2DSVA

Interactions of protective signalling factor with chitin-like polysaccharide: crystal structure of the complex between signalling protein from sheep (sps-40) and a hexasaccharide at 2.5a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Carbohydrate binding properties and carbohydrate induced conformational switch in sheep secretory glycoprotein (SPS-40): crystal structures of four complexes of SPS-40 with chitin-like oligosaccharides
pubmed doi rcsb
molecule tags Signaling protein
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dsvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dsvA01
3BXWA 1GOQA 3DYOA 2CCRA 4QP0A 4C7FA 3KEHA 1EOMA 1FHLA 3WEMA 1HP4A 4AZGA 3VGHA 4L4PA 1W9PA 1W2PA 4CD8A 4ZE4A 1GQKA 3L4WA 1J12A 1MW1A 1GJWA 4LXFA 4E8CA 2XGIA 5A6JA 1EOKA 4UFLA 2EXOA 4CCDA 4ZXOA 4Z2IA 1XSKA 1VAHA 1LL4A 3WEOA 1W9BM 2CITA 3OLEA 3IAQA 1FH8A 3WH7A 1EDGA 3BLPX 3VD4A 5FOOA 1PZ2A 1LWHA 5BXRA 3EDKA 3WL0A 4U2ZA 1KBBA 1Q6FA 1JF5A 2DDXA 3S6TA 1GJUA 1D2KA 1V08A 1GPFA 2WKGA 4OBSA 1KXTA 5HPCA 1W9UA 1VJSA 5AC4A 1NWSA 1OD0A 4AISA 2UY4A 1M01A 4AZCA 2BVYA 1H09A 1UKSA 2J78A 3ZOAA 2CBIA 4OOZA 1HKKA 4JFSA 2ZICA 2D0HA 5AYBA 1WZAA 1W2VA 1JYVA 2PBGA 2WZIA 1XCWA 1KGWA 2TAAA 4J3UA 2VMFA 1LL6A 4U31A 4IUGA 3WNLA 2XHYA 3AXIA 2WC7A 5DT7A 5HOSA 3W6MA 3IK2A 1E6PA 1H3GA 2BY0A 3RJXA 4EKJA 3WH6A 3ARXA 3DHPA 3L4UA 1NWTA 4QCFA 1OB0A 3W0KA 2GSJA 1A3HA 3OZOA 2E8YA 3OGVA 4N0RA 3ARPA 1KFWA 3N17A 2V3EA 4GIAA 4ACYA 5I5RA 1EHNA 2BY3A 5M17A 3D3AA 3NSXA 1V6YA 3WF4A 2D23A 1TZ7A 1GVIA 1PPIA 1Q6CA 4GO9A 2BFGA 2CHOA 3AHVA 4IPNB 1SYTA 1KR0A 1VFFA 1UD2A 3CLWA 3KL5A 4UCFA 1M04A 1TVNA 1XSIA 3QGVA 2UY2A 4AD2A 2VT0A 2WWDA 1BHGA 3MSGA 2O9TA 2RGMA 1V3MA 1DWIM 4A4AA 3CZJA 3VD3A 2WBGA 2FHCA 1WE5A 3POHA 4W7UA 2J8GA 2V3GA 4W7WA 3ZQ9A 1KR1A 1R87A 3T08A 1E1EA 4AZ6A 2DGAA 1C92A 4D1IA 1ZBCA 1G1YA 4PUEA 1Q6DA 3ARTA 3SEPA 1JDCA 3W6LA 1I1WA 1DWGM 5I2UA 2WBKA 1AQ0A 4J3WA 4KWUA 1E4LA 1J01A 4GZJA 3VNZA 3WD1A 4UFMA 2JF6A 1V3KA 4JIEA 4TOQA 1HF6A 1BYAA 4DWSC 3VINA 3WUEA 4CGTA 4L4OA 2V3DA 1QNPA 1QW9A 3VDBA 1W9XA 4AC1X 4D6IA 5A6BA 2EPNA 2VR5A 3VPLA 1PJ9A 5A6KA 1E6SM 4BQ5A 3OG2A 2W92A 4J28A 4KRTA 2CIPA 1E0VA 1RPKA 4HZ8A 1UR9A 1UQZA 1JIBA 3RJYA 4ACZA 1OBAA 3CZGA 2Y8KA 1VJZA 1UYQA 2VO5A 3VM5A 2VRJA 4AD3A 3SURA 1HKMA 5ABEA 3FY1A 2BY2A 2ZX5A 3WMBA 2E9MA 4TX8A 3WSUA 4B15A 5HNNA 1J9YA 3HN3A 2BNJA 4DWSB 2VZSA 3GBDA 5EMYA 3AIRA 3MMDA 4D6HA 3SUUA 4AIOA 2QMKA 1DWFM 4NSBA 1BYCA 3MV01 4GO8A 4UOZA 2PWHA 1JZ6A 3PHAA 2VJXA 3GZAA 5E0FA 3PTKA 1QHPA 2EQDA 3EDDA 4P8WA 5CPTA 3UR8A 1HKIA 3N12A 2XSAA 4DUWA 5E70A 1B31A 5A1AA 3CTTA 3OGSA 4UFHA 3WD2A 4LGXA 1X6NA 3FHQA 4UFIA 1GQLA 1CYGA 1BPLB 5BXPA 4NRRA 1J0KA 2CYGA 3MKKA 2EEXA 2CBVA 3AHYA 3RPMA 2WYSA 3SCWA 1SMDA 2GK1A 5JBDA 4HP5A 4IISA 1QI4A 2J8FA 3G6MA 2JE8A 5IFPA 4MAVA 1R7AA 3I3DA 2D22A 1KWGA 2OYLA 1CNVA 2W66A 5JIWA 4OIFA 1HKJA 3CMGA 1JAKA 3CHDA 3WDQA 5BROA 2WCGA 3WQVA 5E6YA 3AHTA 4WKHA 4D71A 4PMOA 2QMJA 4KGJA 3W38A 4A3YA 4HA4A 3WDRA 3M6DA 3PZQA 2PBOA 4P7LA 4AD4A 1W9VA 1HXJA 4R5EA 2Q8XA 1UWTA 5GQBA 3WELA 2DPEA 3KL3A 4OJYA 1J0YA 2EO7A 2VX4A 3OZPA 4H2CA 1HJWA 1EDTA 3QHOA 1PBGA 1VB9A 3L4TA 3O2LA 3GXDA 2PWEA 4MNMA 5I23A 3T0BA 4WJXA 3W29A 2ZUUA 4U5IA 3WQ4A 4CVUA 4W89A 4F79A 2WWCA 1I1XA 2Y5EA 3AIQA 3WBEA 3CHEA 1UWSA 1JDAA 3RM8A 1ISVA 3W53A 4PSRA 3NSNA 1OT2A 1V6VA 6A3HA 2J77A 2ZX8A 3N11A 5HBFA 2BVDA 2WVVB 3MS8A 3I3BA 4PUDA 3W81A 5IXEA 1XCXA 3WMSA 1BLIA 3W25A 1MW3A 1E15A 5LA1A 3ALGA 3WF3A 4PMUA 2GJXA 2F8QA 1BFNA 1ZU8A 1A47A 4P8XA 1FP8A 4HOZA 2BHUA 5EFDA 1CGTA 2EBNA 3N15A 4U3AA 1BG9A 1GHSA 2VZUA 4MB5A 4PCSA 5IHRA 5M03A 1B30A 3SCUA 1CPUA 1YQ2A 3WFLA 2BY1A 1CBGA 4AD1A 1FHDA 3TONA 2CESA 1W1YA 1E0WA 1BGAA 5AYIA 1ZL1A 3PN8A 2W62A 2VURA 3SCPA 3J7HA 3A4WA 1C8YA 4TVCA 1E56A 3SCRA 3PZUA 4OOUA 3CZ8A 1FH9A 1GOKA 4N42A 1ECEA 4LYRA 3M7SA 2WVUA 3NYDA 1HJXA 2DSWA 2X0HA 1OD8A 3ARYA 3B8SA 3VIJA 1W32A 4LYQA 4Z2KA 2J62A 4UNIA 6CGTA 1ZJAA 1E6XM 2J7BA 4GINA 3ZT5A 1NOWA 4D6FA 3EMZA 4QCEA 3N04A 1CIUA 4RL3A 1JZ7A 2J74A 5A6LA 4GZIA 4HMEA 5BRQA 1EH9A 1QW8A 2G41A 1IZKA 4GQQA 4AWEA 2G4FA 1BYDA 4BA0A 1G9HA 3CMJA 1JZ4A 2Y4SA 1MWOA 1SFSA 4TUFA 3ARSA 1PEZA 5HDRA 1UD5A 1H2JA 1EQPA 1TR1A 1UWIA 3W82A 1G94A 2YLLA 4UQCA 3WBAA 3ZMRA 4WKAA 1J18A 1JAEA 3PZOA 3BH4A 3WL1A 1NM9A 4P7NA 4F9JA 4X9YA 1V02E 5E6ZA 3BLKA 1JYNA 1US3A 4PMXA 3A47A 1GNXA 2EPMX 2E9BA 3SCTA 5BWFA 3FNDA 3WNNA 2XJ7A 1C93A 5A2AA 3CBWA 1E71M 2ZUTA 2QPSA 1CXEA 2ZOXA 1Q6EA 1XC6A 2VVNA 2A3BA 4UZSA 1XYFA 1K9DA 4MDPA 3KL0A 5IHSA 1TCMA 4WSJA 2FDMA 3AHXA 4M8UA 2F2HA 3MUAA 3II1A 3AZTA 1CGVA 1XSJA 3U7BA 1V3HA 3MUY1 1TA3B 1WAWA 1VEOA 1W3KA 3UG4A 3L4XA 2YBTA 2D1ZA 2DSZA 1E0XA 2ZIDA 3SCVA 3AICA 3KWXA 1FP9A 1VIWA 1UR2A 5AY7A 1H1NA 1TUXA 2WMHA 4AZCB 2ZWZA 4D6JA 1LL7A 4DUVA 4URIA 4GQRA 1GCYA 3CHCA 1UA7A 2GDVA 1PX8A 3OLIA 2G8ZA 4XUYA 1WDRA 2WC3A 2OSWA 5JUVA 4W8LA 2MANA 1CGXA 2DEPA 3VIIA 3VU2A 3OIHA 4CN1A 4UQBA 1C7SA 3LPFA 2JIWA 3AXXA 3N1AA 4FK9A 4S3JA 4JKMA 1BVNP 2JFEX 1KGXA 2B31A 3T0DA 3BAJA 1BGGA 4PMVA 1NP2A 4BCEA 5DO8A 1ZB5A 4WIWA 4XV0A 1UZ1A 1V0LA 3VKKA 2WVSA 3TTYA 3PBGA 2VZTA 5DMYA 1EGZA 2X05A 4JHOA 4B3KA 1AQHA 1JYXA 4PTXA 4NZCA 4CKQA 4HTYA 3BSHA 3QHMA 1GOOA 3AMCA 3NUKA 4RE2A 4LQ1A 2ZE0A 3TTQA 3THCA 3AJ7A 2FGZA 4D72A 1V0MA 5D4YA 1E72M 2E40A 4OKDA 5A69A 1LG2A 2IXVA 4P8VA 5A6BD 2WSPA 2VL4A 4MJ4A 3ARWA 2WHMA 4IPLA 4P8UA 2WAGA 3N18A 3AYSA 3CUGA 3UR7A 4HOXA 1XV8A 3GXMA 3ARQA 4Q7NA 2IUZA 3JUGA 1JNEA 3LMYA 3RILA 5BXSA 5A8NA 3ZSTA 1UWRA 2VUYA 1CXKA 3PZGA 4J3XA 2ZUMA 3CGTA 2CPUA 2BS9A 1WCGA 1M7XA 1W91A 5D9OA 4P7QA 2ZX7A 4J3SA 4AIEA 2GJPA 4TTGA 1QBAA 1WB0A 4PMQA 2J7EA 2GVYA 3PZ9A 3VGDA 1CECA 2VRKA 2Z1SA 3CUHA 3QR3A 3VDAA 1C90A 4PBGA 4BQ3A 3THDA 4CVWA 1HIZA 1TVPA 3A6OA 4MPKA 2DT3A 1B9ZA 3ECQA 4W84A 5EB8A 1VBRA 1V6XA 1OGBA 4BQ4A 1BAGA 5DFAA 3SCOA 4KRUA 2DSKA 4B16A 2YDSA 1V0NA 5I24A 4AEFA 1HVQA 4HMCA 1UUQA 5ABHA 1Y7VA 3LPPA 3WNPA 1EIBA 3B9EA 1BSIA 4CUCA 4AW7A 4AIUA 1BG4A 1OGGA 1BVZA 3VILA 3K1DA 3ZO9A 1LG1A 5A6AA 5A8OA 7CGTA 1TG7A 3SCQA 3MMUA 3K8KA 2PC8A 1E40A 2X8RA 2YLAA 4X0NA 1QPKA 5A2BA 4FLSA 1QNOA 5D8ZA 4QFUA 3GDBA 1B0IA 4J3VA 2W61A 1Q4NX 1DWAM 3AQUA 3CZEA 5TD4A 3BAXA 1V3LA 2PWDA 3U5UA 1M03A 1UH3A 2A3CA 3POCA 4X0VA 4H41A 1WDPA 2YA0A 3OLDA 5CPSA 4CD6A 5CSUA 2C7FA 2QHAA 1EQCA 1CLXA 2NW0A 4AZ7A 4U33A 3LPOA 4MB1A 5A95A 4YHEA 2XTKA 3K46A 2WLYA 1XGZA 2GK1B 4WK9A 4HZ7A 2VZVA 2WMJA 3WDPP 1OWQA 5A8QA 2CEQA 4PTWA 2AOSA 1UH2A 3AIVA 2WPGA 4LPCA 1K9EA 3AS3A 4JFWA 5CG0A 1ZBWA 2IXUA 2VRQA 1ODZA 4M29A 4W93A 3K4DA 1Z32X 2DT0A 3BAYA 1V6UA 3AIUA 4W85A 3WH8A 1LWJA 1R85A 1QI2A 1CWYA 1EO7A 1UKPA 3CO4A 2YL6A 2AAAA 3GH7A 5CXPA 1E4MM 4F66A 3FAWA 2O9OA 4PTVA 1QI0A 1JG9A 2ZUWA 1J0JA 1WP6A 3OLGA 1PX3A 4V2XA 3WNOA 2HISA 2VX5A 3CIVA 2WCSA 2YKKA 3WF0A 1W3HA 1JZ8A 3T2PA 3RO8A 3WQ6A 2WC4A 3RDKA 1GHRA 3MV11 3OB8A 4CCCA 3AISA 1WKYA 2NT0A 3EYPA 3AIEA 4YN5A 2BHYA 4DUXA 3A4AA 2J7CA 1KQYA 3NSMA 3T0AA 3PZIA 4AZBA 4KGLA 3WUGA 1QOXA 2DT2A 3EDEA 1B90A 1MXDA 1OIFA 1OINA 4YPJA 2J7FA 1F4HA 4Z2HA 1DTUA 1UD3A 2ZUSA 1CGYA 2XFYA 1ODUA 5I3DA 5E9AA 1MQPA 3PZTA 1QNSA 1UR0A 2EPKX 3VM7A 2GJXB 3BCDA 4JZ5A 1FH7A 1EO5A 1PIGA 3U57A 4QLJA 1G0CA 1EXPA 1VEMA 3O9NA 2DIEA 2VX7A 5FL0A 4NF7A 2G3NA 2WSKA 2WZHA 1NWRA 4Q22A 1XD1A 5DEZA 2YJQA 2DH2A 3AS0A 4MTVA 2BHZA 4HZ6A 1TFVA 1KXVA 3DC0A 1C8QA 3VO0A 4W5ZA 1NOFA 8A3HA 3L4ZA 3WDJA 1DWJM 2WMIA 2D0FA 1R8LA 2W67A 2J75A 3WF1A 2ZX9A 4HA1A 1E5NA 3RIKA 3SUTA 2YOCA 1C8XA 2XM1A 3VTRA 3BAKA 3ARVA 1U2YA 1QI5A 4ZXLA 1WDQA 3F5LA 1JD7A 3CHFA 3BMVA 3SUWA 3WD4A 3MANA 1K6AA 2C8NA 1GQJA 4W8AA 4ATDA 3N9KA 1W1VA 2JF7A 5EFFA 1OIMA 2QPUA 1Q6GA 4UTFA 1R86A 1RH9A 1J0IA 1V3JA 1UR4A 2JALA 2JIEA 4MADA 1NP0A 2E9LA 4H04A 2A3HA 3AMGA 5KZ6A 2AMGA 3WUFA 4Z2GA 3O6AA 1KGUA 1KCKA 4ZFMA 4YHGA 1TE1A 2QLYA 4PMDA 3ZIZA 2VNCA 4QAWA 1NWUA 3F5KA 1VF8A 2J7GA 4JL1A 4HMDA 3ALFA 4E4PA 2VCCA 3E1F1 3W4RA 1UD8A 3AZRA 4AZ5A 2UY5A 3I3EA 4ML4A 2CERA 3SUSA 4MB4A 4HU0A 1GUVA 1XHGA 7A3HA 3TA9A 1UWQA 1GONA 2PB1A 4PMYA 2PI6A 3B9AA 1EHAA 1LF1A 3QOMA 4TVDA 2GDUA 3MMWA 1ISXA 1RP8A 3L4YA 4JFUA 1HJSA 2OSYA 1XYZA 1GOIA 3DYPA 3IANA 1NH6A 3BMWA 3AMLA 2X0YA 3WF2A 3PZVA 4XZBA 3RMEA 1CEOA 2XVGA 5C71A 1JF6A 1QI3A 1RP9A 1JFXA 4RE3A 3BC9A 3TOPA 1MQQA 1CXFA 2Y2WA 3VMOA 3OBAA 1HJVA 1UR8A 1W1TA 1DP0A 2J47A 4AMCA 4ZEPA 1CENA 3VIFA 5CLWA 2C0HA 3WY1A 2J79A 4JCMA 4QLLA 1HNYA 1LQ0A 1UG6A 3VD5A 3IJ7A 2NSXA 2J25A 1E6ZA 1MFUA 3GH4A 4PN2A 1HP5A 4PSPA 2CBUA 5GNYA 4U2YA 2XG9A 3S2CA 3SCSA 1UZ4A 3AI0A 4M81A 3MU7A 1JZ2A 3IJ9A 5FL1A 3EMCA 1H5VA 2CBJA 2QV4A 2RGLA 3ZR5A 3UCQA 3ZJ6A 5CGMA 1NARA 1J10A 1JI2A 1JD9A 3U7VA 3IJ8A 3MSDA 2VOTA 5D8WA 2WLZA 1CGWA 1ZS2A 3UESA 3T2QA 1UD4A 2W4XA 4MAZA 2WZEA 1QVBA 3DYMA 2E0PA 4GI8A 2YIHA 4AY1A 4F8XA 2BV9A 3WIJA 4CCEA 3KZSA 1DWHM 2XUCA 2V5CA 4HA3A 2WMFA 1LJYA 5EBAA 1JGIA 3UEQA 4BZYA 3NDYA 3HJEA 5D9MA 5LYRA 4CU7A 2DIJA 2ESCA 3AZSA 3VIPA 2VVSA 1N82A 3N13A 3W24A 2GJRA 4H8UA 5AC5A 2ZXAA 1UOKA 3L4VA 3AS2A 2A3EA 1X1NA 2WMKA 4CD7A 2Y8VA 2OLHA 1ZJBA 4UR9A 1KQZA 2D3LA 4GZEA 5GNXA 5E0CA 4FLOA 1B3VA 3MUIA 5E09A 1CXLA 2V38A 4PMZA 4WSKA 4WKFA 1B3YA 4GI6A 1WZMA 1PX4A 1L0PA 3M07A 3AXHA 1E6RA 2WB5A 4PTMA 1UR1A 4CD5A 4XB3A 1GOWA 1PZ3A 1GOMA 1JL8A 3F4VA 4AZHA 1HJQA 2WVTA 4HOWA 2CNCA 3FAXA 3UG5A 3CUJA 4W5UA 5JH8A 1W9DM 8CGTA 4DM1A 1F4AA 4R27A 2BXZA 1HJUA 3WDHA 1C7TA 1E55A 3BAIA 4PMRA 4U3CA 2WHLA 3FN9A 2CETA 1K9TA 3TTOA 4W7VA 3WDIA 2FH6A 5DT5A 4ZENA 2VZOA 1B2YA 1MFVA 1KXHA 3ZJKA 5ABFA 4W8BA 4C7DA 1E70M 2ZUNA 2CHNA 4UQ9A 1NOUA 3NCOA 2QF8A 5GPRA 4LX4A 1CDGA 1TA3A 4PEEA 3TP4A 4E8DA 2WHJA 1GVYA 3FXYA 4D1JA 1YHTA 4J3TA 1GW1A 3APGA 3L2LA 4JHZA 1CGUA 4M56A 4M24A 2D24A 1G01A 1SMAA 4HU8A 1KXQA 4FMVA 4GPNA 5C8BB 3PTMA 4JKLA 2DT1A 1XH1A 3K8MA 4OBRA 4UZUA 3AIWA 1V6WA 3A3HA 3MO4A 4D6GA 9CGTA 1D3CA 5A6MA 2X2YA 3GNRA 4UOJA 1CTNA 1QHOA 1WZKA 5LA0A 3VNYA 3K4AA 4EE9A 3W37A 3PTQA 1MW2A 2XVLA 4FLRA 5BCAA 4F9DA 4TXEA 2G3JA 4EK7A 5JIPA 1CXHA 2WMGA 1RD6A 4C7GA 4ACZB 6TAAA 3IAPA 1J0ZA 1V03A 1AQMA 2XYLA 3NIYA 1J0HA 5ECUA 2WW5A 1SR0A 1H4PA 1UD6A 1UA3A 3WH5A 2WM0A 2PWFA 4CN6A 1OCQA 3ZM8A 3GNPA 1E3XA 3G6LA 1E43A 3UERA 5M3WA 4AXNA 3WNKA 3EBVA 2V3FA 2WANA 4JFTA 1QBBA 4D6DA 1E73M 2XFRA 4JKKA 1H41A 4IM4A 4B9ZA 3CH9A 2V5DA 2VR4A 1IT0A 2OWXA 2OYKA 4MJ2A 3VIGA 2W91A 3ZT7A 3WUBA 1E6NA 5A2CA 3SCNA 2Z1KA 3PZNA 1H11A 5FIPA 4UQEA 1ITXA 1CLVA 2XPKA 1MW0A 1B1YA 1UQYA 2GUYA 3CUIA 1WZLA 1MQRA 2GFTA 4HPHA 3AROA 2O9PA 2VCBA 1P6WA 1MVYA 3ZJ7A 3ZJ8A 1US2A 5BRPA 4EAMA 1FFQA 1UH4A 3AFBA 3WQWA 1ISZA 1VENA 4MNLA 1GZJA 3VIOA 5DF0A 2ZXBA 5HXMA 3BGAA 4DWSD 2XVPA 5A3HA 4XZWA 2WK2A 2NT1A 5CPQA 3ARRA 2YBUA 1XH2A 4TVUA 1XRVA 3WQ8A 4CD4A 1X6LA 1HL9A 4JAWA 1UKTA 2FGLA 2G3IA 5FKYA 1M53A 3ZR6A 3RM9A 4FF5A 4V27A 4B3LA 2D3NA 1QHZA 4H8HA 3FW6A 4HPGA 3VIHA 2XWEA 3LPGA 1V02A 2XSBA 1EDQA 5CQ1A 5A6SA 4MDOA 1UKQA 1JFHA 3GH5A 2PF0A 1MXGA 2XIBA 4GXPA 4H8VA 4TTUA 2WNWA 2WCAA 1D7FA 5I78A 2WMIB 3AIBA 2F61A 1JI1A 4BQ2A 4AD0A 4CU8A 1VFOA 1IV8A 2UWFA 1JXJA 5D9NA 1OM0A 2X09A 2YA1A 1CXIA 3W28A 3BCFA 3WENA 4BF7A 3VGEA 2D20A 5ABGA 1JYWA 1LLOA 2ZX6A 4M1RA 3VVGA 1E5JA 1NQ6A 3WD0A 4K68A 4P7RA 1H0GA 2YL9A 1UWUA 5C70A 4UQAA 3GXFA 4PRWA 1O7AA 1HN1A 4D6EA 1OT1A 1VFMA 2WKLA 3F5JA 1C91A 3AHZA 3CUFA 2O9RA 5IFTA 1VEPA 1TMQA 1IZJA 7TAAA 4JFVA 1C3FA 2XIIA 4Z2JA 3QOKA 3WD3A 2XFFA 4AZIA 1ISWA 2XGBA 3DHUA 3GNOA 2E8ZA 1JXKA 4PCTA 2HVMA 1H0IA 3VDHA 3WFZA 3WEZA 2X1IA 3VX1A 2CXGA 4ATLA 3CZLA 5I0DA 2E4TA 2VI0A 2W63A 4PYSA 2FH8A 4OUEA 5CZKA 1GORA 3GXIA 4DWSA 1UKOA 2DSUA 1W3JA 4U5KA 3ZSSA 1WNOA 1JZ3A 1E3ZA 1JDDA 4CN4A 3KE0A 2ZXQA 3OGRA 4H7VA 4ATWA 3TTSA 2VQTA 3HMCA 3W26A 4A3HA 2XM2A 2PWGA 3GYCA 2WHKA 3ZT6A 1EA9C 2JEPA 4JCLA 3ARZA 1KCLA 2D2OA 2VC9A 3EDFA 3FHAA 1CZ1A 3RM4A 1VBUA 2YL8A 3EMQA 2OYMA 4XX6A 1V3IA 4EANA 3WH9A 2FHBA 4FLQA 5I77A 3NJ3A 1O6IA 5A8MA 1BQCA 4AD5A 4TX6A 1V0KA 2ZWYA 4J7RA 3SIMA 1HVXA 3W27A 1I75A 3VUPA 3VMNA 3VD7A 2JEQA 4S3KA 4W88A 4OZOA 3WQ5A 1ISYA 1BF2A 4LYPA 1ZBKA 2Y24A 2YDRA 2YA2A 3GM8A 1W3LA 4MNJA 3VMPA 5KEZA 1DHKA 3BAWA 1FOBA 2XWDA 3NDZA 3OA5A 4M80A 1KBKA 3MUZ1 3SUVA 3AOFA 5JBEA 2ZUVA 5LA2A 1XH0A 4UFKA 3T09A 1E4IA 1FA2A 1G5AA 4UQDA 5A94A 3A4XA 2OWCA 4CU6A 2E3ZA 3D5HA 4W86A 1AVAA 3L2MA 1ESWA 4WF7A 1ZBVA 1XD0A 2VQUA 4MB3A 3GBEA 1OSEA 4AEEA 3QHNA 2XVKA 1QNQA 2DSVA 3VOCA 2EJ1A 1R7OA 1VFUA 3ARUA 4MNKA 1MYRA 3VGGA 1E6QM 1KB3A 1E1FA 1AMYA 1H49A 2YDQA 2G3MA 3WKZA 2XVNA 2VCAA 4QLKA 4DM2A 3WMCA 1BTCA 3VDCA 1PAMA 4KH2A 4GKLA 4W87A 4Z2LA 4Y7EA 1L8NA 2BXYA 4M82A 2CKRA 5A8PA 3U5YA 1WDSA 1U33A 4B9YA 5BYWA 3VGFA 2W5FA 5HPOA 1WO2A 2OSXA 5GNZA 5I6SA 1UHVA 2WVVA 5JBFA 1S46A 2WXDM 2FHFA 1U30A 4NI3A 2J7HA 2J7DA 5CSYA 2BVTA 2J4GA 4QDMA 3B9DA 4E2OA 3HU7A 2ZXDA 2DH3A 4ZE5A 3VGBA 3EDJA 5BXTA 2CKSA 1E4NA 4UFJA 4AYSA 3VX0A 2DQXA 4WLCA 3VD9A 3UG3A 2EPLX 1VRXA 4PMNA 3VIMA 4D6CA 4P7OA 2VX6A 1DEDA 5D9PA 4NRSA 2VTFA 3K8LA 1JNDA 3CPUA 3CZKA 2EPOA 2A3AA 1HL8A 3AYRA 3GTNA 5FD0A 2D0GA 4RE4A 4JL2A 3WNMA 5F7UA 5ABFB 2OWWA 1ITCA 1WPCA 2UY3A 3PZMA 5I79A 1FFRA 1B3XA 3WN6A 1K9FA 3AMKA 1W1PA 3DECA 5IDIA 5CLTA 3AS1A 4KMQA 1GQIA 5CJ5A 3UETA 1HT6A 1QNRA 4V28A 4BS0A 3T2OA 1E9LA 1B3WA 5CGTA 3AMDA 4J27A 3BSGA 4UOQA 1OGSA 1JZ5A 2O92A 3M46A 1PIFA 5M5DA 1BYBA 1J11A 1B3ZA 1HX0A 3RCNA 1KWKA 2YL5A 3VIKA 4GI9A 5FCZA
chains in the Genus database with same CATH superfamily
3BXWA 1W5PA 3URQA 3DYOA 4PL1A 1UP0A 3KEHA 2OZ8A 3P3BA 3WEMA 1FWHC 1TVLA 4CD8A 3NEVA 3ERPA 4HNUA 1E9YB 3O5GA 1GJWA 2XGIA 1ONXA 2A1YA 2QPXA 5CBJA 1EOKA 4QGCA 1FCBA 4ZXOA 4YCOA 1QASA 1H5YA 1VAHA 5J6EA 3H2FA 1W3IA 3LHWA 1FH8A 1EDGA 5FOOA 1E0UA 4O4VA 1W3TA 4XAYA 3PJTA 1LWHA 4C65A 5BXRA 3QJAA 1XDMA 3HGSA 4KCVA 1Q7QA 3TCEA 3TROA 3S6TA 3GG8A 1D2KA 5T26A 4IL2A 2J13A 1GPFA 4IG2B 3DG6A 3FKRA 2R1MA 2AL2B 4AZCA 1H09A 3DCPA 3IV8A 3ZOAA 4JFSA 2ZICA 2D0HA 3NQFA 1GKPA 1XIGA 4H9TA 4LRSA 3L12A 5HJYA 4O1EA 3KP0A 3M6YA 2Q8LA 3LLFA 1ONWA 2J24A 4HKPA 4WCJA 1Q7MA 4J3UA 3FYOA 3CL8A 4IUGA 1AUSL 1TMHA 3W6MA 5KINA 1SW3A 5XIAA 2BY0A 4EKJA 1HTIA 3WH6A 4YS1A 3W83A 1NWTA 2QV5A 4IMGA 4LW7A 1QPOA 1W31A 4R7OA 1QRQA 4O8AA 4LB4A 2GSJA 4IGHA 2E8YA 4N0RA 3LZ5A 4IX2A 2V3EA 4GY7A 3TEVA 4ACYA 5I5RA 2DQWA 3H4WA 2XDFA 4GO9A 3N2XA 1H7XA 2Q3RA 2CHOA 4E4UA 1WX0A 4LANA 3M7WA 2A2IA 2LKNA 2B4GA 2XN1A 1TVNA 2YR1A 4WQ6A 1X96A 1T11A 2E25A 2VT0A 2WWDA 3EXTA 1BHGA 4CNNA 3BTNA 1JCNA 4B2DD 1KFEA 2WBGA 2X1RA 2J8GA 1ONRA 3ZQ9A 4S1FA 3PBWA 2XP9A 3B4YA 1YRRA 4Q7IA 1A50A 1NU5A 1G1YA 3LENA 4D1IA 3W6LA 2PDQA 3QGKC 1E4LA 1J01A 3VNZA 3WD1A 2XIOA 4DJFA 2ZA3A 1ZK6A 1S5WA 5BMXA 1HQTA 4JNYA 4TQTA 5D03A 1BKHA 3PG9A 3BW2A 3GDRA 3GDLA 5TF0A 3G8RA 3VPLA 5A6KA 4BQ5A 3G18A 3OG2A 4NNBA 3GTHA 3BJTA 1EPVA 1SO6A 1JIBA 3OTRA 2NVAA 1VJZA 3REQA 1EJ7L 3GU9A 2VO5A 1A5SA 2R14A 3VM5A 2VRJA 4AD3A 3HPXA 3FY1A 3CWOX 3BANA 2ZX5A 1UZDA 3WSUA 1RCQA 3M16A 3IIXA 2YZ5A 3LUOA 3TTEA 2BNJA 3UR5A 4IX0A 5EMYA 3AIRA 3GD6A 1VR6A 4AIOA 3B7XA 1DWFM 4N02A 1EFZA 4MGGA 2Q01A 1J79A 2ZRYA 2RUQA 1GTEA 3GR8A 1IGSA 3INPA 1XJBA 4AVFA 1QHPA 2J27A 4F0SA 4GWEA 4DUWA 3OGSA 5FJIA 3GS6A 1KM3A 1FKJA 3ABXA 4UFIA 1S1RA 1BPLB 4R53A 3COTA 1J0KA 4MIMA 1R9XA 3O6CA 1E1CB 4HPXA 1F76A 3RPTA 3LCLA 1IEXA 3P2VA 1IEQA 4OV9A 1OFEA 2GK1A 3QYQA 5TBOA 3C52A 2J8FA 3R11A 3L65A 5IFPA 3LI0A 1KW1A 4KETA 3I3DA 5DMLA 3IVSA 2D22A 1KWGA 2OYLA 2OTDA 1HKJA 2WCGA 1FCUA 4Z1BA 5H6HA 1FWIC 2QCNA 4PMOA 4D71A 2ISFA 1BQGA 4KGJA 2WZMA 3W86A 4C6DA 5REQB 2FTPA 4DO7A 1CB2A 3LA4A 2MLYA 4XKYA 4R5EA 3MBFA 3BVJA 2VD8A 4XQ6A 2EO7A 3OZPA 1EDTA 3HGJA 3O63A 4NJHA 1BXCA 1H7PA 3PSWA 3HPFA 3BG9A 4JIQA 2FZNA 2KR7A 1VYSX 4KRZA 3T0BA 3GNDA 4ZFCA 2KGJA 1YXCA 4U5IA 3I6RA 4W89A 2Y5EA 3WBEA 2PDXA 1JDAA 1ISVA 4PSRA 4DF0A 3NSNA 3N11A 2BVDA 2WVVB 3SSZA 3MS8A 3BOXA 4Z1DA 2DJXA 1Y65A 1MW3A 4R0XA 1DQUA 3CQ0A 1HO4A 1MZHA 2PTDA 4ZBCA 2ISVA 3N19B 3KOWA 4HOZA 1AZ1A 3F4NA 4UTLA 4XAPA 2BHUA 5EFDA 4M7TA 5JH2A 1CPUA 1YQ2A 3T7VA 3QMSA 5HW8A 3Q58A 3RX2A 1FXPA 3TONA 1IXQA 1W1YA 2CESA 1BGAA 3KDNA 4K39A 5DLCA 1R2RA 2EF9A 2VURA 1RHCA 3A4WA 1E56A 2QGYA 4OOUA 3CZ8A 3O5KA 2E7FA 4DZIA 1N7KA 1GOKA 1ECEA 3TN4A 5AHMA 3NYDA 4LT9A 3B8SA 1K7FA 5D2XA 4Z2KA 6CGTA 3CEUA 3Q67A 4I6KA 3MZ2A 1JVNA 2WOQA 3APYA 3ZT5A 3OA3A 4GVHA 4J9JA 3EMZA 4C6MA 4LTSA 1FVPA 2PWVA 4DB7A 4W4QA 3V5CA 1QW8A 5AHNA 1X7FA 2G4FA 5G4HC 1BYDA 4G9PA 1O66A 4PTNA 1D7KA 1SFSA 4DPPA 1PEZA 2DU2A 1G94A 2OEMA 5KTLA 1E51A 4NXKA 4P7NA 3W7EA 4F9JA 3DU0A 4IIHA 1WXYA 4DBWA 5E6ZA 3MCMA 4CNSA 1CX9A 3QTPA 4LCSA 1PWMA 1EGVA 2VYOA 2XH7A 2PPGA 4UR7A 1US3A 5I98A 4Q7BA 1J4RA 2EPMX 3TWBA 2E9BA 4Q8PA 4U86A 4JOMA 1R47A 3SCTA 5BWFA 2NXHA 3MP5A 2XJ7A 1C93A 3MYOA 4DI8A 2EG6A 1CXEA 2ZOXA 4B5UA 1FHUA 2EKCA 1NFPA 1QW7A 3KL0A 4QTGA 4KCWA 3BWWA 3BLOA 3AHXA 3NQCA 3KBWA 3SSJA 1PXGA 4FNQA 4I9AA 1G4PA 4LF2A 1XSJA 4GQGA 1V3HA 3K13A 4GGQA 3VI2A 4BFAA 3UG4A 3PBMA 3M0LA 2NVDA 3L4XA 5HANA 4QNWA 2D1ZA 1E0XA 1KA9F 3W72A 5AY7A 1H1NA 3GTFA 2WMHA 4AZCB 5AZ0A 2NQ5A 5FA5A 4OT7A 1E9IA 4ITZA 3ZLHA 4GQRA 3M44A 3OLIA 3DFYA 4XUYA 5U7SA 4KQZA 2C91A 3VIIA 3VU2A 3M0KA 4JTCA 4UQBA 2DW6A 4FAMA 1RBOB 2A7PA 4ZGYA 4YCPA 3O5FA 2HBXA 2OX4A 4S3JA 1XRTA 2X0SA 3UXKA 5FF4A 3SJNA 1S2AA 4PMVA 4BCEA 3QVQA 1TTQA 3CGNA 3A3XA 3PUEA 1ZB5A 1YDNA 5EYWA 1XIMA 4Q8MA 2YFOA 1UZ1A 5HWJA 1V0LA 3VKKA 4NZ4A 2GGJA 4XAFA 4JHOA 3USZA 2DZPA 4PTXA 4NZCA 3DXIA 1L6FA 4XZNX 3MMTA 3QHMA 3NQ2A 1ADOA 1EIXA 1QK0A 3NUKA 1FKGA 1JUKA 1BF6A 2OOGA 3ITVA 3EPOA 4Q33A 2ZE0A 3LXCA 3VNLA 2FGZA 5D4YA 3PA7A 4GG9A 3LS9A 3KCJA 2IXVA 4QISA 2XP6A 4P8VA 3CXOA 3BL3A 5MF5A 1Z42A 3ARWA 2ONEA 4Z0SA 3RYSA 2WAGA 1VD6A 3N18A 2R8WA 2V2CA 4CQ8A 4MFEA 1JNEA 3RFAA 4JHMA 2YZRA 3ZSTA 3GR7A 1RZMA 4MOZA 3MZNA 3NTYA 2ZUMA 4DO6A 3CGTA 3WQGA 3W1XA 3IUIA 1WCGA 4JIRA 3E0IA 4TTGA 3C61A 2ZQTA 1UIOA 2PLMA 1PHQA 2XN2A 1VCVA 3VGDA 3PZ9A 2V63A 2VRKA 3CLMA 3VDAA 1XIHA 3THDA 1FKRA 3KBMA 2QCEA 3XIMA 3EWDA 4FAPA 2KI3A 1E9ZB 2QQ6A 3PJWA 3REQB 2WV8A 5B80A 1OGBA 3E9AA 1BAGA 4BQ4A 2YDSA 4AEFA 2O4QA 4UDMA 1HVQA 3EIPA 2F7FA 4HMCA 4IFOA 4L1XA 1Y7VA 1J8VA 3LPPA 2R94A 4NU7A 4XVDA 5CZJA 1EIBA 2PDHA 4IIBA 4CUCA 4AIUA 3K1DA 1LG1A 7CGTA 4IP5A 4Y96A 3SCQA 1KLYA 3KX6A 3MMUA 2ZFAA 2RUDA 4X0NA 4IIEA 1SO4A 4FLSA 4QFUA 3GDBA 3E3HA 4J3VA 3RITA 4E5TA 2W61A 4GE8A 1W1IE 4HSNA 5TD4A 1OC7A 4U10A 3HPZA 1QPLA 3U5UA 1M03A 4JTIA 4X0VA 3E74A 4H41A 1WDPA 2YA0A 3OLDA 4GABA 5CSUA 2C7FA 1CLKA 3B03A 1XLEA 4X3ZA 2FKEA 1C9HA 1CLXA 3KOZA 4AZ7A 1EYMA 5AKQA 3G24A 3K46A 3S83A 1X7IA 3C8FA 2GK1B 4MKVA 2JK2A 5A8QA 4PB3A 5C7VA 4ORMA 3CPRA 4B5TA 1K9EA 3AS3A 4JFWA 2XSXA 1ZBWA 1LT8A 2VRQA 4M29A 5J8LA 2QDEA 5AHLA 1IR2A 1GZGA 4H4IA 1Z32X 4GACA 3UYIA 2P8CA 3SGZA 3HQOA 2ANUA 2ISSA 4UTHA 1W1ZA 1QI2A 3CV2A 1TPC1 2YL6A 5MKGA 3NM1A 2C3ZA 2HXTA 3FAWA 4GX8A 2IKIA 3B8WA 1JG9A 4UTUA 3N9SA 3NWRA 1PX3A 1FKSA 4IT4A 2VX5A 2YKKA 1JZ8A 3RO8A 4H83A 3WQ6A 2MLXA 4GIEA 2WC4A 3RDKA 5DO2A 3KRUA 3MV11 3FDKA 1MUCA 3OB8A 1H7WA 4F0RA 4I9TA 4FXRA 3EYPA 2CW6A 3LEPA 1UOZA 3GVVA 3IKDA 3TLLA 4I5XA 3T0AA 4KGLA 3WUGA 3RRAA 3URBA 3EDEA 1MXDA 4YPJA 3P6LA 4B91A 4Z2HA 1XPYA 2ZQVA 3CQJA 3LY0A 1PDZA 2P4VA 3VM7A 1EO5A 4Y9OA 2ISWA 2Z1XA 3SRHA 4QLJA 1PTGA 2QVHA 1V8EA 2DIEA 2VX7A 4NF7A 3EX1A 2VUNA 3B8TA 4AC7C 1OYBA 2G3NA 3TX9A 3TYEA 2WZHA 1NWRA 5DEZA 1KRMA 2BHZA 5C2XA 3CWHA 1KXVA 3BPWA 5AVNA 1N8IA 4FHAA 3VO0A 4W5ZA 1F5ZA 3O06A 4H9MA 2WMIA 3TWAA 2W67A 4FR6A 2J75A 4PUMA 5FF2A 3O15A 1E5NA 2N87A 3OHMB 4JS3A 1XIFA 3SUTA 3S5NA 3BAKA 3ARVA 1FKFA 1AODA 3WLIA 5IDZA 2RQSA 4PBEA 4DRQA 4O19A 3GYEA 1Q45A 3BQ6A 4JN6A 4ZXLA 3ONBA 1WDQA 1JD7A 3BG5A 3SUWA 1WBJA 3WD4A 3MANA 4HD5A 4Q6XA 4XG1A 3YPIA 5K9CA 1KO0A 4GGBA 1OCJA 3W22A 2PWUA 4Q8OA 3G1AA 3WJXA 2CLHA 1FXQA 5CC3A 2JF7A 1Q6GA 3RU8X 3H55A 1R86A 1J0IA 2JALA 5DANA 4LAMA 1NP0A 3AMGA 2HK1A 3WUFA 4HNVA 5FSDC 2PDWA 4TX9A 5A5WA 1ME8A 3ZIZA 2VNCA 1R9ZA 1GK8A 3H9RB 1TX2A 3O8AA 3KBSA 3ALFA 1TPUA 1LBMA 2I9EA 4FR1A 4N4QA 3SECA 1XHGA 2IQTA 5I02A 3I10A 3BO9A 4PH6A 1LF1A 3LLDA 2PTXA 4Q4SA 1QDSA 4TVDA 5XIMA 5JQ9A 4MLJA 1RP8A 1B6CA 1GOIA 1PINA 4GY0A 5D2VA 2GQ9A 2IKHA 3U48A 1NH6A 3EOEA 3LQGA 1HKWA 4GYJA 3TAKA 3RMEA 4HA0A 1KM1A 1XLCA 3G1HA 3LTYA 1CEOA 2XVGA 2YSWA 2XP5A 3Q65A 4LEQA 3TOPA 1ROUA 2DZAA 5HNTA 3H26A 1G7VA 3OBAA 4NT0A 5BXJA 3E2SA 1JCMP 3WY1A 3LHTA 1XUZA 1HNYA 3N34A 2PDMA 5C54A 4X61A 1V7AA 2J25A 1MFUA 2ZRZA 2R1KA 2VEIA 3AWNA 3CS2A 3MI3A 4U2YA 2HZGA 2INFA 3SCSA 4M81A 5AC7A 5JXQA 1XKJA 1M5YA 2B7QA 2NSOA 4QRNA 4INFA 2RGLA 4KWOA 3EY6A 2QF7A 1JD9A 1O5RA 3IJ8A 3GAYA 1ZS2A 4LAWA 1QPQA 4X2RA 4DHGA 1JPHA 1UD4A 1XISA 3V7PA 3S6DA 1TRIA 4FF7A 4LAXA 3H12A 4HHLA 1LBFA 4AY1A 3S5YA 3TN5A 4RLIA 2VC6A 3U4FA 1GG1A 3UZZA 4DELA 1LJYA 3NDYA 1IZCA 2ATSA 3HJEA 4UWMA 2DIJA 4LV4A 4N6FA 2V82A 1UMLA 3UVIA 3V4BA 1TUFA 3T4CA 3E0WA 1VIZA 3W24A 2GJRA 2ZXAA 1HUVA 1UOKA 3MJYA 5F4SA 1X1NA 2WMKA 3UZYA 4O13A 1F6PA 3VOGA 3C0SA 3UWVA 3KOFA 4UR9A 4A2SA 1F8MA 4BEUA 5GNXA 4C6KA 5E0CA 5H8PA 4FLOA 1M3UA 2Y8UA 1ME7A 5E09A 3TN3A 1AH4A 1BWKA 1O12A 5DELA 3AXHA 3GIPA 4Z42C 2XH2A 1L1PA 3UZJA 3UI5A 1GOWA 2CFFA 3UA3A 5HULA 1JL8A 1FDYA 3F4VA 1TRDA 4RCXA 1HJQA 1NF7A 2WVTA 3U4AA 2PLCA 3CUJA 2AL1A 3PY2A 3O0KA 3TDFA 3ABZA 2HK0A 4C6BA 2A4AA 1VKFA 1QATA 4AMAA 4E2VA 4GFSA 3TJ4A 1HJUA 4DRHA 3WDHA 4QEEA 4PCPA 4U3CA 2CETA 4DZ5A 2V5KA 1VCGA 3RLVA 2FH6A 4ROQA 2VEKA 2YXOA 1ZP4A 4ZENA 3URNA 9RUBA 2RKXA 4NAEA 1R3VA 4JYEA 1K3UA 1IEWA 2XZ7A 1QK2A 3GVWA 1XLHA 3A24A 4Y9PA 4E38A 2QF8A 3E49A 4C6JA 4QIBA 4RZ5A 4L6OA 3QFWA 3TSDA 4PCFA 2WHJA 1GVYA 3N25A 4TO8A 3FXYA 1KM6A 3UCDA 4D1JA 4JQ3A 4WGXA 1KM2A 1GW1A 3LHVA 1A0DA 1CGUA 4ADSA 2Z1WA 1SMAA 3K1GA 2QJHA 3R4IA 1SPQA 3WX7A 4GPNA 4JKLA 5IBXC 3W1QA 3IVUA 1XH1A 3IGSA 1Z6KA 3K8MA 4MWAD 4UZUA 4D6GA 5D02A 9CGTA 3ZZ1A 4GYPC 1Z48A 2XIMA 4DXVA 5LA0A 1RCOB 4NL1A 3WLOA 1O1ZA 3E0VA 4F9DA 3B06A 4TXEA 2G3JA 4EK7A 1EJXC 2ZTKA 4JQ2A 3ES8A 1WQ5A 6TAAA 3IAPA 3GDMA 3UNDA 1AL8A 1I0DA 4GNKB 4HMNA 4LB3A 5B8IC 3H8AA 3ITXA 4LF1A 5U4NA 3VOFA 3WH5A 1EL3A 3MTWA 3P67A 4G7EA 4ZQNA 4MYXA 2PWFA 4CN6A 3N6HA 3ZM8A 1E3XA 1LORA 3G6LA 1E43A 1H50A 3EBVA 3W88A 4ZOBA 2WANA 1FUYA 5HUAA 2V67A 1GYNA 2J88A 4YL2A 2WJZA 3ZWTA 4B9ZA 1SZEA 5MKGB 1IT0A 5C9RA 2MNRA 2OWXA 1VZWA 1FKWA 1KM5A 3LHUA 5T91A 1A49A 3PZNA 1A4MA 1TREA 5FIPA 4UQEA 4JX6A 5B7YA 3NI6A 3EAUA 4ZPTR 1B1YA 3DEQA 4DI9A 1MQRA 3T81A 4ODNA 2VCBA 1W0MA 2PLKA 1P6WA 1V51A 4H8NA 3ZJ7A 1K4HA 4LUJA 3MCOA 1PKYA 4JTKA 1M68A 1FWEC 2PDCA 3BGJA 1M1BA 2WKJA 1FFQA 4XO7A 4GJ1A 1VENA 4MNLA 3UWWA 2V9DA 7REQB 3KUMA 2ZXBA 4ERIA 1EJUC 2WK2A 3JXVA 1UPPA 1OK6A 2YBUA 4N2YA 2GVLA 4IQ2A 1X6LA 1M5WA 3LBCA 2FGLA 1A5OC 5FKYA 3IKGA 3N2CA 2V5JA 4V27A 4JTEA 2K8IA 2OZTA 4KBXA 4LBUA 2BOFX 1RA0A 1A5MC 1DXEA 2GSHA 2QJMA 5HWMA 3LPGA 1EDQA 3FEQA 3P82A 3M41A 1Q3NA 4FALA 2HTMA 5KMYA 1EP1A 2XIBA 2ZQSA 4GXPA 4B90A 5I78A 2G4JA 2WMIB 1KV8A 3AIBA 4GMEA 4UR8A 2ZDRA 2NQLA 1HGYA 3F1QA 4ILSA 2PN0A 2UWFA 4DN1A 1F3EA 3PWIA 2YA1A 1DJGA 1IYXA 3W28A 3ZLFA 3BCFA 3WENA 4WDXA 2I9UA 3VGEA 4QEHA 1ICPA 5BOEA 3NPXA 5J5RA 4K68A 4LUIA 1U1JA 1Z8AA 2X1UA 4UQAA 1EF3A 3PAOA 5DXXA 2P3ZA 3P60A 2OXNA 4D6EA 5KETA 4MZ1A 3OVPA 1TV4A 3HGOA 1AFSA 2WKLA 3F5JA 1DPMA 4KS0A 4NHVA 2HJPA 2JKEA 5G2HA 2O9RA 5IFTA 3HBLA 1IZJA 4JFVA 4MHBA 5EBUA 2XFFA 3GNOA 3IEBA 3F2BA 3QQ0A 3WFZA 1EX1A 2CXGA 4NJKA 3PBYA 7PTDA 4PYSA 5CZKA 4DWSA 1UKOA 5FJTA 1KBIA 1D7HA 2FYMA 2WZTA 1JDDA 4IPIA 1I9CB 4ATWA 1JVWA 5D2WA 2VQTA 3M0VA 2QCHA 3GYCA 3ZT6A 1VPXA 1EC9A 4IXHA 5FF0A 4JCLA 3NQ7A 2D2OA 2NUYA 1QUMA 3LSBA 1CZ1A 1VBUA 2QR6A 4O14A 3EMQA 2OYMA 1V3IA 4EANA 3BLIA 3G1SA 4K38A 5FACA 5E5CA 1WV2A 1Z7AA 3GK0A 3NJ3A 5I00A 1FWTA 4CQBA 3U9IA 2ZWYA 1H7RA 1GYLA 1K8ZA 3IJDA 1HVXA 3W27A 2HS6A 1FRBA 4JEJA 5C9XA 2V81A 3GZ3A 4S39A 3STEA 2ZADA 2Y24A 4GHRA 2QAPA 3ZYZA 3WJZA 1W3LA 3ORWA 3SB0A 2YCLA 2HPMA 1MDLA 4K36A 4IMFA 1WBHA 1AW5A 3SUVA 2ZUVA 1TB3A 5LIYX 3FLUA 1DIKA 3KDOA 3T09A 3A4XA 4CU6A 2E3ZA 3D5HA 4KFPA 3FDGA 2CC0A 3IUDA 4WF7A 3O5OA 3GBEA 3V5FA 3QHNA 2XVKA 1OFDA 3VOCA 3LHYA 3WQEA 1VBHA 3P93A 1MYRA 1TV8A 2RUSA 1V5XA 2ZRWA 4N4PA 1E1FA 1PTDA 2DW7A 4QLKA 2Y70A 4JGDA 3UT0A 3VDCA 1TR9A 1RJPA 1XBVA 1HW6A 4YVVA 1JQXA 3U5YA 1WDSA 4JXCA 4J40A 4LS1A 2W5FA 1JUEA 5HPOA 2OSXA 2Z2AA 1UHVA 3TFXA 5JBFA 1S46A 3OP2A 4YYFA 3T44A 3JYJA 3EA3A 4QSHA 3U2CA 2FQIA 4RXFA 2J7HA 3TYDA 4K2SA 3QTGA 2V30A 3PFRA 2G96A 3VGBA 3EDJA 5DBTA 1AD1A 3LCIA 2C71A 1ME9A 2WM1A 4AYSA 3VX0A 4WLCA 1WKDA 2EPLX 3CPGA 4GYFA 5D9PA 2VTFA 3CZKA 1VPYA 3UJRA 3AYRA 3GTNA 3HFTA 3UJSA 1G4EA 5I03A 1ZNNA 4J1OA 3QR1A 1EJVC 1U1UA 4NAEB 2GZXA 4RE4A 4RDYA 2ZZ4A 2P1FA 1ITCA 2YDAA 1TIWA 5HQMA 2ZR6A 1TTJA 1KKRA 2UY3A 3PZMA 2H9AA 2VM8A 1JCTA 1B3XA 1VC4A 3WN6A 5F2GA 4O2TA 1D9EA 5TIMA 5KZDA 3XISA 4EVZA 1SO5A 2I14A 3OQEA 3UZ5A 3IIZA 1OZQA 1B3WA 3AMDA 1ZP3A 2G3FA 2PTWA 4PC8A 1PIFA 1BYBA 1B3ZA 1HX0A 2ZTJA 5FJUA 2YL5A 4GI9A 3PPGA 3CIXA 2OEJA 3AXKA 2IS7A 1R9YA 1PKLA 4QP0A 4GUGA 1FHLA 3ITLA 4RNFA 4AZGA 4L4PA 2Y7GA 5G1MA 1J12A 1MW1A 1K4GA 4HNTA 1KFKA 2YX0A 4F0KA 4UFLA 4AG0A 3MYPA 2EXOA 2NXIA 4CCDA 4Z2IA 3WEOA 2CITA 3UPBA 3IAQA 3WH7A 3VD4A 1VRDA 4G7EB 4L64A 3H6OA 3UD6A 4KEZA 4LH8A 1XLJA 3PB2A 4U2ZA 2CXEA 1NEYA 1JF5A 4ADTA 3LCFA 4OGZA 4HPNA 2XN0A 4FN2A 3GUGA 2PD5A 8TIMA 5HPCA 2H6RA 3RCYA 1W9UA 1A5NC 4MWAC 5AC4A 2HNEA 3SQMA 1NWSA 4MSPA 4C60A 2UY4A 4KESA 1M01A 3SRFA 2BVYA 1F9CA 4OV4A 1FBAA 1DJWA 2NX1A 5AYBA 1VYPX 3FXGA 3NQDA 1OX6A 1XDJA 1W2VA 1JYVA 1E44A 3E38A 4QDPA 2F6XA 3TV8A 1XCWA 1KGWA 3EB2A 2VMFA 4QAIA 3ICJA 5EMLA 2WC7A 5DT7A 4KCUA 4Y9MA 1E6PA 5LNUA 3RJXA 4O1DA 4O54A 3U8GA 4O18A 1Q7ZA 4QCFA 1OB0A 2ZZ5A 3H7VA 3E2RA 4PEKA 1A3HA 1Y5WA 3OGVA 1KM0A 3BW4A 1KFWA 2O7SA 4QJ1A 4AY8A 3LGEA 3N17A 3LNMA 4GIAA 1A4LA 2BY3A 2GL5A 3D3AA 1GTHA 1GVIA 2G50A 3AHVA 4IPNB 3L5LA 3NZQA 4BF9A 1SYTA 2VDGA 1GT8A 1KR0A 3SY1A 3C2EA 3QBUA 3H4XA 3CLWA 3VYLA 3C2YA 3QGVA 2UY2A 4AD2A 4PUJA 1M9HA 4NNAA 3MSGA 1XYMA 1ZUAX 1WE5A 3N3MA 3KRBA 4NZJA 4QDWA 3TZFA 4GIRA 2DGAA 3DG7A 1POKA 4GUJA 4PUEA 1TWIA 2ZVRA 1JDCA 1I1WA 4M5PA 1AQ0A 3OHIA 4E8GA 4GZJA 4ZO7A 4MF4A 4UFMA 2FGBA 2GSEA 2CLLA 3RN6A 4ES4A 1GPWA 2JGQA 4L4OA 2V3DA 3W2NA 4K6AA 3KP1A 2CLFA 4XD5A 1W9XA 4AC1X 2C13A 4WY0F 3ENLA 2EPNA 1KLZA 2VR5A 5FJRA 3IUHA 1D6OA 4M6UA 4LBRA 4DY1A 4J28A 2DP3A 1FJDA 4LRTA 3KAHA 2CIPA 3IJLA 1RPKA 1XRFA 3GKFA 3NO3A 3UQIA 1UQZA 4GH3A 3WJYA 3TXVA 3UXAA 3OQ8A 1UYQA 3LN3A 3SURA 1VFHA 1HKMA 3VKCA 1SGJA 3PUGA 3O5MA 3DESA 2E9MA 3VC5A 3UXLA 3KVMA 3TAOA 4DRPA 3PVFA 3B40A 4DWSB 3KLKA 5IBXA 5I3KA 3O6DA 2PV3A 1TV3A 4GOAA 2PDLA 3VCRA 3F2CA 4A3RA 2TODA 1BYCA 2X30A 3MV01 2IQDA 4UOZA 3TYAA 2PWHA 3FYYA 1XL9A 1TPVA 4DX3A 3CC1A 4DLMA 5E0FA 3T4WA 3EDDA 3UR8A 2PRLA 2B81A 1LROA 4OBTA 1VHCA 4UFHA 2D69A 3TXZA 3WD2A 5F2MA 1X6NA 2BMBA 1NIUA 1CYGA 5BXPA 4XWUA 2DIKA 2XZ9A 4UTTC 4S38A 4KCTA 2R6OA 4RE0A 3UWQA 3L66A 3P62A 3IJ6A 3T1GA 1YPFA 2EEXA 4L6HA 2CBVA 4JTTA 1SMDA 4HNCA 1J93A 4XIMA 3V0SA 3H53A 1KTBA 2CLEA 3G6MA 1LRQA 2VKZG 1HGWA 4PGLA 3EX4A 1CT5A 1DVJA 1TPWA 5AHFA 1K6WA 4F2UA 5GJPA 4FIQA 5DY3A 3CHDA 4JFJA 4M19A 4Q6JA 1S2VA 4RNHA 2YCLB 1A5BA 1FAPA 3GPKA 5E6YA 3AHTA 2QMJA 3W38A 1W56A 1D3GA 1F05A 2ZKMX 1ALDA 3CV1A 1J2WA 1W9VA 4NQ1A 1HXJA 3KCEA 5BOFA 3TMQA 4GJJA 1S5NA 2AAMA 2QULA 1L6WA 4OJYA 2VX4A 4H2CA 2CWNA 1HJWA 1VB9A 3L4TA 1WKEA 2PA6A 1ZCOA 3GU2A 1R46A 3GXDA 3QC3A 1BL4A 5CG7A 1HL2A 4WDTA 2VR2A 3V35A 3WQ4A 4F79A 1JDFA 4UTMA 3O5EA 4JFKA 1SUXA 4DJDA 3GR4A 1ZTVA 4ZQPA 1RY8A 3W53A 1OT2A 2AQOA 1V6VA 3T8QA 3CAQA 4LCQA 5HBFA 4PUDA 4DYKA 1XCXA 5LIWX 3W25A 4PMUA 5D04C 1ZU8A 1ROTA 1A47A 1FP8A 3ANUA 4J3ZA 3HOJA 1NQKA 3S0CA 3E0LA 1AW2A 4PCSA 4LYKA 3WFLA 4GXWA 2X16A 1M7PA 1J96A 4AD1A 3O0FA 1FHDA 1DJIA 4MKNA 3PN8A 2W62A 3S1WA 3BV7A 4MZ8A 1C8YA 2Z27A 1PZ0A 1OX5A 3EEZA 4N42A 3LD5A 8RUCA 1HJXA 4GX9A 4HB7A 2DSWA 3DH7A 1OD8A 3U2EA 1W32A 3FX4A 4LYQA 4UNIA 1ZJAA 2H9AB 2NV1A 4FSAA 4DAIA 1E6XM 3C4UA 1NOWA 4JDYA 4QCEA 1CIUA 1JZ7A 3IJQA 4GZIA 4HMEA 5BRQA 1EH9A 2CLKA 2IPWA 3A5FA 2RURA 1T6MA 1YNPA 3TDBA 3STCA 2P88A 5HDRA 1W37A 5K7JA 1H2JA 1ZCCA 4G1NA 1TR1A 3W82A 2Z24A 3ZMRA 4WKAA 1J18A 4L9ZA 1JAEA 3QN3A 4FIRA 3BH4A 3WL1A 1NM9A 5CSRA 3UA4A 4IMCA 3AYVA 4QXIA 3H24A 2GLKA 3WLMA 1IHIA 4PMXA 2H3DA 2Z6IA 2KFWA 1Q6OA 4KKXA 1XLIA 4O4WA 4PUKA 3VZYA 4JN7A 3FNDA 4JX5A 2WSYA 5DX7A 3DERA 1E71M 2PTZA 4AEOA 3JYMA 3UF8A 2VVNA 2DZXA 2A3BA 1K9DA 5BMWA 4MDPA 5DRCA 2P53A 4WSJA 4C6NA 2FDMA 2BDQA 3II1A 3ITGA 1DQWA 3MI6A 1PCKA 3AZTA 1CGVA 3U7BA 1UIPA 2HE8A 1WOBA 3QZ6A 4HNLA 4IQCA 1VEOA 3H2EA 2BGNE 4HK7A 5HWCA 4HK6A 2ZIDA 3WO8A 3AICA 3KWXA 4G56A 4WY0A 2A6LA 2LLEA 4ZOAA 1R38A 1TUXA 2CZDA 3FVDA 4D6JA 3EPMA 1LL7A 1BRLA 4GJIA 1Z41A 3CHCA 2GDVA 2Y62A 1R30A 2G8ZA 1WDRA 4NX5A 2MANA 3U2OA 2D2HA 1XYLA 4FNPA 4CN1A 5AHIA 3NL5A 4L9YA 1C7SA 3LPFA 4WGHA 2YXXA 4PA8A 1NDZA 4LS0A 3A22A 2RJGA 2QNEA 2JFEX 1KGXA 1YDYA 1Q6LA 4KPLA 3P8IA 4GBDA 1BGGA 4L61A 1I8JA 1EJWC 3UJFA 5I06A 3TTYA 2VZTA 3PFMA 3OU8A 5DMYA 1EGZA 1YTKA 2QAFA 3RR4A 4ECLA 1PYMA 3QGAC 3W2JA 1AQHA 4CKQA 2R9RA 3GTIA 5AC8A 1Z89A 3MUXA 4DYEA 3I7QA 3AMCA 1UWAA 4LQ1A 1EYEA 4C1KA 5CC6A 3CB8A 4CLMA 4CNTA 1DIEA 1V0MA 1K1DA 1TPDA 3PRAA 2D2GA 3E5PA 4TV6A 1W5MA 4OKDA 3ODKA 2ZZ1A 3W71A 1MNSA 3R12A 3G0UA 1LG2A 3DBNA 5HUOA 5A6BD 3K5XA 3ISIX 2VL4A 3G5EA 3NEHA 3MB9A 3O6YX 3V1HA 3UR7A 4HOXA 3JR2A 3GXMA 4ZB0A 3ZLGA 4Q7NA 2GGIA 3JUGA 2Y78A 1VGAA 4YVPA 5BXSA 2AMXA 3NQGA 3LCXA 5BU6A 2VUYA 3T0CA 2VFFA 1CB7B 4CQ9A 3GDKA 3KS5A 4GIVA 2FZMA 3FJNA 1M7XA 5DQPA 3GX9A 3OZYA 5D9OA 2ETNA 2ZX7A 4J3SA 3IK4A 2GJPA 1QBAA 1WB0A 4WSHA 5LIKX 2XU2A 1SJBA 4LVFA 1MEHA 2J7EA 3OW1A 4R33A 5AOUA 1CECA 2Z1SA 3B4UA 4KFNA 3R7MA 4Q4MA 4PBGA 3FCPA 4BQ3A 3KOYA 4IICA 3QR0A 3L0KA 3A6OA 1UC4A 2DT3A 1YKWA 3ECQA 4RPQA 4AB4A 1MMFA 1V6XA 2QT3A 5DFAA 3SCOA 4KRUA 1FWSA 3V3WA 4B16A 2V6AA 3WFAA 2OQLA 4GKTA 1UUQA 5ABHA 4XAKA 4IL0A 4XK2A 2OJPA 4AW7A 1BVZA 1XLBA 3ZO9A 5A6AA 4Z1CA 5HW6A 1TG7A 3OJGA 3S5ZA 2PC8A 2YLAA 1LOLA 1W5QA 4XZMX 5D8ZA 3RPDA 3H21A 1S1PA 2A85A 3NAVA 1R2SA 4IJRA 3WBYA 3Q94A 3SW6A 1P0BA 1Q4NX 3OBKA 1DWAM 4JNZA 4H9UA 5TAOA 3BAXA 3QY6A 1D8CA 1TPH1 3CGMA 4RK8A 3POCA 3RK8A 4CD6A 3PR2A 1DHPA 3ZVIA 3B8DA 2MUCA 3S3GA 5AC6A 5C0QA 1AJZA 5A95A 4REQA 1Y5XA 4HZ7A 4CQDA 5AVHA 3GO2A 5F1VA 1TWSA 2WMJA 3WDPP 3VC6A 5CPLA 3TQ0A 1AJ0A 1DL3A 3AIVA 4MY8A 2WPGA 4GVFA 2IXUA 1IT8A 4MWAA 3OZMA 1GEQA 2VELA 2RDXA 1DXFA 1XWYA 4W85A 2RSEA 3N9RA 3HURA 3SIZA 3PS7A 2OCZA 3DAQA 4WOZA 2G0WA 1EO7A 3WMLA 3ZVHB 3F2DA 1P5BA 4M7SA 2ZBTA 2WJFA 4F66A 1W5NA 4LY8A 5H91A 1UP3A 4QT2A 5HJLA 2FVMA 2PDPA 2UBPC 3OLGA 3UWYA 2TPSA 1W3HA 4ZO6A 1NFBA 3R0KA 5DCDA 1O5XA 3NA8A 2QJIA 2PBCA 4CCCA 4IT6A 3AIEA 2BHYA 1FX6A 1OX4A 1F73A 1JRBA 3C3NA 4AZBA 2YPIA 2DT2A 3G1YA 1RV8A 2IMRA 1P7TA 3HFYA 3MKCA 3M0HA 2PCQA 3LX9A 1QNVA 1UD3A 1CGYA 3H2NA 1ODUA 4H6QA 4KQNA 5E9AA 1ZLPA 3PZTA 3R5EA 4ZVJA 3G1DA 3W2LA 1PIGA 4DNHA 3MP3A 1EUNA 4HGXA 4FNSA 1EXPA 3O9NA 4Z17A 5D09A 4DUOA 1F8IA 4H6KA 2Y7FA 2WSKA 2YJQA 5TNVA 3WLLA 1AH0A 1TFVA 4HBEA 4IH3A 3DC0A 1C8QA 4IOTA 1NOFA 1XF0A 1DWJM 4DZHA 4LUTA 1S39A 4HBKA 4HA1A 2INEA 3VZZA 4IZGA 1C8XA 1T8QA 3VNMA 5FI8A 5FJPA 3EOSA 2IKJA 3EEGA 2VN1A 3BMVA 4UNKA 3SGUA 1K6AA 5CC7A 3UU0A 2DY3A 2NV9A 4ATDA 2I57A 3N9KA 1Q6HA 1KRCC 1A5KC 2QPUA 3BOFA 2HEJA 1V3JA 3S47A 1UR4A 5FJOA 1XW8A 2IQ0A 4NUWA 2A3HA 3S1UA 2VGFA 1LWIA 4I6VA 4N7QA 2WQPA 4MSSA 2PV1A 4M6QA 4QAWA 2EULA 3FJLA 1NWUA 1VF8A 3GUWA 2O4MA 3P5YA 4JL1A 4E4PA 3LBMA 4I90A 2VCCA 1P6BA 1UD8A 1SZFA 3I3EA 4ML4A 2V2DA 3LLXA 2CERA 4V1XA 5H8UA 3NFUA 4HU0A 1GUVA 1AMKA 1UWQA 5AYYA 4LNYA 5HMDA 1EHAA 1LCOA 4DVOA 4D9PA 3MMWA 3BUVA 3L4YA 4OE7A 4JFUA 3W75A 4R9XA 5CZ0A 2OSYA 5DCEA 2Y88A 2GUUA 3ITTA 3AMLA 3WF2A 3PZVA 4XZBA 3I68A 1JF6A 1QI3A 1RP9A 2XPBA 1JFXA 4YTSA 3BC9A 4JQ4A 3LM3A 3MW7A 4FXSA 2EHHA 1DP0A 1W1TA 1XG4A 2WJEA 4AMCA 4K7YA 1CENA 3VIFA 3N6JA 2J79A 2PDBA 2ZQ0A 3BMXA 4QLLA 2PDFA 4QHRA 3E96A 1BRLB 1QO2A 2NWRA 3WJWA 3T78A 2DG4A 1OFBA 5I07A 4XAGA 4CNOA 2ZR5A 2VFGA 4PSPA 1DYSA 1OADA 2M08A 3GC2A 4JDBA 2ALDA 4X63A 2XG9A 4U4MA 1D3HA 1UZ4A 3QMRA 2PDIA 1OCNA 3EMCA 1VLIA 4TW8A 1ZENA 3LYEA 1S2CA 3R2GA 3ZR5A 3UCQA 3ZJ6A 5CGMA 1NARA 1JI2A 1RAKA 1TSIA 3U7VA 3AALA 4XD3A 1DJHA 3W1RA 1EJSC 2L5HA 3NXFA 3VKJA 3AU2A 4DIAA 4EF8A 4JTLA 5DIUA 4MAZA 2WZEA 4I9JA 4IWWA 1QVBA 3N2OA 1Z3NA 2E0PA 4GI8A 2YIHA 2TRSA 4O16A 3VCNA 3WIJA 1RK6A 4CCEA 1FKIA 4H6EA 1EXBA 2XUCA 3D6NA 4LWWA 3RU6A 2VP8A 4HA3A 1L6SA 2WMFA 3BQ5A 3UEQA 2G97A 4LFYA 3W84A 3HQPA 1QMLA 5D9MA 5LYRA 4CU7A 1BKFA 2ESCA 1SSGA 2QEZA 1TCOC 1N8FA 1NDWA 2VVSA 4L7ZA 3B05A 4LUYA 2O7QA 1R3YA 1LDCA 2IPJA 3TE9A 5C6MA 4L1WA 3GRIA 4YIWA 3ZXWA 4ZQMA 1SW7A 4KT2A 2Y5SA 2A3EA 3WLJA 4CD7A 5HAOA 2X1SA 2Y8VA 1Q4WA 2E6DA 2OLHA 4YNGA 4L6DA 5HQLA 4JR5A 1FWDC 4GZEA 4AAJA 4JFLA 3GHRA 2RJHA 4WKFA 3V0TA 5F4WA 4S2CA 1B3YA 4GI6A 3UWZA 4XSLA 1KTNA 1E6RA 2VEPA 1PZ3A 4XZLX 1XIEA 4AZHA 4HOWA 1X6UA 3VKBA 1G4TA 1A7XA 3DKLA 4W5UA 3CAKA 4GQBA 1IEIA 4FXJA 1ZRQA 1LLWA 2WNNA 3UFYA 3W1PA 1E55A 3BAIA 1TMLA 4XKMA 1K9TA 3TTOA 4FX6M 4LS2A 4W7VA 1JCYA 4O11A 4HVXA 3NR0A 3C5QA 3HJZA 4FX7A 4S3BA 3OPSA 4ZO8A 5H8MA 4LALA 2CHNA 3CMFA 3MDWA 4UQ9A 3NDOA 3NCOA 4LX4A 4PEEA 4ZR8A 3SR7A 1YHTA 2DZVA 3L2LA 2HXUA 1EC8A 4JHZA 1QPRA 3QPEA 5DIVA 4M56A 2D24A 3GXNA 4MGVA 3STFA 4NZ5A 1KXQA 1ZFJA 4G8TA 2GOUA 3PTMA 1K8XA 3A3HA 3MO4A 3OYZA 1FKLA 2KX9A 4L4MA 1D3CA 4RJEA 5E0KA 5A6MA 3KM8A 3GNRA 3S4TA 1BSLA 6REQA 1CTNA 3LV5A 3RNDA 2YXGA 4DROA 1WZKA 4RDVA 3TCSA 3PRBA 1KRBC 4ERGA 3B8VA 3T40A 3N4AA 1DIDA 5BCAA 3CHVA 3EB3A 4REQB 2WMGA 1RPXA 1RD6A 1EZ2A 3RX4A 4ACZB 1AZ2A 1AQMA 1TPB1 2XYLA 3B9OA 1J0HA 1SM9A 5ECUA 4ZSUA 4PBFA 1SR0A 1UD6A 1UA3A 4MWAB 3BDKA 2FVLA 4ORIA 2V68A 1FCVA 3O3RA 1Q6UA 3LRKA 3WNKA 1V6TA 3TYUA 2V3FA 3LQLA 5G1YA 1J4IA 3WLTA 1H41A 4IM4A 3P61A 4BR1A 2W91A 3APTA 2OLAA 2PODA 1E6NA 3GFYA 5BOOA 3EKLA 3SCNA 2Z1KA 4AIBA 2BODX 1CLVA 4HHMA 4HU3A 3CUIA 1WZLA 2HNHA 1OF8A 1FQ0A 5LIUX 3JRKA 2O9PA 2CLPA 1O4UA 4B5NA 4RW5A 1MVYA 3L0GA 2Q6ZA 1OX4B 1US2A 2YW4A 3O16A 3WLPA 2P3EA 4EAMA 5FEXA 2FFCA 2GGEA 3AFBA 1P7TB 2IPFA 1GZJA 1YDVA 2CLIA 4NKCA 1Q63A 5HXMA 4DWSD 5A3HA 3AO0A 3VK5A 1KCZA 5CPQA 1Q85A 3ARRA 4WXYA 3DFNA 1XH2A 2P5NA 4CD4A 1HL9A 1CW2A 1IGWA 2AQVA 2G3IA 1W1B1 4FF5A 4JYDA 3FW6A 3W7RA 1V02A 2XSBA 1TZZA 1XLFA 4O1BA 1KT1A 1US0A 2PF0A 3ABOA 2PAJA 3FSUA 5C5YA 4H8VA 3GTYX 2WNWA 2YGYA 2QCFA 5EMKA 1YEYA 3U2ZA 4ODMA 4LUTB 4IQEA 3S46A 1JI1A 4BQ2A 4AD0A 4XTIA 4J2PA 1IXOA 3KVKA 5FJJA 1D7JA 3P74A 3FKKA 3URAA 2X09A 2RFGA 6XIMA 3N4EA 2I56A 3FA4A 3DENA 4BF7A 1XPGA 3AAMA 1LLOA 3NQAA 1E5JA 3C2RA 1TIMA 1H0GA 1HG3A 4JTGA 3UW6A 1XYCA 3ABRA 3EX6A 4RV3A 1O7AA 4XD4A 2PD9A 1OT1A 1VFMA 1UC5A 3NZGA 3KAGA 3IIPA 3SZ8A 4DF1A 2PLJA 4R9OA 3O07A 2R82A 3HV8A 3H7UA 2XIIA 4PFHA 2CWXA 3QOKA 3S2JA 5LGXA 4AFYA 4AZIA 1ISWA 1I2RA 3HMJG 2W3ZA 4PCTA 3EA1A 1H0IA 3VDHA 3WEZA 1OFRA 3VX1A 4GRSA 5I0DA 1FKTA 3ITYA 1X39A 1TELA 2W63A 2H90A 5LXEA 1S2TA 3BJSA 2GGGA 1TWDA 8XIAA 1UJQA 3ZSSA 1TV2A 2GQAA 2QGHA 1O68A 3KE0A 4EACA 2ZXQA 4H7VA 2VWTA 4MLRA 3TTSA 3HMCA 4NP7A 5BNKA 3ZR4A 3QV7A 4MY1A 1Q13A 1W1A1 4Y9NA 1JGMA 2JEPA 1SR9A 1H60A 3CL7A 1RUSA 3ARZA 3I6CA 4HQVA 3EKGA 3FHAA 4RPPA 4HSHA 2PGRA 2BGQA 3PR9A 2YL8A 3EA2A 4G5DA 1MSSA 4HNOA 3SJ3A 1NMWA 3P0XA 1SFTA 1MO0A 4YLWA 3LXBA 4FLQA 1RA5A 5TQLA 1YE4A 5I77A 2Y7EA 5A8MA 1BQCA 4AD5A 1CI1A 1YBQA 3QW4B 1SJCA 2PPNA 3O5JA 1C29A 2DVTA 1I75A 3VUPA 3VMNA 2JEQA 3OO2A 3O5LA 3QY8A 2MNTA 4YWIA 5HMSA 2YDRA 2YA2A 3V18A 1DORA 1H61A 2Z1BA 3NDZA 1KBKA 2VFIA 4TW6A 5JBEA 2HVNA 3K2GA 3HPSA 5LA2A 1XH0A 3W7JA 4UFKA 1FA2A 1ESWA 1ZBVA 2VQUA 1LQAA 3RLUA 4AEEA 2DSVA 1VFUA 3R25A 1A3XA 3ARUA 1SZGA 3MWAA 2HBVA 1KB3A 2G3MA 1ONEA 1P6CA 4KH2A 4QJ5B 1ZQ5A 3QV6A 1L8NA 4MUZA 2BXYA 2XGZA 2XINA 2HPIA 3MDUA 4DRSA 5HA7A 3CK5A 4AVOA 5A6TC 2WNQA 4J5NA 2Z7KA 5GNZA 3NO1A 1BEUA 3GIQA 2FHFA 4NI3A 1IX5A 3IIOA 1G69A 3N73A 2WQDA 4ZA0A 3LCGA 2JGYA 2J7DA 4QJ3B 2J4GA 4QDMA 2GJLA 5D38A 3B9DA 4E2OA 4ZPVR 3VOJA 4Q8WA 2INZA 1MDRA 2DH3A 1S5VA 5BXTA 2ZVIA 1ML1A 5F2LA 3LZ3A 2OOFA 1FY6A 2DQXA 2POTA 3VD9A 3GW3A 3RLGA 2V8ZA 3UG3A 1RLCL 4PMNA 2FAPA 4YTTA 3W2MA 4D6CA 4P7OA 1X8CA 4N9DA 4WX2A 2VX6A 1AL7A 3KHJA 2PSNA 3CPUA 3TA6A 2KE0A 2FPVA 2A3AA 4IQLA 4O8RA 2C19A 3WK1A 1GQNA 1T7LA 3K4WA 5CBIA 2OT1A 4EXAA 3SO7A 4IHCA 3WNMA 5F7UA 2OWWA 3WLSA 2Q5AA 4EPEC 3FEMA 3G22A 1XLGA 1A0EA 4MMWA 5IOBA 1X1OA 1LLZA 1FFRA 4DXXA 3V75A 4KIRA 1KV5A 1SU5A 2FJUB 3AMKA 3DECA 2PEVA 3EWUA 1POJA 2W0UA 4KMQA 5K9DA 1QTWA 4MG4A 4CCZA 3NVDA 3W85A 3R1ZA 3M9YA 1HT6A 1QNRA 4V28A 3ABQA 3E5BA 3R8GA 3T2OA 1E9LA 4I5UA 3KBVA 3TR9A 5CGTA 3WQPA 5BU9A 3EPNA 4AYGA 4WD0A 1YLVA 1KRAC 5G5IA 1QJWA 5K4XA 3M46A 5M5DA 2DUZA 1KWKA 3VIKA 5A8PA 1I60A 1GOQA 6REQB 2CCRA 4C7FA 1EOMA 3LRMA 3VGHA 2BOEX 4XUGA 5K9XA 1W9PA 1W2PA 2E5BA 1GQKA 5BWAA 3HB9A 2HRWA 4FNRA 4PUWA 4LXFA 5A6JA 2FLIA 4KFOA 2PZNA 3C56A 4A3QA 3TMLA 1J6YA 3OLEA 3A5VA 5HWNA 1QXLA 4DBDA 4C90A 4DJEA 1KBBA 1Q6FA 1F7BA 3BV4A 1V08A 2Z2UA 3CQIA 3MY9A 2WKGA 1KXTA 1VJSA 5DMMA 4AISA 2J78A 2OELA 1H1YA 1FKXA 2CBIA 4K3ZA 4OOZA 4HCDA 1ADDA 4XZIA 2VFEA 3S6OA 1W8SA 4YXGA 3ES7A 4F4RA 5LSMA 1X97A 3NQEA 4J4NA 4NZFA 1LL6A 4U31A 1G6CA 3WNLA 2XHYA 3AXIA 4PUUA 1H3GA 3MP4A 5HMFA 3ARXA 3L4UA 4KWVA 4HYRA 3PNZA 4AF0A 2VDHA 1ZAJA 2NWSA 4ZSTA 2OQYA 2WNZA 3OZOA 5LNVA 3ARPA 5PTDA 2NQJA 3R8RA 3W1TA 1IWPA 1EHNA 3QZAA 4CNUA 4IFRA 4JTQA 3NSXA 1V6YA 2FTWA 3WF4A 1TZ7A 1PKNA 1Q6CA 3P7YA 1I2OA 2BFGA 2WO5A 1UD2A 3KL5A 3DC8A 5D32A 1UBSA 1M04A 1GGOA 1TQXA 1P1MA 1SZRA 1MNZA 1JRCA 1RLDA 3AUJA 1V3MA 1VLWA 1GVSA 3W7OA 3CZJA 4A4AA 3QV8A 4H7ZA 4XAZA 1XFBA 4C6IA 3R10A 4W7UA 3W6YA 4W7WA 2DG9A 1KR1A 1R87A 3T08A 4JFIA 3H2OA 4AZ6A 1C92A 4PRTA 1Q6DA 4DH0A 3A9IA 3SEPA 1DWGM 5I2UA 4J3WA 3MC5A 4KWUA 1YATA 3HM7A 3R8HA 1YX1A 1EJRC 4R7WA 2JF6A 4JIEA 3DBPA 4B3ZA 1HF6A 1NTHA 4DWSC 3UJEA 4PCNA 4CGTA 3FJ6A 4ODPA 3NPVA 1QW9A 2R24A 3KFTA 1EWDA 4Q4OA 2KAUC 4O0QA 5A6BA 2ZC8A 3EWYA 1PJ9A 2ALRA 1E6SM 1EF2A 5CPMA 5D05A 2W92A 3DGBA 2I7GA 4KRTA 3S1XA 5JH1A 1E0VA 1UASA 4Z0JA 3QZEA 4X22A 1W3NA 3P81A 4LAKA 1JCLA 1M7JA 3RJYA 4K1GA 4RZ6A 3RR1A 2Y0FA 5ABEA 1PKMA 1UB3A 2BY2A 3WMBA 3M64A 3GLCA 5HNNA 1J9YA 2PDNA 2L2SA 3AJXA 1PBKA 4BKNA 4LY4A 4Y8FA 3MMDA 2EKGA 4D6HA 3SUUA 2GWGA 2BLEA 4NSBA 1IWBA 4DJDD 3DIPA 4GO8A 1OJXA 2MF9A 4QBXA 4A2RA 3UP8A 3UYCA 4B5WA 3N2MA 3GZAA 1LUCA 4RZBA 1TTPA 2EQDA 2PUZA 5CPTA 1HKIA 3N12A 3H4GA 2FPTA 3BLFA 2G5WA 2XH0A 5A1AA 2HS8A 5FSEC 3G1XA 2NQZA 5T8GA 4LGXA 4C1NB 4FO4A 1K8CA 1GQLA 3HQNA 4NRRA 3P14A 3UWEA 3M0ZA 3TQKA 4D2JA 2GJNA 2PRHA 3AHYA 2Q71A 4GI4A 3GE7A 5JBDA 4HP5A 3PWGA 4IISA 1QI4A 7REQA 1YBQB 3CWNA 1TYGA 1AW1A 3MQTA 1OG0A 1CCWB 1R7AA 2Q09A 3HG3A 1JJKA 2W66A 5JIWA 4YYCA 1SW0A 3CMGA 1PDYA 3UJ2A 5BROA 2F6KA 1YW5A 3GVRA 1KT0A 2BXVA 4WKHA 3MI2A 5HJXA 2PU1A 3WDRA 4AWTA 2VEMA 4BY3A 4RDZA 4AD4A 4MPQA 2Q8XA 1UWTA 3WELA 3KL3A 5CEWA 5HT1A 3M5VA 3N3TA 3LXAA 4Y90A 1LYXA 3O2LA 3GU1A 1RQBA 2JBMA 2PWEA 4MNMA 3STPA 3I65A 4ZZ9A 1RR2A 1Q1CA 2QZRA 2E68A 1J5TA 2ZUUA 2PV2A 4ZB5A 5AB3A 4ODLA 2WWCA 2E28A 4G6CA 3AIQA 1QPFA 3OIXA 1UWSA 3RM8A 2QW5A 2J77A 3HA1A 4ZOEA 3I3BA 5IXEA 3WMSA 3GFXA 1BLIA 4A21A 1E15A 4QG6A 3S2MA 3ALGA 2GVEA 3TLQA 3WF3A 3TSBA 2BZNA 2F8QA 3MA8A 1BFNA 3TZNA 1VH7A 4O28A 5CSSA 2EBNA 4GIYA 5IHRA 4MB5A 2Y63A 2QCCA 2BY1A 1S5MA 2VOMA 3GHTA 1E0WA 1ZL1A 3CQHA 4E2DA 1EB3A 3KRZA 4E4FA 1MRQA 5JMUA 1JNSA 1YTDA 4TVCA 1YYAA 3SCRA 3T42A 4ADUA 4L3NA 4LYRA 2WVUA 4GH1A 4GVIA 2E6AA 2PGEA 3IPWA 2X0HA 3PUDA 4QJ4B 1XLKA 3KTCA 4YWSA 3VNJA 2PDJA 3KVJA 3UZWA 1GVRA 3VAWA 3OOBA 1FWJC 4LJ3A 4D6FA 2C14A 4TIMA 3N04A 2J74A 1IIHA 4IMDA 1LP6A 4GQQA 3P80A 1K03A 1P5QA 1JZ4A 2Y4SA 1L9WA 4BI7A 4TUFA 3ARSA 2F23A 4H7CA 1UD5A 1EQPA 3C0QA 1WXZA 3SFKA 3PZOA 1P0NA 4DLFA 1DTNA 4X9YA 3LTSA 4GA8A 1NDVA 4Q8UA 3GY1A 4IXXA 1JYNA 4UNLA 4S23A 3KHDA 4XZHA 4LVAA 3WNNA 2ZUTA 1F07A 2VGIA 2KZHA 3H2AA 4UZSA 1XYFA 4IGNA 3M5YA 4A35A 3MUAA 1OFQA 2FKPA 1P1XA 3D46A 3FFSA 3MUY1 1TA3B 1OK4A 2GOKA 4GFIA 1W3KA 2YBTA 2Y89A 5HINA 2PMQA 2ZR4A 1FP9A 2ZRUA 3VDGA 4ONVA 3S9YA 2ZWZA 3S1VA 4DUVA 3A21A 1GCYA 1UA7A 3BLDA 3U6WA 4LAYA 3TK7A 2B7NA 1UPMB 3CAVA 1TZ9A 2ACQA 1XRSA 5JUVA 4KEVA 3D47A 3JZEA 6ALDA 3UY8A 3B8UA 1Z44A 3IACA 4EF9A 2A7NA 3OIHA 2FVKA 2VENA 2VFDA 2JIWA 3AXXA 3N1AA 4FK9A 1BVNP 2F2KA 4LVBA 4AF0B 1EBGA 3TU9A 2B31A 4LV9A 1YTEA 3BAJA 2DUAA 3PUOA 2ZZ6A 3VFCA 4ODQA 5DO8A 4QROA 1TO3A 1OC6A 2FB2A 3LG3A 1JPIA 2Z7GA 3QKZA 3OBEA 3AU6A 1JYXA 3LGDA 4C02B 4HTYA 3BSHA 4ODKA 1NVMA 1TKKA 1GOOA 1ZZMA 2PPPA 4OHQA 1TJ0A 3PP7A 3TTQA 3THCA 3F4WA 1LT7A 1E72M 4CQAA 3CNYA 3UBPC 5A69A 1GZ1A 4PE8A 1OQFA 4O1FA 3KBJA 2WSPA 4MJ4A 2BBFA 4ZO9A 4P8UA 1B9BA 2C1GA 2GGHA 3ARQA 3L67A 4JTRA 4XO6A 4AWSA 3PC0A 3C2OA 4HTBA 5I3JA 2QJNA 4LAVA 3GKAA 3NOEA 1EP3A 3C2FA 4WUIA 3R43A 4R34A 3AC0A 2OZ3A 4MY9A 3PZGA 4J3XA 4N9BA 2X7VA 3AYTA 4IJCA 1DXIA 2BS9A 2Q02A 2P8BA 2VEFA 1W91A 2X42A 3ITCA 1XYAA 4P7QA 2V2HA 4AIEA 4OQVA 5JVLA 4ROPA 4L5ZA 2CU0A 3HTWA 4DZAA 1K7XA 3M0JA 4ZPWR 4JFMA 4QS5A 4XZ9A 3CUHA 4R3UA 4CVWA 1HIZA 5CBBA 1YIXA 4MPKA 5FEWA 3LB0A 3W2UA 3PWAA 1B9ZA 2Z1VA 4W84A 2VC5A 1RSCA 4K1WA 1I2PA 6TIMA 4I8DA 4DRMA 4X9SA 2DSKA 1XLAA 3BSMA 4A8IA 5I24A 1NSJA 4AHOA 4EP8C 2RAGA 3LERA 3THQA 3GG7A 3OVGA 1S5TA 3NM3A 3NQMA 3S5OA 1BG4A 1OGGA 3VILA 5A8OA 2JZVA 3K8KA 4R85A 3ZS4A 1QPKA 5A2BA 4NX0A 1XUUA 5D2TA 2FIQA 3O5IA 3SI9A 5CJMA 1JPMA 1O5QA