2DSVA

Interactions of protective signalling factor with chitin-like polysaccharide: crystal structure of the complex between signalling protein from sheep (sps-40) and a hexasaccharide at 2.5a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
publication title Carbohydrate binding properties and carbohydrate induced conformational switch in sheep secretory glycoprotein (SPS-40): crystal structures of four complexes of SPS-40 with chitin-like oligosaccharides
pubmed doi rcsb
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dsvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dsvA01
4AIEA 3I3EA 1IZJA 1NP2A 4N0RA 1E4MM 4Z2HA 2JF7A 3BGAA 4J27A 3SUTA 2DT1A 1CEOA 1B1YA 2Q8XA 2NW0A 3BSHA 1JDCA 1CXFA 2ZIDA 5C70A 3M46A 2JALA 1Q6EA 1VEMA 2GDUA 3GM8A 3PZQA 3TA9A 4L4OA 1J18A 3UCQA 3MV11 3POHA 4AZ6A 1KCLA 1C90A 2OWWA 4WSKA 4OZOA 2A3HA 2D3LA 7TAAA 1W1TA 2VOTA 3OGSA 1B3XA 1KXHA 3WF1A 1H49A 1B3VA 1VB9A 1DTUA 4BQ5A 4IPNB 3ARYA 1E6QM 3AS1A 4UZUA 3VIPA 1JYXA 5GNYA 2WMIA 4F9JA 3WMCA 1V0MA 3GZAA 4MB3A 3PZMA 2ZXBA 2E9MA 4GKLA 2XGIA 4W8LA 4HA1A 5CJ5A 4AZBA 3UG5A 3ZR5A 1B3YA 3AROA 2W62A 3WNKA 5GQBA 2CNCA 1JDAA 1QHPA 1CXIA 4HZ6A 5FCZA 1OB0A 3IK2A 4D72A 2VX4A 3ARWA 4Q22A 2J7HA 5IDIA 4PRWA 4HU0A 1HVXA 3NSMA 2G3MA 1UWQA 3AZTA 1CTNA 1CYGA 3N15A 4BA0A 3GXIA 1E0WA 5C8BB 3B8SA 2V5DA 4V28A 4D6HA 1GHRA 2PI6A 2ZUNA 1WDSA 1G0CA 5HXMA 3TTYA 2EPKX 3ARQA 5BYWA 2WHKA 3VGDA 1CNVA 1ZS2A 2WBKA 3THCA 2GSJA 4UQAA 2CCRA 1AQHA 1GVIA 4TOQA 3VNZA 3B9DA 1XCWA 1M7XA 2EJ1A 2VRJA 2NSXA 4J3WA 1GJWA 4W7UA 2WVUA 3QGVA 5AC4A 1E73M 2J4GA 3QHOA 1EOMA 1GUVA 1E3XA 2PF0A 1KFWA 1QNRA 4E2OA 3L4WA 4LPCA 2VTFA 1R86A 5ABFA 1W1VA 3VVGA 2QPSA 4D6IA 2EPNA 3VGEA 3BAXA 1V3KA 1XSIA 2WB5A 3AHXA 1B30A 4ZE5A 3GTNA 1BTCA 3OB8A 1CGWA 2WMJA 1UH3A 1C93A 1N82A 3VDCA 2WC4A 2YDSA 4AZCA 3GYCA 4AD0A 3AZSA 2ZUWA 1KXTA 2WCSA 4XX6A 1TR1A 3EDEA 5D8ZA 1RD6A 4HZ8A 1TCMA 4H04A 2XTKA 4UFJA 3CGTA 3VDAA 2PWHA 3WEOA 2PWDA 4YN5A 3WIJA 3CUIA 3RJYA 4ML4A 1IT0A 5BRPA 4OBSA 2WVSA 2J47A 5BXPA 4FLQA 1HP4A 3EDDA 2YBUA 4HPHA 5I2UA 1WKYA 2YA1A 1B90A 4PBGA 4UFLA 3UR8A 3VGGA 4E8CA 3N12A 1U33A 1E6NA 3VIHA 3PZTA 1RP8A 3SUVA 1WZMA 1OT2A 2UY5A 3BSGA 4CD5A 5CPSA 1V0NA 1GQLA 1KR0A 2WWCA 1HVQA 4AZGA 1NWUA 4B16A 3GH7A 1C8QA 5HPOA 1SYTA 2DDXA 2BHUA 4W7WA 1K9FA 2XVKA 3FAXA 1WZAA 1R85A 3PZOA 1MFVA 2CERA 3RO8A 3ZM8A 4PTWA 3APGA 2D23A 1M04A 4EKJA 1HP5A 3AHTA 3TTSA 3RM4A 3AMCA 1YQ2A 3U5UA 1XHGA 3BAJA 4LYPA 1UR2A 2DT2A 2CKRA 4PTXA 1SMAA 3KE0A 4Z2LA 1HL8A 2ZOXA 2XFFA 4MNMA 4TXEA 3NSXA 2DH2A 3VD3A 3T08A 4C7GA 4TUFA 1V6UA 1JDDA 5CXPA 2Y24A 1PJ9A 2YL5A 2BVTA 4RE3A 2EEXA 4HTYA 1UD8A 1DP0A 3KL5A 1W9UA 4AXNA 3VX0A 2WW5A 4QDMA 2E9LA 4UTFA 3THDA 1KWKA 3ECQA 4QLLA 4XUYA 3GH4A 4OKDA 1R7OA 4J28A 1EHAA 2J74A 2G41A 1XSKA 1BYBA 3WDHA 1QOXA 1W9BM 2BV9A 1HJUA 4JFUA 5IFTA 3VD5A 3VKKA 4W8AA 3EDFA 1UD2A 3SUSA 5D9NA 4ZE4A 1XYFA 1W32A 3UR7A 2WZIA 1VJSA 1A47A 3AS2A 4QAWA 2WMFA 4HZ7A 5GNXA 3AIQA 2E0PA 3ZSSA 1W9PA 3T0BA 1U30A 2VR5A 3VIOA 4X0NA 5CSUA 2BVDA 3JUGA 5E6YA 1GQKA 1V3JA 3VILA 4V2XA 3RCNA 1LJYA 1EO5A 2XWEA 3UESA 4PMOA 3HN3A 2WWDA 1GJUA 3WBEA 3MUZ1 5FD0A 3VGHA 4M29A 2YLAA 3WF2A 1H2JA 4AZCB 1E15A 2OSXA 4UFKA 3SUUA 3L4UA 1C7TA 4QP0A 1W2PA 1JZ8A 3EMCA 5CPTA 1CXKA 3CZEA 1JGIA 2VX7A 1V3MA 1O6IA 1M03A 1MFUA 1HJQA 1QHOA 1F4AA 1XGZA 4UNIA 3T2QA 3IJ9A 2WBGA 1ZBWA 1V02E 2Y2WA 1XCXA 1QI5A 4UCFA 4P7QA 3J7HA 1ZL1A 2XG9A 4ZFMA 5ABHA 4GINA 2FHBA 2A3BA 1UD4A 1JXKA 1GOQA 1UA7A 2XM1A 1QNPA 3NDYA 2V5CA 1FFRA 2BHYA 3AOFA 4X9YA 4Z2KA 4AYSA 3VIKA 4OJYA 5FL0A 4TVDA 5ABGA 1E6ZA 2Y8KA 4GQQA 2OWCA 1QNQA 1DWJM 2VZOA 2FHFA 1E6PA 4WKHA 1HKMA 3DYOA 1V08A 3W38A 4BQ3A 3ALGA 1JI1A 4WKFA 4ACYA 1J01A 4W5UA 3WNPA 1CENA 2GVYA 4AD1A 1CXEA 3BCDA 5FKYA 1UWRA 3WY1A 1E56A 3PZUA 2F8QA 2VMFA 2BY0A 4PMNA 4EAMA 2XWDA 4P7NA 1NH6A 1KGXA 4J3TA 2NT0A 3RMEA 4UFHA 4ZXOA 5KZ6A 3QOMA 3SCUA 2XPKA 2XVPA 1DWAM 1NQ6A 3ZJ6A 3VDBA 3N1AA 3W37A 5C71A 3A4WA 1UA3A 2OYKA 1JNDA 2OSYA 4H41A 1IZKA 3WEZA 2XM2A 1BLIA 3AICA 5EB8A 3WUBA 4H2CA 1FHLA 5E0CA 4MAVA 1ITCA 1VFUA 3MKKA 1TMQA 2GUYA 3T2OA 1VIWA 3WL1A 3D5HA 2AOSA 2G4FA 1OCQA 1V0KA 3ARVA 1NOFA 1GVYA 1PIGA 1HT6A 2J7DA 1CBGA 2GJXA 2ZUTA 4GPNA 3WFZA 2A3AA 3ZOAA 2V38A 4L4PA 2BS9A 3LPFA 1PX3A 1ISWA 3UERA 4B15A 4U3CA 4TTGA 2YJQA 3LMYA 4CVUA 3PTMA 3OGRA 4UQDA 3VIFA 3ZJKA 1PX4A 3BXWA 1DEDA 2WK2A 2V3DA 1XD0A 3DYMA 1BHGA 3GNPA 1DWGM 1NP0A 3WQWA 3F5LA 5I0DA 2J8GA 1V3IA 2VZSA 3N17A 3T2PA 2CKSA 3CZ8A 4GXPA 4NRRA 2E3ZA 5I78A 4BZYA 2J78A 2DPEA 1F4HA 1QW8A 3OGVA 1W9VA 3PZIA 6A3HA 1M01A 4BCEA 1SR0A 1PPIA 4JFSA 5DFAA 1GPFA 3D3AA 5D4YA 2D1ZA 2WMHA 3WMBA 1B3ZA 2OWXA 4W88A 3WUFA 1QPKA 3RDKA 4W7VA 3PTQA 1DWIM 1ECEA 3GXFA 2WM0A 1JYVA 3ARPA 2EQDA 1J10A 3AYSA 3MSDA 3MUIA 1HKIA 1JG9A 3SCWA 3TOPA 1CGXA 2QMJA 3AXXA 5CSYA 1E5NA 3O9NA 3VDHA 3SCSA 2YL8A 1UUQA 2E9BA 4P8UA 4NI3A 4M81A 2X09A 2OLHA 1HX0A 2X0HA 3VPLA 1MXGA 2YL6A 3MMUA 3VX1A 2DSUA 4DUXA 2DSKA 1H1NA 4NF7A 1E6SM 1J9YA 4AWEA 1JD9A 1JF5A 2WLZA 4FK9A 3WDPP 4DWSC 5I5RA 3A47A 4IISA 4D1IA 2EPLX 2WLYA 1E4NA 1ZJBA 3BAIA 1AQ0A 3BMWA 1EDTA 2Y8VA 3WD0A 4MDOA 4UR9A 3W28A 3HMCA 1D3CA 3VIIA 7A3HA 3CHCA 2WVTA 4DM2A 1TA3B 3GNOA 6CGTA 4MB4A 3S6TA 2G3IA 1E1EA 3KWXA 3N9KA 4J3SA 4W93A 2ESCA 5KEZA 1VJZA 4PSPA 1QI0A 2QF8A 1UKQA 1OWQA 2J79A 1J0YA 5FOOA 3I3BA 4PMYA 5LYRA 2FHCA 4S3JA 1KBKA 1OD8A 2WZHA 4CD7A 3AXIA 3TTOA 5AY7A 3ZJ7A 4W84A 2W92A 4YHEA 4UOQA 2JF6A 1K9EA 5CGMA 4C7FA 2CBUA 3MV01 1E43A 4LQ1A 5BXRA 2C7FA 2GJXB 1WZKA 1CLVA 3AFBA 2Z1SA 4HMEA 4F9DA 1TE1A 5JUVA 1HJSA 1ISVA 4HOXA 5ABEA 4W86A 5CGTA 5BRQA 3AZRA 2E8YA 1FOBA 2ZUVA 3BAKA 2VCBA 1QI2A 5A6JA 3M07A 3N18A 4PMXA 2WMKA 2QLYA 4XZBA 2DT0A 1GOMA 1WPCA 4D6DA 5A6BD 3PBGA 4HMDA 2PWEA 3TP4A 3PZNA 2UY4A 2VZTA 2VZVA 4AEFA 2Z1KA 3IJ7A 3II1A 5DT5A 2VVNA 2E4TA 5D9PA 1W3JA 1UWUA 4KH2A 2W66A 2CBJA 1VFFA 5E70A 3W81A 4FLSA 3M7SA 3MO4A 4PMDA 3N11A 2D20A 2PBGA 1ZBKA 3U5YA 4TTUA 1NOWA 3PZGA 4DUWA 1OINA 1BPLB 3EYPA 1H4PA 4JHOA 1E71M 2CYGA 5DO8A 4BQ4A 3SIMA 3A4XA 2WANA 1NWSA 3SCTA 5JBDA 1CGTA 2XVGA 1J0JA 4D6FA 1C91A 1C92A 1NWTA 2X0YA 2WHJA 2VQUA 3WF0A 3HJEA 5FIPA 1XH1A 1B31A 2MANA 3WQ4A 2BFGA 1IV8A 1RPKA 3T0AA 1NOUA 3WQ5A 2W4XA 5HDRA 5A94A 8CGTA 2VQTA 3WQ8A 1KCKA 2XVNA 3G6LA 2DT3A 1GOIA 5M03A 1CPUA 1K9DA 1CIUA 4FLOA 1H41A 1MQRA 1CGYA 4JFTA 4HPGA 3ZMRA 4P8XA 1XV8A 2EO7A 3VMOA 1V6VA 2ZX6A 4PEEA 4PYSA 3AMGA 3L4ZA 5A2BA 4CN6A 3FY1A 1GORA 1E1FA 4AIUA 5M17A 1UZ4A 4DWSB 2BVYA 3PZ9A 1UYQA 4EANA 1FH9A 3CZKA 1OGBA 4JIEA 3K1DA 1LL6A 4C7DA 2VNCA 3AI0A 1UKPA 4JFVA 5CG0A 1FFQA 2JIEA 4LX4A 1GHSA 1PX8A 3VUPA 3IAPA 2DIEA 2DSVA 3DECA 3AISA 4W5ZA 4MNJA 1UD6A 1H11A 1Q6GA 1LWHA 1XD1A 4V27A 5JBFA 2D0GA 4UQ9A 1UQYA 2W91A 5BROA 1V3HA 3VO0A 4MPKA 4GZJA 1C8XA 1KB3A 2YOCA 3CZLA 1XH0A 4AMCA 1BGAA 5GPRA 4AZHA 3I3DA 4UFIA 3WDRA 4CUCA 2D22A 1JZ4A 5E6ZA 5M3WA 1ESWA 1ISXA 1BQCA 1XRVA 2ZX5A 4GZIA 4EE9A 3U7BA 1CECA 4AD5A 4PCSA 3AYRA 3ARRA 3GXDA 4U5KA 1VFOA 1E55A 1EXPA 3MS8A 4AZ5A 1BSIA 4Y7EA 3CPUA 4NRSA 4DM1A 3SUWA 2D0HA 2WMGA 4RE2A 3OLGA 3CUJA 2FH6A 1J0IA 1MW1A 3WF4A 2ZX9A 4AC1X 5A6MA 3TONA 3IJ8A 4TX6A 2XYLA 3AXHA 4XZWA 1A3HA 3TTQA 1E72M 2OSWA 4MTVA 3MANA 1W91A 5HOSA 1JZ2A 1H5VA 4HOWA 4JFWA 1HJWA 3KZSA 1J0KA 5CZKA 3VM7A 4GI9A 3WDIA 3W29A 5EFFA 5A3HA 2PC8A 4PMRA 5DT7A 4P8VA 3KEHA 1AQMA 1JFXA 3VGBA 1G1YA 5LA2A 3L4VA 3VD4A 1I75A 4HMCA 1E70M 3OA5A 1UD5A 3EDKA 4KGLA 3CMGA 4MB1A 4KWUA 3CTTA 3BCFA 1BFNA 4PTMA 2AAAA 3NSNA 1TFVA 1CWYA 1FP8A 4GO9A 1UWTA 4MAZA 1RH9A 3VGFA 3ZIZA 3DHPA 2ZXAA 2O9OA 1VFMA 1CXLA 3LPOA 1GOOA 4D71A 4CCDA 1NARA 1BVNP 4DUVA 3AIWA 1HNYA 2NT1A 4UQBA 3L2LA 1UKOA 3OLDA 1OIFA 2O9PA 3FNDA 1US2A 4F8XA 4KMQA 4IM4A 1DWHM 4URIA 2CBVA 4LXFA 3W25A 1D2KA 3K4DA 4GIAA 2VR4A 3VM5A 3DYPA 1QBAA 4AZIA 3A3HA 4PCTA 2PBOA 3OG2A 2WNWA 1VBRA 2ZXQA 3AHYA 5A8QA 1BG4A 3FW6A 1W3KA 4YPJA 4BF7A 2ZWZA 3ZO9A 1UR8A 4XB3A 1TVNA 4A4AA 5IHRA 5I24A 4UOZA 4K68A 4CKQA 1BYCA 4WLCA 3N04A 3WNNA 4A3HA 3SURA 2DIJA 2J7GA 4U31A 3SCOA 4JAWA 5JH8A 1W9XA 1TUXA 1H09A 4MJ2A 1TA3A 1G5AA 3VIMA 3CUFA 1HKKA 1Q6FA 4WSJA 3WNMA 3WD3A 3RPMA 1UKTA 5I77A 3EMZA 3WH8A 5A6LA 3W6MA 4U5IA 1GNXA 3WH6A 1X1NA 1R8LA 2VUYA 1FA2A 4P7OA 1ZBVA 1UWIA 3SCVA 3AS0A 1O7AA 4B3KA 1EGZA 5I23A 1Q4NX 2VO5A 4H7VA 3WL0A 1E0XA 4CN1A 3CO4A 3VIGA 2BY1A 3CHEA 1JD7A 1LL7A 4IPLA 2DSWA 2J7CA 2PWGA 1V6YA 2WCAA 4FLRA 3WUEA 5A8OA 1VEOA 1UR9A 1HJXA 1UOKA 3WEMA 5AYBA 5I79A 2WHMA 4PSRA 3AIEA 5EFDA 4TVUA 1I1XA 1LG1A 1HL9A 1V0LA 1EOKA 3CIVA 1JAEA 2GFTA 1UG6A 1JIBA 3K8MA 5A1AA 1EA9C 2DGAA 2IUZA 4HU8A 3ZT6A 2A3CA 3W27A 1WO2A 3AMLA 4PMZA 3IANA 2VRQA 5D9OA 1QI4A 4M8UA 7CGTA 2D2OA 1Z32X 4WK9A 2JE8A 5I6SA 3WD1A 3NUKA 1NM9A 3LPPA 1ODZA 3WH9A 3K4AA 4CD8A 1EH9A 4UQCA 3L4XA 4RL3A 4B9ZA 1JYNA 3QHNA 1VBUA 1C8YA 3VMPA 1WE5A 3MUAA 1L0PA 4YHGA 5DF0A 2PWFA 3WBAA 2CITA 4OOZA 4WIWA 3O2LA 4PUDA 3ZT5A 1BAGA 1V3LA 1JL8A 4OIFA 1E6XM 3HU7A 4FF5A 4IUGA 3UG4A 2X2YA 1M53A 2J7BA 1LL4A 3ARSA 3AHZA 1E4LA 1PBGA 4CU8A 2GJPA 1MW2A 1V02A 4U2ZA 1E0VA 4TX8A 1HKJA 2Y4SA 3K46A 4LYQA 4ACZB 2DEPA 1GQJA 1MWOA 1PZ2A 1JAKA 2CEQA 2FGLA 1OIMA 3W6LA 4P8WA 4Z2IA 1UR4A 3WN6A 1OM0A 2ZWYA 4UFMA 2WVVB 1OD0A 2XUCA 9CGTA 2HISA 4CD4A 3CHFA 1K9TA 3UETA 3ALFA 4JKLA 1E9LA 4MDPA 4F79A 3W0KA 1PIFA 4DWSA 5AC5A 1GQIA 4B3LA 2VL4A 3ARXA 3E1F1 4WF7A 1EIBA 3QR3A 2XHYA 3PZVA 1MXDA 3A4AA 1WP6A 3OLIA 2V3EA 4D1JA 2WXDM 3FXYA 3UG3A 1C3FA 3W82A 2XIIA 3POCA 2C8NA 4D6CA 1EHNA 2RGMA 2WZEA 1RP9A 1AMYA 1HIZA 3S2CA 2X05A 1GOWA 2WSPA 4QCEA 2ZUUA 4J3VA 5BXSA 1LF1A 4U3AA 1S46A 2C0HA 2DH3A 5A6BA 2W5FA 3OLEA 4H8HA 4W89A 4PUEA 3CZJA 3CUHA 4WJXA 2GK1B 4DWSD 4MNKA 1SMDA 4JHZA 2VVSA 3K8KA 2UY3A 1JNEA 1FHDA 2YDRA 4E4PA 2D24A 4LYRA 5D9MA 1KR1A 1HN1A 3ARZA 3NDZA 2VZUA 2WYSA 1BGGA 4J7RA 4CU7A 1CXHA 3WNLA 3F4VA 3QOKA 1L8NA 2EBNA 1VEPA 2W67A 4UQEA 2ZICA 1ZB5A 3GDBA 1X6LA 1JZ3A 5A2AA 3AMKA 2GJRA 3T0DA 5BXTA 4ZXLA 5IHSA 1MQQA 2XSBA 2X1IA 1DHKA 1OGGA 3ZR6A 3OBAA 4LGXA 1OSEA 1E40A 3W24A 2VJXA 2CESA 2J62A 4CCCA 3BC9A 3GBDA 1QW9A 3DHUA 4U2YA 1LG2A 1QHZA 2EXOA 1BYAA 1XSJA 2BY3A 3WELA 4ATWA 5FL1A 5IXEA 3W4RA 1MYRA 1BF2A 1JYWA 5CLTA 2B31A 2F2HA 4CVWA 3W53A 2OYLA 2XFRA 3VOCA 1V6WA 4H8VA 5I3DA 3B9AA 1KQZA 1OT1A 2PB1A 4JCLA 3WDJA 2IXUA 2YIHA 4JL2A 5E9AA 4H8UA 1WZLA 1CGUA 3F5JA 3BLKA 4TVCA 2CPUA 2WSKA 4AY1A 3AMDA 4U33A 4BQ2A 1EQCA 3B9EA 4J3UA 3ZQ9A 1B3WA 3T09A 5A6KA 3MMDA 3WH5A 3GBEA 3VINA 1KBBA 2BXZA 3EMQA 3WSUA 2YBTA 5CQ1A 2V3GA 2CXGA 4M82A 3BLPX 3BAWA 3EBVA 4CCEA 1LWJA 2J8FA 3NCOA 4JZ5A 4PTVA 1WNOA 2CIPA 1H0GA 1DWFM 4AW7A 4A3YA 1Q6CA 3ARUA 4WKAA 1VAHA 5A6SA 3AIBA 1E3ZA 1EO7A 4J3XA 5LA1A 4NSBA 2UWFA 1UR1A 1BG9A 1WAWA 3AIVA 2J7EA 1MW0A 1GZJA 2J77A 2VRKA 1B2YA 1FH8A 2VCCA 1VENA 4ZEPA 1V03A 3F5KA 3CH9A 4CU6A 3RILA 3VTRA 2CHNA 1BYDA 4NZCA 1XH2A 1PEZA 1UZ1A 1UHVA 2WMIB 2QPUA 3MMWA 3VD9A 4AD3A 2FGZA 2HVMA 4JCMA 3FN9A 1JZ7A 4OOUA 1V6XA 3AIRA 3AHVA 1UD3A 5F7UA 4OUEA 1HJVA 4PN2A 4AZ7A 5EMYA 3CBWA 4HA3A 2WKGA 2BNJA 3WMSA 2QHAA 3VU2A 4R27A 3W26A 1JF6A 3L4YA 1AVAA 3CLWA 2J75A 3NJ3A 4X0VA 2YKKA 2ZUSA 4S3KA 4AIOA 3RJXA 4JKMA 3SCRA 3VD7A 5JIPA 1R87A 4KRTA 1HXJA 1P6WA 4UZSA 5AYIA 4GI6A 3PTKA 4QCFA 4MB5A 1MQPA 3AJ7A 2VX6A 1US3A 3RM9A 1EQPA 4PMUA 5A69A 5ECUA 4M56A 1LLOA 3ZT7A 3N13A 1ODUA 1EDQA 3BAYA 1QNOA 3CZGA 3ZSTA 4AISA 3FHAA 2VT0A 4KGJA 2CETA 4P7RA 2ZXDA 3GXMA 1GCYA 2BXYA 6TAAA 5A6AA 3WD2A 1GOKA 2OYMA 2O92A 1WCGA 2V3FA 2VI0A 3NYDA 4KRUA 4F66A 2ZX8A 1TG7A 1UQZA 2YDQA 4QLKA 1MVYA 4AD2A 5ABFB 2RGLA 2VCAA 4QLJA 1TZ7A 2E8ZA 4CN4A 1D7FA 1W1PA 5CPQA 2G3NA 3UEQA 5HBFA 1FH7A 1W9DM 1SFSA 4W87A 1X6NA 3KL0A 3M6DA 4OBRA 3SEPA 4B9YA 3PN8A 2W63A 3A6OA 5E09A 5A8PA 3MUY1 4GQRA 3BH4A 3PHAA 5A2CA 5E0FA 4PMVA 3AQUA 4W85A 3VNYA 3WFLA 2VX5A 4ATLA 2EPMX 4D6EA 1QNSA 1LQ0A 4GZEA 1MW3A 3WUGA 2F61A 4HP5A 1K6AA 1QBBA 2DQXA 2WPGA 3SCQA 1W3HA 4W8BA 5GNZA 4ACZA 2VURA 4JL1A 1JZ5A 2Y5EA 3G6MA 1H3GA 2JEQA 2XFYA 4P7LA 1WB0A 5D8WA 1J0HA 1KQYA 2AMGA 5HPCA 3EDJA 2WVVA 1CGVA 5A8MA 1ZU8A 1B0IA 1W1YA 1CZ1A 3WD4A 3MSGA 1UR0A 4MADA 4EK7A 1E5JA 3WH7A 2O9TA 3GNRA 4M1RA 1GONA 4QFUA 5JBEA 4HOZA 3RM8A 1TVPA 3CMJA 4Q7NA 1ITXA 2UY2A 4Z2GA 1G9HA 1E4IA 3KL3A 4ATDA 2QMKA 4MJ4A 1C7SA 4UOJA 2YLLA 3CHDA 4Z2JA 3ARTA 2J7FA 1W2VA 2WKLA 5BCAA 4CD6A 2IXVA 1WDPA 1KXQA 1Q6DA 1KGWA 1XC6A 3SCPA 1HF6A 1ISYA 3DC0A 2WC7A 1NWRA 3O6AA 3WQ6A 1WDRA 2W61A 3NIYA 2WAGA 3VMNA 1FP9A 2CHOA 2XSAA 3OZPA 4RE4A 2CBIA 1JZ6A 8A3HA 4CGTA 4MNLA 1B9ZA 2GK1A 5EBAA 1R7AA 1CLXA 1W3LA 4AEEA 2JEPA 2ZUMA 3RIKA 2XJ7A 2ZX7A 3WENA 4GO8A 1PAMA 2G3JA 5TD4A 3OZOA 5IFPA 2JFEX 2VC9A 4M80A 2YA0A 2DSZA 2O9RA 2QV4A 5DMYA 4AD4A 1BVZA 2TAAA 2YL9A 3VIJA 1OGSA 3L2MA 3LPGA 2GDVA 1J0ZA 4PMQA 2FH8A 3MU7A 4M24A 1G01A 2WHLA 3WNOA 4R5EA 5JIWA 1G94A 3OIHA 2XGBA 1UWSA 5BWFA 1VRXA 1GW1A 1E6RA 3FHQA 4XV0A 5LA0A 4N42A 4GI8A 2D0FA 1UH2A 2JIWA 2WCGA 4D6GA 1CDGA 2FDMA 1JFHA 2YA2A 4ZENA 5M5DA 3WF3A 4BS0A 2XVLA 1UH4A 2WC3A 4FMVA 3CUGA 3BMVA 1OBAA 2X8RA 1I1WA 1KGUA 4JKKA 1UKSA 1EDGA 1QI3A 3K8LA 1ZJAA 3IAQA 4D6JA 3WKZA 2XIBA 2BHZA 1J12A 1ISZA 3L4TA 1PZ3A 1U2YA 1H0IA 5A8NA 2EPOA 1QVBA 2G8ZA 1KXVA 1WDQA 4HA4A 3FAWA 2J25A 1JXJA 3U57A 5DEZA 2E40A 3ZJ8A 1J11A 1JI2A 3QHMA 3U7VA 1ZBCA 3SCNA 2BY2A 5CLWA 1XYZA 3WQVA 1YHTA 3GH5A 3AIUA 1VF8A 2D3NA 1Y7VA 5A95A 5HNNA 1KWGA 2ZE0A 2A3EA 3WDQA 4E8DA 3AS3A
chains in the Genus database with same CATH superfamily
3GIYA 3UZXA 3FJ6A 2R82A 4H7ZA 2R1PA 1E4MM 2JF7A 1WQ5A 4ZQCA 1XUUA 2DT1A 1CEOA 1B1YA 1OFRA 2HTMA 2Q8XA 5K9XA 4YTRA 1XISA 4JQ3A 3ERPA 3DESA 3AALA 3GFYA 2GGEA 3HGOA 1VEMA 2GDUA 3GM8A 1R0MA 2CHRA 2ALDA 1KCLA 1UP2A 3NGFA 4WSKA 2A3HA 2CFFA 2F9RA 1TPVA 4AX7A 1KXHA 4IICA 3WF1A 1B3VA 2HV5A 1BKFA 2QJIA 1C9DA 1E6QM 3NL2A 1JYXA 4M6VA 3QYSA 3TR2A 3RYSA 3ITTA 1A5LC 3GZAA 4MB3A 4QAIA 3M43A 4W8LA 5CJ5A 4AZBA 2NV2A 4Y8FA 3AROA 2ZVIA 1JDAA 4TIMA 4I90A 5CJMA 3LRKA 5FCZA 4IX2A 2KFWA 1OB0A 4YJ5A 1R3SA 1TPUA 3AUOA 2J7HA 5IDIA 2I5QA 4LCQA 1H7RA 2G3MA 3AZTA 1CTNA 1F40A 1UJPA 2VEGA 3EY6A 3N15A 3GXIA 4JDBA 1E0WA 1J2WA 2FAPA 1V5XA 3QH2A 4EPKA 4D6HA 4Z1BA 4GBUA 5H1WA 1TTPA 3VYLA 1B54A 1UIOA 2P3ZA 3CB8A 1G0CA 5FACA 4GK8A 2EPKX 1XYMA 4HU4A 1CNVA 2POTA 1Z42A 1F5ZA 2G96A 3WQFA 2GSJA 3SM0A 1AQHA 1GVIA 3B9DA 3PJWA 4B4HA 3GXPA 4MY8A 1XIEA 3RFWA 3RU8X 2OZ3A 4NNCA 1P0KA 1BD0A 2WVUA 3IPWA 1QAPA 5AC4A 1E73M 3GWQA 3KTCA 3ITYA 4A21A 4GGQA 4EXAA 3ZVHA 1QNRA 2VTFA 2QPSA 1XSIA 1B5TA 3AHXA 3GTNA 3R43A 3EXSA 5JMUA 3HIJA 1FKKA 3QGKC 1N82A 2OO0A 2WC4A 3NXFA 3IKGA 4U10A 5EMMA 1KXTA 3V5CA 2WCSA 1RR2A 2M2AA 3QMSA 4OU1A 5D8ZA 4HZ8A 1SM9A 1TCMA 2Y5JA 5AB3A 2HBXA 2Q5AA 2XTKA 3H2OA 3CQHA 3SGGA 5HNRA 3CMFA 3WEOA 1RQBA 4YN5A 3CYVA 3MUCA 1GVQA 4Y9PA 5BRPA 1HUVA 2J47A 5CC6A 1QZ2A 3EDDA 1FWNA 3MWCA 4N4QA 3UNDA 5F4WA 2POZA 3VGGA 5LXXA 1HO1A 4UFLA 2UZ9A 2IPJA 2VFDA 1D7JA 4DIPA 4QM1A 1I0DA 1WZMA 3M4HA 4CD5A 4RDWA 5CPSA 4E0CA 3ISIX 4AZGA 2BSLA 3DIPA 1UR3M 4IQ2A 2DDXA 2BHUA 3W72A 2HSAA 5GVJA 2Z7GA 1TJ1A 1M04A 5GPGA 3AHTA 3TTSA 1AL8A 1PBKA 1XHGA 3BAJA 3IUIA 4LAKA 3KBSA 3R12A 1J8VA 2DVUA 4PTXA 4R0XA 2PZ0A 3KE0A 4Z2LA 1XLGA 2ZOXA 1QDSA 3I65A 2XFFA 4TXEA 1EJVC 3W1RA 4AWTA 5CXPA 2Y24A 1PJ9A 4IL2A 1EYWA 4JYEA 4K1WA 5MKGA 3LTYA 2Y62A 3SGUA 4ICCX 1DP0A 1W9UA 4S1FA 4AXNA 2FPVA 4IMCA 4B5TA 3D46A 2E9LA 4XUYA 1ONEA 4OKDA 1F61A 2PDIA 5HNTA 2B7QA 2G41A 1KFBA 3NPXA 1DJNA 2BV9A 1YIXA 2BASA 4FALA 2NLYA 1BWKA 3HG5A 5IFTA 3VD5A 3IACA 1S2UA 4L9YA 5D9NA 4B2DA 3UR7A 3DN5A 3KOWA 1W5PA 4LWWA 4WOZA 3I4EA 1A47A 4QAWA 2J13A 4HZ7A 3ZSSA 4G1NA 3W7IA 3F2DA 1W8GA 4FAPA 4O8RA 1DE5A 3H26A 3KM8A 5TBOA 1EP3A 3JUGA 1EP2A 3WLQA 2PPGA 3OW1A 3VILA 4V2XA 4GY1A 2BX7A 3T40A 3C61A 4AYGA 3C8NA 3UESA 1MEWA 4JY9A 4PMOA 2V8ZA 3OPSA 3BCJA 3HN3A 3L66A 3GB6A 3WQDA 1NY1A 3F4WA 4GLEA 1LDCA 3L4UA 4Y9AA 4A22A 4QP0A 3SN4A 4AY8A 3RGTA 3I10A 2KX9A 3QZEA 3H23A 1L8PA 5AHLA 1O6IA 2DUXA 1JPDX 1UC4A 3T2QA 3R25A 2WBGA 1ZBWA 2Y2WA 3J7HA 4DZ3A 3IGXA 3I6CA 3W7GA 1A4MA 3S5ZA 3MHUA 3ZLFA 1K7FA 2ZRYA 3TDFA 4ZFMA 4H19A 3N25A 3N2CA 4UNLA 3QTGA 3NDYA 2BHYA 4ZS6A 4WRHA 4AYSA 5DN1A 3QMRA 4IPPA 4OJYA 3H6OA 4G50A 4AEOA 4ZA0A 4WKHA 3GUGA 3B8IA 4C5ZA 4XKYA 1JI1A 3LRLA 3GIPA 3WNPA 4HCHA 4AD1A 3TYUA 4RLIA 1JCXA 4EVZA 6XIMA 4WD0A 1UWRA 3TAOA 3WY1A 2F8QA 2GVGA 2PGEA 2Q3RA 1PINA 2VMFA 4KPLA 1RBLA 3S2NA 4AG0A 1YDYA 1KGXA 3BG5A 3BLEA 4Y9OA 4ZXOA 4AH7A 4PUUA 1UOZA 2F2KA 2J24A 3VDBA 3N1AA 5E5CA 5C71A 3W37A 3E74A 1UA3A 4BEQA 2OSYA 2HXTA 5D2WA 1BLIA 2PDHA 5EB8A 4HGXA 4H2CA 3HV9A 2H3DA 3TA6A 1DQWA 1VFUA 2HPMA 3I68A 1VIWA 4LNCA 5ECVA 2AOSA 4S2BA 1OCQA 4HT3A 3VFLA 4M7TA 4XBJA 5CZJA 2P5NA 3E0VA 4LAYA 4S3AA 1K8YA 1ISWA 3CV6A 4O12A 4B15A 3K5XA 1KT0A 3BV4A 4B92A 3OGRA 4MYAA 3MHFA 3LERA 1R38A 3SJNA 1Q8AA 2PP1A 4EIVA 1PX4A 3BOLA 3H4GA 1RSCA 2VD8A 1DEDA 4R7WA 4H6QA 3NM3A 3DFNA 4LAZA 1L6WA 3M0XA 1NP0A 1LOQA 5TQLA 3QQ1A 3PBUA 2W9MA 2VZSA 3CZ8A 4NRRA 5I78A 3T8LA 4E4UA 2DPEA 5CH9A 4GIRA 2DUAA 1EC9A 1QW8A 4X3ZA 1W9VA 3PZIA 3EXTA 1GKQA 4XBKA 5I00A 1W3NA 4JFSA 1ECQA 1QOQA 1OHLA 2INFA 2WMHA 5AYZA 3WMBA 1F6KA 2OWXA 4G8TA 4XZ9A 1ZFJA 4W7VA 3PTQA 1TYGA 4QIBA 1XLFA 1I2OA 3ARPA 2OQYA 3KOFA 4JNMA 4YL2A 3TWBA 1PO9A 3AYSA 2CLLA 3MSDA 4MZ8A 3TOPA 3AXXA 1E5NA 4NJIA 4Q8OA 3O8AA 4WSHA 4Q6XA 4GD0A 1ITUA 5FESA 4JTKA 4M81A 4LV9A 3N4FA 2X09A 1HX0A 2AL2B 2R1NA 4YTQA 4ZSTA 3UJFA 1MXGA 1W1B1 4OBTA 3CQ0A 4L1XA 3D3FA 3KWSA 3VX1A 3LRMA 2DSUA 3PK7A 4H1ZA 1XQLA 2HNEA 4NF7A 1E6SM 3UY7A 3CC1A 3N19B 1IIGA 4M6UA 4LAUA 1E0UA 1VGAA 3E2RA 4I6VA 3LXAA 2NSOA 5TAOA 4N9BA 3NWRA 2WLYA 4C1NB 3H7RA 1TR9A 1E4NA 3W07A 1NFBA 4Q4PA 5AVHA 1KFJA 3WD0A 3GHRA 4TW8A 3GTFA 3HMCA 1CCWB 3S6TA 3HFTA 1E1EA 3BJTA 4W93A 2CU0A 1VJZA 4QJ1A 2OOFA 1TE6A 2E68A 2VKZG 3W7MA 5FOOA 3I3BA 3V16A 4KERA 2E6AA 2VC7A 5AY7A 4IT4A 3W7LA 4JIRA 2C7FA 1WZKA 3QPZA 1CLVA 2Z1SA 4P61A 4F9DA 1TE1A 4LVGA 1RVKA 2RUSA 3WBXA 5JUVA 5ABEA 3GW0A 1NSGA 5BRQA 2QGYA 1WXZA 1IGSA 1S2AA 3BAKA 1QI2A 4XK2A 3GTXA 2Z7KA 4XZBA 4CQ8A 1EBGA 1GOMA 4DI9A 3PBGA 5G2WA 2PWEA 1RQHA 3B8VA 2UY4A 2HQAA 4I9JA 1TPFA 2VZTA 4NJJA 3VNJA 1KO0A 3II1A 5DT5A 2F21A 3V5FA 4KBXA 3MO4A 4RDVA 2D20A 1X7FA 5AZ0A 5F1VA 2PBGA 3U5YA 5T91A 5L9FA 4LUYA 1BPLB 1F6PA 3EYPA 2ISWA 5EMUA 2Q8ZA 3T0TA 4BQ4A 3N2OA 4GZ7A 1NWSA 4LCSA 3H7UA 2ZTJA 5K2ZA 1A5NC 2XVGA 3B0UX 2ACRA 1XKYA 3VNKA 2X0YA 2WHJA 4JEQA 4M0XA 1DXFA 3OTRA 1FKXA 1IZCA 5BZAA 2PTYA 3RX2A 2L5HA 1F3TA 1B31A 4JEJA 2MANA 4X9SA 3FYYA 4L3NA 1XGDA 3T0AA 2AQOA 2UV8G 2W4XA 2QJMA 3W7HA 5CC7A 4KEZA 2Q71A 1KCKA 1O5KA 4G56A 1L1PA 1AJ2A 3WMLA 9RUBA 2XIQA 4GIVA 1CIUA 1H41A 3FSUA 4GRSA 1UBSA 3THAA 4LEQA 2PMQA 5FJPA 1TCOC 3W7DA 3PANA 4OECA 4P8XA 3ABSA 3W1UA 4LUJA 1XV8A 3R11A 4NZJA 2ZX6A 1ZCNA 1S3HA 3EKLA 1KM3A 3AMGA 5A2BA 2I5GA 1XIDA 3BG9A 4AIUA 4ZQOA 1W56A 3P0WA 4DWSB 4TW6A 1LZOA 2WJEA 3LOTA 1OGBA 3E9AA 4GXMA 3K1DA 3PPFA 2VNCA 4DZHA 3AI0A 1UKPA 4JFVA 2C13A 5CG0A 4OHQA 2GOUA 1GHSA 2DSVA 1RJPA 2BGNE 3TFCA 3AISA 4QJ4B 1WBJA 1H11A 1Q6GA 1LWHA 4DHGA 1UQYA 3DBPA 5BROA 4A8IA 1VH7A 4MPKA 4GZJA 1XLHA 1C8XA 1KB3A 3K1GA 4GCXA 4NZ5A 2YR1A 4PRRA 4AMCA 4LOCA 1Y0OA 4B3ZA 2Z25A 3P7YA 4CUCA 5M3WA 1ESWA 1ISXA 2Z1BA 1XRVA 3UQAA 1SFLA 4KR0B 3U7BA 1CECA 1A5SA 4YLWA 4DRJA 4KCTA 3RX4A 1QPQA 2OKOA 3RMJA 4GBDA 1XRSA 3MS8A 1P4CA 4Y7EA 1LQAA 2QV5A 4N6EA 3B0VC 3BANA 3W00A 1TQJA 4DM1A 1Q7MA 2V67A 3OLGA 1I0BA 3CH0A 5BRBA 4LTSA 3PJUA 2REQB 1TKKA 1MW1A 3QFEA 1LOSA 3PUDA 4K3ZA 3W84A 3WJZA 3C2VA 3T9PA 3IIPA 2XYLA 3QVQA 3QR1A 3AXHA 3TTQA 1E72M 2OSWA 1VYSX 4MTVA 2EGZA 4BFAA 1AJZA 5AN7A 1B9BA 1UZDA 4AFYA 1HJWA 2JQXA 1A7XA 3BTNA 3E0LA 2ZRUA 4E8GA 1VYRA 5D09A 3U2ZA 3O1NA 3TE9A 2PTDA 3UXAA 5DT7A 4AHPA 5CKSA 1D3HA 1PHQA 4UTJA 3SQMA 1G1YA 5LA2A 3L4VA 1DJIA 3K13A 4HMCA 4ML9A 2I14A 3LI0A 4MZ1A 4H9VA 3S1GA 2GPTA 3CTTA 3S9YA 2PV2A 2V81A 3VC5A 2O4QA 3NSNA 4CNNA 1S2WA 4GY0A 4QITA 1VFMA 1SZNA 2YCJA 2YYUA 1NARA 4GUFA 4A8LA 3LXCA 1EJUC 3MSYA 3L2LA 4C6CA 2Z4GA 1OIFA 4MOZA 3FNDA 1US2A 4F8XA 4O18A 1ELSA 4URIA 2DW6A 3W25A 3DFSA 3RUBL 1GVFA 2V0TA 4PCTA 4ROQA 1DPMA 3SECA 5A8QA 1SJAA 4XO7A 3FW6A 1OFEA 1UR8A 4XB3A 1TVNA 4ZPTR 3LHTA 2V6AA 3LMZA 3QV7A 2BLEA 4PTDA 1BSLA 3P8IA 4Q8UA 4A3HA 4WGXA 1SJDA 1X8CA 3V4BA 2J7GA 3SCOA 5JU6A 3DOPA 3PAJA 1S2CA 1QPRA 2TYSA 3A64A 2E5CA 1TA3A 4FOKA 1G5AA 3P5YA 4WSJA 5LXEA 3RPMA 1UKTA 2ZA3A 5AYYA 3SI9A 2Q01A 4U5IA 2OEJA 4PE8A 1GNXA 3PRBA 1QNVA 3WH6A 3OZMA 2VUYA 4JYDA 3M0IA 5CAHA 2VO5A 2HPIA 5CZTA 1E0XA 1RY0A 3HFYA 1F76A 3O15A 4HPJA 2PWGA 5G2IA 1U5VA 1M41A 5A8OA 3G22A 4HJWA 3E12A 2Y8UA 3GG0A 3LGEA 2WHMA 3O5DA 2RSEA 3FYPA 5EFDA 4TVUA 1A3XA 5KETA 3CB3A 1LG1A 3CIVA 1Z9AA 2KE0A 3BQ5A 3KFTA 1P0DA 4PMZA 2GQAA 1UPMB 4MJMA 2DG3A 5D9OA 3WJYA 3QBUA 3UGVA 1Z32X 4S3CA 2JE8A 1KM1A 1QR7A 1D7HA 3AUJA 3BL3A 3O5MA 3IS4A 1NM9A 5KZMA 3N2MA 3V75A 3LPPA 4I3GA 3JR2A 1R5YA 1ODZA 4CD8A 1DORA 3ZZ1A 3MBFA 1C8YA 2QR6A 3BW2A 3ES7A 2V30A 4HNVA 4IXXA 2PWFA 2R6OA 4IWWA 2CITA 4OOZA 4K38A 1V3LA 4V1XA 1YPIA 2ITKA 3HU7A 4IUGA 1R2RA 3UWUA 3UG4A 2J7BA 2WNQA 3ARSA 4OFCA 2OEKA 1I2PA 1E0VA 1FD9A 3CGNA 1HKJA 3K46A 3ZLHA 1IXQA 1XLJA 4ACZB 2VHLA 2FGLA 1R3TA 3EEZA 1OIMA 1L6GA 1OM0A 4H6EA 2WVVB 2XUCA 2B5UB 4LAVA 9CGTA 2HISA 2FTWA 3V1HA 2QT3A 3UETA 1PIFA 3BJSA 4FX7A 4K2SA 2QCEA 2XN0A 5AC5A 1GT8A 1B4EA 2GQ9A 4LBUA 4DLFA 1RD5A 3FA3A 4RXGA 3WO8A 8XIMA 1QO5A 3QR3A 2P0OA 2E6DA 3W74A 2HE8A 2V3EA 2WZMA 4HU3A 3FXYA 3MCMA 4IPXA 1C3FA 2XIIA 2C8NA 1EWEA 3KDOA 3KBVA 1RP9A 2QAPA 1AMYA 1XDMA 3BLOA 2KO7A 4ICNA 2C1GA 1NFGA 2ZUUA 3DI0A 4J3VA 2VGIA 2E7FA 5BXSA 1Q85A 4NG3A 2MLZA 2DH3A 5A6BA 3G1XA 2Z00A 2G5WA 1R9HA 1DJYA 2MLXA 4US6A 1KKRA 4E2DA 4E38A 2GK1B 3YPIA 4DWSD 4GIEA 1BQGA 2B7PA 1Q65A 5D9MA 1IEXA 3B05A 4LVFA 1XL9A 3NO5A 5KMYA 4RV3A 2R1LA 1W5MA 2P3EA 4C90A 4J7RA 1S2TA 1TV4A 2NX1A 1YW1A 4DBSA 1L8NA 6XIAA 2W67A 2ZICA 4B91A 1ZB5A 3PBMA 3E0WA 5A2AA 3AMKA 4O17A 5LNUA 2PLJA 2X1IA 5HJYA 1Q63A 5D32A 2AL1A 1OSEA 2FMOA 3KS6A 3W24A 3B0XA 1FTXA 2CESA 4I5RA 3GBDA 4DRQA 2FPYA 3OQEA 1QHZA 1XSJA 3QW4B 3GXTA 4REQA 1W5NA 4X63A 3BOFA 3WELA 5IXEA 2F6UA 1MYRA 4JNZA 1J5SA 3QC0A 1DV7A 1RA5A 3IIXA 4Q32A 2OYLA 2XFRA 1V6WA 4QT2A 5I3DA 1RLCL 1UCWA 7TIMA 1KQZA 1OT1A 3ZFHA 3IARA 1O4UA 4QSHA 7XIMA 2OCZA 3SQSA 1MZRA 4H8UA 2PBCA 3LBMA 4UTWC 3R2GA 3C0LA 2CPUA 2IF4A 4ZB5A 3FS2A 3B9EA 3EWXA 3CQIA 3LHYA 5HW6A 4GNVA 3WH5A 3VINA 1KBBA 3EMQA 3WSUA 3NAVA 5HTGA 1UC5A 4M82A 3BGGA 1SW3A 4CCEA 1EB3A 3BURA 3NNTA 2J8FA 4JZ5A 3WH0A 1X1ZA 3SQLA 4J4OA 2CIPA 4S3BA 3DHDA 1MO0A 4AAJA 1Q6CA 3ARUA 2GQ8A 5A6SA 3VOIA 3UG8A 3USZA 4GKTA 4R33A 3UXDA 1X96A 1AH0A 1BG9A 1WAWA 2A21A 1R9YA 1OZQA 1ZENA 1L6SA 2VCCA 1VENA 4C6BA 4ODRA 4ZPWR 4HNNA 2H9AA 3GNDA 3CH9A 4CU6A 1DKWA 3RG6A 5BWAA 2MLYA 1XH2A 2BBFA 3VD9A 3VNIA 4Q4SA 2HVMA 3CXOA 2RQSA 3AIRA 2AMXA 4O52A 4XTIA 4OUEA 1HJVA 4PN2A 4CEXC 3E2VA 4GUGA 3GU9A 1Z7AA 3O3RA 4A8RA 4FR6A 2QHAA 1GJPA 3WLIA 3UA3A 3LLFA 3G1SA 3R8GA 2F38A 3R58A 4LBSA 1UBPC 1GOXA 3COTA 3IV3A 1PKYA 2YKKA 3TYAA 1JCLA 3RJXA 5JIPA 4W9TA 2DFAA 1NMWA 4DJDA 1HXJA 1P6WA 1MQPA 3AJ7A 4JTFA 2QCLA 3RM9A 1JEZA 4PULA 1XYBA 2PDWA 3ZT7A 4DRIA 5CBBA 1EDQA 5H6HA 3WFAA 4OV4A 5FJOA 4KEUA 3CAWA 2FYMA 2Y5SA 1VPQA 4AISA 2GZXA 1HKWA 3NZRA 2VT0A 3BV7A 2VEKA 3KBWA 3QEZA 2ZA1A 3GVRA 5C9ZA 4J40A 1MDRA 2PC4A 1GOKA 1DHPA 2OTDA 1WCGA 1P48A 3KBJA 4KRUA 1TG7A 3ZVHB 5FA5A 4O8AA 3V0UA 4AD2A 3I7RA 2VCAA 3KZPA 4QLJA 2E8ZA 1H50A 1ICSA 5HAOA 5AZ1A 2E67A 3WJXA 1D7FA 2NX3A 3U9IA 4L56A 1W9DM 1SFSA 1X6NA 3SEPA 3M6DA 4OBRA 3PN8A 2W63A 5C9UA 1WYIA 3QJAA 1LBFA 2FLIA 5A2CA 3PHAA 1P5QA 3AQUA 1WBHA 1RK6A 5T9BG 2YZRA 4GX9A 2ON3A 2VEMA 4WGHA 5SWUA 5LHFA 4D6EA 2GGHA 1KCXA 1MW3A 5DCDA 1QBBA 3BMXA 3TZNA 3SCQA 3TYBA 5GNZA 4W8BA 3WZ0E 2JEQA 2XFYA 2GWGA 3LSBA 3IVUA 1X6UA 4RXFA 5GJMA 3FGCA 2YZ5A 2GYIA 1LROA 1KQYA 2AMGA 2BG5A 5A8MA 5I3GA 1W1YA 3WD4A 2YW4A 3MSGA 4MADA 1E5JA 3O5OA 3WH7A 2O9TA 4Q33A 4DZIA 1I2NA 3MW7A 3KRZA 4DROA 3NQ6A 2DJXA 1GONA 4KESA 1H7WA 3F1QA 1TVPA 1ITXA 3W22A 4Z2GA 1G9HA 4CQCA 4MJ4A 4UOJA 5G4WA 5LGZA 2QQ6A 2J7FA 1W2VA 1WDPA 3INPA 1R9ZA 5DMLA 3KS5A 2DJLA 3KLKA 4I9MA 1SO3A 3SCPA 3DC0A 3NTPA 3O6AA 2WPBA 3Q58A 4FPSA 3GHTA 3D6NA 3NIYA 3GR8A 5DCBA 1XIIA 3RU6A 3ZXWA 4AC7C 2YXXA 5GJPA 4RE4A 4NASA 2HJPA 2ZZ7A 1L2QA 3EGJA 3PWGA 4AEEA 3WENA 1AL7A 2XJ7A 3EWZA 3LN3A 2G3JA 3FA4A 3KCJA 5IFPA 3KW3A 1G4EA 2A6LA 3V36A 2YA0A 5MKGB 1J2BA 4N19A 4EF9A 4ERGA 2V2CA 3L2MA 3LPGA 4PMQA 4S2CA 4XD3A 5DX7A 1FAPA 3FEMA 1ZP3A 2OX1A 5JIWA 3NM1A 3UPMA 5G4HC 1RAKA 1U22A 1VRXA 4E3VA 3R8HA 3FHQA 2ZC8A 1AW1A 4GQBA 4N42A 4KQNA 4GI8A 2C15A 4Y96A 5LIUX 1GYNA 3UXLA 1CDGA 4KEVA 4HCDA 2YA2A 4DBEA 5M5DA 2XVLA 1UH4A 1RJRA 1Q2SA 1FWTA 2E77A 4ODKA 1OBAA 4JTSA 4DO4A 2C3ZA 1VIZA 1UROA 1ZJAA 1OF6A 3WKZA 1FKTA 4IIDA 2BHZA 1XRFA 3L4TA 1ZK6A 2VEIA 3PBYA 2RH9A 4ORIA 5A8NA 2FB2A 3K4WA 2G8ZA 4U4MA 1WDQA 4MJZA 3OVPA 2J25A 1JXJA 2VCDA 4DT4A 1UPPA 4O16A 1QOPA 1K4HA 2PD9A 4IJRA 2O7SA 2I9EA 1BF6A 2P8CA 1U1JA 3NEVA 1LLWA 1FX6A 2D69A 5BXJA 1DE6A 2FJUB 3AS3A 3LD5A 5AHFA 3TNOA 3BGAA 3IRSA 1J6OA 2Q3OA 4A6GA 1DL3A 1VFTA 3O5IA 3KOYA 1JDCA 1TWSA 2OT0A 4WHBA 4X22A 3GKAA 1TJ2A 4I9AA 4DXKA 4IGNA 3POHA 3H54A 4ASTA 2OWWA 4OZOA 1YNQA 7TAAA 1UJQA 1B3XA 3NO3A 4NILA 5EMLA 1VB9A 3WLKX 1R3RA 2RUQA 1XCFA 4IPNB 4RPQA 3AS1A 3VIPA 2O55A 1L6FA 5GNYA 3QY8A 5AC7A 4IZGA 3M1ZA 4X2PA 2INEA 3PZMA 2XGIA 4HA1A 1B3YA 2J6VA 3WNKA 5HINA 3U0HA 4GISA 5AC8A 1GVSA 2TRSA 1G7UA 1DQXA 3G8RA 5MF5A 3ME3A 1E44A 2E28A 1AH3A 5REQB 1G69A 4PRWA 4HU0A 1HVXA 2G37A 3VNDA 4PH6A 1EA0A 3LBOA 1HL2A 4QDWA 2V5DA 3UZZA 4NXSA 1VFLA 2PI6A 2ZUNA 2BODX 3NQVA 1WDSA 4LW7A 2P88A 3RFAA 1DVJA 5BYWA 3VZZA 4GUHA 1THFD 1WUEA 4O1DA 2QUTA 1MSSA 1N8IA 1UWAA 3FXGA 5C54A 3PUOA 4JTQA 1MUCA 2TODA 5K9DA 4HPXA 1P43A 3SFKA 4L6OA 5I7GA 4WDTA 1M7XA 2VRJA 4J3WA 2DZBA 4B5VA 3RXZA 1H1ZA 4PODA 5K7JA 5DY3A 4JTGA 3UI6A 3U2EA 3KP1A 2R9RA 6ENLA 3DG7A 3UXIA 2PF0A 1KFWA 2MUCA 4E2OA 1ZSXA 4LPCA 1R2TA 4G7FA 1LOLA 3VVGA 2QS8A 1ZAHA 1UZHA 2EPNA 3PNUA 1AK5A 3BAXA 1V3KA 2WJZA 4LUSA 4NI8A 5FEWA 1B30A 4ZE5A 2P8BA 4HHLA 3UJ2A 1H7XA 2YYTA 4G5DA 4MHBA 4ADTA 2YDSA 5DBUA 3T0CA 4AD0A 1L2UA 4IMFA 2ZUWA 1GG0A 1YMYA 1TR1A 1V7AA 5HK4A 1VPXA 2YBVA 1RD6A 4NZ3A 4KCVA 1ALDA 3VDAA 3SN0A 2FMNA 4Z08A 2PWDA 3WIJA 3CUIA 3P0XA 3RJYA 3NVTA 4JFKA 4H9YA 5F4XA 1ME8A 4B90A 4HBOA 5D2VA 2OLSA 1Z48A 5KINA 2HNHA 3I6RA 4JR5A 3MSRA 5C9WA 4Q8NA 1EQ3A 4XKMA 1RP8A 3P2VA 4K6AA 1LRNA 4ZO9A 3RPTA 3MDUA 3BSGA 5JVLA 4NY2A 3UWWA 5IRPA 3EZ4A 1V0NA 4EX4A 5E93A 1KR0A 1HVQA 4B16A 2Z1VA 3GH7A 3DCPA 1C8QA 3GNXA 4IP5A 2BGQA 4HTBA 4J2MA 3O16A 3RO8A 3RF9A 3ZM8A 2FJKA 4PTWA 4HKPA 1Y5WA 1FWDC 2D23A 1X98A 1DIKA 3AMCA 3HOJA 5D38A 4LYPA 4FNSA 3HQPA 3GQYA 2DT2A 4Q8QA 2CKRA 4S39A 1SMAA 5HR7A 4MNMA 1Q8JA 1GPWA 2Y6ZA 2EEXA 4M19A 1W54A 1SZRA 1Z41A 1UD8A 2DQWA 1M5WA 4UTFA 3N6JA 1QWKA 3OG3A 2IS7A 1KWKA 3DFTA 1SUXA 3DG3A 4FSAA 4QLLA 1RV8A 2HBVA 4IJCA 1JRCA 3WDHA 5LIXX 3NRKA 1QOXA 2ZVRA 1HJUA 4F0MA 4W8AA 3EDFA 4NZFA 2I9UA 2QNEA 4MVAA 1XYFA 1OFAA 1W32A 3L7RA 1UP0A 1G4SA 4LEFA 3OA3A 2DVXA 1EUAA 3OJGA 4YMZA 4ECLA 3T0BA 2QKFA 1OEPA 3P84A 6REQA 2X40A 4HMNA 3UVAA 4UDMA 3WQEA 4JY8A 1LJYA 4Z1CA 5H91A 4DQWA 3HA1A 1EZ2A 3H53A 4C65A 5U7SA 2X42A 4IGHA 1YPXA 2RJHA 3W1AA 4XSLA 1XDLA 3MUZ1 4XZNX 4DJEC 1H2JA 3L0KA 4LCRA 2GDQA 2I56A 4PUKA 4Y90A 3D0CA 3G1YA 2D2GA 3SADA 4UFKA 4B2DD 2Y70A 1W2PA 1EBHA 3CZEA 1JGIA 3BPWA 8XIAA 4HJFA 5JH1A 3NQ8A 1HJQA 1F4AA 1XGZA 4O28A 2CWXA 3C2FA 4XQ6A 1EX5A 4DBWA 1V02E 4H83A 3OOQA 4UCFA 1NDWA 3FLUA 4F0KA 4PEKA 4K8HA 3JZUA 3M5YA 4PUWA 1M5YA 2FHBA 2A3BA 2OPJA 1UD4A 2ZADA 1GOQA 2IKHA 2XM1A 4C6PA 1QNPA 3EX6A 1FFRA 1R9XA 2EJAA 4Z2KA 3DFYA 4L1WA 4UTTA 1KM5A 1Y0EA 1E6ZA 2Y8KA 2OWCA 2WSYA 2VZOA 5H8MA 2FHFA 3H55A 1GQNA 4JTRA 1V08A 3M0YA 3ALGA 4GQGA 2PDNA 1XIGA 1J01A 1IR1A 4GUIA 4JQAA 1CENA 1D8WA 2Y85A 3IIZA 1K8CA 3BCDA 5FKYA 2PDLA 1FXQA 1E56A 4JX5A 5G1YA 2PWUA 1FCVA 1J5TA 4J3TA 1JPKA 2FTYA 3RMEA 4IJBA 4XD5A 4ZCWA 5KZ6A 3EX3A 1SW7A 4Z1YA 1NQ6A 4IT6A 4UTKA 1JNDA 2VFHA 3OZYA 3WEZA 3DENA 4N4PA 2XM2A 2Y7FA 1Q1CA 2ZZ1A 3CASA 3BK0A 3MKKA 1HKVA 3QZAA 9XIAA 3WLJA 3N14A 4QRNA 3NPWA 3WL1A 3D5HA 2G4FA 5C9XA 4NZ1A 5DLCA 1V0KA 1TIMA 4LVDA 4JTAA 1GVYA 3DERA 2V38A 2BS9A 2ACSA 3LPFA 3DU0A 3F7JA 4D9PA 4IIHA 2NXGA 3E5BA 3TR9A 2VM8A 5J6EA 2YJQA 3S1UA 4CVUA 4E3TA 2ALRA 2Z6JA 4G2PA 3WYZA 3B06A 2X16A 2WJFA 4M3PA 2OT1A 2IKJA 4MWAC 3QV8A 2WK2A 2ABBA 2VC5A 3LNMA 1BHGA 1K8ZA 2B7OA 1DWGM 1BL4A 4I5XA 2KR7A 3B04A 3IRDA 3WQWA 3TN4A 1XIFA 3FSTA 1V3IA 3W23A 2N87A 3ODKA 4UTHA 2E3ZA 3T07A 4CNSA 3W7OA 3L5AA 4L9XA 2Y7DA 1QU4A 4A3QA 1NJJA 2WM1A 2EPHA 4DZAA 4RJEA 1GPFA 2C1IA 2MPHA 4CLMA 1DTNA 2ACQA 5AC6A 4C6JA 4R7JA 1DWIM 3HGSA 2WM0A 5DCEA 1PWMA 5K9CA 4IF2A 4O11A 3UW6A 3VI2A 4R34A 3E49A 5T8GA 4LRTA 4MY1A 1VLIA 4GACA 3SCSA 2YL8A 1UUQA 1YXDA 4DXVA 2OLHA 3MJYA 5CEWA 2X0HA 4ODPA 4CNPA 1BXBA 2P10A 5CZSA 1E9IA 3FAPA 3H4XA 4QS6A 1LCOA 4RDZA 5IDZA 3TTEA 1JULA 2DSKA 4C6FA 4JFJA 4C1KA 4R9XA 1J9YA 3A3WA 4AWEA 4DAIA 1JD9A 3PTDA 3SRDA 4XAKA 1JF5A 3GU1A 2WLZA 4FK9A 2EG6A 2QZRA 3DFHA 4D1IA 3PS7A 4FXRA 3GNNA 4H6RA 4FZIA 3GG1A 3ANUA 4DIAA 2Y8VA 4WXZA 4N02A 3W28A 1KFKA 7A3HA 4Q4OA 4RK8A 4QGCA 2WVTA 3AXMA 4DM2A 1TA3B 3GNOA 1YX1A 3N9KA 4J3SA 5F2LA 2H6RA 1QI0A 3QV6A 2RKXA 3GC4A 2QF8A 1K6WA 1OWQA 1S39A 3PJXA 1YTKA 4PMYA 4S3JA 1LM1A 3TTOA 3ZJ7A 4W84A 2W92A 1HGYA 4KCWA 2CBUA 3SR7A 1E43A 4LQ1A 4Z42C 4MF4A 3B9OA 1HJSA 1H51A 2REQA 3AZRA 3W2UA 1TWIA 1JCHB 2VCBA 3EA2A 4F2TA 5CSSA 2OOGA 3M7WA 4FOJA 3EEGA 1XJBA 3BZGA 3UJSA 2X1RA 1ZHAA 1PE1A 4NL1A 4W4QA 3EB4A 4JD4A 4AEFA 2E4TA 5D9PA 1W3JA 3I6EA 5E70A 1F8AB 3M7SA 5IM51 4PMDA 3N11A 2PU0A 3UXKA 4M1BA 4ZOAA 4TTUA 1NOWA 2HRWA 1A53A 1OINA 1H4PA 4KWOA 2HK0A 5LNSA 3UZJA 1GYMA 3GU2A 4XD4A 1ZTVA 4R88A 2VFFA 3AO0A 1TV2A 4WX2A 1J0JA 1VFSA 4KT2A 2FKEA 3U6WA 1NWTA 2YCIX 1DQUA 5FI8A 4JIIX 1PDYA 3NZPA 4ENLA 4QG9A 1H7NA 4HHPA 3WQ5A 5HDRA 4O1AA 5A94A 1YADA 4YS1A 4DRPA 3WQ8A 3G1VA 2F84A 2XVNA 3G6LA 5KZEA 4OE7A 2CLPA 4I8YA 5M03A 4NZ4A 4C60A 1W1ZA 2NXHA 3KTSA 3EWBX 4AHOA 1CGYA 2BTMA 1JPHA 4G6CA 3TC5A 1RVGA 4HPGA 3ZMRA 3KRSA 2EG7A 4DO5A 1YW5A 4Z0SA 5CCZA 2VR2A 2EO7A 3SDOA 1WKEA 4PYSA 4FB7A 2FIQA 1XICA 4FX6M 1GORA 1RCOB 4H00A 1E1FA 5M17A 4B5WA 4EANA 4G2DA 1G67A 3ONBA 1XLCA 4JIEA 3NI6A 1G4PA 4C7DA 1WX0A 2OZ8A 1VJIA 4NAEA 5HT1A 1P0BA 3VCRA 1D9EA 3VUPA 1W5QA 3G3DA 4FOUA 1A0DA 3T55A 4W5ZA 4MNJA 5I3IA 5HMEA 4GYFA 3P3BA 1GEQA 4US5A 3VO0A 4YWSA 3O0FA 5BMWA 3CZLA 1MDLA 3P6LA 3GD6A 2NQ5A 3QM3A 5GPRA 4AZHA 4UFIA 2WNZA 4GI4A 5E6ZA 3N9SA 4MSPA 4Q8WA 3GXDA 1TX0A 4Q4KA 1E55A 3A4JA 1EL3A 1FWJC 4XISA 4AZ5A 3AYVA 3CUZA 2B0MA 3CT2A 2XFWA 4NRSA 4TNSA 2OELA 2Y63A 3WCZA 3UBPC 4CCZA 1D8CA 1RUSA 2ZX9A 4AC1X 3PC0A 4TMBA 5A6MA 3IJ8A 4XZWA 2PRLA 2IKGA 3M64A 1ADDA 5C2XA 1VPYA 4BF8A 2XH2A 4Y9MA 2ZCGA 4HOWA 2FTPA 1JCTA 3GLCA 4REQB 3U2CA 5EMKA 3GC5A 4JHMA 3KZSA 1QWGA 1J0KA 1T8XA 2FVKA 5CZKA 3STCA 4GI9A 2PC8A 4PMRA 2JGQA 1R46A 2OKTA 3C3UA 3V18A 2I7GA 2ZKMX 3VGBA 3TQVA 4HQVA 1E70M 3OA5A 1UD5A 2XN2A 4FIRA 1KV8A 3EDKA 1XX1A 1AZ1A 3SB0A 4MGVA 4GH1A 2OU4A 3NQDA 2AAAA 3N2TA 1CWYA 2FFIA 4LH8A 4YVVA 5HWBA 1FP8A 2Z27A 3VGFA 3ZIZA 2ZXAA 2O9OA 3N4EA 1CXLA 1GOOA 1NU5A 1BVNP 1EPVA 4UQBA 3RN6A 3MI3A 4JFLA 2HCVA 2NQLA 4JQ1A 4NYYA 1KM6A 3WQPA 2CBVA 1VP5A 3WBWA 4GIAA 4XG1A 4RNIA 4NJKA 2WNWA 1VBRA 2ZXQA 4L4LA 3PM6A 1ZQ5A 1BG4A 5T9CE 1XINA 3CLMA 5HWNA 3DXIA 2C71A 1FUYA 4S23A 3LI1A 3LHZA 4XBSA 3CIWA 2VWSA 3CAVA 4QEEA 4IMGA 2V2HA 4U31A 3GAYA 3KBMA 4JAWA 1TWWA 1A5BA 1F74A 4LVBA 1XLEA 1H09A 2NQHA 2NVCA 2PDKA 1LBMA 4U84A 1EJSC 1HKKA 1Q6FA 4J5NA 1S5WA 2FZ9A 3EMZA 2PDPA 5A6LA 3W6MA 4TV5A 2PUZA 3MQTA 4Y8EA 1C8VA 1ZBVA 3VZXA 1O7AA 1ONRA 3HQNA 5I23A 4FXSA 4QXIA 4H7VA 4CN1A 1XF0A 3CO4A 2ZQVA 4ZB2A 1K03A 1FKHA 4RZBA 2RDTA 2DSWA 2ISFA 4XVDA 4FLRA 3WUEA 3DUGA 2ZZ2A 3FJNA 3VOHA 4ONVA 5JXQA 3C56A 3WEMA 4IT1A 2O0TA 3TCZA 3E3HA 1HL9A 1ZRQA 2GFTA 2HVNA 3QQ0A 3K8MA 1JIBA 5A1AA 1EA9C 2DGAA 1LQ2A 2XZ7A 3QC3A 3ZT6A 2XISA 1K7XA 3MI6A 4ZQPA 4LVAA 2J8TA 1U79A 4KFOA 4Y6GA 3WLLA 3HG2A 1O5QA 4ZVJA 7CGTA 4RUBA 5IBXA 1X97A 4DRKA 1E1CB 2GVEA 3WK0A 3P81A 4DB7A 3NUKA 4GNKB 1T96A 1TB3A 1OCJA 3P8JA 3WH9A 3P14A 4J35A 5J5DA 4YVPA 3LM3A 5FF7A 2RHGA 3TYZA 3LUTA 4ICMA 4B9ZA 1P0NA 1J79A 1EEPA 1VBUA 3VXGA 3KVLA 3OYXA 5AOUA 2P50A 1L0PA 3NQAA 2ZYFA 4NX5A 2NUWA 2OZTA 4WIWA 3O2LA 4PUDA 5C2GA 4OIFA 3A5FA 2AKMA 4HYVA 3BSMA 4FF5A 4F2UA 1SU5A 3TDBA 1PBGA 4CU8A 3VE9A 1V02A 4LYQA 2P76A 2Y4SA 1UMYA 2VN1A 1QXLA 5RUBA 3G8EA 2DEPA 3LLDA 1MWOA 1JAKA 2CEQA 1TMHA 1JQXA 1QTWA 3R7MA 1EIXA 4Z2IA 3FGCB 1UR4A 2ZWYA 5BU9A 2CLFA 4TR9A 3CHFA 4L72B 4A29A 2PWVA 3BICA 3N3TA 2R14A 1E9LA 1Q66A 2OODA 3LHVA 3PR9A 1Q6LA 2Y89A 2CLMA 4F40A 4PCPA 3QSRA 4B3LA 1LLZA 3TMLA 1P0EA 4JXCA 3T1GA 4F2BA 3U48A 2NUXA 1MXDA 3Q67A 1WP6A 5I07A 2VEFA 4D1JA 1EX1A 1O95A 4PBEA 2RGMA 2Z1WA 3S46A 3S2CA 1SJCA 3GDMA 1FWRA 3DFOA 1VBJA 1GOWA 1I6NA 2WSPA 1YE6A 1SZFA 4KW2A 3TLQA 1NDVA 3WLSA 4JPGA 4IIFA 1S46A 2C0HA 4U3AA 4JTJA 4H8HA 3W2NA 4RNJA 3FEQA 4DRNA 4PUEA 3CUHA 2Z1XA 2G0WA 2YCEA 2GJLA 5TF0A 5G4EA 4DJFA 3VAVA 3VA8A 2UY3A 1JNEA 3GSMA 4LYRA 5LNWA 1KR1A 1HN1A 1SSDA 3ARZA 1PKNA 1R6WA 2VZUA 4M7SA 3TX9A 1BGGA 1KFLA 3F4VA 2EBNA 1VEPA 4UQEA 5BOFA 3GDBA 1W8SA 2WJDA 2YXOA 2OEMA 1C9WA 4H6KA 3T0DA 5BXTA 2C91A 1EUNA 1MQQA 4G9PA 4JIPA 2TSYA 2NV9A 1J93A 2J62A 2QPXA 3DHUA 4R3UA 5KTLA 1BYAA 3RCMA 2DY3A 3QPEA 1J4HA 3W4RA 1JYWA 3GHSA 2F2HA 3W53A 3UWEA 1A0CA 3EX1A 1EYMA 4NT0A 4A2RA 1KKOA 2IXUA 2M1IA 4P2VA 3MYOA 1WZLA 1K7EA 3CQJA 3BLKA 1G6CA 3M0LA 1OFDA 2WSKA 4AY1A 4EXBA 4GY7A 4J3UA 4PTNA 2J27A 1OFOA 3DC8A 3T09A 3MMDA 3GBEA 3V7PA 4DH0A 2BXZA 3TWAA 2XP3A 4C5YA 3HF3A 1XYAA 2V3GA 2CXGA 1MNSA 1C9HA 1PVNA 1UMLA 1GVOA 3BAWA 3EBVA 3CV2A 3RO6A 1SPQA 2KAUC 4UMBA 1GKPA 4POCA 3ZVIA 1DWFM 7ODCA 1M65A 2O4MA 2E09A 2TPSA 1VAHA 2JKPA 3OVRA 4J3XA 5LA1A 1EEXA 3GDKA 4MKSA 2UWFA 4LS2A 4CQDA 3KHDA 2VRKA 4RV8A 1EF3A 2GUBA 3ANVA 4ZEPA 1V03A 4FA3A 4QSFA 4WOQA 3F5KA 1OFPA 4FNPA 1GRJA 4D8ZA 3OEXA 3UD6A 1UZ1A 2V9DA 1UHVA 4DNHA 2QPUA 3CYJA 2FGZA 4AD3A 3FN9A 4XAGA 2KI3A 4M51A 3AHVA 1LT7A 3M5ZA 4YIWA 1I4NA 5F7UA 2QXWA 2WKGA 3CAQA 3BLLA 2BNJA 3GUWA 2OB3A 4R27A 5HQEA 1JF6A 4ZO7A 3FJLA 4CNOA 3W1MA 4L6DA 3CLWA 3IK4A 3NJ3A 4X0VA 5E9XA 3P74A 1OFBA 2ZUSA 1RCQA 2PU1A 3MTWA 5CPMA 4AIOA 5HA7A 3O5JA 3SCRA 1IYXA 1NELA 1R87A 5EGRA 3S5SA 4UZSA 5AYIA 4MB5A 4FAMA 3VNMA 1Q13A 4X61A 3FA5A 1EC7A 1DJWA 1US3A 2E6YA 3F2BA 5C6MA 2W3ZA 3GDTA 5ECUA 4M56A 3KOZA 1T11A 1YTEA 1ZGDA 4QE5A 2DVTA 3N13A 3M0MA 3CTLA 4WDXA 4AVOA 1FWBC 3PJTA 4WR3A 3CZGA 3ZSTA 4HNUA 3W7PA 4AWUA 2ISDA 3FHAA 4PUNA 1FWIC 3NQFA 4KGJA 3LCFA 1ICQA 1SQ7A 3GXMA 1GCYA 1XLKA 2BXYA 1V6TA 3E0IA 1EJ7L 3W3OA 1FCQA 1RK5A 4H3DA 1G7VA 1XWYA 2C19A 1MVYA 4U28A 2XINA 4GFIA 2ZR5A 4RZ5A 2OFNA 1NFPA 5M2FX 3KL0A 4LUSB 3ANYA 5I3JA 4TX9A 3A6OA 5I03A 3NQGA 5A8PA 2IKIA 4GQRA 3RR1A 5E0FA 5AKQA 2D73A 1VC4A 4FIQA 4W85A 5HWJA 3WFLA 2WZTA 1CI1A 4ATLA 3ZYZA 3QKZA 1QNSA 5D03A 5HANA 2F61A 4GGHA 4JTIA 3ITXA 5D02A 1J4RA 1KM0A 2WPGA 1JVWA 1W3HA 2BOFX 3G6MA 3SY8A 3MB9A 2A7RA 1IE7C 1E9YB 5D8WA 1TO3A 2QUUA 5HPCA 2XDFA 3EDJA 1RCXB 1CGVA 1NMVA 1KLYA 4EK7A 1A5CA 3O6CA 1EWDA 5CBIA 1KM4A 3O5FA 3HM7A 4PFHA 3PULA 1KRAC 2YW3A 3JZEA 4HYWA 2QDGA 1FWHC 3E96A 3CPGA 2ZQSA 3GK0A 4LU0A 2VP8A 4KKXA 1E0TA 1IWBA 2Z2UA 1EJXC 4Z2JA 2WKLA 5BCAA 3CL7A 1Q2RA 1K4GA 1TIWA 3CWHA 2ZR6A 2QIIA 1ISYA 4EACA 3KLLA 3NL5A 3PWIA 4C1LA 5BU6A 3L68A 3VC6A 1WDRA 4R7OA 3ITCA 4L7ZA 1ZJHA 1F9CA 3LS9A 1FP9A 2XSAA 1U83A 2CXEA 3OZPA 4V15A 5REQA 2CBIA 3BE7A 1I2RA 1JZ6A 8A3HA 2QJHA 1KTBA 1B9ZA 5LNVA 1W3LA 1CLXA 4I8DA 1T6MA 2ZUMA 4XAYA 2Z2AA 4D8LA 4ZQRA 3HG4A 2DSZA 2C0AA 2O9RA 4FNQA 3W70A 2QV4A 2PP0A 4AD4A 5I02A 3CGMA 1BVZA 2TAAA 2H3BA 3O5GA 4QEHA 1R30A 2FH8A 1G01A 3PUGA 4MFEA 3PG8A 1TV7A 5CGQA 1K1DA 3OIHA 2PN0A 2XGBA 1UWSA 5BWFA 5C7VA 1GW1A 2NWSA 1ZLPA 4F0RA 2PTXA 1VQTA 1YATA 2F6KA 3WLHA 2VC6A 1UH2A 1VKFA 3MT1A 3IJQA 2V69A 4H01A 1M3UA 4IFKA 2VOMA 3VABA 2WC3A 1ADOA 1FY6A 1FCBA 2X8RA 4ALDA 1KFCA 6REQB 4YTSA 4D6JA 2GUUA 4UTUA 1YPFA 1ISZA 3IGUA 1PZ3A 3TC3A 1QRQA 3HPFA 3M41A 3DAQA 3FAWA 3VKCA 3TSDA 3UPBA 5DEZA 2E40A 1VBGA 3QHMA 4K36A 2PTWA 1ZBCA 3OVGA 1ZP4A 5CLWA 2FKPA 3EOEA 1IQ8A 1Y7VA 5A95A 1Q3NA 1S3TC 2X0SA 3WDQA 4E8DA 4AIEA 4OV9A 1IZJA 4HHMA 4ZTYA 4N0RA 4Z2HA 1Z3NA 2PRMA 1HGWA 4J27A 3SUTA 4TX0A 1RALA 1EF2A 3BSHA 4AHQA 1CXFA 1U1UA 2JALA 1Q6EA 4LY4A 3PZQA 4ODOA 3CIXA 3TA9A 3MV11 1MRQA 4FNRA 1C90A 5KSWA 3IWPA 3NR0A 2NVAA 2D3LA 4FS9A 2PODA 3E2SA 3A22A 4R85A 2XN1A 4Z1DA 1DTUA 4DPPA 1ME7A 3C2YA 5H8PA 1S5MA 4F9JA 2ZZ3A 3WMCA 3OHMB 1V0MA 3QN3A 3NTYA 3RLUA 2H90A 3NQ2A 2E9MA 3UG5A 3ZR5A 2ZRZA 1K8XA 4AVFA 3UU0A 3H2MA 1CXIA 1RXOB 4HZ6A 3QLLA 4HYRA 4ILSA 2VX4A 4IX0A 2ICSA 3QTPA 3ARWA 4LS0A 4KWWA 3CS2A 4BHYA 5C8BB 3OP2A 4V28A 3QYQA 5JQ9A 1F3EA 1GHRA 1ZUAX 4H7CA 2PP3A 4MFDA 4ITZA 4BF5A 1EJTC 2CW6A 3NGJA 5HXMA 3UQNA 4ZBCA 4GYPC 3VGDA 4I7VA 1ZS2A 3THCA 4UB9A 3VNZA 3RK8A 1XCWA 5EU9A 3B8WA 2NSXA 1S38A 3W7JA 1GJWA 3LZ3A 5CJNA 4W7UA 3BMBA 1ZCOA 3QHOA 5FEZA 4DBUA 1GUVA 2RDWA 3PY2A 1E3XA 2WQPA 3S5NA 3TK7A 3L4WA 1R86A 3AYTA 1W1VA 2PGFA 1JDEA 2WB5A 2QW5A 5EPDA 1BTCA 4S3FA 1CGWA 1UH3A 5CPLA 1C93A 3GXNA 5HW8A 1FRBA 3L21A 2VGFA 2PGRA 3UWQA 4LUTB 3GYCA 3AZSA 2D2JA 4QJ3B 5HQMA 5D33A 3LCWA 4HHHA 4H04A 4DELA 1QPFA 4WXYA 3CGTA 2TMDA 2YPIA 3QMTA 4ML4A 1IT0A 1AZ2A 1DJZA 3LX9A 2QAFA 2WVSA 3O05A 4FLQA 1HP4A 1QK2A 3TC6A 3S1WA 4MKNA 3M16A 4O1EA 1OG6A 2ZRWA 3S3GA 4HPHA 3MJMA 1WKYA 2YA1A 4PBGA 3UR8A 1XBYA 4E8CA 3N12A 1U33A 4HBEA 4KCUA 1S1PA 2ANUA 3SUVA 4HN8A 1OT2A 1R3WA 5J04A 3LGDA 2WWCA 3R1ZA 3OQ8A 1K9FA 3T05A 3FAXA 5LNRA 4FXJA 1R85A 3TCSA 5D05A 1TPEA 1IEIA 1Q7ZA 4H9XA 2Y61A 3AJXA 4EKJA 3H9RB 4QG8A 1OC5A 1YEYA 3EOSA 3U5UA 4YTTA 4IIGA 1UR2A 4ZR8A 4JN6A 1HL8A 4KETA 4E6MA 3NSXA 4JYFA 1WKDA 3VD3A 3W83A 4TW7A 4RX0A 3EIPA 1V6UA 1JDDA 3GRIA 2BVTA 1F8MA 4HTYA 2QCDB 4GC4A 4ZZ9A 5HMSA 3KL5A 2XGZA 1XM3A 3VX0A 3B4YA 2WW5A 3BJFA 1QATA 3L67A 1G4TA 3THDA 2MNTA 2YCLB 1AFSA 3S47A 3KP0A 4QX4A 3GH4A 1R7OA 4WJ8A 1V7YA 2J74A 4OT7A 1XSKA 1Q5MA 1BYBA 2IW0A 1FJDA 1W9BM 2BOEX 4IGMA 5B80A 3F03K 4MWAE 1XI3A 3O5LA 3SUSA 3UNTA 4ZE4A 1VJSA 3ID7A 3GC2A 3IK8A 1KLZA 1Q6UA 4NUWA 3SN1A 3GFXA 2E0PA 4UC5A 1W9PA 3B8UA 3O07A 1TVLA 2VR5A 4D8AA 1TZZA 2IQDA 5TNVA 4X0NA 3SRKA 3E5PA 1GQKA 3WBYA 2WV8A 4IQEA 3RCNA 3BLFA 3N2XA 4O0KA 3GKFA 1LP6A 1RZMA 3A3XA 4EWND 4JOMA 4BI5A 1GJUA 3WBEA 2HVOA 4M29A 4L6HA 2YLAA 3WF2A 4AZCB 1TRIA 4PMJA 4ZO6A 5AHEA 3SUUA 1XPGA 1C7TA 1SO5A 4LANA 1JZ8A 5CPTA 1CXKA 1FKIA 3NOEA 3IKDA 6ALDA 3R8RA 1UP3A 1MFUA 3IJLA 1QHOA 3R94A 3PPHA 3VZYA 2SFPA 4BR1A 4QNWA 4Q4RA 1WUFA 1ZL1A 2QCMA 2FZMA 3VK5A 1GW9A 1FKDA 4GINA 4JN7A 2NWRA 2YB1A 4YYFA 3GE7A 4XZIA 3VIKA 2GLKA 3OBKA 3LCXA 3FDGA 5ABGA 4GQQA 4AX6A 2FVMA 3O5KA 1QPLA 5G1TA 3UZWA 1E6PA 3MUXA 1HKMA 3W38A 1MEIA 4BQ3A 4HPNA 4W5UA 5F2GA 2GVYA 1X39A 4LV4A 3MY9A 3IVSA 2DZAA 4B4FA 4MUZA 3NZ1A 2IPWA 4GGBA 3PZUA 2QCHA 2BY0A 1XBXA 3W6YA 2XWDA 4L64A 4P7NA 2RFGA 1TWDA 5C5YA 4UFHA 4NAEB 3PWAA 1XC4A 3GS6A 4O57A 3TJXA 3UY8A 4AMAA 3EKZA 2OYKA 3PUEA 1T7LA 4H41A 4HVXA 1IZKA 2HE5A 9XIMA 3AICA 1AA1B 1ZCCA 5I09A 5HW7A 4HARA 1ENUA 3FV9A 3G77A 1TMQA 1V51A 1A5UA 1CT5A 2LJ4A 3T2OA 2OQHA 4JFMA 1QJWA 2CLOA 1M6JA 3L12A 3ARVA 3EOOA 1PIGA 1HT6A 3S8HA 3IVTA 1CBGA 2ZDRA 2ZUTA 4GPNA 3ZOAA 2LPVA 1JPIA 4ZOEA 1FWWA 3H2CA 3VDGA 3WLTA 2OJPA 3TN5A 3TFXA 4N9DA 4U3CA 4TTGA 4C6QA 3MHGA 3LMYA 2DZUA 3RNDA 1I9CB 2G95A 2EHHA 3GFZA 4BKNA 1NEYA 4UQDA 4ROPA 2PDJA 3VIFA 4AQLA 3M9YA 3WLPA 4NXKA 1T99A 1XD0A 3FKRA 1T41A 1H7OA 3GNPA 5C9RA 4FI4A 4GX8A 5FF4A 5I0DA 4DN1A 1W0MA 3STPA 4Q6JA 2VGBA 1BXNA 4IMDA 5DBTA 4Q7IA 2OG9A 4BZYA 3HG3A 1E51A 1XLLA 2J78A 3R0KA 1F4HA 2R94A 3GDLA 1MUWA 3L9CA 3G24A 3FK4A 3OGVA 4EWJA 4HD5A 1D3GA 1M01A 4OQVA 3IJIA 4BCEA 2J88A 4GE8A 2V5KA 4JTDA 3FVDA 1F2JA 5DFAA 4NYUA 1LBLA 1GKRA 3RLGA 1KA9F 2D1ZA 4CQAA 1B3ZA 4PL2A 4W88A 3WUFA 1QPKA 3FYOA 3MDWA 3RDKA 2PPNA 3LLXA 2XP9A 1J10A 1XR2A 2FGBA 3HMJG 2OMAA 1Z8AA 5DO2A 1XBVA 3MUIA 1HKIA 3TKFA 1PKMA 1JG9A 2ONEA 3MC5A 4DRMA 4JS3A 4MGGA 1JUKA 3O9NA 4RPPA 3TROA 2ZQUA 2E9BA 4NI3A 4XIMA 3EAUA 3KAOA 1H1YA 4C6MA 3MVTA 1DJQA 1VHNA 2A85A 2PSNA 3VPLA 3S6DA 1XKJA 2YL6A 2XIOA 5FEPA 5DQPA 2A7PA 2X1UA 1WKFA 1V93A 3DKLA 4DUXA 3RR4A 3T6CA 4ES4A 2Y78A 1F6YA 2YGYA 1R3QA 4DWSC 3B97A 3IUHA 5I5RA 4LAMA 2EPLX 3O6DA 4A05A 1B4KA 1EPXA 1ZJBA 2DZWA 4K8GA 2PDYA 4BWLA 1N55A 1WAUA 1XLMA 1ZALA 2CLEA 3KAIA 2XIJA 4MYXA 3CHCA 2ASHA 1OADA 3S2JA 4XZMX 3DH7A 1AUSL 6CGTA 4HSHA 3LGGA 3PNZA 1PTAA 2G3IA 4BEUA 1IF2A 1VR6A 3W1NA 1IXPA 3CPRA 3KWXA 4PSPA 1UKQA 2J79A 1J0YA 3KTXA 1K70A 5DIUA 1KBKA 2WZHA 4CD7A 3AXIA 3KCLA 3QZ6A 5LHEA 1H63A 4GQ0A 5L6UA 3W7RA 4PCFA 4EXQA 5CGMA 4C7FA 3EPOA 3MV01 2R24A 3B8DA 4E5TA 5BXRA 2GJXB 4FNTA 2W0UA 3AFBA 1U5HA 4HMEA 4HOXA 5CGTA 4R53A 3EKGA 4L80A 2ZUVA 5A6JA 3M07A 3N18A 2WMKA 2QLYA 3SJ3A 2VD9A 2FVLA 1A5KC 1BKHA 1FDZA 4YNGA 2ZDSA 3EXRA 4D6DA 2RDXA 4PL1A 5C0QA 3SAZA 3TP4A 3PZNA 2PS2A 3JW7A 4NJHA 2XZ9A 2Z1KA 4L9ZA 2YFNA 1YXYA 3QKEA 1W26A 4ODMA 2CBJA 1FWFC 1VFFA 3W81A 2RAGA 4FLSA 4LSBA 3UWYA 4NP7A 5XINA 4O2TA 1PCKA 5IOBA 4IL0A 4DY1A 2YDAA 4RR4A 4ZL1A 2BDQA 1A5AA 3GDRA 2CLHA 3A4XA 3LQLA 2WANA 2PDBA 3SCTA 4JICA 5JBDA 1CGTA 3WQGA 2XH0A 3B7XA 4D6FA 1C91A 3TJIA 2VQUA 3WF0A 3HJEA 5FIPA 5DELA 4O1BA 4RNHA 2Y0FA 3JU2A 1FDJA 1RPKA