEQA 1XINA 1FKJA 2NUWA 1REQB 3UWYA 1PWMA 1MEWA 3H23A 4PH6A 1RZMA 4Q33A 3R1ZA 4ZE4A 1TMQA 1ZJBA 3FJ4A 1T8XA 3KOFA 4Y90A 1JZ2A 2WW5A 2OFJA 1HL2A 2MANA 1BRLA 4PCNA 3MVTA 1OADA 3A64A 3CAQA 3W76A 1OIFA 2VL4A 1ME9A 3DKJA 5I07A 3NQ8A 5KETA 1XFBA 3CMGA 2WNQA 2WPBA 5BOFA 1AQHA 2QAFA 1MRAA 4BZYA 3I7QA 2J77A 3L9CA 5LA1A 4PFMA 4S3JA 1ADDA 2FVLA 1UASA 3REQB 1S2AA 4DAIA 1E55A 5DMNA 3CUHA 4PTVA 4F0SA 3IRDA 4UQCA 1TO3A 1A4LA 2AQVA 2WZEA 1TREA 4XZHA 3VCCA 3W74A 3TU9A 1EO5A 5KITA 1I8JA 4TV5A 1XHGA 4GX8A 3GNPA 4DJDD 4C60A 3OOBA 3W2KA 4J3VA 2V9DA 3KTSA 4ATDA 3QC3A 4C7DA 3STPA 5DANA 2C19A 3UPWA 3N14A 4AXKA 3GIPA 7ENLA 2QIIA 1WOAA 4DEFA 1PCWA 4O17A 2YKKA 4NIRA 1FA2A 1I45A 1NP2A 3CV6A 2YLAA 4AIBA 4DUVA 2IPWA 1KD0A 1OYAA 4JHOA 3FKRA 4HZMA 3H2EA 3XIMA 4WVXA 3BURA 2TODA 3LRLA 5ECVA 3V36A 3WDPP 3PTDA 3M07A 3WLJA 2Q01A 1KM3A 1VBUA 4Q4SA 3A12A 3JVAA 1FDZA 2DVUA 4IJRA 2PV3A 1SR0A 3O63A 1R3RA 3RPTA 4JFLA 1WPCA 3VCRA 1FVPA 2I7GA 1MW1A 4K8GA 4GIVA 2VR4A 3K2GA 3OIHA 3WK2A 1TX2A 1U5VA 1W9PA 4JKLA 3W82A 3I3BA 1P1XA 1SR9A 4NHVA 2C0HA 5I5RA 3FJLA 3JZUA 3G24A 4TMBA 4UTWC 4QEEA 2C1HA 1HT6A 2P53A 2YFOA 3T44A 4C5YA 3W0KA 4HNVA 5ABGA 1JCNA 3UY8A 1WNOA 2VELA 2IUZA 4QG9A 1VFFA 1OD0A 3NL5A 5BW6A 2VDIA 1VRXA 1F40A 3FA3A 3THQA 4HPHA 1U30A 1EJUC 5CPTA 3O0FA 4O57A 1T40A 2VOTA 4LVAA 5LXXA 4HGXA 3BGGA 2OKOA 3WUEA 2Z4GA 3G1AA 4IFOA 1O7AA 3BCJA 1RA0A 2D24A 4A8RA 1JI2A 4AY7A 4D6IA 2P88A 3FJNA 4JTRA 1U1HA 4XZMX 1G1YA 4L56A 5AYIA 3MUIA 3R0KA 1XBYA 3VNIA 2CLFA 2WPGA 1JUKA 3DERA 3V0SA 3MHGA 1H0IA 1CGWA 3W2JA 4WKFA 3GX9A 3USZA 3HGOA 3VIOA 4AD4A 4N6FA 1PS9A 1W91A 3CH0A 1W54A 3TYCA 5F7UA 3W25A 1JI1A 2GOUA 3WQDA 3UXDA 5DLCA 4M6UA 4GUJA 3CZ8A 1SPQA 1BTMA 5I6SA 3UF9A 4QJ5B 3PJWA 4X2RA 1J6PA 1XD1A 3CQKA 4L65A 4MSPA 4C1KA 3LI0A 1B2YA 4MGVA 5AN7A 4Z42C 2DIKA 3NVDA 3NM3A 2FAPA 3CUIA 2W62A 5DT5A 1V3HA 4IMCA 4MB1A 4MDOA 4PRTA 2XIBA 1GK8A 1HXVA 2CKRA 3UZXA 3AZRA 4XAPA 3OB8A 2NQHA 3WN6A 1Z48A 3M43A 1V0LA 5C2XA 1XUZA 3ANVA 3N4FA 1LBFA 1BKHA 5EMLA 3DI0A 4HOWA 5CPOA 1P5BA 1D6OA 4NNBA 3ME3A 3THAA 1XYLA 4YS1A 1GPFA 3GD6A 3H7RA 1NJJA 1UYQA 1BQCA 4ZSTA 4JTCA 1QPNA 3APTA 4O1AA 3UCCA 2BTMA 3TQVA 4JBRA 4QG8A 1Z32X 3T0CA 5AFDA 1LBMA 5D30A 2QDGA 1GNXA 4W86A 1OC6A 2R24A 5C9UA 3GK0A 3DYOA 2ZXBA 4Z1AA 4JYFA 4HD5A 1N7KA 4LGXA 4EF9A 3EEZA 4U28A 3PAOA 3EDEA 2CNCA 4FR1A 1PKLA 5CGQA 1E6RA 2ACRA 1X6UA 3GVQA 4PZVA 3A4JA 1Y5VA 5HNUA 1XSIA 3H21A 1GOWA 3UQBA 1DV7A 3NFUA 3B9AA 1DPMA 4OGZA 4WY0F 2Z0IA 3QXBA 4WSKA 5BMWA 1T6MA 3FS2A 3TAKA 4PTMA 1GORA 2NXIA 1GJWA 3JUGA 2VWSA 4CQ8A 2ACSA 1UQYA 5I79A 5FOOA 1C9WA 1QU4A 2GWNA 4HKPA 3TMQA 5AZ1A 5D2WA 4RLIA 3TLQA 4GUHA 5IDIA 1I6NA 1S5VA 3W1QA 1F5ZA 3M64A 1RJPA 4KGLA 3T42A 4C6BA 3WD4A 3PRDA 4U3CA 3BW2A 4DUOA 4JY9A 2DZSA 1EJ7L 1NELA 2WQDA 3SECA 4PMRA 1JUBA 1K02A 4QE1A 4TX9A 2WC4A 3RFAA 1IE7C 6ENLA 4MTVA 3EKLA 2VQTA 4O11A 1UWTA 1E1CB 4FNUA 2ZXDA 2DUZA 2B7QA 5HR7A 1EOMA 4M7TA 1OK4A 3ALFA 2Y7FA 3LMZA 3MKKA 2HE5A 1ZENA 3WUBA 3NSMA 4WOQA 2YA1A 1A5OC 5AYXA 2HVNA 2BBFA 5E93A 4R88A 4ML4A 2YR1A 3KVMA 1LLOA 5HATA 4GY7A 4JQ1A 2ZRXA 3DG3A 1Q65A 4A3YA 5A6AA 3LDVA 1HP4A 3KXQA 5JIWA 4XISA 4YXGA 1A0CA 1AW2A 4OT7A 3GDTA 1US0A 3V1PA 4S3GA 4JCLA 3W7JA 3WDQA 5BYWA 4ZXLA 2PAJA 4GQRA 3TDFA 4ATLA 3NPVA 1Q6HA 1OCJA 4M24A 3NL2A 5AYBA 4H6KA 1ZP4A 1YPXA 2ZX7A 3VIIA 3AJ7A 2NUXA 3QN3A 3TCEA 1B3WA 4RJEA 1KFEA 3CLWA 1F4HA 4CLMA 3N2BA 1A3XA 1UR3M 4AHOA 2H6RA 4F66A 1PTDA 3CWHA 1IX5A 4LB4A 2BY1A 3E02A 3DFHA 3BLOA 5JQ9A 4IFKA 4HNOA 1NQ6A 3J7HA 4LYRA 1QPKA 3OP2A 4O1FA 3OVGA 4MZYA 1OC7A 1M3UA 3AIBA 2X8RA 3UNDA 3KLKA 3DBNA 3C3UA 2RDUA 1O5QA 4FSAA 4O1CA 2YXXA 1P0BA 4S2BA 2N87A 4YYFA 1SJBA 1QATA 4G50A 3TW9A 2ISVA 2QF7A 3IJ8A 3UU0A 1GTHA 3L0NA 3H7VA 1O1HA 3WLNA 5CC5A 2Z1VA 2WKLA 3TTSA 3TSDA 3S5YA 2VGBA 1DE6A 4UNKA 1VJIA 3QTPA 3UG4A 1Q66A 1S2WA 1WE5A 3RCYA 1BHGA 3KVLA 1TA3A 3SSZA 1FHVA 2XFFA 1PHQA 3QR0A 3VA8A 3GXDA 3HPAA 5HNRA 3KAHA 3O16A 3UJ2A 4F4RA 6PTDA 1KBLA 4FOUA 1OX4B 4J2MA 2NQLA 1JIBA 3KTCA 2JIWA 3O8AA 4EACA 3DCPA 4WXZA 3S1XA 2C1GA 3SDOA 5FL0A 3MDUA 3WJWA 4AW7A 2F23A 2WO5A 2D0HA 4XVEA 4P61A 1QPRA 4H2CA 4WJXA 2PF0A 4GNJA 1ZU8A 3VKDA 1SO4A 3GQYA 2C1IA 1BF6A 2EKGA 2RDTA 1NWTA 4EXAA 1LOQA 3BLPX 3EB3A 4IMFA 4K2SA 4GGQA 4GACA 4DRKA 2WNZA 3EWCA 1E6XM 4XK2A 5T91A 5ABEA 3SEPA 3URQA 4IG2B 1B3OA 1C8YA 1J6OA 3AU6A 1SFJA 1EUNA 4P7NA 2Z24A 5G2WA 3QSTA 1DOSA 3FA5A 3I6EA 1OF8A 7CGTA 2XSAA 1YEYA 3EWWA 2V3DA 1S38A 3QR3A 2KE0A 2E9MA 1TZ9A 5A8GA 3CJPA 3M0YA 4NY2A 4PC8A 5BRQA 1B0IA 1F05A 1FWBC 4HNNA 3LENA 4TVDA 3AHZA 1R2RA 2E7FA 1FKSA 2PDIA 3HO8A 2V81A 1YNQA 3UYCA 3GVRA 2OB3A 1DE5A 1R8LA 3WQGA 1UBPC 4DAFA 3WH7A 5KZMA 2YBVA 1VZWA 3KWXA 3IRSA 1MUWA 5HW8A 2XVNA 4IGMA 4E4PA 3EKZA 2GSJA 2J4GA 3W75A 4DELA 1X97A 2WLZA 3IJ7A 2RH9A 4E2BA 3LZ3A 4CQ9A 1H5VA 1T96A 4BF7A 4BCEA 4RW5A 1IV8A 1OJXA 4FLQA 4Z1YA 4L9ZA 3WFLA 2VRJA 5BCAA 1S2TA 1VBRA 3BLFA 1GWJA 2IQDA 1AJ0A 3QHNA 3UWZA 2CHNA 2GPTA 1KXQA 1MW2A 1T7LA 2Y7GA 1R9ZA 2AWGA 2JKAA 1HKMA 4S3KA 1RR2A 4DZAA 3W88A 3C4UA 5I3FA 2VDHA 4AMCA 1UPMB 2WWCA 4MKNA 1CEOA 3T0AA 3ZJKA 2ZCGA 4J4OA 4HNLA 2JEPA 4RZ6A 3QMTA 2FHBA 4DIAA 4LJ3A 4ZPTR 1TRIA 2QJGA 2NVCA 2IS7A 1E0VA 3DFQA 1ZZMA 3VU2A 3CGNA 1BWLA 1RD5A 2YCKX 1UKQA 4ZFMA 5L6UA 5A6BD 4RNIA 3DESA 1L6FA 4O13A 5DMLA 3QV7A 2Z6JA 3W1PA 2KGJA 3NDOA 1VBHA 3K5XA 3W02A 4JYSA 3URAA 5I23A 1FH9A 5HT1A 2Z00A 4IMDA 3W1UA 1HKVA 2OWCA 3KHDA 1UZDA 4HMNA 4IX2A 3MYPA 1EA0A 1R3YA 3FVMA 2TYSA 3NSNA 4W85A 4OBTA 3PBMA 3ABRA 5C8BB 1PSCA 5G1TA 1DJNA 3HURA 3UG8A 1EIBA 4MF4A 1CLKA 3ALGA 1DWFM 1HQTA 2F2KA 1JYWA 4W87A 1EJXC 1B4KA 2QW5A 3V75A 3W6MA 1C8XA 3MB9A 1DEDA 4WHBA 1PPIA 2BGSA 1SO5A 2IXVA 1O5XA 3N2OA 3KZPA 4U33A 3Q94A 4JIEA 5C9RA 1XW8A 1TPEA 2VEMA 1UIOA 1GEQA 1IEIA 3VGEA 4XBJA 4IGNA 2ESCA 4AIUA 4C1NB 2PDBA 4QDPA 1K03A 1H62A 3P14A 1EH9A 1OF6A 3TN3A 2YSWA 4CUCA 4QLKA 3TIMA 3KTXA 2EJAA 2RGMA 3EXSA 2E9BA 3MWCA 2C91A 6REQB 1EX1A 2AKMA 2PTDA 3WBYA 3RR1A 4KCVA 1DXEA 1W1YA 5FJTA 3NL6A 2YCJA 2EF9A 4LAVA 4UQDA 3SADA 1X1OA 3T1GA 2FH8A 1PIFA 1A0EA 1KNWA 3VKAA 2ZUSA 3KP0A 4QLLA 1G7VA 1ECQA 4PUUA 4QS5A 3WBEA 5HQMA 2WJDA 3QKEA 1PDZA 1RP9A 5I3DA 4FX6M 1J18A 2A3HA 2Y8UA 4Q8WA 2J24A 5LGXA 3KBNA 4AZCB 4M7SA 5DY3A 1OG0A 3VIHA 2GVJA 1FP9A 1ZAHA 5LA2A 3STEA 3LCFA 4W7UA 2R1MA 4EX4A 2DV0A 2OMAA 3HQNA 4UFMA 1T11A 3K8MA 4GNVA 3VGHA 2VCCA 4RZBA 3WNPA 5A8NA 3UYIA 1PCKA 2PS2A 3SGZA 5I98A 4LUIA 3TYBA 3C52A 2XFYA 1EEXA 1M1BA 5I3GA 2GGHA 1A0DA 2H3DA 4R27A 3NQDA 1T5AA 4FNQA 2WHJA 4OWGA 3AXXA 2Y5SA 3SCTA 4QAIA 4HBKA 1EXPA 3IGXA 1WV2A 5A6MA 1MQRA 4YNGA 4DLMA 2VC5A 1CXHA 1QO2A 1UIPA 2QHAA 1H7WA 1KRMA 2PRHA 2YW3A 2OELA 2QJMA 1Q6QA 3UXKA 4AD0A 4A8IA 1GQLA 2REQA 1M01A 4I5XA 2NLIA 2OSXA 1UZ1A 1EJRC 4E8GA 2Y5JA 3QHOA 4YN5A 4NKCA 3U57A 3UWEA 4XZBA 3GTYX 5CPNA 4GBDA 3ZVIA 4ZCWA 3C86A 2PDGA 1FCQA 1QWKA 3R10A 2QV5A 1OVDA 4KF1A 3ES8A 1TPFA 2PFHA 4ODNA 2H8XA 1J8VA 5HMEA 1LDCA 4UOQA 3M0HA 1DIOA 2ZZ2A 4GMEA 1XUUA 1NWSA 1X6NA 2BGQA 4F2BA 4NSBA 3OTRA 1S1RA 4DZ2A 3L12A 4LANA 3UW6A 3O5DA 3A3XA 3R25A 1ZCCA 2DVXA 4I7UA 4J40A 3LD5A 3WNOA 2Z1WA 4H9ZA 2TRSA 3MZNA 3GTNA 1OY0A 2Y1HA 3AMKA 4MWAD 1GVSA 4PRWA 4U10A 4EAYA 1XYCA 4GIRA 5C7HA 3HF3A 4JY8A 3QFEA 4MGGA 1GQJA 2EJ1A 1XPGA 3V5FA 1RD6A 1ENUA 1EJWC 4C65A 4XIAA 1G5AA 1Q8AA 1KQZA 4GYFA 3ABQA 1EDTA 1SW3A 1XKYA 2O0TA 5K9XA 3V18A 4CQAA 3CWOX 4PODA 3TAOA 3ARRA 2OZ8A 1A49A 3HTWA 1OM0A 1RPKA 2NT0A 4M6VA 4TR9A 1E5JA 3WKZA 1US3A 2Y78A 4L5ZA 4CCCA 4O0ZA 3HA1A 2BVDA 4V27A 1PWLA 4PYSA 2BB0A 3I7RA 4BEQA 1UQZA 3GG1A 5CJ5A 1RBAA 3IWPA 4HCDA 1A53A 1GOOA 1LTDA 4O10A 3OYXA 4AZIA 4Z17A 1NOWA 3H55A 4O8AA 1HJXA 1F8AB 3NO5A 5ABFB 3GH4A 3BV4A 1TWWA 3RMJA 5CAKA 4NZCA 3ARTA 1POKA 2BX7A 3BAXA 4HPJA 2J78A 3E2QA 7REQA 2BS9A 3CUZA 4Z2IA 3DI1A 1JNEA 1KM4A 3GW3A 4A6GA 2PTZA 1TV4A 2XP4A 3G2GA 3GYCA 3GVVA 4MWAB 1CXKA 3B7XA 5AC7A 3HGSA 3GG8A 1ICPA 3KL5A 4RXFA 3G5EA 1H41A 3OVQA 1D3HA 4JKMA 4ATWA 1YE4A 4S3EA 4IFRA 3CEPA 1Z69A 4MDPA 3E2SA 3AO0A 1QBBA 1B9ZA 1GJUA 1HL8A 3EDKA 2VCBA 3EMZA 2V82A 3O5LA 1LQ2A 3S2MA 5LA0A 4HMEA 2XSBA 4UTUA 5K2ZA 5I2UA 3TQPA 4XUYA 3DIPA 4QBXA 2FKEA 1TPUA 2ADAA 3DFYA 4L3NA 1XKJA 3UP8A 4XD5A 3WLTA 5E1QA 5HA7A 3CPRA 3D3FA 2PWUA 3TC6A 3C6CA 3IK4A 3PANA 4EWJA 2PCQA 2X1UA 3THUA 4IIEA 3S1WA 1EC7A 4LS0A 1Y7VA 3UJSA 1NTHA 1MQPA 4IWWA 4EPEC 1KBBA 3B8IA 3DN5A 3QY8A 4O1BA 3VMOA 5D2TA 1EQ3A 2DW7A 1XPYA 3NCOA 3EX1A 1F9CA 4JD4A 5D9NA 1A5MC 1AJ2A 3L5LA 4CCEA 2ZXQA 2BY2A 3KFTA 1VIZA 1WKEA 4FNPA 1IIHA 3W2MA 3CZGA 4S38A 1K7XA 1AW1A 4O4VA 1I2QA 4XKYA 4Q7NA 5C70A 2XIJA 2AAMA 2B4GA 4NILA 4U2YA 4NAFA 2O9PA 1QNOA 4FOKA 3FYOA 3K30A 3EY6A 4FO4A 1ZGDA 4NG3A 3FFSA 3O05A 2VRKA 2W27A 4IH3A 4GI4A 2YB1A 1PTGA 2P10A 1A3HA 1J0HA 4KKXA 5HQEA 3L4VA 1G4SA 1H4PA 2CEQA 2MUCA 1Q7MA 4JTGA 3WJXA 5C9ZA 4LAMA 3VX0A 2J9ZA 3L21A 3BG5A 4HU3A 1GKPA 4AFYA 4J9JA 2TPSA 4KEMA 2ZVRA 2G5WA 3MWAA 4CCZA 1B57A 3SUTA 1HXJA 1E43A 3C0LA 3ITGA 2D9FA 4NJKA 1PL9A 2EPMX 4JIQA 5D05A 4V33A 1M6JA 1FWTA 2AGTA 3WF2A 3I4EA 4AC1X 1A5CA 1QWGA 4DWSB 3LCLA 2AL1A 5KZDA 3BJFA 3ZR5A 3NQBA 2OQYA 1JVNA 1HW6A 4W89A 4R7JA 1TJPA 4H3DA 5EFDA 5DFAA 1K8XA 3PRAA 4N6EA 3R13A 3K4WA 3WY1A 1YBQB 4PUWA 2P4VA 1E6QM 4RXGA 5CZTA 3PJUA 3MMTA 1X8CA 1XS2A 3H26A 5D9PA 1RJRA 3P6LA 3N11A 3TCZA 1UR1A 1J4HA 1US2A 4RE4A 1TMLA 5L9FA 4RL3A 1BWKA 5CJMA 3WH9A 3W29A 3GC4A 4GIAA 2BOFX 1KRAC 2ZX9A 2WJZA 4P8WA 3GVWA 3PSWA 1DQUA 3BZGA 2J27A 5HKGA 3CIWA 3TX9A 1ZTVA 4NT0A 3MANA 5DO2A 1JYVA 1PVNA 3TNOA 4HU4A 1V3KA 3AISA 3EOOA 3M5YA 4PBEA 4ZTYA 4CEXC 3IAQA 1TJ1A 4UZSA 3AXMA 2D3NA 2W9MA 5AC5A 1PKMA 3IIXA 3SJ3A 5D37A 1E71M 2PGRA 1CXIA 4JTQA 3VD4A 3LHWA 3LK6A 3OHIA 1XIBA 3IV8A 3S9ZA 1DIEA 3XINA 3UQAA 3LTSA 3AJXA 3U4FA 2GL5A 5A2BA 3QOKA 4M1RA 4TTGA 1H0GA 3ARPA 2CERA 3DECA 3GRIA 4DWDA 5CBIA 2P0OA 3EA3A 4YWIA 3HPXA 2O7QA 3EDJA 2Q3OA 3PFMA 1HKIA 5F1UA 4KERA 5CPLA 4JEJA 3ARXA 3WD1A 4S23A 3C56A 2BZNA 1JDCA 1JCHB 2O56A 3T4WA 1ZB5A 3IJ9A 4DVOA 5I7GA 1WDRA 5A1AA 4DJEA 3E0LA 2DPEA 1JULA 3AICA 1D7KA 3KVKA 3GVGA 4GUIA 4Q8MA 4XIMA 3ORWA 2YXGA 2QCNA 3AU2A 3HGJA 4P7RA 4FIQA 3W1RA 4E3TA 3JS3A 3WQFA 3H54A 1C90A 4QGCA 1IGSA 2VGIA 3O07A 3ZLHA 1WXYA 2DT3A 2PWVA 4OOZA 3K8LA 3LBCA 1S5WA 2V2CA 3PZ9A 5CEWA 1GUVA 1AQFA 3VGBA 2WSQA 4BJHA 4X9YA 4CD7A 4GCXA 5E6YA 1LT8A 4UTKA 1H5YA 1OCNA 1E9YB 1TTQA 3R94A 4I3GA 3N6QA 3PPGA 1OWQA 1HO4A 4HZ7A 3LHTA 2D1ZA 3EZ4A 4M0XA 1JAEA 3LMYA 2IPFA 3DBPA 4NI3A 3GXIA 3F2BA 3NAVA 3BSMA 4H01A 5AC4A 1EWEA 3W72A 1KLZA 3MI6A 1EXBA 1HGYA 5EY5A 4ODPA 1NMWA 4LALA 3H2CA 1QI4A 3U2OA 3C0QA 4CD5A 3VD9A 2PZNA 4JIIX 1W1B1 1XLFA 5CSSA 1A5SA 1HKJA 2V67A 4IF2A 5LYRA 4PMOA 4AHPA 3VMNA 3EPOA 1T0OA 1UWQA 5BXTA 3G0XA 2QR6A 4E3VA 4R5EA 1XV8A 1TKKA 3ABZA 4GA8A 3SIMA 3RMEA 2HCVA 3NA8A 1KKOA 2QCMA 4PMVA 1GVQA 1JQXA 1F6PA 4MNLA 3NQ7A 4B90A 3LA4A 4MKVA 4S2CA 1JZ4A 3HV8A 4PN2A 3WQEA 1H7PA 3GU9A 2VC7A 1JZ6A 1NEYA 1RCQA 3LBMA 1AH0A 5FEZA 4HN4A 2B81A 1TQJA 2P0IA 2ZA1A 1TMHA 5BOEA 1PIIA 1RY8A 4CN6A 2QPSA 4JTDA 3OGVA 2ZDRA 3FJ6A 3F03K 2F38A 1E9LA 1Z6KA 2OLAA 4ZZ9A 5HPCA 1HL9A 5B7YA 4PA8A 1FH8A 2VR5A 4IP4A 1L8NA 3C5QA 4KCUA 4ZE5A 1XIJA 1OGBA 1TWIA 4YL2A 2E8ZA 5LXEA 5CQ1A 3OLDA 1QRQA 4GVGA 4WK9A 1V3JA 1EYEA 4ENLA 2ZX6A 1WBJA 4AD5A 1NIUA 2ZQUA 4Z08A 3HG3A 3ZJ6A 3N15A 4J3XA 1QNVA 2Y8VA 2GK1B 2BY3A 1V02E 4JN8A 2D20A 4DO5A 5CKSA 3BWWA 4PRRA 3N34A 3VCNA 5D2YA 3UJRA 4B4HA 1XGEA 3CIXA 2BV9A 1B4EA 4N19A 1VKFA 2KFWA 2ZRZA 4AVOA 3WELA 1W9VA 1PHWA 3M1ZA 4H9TA 4AYGA 3F4CA 2DZTA 2ZC1A 3ZYZA 2Y5EA 2YZRA 1DIKA 2X41A 2UZ9A 4ICCX 4U31A 3CQHA 4BQ3A 1DL3A 1K1DA 1JZ7A 3WL0A 3CU2A 3SUUA 5ABFA 1Q6CA 5ECUA 1W3JA 3ATZA 4AWUA 3P7YA 1MXDA 3OLEA 1E6ZA 1PE1A 2X2YA 1VHNA 3MJMA 4UB9A 4LVGA 3EDDA 4LB3A 4HOZA 1UMYA 1VRDA 2QVNA 4PMJA 3NEHA 4QTGA 1VJZA 4OBSA 3M5VA 4XWUA 3DU0A 4W7WA 1K8ZA 3L66A 3VOJA 3G22A 4GYPA 1ALDA 4NUWA 2PP0A 5HQLA 1L2UA 4HBOA 2Z7KA 3F4WA 1E70M 3IIOA 4CKQA 5HXMA 3T08A 3B0YA 4NAEB 1AMYA 1EJTC 3OHMB 3LEPA 3RLHA 4WZHA 4BA0A 3EPNA 2GLKA 4E2DA 3WK3A 2UZ5A 1QZ2A 4U3AA 4UMAA 2PLCA 2JGQA 5CAHA 2VZSA 1MDRA 1NDZA 2VUYA 2XP3A 2WM0A 2XZ9A 3IKGA 3BAKA 4N0RA 1S2UA 1KRCC 3WYZA 1ZP3A 1RSCA 2F9RA 5EA9A 4LUSB 4MNJA 4I6VA 2OQLA 2UWFA 3G1VA 2A2IA 2PE4A 4NASA 4PSRA 2FJKA 1SFTA 3ISIX 4PCSA 1YQ2A 1QW9A 4PUNA 4ERGA 1LROA 3AIVA 4L4PA 1TV2A 1BVZA 5LIYX 1Q6RA 4JIPA 1C7SA 3B03A 4FLRA 1QOXA 1Q7QA 5GNXA 1SZEA 3U9IA 4D1JA 1JCYA 4IZGA 1FTXA 2D0FA 3MT1A 2V69A 4AY1A 4X9SA 2AGKA 5JH2A 3E74A 4PTDA 4M56A 4AMAA 2ZIDA 1VFLA 3G1FA 4DJED 3L0GA 5EMMA 4WEVX 3WD3A 1FWFC 1CCWB 2J7DA 1JYXA 2OKTA 2QMJA 2PBGA 4HMCA 4ZO7A 3R8HA 4HMDA 4YVPA 3NQ2A 2PLJA 4JIHA 5C6MA 1IWBA 4GI9A 3T6CA 3ZVHA 4ES4A 1UB3A 4A05A 2E0PA 3TC3A 2GFTA 2BG5A 1W1IE 4PMUA 5LNSA 1IEVA 4MYAA 4GWEA 1YDOA 6XIMA 4LNYA 1XLGA 2BHUA 4GXMA 1VC4A 2CFFA 2QGHA 4PSPA 2HTMA 1TVNA 4IPPA 1E56A 3CPUA 1PYFA 4DHGA 3E38A 2G41A 1PKYA 3OA3A 5DXXA 1EJSC 2J13A 2FB3A 4ASTA 1TUFA 3P84A 3F5JA 1AH4A 1DQWA 4Z2LA 4Q6XA 1XXXA 3LTPA 5DN1A 3A23A 4YTTA 2NV1A 3OW1A 4GXPA 4QQUA 4HTBA 3IAPA 2C15A 1DTUA 4AVFA 1XFCA 2OYKA 4D6GA 4MPKA 4DX3A 4YWSA 4L7ZA 4GABA 4A22A 2LLEA 1D7HA 1UBSA 3BLEA 1FKWA 1N82A 1XG3A 4NNCA 3NR0A 1R85A 3GXMA 3V16A 4GVHA 1CLVA 3U4AA 4W84A 4O15A 1AJZA 4A29A 4ROQA 3O15A 3QW3A 3RUBL 5MHBA 3POHA 3ZT7A 2V5BA 2VC6A 4JDBA 1S5NA 1XLMA 5BXSA 1KT0A 5HBFA 4L6HA 4LF1A 3SY8A 1DORA 3W01A 3G18A 1JL8A 3KAFA 1P6CA 1BAGA 3C8FA 3W2NA 2JEQA 3OIXA 1OCQA 4UCGA 2XP9A 5GQBA 3CO4A 3N19B 5KMYA 5BXRA 3FHAA 4R53A 3M6YA 3GR7A 3N04A 1V7YA 4MZ1A 4B92A 4W9PA 5XIMA 4AEFA 3GC2A 3T9PA 3DFSA 3WLOA 2GDUA 3FEQA 5BMXA 3EGJA 1A4MA 3ITVA 3CAVA 3S5OA 2ISDA 5BWAA 3QJAA 1IZCA 4FEZA 2MF9A 1R9XA 4HJFA 1F73A 4MNMA 4Y96A 2PD9A 4R85A 4Y9MA 2YFNA 4C6OA 4M29A 3CC1A 4F9JA 3O5QA 4C1LA 1C29A 1EP3A 2EBNA 3GHTA 5I03A 2WMKA 2PDYA 1S46A 1F61A 3PZGA 1BYDA 1UD5A 4DYJA 3NURA 4L6OA 4ZEPA 2GVGA 2I9EA 3TROA 2DT0A 2IKGA 4OECA 1F7BA 1QCWA 2UY2A 3UT0A 2IPGA 5BU6A 4F0MA 1K4HA 1NFGA 4E0CA 3STGA 1R3VA 4UTIA 2ZWZA 1IXNA 3CHDA 4UR8A 2CU0A 3SCQA 1WZLA 4I5UA 3LOTA 4QROA 4F2TA 2ZFAA 2VEGA 1E5NA 5HOSA 4PGLA 4Z2KA 3OZPA 1F74A 1MEIA 1B30A 1Q4WA 4XBSA 3KDOA 3O06A 4GJ1A 5T9BG 2D3LA 4I7WA 4UTHA 4EF8A 4ECLA 2O9TA 1W5QA 3W07A 3ITOA 2J9YA 2JF7A 3TNBA 4GFSA 1V02A 3TJ4A 1WYIA 4N9DA 3OZYA 3H4XA 3QV6A 1PINA 3QPEA 2ACQA 2JGYA 5M17A 2XN0A 4RE0A 2GQ8A 3N9KA 2VX6A 4Y9PA 4W5UA 2WMGA 3NDZA 4B9YA 5D38A 4OU1A 4A3UA 4J4NA 2PDHA 4EXBA 3TXZA 1XJBA 3ZT5A 4UWMA 1KV5A 1WKFA 3F4VA 1KTNA 3NOEA 1Q45A 1AL8A 4OV4A 4JQ3A 5DCEA 4XD4A 2ZVIA 3M9YA 3WF3A 1X7FA 3NQVA 2NQZA 3UA4A 3SW6A 1Q85A 5CPQA 3ID7A 2EO7A 3WQVA 1SW7A 3LS9A 3NEVA 1KXHA 4KFOA 1OSEA 2ZX5A 4QCEA 4A8NA 5GJPA 1UP2A 2FTYA 4GQBA 4IUOA 1HO1A 3LPGA 1TE1A 3VI2A 2OZTA 1RY0A 4IL2A 2Q6ZA 2PPGA 1YNPA 4WQ6A 5FA5A 5T8GA 1DWHM 3N17A 4J1OA 2HPIA 1YATA 1ME8A 3TJIA 1ISZA 4G7FA 2AL2B 3BMXA 2ZZ7A 1XQKA 2PDKA 4LXFA 2POZA 4PTNA 3KDNA 2XUCA 5BRPA 3M0IA 2R9RA 4Y8FA 1XLCA 1JJKA 3NRKA 3OZMA 4LH8A 3LU2A 1GYMA 1JAKA 4ODQA 3V0UA 3VNMA 2G3NA 1DHKA 3EWZA 2E6DA 1EC9A 4B15A 4GI8A 4V28A 2VMFA 3MKVA 1QPFA 3PB0A 1UKSA 2X2GA 4MAZA 3TTYA 3RO8A 3KL3A 4MOZA 2I9UA 4GINA 2V3GA 1NSGA 1V0NA 3QEZA 1DXIA 1R3WA 2XP8A 3P5ZA 4DZHA 2BDQA 4V1XA 1KRBC 1E6SM 1CB7B 3ZLFA 1FBAA 1VEPA 5REQB 4W88A 3CT7A 2J8FA 3TP4A 3S83A 3FX4A 3UF8A 1JZ3A 5F2LA 1YE6A 4XO7A 3W7PA 1LL6A 2H90A 4M3PA 2PZ0A 1YXYA 3SGGA 1L6GA 3EMCA 3FAPA 5DRIA 3O1NA 4GOAA 4ACZB 3KBWA 1DJHA 1GQKA 4DM1A 1TCDA 2MLXA 3PBYA 2CLOA 2NSXA 1LRNA 1LRTA 3BMWA 3LV6A 4LUTA 3NG3A 5HWMA 2ODOA 4AF0A 1R9YA 2SFPA 2X7VA 1EKOA 1DJYA 4CNNA 1S2VA 3TC7A 4XAFA 2VX7A 2GGIA 1NFBA 4JTJA 3QC0A 2INFA 5HTGA 3NQEA 3JR2A 3NDYA 3LGGA 3C2YA 2GOKA 2L5HA 4K36A 2A79A 2CKSA 3BJSA 2J74A 1ZSXA 2XH4A 4ZQOA 4IQ2A 2C0AA 1MDLA 3RIKA 1O4UA 4N2YA 4LV9A 3GBEA 1I2NA 3SN4A 1A3WA 2ATMA 2J25A 1K8CA 4OJYA 1K4GA 3WLKX 1FWIC 3E96A 3UA3A 5HDRA 1A5UA 2ZQVA 3MI2A 4OE7A 4EPBC 5D09A 3SO7A 4NX0A 3AUOA 1WO2A 2Y7DA 1D8WA 5EBAA 2BXVA 2YGYA 1ONWA 5I24A 3EYPA 3WMCA 1VCVA 4ZB0A 2FZBA 3LHUA 5LHFA 3QF0A 1TG7A 2BWGA 5PTDA 1ZLPA 3HFTA 4ZGYA 2IKJA 1VYRA 3O6DA 4TX8A 1EDQA 2OVLA 1J79A 1GTEA 3VD3A 1H7NA 3EOUA 1MRQA 3KOZA 4HPNA 4NP7A 4A2SA 3UZ5A 3CL8A 3H2AA 1UD2A 1MXSA 4LYPA 4B5UA 2I57A 1UJQA 4HK6A 3P60A 3TTOA 1DJGA 1XI3A 3H12A 2DT1A 4URIA 2QCEA 3EKGA 5LZLA 1WDPA 3E2RA 2V5CA 5K7JA 2EAWA 1L0PA 3SUSA 3WIJA 1CGVA 4IL0A 3HPZA 3AXIA 2QZRA 1Q63A 3QHMA 2HNHA 3N4EA 3GLCA 5FEXA 1C9DA 4GH3A 4AD3A 2QGYA 9RUBA 1EFZA 1TZZA 1B6CA 2A6LA 2CLMA 4ZS6A 3MY9A 4QDMA 4ZR8A 5FIPA 5BWFA