2DSVA

Interactions of protective signalling factor with chitin-like polysaccharide: crystal structure of the complex between signalling protein from sheep (sps-40) and a hexasaccharide at 2.5a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbohydrate binding properties and carbohydrate induced conformational switch in sheep secretory glycoprotein (SPS-40): crystal structures of four complexes of SPS-40 with chitin-like oligosaccharides
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dsvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dsvA01
1OIMA 3ARZA 3D5HA 1W9BM 1ZJAA 3AHVA 2RGMA 1UQYA 1TZ7A 2OSWA 1E4IA 4D6IA 3ECQA 1JF6A 2CNCA 3U7VA 3AZSA 3HN3A 3UEQA 4JHOA 1UQZA 1UZ4A 4WSKA 3UERA 1NOFA 2VCAA 5M5DA 4U33A 1GOKA 4ZE4A 1H3GA 3QOMA 2WZEA 1C7SA 2ZE0A 5I6SA 5I79A 1HVXA 1QBBA 2DT1A 3E1F1 4M24A 5A2CA 1GQKA 4ZEPA 4V28A 2WCSA 2CKSA 4DWSC 3TOPA 2GDUA 2VT0A 4E2OA 3MMWA 4ML4A 4FLQA 4EKJA 4HA4A 3CUJA 3LPOA 2YDRA 1GQIA 1CGYA 1UA3A 3S6TA 1E72M 4FF5A 1SR0A 1US2A 3TP4A 4R27A 2HISA 5ABGA 1WKYA 3VX1A 4YHGA 3ARTA 2Y2WA 1BYCA 1M04A 5D4YA 3T2OA 1QBAA 1SFSA 4OZOA 4HZ6A 1DWIM 3VIIA 3W6LA 1QW9A 2D22A 1MW2A 1E6NA 4W88A 5A94A 1U30A 3VIMA 4CU8A 3OLIA 1VEMA 1L0PA 1KFWA 2QMKA 1J10A 5E70A 1GUVA 1E6PA 1X6LA 1W1YA 1K9DA 3CMGA 3DYPA 4TUFA 2XVGA 2YOCA 3AXXA 1XSIA 3BMWA 1HL9A 4LYPA 1ZBWA 5LA0A 2XFYA 1KGUA 4CN6A 4WKHA 1OGSA 5DO8A 1NQ6A 4MADA 1GORA 4PRWA 3WUBA 1E56A 5JBDA 2VX6A 1C90A 3CTTA 3LPGA 3WDIA 4BS0A 3TTQA 1R85A 3EMZA 1TCMA 1ODUA 1G94A 4V27A 3K46A 1E0VA 1NARA 3VD9A 1JD7A 1RD6A 1ITCA 5A6KA 3MSGA 3G6MA 4LYQA 5BXTA 3MSDA 3B9AA 3BMVA 3GH5A 3OLDA 2QMJA 3GDBA 2UY5A 1GOIA 3NUKA 3EMQA 2DIJA 1K9TA 1KR0A 2BVDA 3ZSTA 4IM4A 1UD3A 1O7AA 3WMCA 3EDKA 4D72A 1J11A 3M7SA 2W91A 4D6JA 5M3WA 1JL8A 4AZIA 3W26A 2GJPA 3I3DA 5IXEA 4FMVA 4D1JA 3VILA 4CD7A 2VX5A 4DM1A 2G4FA 3T2PA 4OOZA 1ECEA 2PC8A 4HU0A 1EA9C 1HKKA 6CGTA 3F4VA 1HKMA 1WAWA 5I77A 3A4WA 5HDRA 1XD0A 4Q22A 3GNPA 3L4YA 4UQEA 2VO5A 4NF7A 5BCAA 5A8MA 2XM1A 1H0IA 4W8AA 1EDTA 1A3HA 4OKDA 5IFPA 4GXPA 4W5ZA 3VIFA 3NSNA 4B3LA 2WC3A 3VVGA 5DFAA 3U57A 3WIJA 2EJ1A 2ZWZA 5I2UA 2W4XA 4LGXA 1WB0A 3W0KA 3UR7A 2WWDA 1R7AA 2DT2A 1CLXA 3SCSA 3OB8A 1Q6GA 4U2ZA 2EPLX 3N13A 4U2YA 3SCUA 1B30A 4PUEA 1KGWA 4DUWA 5E0CA 3GXIA 1OCQA 1V6YA 1VEPA 4KGLA 3NDYA 1E6ZA 2IXUA 1AQHA 3IANA 3GYCA 1W32A 1B3XA 4H2CA 5FIPA 1CWYA 1G5AA 2J7DA 3ZR5A 5EFFA 7CGTA 1QNQA 3ZJ6A 2D23A 3W53A 3QR3A 1W3JA 3AMLA 1V3KA 1QI4A 5A2AA 4UZUA 2E9MA 3BAXA 5A6SA 4D6GA 3VTRA 1PIFA 2WBGA 4ZXOA 2Y5EA 4MB1A 4E8CA 3ALFA 2XJ7A 4E8DA 3FAWA 5A8OA 2B31A 3MS8A 3ZOAA 3N18A 1Q6EA 3W4RA 2AMGA 1DP0A 4FLOA 1FA2A 1ZBCA 1LLOA 3BH4A 2BY0A 3RM4A 4BQ3A 2EO7A 4IPNB 3CZJA 3SCRA 1HJWA 5ECUA 3VM5A 3WY1A 1W1PA 1Y7VA 5M03A 4AEEA 1J0HA 2ZXAA 1HJQA 2E40A 1G0CA 3DHPA 2PBGA 1FHDA 2WCGA 4PEEA 5C8BB 2J74A 1GOOA 1AVAA 3VNYA 3IJ7A 1VF8A 4B9ZA 3BCDA 1H1NA 2OYLA 3AMDA 2XWDA 3T0AA 4W7VA 1MXGA 4OJYA 2YL8A 1GOWA 2E4TA 2Y8KA 2Z1KA 2O9PA 2VJXA 1E40A 2D0HA 2YL9A 1GJWA 1W91A 2XG9A 3OGSA 3WFLA 1JNEA 1NH6A 1PEZA 2ZX5A 1OM0A 3ZT7A 1WZKA 1XH0A 4HTYA 4U5KA 5CQ1A 5BXPA 4PMUA 1W9PA 3AS3A 1WNOA 1ITXA 1QOXA 3LPPA 1CXKA 4GQQA 1HXJA 1NP0A 4PTVA 2ZUWA 4HU8A 1UD5A 3W27A 1VJSA 4HP5A 2RGLA 1WCGA 1PX4A 3SCOA 2WVTA 4AZBA 1OT1A 2V3DA 4KRTA 1EHAA 3CUFA 3WNMA 4PTMA 3A47A 1E5NA 3EDFA 3PTMA 2V5DA 4XUYA 2GVYA 2WZIA 4ACZA 3N04A 2CHOA 2WB5A 2E8ZA 4W85A 5BXRA 2GSJA 4HMEA 1PIGA 3N15A 3PN8A 4EAMA 1Q6DA 4QAWA 1CECA 4F9DA 2ZXQA 2OLHA 1JGIA 2O9RA 4XZWA 1XCXA 3RILA 2ZOXA 1ODZA 4H7VA 5CPSA 4F8XA 3ARPA 5A8NA 1UWQA 1CGXA 2WVUA 2DSUA 3AYRA 3AIWA 3PZNA 4UOJA 5CLTA 4F66A 1CBGA 2BHZA 3CHFA 1MYRA 1F4HA 3ARXA 1OGGA 4AD0A 1KCLA 4QDMA 3WF4A 4GI8A 4UFMA 1GW1A 2GFTA 3WNNA 3NDZA 1V02A 4U5IA 1E3XA 3OGVA 2DPEA 2VQUA 3CZEA 4BA0A 1E6QM 4WF7A 2FGLA 4W93A 5DF0A 3AOFA 5A1AA 2CCRA 4M1RA 4XB3A 3VOCA 2DT0A 3WBAA 1C92A 2WHMA 2X0HA 1MFVA 4PTXA 1UKPA 3GBDA 2CIPA 2O9OA 4XV0A 1V03A 3RMEA 3VUPA 2D0GA 3FY1A 1BTCA 3VINA 3ARYA 4NZCA 1SYTA 1UWSA 2J7FA 2OSYA 3TTSA 2E9BA 1ZBKA 1Q6FA 5A6JA 4H8HA 3VU2A 2XTKA 5TD4A 4WLCA 3SCVA 3AMGA 2V3GA 1GNXA 1VFFA 2X2YA 2WHJA 3OA5A 2BXZA 4QP0A 3KZSA 1JXJA 4GQRA 4NSBA 3UESA 2J79A 5ABFA 2A3EA 3SURA 1FH7A 2VZOA 2VC9A 4WKAA 4J3VA 1X1NA 4PMQA 1AQ0A 3PZGA 1QI5A 4W8LA 1FP8A 3APGA 2ZXBA 5A69A 3SUVA 4PMZA 4PMRA 1W1VA 1KB3A 4A4AA 4TTUA 3BLKA 1IV8A 3PBGA 4KMQA 4U31A 1WZLA 1KGXA 3UG5A 1B90A 1DWHM 3CZLA 3WEMA 4PBGA 1EDGA 3I3EA 4CU7A 1BVZA 5I0DA 1JZ4A 2V3EA 5A8PA 1J9YA 2J77A 5D9MA 3OLGA 1JAKA 2CITA 2XPKA 5ABEA 3IJ9A 1C93A 1XD1A 1VAHA 1MW3A 2EXOA 1BYBA 2G3IA 3N17A 1CXLA 4AD1A 4JKLA 1IZJA 1MXDA 4GI9A 1V3JA 2FHBA 2XHYA 4A3HA 5JBEA 4FLRA 3VD7A 1B1YA 2A3BA 3EDJA 4CUCA 4DUVA 1XRVA 1K9EA 3VIJA 5C71A 3G6LA 1E70M 3K8MA 2WNWA 3QHMA 5A8QA 3W25A 2V38A 3DYMA 3PZOA 2XSBA 3VO0A 4TVCA 4PCTA 4URIA 1HJUA 2D0FA 2EQDA 1GVYA 4ZXLA 4UOQA 2CYGA 1HKIA 1V3LA 2PWGA 1O6IA 2WXDM 3ARSA 3POHA 2ZUNA 2WKGA 4TVDA 2VVNA 4JFSA 1V0MA 1JAEA 4AD2A 1VEOA 4H41A 3WD1A 4IPLA 2FDMA 1XYZA 1Z32X 4CU6A 2XFRA 3GNRA 2OYKA 3WMBA 2JE8A 2XUCA 1VJZA 1UZ1A 1JYNA 1UH3A 4CD6A 4RE2A 1JDCA 3CIVA 3KL0A 4MPKA 3VIGA 2VURA 4W86A 2O92A 4CCEA 3N9KA 1DWJM 3SIMA 1JYWA 3D3AA 4AIEA 2WAGA 2ZUMA 1CPUA 1LG2A 3WNKA 5GPRA 1EQPA 4PUDA 2WMKA 1R8LA 4Z2JA 2BY1A 3SCQA 3CGTA 1JNDA 4AZHA 1WDRA 1JIBA 4M8UA 3MU7A 4RE3A 1BHGA 2YA1A 5HXMA 4BF7A 1HJXA 1KXTA 4HA1A 1J01A 5GNYA 2GJRA 2VX4A 2QF8A 1PPIA 3L2MA 3F5LA 2BY3A 4J3SA 5HPCA 1Q4NX 3BSHA 2EBNA 5A6BA 3I3BA 3PZMA 4M80A 5D8ZA 5CGTA 3L4TA 3N11A 2X8RA 4Z2HA 2CHNA 2DT3A 4X0NA 3AIRA 1WDQA 1H2JA 1NOUA 2GJXA 3VDCA 1XV8A 4BCEA 1I75A 5CPQA 4AW7A 5HNNA 2ZUUA 1GPFA 3U7BA 1PZ2A 1SMDA 1OBAA 5GQBA 1B31A 4Z2KA 2VX7A 4JIEA 2VRJA 3DC0A 4HMCA 3EMCA 2YDQA 1XH2A 4P7LA 4PMOA 2J7BA 2PWFA 3CHCA 3LPFA 1J0ZA 2D1ZA 1UD4A 2XVPA 4UQAA 3WKZA 1LJYA 3J7HA 3PZUA 2D3NA 4MTVA 2PWEA 3A4XA 1DWAM 1FHLA 1UKQA 2XGIA 4K68A 3EYPA 3QOKA 1JYVA 2W63A 4QCEA 3AHZA 1H5VA 2OWWA 4D71A 2OSXA 3PZIA 4MAVA 1V6WA 5GNZA 5KEZA 2YLLA 3NJ3A 1OGBA 4CD8A 3FNDA 4AIUA 3GXMA 2JFEX 1FP9A 5A6MA 3WD0A 5BROA 1ZB5A 3B9EA 3WD2A 2YLAA 3ALGA 1H11A 4JZ5A 4PMXA 3WN6A 2O9TA 3AICA 4TXEA 2W61A 4PSRA 4S3JA 2EPKX 4HPHA 1BVNP 5HOSA 3VDAA 3AI0A 3HU7A 4GZEA 1NWRA 1E43A 4AZ6A 1FOBA 2YBTA 1V0NA 1NOWA 5BWFA 1UKOA 3WDRA 1XHGA 4HOXA 4MDOA 2YDSA 3NCOA 1LG1A 2IXVA 1UR1A 2YBUA 1W9VA 5A2BA 3SCPA 4PCSA 4B3KA 3A3HA 1JYXA 1EIBA 2G8ZA 2VR5A 2CPUA 2XWEA 5IDIA 1W9UA 1HKJA 1KQZA 2CBUA 3MV01 2XFFA 2DH2A 2EPMX 2W66A 1PZ3A 4OOUA 1EXPA 4WSJA 3WEZA 5EFDA 3WDPP 4PSPA 4R5EA 4DWSD 3AZRA 5I5RA 1E71M 1D7FA 3AQUA 1E4LA 3ZMRA 3AROA 3ARVA 1S46A 5LYRA 3AJ7A 1W9DM 1K9FA 2JF6A 1JI1A 3AIBA 2DEPA 4WKFA 3T2QA 4ACZB 1CENA 1KCKA 2IUZA 1J12A 1UR0A 2C7FA 3NYDA 3POCA 3AISA 3SUSA 3WELA 4AY1A 2A3AA 3MMDA 4QLLA 3THDA 4UFHA 2QV4A 4JFVA 3U5YA 4CD4A 3ZJ8A 3GZAA 4B15A 3NSMA 2JF7A 1YQ2A 1UYQA 3VGDA 3AHXA 5ABFB 4B9YA 2VMFA 4P8XA 3AZTA 3PZ9A 4PMYA 3THCA 2BS9A 4JL2A 4MDPA 1UR4A 4FLSA 4LQ1A 4AWEA 2JEQA 2XVLA 2VI0A 1V6XA 2GK1A 1XCWA 1CGWA 2ZUVA 1UKSA 2GUYA 2VCBA 3KWXA 2WMIA 1B3VA 4YHEA 3WL1A 2WBKA 1B3YA 2WKLA 1QI3A 5KZ6A 1GHRA 2PI6A 2ZX8A 2WVSA 1R87A 2QLYA 2BVYA 2GDVA 1VB9A 3DECA 1JZ6A 2W5FA 1E3ZA 2OWCA 4D6EA 2NW0A 1JG9A 3M6DA 2J7GA 3UG4A 3CPUA 4J28A 3ZT6A 2Y24A 1HIZA 4C7DA 3CH9A 1E5JA 3N12A 1MVYA 3PZVA 1ISVA 2VNCA 1UWIA 3MUZ1 2XVNA 3O2LA 3SUTA 1TR1A 1QPKA 2DSWA 3IAPA 5BRQA 3GH7A 1H0GA 1P6WA 2X1IA 3UG3A 1W3LA 1CXHA 5DT7A 4UTFA 1EO5A 2NSXA 1BYAA 1W2VA 2WSPA 3ZSSA 2WMHA 2BHUA 1LL7A 1SMAA 3K1DA 2VOTA 1BPLB 3KEHA 4JCMA 1H41A 1J0KA 1VENA 4W7WA 1K6AA 1JZ5A 1B0IA 4RL3A 3U5UA 3WQVA 1W3KA 1I1XA 1QVBA 1JF5A 3WUEA 1JXKA 1JDDA 3WH6A 1OT2A 5CLWA 3CHEA 2E8YA 2DSVA 1UR9A 3OZPA 3TTOA 3SEPA 4YN5A 2EEXA 1E6SM 1GHSA 1C8YA 1HJVA 3L4ZA 1KBBA 5JH8A 1TUXA 1CGVA 1ZS2A 1TFVA 3AHTA 3WSUA 3W38A 1EO7A 1HF6A 3PZQA 4UQBA 2Y4SA 3GNOA 1KXVA 5D8WA 4AXNA 2VRQA 1WE5A 3IK2A 1FFQA 4U3AA 4CKQA 4UFLA 3AMKA 4AC1X 1V3MA 1D2KA 4M56A 4X0VA 3RJXA 3EDDA 5CGMA 1IZKA 1KBKA 1ZBVA 4PN2A 4BQ2A 3PTQA 3WQ6A 5HBFA 5E6YA 4CVWA 1UWRA 1BSIA 3M46A 1R7OA 3WENA 1WPCA 1UH4A 2C8NA 1X6NA 4D6FA 4AZ5A 2V3FA 2WVVA 3K4DA 1W9XA 2ZX9A 1OB0A 3WF2A 4AEFA 1RH9A 2D2OA 2ZUSA 4CN1A 2CERA 2J25A 2WLZA 1E1FA 1OD0A 1V08A 4TX8A 3OGRA 3QHNA 1H09A 3HMCA 3RM9A 3BAKA 1M01A 4CN4A 1GVIA 4PMVA 1UOKA 2YL6A 3WH7A 4D1IA 4FK9A 1VBUA 3VDBA 2AOSA 3RM8A 3QHOA 1UKTA 3CO4A 2FH8A 4P7OA 3JUGA 4QCFA 2EPNA 3FAXA 4QLJA 4E4PA 2WWCA 1WO2A 3T0DA 4JHZA 1XGZA 4MB3A 1E9LA 1MW0A 2XIIA 4AZGA 3RDKA 4W7UA 4C7FA 3MMUA 4W5UA 1UA7A 1DEDA 1U2YA 3W6MA 3WQ4A 4MJ2A 4KH2A 3IJ8A 2D20A 4HOZA 2WSKA 4UR9A 4PTWA 3L4XA 1MW1A 5CXPA 4HOWA 3W24A 4P8WA 2VR4A 2VRKA 1U33A 3TA9A 4JFTA 1RPKA 2Y8VA 1US3A 4GI6A 1UD8A 2G3JA 5I3DA 5IHSA 2UY4A 1QI2A 5I23A 3VGBA 5AC5A 3VPLA 4ATLA 4RE4A 1CGUA 3BXWA 1HX0A 2WMFA 2JALA 2Z1SA 1HJSA 1BAGA 1H49A 1VIWA 5A6AA 4JL1A 1OD8A 3AIVA 1CZ1A 1PBGA 3AS1A 5AYBA 1WZMA 1ZL1A 4GIAA 4HZ7A 3MUY1 3OG2A 4H8UA 5F7UA 4JAWA 2DGAA 1V0LA 4KWUA 2DSZA 1CEOA 3AHYA 4QFUA 2PWDA 1D3CA 5E0FA 4D6CA 3AIUA 4WK9A 1DWGM 1B3WA 2W92A 3WNPA 3ZIZA 5D9OA 1ZJBA 1NWSA 4UQDA 1V6UA 4TX6A 3B8SA 4M81A 5JIPA 3W37A 4MNMA 1TMQA 1EHNA 2XIBA 3MO4A 1LL4A 2WW5A 2WC7A 1OWQA 1E6XM 3TTYA 5CSUA 4MB5A 5A95A 1JZ2A 2QPSA 4N42A 1NWUA 4F9JA 3OBAA 4J3TA 4LXFA 4P7QA 3WUFA 3CZ8A 4P8VA 3GXDA 4CVUA 1MQRA 3FHAA 3RCNA 1DWFM 1CYGA 2FHCA 3BSGA 3OIHA 2QPUA 4YPJA 4AD3A 3VIOA 3K8LA 3WH5A 3ZO9A 4F79A 1HN1A 4GZIA 3ARQA 1HL8A 4MB4A 1QI0A 3EDEA 5LA2A 4ATDA 2TAAA 4X9YA 3DHUA 3IAQA 2VZUA 1KXHA 1TA3A 3T0BA 2DSKA 5DT5A 2CEQA 2PBOA 1KR1A 2NT1A 2FHFA 4ACYA 3N1AA 3MANA 1XH1A 4AISA 1GCYA 2VZTA 4W8BA 1C91A 5I78A 1QNSA 3L4VA 1GQJA 1BYDA 1RP9A 3PZTA 4BZYA 1FH8A 2DIEA 1EGZA 1KXQA 4PMNA 3LMYA 2WHKA 4KRUA 3ZR6A 4JFUA 2ESCA 1QHOA 2Q8XA 4BQ5A 5IFTA 1H4PA 1GOMA 3BGAA 1CGTA 1L8NA 4LYRA 1Q6CA 1OSEA 2YKKA 3VD4A 3WUGA 7A3HA 1V3IA 4HZ8A 3VMNA 1B3ZA 3UR8A 5DEZA 5CPTA 7TAAA 1JI2A 2C0HA 1QW8A 2WYSA 3VM7A 5A6LA 4KGJA 1A47A 4D6DA 1BFNA 2J78A 4H8VA 1LWHA 1ISZA 3W82A 2ZX7A 4MNKA 9CGTA 1GQLA 2YIHA 2UWFA 1TVPA 3BCFA 3KL3A 1UHVA 5LA1A 5FD0A 4V2XA 2ZXDA 1M7XA 2G3NA 4UCFA 3BLPX 1JFXA 1QNOA 1JZ8A 3A6OA 4J3UA 4AZ7A 2BXYA 3S2CA 3AS2A 4GO8A 1J0IA 4J27A 1B9ZA 1AMYA 2WANA 1F4AA 2VQTA 3VX0A 5AC4A 4JFWA 1ZU8A 3CHDA 2CBVA 1VFMA 2CETA 1UG6A 2W67A 2DH3A 2JIWA 1NM9A 4UQ9A 3CZGA 2XM2A 1E6RA 3WD3A 2BY2A 2JEPA 2VUYA 3WDQA 3W81A 5BYWA 5EBAA 2VVSA 3MUAA 4UFIA 1E15A 1M53A 4C7GA 1VBRA 2CXGA 1JZ7A 5CZKA 5EB8A 3ZT5A 4Z2IA 4W87A 1MQPA 1HNYA 3GXFA 3VGGA 3RPMA 4P8UA 3AS0A 3F5KA 4ZE5A 4UQCA 5ABHA 4LX4A 4Y7EA 3WF0A 4N0RA 5I24A 4AD4A 3GBEA 2ZUTA 2F8QA 2NT0A 1UD2A 2WC4A 4DUXA 1WDPA 4WIWA 3M07A 5HPOA 4AZCB 4M82A 2CKRA 3AFBA 5A3HA 1BQCA 2A3CA 4DWSB 1YHTA 4MAZA 1MQQA 4HMDA 4BQ4A 1TE1A 3AYSA 4OBSA 2EPOA 5BXSA 5JBFA 2CBJA 2J8GA 3MV11 1JDAA 6A3HA 2J8FA 1TVNA 4HPGA 2J7EA 1BG4A 3F5JA 2UY3A 2J75A 1E55A 2WMIB 2CBIA 1J0YA 1UD6A 3VDHA 4QLKA 3GH4A 4GO9A 2HVMA 5A6BD 1J0JA 1ISWA 4CCDA 1G1YA 2VZVA 4CGTA 1AQMA 2E9LA 1NP2A 4CCCA 5CSYA 2WK2A 3WNOA 4OIFA 1BLIA 4W84A 3CBWA 3ARRA 1CXEA 5M17A 2XGBA 3SUWA 3L4WA 1GONA 3FXYA 2E0PA 1M03A 2PWHA 1CIUA 4H04A 1PJ9A 2WLYA 2BFGA 2X0YA 3VIPA 4OUEA 3UCQA 2QHAA 1R86A 3OLEA 3RO8A 1UWTA 1VFUA 3EBVA 3ZQ9A 2MANA 3SCWA 2G41A 4Z2LA 4S3KA 1WZAA 3FN9A 2A3HA 3WDHA 1UWUA 1G9HA 4J3XA 1KQYA 3ZJKA 2OWXA 5BRPA 2PF0A 4GZJA 3CUIA 1C3FA 2PB1A 2XSAA 4ATWA 1E0WA 1TA3B 4B16A 5E6ZA 2J62A 1LL6A 1JFHA 2XVKA 2V5CA 4UFJA 1MWOA 4UZSA 1KWGA 3AIQA 1V0KA 3WF1A 1EH9A 3VIHA 1CXFA 3W29A 3L4UA 3VGFA 3K4AA 4UFKA 1UR2A 1HT6A 1HP5A 3QGVA 2BNJA 4D6HA 1BG9A 1CLVA 3WH8A 3CMJA 2CESA 2D24A 1UUQA 1C7TA 4UOZA 3A4AA 5E09A 1QNRA 1MFUA 4TVUA 3L2LA 1UR8A 1ESWA 2XYLA 1DTUA 3O6AA 6TAAA 2DQXA 1TG7A 3WBEA 3SUUA 1FH9A 1FFRA 3WD4A 1JD9A 1V02E 3BAWA 4AD5A 2ZWYA 1IT0A 4JKMA 4OBRA 1VFOA 3BAYA 2ZIDA 1RP8A 5CJ5A 1N82A 1EOKA 1EOMA 2JIEA 2VL4A 3BAJA 3VKKA 4UNIA 1OINA 3WNLA 5FL1A 1CDGA 4GINA 3ARUA 3CLWA 3CUGA 5IHRA 2ZICA 4MNLA 3VGHA 4JKKA 2GK1B 3TONA 1XYFA 3NIYA 1E1EA 5FL0A 3AXIA 4CD5A 4L4PA 4DWSA 2J47A 5FCZA 2E3ZA 4ZFMA 3WL0A 2ZX6A 1XSJA 3B9DA 1E0XA 3SCNA 3MKKA 1HVQA 3AMCA 3OZOA 3VMOA 1OIFA 3WH9A 1W2PA 4P7RA 3KE0A 3II1A 4LPCA 3PTKA 4AZCA 4MJ4A 3VD5A 1E4MM 3O9NA 5GNXA 1V6VA 1G01A 2WM0A 4Q7NA 2J7CA 3WMSA 4XZBA 2YL5A 4NI3A 3VNZA 1W1TA 4JCLA 4ZENA 3HJEA 3WEOA 2VTFA 3GM8A 4AMCA 5FOOA 1LWJA 3W28A 1HP4A 1W3HA 3SCTA 4IUGA 2WMGA 2J4GA 2GJXB 3ARWA 4MNJA 2WZHA 3ZJ7A 4NRSA 1XSKA 3WQ8A 3AXHA 1ISYA 1EDQA 4IISA 4L4OA 3VIKA 5DMYA 4GPNA 3RIKA 2VCCA 1EQCA 1C8XA 1XC6A 5FKYA 1I1WA 3VMPA 1ISXA 2WVVB 3GTNA 3DYOA 5AY7A 4P7NA 2WHLA 3T09A 3WFZA 3NSXA 2X09A 3K8KA 1BF2A 4U3CA 2DDXA 1LF1A 2W62A 1DHKA 1QNPA 4M29A 2G3MA 1CXIA 4XX6A 3VD3A 4PYSA 1GZJA 2WMJA 1CNVA 4WJXA 4TOQA 1WP6A 3KL5A 5EMYA 3PHAA 8CGTA 3MUIA 1UH2A 3WQ5A 1CTNA 4J3WA 1BGGA 3ZM8A 1C8QA 4EK7A 2BHYA 2YJQA 3FHQA 4EE9A 2WCAA 4EANA 5CG0A 5D9NA 3WF3A 3CUHA 4A3YA 2F2HA 1WDSA 1QHZA 3WQWA 1JZ3A 4DM2A 2WPGA 4NRRA 3FW6A 1KWKA 4GKLA 3VGEA 3RJYA 1NWTA 1E73M 1B2YA 2UY2A 2X05A 1PX3A 2FH6A 4PMDA 4HA3A 2BVTA 1VRXA 2YA2A 3UETA 5JIWA 4J7RA 3AIEA 1PAMA 5C70A 2FGZA 1QHPA 8A3HA 1LQ0A 3T08A 5JUVA 5AYIA 4W89A 2AAAA 1E4NA 1V3HA 3CZKA 2F61A 2VZSA 4TTGA 2OYMA 5E9AA 1BGAA 1J18A 3WDJA 4Z2GA 3BAIA 1PX8A 2D3LA 5D9PA 1GJUA 2YA0A 4AIOA 2BV9A 2J7HA 3BC9A 1GOQA 4AYSA
chains in the Genus database with same CATH superfamily
1YEYA 1ZJAA 4O1BA 1V5XA 3M7WA 2RGMA 1UQYA 1TWZA 1EWEA 1TZ7A 2WJEA 4P2VA 5F4SA 1Y0EA 3LG3A 2XSXA 2OQYA 2FJKA 5LNVA 4JNYA 1UQZA 2E28A 2A1YA 1UZ4A 3M9YA 1TPH1 4H9XA 1GOKA 4ZE4A 4ERAA 3W71A 2WZEA 4TR9A 4I5UA 4G7FA 1GYLA 1DKWA 3M43A 5T9CE 2DT1A 4Y9OA 4IQLA 1XFCA 2Y88A 1EZWA 3DEQA 2WCSA 3TOPA 1FWJC 4V1XA 2GDUA 3NPUA 3GXNA 3G1DA 4E2OA 1F6YA 5I00A 5F2MA 2YW4A 4EKJA 3OODA 1UBSA 3M0VA 3VXGA 1GQIA 1UA3A 4REQB 2I17A 1Z89A 3ARTA 2PDQA 1KLZA 2RUCA 1BYCA 3R12A 4Y96A 1R5YA 3W6LA 1QW9A 4DJFA 4K7VA 4DLFA 4JBRA 1E6NA 4W9TA 3KOWA 4W88A 1Y8BA 4LS0A 4HD5A 3E02A 3BOLA 3E2RA 5JXQA 3RU8X 1L0PA 4GJ1A 5FJOA 2QMKA 4DPQA 1QPNA 2DZUA 3QZAA 4WOQA 4H9VA 5LXEA 4TUFA 1K9DA 3W1NA 1B3OA 4GVFA 1LQ2A 1HL9A 1VJIA 4DJDA 2XFYA 1KGUA 4Y90A 1DTNA 1OGSA 5DO8A 3DZ1A 4C91A 1GORA 1V8EA 4PRWA 3WUBA 4MGVA 1YBQB 3CTTA 3NTYA 1FKRA 2BVWA 4F48A 2GGGA 1TCMA 1KD0A 4EIVA 1G94A 3K46A 1NARA 2OX4A 4C6NA 3Q58A 1XG3A 1E9IA 2DZXA 2I5GA 4PTNA 1KFJA 1XIIA 2ZZ4A 4DLMA 1OVDA 3LHZA 2QMJA 4LWWA 3EMQA 4J2PA 1KR0A 3V5CA 5LIXX 3WLJA 4HB7A 1YDYA 4PUWA 4B5XA 3EDKA 4A8NA 3UYCA 2A85A 4D72A 4LAZA 2YCKX 3M7SA 2W91A 1JL8A 3CT7A 2PDPA 3I3DA 2NQLA 4FMVA 3O8AA 4MJZA 5LIUX 3HFYA 3N9SA 3F2CA 4OOZA 1ECEA 2PC8A 5D03A 2QZRA 6CGTA 3F4VA 1HKMA 5I77A 2PS2A 4JX6A 1Z7AA 4KETA 5K4XA 4TQTA 4UQEA 4YVVA 1K7EA 3VNIA 1LDCA 1ZAJA 1OYBA 3JZUA 2GGJA 1H0IA 2VDIA 4OKDA 3VIFA 3NSNA 3VVGA 4GD0A 3A4JA 3KWSA 5I2UA 4IQEA 1KM1A 4LGXA 1WB0A 3UR7A 2WWDA 1R7AA 4JYSA 1EP1A 3QQ1A 2GGEA 3SCSA 3JYJA 4EPEC 2EPLX 2YFNA 2QJMA 3GVWA 4M1BA 2QUMA 1W8SA 1B30A 2IPWA 2YGYA 4Q7IA 4DUWA 2C16A 3WLSA 3GXIA 4XZHA 1OCQA 2CZ5A 3UI6A 1NDZA 2IXUA 1AQHA 4HARA 2BOFX 1U1JA 1XR2A 3QFEA 3CUZA 3F7JA 5FIPA 2WJZA 1F3EA 3R58A 3UA3A 7CGTA 1XX1A 1W3JA 2NX1A 1B6CA 4Z0JA 3GPKA 2ZR4A 3S5NA 4Z17A 3HFTA 4ZXOA 4E8CA 4MB1A 3ALFA 4C6LA 3PWGA 2R9RA 1OHLA 2B31A 1US0A 5DIUA 3MS8A 3ZOAA 3N18A 3TCZA 1KW1A 1FKDA 3HV9A 3OTRA 4FLOA 3OP2A 1GZGA 3E0VA 1LLOA 1F8AB 3BGJA 3KZ7A 3MKVA 5RUBA 5F1UA 1ONWA 2VDGA 3CZJA 3QBUA 2E25A 2PURA 1W1PA 1Y7VA 3VKAA 2CZVA 1BSLA 1S2WA 3FA5A 3O16A 1FHDA 4R88A 2WCGA 1L6SA 3KFTA 1RY8A 1AVAA 4YTQA 2B81A 3BCDA 3LGDA 3N73A 4LV9A 5EMUA 5EBUA 1IE7C 1MXGA 3VA8A 1BEUA 1TX0A 3O6YX 2YL8A 2Z1KA 1XG4A 2XH0A 2D0HA 2Y85A 1W91A 1OF6A 4QSFA 5CAHA 1PEZA 3F2DA 1WZKA 1XH0A 4HTYA 4QIUA 3MYPA 2BG5A 4XKYA 2XIMA 3P7YA 4D8AA 3M0XA 3V5FA 1QWKA 5K2ZA 1NP0A 1TPUA 2ZUWA 4EP8C 3TFXA 4GC4A 4LBSA 2D73A 5CPNA 4HP5A 1A5NC 2OX1A 4IP4A 3JU2A 3URQA 1GT8A 3SBFA 1PX4A 4LF1A 1RY0A 3SCOA 2WVTA 4AZBA 3CB8A 2ALDA 3WQFA 4O57A 3EIPA 1ITQA 4PTMA 3A47A 1E5NA 3PTMA 4XUYA 1Y65A 4DZHA 5F2LA 4Z1CA 3N04A 2PDGA 5HQLA 4HMEA 3N15A 4QM1A 1NFBA 4LUTA 1ROTA 1ZHAA 4G1NA 4GFSA 2ZXQA 2OLHA 3UR2A 3RR4A 3FFSA 5I7GA 2YX0A 3UJRA 2YB1A 5LGXA 1OF8A 3AYRA 1F8IA 5FESA 4X60A 1FAPA 3VKBA 2X7VA 1A5AA 3C2EA 3ARXA 3IV8A 3KVKA 1KCLA 4QDMA 1K7FA 4DRSA 1GW1A 2P3ZA 3NZPA 4B5TA 3OGVA 2DPEA 2VELA 2FGLA 5DF0A 1TV2A 2KE0A 2MPHA 4XB3A 3TTEA 4L1WA 1CI1A 1P48A 4RZ5A 3RX3A 3GK0A 1FY6A 5EMMA 4DXVA 2O9OA 3FJ6A 1U5JA 5D09A 3O0FA 1V03A 3RMEA 2D0GA 4PB4A 3CWOX 3VOFA 3LHUA 4O16A 1AMKA 3ARYA 4NZCA 1SYTA 1UWSA 1ZSXA 2J7FA 2ZC1A 4J2MA 1ZBKA 1TPB1 3CU2A 3WK3A 5A6JA 4H8HA 3VU2A 4E2DA 4GIYA 4GYFA 1K70A 2GQ9A 3SCVA 3T1GA 2GWNA 3AMGA 3SY1A 2B7QA 2Q8LA 3H54A 2Z1XA 3OA5A 2BXZA 2I16A 5J5RA 1JXJA 4GQRA 3LOTA 2J79A 5ABFA 1G67A 4BF9A 4MSPA 4A3UA 1ZJIA 4W8LA 1FP8A 2ANUA 3SUVA 1W1VA 2RKXA 4XD4A 2J6XA 2WO5A 1N1AA 3C2RA 2Y89A 1LOLA 1YPFA 3W86A 3W07A 3WEMA 4PBGA 2X40A 1W5OA 1EDGA 2PBCA 1PXGA 4CNOA 2WM1A 3CL6A 3FVMA 2POZA 1JZ4A 2V2DA 1RK5A 4JTCA 2B0MA 2J77A 1VPYA 3GIQA 4IPXA 1JCTA 4XO7A 4JTSA 2MLYA 3RGCA 3NG3A 3CV6A 2EXOA 3F4NA 2G3IA 4KEVA 5FSEC 1IZJA 1MXDA 1OCNA 4GI9A 3DUGA 4ES4A 7REQB 1Q6QA 4FLRA 2DY3A 1LQAA 1B1YA 1TUFA 1V6TA 5C71A 3IGUA 1SJAA 3G6LA 4S3CA 1IT8A 4A8LA 3W7QA 2WNWA 1HG3A 3S42A 1R3RA 3VO0A 4NZFA 4TVCA 3WBWA 4ADUA 4L56A 2VENA 3O5PA 2CYGA 3DFPA 1V3LA 2PWGA 2C15A 2IPGA 3N19B 3CQJA 3KVLA 3MHGA 4FNUA 5AFDA 4JGDA 4PH6A 4GXMA 2PTWA 4P5UA 4CU6A 1UUOA 1ZP3A 2OYKA 5E1QA 4O52A 3CIWA 2POTA 1P1MA 1LM1A 3HGRA 3NM1A 2QJNA 1VGAA 2VWTA 1UZ1A 5LIKX 4B4FA 3H2AA 1A5CA 3M1ZA 4CCEA 2ZZ7A 2ZQVA 4QJ4B 2PWVA 1ME8A 2GJLA 2ZUMA 3CTLA 1GWJA 4PUDA 3SCQA 3CGTA 1D3GA 1YTKA 3W1LA 3NPXA 1BHGA 1R3WA 5HXMA 5LZLA 2PZ0A 3I68A 1V7AA 4FX7A 4BF7A 1KXTA 3STFA 2GJRA 3DGBA 5AHLA 2QF8A 2W27A 2BY3A 3ZR4A 4C6BA 3LLXA 3P0XA 5HPCA 1Q4NX 2GOKA 2EBNA 5A6BA 3PZMA 4EOUA 2X1RA 3L4TA 2DZSA 2X8RA 2CHNA 1L9WA 4Q4MA 1LBFA 2Y7DA 3BDKA 4RZBA 5PTDA 2FB3A 1WDQA 5K3VA 3TMQA 1RLCL 5T26A 4N9EA 1H5YA 3GFYA 2QPXA 4BCEA 3Q65A 1I75A 3A23A 3UXAA 4AW7A 1YKWA 1P5BA 2KR7A 2ZUUA 3U7BA 1IQ8A 1PZ2A 1ICQA 1SMDA 4JIEA 4PMOA 2J7BA 4KQZA 2PWFA 3MZ2A 4ASTA 1PCKA 2PP0A 3LRKA 2H9AA 5AN7A 4MKNA 3DOPA 3RYSA 4FIRA 2PDUA 5IBXA 1T8QA 1DWAM 1TIWA 3WX7A 1FHLA 4K68A 3U48A 2AGTA 1JYVA 2W63A 3UF9A 3SW6A 1W1IE 4YXGA 2ACRA 4DYJA 4DJFD 1XKJA 4DZIA 1SZEA 2J6VA 5KEZA 3A21A 3NJ3A 2P4VA 4CD8A 2O7QA 3FNDA 3PM6A 5FSDC 2JFEX 5A6MA 3SJNA 1L6FA 5EMLA 4JZ5A 3LX9A 3QVQA 4S39A 2O9TA 5TIMA 3AICA 4IQ2A 2G95A 2W61A 4DRHA 4PSRA 4S3JA 4KKXA 3MBDA 1SJBA 4O8RA 2QUTA 1HZYA 2YZ5A 1UZHA 4GC3A 4PUKA 1PTAA 1UKOA 3UW6A 2FMNA 4K39A 4HOXA 3N3MA 1K4HA 4BHYA 1GW9A 2LPVA 3NCOA 3NQ6A 5CSRA 1UR1A 1W9VA 2GQAA 3ABRA 2QVHA 3FIGA 1RQEA 3A3HA 5EMKA 2Y62A 1JYXA 1TJ0A 3EWCA 2VR5A 5CBIA 1T96A 2NQ9A 5IDIA 1W9UA 2QCFA 4IGNA 1TV7A 4LCSA 2W66A 4KIEA 1PZ3A 3OVGA 4OOUA 4LF2A 1K7XA 5EFDA 3RX2A 5I5RA 3TCSA 1E4LA 2C1HA 2DV0A 4NP7A 3UWWA 3BMBA 5C9ZA 4JX5A 2JF6A 1JI1A 3MDYB 1UWAA 4WKFA 3T2QA 1OFOA 2I5QA 1UR0A 2IUZA 3N29A 3NYDA 5BMXA 3WELA 2A3AA 3THDA 3O5GA 3S0CA 2PSNA 1LWIA 3RITA 3IK4A 3R7MA 3SDOA 3LDVA 4KEMA 3VAWA 4DRKA 3RLHA 3S6OA 3NSMA 1FKXA 1UBPC 1UYQA 3AHXA 1JCNA 2VMFA 4P8XA 2PRLA 4L4MA 2BS9A 3EPOA 1UR4A 5C0QA 3HQNA 4AWEA 1ONRA 2JEQA 1JUKA 3PR2A 2VI0A 2GK1A 1XCWA 4W4QA 4PODA 8XIAA 1QI3A 2PI6A 4GUFA 4DROA 3PFRA 1KM5A 2GDVA 2VC5A 1JZ6A 2HE5A 1KTNA 1TPFA 4LB4A 1AH0A 3WLLA 4DZ3A 1VCVA 3P8IA 4D6EA 1GYNA 4C1NA 1A50A 1LUCB 3E5BA 1X7IA 3BW2A 3H2FA 3MVTA 1U5HA 2J7GA 3UG4A 5AYXA 1HIZA 4C7DA 1E5JA 2DUXA 4ZOCA 2AL1A 3LY0A 3PZVA 1UWIA 3Q94A 4GNJA 5AHMA 2M1IA 3SUTA 4ZO6A 2BLEA 5FJUA 3GH7A 3TCEA 2X1IA 3CUXA 3QC3A 1JPHA 4WSHA 1H50A 1QW7A 5DT7A 2NSXA 3ZSSA 1KV8A 3MKCA 2ZZ2A 1BPLB 1CCWB 3LM3A 3C0JA 2PZNA 3KP1A 1BXNA 1H41A 1UB3A 3EOOA 1JZ5A 5AECA 3FV9A 2OXNA 2D2GA 1W3KA 4LVFA 4LRTA 1TTQA 4KWVA 3CHEA 2E8YA 4NJJA 5H8PA 1KRBC 5I3KA 3OZPA 3BUVA 2EEXA 4KFPA 1GHSA 4F2BA 1YW5A 3L4ZA 3BMXA 3B8VA 3YPIA 1KBBA 4LEFA 1MEHA 3COTA 1TFVA 3UZJA 3PZQA 3BICA 3GNOA 3KOXA 5D8WA 3JVAA 3P67A 3HO8A 4AXNA 1TTIA 1WE5A 2Y5SA 2KFWA 3IK2A 3GG0A 1FCQA 3N6JA 1K8XA 1S3HA 1EC7A 1E9YB 4ZTYA 2OOFA 2W6RA 1AJ0A 4JN6A 4M56A 4X0VA 2FDSA 3FAPA 4UC5A 1EPXA 1VD6A 1ZBVA 4PN2A 4BQ2A 3K5XA 3TAOA 3M16A 3CT2A 3W2JA 4L72B 1LRNA 1BSIA 2FPTA 1RCOB 4NIRA 3M46A 1X96A 2Z6JA 1PVNA 3PB0A 1FHVA 2FZBA 2V3FA 3BJFA 4ORMA 2ZX9A 4DQWA 2KO7A 4Q33A 4AEFA 3TE9A 4GQBA 3U8GA 4AC7C 1XFBA 1A5BA 1OX4A 5KITA 4IWWA 2CERA 2EHHA 4Q6JA 1P5QA 4AFYA 1E1FA 1OFPA 4TX8A 1T7LA 3NYZA 3QHNA 4NILA 4X2RA 3HV8A 3QPYA 1GVIA 2OEJA 2R94A 3B8DA 2YL6A 4H8NA 3WH7A 1R9XA 4HMNA 4FK9A 3BLEA 4Q8PA 5I3IA 3NL5A 1EEXA 1S5MA 4ZFCA 4Q4PA 4GX9A 1Q63A 2AOSA 3RM8A 3M0LA 1JVWA 3N3TA 5TAOA 1ZUAX 3FAXA 3U4FA 5REQA 4JFIA 2Z1BA 2XIIA 4C7FA 3MP4A 1DEDA 4GY7A 5B80A 4F2UA 3EPMA 3QV7A 2DW6A 4XD5A 4XZNX 3IJ8A 2D20A 4C1LA 5BNKA 1GK8A 2ZRUA 4PTWA 4FXJA 2QCDB 4HOWA 5HMFA 1TJRA 2WQDA 4K36A 3B0VC 1ZAHA 1U33A 4NHVA 4JFTA 2FZ9A 3MQTA 3UY8A 4GGQA 3FKRA 3EY6A 3PUEA 1US3A 4AY7A 4GI6A 2ZRZA 5JVLA 3GDTA 4Q8VA 5IHSA 3OIXA 1JQXA 2UY4A 3H2NA 3ZYZA 3RK8A 3PVFA 4EF9A 2WMFA 2JALA 1HJSA 1BAGA 2KI3A 4JL1A 3AIVA 3CNYA 3ENLA 4Z1DA 4INFA 2BGNE 1K02A 1WZMA 3P60A 1ZL1A 3O5IA 1XICA 4BJHA 1QDSA 3OG2A 4ZQCA 4JTQA 3FVDA 2CW6A 4JTJA 4MF4A 4D6CA 4IJRA 1GVFA 3F1QA 3MJMA 3GXTA 4UQDA 3NGJA 3B8SA 3VKDA 1EJWC 4L65A 1EZ2A 1XPGA 5JIPA 3OBKA 1TMQA 1EHNA 4ORIA 1DBTA 1LL4A 1PKMA 5A95A 2ISVA 1JZ2A 4N42A 4F9JA 4J3TA 2PFHA 1XUUA 1IWPA 4P7QA 3WUFA 3GXDA 4JTKA 4RV3A 4FX6M 2REQA 1AJZA 4O14A 3FHAA 2INEA 2XH4A 4I8DA 2CXEA 1CYGA 3BSGA 3KHDA 2NX9A 3EGJA 4I7UA 3VIOA 1LBMA 4GZIA 4GQ0A 3LTPA 1XLJA 1D7JA 2G0WA 3WJZA 4MB4A 3BLFA 5AKQA 3OYZA 1JQVA 4FA3A 4O15A 2GUBA 4EWJA 5DT5A 5HTGA 1XQLA 5LNRA 1LORA 2FHFA 1XLDA 2ZADA 1EC8A 4HU3A 1Y5VA 4YL2A 4IZGA 3MANA 3MA8A 3FYOA 3W1TA 2XU2A 1GCYA 1H62A 4W8BA 1C91A 3W75A 1RP9A 3PZTA 4WEVX 4PMNA 4MFEA 3CH0A 4PZVA 3O05A 5IFTA 4GIRA 1K77A 2G50A 3O5EA 4I9JA 1S2UA 2VYOA 2ZBTA 1MI3A 2OODA 3BL3A 1GG0A 1Q6CA 4ZPWR 1J6PA 2YKKA 2LGOA 2FJUB 1A0CA 1CT5A 1TO3A 3PC0A 2E7FA 5D2YA 3TXZA 2HV5A 2PDIA 5DELA 3KOFA 1JI2A 3GDRA 4DAIA 4OGZA 4TW7A 2PV1A 2J78A 3M6YA 2WPBA 1LWHA 1ISZA 3W82A 1KBIA 4Q8UA 4JEQA 1TVPA 5LA1A 3GR7A 2H6RA 1KV5A 1Q5MA 4H9UA 3WBYA 2ZXDA 4IGSA 3LERA 1AL8A 1K8CA 1Q4WA 3IS4A 2INFA 1QNOA 3A6OA 1T99A 2YYTA 4N9DA 4HJWA 1TELA 1SW7A 3SRKA 5AC4A 5BOOA 4I8YA 1KM2A 2DH3A 1V93A 4FR6A 4ODRA 2V30A 3L0NA 4CQAA 3GDLA 1BKSA 1N2VA 2VUYA 1OZQA 3MI3A 2OPJA 4ROPA 3IJDA 5EBAA 4UTMA 1LZOA 1F7BA 4LAXA 4BWLA 2Q01A 3HPSA 4CEUC 1M53A 1VBRA 1ZY9A 2CXGA 5EMJA 3C2OA 2B4GA 5CZKA 4Z2IA 1MQPA 3IJIA 3GXFA 1J2WA 4FOUA 3RPMA 5HJXA 2PLJA 2VWSA 3AS0A 3OJGA 4ZE5A 4NAEB 5ABHA 4Y7EA 2DFAA 4HNLA 3NPWA 2FVLA 4N0RA 2ZUTA 1WXYA 2VXNA 4A35A 3INPA 3GW3A 1FWRA 2WSYA 1LT7A 1BQCA 2A3CA 4DWSB 1YHTA 1C29A 3RLUA 4BQ4A 1ZK6A 5J6EA 1H7PA 3NQ2A 3KW3A 4NQ1A 5BXSA 2CLFA 5JBFA 5LHFA 4XAYA 4HPGA 5DO2A 2V82A 4Y6GA 1BG4A 2E5CA 2UY3A 4N9BA 1E55A 3DG6A 3NNTA 1J0YA 3VDHA 5HWCA 3BWWA 2QJIA 1N55A 4GBUA 3DU0A 5CSYA 3W1QA 3WNOA 4NZ1A 1JRCA 4W84A 3CBWA 3ARRA 5F2IA 3HGJA 3KLKA 1CXEA 5M17A 1GONA 4Q8MA 1ICSA 2TMDA 4X2PA 3EX6A 1CIUA 1PJ9A 2I56A 3HJZA 3VIPA 4OUEA 3CL8A 3UXKA 5U7SA 3RO8A 1T11A 1GQNA 1UWTA 3SCWA 2AAMA 2G41A 4Z2LA 3H26A 4LALA 4G9PA 3MUCA 4M6QA 1KQYA 3QYQA 1I2OA 3ZJKA 3LZ5A 2OWXA 4QS5A 2PF0A 2ZKMX 1N8IA 3CUIA 3OO2A 2PB1A 3KCLA 1V51A 1E0WA 4QDWA 3T07A 5E6ZA 4AF0A 1VH7A 2J62A 2PODA 3IARA 2PDCA 5CCZA 1IWAA 2J88A 1EH9A 1U83A 4ZODA 1VBGA 1PV8A 3G1VA 3IIXA 2PDHA 4IT4A 3W29A 3AXMA 1VYPX 2FZDA 1SJDA 3VGFA 4HTBA 1UR2A 4R85A 5A6TC 4D6HA 4LRSA 1BG9A 1CLVA 3O6DA 3SAZA 1OFQA 3WH8A 3CASA 3CMJA 2D24A 3O06A 1C7TA 8XIMA 3N2MA 3EKZA 1QNRA 1ESWA 3ATZA 2QVNA 6TAAA 3P74A 1NMWA 2DQXA 3EXRA 5LIWX 3OPSA 5HW6A 3R8RA 2ZRWA 2DZAA 1I2PA 1V02E 4AD5A 1EXBA 4JKMA 4OBRA 4KIRA 2R82A 3I4KA 2ZIDA 4N19A 4JTLA 2Z24A 2JIEA 4IXXA 2VL4A 3WO8A 1OINA 3PNUA 2GQ8A 3SY5A 4GINA 4IGHA 2VOMA 4ZVJA 2ISDA 1J6YA 4FAPA 1ZCOA 4Y8FA 5CC5A 1SPQA 3TONA 3NIYA 3KOZA 5FL0A 4MVAA 2ABBA 4L4PA 2J47A 2E3ZA 2ODOA 3WL0A 3W70A 4QQ3A 4MY9A 3B9DA 1E0XA 4UTKA 1QPLA 3MP5A 1HVQA 3NL2A 4DRIA 1OIFA 2BTMA 4I7WA 5K4ZA 4HSHA 4L80A 2I9UA 1ZPTA 1IGWA 4MJ4A 1E4MM 1FKWA 3O9NA 3S5YA 5C9RA 1FRBA 4CQDA 3UJEA 2WM0A 2YL5A 4NI3A 2XPAA 4AX7A 4CNNA 4ZENA 3UPMA 3KXQA 1REQB 1LP6A 4WY0A 3AU6A 1W3HA 4TX9A 2OQHA 4IUGA 3SCTA 1JUEA 3DDMA 4MNJA 2WZHA 1KCZA 4ZS6A 1ISYA 4O0ZA 3OBEA 5D04C 3H2OA 4GPNA 3AC0A 3PAOA 2VCCA 2E77A 4ODKA 1XC6A 2B7NA 4NXSA 4TMCA 2B5UB 3K4WA 4F0HA 4U85A 3B04A 4P7NA 3FGCB 3T09A 2RDUA 2Y8UA 3TYEA 3UZWA 3DHFA 2X09A 1OX5A 4H19A 4BFAA 2V8ZA 4E5TA 2F21A 2OGJA 2QIIA 4F4RA 4M29A 5JMUA 4MUPA 3B97A 3GC5A 2QCGA 3VD3A 3FXGA 4EXQA 4BI6A 2WMJA 3CS2A 1PKLA 3TQKA 3QLDA 1BGGA 1H1YA 1XI3A 3T8QA 4EK7A 2BHYA 2FVMA 3DCPA 3R0DA 1RBAA 5DN1A 5LGZA 3WF3A 3CUHA 4O19A 2F2HA 3N2XA 5C9XA 3WQWA 1GJPA 1TZZA 2DZBA 4ICNA 5DMMA 3ITOA 1PTGA 2DU2A 4GKLA 2GGHA 3VGEA 4GUIA 4XKMA 3QGKC 2RH9A 4E3VA 2ZRXA 1X39A 1VRXA 3UETA 2QCCA 3AIEA 1PAMA 1QFEA 1P6CA 3ES8A 5EPDA 1XIFA 3W9ZA 8A3HA 4IMGA 2DZVA 1EJTC 4O18A 2DW7A 1A4MA 2AAAA 3W7LA 4L64A 1E4NA 3V16A 3CZKA 2F61A 5HNRA 1BGAA 1P0NA 5JU6A 3TJXA 3BAIA 2VKZG 2D3LA 4D8ZA 4WDWA 4PUJA 3A9BA 4C6CA 2J7HA 3BC9A 3ZZ1A 1XYBA 4AYSA 1XRSA 1OIMA 3ARZA 1ZCCA 2QR6A 3D0CA 2OSWA 4XTDA 3ECQA 3SECA 2ZDSA 1W5NA 2GDQA 4J1OA 1EX1A 3QN3A 4S23A 4U33A 1NF0A 3CQKA 1FDJA 4B4HA 1W5QA 3AYTA 1C8VA 4FXRA 1Q7QA 5I79A 1HVXA 1QBBA 1QOQA 4JOMA 3E1F1 4M24A 2X1TA 4MY8A 5AB3A 3P6LA 1I8JA 1A53A 2A7RA 3O0KA 1ZGDA 4ML4A 2F9RA 2Z0IA 4H6EA 5D2TA 3LGGA 1E72M 3ERPA 4R27A 3NZRA 3CQ0A 3P8JA 3SQSA 4O1FA 2Y2WA 5D4YA 1J5SA 3NGFA 3T2OA 1SFSA 1H1ZA 2PWUA 2QCMA 3RFAA 4NNAA 4CU8A 1YTEA 2QDHA 3ES7A 3DYPA 2XVGA 3AXXA 3LHVA 1Y5WA 1VP5A 3BMWA 4LYPA 2PC4A 2OLSA 1W1A1 1DJYA 1NQ6A 3E12A 3LD5A 2ZE3A 4YNGA 2XZ9A 5JBDA 1THFD 2VX6A 3LPGA 4FS9A 3M0YA 3S1WA 3EMZA 3G1YA 3VZXA 1E0VA 4EPBC 3VD9A 1JD7A 1RD6A 4FNTA 4O50A 2Y70A 5A6KA 3MSGA 3P2VA 2P50A 2Y7EA 3BG9A 3MSDA 3EWDA 3BMVA 3C86A 3OLDA 1DJIA 5FI8A 1GOIA 2PDXA 1RBLA 1K9TA 1YW1A 2C71A 1EA0A 1XXXA 3N4EA 3RRAA 2EKCA 3WMCA 4CNTA 4IOTA 3ZWTA 4NX0A 3MMTA 2YYUA 1J11A 4D6JA 3HF3A 4AZIA 4H3DA 1J96A 1H63A 1OYAA 4UR8A 3VILA 1IHIA 2JK2A 2VX5A 4DM1A 2EG6A 4LBUA 5HDRA 4GISA 3L4YA 5AVNA 3LGEA 3EAUA 2FAPA 2VO5A 5EGRA 3O63A 5BCAA 2XM1A 5IFPA 2RQSA 2XN0A 1PB0A 2WC3A 3BTNA 2KZHA 4HHLA 2FLIA 1D6OA 6ENLA 3O5FA 2EJ1A 4ENLA 5CBBA 2ZWZA 3W02A 1UPMB 1DJGA 1G4SA 3VC5A 1ADDA 4R33A 3QSRA 2QAPA 3G0UA 3I10A 1MNSA 2RJGA 1Q6GA 3OB8A 1MRAA 1EJ7L 3N13A 3F03K 5FF0A 4MJMA 1ALDA 1YDVA 4IXHA 1EJUC 4C6OA 3A5FA 4DRMA 1NIUA 4O1AA 2ZA1A 3HG5A 4KGLA 3NDYA 4K8EA 1AZ1A 3GYCA 4JTRA 4HBOA 2ZZ6A 4NX5A 3HBLA 4OV9A 2FVKA 1CWYA 3SY8A 4OT7A 4NL1A 1VFHA 3O5OA 5DCBA 1N8FA 1QI4A 2A21A 3ME3A 3TNOA 4B5SA 5CPMA 4E8DA 3FAWA 3IKGA 2NVAA 4GWEA 4Y8EA 3U2EA 4HBKA 2AMGA 3R89A 5HNUA 1JCHB 3ITCA 4HIBA 4WZHA 3RM4A 3H9RB 2NUXA 4IPNB 1Q2RA 3SCRA 3XIMA 1HJWA 3VM5A 1MZRA 1OFAA 3WY1A 2VC6A 1SZNA 4O1CA 3V5OA 4DYKA 2EG8A 3DHPA 4B5NA 2PBGA 2BOEX 4L7ZA 4PEEA 1TWIA 3LZ3A 2J74A 2OEKA 3VFLA 1GOOA 3VNYA 2GPTA 2CLKA 3OQEA 4UCGA 3GUWA 4RLIA 4WY0F 2QULA 3T0AA 3EKGA 4HKPA 1PKYA 4JS3A 1Z44A 3FOKA 1GOWA 2Y8KA 4B2DD 3RO6A 2O9PA 1E40A 3QY6A 2YL9A 3UWYA 3IJLA 4N6FA 1Q3NA 3CO8A 1YATA 4ZSTA 4M6UA 1JNEA 2PD9A 4IPIA 2ZX5A 1OM0A 3ZT7A 5CQ1A 5BXPA 1WNOA 1ITXA 1QOXA 3LS9A 4IICA 2Z1VA 5C9WA 4S38A 1YDNA 3RFWA 4HK5A 3GIYA 4DO6A 2DJLA 3KVMA 3W1MA 2TPSA 3OYXA 1XW8A 3W22A 3UZ5A 1OT1A 1XLCA 2V3DA 5KSWA 4EACA 2KX9A 3WNMA 3EDFA 1DIDA 1TTPA 2NQZA 3NQ7A 4ACZA 3AALA 3PPFA 4X61A 2WB5A 4E2VA 3EPNA 5BXRA 4I9TA 1VCGA 1O5KA 1GEQA 3O07A 2Q02A 2C18A 1PIIA 4K37A 3LCFA 5DRCA 5LKYA 1N8WA 5D38A 4XZWA 1J4EA 5CC3A 4BR1A 3RILA 4A8IA 3HQOA 2FTYA 4ZL1A 3ARPA 4DZAA 1CGXA 2WVUA 4E8GA 4IMAA 1D3HA 4O2TA 4XD3A 4BF8A 4UOJA 2Y7GA 3FCPA 4JIPA 1W56A 3CHFA 2GSHA 1MYRA 3BVJA 2ETNA 4AD0A 4LH8A 2PV3A 3QQWA 3WNNA 1V02A 4U5IA 1E3XA 1Q85A 3RLGA 3RMJA 5CBJA 4XISA 1M7JA 3CZEA 3S2MA 5A1AA 2YCLB 1H7OA 4WDUA 4AB4A 2R24A 1XP3A 1Z42A 2WHMA 4LAUA 1I6NA 1GVRA 2RUDA 4CNUA 1IF2A 1QK2A 3GBDA 2YXXA 5C2CA 2PN0A 1OFBA 4XV0A 3VUPA 3Q67A 3S3GA 3THAA 2WNZA 1QMLA 3TTSA 5G4WA 1Q6FA 3VAVA 4HNOA 1W1B1 4R34A 5TD4A 2YR1A 4RW5A 3G8RA 2CWNA 3STPA 3QTGA 1VFFA 1FWEC 4G1KA 3CHVA 2DG4A 1TB3A 4QP0A 3KZSA 5KZEA 2G5WA 3UESA 4RNFA 3V35A 5TF0A 3PBWA 1K3UA 1W6TA 4J3VA 4GHRA 1NSGA 1X1NA 5AYYA 4UBPC 5A69A 2PGEA 3A13A 2PU0A 4UWMA 4ZBCA 1KB3A 1RJRA 4I5RA 2QCNA 4KMQA 3T4WA 1DWHM 4ZPTR 3CZLA 4TU1A 5H8MA 1LBLA 4HCDA 5FACA 1BVZA 5I0DA 2V3EA 1FWGC 5D9MA 3UWUA 2XPKA 3BQ5A 1OC5A 3IJ9A 4LJ3A 4Y9NA 5ABTA 4S1FA 2AKMA 3REQB 1W5PA 2V63A 2QIWA 2Z25A 1XD1A 2GVJA 2PDLA 3R5EA 9RUBA 1VAHA 1SSGA 4WOZA 3FDGA 2WQPA 1BYBA 3HPXA 3VKJA 4NJHA 4JKLA 2O0TA 1S5WA 1V3JA 4U28A 2FHBA 3B0PA 3MZNA 5JBEA 3C3NA 3UF8A 2RAGA 1XRVA 1K9EA 1QO2A 4RNIA 5FF4A 1XCFA 4P61A 5AHEA 3K8MA 5A8QA 3QHMA 1FKTA 4TV6A 3TKFA 2V38A 3DYMA 3A22A 4Q3MA 3UR5A 3GFZA 4PCTA 4AUBA 1HJUA 4GCAA 3NZGA 4UXDA 1GVYA 4WGXA 4UOQA 5G4HC 4REQA 4HHHA 4OWGA 3JW7A 4IT1A 4F3HA 2KGJA 3ARSA 2OJPA 2ZA2A 4QT3A 1TREA 2WKGA 2VVNA 3GIPA 4AD2A 4LUJA 2CWXA 1VEOA 4M7SA 1JNSA 3WD1A 2FDMA 1Z32X 2YXOA 3GNRA 3WMBA 3R13A 4QQUA 2XUCA 1XBZA 4ZO8A 3CWHA 3OHIA 3ONBA 1UH3A 2NX3A 1NSJA 2ZA3A 3KDNA 4I9AA 3CIVA 4MPKA 3B4YA 1EYEA 3N9KA 3ICJA 4X3ZA 3S5SA 4IPJA 1FKIA 3WG6A 1ELSA 4AIEA 5DXXA 4GIVA 5GPRA 1EQPA 2WMKA 3GHUA 4Z2JA 2IPJA 1JNDA 3WJXA 1JEZA 3BV4A 3MU7A 3O3RA 2HNHA 5AC6A 2X0SA 4A2SA 3TC7A 2VEMA 4A3RA 1I2RA 1WV2A 3L2MA 4HT3A 3I3BA 2E68A 1Q6HA 1GYMA 3N11A 4G7EA 4M6PA 1IR2A 3B05A 4X0NA 4NAFA 2MUCA 3MO7A 2GJXA 4H00A 4NKCA 3LCXA 3UZZA 3UP8A 1REQA 2JZVA 5CPQA 4ZPVR 5HNNA 4PUMA 4XVEA 5F4WA 3S2JA 1YE4A 1B31A 1I9CB 1KRCC 2VX7A 2VRJA 3DC0A 1IWBA 3APYA 2YDQA 1M5YA 4GYPA 1J2BA 1WXJA 2DQWA 4XBKA 3L65A 2D1ZA 3GWQA 2DG3A 1UD4A 5DMNA 3J7HA 1LJYA 3OHMB 2D3NA 2Q8ZA 3R8GA 1QASA 2PWEA 3A4XA 4AX6A 4K3ZA 3QOKA 3NQAA 2OWWA 3V4BA 4D71A 3NOYA 4IQCA 3BCJA 1DJXA 2YLLA 3FYPA 3IIZA 5HT1A 4BK9A 3LBCA 4JTDA 4NNCA 3DENA 3GXMA 3WD0A 3LBMA 3H7VA 1ZB5A 1UASA 2NVCA 3WD2A 4E6MA 1H11A 4B5UA 3CAVA 4PMXA 3CPRA 4TXEA 4A05A 4QGCA 4NUWA 3G77A 4JTEA 4HPHA 5HOSA 4HQVA 3REQA 3HU7A 5IBXC 2EKGA 4EPDC 4DZ5A 1V0NA 3D3FA 5B8IC 3GX9A 3OZYA 4PGLA 4MG4A 3WDRA 4IQDA 2PGFA 4MDOA 3H12A 3NQBA 4QE1A 5DCEA 5DBUA 2AWGA 3SCPA 4PCSA 3SFKA 2IS7A 3M0MA 2G8ZA 1B54A 3UA4A 2XWEA 4WQ6A 5I07A 1KQZA 1UMYA 4MOZA 1POKA 4KBXA 3MV01 1AW5A 4Q8TA 4WRHA 2J9ZA 2VFDA 4PSPA 3AZRA 3TXVA 3VCRA 3V7PA 5IDZA 3ZMRA 1FKBA 3AROA 5LYRA 3AJ7A 1W9DM 1AJ2A 1KCKA 4HPNA 4WXZA 5J8LA 1QPFA 2C7FA 2ZZ1A 4JXCA 3POCA 1XBXA 3AISA 2PDYA 1IGSA 4AY1A 4QLLA 5EY5A 5HUOA 2QV4A 5HNTA 2XINA 1EX5A 3BSMA 3ZJ8A 4LCQA 3W2MA 4B15A 4RDZA 3BO9A 5FJJA 3SN0A 2A0NA 3KVJA 1Q8AA 4MDPA 5CZTA 5DANA 3B4UA 4XZIA 1CGWA 1C9WA 2ZUVA 4IMCA 2QV5A 2RURA 3KWXA 3MJYA 3WL1A 2E6AA 1H7NA 3KM8A 4PL1A 4G56A 4E3TA 5KZ6A 3S1UA 2ZX8A 3W7NA 1MRQA 4Q8OA 2WVSA 3KS6A 4LVDA 1VB9A 2W5FA 3MW7A 3SO7A 3WFAA 1JG9A 4MKVA 5CZSA 3M6DA 3PULA 3MB9A 2Y24A 2UV8G 1XLAA 2FYMA 1WUEA 3TH6A 1QAPA 3SGUA 4JTGA 4DN1A 3O2LA 1TR1A 1W31A 3HPFA 4KW2A 1MO0A 2DSWA 1XLFA 1H0GA 4BY3A 5AC7A 2Z4GA 2IKIA 2FKPA 3JZEA 1BYAA 1W2VA 2WSPA 4IP7A 5GJPA 6PTDA 2BHUA 4AIBA 1SMAA 1T6MA 3W2KA 1MNZA 2DG9A 1XM3A 4I9MA 2VCDA 4JCMA 4W7WA 1B0IA 3TDBA 5LXXA 4TNSA 5T9BG 3RF9A 1I1XA 1QVBA 4HU4A 3WUEA 4UUIA 2IKGA 3KTCA 1FKFA 1DOSA 3ITLA 3H23A 2DSVA 2ITKA 1MZHA 1UR9A 1DIOA 1G4EA 1MEWA 2PTDA 3WQCA 3TTOA 3SEPA 4JY8A 1E6SM 1C8YA 1A0DA 4DEFA 4NNBA 3B40A 3M41A 4AXKA 3AHTA 3WSUA 1TKKA 4ZB0A 1EO7A 4UQBA 2Y4SA 4YCPA 2P0IA 1P1XA 1KXVA 5AZ0A 1TV4A 2VRQA 4IMFA 1SO3A 1FFQA 3CV1A 1T8XA 1IIGA 2SFPA 2QAFA 2ISSA 1KO0A 3T40A 3T0CA 1IZKA 1KBKA 1FDZA 3D6NA 3WQ6A 4FZIA 3DBNA 4DPPA 2OZTA 2PGWA 2C8NA 4PA8A 4Y9PA 1JPIA 4HCHA 4HCLA 3P82A 1W9XA 5D02A 1S39A 2XIOA 2ZUSA 2I5IA 4CN1A 2P3EA 2WLZA 4Z1AA 3OQ8A 3RM9A 3W7IA 4K7YA 3P5ZA 1M3UA 1VBUA 1PHWA 2CFFA 2CLHA 3TC6A 3CO4A 2HEJA 3ZVHA 2FH8A 3JUGA 1QATA 4QIBA 4HN8A 2EPNA 4MWAD 5K9XA 4EWND 4QLJA 2WKJA 4E4PA 2QUUA 1M41A 3LV5A 1WO2A 1EL3A 3AWNA 4MB3A 4YTRA 1E9LA 4AZGA 1JCYA 3N6HA 4DIPA 2ASHA 2BX7A 5D37A 1I4NA 1R38A 1FWTA 2QJHA 2G37A 3W6MA 4MJ2A 3QGAC 2AQVA 4KRZA 2WSKA 1B9BA 3BLOA 3VABA 4N7QA 3L0GA 4TV5A 2H8XA 3L4XA 5BU6A 1MW1A 2OO0A 2DVUA 3W24A 1F2JA 3OOQA 4F0KA 2JGYA 3IJ6A 3URNA 2Y8VA 1UD8A 2Y61A 1F3XA 2G3JA 3I6EA 4IG2A 1UR3M 2GYIA 5I23A 2F2DA 4XUGA 1YE6A 5E93A 3VGBA 2P5NA 3DHDA 1XINA 4RE4A 3VPLA 4ATLA 4PUUA 3W7MA 3BXWA 2HPMA 4PUNA 1HX0A 2Z1SA 1H49A 5A6AA 3ZS4A 1CZ1A 2A79A 1PBGA 5AYBA 5HK4A 2YCLA 4BEUA 3AO0A 3CJPA 4HZ7A 4DXKA 2F7FA 3O7UA 4GK8A 4GGHA 2DGAA 4KWUA 3E2VA 3GU9A 4AG0A 3KBSA 4J40A 5E0FA 3PSVA 3AIUA 4WK9A 1B3WA 2HSAA 3GY1A 3WNPA 3VDGA 4FOKA 1NWSA 3SZ8A 3N14A 4ONVA 4MWAA 2V9DA 3FLUA 4R7OA 4DJFC 2XIBA 2XPBA 3GTYX 1GVOA 2WW5A 2WC7A 5AHFA 1FUYA 2ACQA 2BWGA 4MB5A 2QPSA 3OBAA 4LXFA 3MWAA 2NZLA 4S3EA 4CVUA 1U1UA 1TJ2A 2HBXA 3KAHA 4PB3A 2FHCA 4JNMA 1Q66A 2QPUA 3EXTA 1FWSA 2OKTA 4AD3A 1XLHA 4GQGA 4F79A 2DZTA 1Q6IA 3W7EA 4QRNA 1HL8A 2YCEA 3DGRA 3EDEA 1EYMA 1R0MA 5DIVA 3DHUA 1KXHA 7ENLA 3BQ6A 1SR9A 3QY7A 1RQHA 4FOJA 3LN3A 3W83A 1Q65A 2PPPA 3WLRA 3N1AA 3CQIA 2VZTA 2A2IA 3KAOA 2NXHA 1QNSA 3Q2DA 4PCNA 1GQJA 3RG6A 4BZYA 1OQFA 3TC5A 2AGKA 2ESCA 4L61A 1QHOA 2Q8XA 1H4PA 2VC7A 1M6JA 1SUXA 1RQBA 1L8NA 1R3SA 3Q45A 3PRBA 4RZ4A 3WJWA 1EWDA 1OSEA 5G4EA 1R9HA 3MCOA 4GYPC 4WR3A 3WLHA 1V3IA 4HZ8A 5HULA 1FX6A 3EX2A 5DEZA 7TAAA 2C0HA 2Q3RA 2WYSA 4LNCA 3MBFA 2CLOA 1PWLA 4QTGA 1BFNA 3LHWA 1IR1A 2YIHA 3QEZA 3WQDA 3EWWA 1O4UA 3LXBA 5FF2A 3S1VA 4RV8A 3JS3A 4O13A 3KL3A 1UHVA 4JYDA 2HVNA 3CYVA 4DVOA 5FEWA 5FD0A 6XIAA 4HSNA 3BARA 2G3NA 2VN1A 4DRPA 1JCJA 1YDOA 1M7OA 1IT7A 1QPRA 3S2CA 4Q4OA 1ZZMA 2FKEA 4GO8A 5MHBA 2WANA 1F4AA 2CBVA 2W67A 2Q5AA 1NM9A 3IUDA 3WLQA 2FGBA 2LJ4A 4FI4A 4S3AA 1E6RA 2BY2A 5MF5A 2Y78A 2CC0A 3IGHX 5BYWA 2YW3A 3WQGA 2O7SA 1ZRQA 4HGXA 3SSZA 1V7YA 3NDOA 1HNYA 4N4PA 4K1GA 1K1DA 4GYJA 4QE5A 3F5KA 3PF3A 1ENUA 4NAEA 1NQKA 3H2MA 2R1MA 4LX4A 3WF0A 4Y9AA 5H91A 1ZP4A 3L2IA 4WD0A 5BOEA 1DJHA 2F8QA 5B7YA 2VFFA 3I6TA 3N9RA 3MHUA 1BQGA 2OOGA 3M07A 4KWWA 4M82A 1VC4A 5A3HA 3B8IA 2RJHA 3ABQA 4MAZA 1MQQA 3P61A 4HMDA 1YNPA 3LV6A 4QAIA 2EPOA 2J8GA 4WGHA 2BB0A 5DQPA 2ZC8A 1AZ2A 1JDFA 2J7EA 3F5JA 2ZTKA 4V15A 2J75A 2Y7FA 4O12A 1AD4A 2CBIA 2VD8A 4CQBA 4GO9A 1YPXA 4EPKA 4ODLA 3HPAA 4QXIA 1ISWA 1IEVA 3STEA 5I06A 2E9LA 1NP2A 3C0LA 3NTPA 2OTDA 5CJNA 1QPQA 3P3BA 2NQJA 1M03A 4AWTA 2PWHA 4H04A 2CLLA 2VD9A 4LBRA 3VZYA 2X0YA 2QHAA 3EB2A 3MY9A 1VFUA 3ZQ9A 5BRBA 3WH0A 4MPQA 3PB2A 3T6CA 3PK7A 1IX5A 3FN9A 4IFKA 2CZDA 2A3HA 3WDHA 1UWUA 3E96A 3ANUA 3NR0A 4HNNA 1C3FA 5EU9A 4KR0B 3C2FA 1O12A 4ZO9A 4ATWA 3GTIA 3WYZA 2UZ5A 2CU0A 3SRFA 3RU6A 1JFHA 2FTWA 4FSAA 4UFJA 1MWOA 4UZSA 3TN5A 1V0KA 3WF1A 3IGXA 2OCZA 3VIHA 3PBUA 4Y9MA 3DG7A 5C2GA 3W23A 1DJZA 2PDMA 4XQ6A 3IVTA 4UFKA 1HP5A 2BNJA 2O4MA 4YIWA 2CESA 1UUQA 4LAOA 1D9EA 4QS6A 2PP3A 3A4AA 4LW7A 5E09A 5ENLA 4J9JA 1MFUA 4LANA 3NEHA 1WBJA 3PAJA 2D2HA 1F3TA 1UR8A 1AQFA 2PDFA 2XYLA 4HK6A 4NZ3A 2OFNA 1TG7A 3WBEA 1UW9A 3QKZA 3NQDA 3BAWA 2JGQA 4LNYA 3G5EA 3QRHA 3BAYA 1B4KA 1RP8A 5CJ5A 1EOKA 1EOMA 2Z1WA 4UNIA 5FL1A 3TYDA 1Z6KA 3ARUA 5IHRA 2HK1A 2ZICA 4WJEA 1WKFA 5E9XA 3KOYA 4KWOA 3C8NA 4JKKA 1OEPA 3SGZA 1XYFA 1E1EA 3QXBA 4U10A 4B2DA 4M5PA 2ACSA 1ZAIA 2D9FA 2ZX6A 4RPPA 1QWGA 3B9NA 4PTDA 4XSMA 1JULA 3SCNA 6REQA 2DVTA 3OZOA 3VMOA 1HW6A 4DO4A 3DX5A 4H6KA 5IRPA 4H9YA 3VCCA 1K8YA 5GNXA 2PEVA 2Z7GA 4LSBA 2ATSA 2J7CA 1DJNA 1CB2A 3TX9A 3VNZA 1W1TA 4MLJA 1TMHA 2ISWA 3WEOA 3GM8A 4AMCA 4Y2WA 5KZDA 3E0FA 3UCDA 5I02A 4IMDA 4OQVA 1XSKA 5GVJA 3WQ8A 4ZO7A 4C90A 1IXNA 3E0LA 1LT8A 5LNSA 4IISA 1NU5A 4L4OA 4QSHA 3EOEA 4C5YA 5DMYA 3I4EA 4KT2A 5H8UA 2AQOA 4TIMA 3TWBA 1J4HA 1BF6A 3O5LA 1LOQA 1I1WA 2OQLA 5AHNA 3VMPA 1ISXA 2WVVB 3EB4A 3TFCA 5AY7A 3OA3A 1TIMA 3LK6A 4IL2A 3DXIA 3FSTA 3WFZA 4LY4A 3K8KA 3H55A 2OFJA 4U3CA 5T8GA 4QISA 1L1PA 1QNPA 1CXIA 3KAFA 3OU8A 1J4RA 4PYSA 1GZJA 4XAGA 4DB7A 3AU2A 1FHUA 4QT2A 1UH2A 4YS1A 1MUWA 4HBEA 3TW6A 1BRLA 3FHQA 3RCMA 4EANA 4LYKA 4DI9A 4MY1A 4JQ4A 1XYMA 2GZXA 4A3YA 1QHZA 2GOUA 4DM2A 4NRRA 1BVWA 1KWKA 3N4FA 1DJQA 4LB3A 3FGCA 3R43A 4LUYA 1E73M 1B2YA 2X05A 1PX3A 3N25A 2WSQA 4ERGA 4PMDA 2TODA 4Q7BA 5A5WA 4AU0A 2BVTA 5HANA 5K7JA 5JIWA 1EP2A 1FXQA 5C70A 1KTCA 4H2HA 3UY7A 1ECQA 3TQVA 4DF1A 1MMFA 1H7XA 1V3HA 2X42A 1X7FA 2OYMA 5E9AA 5HQEA 4JHMA 3SFWA 3PP7A 3LLFA 2YA0A 4H9ZA 2M2AA 2BV9A 3GTHA 3PNZA 4CN6A 1T5AA 1W9BM 4L1XA 4I6KA 3HGSA 4O4WA 2C6QA 2XP3A 3AHVA 2PAJA 1KM4A 2XFWA 2Y5JA 5CH9A 4D6IA 4GABA 3ZVIA 1XGEA 3NOEA 1JF6A 3C3UA 2CNCA 1EF2A 3UQNA 3AZSA 3HN3A 3UEQA 4JHOA 4WSKA 4MSSA 1NOFA 4JNZA 2VCAA 3MDWA 4JIIX 1EJXC 5M5DA 2K8IA 1XLKA 2ZTJA 3G1FA 2HCVA 3UXLA 5A8GA 1VRDA 2ZE0A 4DH0A 3W88A 4LVAA 3USZA 2BSLA 5T91A 1DXEA 4L5ZA 3ODKA 1TVLA 3KTXA 3GC2A 2VT0A 1GZ1A 1M7PA 2YCIX 4FLQA 4MHBA 4HA4A 1X8CA 3KZPA 3LPOA 3E74A 1CGYA 3WMLA 3C2YA 1XIEA 2HISA 2I14A 3K30A 4CNPA 5HJLA 1R3VA 4MM1A 3LB0A 1QBAA 2EG7A 2X16A 3LENA 2D22A 1MW2A 5CKSA 1UPPA 5A94A 1U30A 3VIMA 4EXAA 3OLIA 4UTTA 3GHRA 3LCGA 2HROA 1Q13A 1JCXA 5K9DA 1KFWA 2VR2A 4RKAA 1J10A 3E38A 1W8GA 1E6PA 1W1YA 2OO6A 2C79A 4GX8A 3GB6A 3SQMA 2NWSA 2W9MA 2ISFA 1VPXA 5LA0A 3ORWA 3UXDA 1RCXB 1C90A 3CEPA 5H1WA 4BS0A 4JFLA 5AOUA 4DBUA 4XAKA 2QDEA 1ODUA 3W1UA 1V4YA 4L9XA 1ITCA 4KCWA 4HA0A 4AQLA 2VFGA 3G6MA 2WSRA 1IIHA 3N2BA 5CPLA 3W7GA 5FEXA 5TQLA 1RJPA 4LTSA 4YWSA 2BVDA 1LROA 5CZ0A 1UJQA 1UD3A 1XDMA 3UT0A 3PG9A 1O7AA 4GA8A 4S2BA 1XLIA 5I3FA 3QY8A 4HYWA 2ICSA 1GOXA 5FAGA 1WQ5A 2GJPA 4UTJA 1F76A 4D1JA 4QNEA 4C6PA 2G4FA 3T2PA 3W6YA 2DVXA 1PSCA 1EA9C 1HKKA 4Q22A 1UROA 3GNPA 4KPLA 3T0TA 4IL0A 4GI4A 4XAPA 1GGOA 1SU5A 4W8AA 5LHEA 1A3HA 4GXPA 1VHCA 4C60A 4IUOA 5DFAA 3U57A 4TMBA 3WCZA 4WDTA 3IIVA 2JBMA 3HGOA 3OZMA 3W0KA 5HMSA 2DT2A 1CLXA 3C61A 5BU9A 4U2ZA 1K03A 3UFYA 1YIXA 2Z6IA 4POCA 4U2YA 4DXXA 1YX1A 1PO9A 1PYFA 1E0UA 4A6GA 2HJPA 3M64A 3KBJA 3RAOA 5C54A 3TR9A 1RK6A 4H6RA 1V6YA 1VEPA 1TZ9A 4O10A 1E6ZA 5C55A 1SJCA 1W32A 1TRIA 2QCDA 1KNWA 1TE6A 3OVPA 3G3MA 3N6QA 3GR8A 1DQUA 2YPIA 1UUMA 4LUIA 1G5AA 3ZR5A 2Q71A 3B03A 5EFFA 2CZFA 3UNTA 3ZJ6A 4OV4A 2D23A 3W53A 4AHOA 2CHRA 3QR3A 3CV2A 3TZFA 2NQ5A 3AMLA 1V3KA 3BJSA 1T0OA 3M47A 5A2AA 2QNEA 2E9MA 3M0ZA 5A6SA 4D6GA 1PIFA 2Y5EA 3O6CA 1FWFC 3THUA 2XISA 5A8OA 1TCOC 1UIPA 3GKFA 5SWUA 2YXGA 4OBTA 3IEBA 3W4RA 1JRBA 1ZBCA 3E0WA 2BY0A 3CB3A 1JUBA 4Z08A 3SRDA 4BQ3A 1SZFA 2EO7A 2RHGA 3WK2A 5ECUA 5M03A 2ZXAA 1HJQA 3NQCA 3VKCA 4B5VA 1RV8A 3NQFA 3IJ7A 1VF8A 3R25A 1H1NA 2OYLA 4IIEA 3AMDA 1FD9A 4Q4KA 3V18A 4OJYA 3NEVA 1RBOB 3Q4DA 1F61A 3GVGA 3PUGA 1Q7ZA 2VJXA 4GUHA 2XG9A 1UOZA 4O0QA 4B5WA 3WFLA 3E9AA 1NH6A 2P0OA 4C6FA 1XKYA 3V1PA 4Z42C 1YLVA 5AVHA 3VFCA 4PMUA 3AS3A 4YWIA 3LPPA 1J4IA 3CV7A 1HXJA 1FBAA 3HA1A 4DIAA 2PF8A 4GBDA 1WBHA 4O28A 3W7PA 1OZMA 2RGLA 1WCGA 4NXKA 1XISA 1QO5A 4ROQA 4S3GA 3CUFA 3GNXA 4QZVB 2OT0A 1XIGA 2V5DA 1ADSA 2PD5A 4KQNA 1S3TC 3TC3A 2Z27A 1EB3A 3E6EA 2WZIA 2ON3A 3VE7A 2C14A 1DVJA 2CHOA 2E8ZA 3FS2A 4M7TA 1TPC1 5HW7A 4QAWA 1VFTA 4MZ1A 1OY0A 1JGIA 3TV8A 2O9RA 1YYAA 4HSOA 4EVZA 3M0HA 1VYSX 4L9ZA 2ZOXA 3BW4A 1ODZA 5CPSA 3P93A 5A8NA 1UWQA 3GFXA 7XIMA 3H8AA 3AIWA 2IKHA 5CEWA 2V5JA 1FCVA 4ZOAA 1AH3A 1TJ1A 2DUZA 3O5QA 4NT0A 3OG3A 2V6AA 4R3UA 2VP8A 4LVBA 5TBOA 3GU1A 3C8FA 2Z28A 3CC1A 4GI8A 3UQAA 4UFMA 3W1XA 4LAMA 2GFTA 3NDZA 4W9OA 2M08A 5HW8A 1GVQA 4XTIA 3AOFA 1NFGA 1A5UA 3T4CA 1D7HA 1KBJA 3QZEA 2P8BA 3VOCA 2DT0A 3O5JA 1OG6A 4G8TA 4KF1A 2G97A 1MFVA 1I2QA 2XP4A 4U86A 3LHYA 1PYMA 3CGMA 1XQKA 1VYRA 3BG3A 3WLKX 3SSJA 6REQB 5EYWA 3FY1A 3E5PA 2Y1HA 3MVIA 4UMBA 4JX4A 1BTCA 3SRHA 4GNVA 4NJKA 2OSYA 1JPKA 3LCIA 2XTKA 5L9FA 1QXLA 3GQYA 2V3GA 1J8VA 5FA5A 1GNXA 2WHJA 3IRDA 3CL7A 3P81A 2HS8A 1NJJA 4DBDA 2A3EA 3SURA 1FH7A 2VZOA 2VC9A 5D75A 4PMQA 3T44A 1AQ0A 3PZGA 3PPHA 4UDMA 3APGA 2ZXBA 4A4AA 3LI1A 3BLKA 1X1ZA 3PBGA 3EEZA 1KGXA 2NLYA 1B90A 3UG5A 5BMWA 3D47A 1G4PA 1ONEA 4D2JA 3EA3A 5DY3A 5HMEA 3I3EA 2NQHA 3EA2A 4CU7A 1A7XA 3NQEA 1O95A 2CITA 3A3WA 1TRDA 3DERA 1C93A 2FZ8A 4S3DA 3A9IA 4RNHA 3WBXA 3M0JA 1MDRA 2QCLA 1FXPA 4ECLA 3N17A 2IW0A 3C5QA 4GRSA 1UMLA 2XHYA 3V3WA 4FIQA 1XRTA 3VD7A 4R7JA 3WJYA 4CUCA 4DUVA 3VIJA 2NUWA 3EX1A 1M5WA 1S5TA 2DZPA 4MIMA 3CEUA 2OZ8A 4DO5A 1L2UA 1E70M 4K8GA 3GZ3A 4O4VA 2OEMA 5CC7A 3VCNA 3KCOA 1LYXA 3PJWA 1F05A 4JD4A 3TWAA 1U1HA 4RE0A 1D8WA 3LCWA 4URIA 2D0FA 1EFZA 2ZQTA 4ZXLA 4OTKA 5FF7A 2RDXA 1P0EA 4C02B 1B4EA 3POHA 4JDBA 2AQWA 2ZUNA 3W7JA 2VFHA 1NELA 1V0MA 4JY9A 3NO3A 3LA4A 4DX3A 3KRBA 3A24A 1G69A 5I09A 4Q8WA 3H6OA 4IPLA 1XYZA 2BASA 2C19A 4AY8A 4RW3A 2JE8A 3FJ4A 1GPWA 2QJJA 2WZMA 1A5KC 1RALA 3T8LA 1L2QA 1JYNA 4CD6A 3ITGA 4RE2A 3BE7A 1JDCA 4XZ9A 3BLDA 3JRKA 3VIGA 3L7RA 4US5A 3BW3A 3P0WA 3PWAA 5FJIA 1JYWA 4FB7A 4IIGA 4BWLC 3CGNA 2JQXA 4GIEA 4AMAA 2WAGA 5KZMA 1LG2A 1NVMA 4RX0A 2A4AA 4AZHA 1WDRA 4M8UA 4JFJA 4MUZA 2VEFA 4J35A 1F74A 1NDVA 4CQCA 3H21A 4HA1A 1J01A 4E4UA 3GVQA 5GNYA 2VX4A 5BZAA 3NVTA 1Z41A 1XBYA 3BSHA 5GJMA 4F0SA 5CGTA 4KEUA 2R1KA 1P0BA 2VGFA 2DT3A 4GUJA 1TQJA 3B8WA 2VFEA 3AIRA 4EAYA 4DY1A 2OKOA 2QDGA 2VEKA 1NOUA 3VDCA 5HWMA 3T81A 5KINA 2PPGA 3W2UA 1XWYA 2QDDA 4YVXA 1GPFA 2YCJA 3WLIA 1ADOA 3KACA 3TK7A 3MI2A 4CCZA