2DSVA

Interactions of protective signalling factor with chitin-like polysaccharide: crystal structure of the complex between signalling protein from sheep (sps-40) and a hexasaccharide at 2.5a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Carbohydrate binding properties and carbohydrate induced conformational switch in sheep secretory glycoprotein (SPS-40): crystal structures of four complexes of SPS-40 with chitin-like oligosaccharides
pubmed doi rcsb
molecule tags Signaling protein
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dsvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dsvA01
2GJPA 3GXDA 3M7SA 3GDBA 1CECA 3NUKA 1W32A 3PZMA 3TTYA 3AFBA 3GNOA 4TVCA 1LL7A 4AIOA 1WNOA 3AHXA 3NCOA 3GBDA 2IXUA 1PZ3A 3W29A 2GUYA 5CLWA 2WC3A 4TTGA 2G3JA 2J79A 3UG3A 4U2ZA 4JL2A 5I77A 2O9PA 3EDDA 2ZX5A 1VEOA 1B3ZA 3WBEA 1Q6FA 3AMCA 1BAGA 1AMYA 4H04A 7CGTA 4WKHA 5FIPA 1GVYA 2EXOA 1UR0A 2VCBA 3F4VA 3G6MA 1D2KA 1OGGA 2X0YA 4JAWA 4V2XA 5M5DA 1NQ6A 3VKKA 3A4XA 4EAMA 1NWUA 5E0FA 1V3MA 3EMCA 3SUVA 1QOXA 4AD3A 2WMIA 2WC4A 2YL9A 3CZEA 4HZ7A 5HNNA 2JEPA 1E0WA 3WH5A 4ZXLA 5BXRA 1QPKA 2W67A 2WXDM 4W8LA 3N1AA 1G1YA 5ABHA 2PBOA 4C7DA 4OBSA 3VUPA 1O7AA 2WWCA 3OZOA 3WKZA 3KWXA 3FHAA 4UCFA 3VIMA 3DYPA 1H0GA 4AD1A 4NF7A 5IFPA 3WFZA 4L4OA 3ZT6A 3AMGA 4JCMA 1UQYA 1XSJA 4CKQA 1F4AA 1HKKA 1WZAA 1XGZA 2OYKA 3ARVA 3WIJA 3AIWA 3WQ4A 1JXKA 1HT6A 2XSBA 5D9MA 2NSXA 3VNYA 4UQ9A 3OLIA 3KEHA 1NWSA 1CENA 2A3AA 3II1A 1V3IA 4D6CA 1NH6A 1GHRA 5BXSA 4XZWA 1LLOA 3BAXA 5GPRA 4U3CA 2DSZA 4UOZA 3VIKA 3WMSA 1HXJA 3WDJA 2DEPA 2VX6A 1HL9A 3JUGA 4CU6A 2XSAA 3VIJA 4OOUA 3SIMA 2UY2A 4F66A 3K46A 4WKFA 3MS8A 3GXFA 3WNMA 1W9PA 4PBGA 1CLXA 4MB5A 3RCNA 5AC5A 1QI3A 4F9DA 2WZEA 1QW8A 3AXXA 3L2MA 1EGZA 3WUEA 3EDKA 2FGLA 1V0MA 4J3WA 4CGTA 3UETA 2WBGA 1W1TA 4DWSA 2XM2A 1CYGA 4BS0A 1L8NA 4JL1A 4TVDA 4KWUA 3MU7A 4J3UA 1GQJA 2XIIA 3WY1A 2CKSA 2JIEA 2ZX8A 3F5LA 4NZCA 2PWEA 1OD8A 4H8HA 4OIFA 4WSJA 2QPSA 2YDSA 2EEXA 2D2OA 1R7OA 2J7BA 4MADA 3DHPA 5JH8A 3PTQA 1H11A 1HNYA 2DIJA 3WNNA 2JE8A 1UD6A 4KMQA 1Z32X 3MANA 3W6LA 4DWSD 4KGLA 1JZ6A 2JF6A 4CUCA 2VZTA 3POCA 1W1YA 1CDGA 4CCDA 2DSUA 1GJUA 4EANA 3NDYA 4TX6A 1JYWA 2WAGA 3OBAA 2ZWZA 2GVYA 5C70A 2BVTA 1PPIA 4KGJA 1QI5A 5D8ZA 3WNKA 3BSHA 2VX4A 3PZQA 2VNCA 4A3YA 4DWSB 1UR1A 2BHZA 1KR1A 2Y2WA 1ECEA 2GDUA 1CXLA 4ZFMA 2VR5A 4WKAA 3ARYA 3ZIZA 1LF1A 4XV0A 1HJUA 3FAWA 4U31A 1H1NA 4JHOA 2AOSA 1KFWA 1DP0A 4GQRA 5CPSA 4PCSA 1MQPA 3BH4A 1WDQA 1UKSA 1EXPA 1W9BM 4JKKA 1RH9A 1ESWA 2VVNA 3BAJA 2VQUA 3CHCA 4RL3A 2UY4A 1VJZA 3NIYA 3FXYA 4BQ3A 4AD4A 1E72M 2BVYA 3VM7A 4W7VA 1UH2A 5A95A 4HMDA 2VZSA 4UFKA 4MNKA 3N11A 3CUGA 1XHGA 2XTKA 2ZX7A 1B31A 4YHEA 1AQMA 2YLAA 1DTUA 3FAXA 5E0CA 4ACYA 4CD6A 3WMCA 3VX1A 3DYOA 4E8CA 3ARRA 2XGBA 5E9AA 3CMGA 4D6DA 2Y5EA 1V6WA 4IM4A 2YA2A 3DC0A 2J7FA 1L0PA 4KRTA 4WJXA 2CHNA 4GZJA 3TOPA 4IISA 1JD9A 2F8QA 1E73M 4MJ4A 2BHUA 3WN6A 1RPKA 3SCQA 4CN1A 1DWIM 1UR9A 2OWCA 1E1EA 1CGXA 3PZGA 1QBBA 1OCQA 5E09A 1W2VA 4OBRA 4B9YA 2CITA 2Y4SA 3CPUA 5CG0A 1J9YA 2C8NA 3WH7A 5AYIA 3T2PA 1US2A 1GOKA 1UR4A 1ISVA 1BYDA 1Q6CA 4UOQA 2D3LA 4JZ5A 1WPCA 1E6XM 1GJWA 2QHAA 3O6AA 4JHZA 4QAWA 3N13A 1K9TA 1XSIA 4LPCA 3N15A 4JKLA 5JBEA 5IHSA 1XYZA 2XVNA 4UQCA 1M03A 1ITCA 2YOCA 1VFOA 4DUXA 5LYRA 3SCRA 2O9RA 4NI3A 4LYQA 2G3NA 2J74A 4UFIA 1R8LA 1OBAA 4PMOA 2XG9A 3WUFA 2XYLA 3W38A 3WF2A 3PZ9A 1TA3B 3W27A 2A3BA 1C7SA 2WCAA 4WLCA 3LPFA 4PN2A 5CLTA 1UWRA 1V0KA 1WCGA 1V0LA 4WSKA 1CZ1A 1ZBWA 5FD0A 2YL5A 4JFWA 3CMJA 1ITXA 1PBGA 1PJ9A 1WAWA 2A3CA 1R87A 5KZ6A 2WYSA 3CUHA 3PHAA 2XWEA 1C8QA 2E9LA 3ZJKA 5FL0A 1E6NA 4GZIA 2GK1A 4EE9A 2ZX6A 1E9LA 5I0DA 1PX3A 4AEEA 2X8RA 1UYQA 1B0IA 1E6QM 3U7VA 1TE1A 1UZ4A 1GNXA 2WSPA 1B90A 4W7WA 3VGEA 4AZGA 1M53A 1JI2A 2VCCA 2YL8A 3ZO9A 2QLYA 2WHMA 3VD3A 3WEMA 1V02E 1BHGA 3PZTA 2XVLA 2WLYA 2FHCA 2OSYA 2XVGA 2PWFA 2W4XA 3VNZA 2XUCA 3ZR6A 1OM0A 1Q4NX 1BQCA 2VJXA 3ZJ8A 1LL4A 2X05A 2WWDA 3VIGA 1US3A 5A6LA 3CZJA 2J7CA 3TTOA 3A4WA 4MNJA 3GYCA 1OGSA 1GOWA 1J0ZA 1E4MM 4UFJA 1HF6A 4P8XA 5I6SA 1EO7A 4LGXA 4FLRA 4HP5A 3L4ZA 4B9ZA 3IJ9A 4U2YA 3UERA 1BG9A 2FH6A 4Z2GA 2EPNA 4JKMA 4XUYA 1VBRA 4NSBA 1DWJM 1QI4A 4HMCA 1HIZA 1TR1A 3G6LA 4AC1X 1GOMA 4OUEA 4BQ2A 4M8UA 1B30A 4PYSA 1XV8A 4RE3A 5AY7A 4YPJA 5A8MA 1G5AA 3TTQA 4MB4A 2BHYA 1J0JA 2WMGA 2CPUA 1VAHA 3W53A 1CGTA 5LA1A 2WK2A 8A3HA 5ABEA 2W91A 1NARA 3WL0A 3GH4A 3WSUA 2EJ1A 3KL5A 5I23A 5EBAA 4XZBA 3RJYA 1KGWA 4DM2A 3AQUA 2WMKA 3GTNA 5A8QA 2VL4A 3BMVA 4D6IA 4JCLA 3LPGA 1H2JA 1GONA 2CHOA 4CD4A 3WDHA 5LA0A 1JDCA 3W4RA 4UFHA 3K1DA 2YA0A 4M24A 1E4IA 4PSPA 2VURA 3UG4A 1JG9A 3OGSA 3CUJA 4MDPA 1J0YA 1H0IA 4ATWA 2XFRA 4P7NA 4FMVA 1B2YA 3A3HA 1Q6DA 1K9EA 4PMDA 3AISA 2CBUA 3OLGA 3AS1A 3K8KA 3AZRA 2D0HA 4HU8A 1X1NA 4J3SA 4D1JA 5DT7A 3QHOA 3BAIA 4J3XA 1JZ2A 4AZ7A 3VIHA 4HA3A 1MW1A 5A3HA 1VB9A 3ARQA 1WO2A 1MXGA 1UD5A 2E0PA 2UY5A 3A47A 5BWFA 3WQ8A 3L4UA 4UTFA 3WDPP 4F8XA 1KXQA 3GNRA 1E3ZA 1VEPA 3WF0A 3QGVA 1ISWA 1B3VA 2BY3A 1KXVA 3O2LA 1W1VA 3AHZA 1HKMA 1C93A 2VCAA 3SCVA 2FH8A 1MWOA 4HOWA 4CCEA 1V03A 2G3MA 1CNVA 4W88A 3RPMA 1MW3A 2DGAA 1V6UA 1V02A 3ZSTA 4CU8A 1W9DM 1PAMA 1HKJA 1LWJA 4V27A 4J3TA 1EHAA 2EO7A 1UD8A 4P8WA 3ARPA 3VDAA 2WVVA 2VO5A 4IUGA 4AZ5A 3LMYA 6TAAA 2PWGA 1X6NA 4J3VA 1EIBA 1XSKA 2YBTA 1GORA 4WK9A 2J47A 3AYRA 3GNPA 4HPGA 4AD5A 1Q6EA 1PIFA 1XD0A 4GPNA 4J7RA 3WH9A 1XH2A 5EFFA 4TTUA 3O9NA 1A47A 1BGGA 1R85A 1VBUA 3MUY1 1MW0A 4FF5A 4KH2A 4ML4A 4S3JA 1UKOA 4ZEPA 2WB5A 1WZMA 2DDXA 3EMQA 4LYRA 2EPOA 2QPUA 4PMXA 2ZUSA 1W3JA 5D9OA 3AHTA 4LQ1A 3T08A 4UOJA 1C91A 2PC8A 4Z2KA 3VGFA 2OLHA 3SCWA 4HOXA 1CGWA 2YBUA 1UR2A 1V3HA 2BV9A 2MANA 1FHLA 2FHBA 4BQ5A 4JFSA 4DUWA 1JYXA 1KBBA 2WVVB 3S6TA 3VGDA 3EDEA 1TMQA 2D1ZA 3MMUA 4E8DA 5I78A 4QCFA 1PZ2A 1XD1A 3WUGA 6A3HA 4TVUA 2HISA 1CGVA 3IAPA 3SUUA 3AHYA 2XFFA 1DWFM 3W81A 4RE2A 4CCCA 2EPLX 3WF1A 4UQBA 3WQWA 4LXFA 1UD2A 3CBWA 3M07A 2J25A 4PRWA 4AIEA 2WC7A 4GZEA 1GOOA 3AIEA 2WKLA 2JALA 3DHUA 2J7GA 2O9OA 3SCSA 1JZ3A 3K4AA 3KL3A 4GI9A 1H09A 2D22A 2J62A 1J12A 3ARZA 1QI0A 1HP4A 1QW9A 3A6OA 1MFUA 4AZBA 3POHA 5I5RA 4Z2JA 3MO4A 2ZICA 2E9BA 3F5JA 3ECQA 3WD4A 1E40A 1X6LA 5EFDA 1H49A 3VD4A 1W9UA 3AOFA 1M7XA 3VGGA 3OLEA 1Y7VA 2VRKA 4AZ6A 3ARWA 1NP0A 2CETA 4CD7A 3AXIA 1H4PA 4W5UA 5DFAA 3RM8A 1LJYA 3W6MA 4H8UA 4UZUA 2CESA 3AIQA 3OGRA 5E6YA 4AZCB 6CGTA 3VX0A 2E40A 4Z2LA 4MJ2A 2WSKA 2XJ7A 2WCSA 1LL6A 4TXEA 2UWFA 4GQQA 1VFFA 2WMHA 3L4XA 2D3NA 4F79A 5ABGA 5LA2A 1MFVA 2EBNA 2VX7A 3WNLA 4HMEA 4MNLA 1JDDA 4CN6A 2W63A 2WCGA 3WMBA 2QMKA 4GO9A 1MQQA 4GKLA 2NT0A 4D72A 3WNPA 3AIBA 4P7OA 3VDCA 1EDQA 4PSRA 2CERA 1D3CA 1HKIA 3FY1A 3TTSA 4AYSA 2ZIDA 2W5FA 3AMLA 3W25A 3AS0A 2PF0A 1JZ5A 1UKPA 1OIFA 1GVIA 1O6IA 4W8AA 2EPMX 1J0KA 2C0HA 4PUDA 1KGUA 1UD3A 4GXPA 3BCFA 4M81A 2OYMA 4BCEA 5D4YA 5CPTA 1V3LA 4B16A 1W91A 1BTCA 1EQCA 1WZKA 3UEQA 1BYCA 3GBEA 2GDVA 2TAAA 2RGLA 3BLPX 1OGBA 5GNZA 4AZHA 1W3LA 1XC6A 2CBJA 2O92A 3GH7A 1UUQA 2F61A 1E5JA 4TOQA 1R86A 1H5VA 1CBGA 3NSMA 2NW0A 1BF2A 2VI0A 1W1PA 2V5CA 3NYDA 1WZLA 2IXVA 5I24A 1WDPA 3VGHA 3AZSA 1FH7A 3IJ7A 1V0NA 1C8XA 1E4NA 2NT1A 4P7LA 5A69A 2DIEA 5ECUA 3ALFA 3RMEA 5C8BB 4HA4A 3CUFA 2ZXQA 2G4FA 3PBGA 1UG6A 1GOIA 2WLZA 1TA3A 4QCEA 5BRQA 4ATDA 5BRPA 2FGZA 5A6BA 2X1IA 1C7TA 1ZB5A 2DH3A 4PTWA 1GOQA 4AXNA 4W89A 2G8ZA 5A8NA 1UA3A 1E5NA 4AIUA 1PEZA 1E15A 3BAYA 5CGMA 1GQKA 1UWSA 1EOMA 1JD7A 4J28A 1GZJA 3IAQA 4U5IA 4PUEA 2E8YA 3LPPA 1SMDA 4F9JA 3N12A 1CGUA 1ISZA 1KQYA 4X0NA 1OT2A 5AYBA 3SCOA 2E8ZA 2AAAA 4PTMA 5M17A 3MMWA 1DWGM 1VRXA 1W2PA 3N17A 5E70A 4FLOA 5A6BD 1K9DA 4FK9A 2VRJA 1AQHA 2VUYA 4J27A 3BC9A 1EOKA 3GXIA 2J7HA 1EDGA 1ISXA 3PTMA 2WMFA 3MMDA 1KCLA 1ZBCA 3WL1A 3VIFA 2D24A 3L4VA 5CSUA 3D3AA 4HOZA 3N9KA 1HJXA 2PWHA 1KCKA 4NRSA 1XRVA 4P7QA 1V3JA 3RDKA 3WEOA 1SR0A 3WQ6A 3FN9A 1KWKA 3VD5A 4WIWA 5FKYA 3L2LA 3BAKA 2XPKA 3OGVA 1SFSA 3B9EA 4IPLA 1VIWA 4M80A 3OA5A 2PI6A 4MNMA 3VILA 1M01A 2QV4A 3AXHA 5FCZA 4R5EA 2O9TA 4X9YA 1J18A 3OG2A 1KXTA 2DT2A 2YKKA 5A2CA 3QOMA 1OD0A 2XVPA 1YQ2A 1C3FA 1EO5A 5ABFA 1ODUA 2AMGA 2XGIA 2WNWA 5IHRA 5D8WA 1WE5A 3UR8A 5F7UA 1ZBVA 3MUIA 5I2UA 3T2OA 1AVAA 2RGMA 4AD0A 2D23A 2BY2A 4QFUA 2DH2A 4AD2A 4IPNB 3THDA 3GXMA 3WELA 3F5KA 5M3WA 5D9NA 1WB0A 3WQ5A 3ARUA 2VOTA 1EH9A 5GQBA 3T0AA 2UY3A 1H3GA 3CUIA 1NOFA 2VZVA 4LX4A 3VM5A 1JZ4A 1QNQA 1GCYA 1FP9A 1XH0A 4QLLA 2QF8A 5CPQA 3AIRA 1XCWA 3VMPA 3WH8A 2WANA 4GIAA 2E3ZA 4W84A 1NWTA 1QNRA 1JNEA 3BMWA 3OB8A 1BPLB 3PN8A 1V6YA 4HTYA 4W8BA 2V3DA 1BGAA 1UA7A 4B3KA 1UWUA 4C7FA 1RP8A 3M6DA 1MVYA 5GNXA 5ABFB 3BXWA 1GHSA 3T09A 4QDMA 4URIA 2ZX9A 1GQIA 5CGTA 1FFRA 5EMYA 3T2QA 1UWTA 5DMYA 3VIIA 4CD5A 2Z1KA 2X2YA 4PTXA 4AW7A 4GO8A 1JF5A 3E1F1 1W9XA 3W0KA 4BZYA 1VENA 1H41A 2OSWA 4HPHA 5E6ZA 4OOZA 3AI0A 1GPFA 3ARXA 1D7FA 3I3DA 3VDBA 1NOWA 3AICA 2J75A 4W85A 2JIWA 3CLWA 4K68A 2WVUA 3PZVA 3ZR5A 5A6AA 3UESA 1J11A 1EQPA 5CXPA 5BCAA 3KE0A 3WEZA 2CBIA 3OIHA 3W26A 2HVMA 3KL0A 5IXEA 3J7HA 4M1RA 1JYVA 2J78A 2WVTA 4EK7A 3HU7A 4P8VA 3I3BA 4WF7A 4AEFA 2WHLA 5KEZA 1CPUA 5A2BA 4UZSA 5D9PA 4FLQA 2CKRA 3AZTA 2WM0A 3VD9A 1GUVA 3ZSSA 4GINA 1ZU8A 1B9ZA 2ZUTA 4D1IA 3WDQA 3TONA 5A94A 1JZ7A 3AMDA 3SUWA 1E6ZA 4YHGA 3K8LA 3WNOA 4PMQA 2C7FA 1LQ0A 3TA9A 2CIPA 4D6GA 1TCMA 3GH5A 1QI2A 4H7VA 4CU7A 1BYBA 1K9FA 3WF4A 3AIVA 5CQ1A 3BSGA 3A4AA 1VFMA 3PZIA 4E2OA 2VZUA 1JGIA 1E6PA 2YLLA 3OLDA 3UCQA 2ZUUA 1XCXA 4E4PA 1AQ0A 1DWAM 2VTFA 3NDZA 4PCTA 2B31A 4H8VA 4M29A 3BGAA 2VRQA 2ZWYA 3CGTA 3CO4A 1ZJAA 1LG1A 3GM8A 4QLKA 1B3YA 1PX8A 1HJVA 3CH9A 2X09A 4BF7A 1JFHA 4B15A 2W92A 3IJ8A 3WD0A 1ZL1A 2BVDA 2VT0A 3DYMA 1FHDA 4D6HA 3T0DA 1WP6A 2E4TA 1F4HA 3EDFA 1B3WA 1C92A 3BCDA 4PMNA 3WD3A 4MB1A 2Q8XA 3MV01 1YHTA 1CLVA 3CZKA 2JFEX 2VZOA 4HA1A 2J77A 4M82A 1IZKA 5BXPA 2GSJA 4U5KA 3WBAA 2V3EA 5CZKA 1DHKA 3WDIA 5AC4A 4L4PA 3SCNA 3WDRA 7TAAA 1UKQA 1FP8A 3HMCA 3W24A 1JDAA 2D20A 2VC9A 4OZOA 3W82A 4UNIA 1W9VA 4H41A 1KR0A 1E43A 1BVZA 3MKKA 2ZUNA 4OKDA 1HJSA 1NWRA 1ISYA 2J4GA 1GQLA 3WH6A 4P7RA 1LG2A 1ZJBA 4UQEA 1BYAA 4RE4A 1ZS2A 4MPKA 2BS9A 1LWHA 3AYSA 2DT0A 4AZCA 4PMZA 3WD1A 1FH8A 2DPEA 3ZOAA 1HVQA 1PIGA 4Z2IA 2WZHA 5JIWA 1VEMA 2WMIB 4PTVA 4W5ZA 3GZAA 1JF6A 1BVNP 3I3EA 2EQDA 1JIBA 2J8FA 3THCA 3VIPA 4NRRA 3M46A 2CCRA 1JAEA 3VTRA 2A3HA 1R7AA 1MW2A 3SUTA 1P6WA 2PWDA 1OT1A 2OSXA 1KGXA 3SURA 3ZMRA 1FA2A 2G3IA 1OSEA 3CTTA 3EMZA 3VD7A 9CGTA 2XWDA 4AWEA 3T0BA 3AJ7A 2YJQA 4AY1A 1MQRA 4ACZA 3VMNA 1WDRA 4Q22A 1FH9A 2J8GA 4ZXOA 2PB1A 1BSIA 2ZOXA 3NSNA 4CD8A 4TUFA 7A3HA 5HXMA 2ZE0A 5CJ5A 2XVKA 1WKYA 4HU0A 5JUVA 2OWXA 2G41A 5C71A 2CXGA 1JXJA 2E9MA 1B3XA 3CIVA 4Q7NA 3RJXA 4MDOA 3U5UA 5A8OA 5HPOA 3QOKA 1KWGA 3ZM8A 4DWSC 1E71M 2BXYA 2VX5A 2VR4A 2ZXDA 4Y7EA 2VMFA 1OINA 5HBFA 2DT3A 4U3AA 1CEOA 2BFGA 1J01A 5A8PA 2V3FA 2BXZA 2X0HA 2DQXA 1JL8A 1KXHA 1MYRA 1J0HA 1B1YA 1TVNA 2W66A 2XHYA 2W62A 4A3HA 1CXIA 3PZOA 1JYNA 3CHFA 3ARTA 1OWQA 1W3KA 2WHJA 3AIUA 1EA9C 2YIHA 1CGYA 3QHNA 2FHFA 4HZ8A 4ACZB 3AHVA 4M56A 1UQZA 3WF3A 4N42A 5FL1A 1IV8A 3AMKA 4MAVA 1FFQA 2ZUWA 2V3GA 1QHPA 1UWIA 1KB3A 3PZNA 3SUSA 4PMVA 2ESCA 3VO0A 3RM9A 2V38A 2F2HA 3CZLA 2EPKX 2DT1A 3OZPA 1UR8A 1QNSA 3KZSA 3EDJA 1VF8A 1V6VA 3K8MA 2Y8KA 1G9HA 4UR9A 2ZUVA 3U7BA 5A1AA 1M04A 1UZ1A 1VJSA 4YN5A 2CYGA 3QR3A 3U5YA 2J7EA 1XYFA 1QHOA 1CXEA 4FLSA 2OWWA 2XFYA 2Y8VA 3MSGA 3HJEA 4W7UA 1CIUA 5DT5A 1CTNA 5HDRA 1UOKA 3MSDA 1RD6A 1FOBA 3AS3A 2JEQA 1Q6GA 1PX4A 1WDSA 3RILA 5A6KA 5IDIA 5DF0A 2CNCA 4C7GA 4OJYA 1ZBKA 2ZUMA 1E6RA 1E70M 3VGBA 3CZ8A 3SEPA 1JZ8A 1TG7A 2IUZA 5HOSA 4QP0A 5I3DA 3SCTA 3IANA 4D6EA 3VPLA 5DEZA 1J10A 3CHEA 4CVWA 4DM1A 4ZE5A 4AMCA 3W37A 1E55A 4N0RA 1QBAA 5DO8A 1C90A 3ZQ9A 4CVUA 4A4AA 2WKGA 1E0XA 1NOUA 3N18A 3IK2A 4MAZA 3WFLA 3FW6A 3ZT7A 2GFTA 4ZE4A 1SYTA 1TVPA 5I79A 4S3KA 1G0CA 3BLKA 2D0FA 1TUXA 3MV11 4PMRA 4MTVA 1HJQA 3WQVA 1I1WA 3RM4A 1TZ7A 2CEQA 2J7DA 4JFTA 4BQ4A 3N04A 1ODZA 3NSXA 1I1XA 3TP4A 1HP5A 3WD2A 1W3HA 1N82A 2YDQA 2WBKA 3QHMA 1NM9A 1G94A 3ARSA 2ZXBA 1BFNA 2DSWA 1KBKA 1KQZA 1CXHA 4MB3A 4UFMA 1GW1A 4JFVA 1QVBA 5EB8A 3ZT5A 2D0GA 1G01A 3LPOA 1CXKA 4AZIA 2VVSA 1U2YA 8CGTA 1A3HA 4W86A 3UR7A 3VDHA 1UD4A 3MUAA 2A3EA 5BROA 3WUBA 1E4LA 5JBDA 3K4DA 1SMAA 4PEEA 4UFLA 3FHQA 2PBGA 2WW5A 4ZENA 1QNOA 3L4YA 3FNDA 4TX8A 3RO8A 3VIOA 1HX0A 4B3LA 1DWHM 1JNDA 2WMJA 1V08A 1E0VA 3CZGA 4GI8A 4V28A 4U33A 2BY0A 4QLJA 1HL8A 1UHVA 2QMJA 2BNJA 3VU2A 3U57A 3B9DA 2DSKA 1UH4A 1U33A 4PMYA 3EBVA 4XX6A 1S46A 5CSYA 1OB0A 2CBVA 2YA1A 4DUVA 2GJXA 3SCUA 2V5DA 3B9AA 1NP2A 2YDRA 4UQDA 2FDMA 2W61A 1HN1A 2BY1A 2GJRA 4W87A 3W28A 1J0IA 5HPCA 4R27A 5A6SA 2Y24A 3APGA 3D5HA 3UG5A 1JAKA 3S2CA 1E6SM 1EDTA 4KRUA 2WZIA 4ATLA 1VFUA 2WHKA 2YL6A 1MXDA 3AROA 1U30A 1BG4A 1OIMA 1EHNA 5TD4A 2ZXAA 2OYLA 3VINA 1DEDA 1RP9A 5M03A 2XIBA 5JIPA 4D6JA 1UH3A 4UQAA 4Z2HA 5A6JA 4HZ6A 5IFTA 1CWYA 4CN4A 2Z1SA 1E56A 1V6XA 3AS2A 4H2CA 1CXFA 3MUZ1 5A6MA 3PTKA 3VVGA 2GK1B 4D6FA 1E1FA 2WPGA 5BYWA 4X0VA 1IZJA 2JF7A 1QNPA 1QHZA 1UWQA 4JFUA 3ZJ7A 1HVXA 3WENA 1BLIA 2DSVA 4XB3A 3HN3A 1C8YA 4AISA 4EKJA 1TFVA 3DECA 2GJXB 2VQTA 4PMUA 4D71A 2XM1A 4P8UA 3ZJ6A 4BA0A 1JFXA 4JIEA 5JBFA 1UKTA 1I75A 4LYPA 3RIKA 3SCPA 3NJ3A 3EYPA 1JI1A 2WVSA 3CHDA 1XH1A 1K6AA 3PZUA 3L4TA 1IT0A 1HJWA 1E3XA 3BAWA 3B8SA 3L4WA 3ALGA 4W93A 5FOOA 5A2AA 5BXTA 4GI6A 3VOCA 3VMOA 1V3KA 5GNYA
chains in the Genus database with same CATH superfamily
2Q09A 3GXDA 3NZRA 1W3IA 1CECA 1NTHA 4TVCA 3GNOA 1EC9A 1LL7A 1J4EA 5AZ0A 4PUNA 1B4EA 2GUYA 3OZMA 2WC3A 4BEQA 1RPXA 4BF5A 1DQWA 1RCXB 3L21A 2C91A 3QPZA 2E5BA 4U2ZA 3VNKA 1Q85A 3TLLA 3EDDA 2ZX5A 4RNJA 1D7JA 1N8IA 4HN4A 3V36A 4H19A 2V9DA 3IUDA 3AMCA 1BAGA 1NY1A 2TSYA 4X3ZA 4RUBA 4XAFA 1F9CA 3HQNA 1GVYA 2VFGA 2AL2A 2EXOA 1R9ZA 4IGHA 3G6MA 3GDKA 4V2XA 3BOXA 3VKKA 4QX4A 4KKXA 3A4XA 1V3MA 3UFYA 1QOXA 3HGRA 3LGDA 5AC7A 3Q65A 1AA1B 2Z1WA 1K6WA 3CZEA 4A22A 3HIJA 2JEPA 4HNNA 4ZXLA 5BXRA 2VCDA 2W67A 4JTDA 4IFRA 1UROA 5K2ZA 3E74A 2C1HA 1VFHA 2WWCA 4HBKA 2P53A 3DYPA 3WJXA 1JUEA 3VFCA 1L2UA 4GY0A 4M1BA 4Q4QA 5IFPA 4L4OA 2G4JA 8RUCA 4C65A 3W85A 2QZRA 1HKKA 4DB7A 3KLLA 3LZ3A 3WIJA 3VZXA 4Y9OA 3AIWA 1DXEA 1W37A 1W5NA 2NSXA 3VNYA 3LCLA 1XDMA 3QPEA 4OGZA 3OLIA 3CQJA 5HUAA 1IEWA 1DJXA 3RN6A 4QE4A 5CPOA 3KRSA 1V3IA 3W1TA 3QW4B 4B5TA 3BLDA 4KWVA 6REQA 4QHRA 1NIUA 1FKGA 4XZWA 4HCDA 1LLOA 1QT1A 2PPOA 5C9RA 3NGFA 3D46A 3R10A 3WMSA 3WDJA 2H3BA 1HL9A 4A8NA 4OOUA 1IXQA 4LUYA 3SIMA 4FN2A 3K46A 3LLDA 4IMCA 5CC3A 1QPFA 1W9PA 5AC5A 4MB5A 4YTQA 3NQCA 1QI3A 3H7UA 3V16A 4DI9A 2WZEA 4IIGA 3L2MA 5DXXA 4LVDA 1XUZA 2WBGA 3W7GA 1EEXA 2ZQTA 4KEUA 4KWUA 5E93A 4IG2B 1FWHC 2GQ3A 4OV4A 2XH7A 2JIEA 1XGEA 3F5LA 2DZXA 4WSJA 1VC4A 3KCOA 1A5AA 2EEXA 2D2OA 1R7OA 4WSHA 1RJQA 4MADA 4EF8A 5GJNA 3STFA 1WV2A 2JE8A 1Z32X 3DDMA 3W3OA 4AC7C 3T8LA 1YW5A 2PF8A 2R14A 1W1YA 3R89A 2RDXA 4N2YA 3F1QA 3NDYA 4US5A 3L0GA 2WAGA 1QZ2A 4HT3A 2ZWZA 4ZOEA 2GVYA 5C70A 3NQAA 1PPIA 4KGJA 3WNKA 4FAMA 1K8XA 2VEFA 4UTIA 4AWSA 4DWSB 1ONRA 2BHZA 1GTHA 1EJXC 1DQXA 4ZFMA 4WKAA 2VC7A 5AHEA 1LF1A 4WD0A 1HJUA 4U31A 1EEPA 5PTDA 3LB0A 1VZWA 3M0LA 4E3VA 1OK6A 2A3LA 3BH4A 3EX1A 1EXPA 2R24A 2NQZA 4US5D 1W9BM 4JKKA 1RH9A 1D9EA 1IXPA 3GVWA 5AKQA 2VQUA 1RJPA 4DYJA 1XFCA 4GVFA 2F4EA 4RL3A 2UY4A 4ZS6A 4DJFC 4DNHA 1FKHA 5DY2A 3SB0A 1VBGA 4AD4A 3WLOA 2ASHA 4N9DA 2BVYA 3GVRA 3VM7A 3M9YA 3MI2A 3WK0A 3MZ2A 2XH2A 1B31A 1B9BA 3VNMA 1AQMA 3M64A 3UXAA 3GDLA 4DO4A 3DYOA 4E8CA 4M51A 4C91A 1WAUA 3IJ6A 4D6DA 1W1IE 1W5OA 3CEPA 4C1LA 1V6WA 3P82A 1G69A 1SVDA 1GWJA 2CHNA 1Q6OA 3TOPA 5KSWA 2PCQA 1JD9A 1LYXA 1MSSA 4MJ4A 3B05A 2XP9A 1OQFA 2BHUA 3PG9A 3LERA 4O50A 4JFMA 2Z7KA 1ZAHA 4MYXA 3WN6A 4CN1A 1JDFA 1UR9A 2OWCA 1WKFA 3PB2A 4FEZA 1OCQA 4DYEA 3P6LA 1W2VA 2OKOA 2Y4SA 5CG0A 2GGEA 1SZNA 3OVQA 3ES7A 1O95A 1HTIA 3E38A 5AYIA 3T2PA 4X9SA 3SDOA 1UR4A 2I14A 3KADA 3QSTA 3NTYA 1Q6CA 4DX3A 1XPGA 4UOQA 2D3LA 4GUIA 5HJXA 1RCOB 4YL2A 4QAWA 4JKLA 4HMNA 3VNLA 3N34A 4UQCA 3TCEA 1ITCA 5K9XA 3WK2A 4Y90A 4WHBA 4DUXA 1PKNA 5LYRA 1GGOA 1WUEA 3DI0A 4EAYA 3RK8A 3WUFA 4HNOA 1TA3B 3W27A 1C7SA 2GPTA 5CJMA 3AJXA 4F0RA 1I4NA 2WNQA 4FX8A 5CLTA 3LHVA 4HHMA 1UWRA 1V0KA 4WSKA 2BZNA 3TZFA 1OC7A 4JEQA 1ITXA 1X7FA 1R87A 1ZALA 4FX7A 4O2TA 4HPJA 2VGBA 2E9LA 3EB3A 3O0KA 1XLKA 1E6NA 4GZIA 2GK1A 4JTUA 4PCPA 4EE9A 1VBJA 3IV3A 3FGCA 1FWAC 1PX3A 2KO7A 3FX4A 1T99A 3KVLA 2FB2A 2X8RA 1FD9A 1E6QM 4QNWA 1DTNA 1GNXA 1B90A 1NF7A 3H2NA 4A29A 3FK4A 4AZGA 3RRXA 3W7HA 1R6WA 2QLYA 3CIXA 2QJNA 1V02E 3A9BA 1WOAA 2Y7EA 4QR6A 1Q4NX 3UWWA 3LN3A 1D8CA 3C2RA 3VIGA 3CTLA 4DRPA 2J7CA 3TTOA 1FDYA 3SRFA 4LW7A 1OGSA 3S4TA 2E68A 3CYJA 3P74A 4P8XA 4IGMA 2V82A 4Q7IA 3FLUA 1K77A 4HYVA 4HP5A 1S3HA 3IJ9A 5EL1A 4C6PA 2ZZ5A 5K9CA 1BG9A 3EWBX 1PO9A 1DL3A 2EPNA 3HG2A 1Z69A 4AVOA 1S1RA 1V51A 4ODLA 3P84A 3GNXA 1H62A 4NASA 1TR1A 4ODMA 1GKPA 2Z6IA 4Z08A 4FHAA 5HNUA 4M8UA 4IQEA 2PP0A 3O16A 5A8MA 3TTQA 2HCVA 4PGLA 2BTMA 2IPWA 1EJUC 1A0CA 4W4QA 4RXFA 4YTUA 1R9YA 2QKFA 1SSDA 1Q6QA 1NARA 2BDQA 5EBAA 2QJJA 1JCXA 1KGWA 3KVJA 4D6IA 1EGMA 1FHVA 2OEJA 5AZ1A 2CXEA 1JPMA 1RVKA 4WJEA 3T0TA 3CH0A 4UFHA 4B2DD 2Q3OA 2OQLA 3VE7A 5BW6A 2Y5SA 1NAL1 4CNSA 2VDIA 3CUJA 2J8TA 4NZFA 3B8TA 2YCLB 4ATWA 4P2VA 1MUCA 4O19A 3R12A 3ABQA 3PRBA 1JNTA 1I9CB 4PC8A 3OLGA 5H1WA 3NXFA 5EYWA 1KT0A 4J9JA 3BGGA 5J5DA 4LAUA 3VABA 2ZKMX 4J3SA 4D1JA 5DT7A 4QE1A 3EWXA 1IR1A 2PGWA 1VBHA 2PDWA 1RK5A 1ZZMA 4OFCA 2REQA 3UWUA 5A3HA 4PUJA 3VUSA 1WO2A 3U3HA 3EXRA 3TW9A 5BWFA 3WQ8A 4DZHA 1ONEA 2J6VA 5DMMA 1E3ZA 2CZ5A 3V5FA 3O2LA 2VCAA 1SZEA 3SCVA 2GVEA 2FH8A 1J96A 3SO7A 1CNVA 1F2JA 3URAA 1MW3A 2DORA 4WZHA 4CU8A 3LY0A 4ICMA 1W31A 4J3TA 4HGXA 4ZB0A 2VO5A 1F6YA 1NDWA 4KEZA 3KHJA 2RUDA 2HBXA 1EIBA 1GORA 1V5XA 4WK9A 2VD9A 2J47A 2V5BA 3AYRA 1XD0A 4UMBA 3ISIX 2HPMA 1P6BA 4LY8A 3FYOA 3TQKA 1I8JA 2V2HA 4TTUA 4CEXC 1BGGA 1VBUA 3MUY1 4KH2A 2QCGA 2Z27A 4IXXA 1EJRC 5CC5A 4ZEPA 1MZRA 4LAWA 1OF8A 1PHQA 1QFEA 2I1OA 1YNQA 3ABXA 5DANA 3EMQA 3QC3A 4W9QA 1U83A 1D3HA 3L23A 2ZUSA 2NQLA 4GQGA 3RU6A 4IIFA 5D9OA 3QY6A 3AHTA 3G0SA 4LQ1A 3FJLA 3VGFA 3DGRA 1FQ0A 1V3HA 4DXXA 1FWSA 1NFPA 4DXKA 2MANA 3P8JA 4AVNA 1E9IA 4BQ5A 2V5LA 3S6TA 4UCGA 1O5RA 2D1ZA 4MSSA 3TIMA 2IQ0A 2O55A 3HGOA 3U4AA 3W72A 1MDRA 1EUNA 4AY8A 3W81A 3MWCA 4RE2A 2P50A 5FF0A 2A4AA 1ZRQA 3M07A 4E5TA 4INFA 2D69A 4GZEA 3NQFA 3AIEA 3DHUA 2J7GA 1JZ3A 5CKSA 2J62A 1J12A 3ARZA 3WO8A 4WDWA 1UMYA 4AZBA 4M6VA 4Z2JA 2E9BA 3F5JA 3ECQA 3L0NA 1REQA 3MCNA 2O56A 5EFDA 1H49A 3VD4A 1W9UA 4WOQA 4LU0A 2QS8A 3OLEA 1Y7VA 5CZTA 1NP0A 3REQA 1H4PA 4W5UA 2KI3A 3N6QA 2P3EA 3IACA 3AIQA 5E6YA 1H7PA 1YPXA 1LUCB 5B8IC 1FCUA 2QDDA 2WSKA 2B81A 4IPJA 1UJPA 4TXEA 2G5WA 2Y63A 2AKZA 2WMHA 4MUPA 3V0UA 4XD5A 4QITA 3WNLA 4CN6A 2WCGA 3ZR4A 2H8XA 4O0QA 5JU6A 1RA0A 2HXUA 2G0WA 5G1YA 1EDQA 2Y88A 3KVMA 4PSRA 1EJWC 2CERA 4RZ5A 4EP8C 1D3CA 3P5ZA 4Z0JA 3WH0A 3W25A 1FWNA 3EX3A 1P5BA 1MUWA 1GVIA 2CLEA 1ZENA 1O6IA 4PUDA 3TYBA 4WY0F 1AL8A 4YYFA 4HPNA 4BCEA 5CPTA 2PDIA 2WSRA 2RDTA 1XR2A 3GBEA 3BLPX 1AJ2A 1OGBA 5GNZA 3FOKA 3K2GA 2B7NA 2CBJA 4Q4SA 3GH7A 2OCZA 3PTDA 2ZRZA 2PA6A 3HB9A 3QN3A 2I5QA 3H23A 4NNAA 1W1PA 4RZ6A 3P81A 1WDPA 1FH7A 1C8XA 3QF0A 3QLLA 3GSMA 4P7LA 3Q2DA 4Q4KA 3LRLA 5C8BB 3CUFA 1GOIA 2PWUA 3QEZA 5FI8A 1Q5MA 3LTPA 4JYEA 3IS4A 2X1IA 3O5KA 4DY1A 2VFIA 1GOQA 2G8ZA 5A8NA 1E5NA 3SQLA 4AIUA 1KO0A 1E15A 5CGMA 4FXRA 4U5IA 4N6FA 3N12A 2GVGA 1ISZA 3I6CA 1OT2A 5JVLA 2E8ZA 2WJFA 2PTWA 5M17A 3LZ5A 3MMWA 1VRXA 3MI6A 4A8RA 4C6QA 2PURA 1I2PA 1W2PA 2JK2A 4QROA 3LS9A 1K9DA 1I2QA 2F23A 2NQJA 2VRJA 3W71A 1AQHA 3LCFA 4P61A 5JH1A 3BC9A 1SGJA 3TFCA 3G1RA 1PYFA 3BW2A 4J35A 4PRRA 4I7VA 1TPUA 1YX1A 1ISXA 2IQTA 4L1WA 4NJHA 3AXMA 2WMFA 2OG9A 1P0NA 3LCHA 1PKYA 4BEUA 2D24A 3L4VA 1QATA 3S2JA 1FCBA 3IHZA 3D3AA 2AAMA 3TE9A 3N9KA 4B5XA 2XP6A 3PJUA 2LPVA 2ATMA 2PWHA 2RJGA 4HVXA 4J4OA 4P7QA 5KITA 4QJ3B 3ITTA 4Z1DA 3RGCA 1KWKA 4WIWA 5FKYA 1FWWA 3F03K 2J27A 3T07A 1YRRA 1SFTA 3W1RA 1QPOA 4IJRA 2PDJA 4B91A 3APTA 3OA5A 4MNMA 4GUHA 2J9ZA 2E5CA 3VILA 4GXWA 1YDOA 3AXHA 1M7PA 4QT2A 5HANA 1Y5VA 2DT2A 4LNCA 3QYSA 1AJZA 5D75A 4UIOA 1CT5A 3UJEA 4XBKA 1SU5A 1EO5A 5ABFA 3NPWA 3A22A 5IHRA 1XIGA 4TMBA 3EOOA 4C6FA 3H55A 3I6RA 4K39A 5BMWA 2QGYA 1ADDA 1VPQA 3M0IA 1LBFA 2BP1A 4NZ1A 3W7DA 3F5KA 3GYEA 5CPNA 5D9NA 3JR2A 4ZODA 3SFWA 1XIMA 1FCVA 3HZ3A 5FAGA 2YFNA 1JZ4A 4O11A 1NEYA 4IOTA 4IMDA 3AIRA 3NOEA 4MPQA 2E7FA 1VH7A 2NSOA 2DG9A 2ITKA 1SPQA 4FAPA 4GIAA 2FZBA 3TYEA 1BWKA 2Q3RA 1BPLB 2V2CA 4LF2A 1KFEA 4AFYA 4C6CA 4QS5A 2OFNA 4C7FA 2OOFA 3G1SA 3M6DA 4V1YA 3L0KA 1C9HA 4O4VA 3RHGA 1Z3NA 5EMYA 2P88A 3T2QA 3O1NA 3TVAA 4U85A 3TKFA 3WLSA 1S5NA 1JF5A 4PBFA 3E1F1 4MJZA 4HPHA 4K2SA 4OOZA 1SJAA 3I3DA 3QJAA 3VDBA 2PODA 1NJJA 3AICA 1R2RA 4GGQA 2HWGA 3PZVA 5FEXA 2BX7A 4Y9NA 3UESA 2NX1A 5GJMA 4NL1A 5A6TC 5CXPA 4GIVA 3EAUA 5B7ZA 3OIHA 3KL0A 1F74A 3PM6A 5IXEA 3J7HA 3V7PA 5BOEA 3R7MA 2Z26A 4JOMA 4AEFA 4X60A 2WHLA 3RPDA 3TTEA 5D9PA 4WQ6A 2OLAA 3GRIA 1J2BA 3TQPA 1E1CB 4JIRA 1ZU8A 1B9ZA 4AWTA 1DV7A 2ZUTA 3IKGA 3NL5A 2C71A 2Y70A 2LKNA 3AMDA 4YHGA 3BZJA 1LM1A 2P4VA 4OT7A 4XO6A 2QCDB 3PBUA 4HQVA 4LCRA 1LQ0A 4LAZA 4UR8A 1IEIA 1DXIA 1O5QA 2X7VA 2VKZG 3HFTA 3A3XA 2VGIA 2PDGA 1IWPA 4XAPA 3P14A 3PSWA 2EG7A 4KERA 2YCJA 3MJMA 5KINA 1JGIA 1LORA 1FWFC 2QGHA 1OYAA 4BI6A 5G4EA 1TRDA 3UG8A 3UVAA 3O5IA 4H8VA 3TA6A 3E9AA 3GHSA 2VRQA 3U48A 3GM8A 4YTSA 1B3YA 3UCCA 3CH9A 2X09A 4ZO7A 4B15A 2BVDA 4OWGA 5FJRA 4IIBA 2E4TA 1F4HA 3WX7A 1B3WA 1QPQA 1DJWA 5G1TA 1O5KA 3NI6A 1VKFA 3AU2A 3S5OA 3TYCA 3P80A 3DFSA 4H9VA 2J77A 1IZKA 5BXPA 2WQDA 1S2WA 5KMYA 4U5KA 1MNSA 2M1IA 2V3EA 1OHLA 3S1WA 1CI1A 2AL1A 1FXQA 2XP5A 3ATZA 1UKQA 3HMCA 4H41A 1E43A 5M2FX 1VP5A 1BVZA 2AL2B 2ONEA 4P7RA 4IX2A 4CQDA 3WQOA 3PJTA 1QWKA 3AYSA 4L9XA 4AZCA 3KOXA 1PIGA 3PUGA 5AHFA 3GKFA 5BNKA 5LNVA 4LVBA 3THCA 4NAEA 3NWRA 1GYNA 1MW2A 4O18A 2OSXA 1KGXA 1L6FA 3ZMRA 6XIMA 3WLKX 3ELFA 4L6DA 3VNIA 1DJHA 4JQ4A 4BY3A 2K8IA 3STEA 3LU2A 3EMZA 3KP1A 4I3GA 2FVMA 3FS2A 1HZYA 2P0OA 2J8GA 2LJ4A 4E4FA 1BSIA 2Z00A 4CD8A 1A80A 1U1JA 5H8PA 4N9CA 2G41A 1BEUA 2E9MA 2ISDA 3LHWA 2PZNA 3AWNA 5A8OA 3MMTA 2Y7DA 3VOHA 2CWNA 4F0SA 4ZOBA 3QOKA 1KWGA 1IGWA 4DWSC 3UR2A 2VR4A 6REQB 4ODPA 2ZXDA 1A0DA 3TW6A 4JTFA 1TJRA 1OF6A 2BFGA 4NNBA 2OEMA 4O4WA 2ZRVA 5A8PA 2BXZA 3LM7A 4KF1A 3FA5A 1MYRA 2OZ8A 5HQLA 1CXIA 1XLDA 4ZA0A 4MKVA 4JYDA 4K8EA 3ARTA 3GVVA 1OWQA 2J24A 1T5AA 3UZJA 3QHNA 2FHFA 4M56A 1UQZA 4N42A 5FL1A 1IV8A 3MC5A 4LSBA 4TX9A 1PWMA 1J6PA 5C2XA 3FFSA 2C79A 1OX4B 1L9WA 3PZNA 3GFYA 1XLEA 1XIFA 2F2HA 1G4PA 4CNUA 1HXVA 4MF4A 2Y8KA 3FV9A 2BSLA 2JKEA 4FIQA 4DBWA 1HFBA 3U7BA 4BF8A 3NEVA 2CYGA 3U5YA 4NJKA 2RUSA 2V8ZA 1IF2A 1XYFA 4KQNA 1QHOA 4MZ8A 4O54A 1CXEA 2OWWA 2TYSA 2XFYA 5G1MA 4C5ZA 3C4UA 1A3WA 1JVNA 4U28A 1CIUA 3NZPA 5EMUA 2C14A 3BJSA 3MT1A 3E0VA 1FOBA 3STGA 3ITXA 3C2EA 3RILA 3EGJA 1R2TA 4C7GA 2ZUMA 5BRBA 1E70M 2A6NA 3GG8A 3H4XA 3CZ8A 3QGKC 1JZ8A 2OJPA 2GVLA 3G1AA 4F0KA 2A5HA 3FA3A 5DEZA 3CHEA 4ENLA 1SUXA 4IIEA 3W37A 4S3DA 4N0RA 1YXDA 2I9EA 1F3XA 3BW4A 3FDKA 3CGNA 3DFOA 1G4SA 3NQVA 3H6OA 1SYTA 3PY2A 1Z48A 3BLKA 4ZMGA 4DROA 3MV11 4ODOA 1X8CA 1Q1CA 3M0ZA 3UP8A 1R47A 3HQPA 1YXCA 2CEQA 4JFTA 4BQ4A 2VEIA 1ODZA 3M43A 3MO7A 4FOUA 4FF7A 3QHMA 1NM9A 3ARSA 4RDWA 2ZXBA 4FNPA 1B5TA 1KQZA 5HK4A 5EB8A 2D0GA 1CXKA 1J5TA 3VDHA 1T41A 4XG1A 3O5GA 1RZMA 3W73A 3OW1A 2GOKA 2A3EA 4AUBA 1Z44A 5JBDA 3K4DA 4L5ZA 2EJAA 1RSCA 1DIOA 2QJHA 1EB3A 1QNOA 3MDUA 4RV8A 4R85A 3IRDA 4TX8A 1HGYA 2GLKA 3PAOA 5E1QA 3E0WA 2Q01A 1NU5A 2A85A 2OEKA 4GI8A 2UBPC 2VXNA 7ODCA 4V28A 5AC6A 3CK5A 2BY0A 1HL8A 4N19A 1LRQA 1A49A 1C8VA 1U1HA 3H8AA 3FVMA 3KCJA 2DSKA 1U33A 3GY1A 3DGBA 1J93A 3CWHA 3WJSA 4JQ2A 4OQVA 4IIDA 2YA1A 3VNDA 2W27A 2GJXA 2YDRA 3JZEA 4IFKA 2FDMA 5G5IA 1L6SA 1HN1A 4B5NA 2GJRA 4W87A 1XL9A 2FVLA 1J0IA 1W54A 3LSBA 2Y24A 4A3RA 4BI5A 2YBVA 3R94A 3N3MA 2Z6JA 1E6SM 4KRUA 1JUKA 4GBDA 4GI4A 3C6CA 4Q4MA 3NURA 1KM1A 1BG4A 4G50A 1OIMA 1D8WA 2OYLA 3R79A 1E0UA 5JMUA 1DEDA 2VEKA 4NX5A 1P0EA 4JX4A 5IFTA 1TYGA 1CWYA 1XUUA 3RO6A 3RXZA 3EKGA 3RLUA 1CXFA 3MUZ1 4JN6A 4CQBA 4Z0SA 1OJXA 2ZE3A 3ABRA 3VVGA 3R2GA 2GK1B 4D6FA 1PUDA 3FGCB 3C0LA 2CZEA 1QNPA 3KAOA 1Y65A 4XUGA 3LCWA 2EPHA 1VIZA 1M41A 1JCLA 1Y0OA 1KBLA 4PMUA 2DW7A 3KAGA 1JFXA 4N4PA 3QTPA 3SIZA 1I75A 3SI9A 4POCA 1JI1A 1CW2A 2WVSA 3CHDA 2YW4A 2PLMA 3LNMA 3PZUA 1RAKA 4JDYA 2Y8UA 1EJTC 1E0TA 5AHLA 3N9RA 3B8SA 2IPJA 3L4WA 4HSNA 4C6IA 3BG5A 5BXTA 4GI6A 4PTNA 4GABA 3VOCA 1JNSA 1S2TA 1SZGA 4Y9AA 4LAYA 1NMVA 3USZA 3NUKA 4HK5A 3TTYA 2J6XA 4O15A 2LLEA 1WNOA 2DY3A 1UIPA 2J9YA 3A12A 5AVHA 3RPTA 1F3TA 1PZ3A 4XZNX 1XWYA 5HKGA 1QPNA 2J79A 3CPRA 4NJIA 3UG3A 4V15A 5I77A 1A0EA 4E3TA 1RLDA 2O9PA 3DFYA 3WBEA 1PZ0A 5I3GA 1YKWA 1AMYA 4H04A 4ALDA 1HO4A 5FIPA 4O14A 1MEIA 1JDEA 3LGGA 3ODKA 3HTWA 3F4VA 1OGGA 2X0YA 5M5DA 3S5ZA 3DG6A 2E1WA 4GACA 1XDJA 4OUIA 3EMCA 4WRHA 4GLEA 4LCSA 1DKWA 3DERA 2WMIA 3ITVA 3UF9A 2KAUC 4JTCA 1X7IA 3FAPA 1UW9A 1QPKA 2WXDM 2BOEX 1ICPA 1K7FA 4W8LA 1G1YA 4C7DA 4GE8A 1XDLA 4ZSTA 4LJ3A 3OZOA 2LGOA 3WKZA 3FHAA 2OGYA 3IRSA 5C5YA 3IIVA 5F1UA 1KBJA 5HATA 3TQVA 4JCMA 4CKQA 3LV5A 2BASA 4QJ1A 3O5LA 1WZAA 1D6OA 4KS0A 3L12A 3CC1A 3H26A 3WQ4A 3PSVA 5AN7A 2QCCA 5TBOA 2VWSA 1JXKA 2REQB 3W2UA 2VYOA 1S38A 1WOBA 3RX2A 4UR7A 2XH0A 4JXCA 3EB2A 1CENA 3MBDA 4UWMA 3HV8A 2PLCA 1GHRA 4ZPTR 1XG3A 2DSZA 2I17A 4UOZA 2V0TA 3VIKA 1HXJA 4CU6A 3T42A 3FIGA 3GX9A 3IV8A 4KW2A 4JX5A 3GNDA 3GW3A 3GO2A 4PL2A 3BL3A 1CLXA 4GUGA 2PSNA 1QW8A 1YYAA 3WQEA 3S1VA 2FGLA 1ZCNA 4S2BA 4B4FA 3GE7A 1V0MA 4CGTA 2WZMA 4O12A 3UETA 4DWSA 2XM2A 1KRCC 4JL1A 1P43A 2JZVA 4GWEA 1GQJA 1DJGA 4Z17A 2CKSA 3TCSA 5A8GA 1IX5A 2GSEA 1TJPA 2YDSA 1RHCA 3KHDA 3S5NA 3WZ0E 3DHPA 3PTQA 3TWBA 1H11A 4UTTC 4Q8TA 4KMQA 4DWSD 4KGLA 1JZ6A 4ZQOA 2JF6A 5FEZA 4CUCA 3POCA 1CDGA 4ZB2A 3F2BA 3OVRA 1TELA 4FPSA 2NUXA 4CCZA 4LUSB 1OK4A 3E2VA 1QI5A 5D8ZA 1ONXA 4JTAA 4LAMA 1FKJA 1LT7A 2IPFA 3UNDA 4X61A 3WQDA 3ORWA 2ACSA 5I3HA 1OCBA 1XYCA 4JFLA 1GT8A 4XV0A 4DO6A 3JRKA 3TEVA 4E2VA 3G1YA 4MIMA 2Y61A 5XIMA 1DP0A 3PF3A 2C13A 4PCSA 3MP3A 1MQPA 1WDQA 4MWAA 2QPXA 1KFLA 4WXYA 4DYKA 4RDZA 3GIPA 3CJPA 3BAJA 1BQGA 2C16A 5CSSA 1BD0A 4Z1CA 2OQYA 3L68A 4R34A 4ZOAA 1A3XA 2VZSA 5K4XA 4MNKA 2HXTA 3N11A 2XTKA 1PVNA 3NL3A 2V6AA 3AYVA 1R3YA 2VR2A 3OYXA 4ACYA 2A7PA 3WMCA 1QASA 3PR2A 4MGVA 3LXAA 3ARRA 3GFXA 4MWAD 2XGBA 5E9AA 3CMGA 1L0PA 3F4WA 4WJXA 4GZJA 3RFAA 4N9BA 2F6UA 1E73M 4HTBA 3R13A 1ZGDA 2E77A 1V79A 3GUGA 3B7XA 4TV6A 4YS1A 4WGXA 5C9UA 1E1EA 4ZQCA 3GTXA 3PZGA 1QBBA 4QEEA 2FTYA 4CNPA 4DVOA 4EWJA 3NAVA 4HPXA 3NNTA 4PCFA 4EPKA 2C8NA 3LUOA 3DC8A 1US2A 4YVVA 2BBFA 1GOKA 3W76A 3C56A 1BYDA 3P0XA 1LQ2A 2WSYA 4C6NA 1E6XM 3CHVA 1JCHB 3O6AA 3W02A 3O5MA 3BE7A 4JDBA 1K9TA 4LPCA 1QCWA 3N15A 4JNYA 4EPBC 5JBEA 4ZQRA 4HHLA 1XYZA 1ZP3A 2VEGA 3TLQA 4GXMA 1ZJIA 2VGFA 4M0XA 2G3NA 2HV5A 2XG9A 2XYLA 3W38A 1A5NC 3DKLA 1EJVC 4IXHA 4WLCA 3QZEA 2VEMA 3MI3A 5K4ZA 4XZ9A 1O66A 5FD0A 4LNYA 2A21A 5CCZA 1V8EA 5EGRA 3MUCA 5KZ6A 1XG4A 4R9XA 5SWUA 3PHAA 4CNNA 4IJCA 1PIIA 4LCQA 1FWTA 2CLLA 3OJGA 2ZX6A 3W1NA 5CJNA 1UYQA 4TIMA 4UTUA 4M6PA 2ZA1A 2X1SA 1TE1A 1UZ4A 1H7WA 2WSPA 1JI2A 3L7RA 4O1AA 3ZO9A 3B8VA 2WHMA 1YTDA 2FAPA 1IHIA 3BLEA 4QRNA 2GL5A 2WLYA 4XISA 2FHCA 2PWFA 2W4XA 2XUCA 1OM0A 3HOJA 2VJXA 4GY7A 1M6JA 1VYPX 5I03A 1JPHA 5A6LA 3KRZA 3WLHA 2R1LA 1XX1A 4Z42C 3A4WA 4MNJA 1GOWA 1J0ZA 4XAKA 3E0LA 1V4YA 2PAJA 5I6SA 2RUQA 1EO7A 1N8FA 3L4ZA 4U2YA 4FR6A 3UERA 5T8GA 5I00A 2FH6A 4J5NA 5T91A 2I5IA 4JFJA 5I09A 2VM8A 3QR1A 1N1AA 1QMLA 3ZWSA 4XUYA 1XS2A 4D8ZA 1OFBA 1QI4A 2Z25A 1V6TA 1SM9A 1WKEA 4DJEA 2WJDA 1A7XA 3B8UA 3IIPA 2Y6ZA 4PYSA 4RE3A 1G4TA 3G1FA 4FNQA 2QR6A 1G5AA 4YPJA 1T8XA 1XRTA 3ITLA 2BHYA 4HK7A 2CPUA 2HE8A 4UNLA 1CGTA 4O0ZA 3W7MA 2WK2A 3AXKA 3CNYA 4JIIX 5D05A 8A3HA 5ABEA 5D09A 3M5VA 3GH4A 2X7WA 3PR9A 4L4LA 3RJYA 2X2GA 4DM2A 2WMKA 5A8QA 2VL4A 3BMVA 2PDCA 5AOUA 2OXNA 3LPGA 3NQMA 3BG9A 3FKKA 1KC7A 4MMWA 4DJED 1VHCA 2ANUA 4S3GA 1IXNA 1TJ1A 5LA0A 1JDCA 2YA0A 1T7LA 4PSPA 1XYLA 5D04C 3OGSA 4S38A 3VC5A 3CIWA 2ZQUA 2GGJA 4HNLA 3NO1A 4DO5A 2EHHA 4ZTYA 3PUEA 4P7NA 3W7QA 1K9EA 5BMXA 3AISA 3M1ZA 1TMHA 3FJ6A 4L9YA 3DHDA 3AS1A 4S3CA 3K8KA 4G2DA 5AYXA 4QDWA 4MG4A 1X1NA 1AW1A 3OQ8A 3QHOA 4M19A 3BAIA 3N4AA 4J3XA 4AZ7A 3VIHA 3QV9A 5DITA 3ZVIA 4C02B 1TTPA 1KA9F 1DOSA 1MXGA 4IFOA 5D2YA 4ZB5A 3RCMA 4HB7A 4DRQA 3WDPP 1TV2A 1JQVA 1VEPA 3R8GA 3PFRA 3QGVA 1TPB1 2Y0FA 1B3VA 2BY3A 1F05A 1W1VA 3N9SA 1HKMA 1C93A 3NFUA 5DBTA 3KRBA 2PEVA 3O07A 2X1TA 4HSOA 5FA5A 4LFYA 5E5CA 5HULA 4YTRA 2DGAA 2MLXA 3R6IA 1W9DM 3JYMA 3MCMA 1EHAA 5K3VA 1WX0A 1UD8A 4ADSA 4P8WA 4ADUA 2AWGA 3ARPA 4IUGA 4OV9A 2CFFA 3LCIA 3LMYA 2QJMA 5I7GA 3S6OA 1Q7ZA 2POZA 1XSKA 1VFLA 1MEHA 3GNPA 2QCEA 3HV9A 2VHLA 1XH2A 4PCNA 3CPGA 4HBOA 4L4MA 4PULA 2QW5A 1EWEA 4FF5A 1KM4A 2ZFAA 1UKOA 2XP7A 4NNCA 1WZMA 1A5OC 2DDXA 2HPIA 3KRUA 3FSTA 3NPXA 4LYRA 3UZYA 2BMBA 2JGQA 1S2AA 2OFJA 2QQ6A 5XINA 1QO2A 4UOJA 1C91A 2PC8A 2YPIA 3SCWA 4HNCA 4HOXA 2F21A 1CGWA 2YBUA 3LHTA 1UR2A 2BV9A 1PHWA 1KV5A 4DZ2A 3GVGA 3UQBA 3UXIA 2GYIA 1Q6UA 3UJRA 5CSRA 1F8AB 4D9PA 4JFSA 3W07A 5KZDA 4DUWA 1U79A 1JYXA 4WR3A 1TV3A 2W9MA 4R0XA 1TMQA 3HG5A 3NEHA 4DRKA 1X39A 1DJNA 2NLYA 4E8DA 4LV4A 7REQA 5I78A 4QCFA 1XD1A 1AW2A 3VOGA 4C1NB 5H8MA 5G2IA 3SUUA 2EF9A 3TDFA 1FWRA 4HD5A 3N2XA 4TU1A 4BJHA 4LXFA 1B6CA 1S5TA 3CBWA 2EG6A 4UTTA 4AIEA 1QXLA 5CAHA 2PDKA 2R1MA 2SFPA 1GW9A 2JALA 2O9OA 4GI9A 2XIQA 1H09A 2D22A 4I5RA 1LROA 1QW9A 4GQ0A 2ZICA 2F2DA 1E40A 1M7XA 5HW6A 4IT1A 1TX0A 5F4SA 4HNUA 4O57A 4DJDC 2CETA 4CD7A 3AXIA 1TTQA 3TW7A 5FAJA 2PDMA 1LJYA 4TNSA 2V2DA 3IKDA 2QCNA 4I9MA 4AZCB 3VX0A 4Z2LA 4MJ2A 3WLPA 4DPPA 4L7ZA 2FFCA 1DJYA 1YTKA 3L4XA 2D3NA 4F79A 1YEYA 5ABGA 1YBQB 1MFVA 2V30A 3ABSA 2PPNA 2NX3A 4K6AA 1VRDA 3W01A 3WBWA 1E9YB 4GKLA 2Z24A 3G0XA 4DAFA 3AMLA 1QPLA 5CPLA 1RALA 3LCXA 3AWOA 1VR6A 2R1KA 4W8AA 3S9YA 2QDHA 1RD5A 4GXPA 2GWNA 2WNZA 4GG9A 4DUOA 5BWAA 1V93A 4IF2A 4KCVA 3KM8A 4TW6A 2OYMA 1YNPA 4GK8A 1V3LA 3KBNA 2AMXA 4DZ3A 1TWSA 5CH9A 2TAAA 4KQZA 3QMSA 1W3LA 1XC6A 3HO8A 2F61A 4IMAA 1H5VA 3T05A 1CBGA 3NSMA 2PMQA 4O1DA 1KM3A 4GIEA 4R9OA 5IDZA 3NYDA 2OO6A 5I24A 3IJ7A 5H91A 1X96A 4CEUC 3PS7A 3T55A 2NT1A 1TO3A 2DIEA 4HU3A 4MGGA 2GJLA 5FJJA 3PBGA 4I9AA 5A6BA 5HTGA 3WG6A 1AH0A 1C7TA 2BOFX 2DH3A 4PTWA 4AXNA 3R58A 1SFJA 3VKAA 1PEZA 1NSJA 3BAYA 1EP1A 1UWSA 1EOMA 3LENA 3B4YA 1GZJA 2Z29A 4GY1A 4I9JA 2R1PA 3QSRA 2ICSA 3SQMA 1PSCA 4X0NA 4KBXA 3P61A 3CYVA 2AAAA 4PTMA 3GKAA 4BI7A 2G95A 3BCJA 5HR6A 1RY8A 3N17A 1FY6A 3SM0A 2YZ5A 4FLOA 3Q67A 5A6BD 2Q6ZA 2JGYA 2GWGA 3NGJA 4FK9A 4KCTA 5D02A 3E5BA 1EOKA 3UBPC 1XINA 3G8EA 3B06A 1EDGA 3E12A 1P7TA 1YNYA 3EPOA 4R88A 3WK3A 1EUAA 4DBSA 2QUVA 4AAJA 2F6KA 3VIFA 3LRMA 5CSUA 2PDQA 4AXKA 2L2SA 1I2NA 1XLLA 2QDEA 3FVDA 1HJXA 4JTLA 1VJIA 1OFDA 3N2MA 2DZTA 2GSHA 1V3JA 3G5EA 3WEOA 1SR0A 1RR2A 3WQ6A 3FN9A 5FJIA 1LT8A 3UXKA 3PANA 5HWBA 2XPKA 3SECA 4DZAA 3OGVA 2XP3A 2G97A 2BXVA 4RPQA 3ZVHA 3GHTA 1PWLA 4M80A 3BSMA 4UBPC 2PI6A 4UTLA 3M44A 4ZSUA 3U2OA 5C9ZA 2QV4A 5FCZA 4R5EA 2O9TA 4X9YA 1J18A 4GVHA 4OVXA 5K9DA 3ZFHA 3CAVA 4NVTA 1TPWA 3OP2A 1ODUA 1UP3A 1WE5A 1YXYA 4G9PA 3T2OA 4MZYA 1I45A 1J4RA 3VCCA 4QFUA 1TR9A 4IPNB 3AC0A 2OKTA 3GXMA 2XZ9A 3KVKA 2ATSA 1EBGA 3E2RA 4EXBA 2VOTA 3U2CA 3E6EA 4H3DA 5GPGA 3CUZA 3KAFA 1TWIA 3TCZA 4C90A 4B5VA 2VZVA 3TC3A 4ZVJA 3UA4A 1GCYA 4GIYA 1FP9A 1W8SA 1QW7A 4UB9A 5CPQA 2OGJA 2HK1A 1JR1A 3P8IA 1JULA 5HQMA 3PPCA 1I2RA 3BMXA 1TQJA 2Q02A 1NWTA 4HHPA 3BMWA 1IE7C 4U10A 3QYQA 4HTYA 4A2RA 1UA7A 3C52A 4K7YA 1MVYA 1TUFA 5GNXA 1GHSA 3T09A 2CU0A 5HJYA 1GQIA 1FFRA 3VDGA 1UWTA 4YVXA 5DMYA 3E5PA 4GO8A 2PGEA 4BZYA 1H41A 1M1BA 1KTNA 4A35A 1GPFA 3JYJA 3NTPA 2ZC1A 3GHRA 4W85A 3CLWA 2F2KA 4K68A 4AU0A 1JPDX 2FZDA 3QQ1A 3UPWA 1YDNA 3STCA 1EQPA 5BCAA 3PULA 3KE0A 4LANA 1RLCL 3UY7A 1KKOA 5CEWA 1JYVA 2WVTA 4DLFA 3QXBA 2NV2A 3GHUA 4P8VA 2F7FA 4WF7A 4AIBA 1XIEA 1R3RA 3W7LA 4UZSA 4RX0A 4FLQA 2CKRA 1H7XA 3GIYA 2PTXA 3VD9A 2DZWA 1A5KC 4GINA 1J2WA 3H21A 3DHFA 3G8RA 3EB4A 4XK2A 1JZ7A 3HJZA 4GFSA 3SUWA 1R3TA 2DFAA 2UV8G 3MP5A 4ZQPA 3IGUA 1ZP4A 1QTWA 3HG3A 3W1MA 2INZA 2ISSA 3TA9A 3RYSA 3GH5A 4LYKA 4CU7A 1K9FA 3AIVA 3CV2A 1ZK6A 3A4AA 4IGNA 3W7EA 5DCDA 1BTMA 3TYAA 3PZIA 3NL6A 1JPKA 1E6PA 3ABZA 2FMNA 3BDKA 2ZUUA 1WA3A 3LD5A 3A5VA 3KOWA 2JKPA 4Q6JA 3SRKA 2YB4A 3CGTA 4N7QA 3LNPA 1LG1A 1S39A 2ZZ3A 3TQ0A 1PX8A 2NWRA 5C54A 3RX3A 3TR2A 3IJ8A 3QR0A 1ZL1A 3EX6A 1KM5A 3DYMA 3T0DA 3TC5A 1WP6A 1XQLA 4PH6A 3BCDA 4XAZA 3WD3A 4MB1A 1CLVA 5LIYX 2OQHA 2JFEX 2Y1HA 9XIAA 3HPSA 2ZRWA 2ZZ4A 1DHKA 1GG0A 4ZZ9A 2PBCA 3KCLA 2QCFA 3O5JA 1FP8A 3W24A 1JDAA 4R7WA 4UTJA 1UZHA 1W9VA 3IK4A 1X98A 3CEUA 4W9TA 5EKYA 1NWRA 2Y78A 1GQLA 5DO2A 1WKDA 5TIMA 1XF0A 4MPKA 4OTKA 4LF1A 2H3DA 4NI8A 4RW3A 3TN5A 1MZHA 1O4UA 4AH7A 1KCXA 3WD1A 5DIVA 1K7EA 2DPEA 3QMTA 1HVQA 3ZOAA 4US6A 5JIWA 2WMIB 3CUXA 1DHPA 3GG0A 3HQ1A 1F61A 1QK0A 3GZAA 1BVNP 1Q65A 4JR5A 3VIPA 4MVAA 5FACA 5HW7A 3VTRA 2A3HA 2PE4A 3BURA 1P6WA 2PWDA 1W1ZA 1W17A 2CLMA 5CC7A 1OSEA 4QSFA 4DJDA 4ZBCA 1EBHA 1A53A 4AWEA 3S9ZA 4H9YA 2X41A 1UPMB 3AJ7A 2YJQA 3CAWA 1MQRA 4PUUA 5DCEA 1FH9A 2VFFA 2PB1A 1KLYA 4H6KA 5HXMA 7A3HA 3BUVA 3QZ6A 3IGHX 2ODOA 2MLZA 2XVKA 1WKYA 1OX4A 4HU0A 3KWSA 3EOEA 1IEVA 3NVTA 1JXJA 3LTSA 1VPXA 1N8WA 4QAIA 3UI6A 3O5DA 2ABAA 4MDOA 1Z89A 4IPIA 5FEWA 4DJDD 4GH1A 5FEPA 4Y7EA 1YE4A 1XLJA 5HBFA 4UDMA 2VC6A 1J01A 2V3FA 1TJ0A 4KFOA 3GU0A 3MYOA 4DRMA 2P5NA 4XIMA 2XHYA 5EA9A 3FKRA 3PZOA 3DIPA 1VYSX 2D2GA 3C2VA 4XAYA 3KBMA 5LKYA 1PDYA 1W3KA 3BICA 3W22A 3AIUA 1EA9C 3WCZA 2I56A 4ZPWR 1CGYA 2VGGA 4ACZB 3ATYA 1TZZA 2GJNA 3V1PA 4AWUA 2C0AA 1QU4A 3WLLA 2GVJA 5LZLA 5B80A 1A5LC 4MAVA 3QFEA 2V3GA 5AHNA 1UWIA 1Z8AA 4IT6A 5C7VA 3Q58A 3SUSA 4ZTXA 3VO0A 2ABBA 3RM9A 2V38A 3CZLA 4LVFA 4MY1A 1QNSA 1OC6A 3KZSA 2PP3A 1V6VA 4I90A 4CLMA 4UR9A 1Z7AA 1LCOA 3Q37A 2ZUVA 4KWWA 5A1AA 4ICNA 2OO0A 1VJSA 4ASTA 2J7EA 1CCWB 1EF2A 4MSPA 3A13A 3DFQA 3A5FA 3HJEA 3W75A 4ITZA 3BLOA 1LDCA 4REQB 3PC0A 1CTNA 3W7OA 3MSDA 4XD3A 3ZYZA 1ZUAX 1Q6GA 1PX4A 1WDSA 1F6KA 4J3ZA 3W7KA 1KD0A 3U2EA 1O68A 1ZBKA 3MBFA 4E38A 3PPGA 5I3DA 1W1A1 1UBPC 4D6EA 1UUOA 1RY0A 4KFPA 4ZE5A 3DFHA 1E55A 4MZ1A 1C90A 4CVUA 1NVMA 6ENLA 1NOUA 3NQDA 4GUJA 4MWAB 5CZSA 2C3ZA 5HJLA 3IK2A 2GFTA 3E2QA 4S3KA 3IEBA 4HJWA 3ZWTA 4E6MA 4ROPA 4EXAA 1TUXA 2QUTA 4GVGA 5D38A 2FIQA 3BV4A 2J7DA 3RM4A 4GH3A 4LS1A 3FYPA 4CNOA 4DAIA 2NV9A 1HP5A 3WK1A 3WD2A 4IGSA 1W3HA 4LBSA 4F3HA 3GWQA 1BFNA 4EIVA 1XKJA 1KBKA 2PU1A 1GW1A 4HHHA 1K8ZA 3PUOA 2C19A 4D8LA 3LPOA 1G01A 3W87A 2VVSA 1U2YA 1UB3A 1A3HA 3UR7A 4KESA 1QRQA 4XTIA 4F0LA 2ZZ1A 3MUAA 1X38A 3AUJA 5BROA 3WUBA 4WDTA 2X30A 2N87A 4EACA 3GB6A 3ANVA 2XP8A 3FHQA 4IPPA 1P4CA 5LHEA 4ZENA 1IGSA 3L4YA 4ZL1A 4DZIA 1G67A 3FNDA 1QAPA 4FIRA 2HEJA 4B3LA 4IQJA 1E0VA 2C1IA 4NZ5A 5LNSA 1H51A 1K70A 1XBVA 4GNKB 4QLJA 2QMJA 4KEMA 2BNJA 3NRKA 3RMJA 3C3NA 3B9DA 5G2HA 3VI2A 1UH4A 4M6QA 3VOJA 4I6VA 3C0QA 3NO5A 2O4MA 3CB3A 4XZLX 2E5DA 4PMYA 3EBVA 1OB0A 4DBDA 1XRFA 1IT7A 1UPPA 2NQHA 1GVOA 2ZDRA 4Q3MA 3W28A 5HPCA 4R27A 2KE0A 4NQ1A 3OQEA 1XIHA 1JAKA 4NT0A 3NYZA 1EDTA 1TPC1 3BANA 1FKXA 2WZIA 1VFUA 2YL6A 4GQBA 3KFTA 1EHNA 4WGHA 1W3TA 3VINA 1GOXA 5JIPA 2DZAA 1UH3A 1D7KA 3CU2A 4CN4A 4JYSA 3E96A 2DG4A 2F38A 4H2CA 3LCGA 1B4KA 4DPQA 2L5HA 3PTKA 1KFJA 1OZMA 1E1FA 2PGRA 4XIAA 2WPGA 4X0VA 4IIHA 1IZJA 2V63A 2JKAA 1UWQA 4WEVX 1C29A 4MM1A 1HVXA 3LXCA 4B2DA 5FJPA 3HFYA 1C8YA 4EKJA 1TFVA 3DECA 4HYRA 1SFLA 3EKZA 2XM1A 5C9WA 3KOYA 4JY8A 4KEVA 4QBXA 1FKIA 5E9XA 4JIEA 4LS2A 2R82A 1UKTA 4O8AA 4K7VA 4U84A 4XD6A 3WQCA 3RIKA 3P93A 2ISFA 4CQ9A 1XH1A 1KFCA 3MCOA 4IQCA 1B3OA 3THQA 1IT0A 3XISA 3BAWA 5ECVA 1XBZA 1LBLA 3JS3A 3KTXA 2PC4A 1V3KA 1UBSA 3M16A 2GJPA 3JXVA 3SY5A 2V68A 2IS7A 1W32A 3O3RA 4AIOA 1DIEA 3DI1A 3AHXA 3GBDA 2IXUA 1G4EA 1AH4A 5CLWA 2E67A 2XIJA 2ZA2A 4TTGA 2G3JA 4W9PA 1F7BA 2X1RA 3UWVA 2ZQVA 9XIMA 3EXTA 4JL2A 3OZYA 5DLCA 3M0XA 4I7UA 1R38A 2FJKA 3V75A 4S3AA 1PCKA 3U2ZA 4S1FA 9RUBA 4LS0A 5EY5A 1G7UA 1UR0A 2VCBA 1D2KA 1A50A 4JAWA 1OYCA 1PTDA 3QRHA 3TFXA 1NWUA 2OU4A 5E0FA 3FYYA 3SUVA 1NMWA 4B92A 2XFWA 3QTGA 2WC4A 2HE5A 2YL9A 1R2SA 5HNNA 4GBUA 3WH5A 5HWNA 3PPFA 3H2MA 1XW8A 3GZ3A 4JN8A 3N1AA 4OBSA 2GGIA 3CMFA 1TWDA 4BKNA 1I2OA 1WDWA 4DF0A 1O7AA 2GDQA 3KWXA 3RNDA 3VIMA 2PTDA 4N9EA 2ACRA 2VELA 3N3TA 3WFZA 4QT3A 4MWAE 3IVTA 3ANUA 4KWSA 2IKGA 4GIRA 1FKDA 3TYZA 4P5UA 3WMLA 1TV4A 3KS5A 3HPZA 5LXXA 3TN4A 1RCQA 3BK0A 1XGZA 2VD8A 4HA0A 3ARVA 4HN8A 1XCFA 4DEFA 4HNVA 3LM3A 3E0FA 1HT6A 2Z1VA 2DW6A 2O7SA 3MSRA 4YLWA 4X2PA 3M0KA 3IUIA 3KEHA 1NWSA 1XRSA 4S3EA 1IT8A 2YZRA 3QV7A 5F2LA 3II1A 2XPBA 3QKEA 1NH6A 1TCOC 2PLJA 3GU9A 2ZTKA 5BXSA 5C2CA 3BAXA 5GPRA 3WYZA 1IWAA 1G6CA 4IQDA 4ODRA 2E09A 1DVJA 1N55A 2DEPA 1MI3A 3JUGA 2MLYA 1SW3A 3HF3A 3VIJA 4N4QA 2PFHA 3F4CA 1F3EA 4F66A 4WKFA 1BXNA 3MS8A 4GX9A 3OHMB 1D7IA 4B90A 3WNMA 4X22A 3RCNA 4DF1A 2WSQA 4F9DA 4LUSA 4ADTA 1R3QA 5G4WA 3AXXA 1UC5A 3TZNA 1EGZA 1W5QA 3WUEA 3GTHA 4J3WA 1QO5A 1W1TA 4WDXA 1CYGA 1Q2SA 4TVDA 4L72B 3MU7A 4XO7A 4J3UA 3B0VC 2QCHA 2OODA 3NQ7A 2XIIA 3UWZA 3WY1A 1JCMP 3BW3A 4GD0A 2QV5A 2ZX8A 2P3ZA 3FDGA 3SGUA 1OD8A 3H7RA 4RCXA 2HK0A 4OIFA 2Z4GA 2QPSA 4HSHA 3UPMA 3CV1A 1TX2A 2J7BA 4LWWA 5JH8A 3FXGA 1XJBA 3W1AA 1UD6A 4AEOA 4XKYA 3MANA 2VZTA 2KGJA 5DCBA 2PRHA 2R1NA 2PLKA 1GJUA 3N25A 4QTGA 1OYBA 3C0JA 3U9IA 1VS1A 1NDVA 4TX6A 1JYWA 3S3GA 2BVTA 4YYCA 7REQB 3TK7A 4A3YA 3KXQA 3RU8X 1AG1O 1KR1A 2Y2WA 1ECEA 1X1OA 4M5PA 3OBKA 4JICA 2MPHA 2GDUA 3HMJG 1CXLA 3T44A 3ARYA 1PKLA 3ZIZA 3KABA 2FPVA 3FAWA 3BVJA 3N2OA 2OVLA 1PYMA 1KW1A 3JW7A 5G2WA 5TF0A 1XYAA 5MKGA 4LAOA 1OFEA 4XVEA 2CLHA 5DX7A 3CHCA 4JGDA 4KFNA 5LIWX 1BXCA 1EJ7L 3NIYA 3FXYA 1MO0A 4BQ3A 1E72M 3W1QA 3UD6A 4R3UA 2FPTA 3V35A 4HMDA 2DUXA 3H2FA 1THFD 1PXGA 4EF9A 3MKCA 1JCJA 2KZHA 2YLAA 1PDZA 1DTUA 3FAXA 5E0CA 4ERIA 4CD6A 2QVHA 3LDVA 4BHYA 3M41A 2NUYA 1O1ZA 4IJBA 2Y5EA 3UVIA 4IM4A 2YA2A 3DC0A 2VDGA 2J7FA 1KM0A 3ZLFA 4IISA 3N19B 2A2IA 4O17A 4MUZA 3M5ZA 3S0CA 4PZVA 4Q8NA 3QV6A 1AZ2A 1DWIM 4IHCA 2ZZ7A 1CGXA 5D2TA 5E09A 4H00A 4PR4A 2FTPA 4B9YA 3DEQA 4UUIA 2B7OA 3EA3A 3PNUA 2P1FA 1YDYA 1ISVA 4TW8A 2IKJA 5HWMA 4GRSA 4JZ5A 4JHZA 4LVAA 3N13A 2VDHA 3T6CA 3W2MA 5IHSA 2XVNA 4CQCA 1VFOA 3MKVA 1A5CA 1FCQA 4NI3A 1XISA 1IIHA 4LYQA 2J74A 3S42A 1OBAA 2FZ8A 2DVUA 3WF2A 3PZ9A 1PTAA 4E2BA 2BLEA 4PN2A 1JRBA 1ZQ5A 1WCGA 1V0LA 2QXWA 1UJQA 2YL5A 1T6MA 1PJ9A 1WAWA 1LTDA 1QUMA 2WYSA 3GDRA 5DIUA 4E4UA 3KOZA 4QNEA 3ZJKA 5FL0A 3D47A 5T26A 3NOYA 4AEEA 5HWJA 1UMLA 4LALA 4OU1A 3U7VA 4L65A 4S2CA 3RLGA 3VGEA 2OLSA 1M53A 3LSCA 5D30A 2VCCA 1FJDA 4MY8A 5LGXA 4EX4A 1CX9A 3VD3A 3VKCA 3PA7A 3PZTA 3UWYA 2OSYA 3GC4A 4RPPA 1P7TB 3ZR6A 1BQCA 3ZJ8A 1LL4A 4GYPC 3C61A 4L56A 2CLPA 2Q71A 3SJNA 3GYCA 3MDWA 3IWPA 4UFJA 2R94A 3TJIA 1HF6A 4JPGA 3G1XA 4LGXA 3JVAA 3P3BA 1EYEA 3S5SA 4JKMA 4NILA 4RR4A 3R43A 4NSBA 3ZVHB 2DV0A 3KLKA 2NVDA 1H7OA 4GZ7A 3CM4A 4AC1X 3GPKA 3GTYX 4YMZA 4YIWA 3SY1A 1B30A 3W7JA 5AY7A 3T4WA 1OCNA 2Y5JA 4MB4A 3D3FA 4GYKA 2WMGA 2HQAA 1IWBA 1VAHA 1TB3A 1HUVA 5LA1A 4MKNA 3SY8A 3G77A 1FDJA 2EJ1A 3KL5A 5HW8A 4I5UA 1LZOA 1OABA 2Z7GA 3TMQA 1KRAC 2PDYA 4JCLA 3Q45A 1GONA 3DZ1A 4DRHA 1DIKA 4L80A 2Q5AA 3A3WA 4AX7A 1I0DA 3CV6A 3MSYA 3KBWA 4ODQA 2J9XA 3OHIA 3W4RA 1K4HA 5HNTA 4M24A 3UI4A 1E4IA 2VURA 3UG4A 4DBUA 1JG9A 2OX1A 1LP6A 4M6UA 5LGZA 3KDNA 1J0YA 4A2SA 3TJ4A 5LIXX 2XFRA 4FMVA 1B2YA 3A3HA 2CBUA 2MUCA 5FF4A 1Q45A 3BOFA 4MY9A 3E02A 3TXZA 3NDOA 4IPXA 3LRKA 4A21A 1YLVA 1KBIA 1GJPA 2D0HA 3W6YA 1W8GA 4JN7A 3W2JA 1UP0A 4Z1AA 3RITA 2ALRA 1XIJA 4Q8VA 1IXOA 1JZ2A 1IEQA 2F9RA 4IQLA 5DRCA 3BOLA 4HA3A 4PB4A 1EP3A 1VB9A 3ARQA 2XU2A 2VFHA 3O63A 4GJJA 1UD5A 2E0PA 2UY5A 1FBAA 3L4UA 4F8XA 1KXQA 2FZ9A 3GNRA 3WF0A 4EVZA 1EFZA 2YCIX 4LOCA 1KXVA 3L2IA 4JHMA 3KBSA 3MDYB 1MWOA 3GR4A 2AQOA 3B8WA 3MA8A 3ZSTA 3IJDA 1PAMA 1HKJA 1LWJA 3CASA 4V27A 4ILSA 5FSEC 5F2IA 3EKLA 1E51A 2EO7A 3B8IA 3EZ4A 3EXSA 2Z2AA 3QZAA 4NJJA 4AZ5A 4HZMA 3MQTA 3ONCA 2PWGA 4UTWC 1VD6A 1FXPA 3GIQA 1LWIA 3RLHA 5KTLA 1DQUA 1GEQA 4JIHA 4AD5A 4H7CA 4C1NA 4J7RA 3EA1A 3WH9A 5JXQA 4DT4A 2ZZ6A 5EFFA 5F4XA 4F2TA 4M7TA 1Q6IA 3CQHA 1R85A 3CWNA 1GEHA 4ML4A 4JY9A 3WJYA 5I3FA 3WLIA 4YJ5A 3UA3A 1US0A 2QPUA 1O60A 1WYIA 1GPWA 3O06A 1W3JA 3VAVA 4DLMA 3T08A 1UOZA 1Q66A 4H9TA 2DVXA 4QXIA 5I98A 3G18A 3GW0A 1Q2RA 3IGSA 3BARA 2Z0IA 3VAWA 4FR1A 3U8GA 5CAKA 3N6JA 2P8BA 1GYMA 2WVVB 4L1XA 5LIUX 3QMRA 3SJ3A 4NX0A 2HZGA 3MMUA 1XICA 5T9CE 4XSLA 1YBQA 1FWBC 1PZ2A 3VOFA 6A3HA 3TNBA 3NZ1A 1CGVA 4Q6XA 3IAPA 3AHYA 1G7VA 2XFFA 1DWFM 2ZR4A 2ZADA 1EZWA 2FMOA 1UD2A 1XBYA 2J25A 4DIAA 1Q7MA 1GOOA 2WKLA 3B04A 2CWXA 2M2AA 3K4AA 3EOSA 4A05A 1QI0A 4MOZA 3M6YA 1MFUA 3POHA 4B5SA 5I5RA 3WD4A 4EWND 3AOFA 4KCWA 3O6DA 4H9MA 4Y9PA 3GXTA 4AZ6A 2E6YA 4L9ZA 4GNVA 5DFAA 3RM8A 3W00A 3T81A 1JVWA 3SGZA 3W6MA 2INFA 3PBYA 4H8UA 2CESA 3OGRA 3Q94A 5CBBA 1N7KA 6CGTA 2E40A 4H2HA 2Y85A 4GJIA 3V5CA 2UWFA 4GQQA 4QE5A 5E0KA 4QSHA 5LA2A 2WJEA 4L61A 4GISA 4HMEA 3NO3A 1JDDA 4ZO9A 4TX0A 2NLIA 1IR2A 3WMBA 3TWAA 4YTTA 4KRZA 3PBWA 4IP5A 1MQQA 5H8UA 4D72A 4ERGA 1KNWA 3WNPA 3AIBA 4P7OA 3VDCA 4C6LA 4QEHA 3FY1A 2GQ9A 2ZIDA 2W5FA 1VQTA 4Q8QA 2M08A 1ITUA 2WPBA 3GG7A 3UZZA 1JZ5A 3DUGA 1A4MA 1F8MA 5EMLA 1BXBA 5BU6A 1J4IA