2DSVA

Interactions of protective signalling factor with chitin-like polysaccharide: crystal structure of the complex between signalling protein from sheep (sps-40) and a hexasaccharide at 2.5a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbohydrate binding properties and carbohydrate induced conformational switch in sheep secretory glycoprotein (SPS-40): crystal structures of four complexes of SPS-40 with chitin-like oligosaccharides
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dsvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dsvA01
4W8BA 1V3HA 2YOCA 3UEQA 3T09A 5A6BA 5D8ZA 4P7OA 1D2KA 5DF0A 3HMCA 2BV9A 3AYSA 1J0IA 4UFLA 3MMUA 1OB0A 1GUVA 2ESCA 2VQTA 3WUBA 4EANA 1E4NA 4HMDA 1V6VA 4C7DA 4CD5A 3L4VA 4AD3A 2Z1KA 2D3NA 3B8SA 1R7AA 1B3YA 4ATDA 1C8QA 3B9EA 2XFYA 2WW5A 3M7SA 4N0RA 2DSZA 1JD7A 5BXPA 4AD2A 1TR1A 1FFQA 1EDQA 2WANA 3CZ8A 5E70A 1W1PA 3AOFA 4RE4A 3D3AA 2NW0A 1WO2A 2WLZA 1XSIA 4U2YA 3WQ5A 2DT3A 3TOPA 5AC4A 3ZOAA 2J78A 3U7BA 3ARXA 2EQDA 3LPFA 5M03A 2QPUA 2OYKA 4PMUA 1CXEA 5GPRA 4UQAA 3AMDA 5F7UA 3ARQA 3I3BA 5HOSA 3NUKA 1R8LA 3OLDA 3NSNA 1OIMA 2G3IA 2OWXA 2V3GA 3EMQA 2O9RA 5JIPA 4P7QA 1AQMA 4AZIA 5FL1A 2J7DA 1E6SM 4ZE5A 3IK2A 2YDRA 4W93A 3W25A 1DEDA 2OSYA 2ZX5A 2WM0A 3GXMA 1C3FA 1VIWA 3AHTA 4OIFA 4AZBA 4PTVA 2E4TA 1HJSA 3WQVA 2YDSA 4DWSB 1OD0A 3S2CA 1UWSA 2DSKA 3HJEA 4Y7EA 2PBGA 5D9NA 3IAPA 1V3JA 1JIBA 1MW3A 4KGJA 1BYDA 4U5IA 4P7LA 3IAQA 1Q6FA 5LA2A 5D9MA 5I0DA 2WMGA 2D2OA 3BAIA 3ZR6A 4UCFA 3A4AA 3WD3A 1PZ2A 1E0VA 1CDGA 3AISA 2DQXA 4HMCA 5DMYA 1ZU8A 4PCSA 3ZJ8A 3AMLA 2FGZA 1W3HA 2WHMA 1Q6CA 1CIUA 1EGZA 1MXDA 1WNOA 3EBVA 1LQ0A 3GNPA 3VNYA 2Y24A 2GDUA 2XFFA 2A3HA 2X1IA 2XUCA 4GZJA 4XUYA 1S46A 1G5AA 3UR7A 3RCNA 2EPOA 1HP4A 4UFMA 4CU6A 3WH9A 5BXRA 2QMJA 1HVQA 3WFLA 3SEPA 3ZT5A 4WSJA 3GXIA 1CPUA 3AMKA 2XVPA 5I6SA 1UKOA 1JZ8A 3RJYA 1CEOA 3ARUA 3AROA 1HF6A 1CGUA 4Z2IA 3MMWA 2G8ZA 1CZ1A 5LA0A 3BMVA 1X6LA 1G9HA 2JEPA 1EO5A 3WL1A 1UH3A 2XVNA 3A47A 4QCEA 3VU2A 1UUQA 3PN8A 1LLOA 4C7FA 3B9AA 3II1A 4W86A 1FHDA 2O9PA 4URIA 1JAKA 1VFOA 4MJ4A 5E09A 4MNLA 3GH4A 2JIEA 1H49A 1JI1A 3E1F1 3QHOA 2WCAA 4ZFMA 1ISWA 1EXPA 1J0HA 5AYIA 3EMCA 1UYQA 2O9TA 5I3DA 4NSBA 2VCBA 1XH0A 1G1YA 3AIQA 4J3VA 1B31A 2YL8A 3JUGA 1UHVA 1J11A 1WZMA 4ZXLA 2V5CA 1J12A 1CYGA 3CZGA 3WDRA 3AI0A 4N42A 1B3VA 5IHSA 3G6LA 3ZT6A 3AHZA 1A3HA 4YPJA 2J7EA 1V0KA 3CMGA 2XM2A 4AZ6A 1AQHA 4MTVA 4NI3A 4W7WA 3VGGA 3APGA 4TOQA 3OLIA 4B16A 3SCUA 1KXHA 1AQ0A 1MW0A 1B3ZA 5CPSA 2O9OA 3CTTA 2DSWA 3NCOA 5GNZA 1VEPA 1UWQA 3NSMA 2ZXQA 5AY7A 4D6IA 1B2YA 5FOOA 3RIKA 1GONA 2BS9A 4DM1A 3VD3A 5EFFA 1GJWA 3RILA 1MYRA 2IXVA 1DWAM 3AIRA 2JFEX 3W53A 4FLSA 1C8YA 3CZLA 3ZSTA 3SCOA 2E8ZA 4GO9A 3PHAA 1C93A 1B9ZA 3WUEA 3L2MA 1LG2A 4U5KA 3W6LA 1GOOA 1VJZA 5FKYA 2WXDM 3O6AA 3TTSA 1H11A 1R86A 4W87A 1WDRA 4JHOA 4B15A 2ZUUA 1C7TA 1GVIA 1EIBA 3F4VA 4MDOA 1ECEA 3VIHA 1JYVA 1BGGA 2BVDA 2XG9A 3ARSA 3WKZA 3AXHA 2CBUA 3OBAA 2BVYA 1NP2A 3QHMA 2J7GA 3K8MA 3BAYA 2OWWA 1UD3A 2VX6A 4D72A 1OT1A 2WK2A 1RD6A 3AIBA 1UWRA 4Z2LA 2C0HA 1E43A 4ZENA 1UQYA 2V3FA 1W9BM 3DYPA 3WNPA 1HJVA 3BAJA 3VIMA 1DTUA 5AC5A 1E55A 2EPNA 3VIPA 3NSXA 2WCGA 3W81A 4UQEA 5E0CA 5IDIA 4AIOA 1EOKA 1WZLA 2JF6A 4JCMA 2VVNA 4P7NA 1CXKA 5IFPA 3PTKA 3N9KA 5D4YA 1W3JA 1KXQA 1KQZA 1RH9A 5D8WA 2YDQA 2BNJA 4A3YA 3CUIA 5I24A 4JFWA 1M53A 1JZ7A 1UR1A 4D6EA 4UZSA 4DWSA 2FH6A 3O9NA 1H41A 4JZ5A 3VDHA 4QLJA 3CHFA 3ZJ6A 3VIIA 5GQBA 1MXGA 4MAVA 3SUWA 2DSVA 1US3A 3N04A 4D1JA 3SCRA 2WVSA 2E9MA 1NOFA 1R87A 3NDYA 3SIMA 4X9YA 3ZM8A 1UQZA 4H8VA 4GI8A 1JYWA 3UETA 3DECA 1UR2A 3MMDA 5BRPA 3PZMA 1C7SA 1E72M 4XZWA 1E15A 1SFSA 3MO4A 3RDKA 2VI0A 5IFTA 1Q4NX 2X2YA 2YL5A 1KXVA 4J3WA 5A8QA 1BLIA 3KZSA 1TA3A 1W9PA 1UKTA 3L4ZA 4WJXA 4MB5A 4UOZA 3VM7A 2CPUA 3WFZA 2JIWA 4P8VA 4Q22A 2WZIA 1KCKA 2PWHA 1V0MA 3VD7A 4JIEA 3CLWA 5CZKA 3VGHA 2G3MA 1E4LA 1ZJAA 2WVVB 3DYMA 1JL8A 2DPEA 3BCFA 3BCDA 4ML4A 1XH2A 4UQ9A 4FLOA 4YHEA 4M82A 2Y8VA 1LF1A 1J10A 1QW9A 1B90A 1U33A 2CKRA 1BF2A 1OBAA 1CLVA 5A6AA 4JL1A 2Q8XA 3WUFA 3FW6A 4MNJA 3SCWA 4UTFA 5HXMA 2VX7A 3WN6A 1I75A 1V6UA 3N18A 4PUEA 4H8HA 4HOXA 5HPOA 5ABHA 1CENA 6A3HA 3WEOA 2EBNA 4V2XA 4CKQA 5DT7A 4QDMA 3AYRA 2XYLA 1TA3B 1V6WA 2W62A 2GUYA 1XCXA 3VX0A 1UD8A 1W2PA 4OKDA 4CD6A 5LYRA 1HKJA 3VMNA 2CITA 5E0FA 3ARZA 3MANA 2XSBA 3MS8A 3EDEA 3BAKA 1MWOA 2J7HA 2WBGA 3L2LA 1I1XA 1Q6GA 4J3UA 4S3JA 1GOMA 1NWRA 1XH1A 3WELA 4ACYA 1WZAA 1JXJA 4FMVA 4D6GA 1E9LA 1WDQA 4JCLA 2AOSA 2XWDA 3CHCA 1VRXA 4UFIA 2J77A 4GQQA 4M24A 4K68A 4JKMA 1GPFA 7CGTA 3WSUA 2YLLA 1F4HA 1HL9A 1VEOA 3SUSA 2CBVA 3UESA 4UOQA 3AS0A 3CGTA 4BQ2A 1H0IA 4AMCA 5HNNA 1H0GA 3WF0A 2BXZA 1BQCA 1L8NA 1E6RA 1W2VA 2WPGA 3UG3A 2X05A 4F8XA 2V3DA 5JBEA 2V38A 1V6YA 4B9ZA 1WAWA 2J8GA 2D1ZA 4HA4A 1E70M 2ZX7A 2F2HA 1ITXA 3OA5A 4Z2HA 1UD6A 2XM1A 3KL5A 1CGTA 1MW1A 2ZX9A 4R5EA 2W66A 2A3CA 1H5VA 3T2OA 3SCQA 1HJUA 3PZIA 3WD4A 4W7UA 1JFXA 3EDDA 2VZVA 3WDPP 2D22A 1K9EA 1HP5A 3PZUA 5A2CA 1V02E 2WB5A 5A2AA 3GYCA 1ODZA 1CNVA 1QNOA 2OWCA 1E5JA 2WNWA 2ZIDA 3VINA 3M46A 1JD9A 1IV8A 3QR3A 1E56A 5EMYA 2WC4A 1R85A 3W24A 3ZR5A 1KQYA 4CD8A 2Z1SA 1E40A 1U30A 1E6NA 5JIWA 1BVNP 2VL4A 1B0IA 1QI0A 4AZCB 4WF7A 2WVVA 1TVNA 4YN5A 8CGTA 3NYDA 2A3BA 2WAGA 4AYSA 5CXPA 4W5UA 3WD0A 1SMAA 1EDTA 5A6SA 1UD4A 4KGLA 5CGTA 2WWCA 5A1AA 2PF0A 3ZMRA 4U33A 2YBUA 5CQ1A 2J25A 1J0YA 2YKKA 3U57A 1GQKA 3FHQA 1Q6EA 4GZIA 4H7VA 3QGVA 4PMRA 2JEQA 5JUVA 2JE8A 3ZQ9A 3THDA 1QI5A 3GDBA 1JZ2A 5DO8A 3IJ8A 4GINA 4P8XA 3W26A 1TG7A 4IPLA 1UKSA 2CESA 1O7AA 3RM8A 1UH2A 1DHKA 2VNCA 1VBRA 4W8LA 4M29A 2CKSA 1UR0A 2ZXBA 1IZKA 4PUDA 3WH7A 1BSIA 3F5LA 3GBEA 1CLXA 2WMIA 4OUEA 2WMIB 4QCFA 3THCA 5I77A 3IJ7A 4GI6A 1TVPA 1HJQA 1XV8A 1GJUA 1J0KA 1W91A 3ZJKA 1MFVA 2J74A 2PC8A 4HZ7A 4XV0A 2E0PA 4C7GA 5CJ5A 1NOWA 1JDDA 3SCNA 2WZHA 1MQPA 4XZBA 1NARA 2RGMA 3MUIA 3N1AA 3W27A 2YJQA 2BY3A 2CEQA 4OOUA 5A94A 3WL0A 1JAEA 4QP0A 1NH6A 1QNPA 3D5HA 2FHCA 3I3DA 3VX1A 3WDJA 1JXKA 4OJYA 4U2ZA 3AS3A 2VZSA 4DUVA 1KBBA 5DT5A 3WMSA 2WC7A 1G01A 1M03A 3L4TA 4W84A 4IUGA 4WK9A 2AAAA 5A3HA 1VB9A 1JF6A 4UFJA 4MADA 4OOZA 3ZJ7A 6TAAA 4MPKA 1BG9A 3FHAA 3VDBA 4NRSA 4JHZA 4P8WA 5LA1A 1BYBA 3SUUA 2GK1B 1BPLB 1HXJA 4AZGA 3CUHA 1BYAA 2DT0A 2ZUNA 4ZXOA 3VIOA 3OGSA 4W85A 3MUY1 2ZXAA 2CXGA 4PMOA 3AXIA 3VGBA 3MSDA 4HPGA 3PZQA 5M17A 1WZKA 5IHRA 2FGLA 3A3HA 4MB4A 1OGSA 5DEZA 4UQCA 1HX0A 1E1EA 3U5UA 1ODUA 5CLWA 2VRJA 3AFBA 1ITCA 1D7FA 1JG9A 1E6PA 1BAGA 3EDJA 1OCQA 4TX8A 3CPUA 3W28A 1DWGM 2UY2A 1VBUA 1W3LA 2QHAA 3AHYA 1FHLA 4TTUA 3SCVA 4BQ5A 5I23A 1E0WA 3WD1A 4M8UA 2BY0A 3KWXA 3PBGA 5A6LA 4PTXA 3UG5A 3WNMA 1W9DM 1FH9A 3AIWA 1IT0A 3POCA 4KRUA 4JKLA 1KR0A 1E6ZA 2J79A 1FH7A 3VNZA 3AZTA 1CBGA 4CGTA 3ALGA 2PWGA 1UWUA 1M04A 3TTQA 1CXLA 4AIEA 4NZCA 2YA0A 2WKGA 1LJYA 1B3XA 1EDGA 2ZUTA 1WKYA 4E2OA 5M3WA 1W32A 2C7FA 3ALFA 1UD5A 1VJSA 1JDCA 1UR4A 1C8XA 2VRQA 5I2UA 1CWYA 1PX8A 4M80A 4PBGA 4GQRA 2WVUA 3AZSA 4PMDA 1PPIA 2XVKA 1OWQA 3VIJA 2VZOA 3WQ4A 4PN2A 3ECQA 1ZL1A 2EPLX 4LPCA 3SUVA 3IJ9A 5ABEA 4D6HA 1R7OA 2BY1A 3LPGA 1AMYA 4GZEA 5BRQA 1JZ5A 1KB3A 1RP9A 1JF5A 3ARYA 3EMZA 1OGBA 3W4RA 3RO8A 2ZWYA 3OG2A 3VTRA 3UERA 1MQRA 2AMGA 5EB8A 4HTYA 1IZJA 1NOUA 1QI2A 2XVLA 2ZWZA 3GNOA 5HBFA 1US2A 4AEFA 2BHYA 3MV01 1UD2A 4V27A 4L4PA 4PSRA 1KWKA 2A3EA 2O92A 2WVTA 3AHXA 3VVGA 1TCMA 1BVZA 1E73M 1KBKA 3RM4A 2W92A 2Y8KA 4QLKA 4JFVA 2G41A 5M5DA 1QNSA 3WMBA 4Z2JA 1ISXA 2GJXB 1H1NA 2GJPA 2DDXA 3VMOA 3I3EA 1QPKA 3RM9A 3W37A 4L4OA 4HPHA 3VD5A 1V3LA 1QNRA 3AIUA 4PMQA 3WF3A 5A6BD 2OSXA 3OLGA 1FA2A 2CERA 1PIGA 4AW7A 1I1WA 3HU7A 1M7XA 4RL3A 1OD8A 5CPQA 5A8NA 1DWIM 1AVAA 2WHJA 1GCYA 3WENA 2FH8A 5KEZA 2G4FA 4ACZA 4U3AA 3CBWA 1QI3A 2WBKA 4OZOA 2MANA 2ZUWA 2Y4SA 1L0PA 5I79A 1W1TA 2JF7A 3CZKA 4BA0A 3DC0A 2J47A 3CUGA 3OZPA 4NF7A 1DWFM 1QW8A 2ZX6A 3VDAA 1J01A 1PIFA 4FF5A 2CHNA 2PBOA 5FD0A 4X0VA 3K4DA 2GJXA 3MU7A 4TUFA 2WLYA 2V5DA 5FCZA 2D24A 2PWFA 3CIVA 3SUTA 1E3ZA 2VQUA 3GH7A 2EEXA 3WMCA 3BLKA 1HKKA 1UWTA 2EXOA 1E0XA 4B3KA 1NM9A 2E40A 4F66A 2D23A 2BFGA 3FY1A 4ZE4A 4V28A 2DH2A 1H4PA 3ARPA 3WH6A 2J7FA 4FLRA 2WSPA 1TZ7A 4WKFA 4HA1A 1D3CA 4B3LA 3PZ9A 1OIFA 1Y7VA 2VR5A 2DSUA 1CXHA 4PMXA 2CBIA 4AZ5A 1WP6A 4PTWA 3N11A 3T0BA 4AC1X 5CG0A 1VEMA 4A4AA 3FNDA 1PX4A 3CMJA 3K8LA 3TTYA 3OB8A 3WDQA 4AIUA 5HPCA 2XTKA 2QPSA 2DIJA 1B30A 4MAZA 3VGFA 4CVUA 2E3ZA 1OGGA 4AZHA 3OLEA 1EOMA 2W4XA 1XD0A 2F61A 4UOJA 4S3KA 3DYOA 4H41A 1GZJA 4EAMA 2QLYA 1WCGA 5KZ6A 2VX5A 2W61A 3PTQA 2OYLA 4MDPA 2XHYA 4W7VA 1ZBVA 4UFKA 2GJRA 5A6JA 1HKMA 1XSJA 2OSWA 2BXYA 1WE5A 1LL6A 5CGMA 2XGIA 5E6ZA 1V0NA 3VUPA 1K9FA 1HIZA 1ZJBA 3VIGA 3HN3A 4WSKA 4R27A 2VUYA 2YA2A 3VIKA 3S6TA 3K1DA 2E9LA 1HJWA 3SCSA 2C8NA 4DWSD 4MJ2A 3WQ6A 1PBGA 1ZS2A 4H04A 4J7RA 1CGWA 1PJ9A 1PX3A 4PEEA 2WMFA 4GXPA 4UQBA 5BWFA 3WUGA 2DH3A 2CYGA 3ZIZA 3MUAA 4JL2A 3VDCA 2D0GA 3WBAA 4CN1A 1HVXA 1V08A 1CGYA 2XWEA 1HT6A 4CU7A 2YL6A 5ABGA 5BXTA 3WH8A 2VJXA 4JFUA 4QFUA 2W67A 3RPMA 1E4MM 3VM5A 1CXFA 3T2PA 5GNYA 1PEZA 3LPPA 3EDFA 1CGVA 2TAAA 1C91A 4M1RA 2W63A 4DM2A 4TXEA 1ZBCA 3LPOA 2PWDA 3GNRA 1B1YA 4HA3A 5I78A 1KFWA 1VENA 4MNKA 2X8RA 3AS2A 3EDKA 1DP0A 3BLPX 2D0HA 4GI9A 3W6MA 1C92A 5HDRA 1TMQA 3WNLA 5BXSA 1UZ4A 3AICA 4BQ3A 3TA9A 1KWGA 4W8AA 1OINA 3MKKA 2J62A 2E9BA 1JYXA 4HMEA 1GORA 2NT1A 4HU0A 4PYSA 3OGRA 5ECUA 3OGVA 4HU8A 3WQWA 3CO4A 2PB1A 1UKQA 2GFTA 2ZXDA 1BFNA 3OIHA 4PMYA 1JI2A 1E3XA 3G6MA 1GQIA 1M01A 4GIAA 4P8UA 3CUFA 4IM4A 2UY3A 1ISVA 1ZB5A 2UY4A 3ARTA 5JBDA 5D9OA 5CSYA 1EH9A 4CU8A 5JH8A 2B31A 2VRKA 1UR9A 2VVSA 2VOTA 2GDVA 1GOIA 1UA7A 5A8OA 4CN6A 3WY1A 4TVUA 4FK9A 2JALA 4J27A 1KCLA 2YIHA 3GXFA 1Q6DA 1FFRA 2OLHA 4LGXA 4M56A 3PZGA 1GOWA 2HVMA 2YL9A 2NSXA 1QHOA 4DUWA 3ARRA 4ZEPA 4AXNA 1J9YA 2BHUA 2J8FA 1FH8A 3VOCA 2CETA 3AMCA 1H09A 3T0AA 2VO5A 1UOKA 1J0JA 3FXYA 3N12A 3GBDA 3DHPA 4EE9A 1MW2A 1XGZA 4W89A 3N17A 4LYQA 4GPNA 2UWFA 1UR8A 1UWIA 4AZ7A 2NT0A 4BZYA 1NWTA 4NRRA 3T2QA 2WHKA 3WD2A 1HNYA 4HOZA 4TVDA 5C8BB 2HISA 5A8PA 4ATLA 2V3EA 5BROA 1KGXA 4RE3A 4KWUA 4J3TA 3SURA 1W1YA 4PMVA 4U31A 4GO8A 4TVCA 1V03A 1LG1A 1W3KA 3LMYA 4AZCA 2D20A 1K6AA 3ZSSA 3CHEA 4J3XA 4F9DA 1OT2A 2XIIA 4GKLA 3BXWA 3GH5A 4CCCA 3WQ8A 4LYPA 3W0KA 1CGXA 2IXUA 2VX4A 3KL3A 1OSEA 1ISZA 3WF1A 1X6NA 1OM0A 1YQ2A 2EO7A 4QAWA 4AD0A 2DIEA 3GM8A 3VD9A 2GSJA 1W9XA 4W5ZA 3K4AA 4TX6A 2VURA 1GQLA 2WHLA 1V3MA 2XSAA 2ZUSA 4AISA 3L4YA 1FP8A 3PZTA 1HL8A 5A6KA 4WIWA 2QV4A 4KH2A 3VGDA 3PTMA 3IANA 1JFHA 3MUZ1 2BY2A 1GNXA 1WPCA 3OZOA 3NJ3A 3BAXA 1E71M 3WIJA 4CN4A 1GQJA 4UZUA 1N82A 4D6FA 4CD4A 4IPNB 1JYNA 2G3JA 2ZX8A 2QMKA 3KEHA 2Y5EA 4OBRA 1F4AA 3BC9A 4BQ4A 3WF4A 2WYSA 3AQUA 4CCDA 3CHDA 1BGAA 2EPMX 4JFSA 2YBTA 5FL0A 4LXFA 3ZT7A 2WWDA 1BHGA 2WC3A 1SR0A 4F9JA 4JFTA 1QBBA 1WB0A 1Z32X 1XHGA 3WNNA 3VD4A 4LQ1A 2J75A 3GZAA 2DGAA 1HJXA 5DFAA 1SYTA 2PWEA 1PZ3A 4PTMA 1H3GA 2WSKA 4E8DA 7A3HA 1J18A 4E4PA 2W5FA 2BHZA 5I5RA 4B9YA 4PCTA 1MQQA 3M07A 3AS1A 3AXXA 5CPTA 1K9DA 4HP5A 4IISA 3FN9A 4XB3A 4F79A 3W82A 2YLAA 3BAWA 3L4UA 3N13A 3A6OA 3W38A 2FHBA 4AY1A 4H2CA 2BVTA 1UZ1A 3WDIA 4QLLA 4DUXA 1KGWA 4EK7A 2QF8A 1XYZA 3WNOA 2ZE0A 5A8MA 3QHNA 3DHUA 4CVWA 4EKJA 2D3LA 3F5JA 1JGIA 1K9TA 4X0NA 3BSGA 1B3WA 1KGUA 4Z2KA 1LL4A 2FDMA 5JBFA 3VMPA 1QNQA 4M81A 1JZ6A 3POHA 1VFMA 2VMFA 1BYCA 3NDZA 1CTNA 3WEMA 4UFHA 5EFDA 2YA1A 5D9PA 1EHNA 1XYFA 4LX4A 1EHAA 2DT1A 2CIPA 4KRTA 5ABFA 1V6XA 1VFUA 1RPKA 2WZEA 1XSKA 1JZ3A 3RMEA 3SCPA 2GK1A 1GW1A 1KXTA 4D71A 4AD5A 1DWJM 1RP8A 1XRVA 1X1NA 2WCSA 2D0FA 1MVYA 1WDPA 3EYPA 1EQPA 3AIVA 4WLCA 3PZNA 3WNKA 3T0DA 2J7BA 4BF7A 1E4IA 3BH4A 1GHRA 3BSHA 1J0ZA 2XGBA 4CD7A 3FAWA 2VZUA 2VCCA 3K46A 1A47A 4AEEA 1XCWA 4WKAA 4KMQA 4A3HA 5CSUA 4MNMA 4FLQA 1JNDA 4HOWA 3AMGA 1E6XM 1QOXA 2CCRA 2VR4A 1C90A 4PRWA 3VPLA 2XJ7A 4D1IA 2WMHA 1E1FA 1XD1A 1BG4A 4J28A 3PZVA 1G0CA 2E8YA 4D6CA 4YHGA 2ZUMA 2XPKA 4PSPA 4CCEA 3F5KA 3NIYA 3QOMA 1P6WA 3ARVA 2WMKA 4AWEA 3B9DA 4WKHA 4UQDA 3ZO9A 1TUXA 3WF2A 2XIBA 3MSGA 5GNXA 4AD1A 3VIFA 5A95A 1V3IA 3A4XA 2EPKX 1LWHA 2VZTA 1HN1A 4HZ8A 5IXEA 1MFUA 3AZRA 3WDHA 2X09A 5A6MA 2EJ1A 2RGLA 5BYWA 1QVBA 1NWSA 1NWUA 1KR1A 2VC9A 3BGAA 3PZOA 2ZICA 5A69A 1UA3A 3MV11 5BCAA 1V0LA 3VKKA 4D6JA 1PAMA 4H8UA 3AJ7A 1JZ4A 1NP0A 4JAWA 3U5YA 3W29A 3WH5A 2ZUVA 3L4WA 1W9VA 2VCAA 5TD4A 4TTGA 3SCTA 2F8QA 2FHFA 2WMJA 1U2YA 1JNEA 2G3NA 4BCEA 4RE2A 2XFRA 3RJXA 1UKPA 1CECA 1EQCA 2CHOA 1QI4A 2Y2WA 2J4GA 4XX6A 1GOKA 2DEPA 3VILA 4AD4A 1DWHM 3A4WA 4P7RA 3K8KA 3T08A 3WEZA 3CZJA 1TFVA 4E8CA 3L4XA 4MB3A 4LYRA 3KE0A 3TONA 5A2BA 2A3AA 2VT0A 4MB1A 4PMZA 4OBSA 1ZBKA 3BMWA 3UR8A 1E6QM 1W9UA 4HZ6A 5EBAA 2PI6A 3O2LA 2ZOXA 4BS0A 1FP9A 3AIEA 1XC6A 3TP4A 1GVYA 1O6IA 5C71A 1H2JA 1JDAA 3WBEA 4UR9A 4J3SA 9CGTA 1BTCA 5ABFB 2VTFA 2UY5A 1LWJA 5CLTA 1ZBWA 4D6DA 4PMNA 1ESWA 3UG4A 2CBJA 2X0HA 1QHZA 1VF8A 4JKKA 3VGEA 1ISYA 5E9AA 1SMDA 2GVYA 5FIPA 1GHSA 1VFFA 1V02A 3CZEA 3N15A 1W1VA 5E6YA 1HKIA 2WKLA 8A3HA 3M6DA 1WDSA 2XVGA 1FOBA 4CUCA 2CNCA 2DT2A 1NQ6A 3ARWA 1QBAA 2W91A 1E5NA 3U7VA 2OYMA 1VAHA 3GTNA 3VO0A 1GOQA 3QOKA 4Q7NA 4DWSC 1EA9C 1CXIA 3AHVA 3TTOA 4W88A 4ATWA 3CUJA 3FAXA 1QHPA 1YHTA 1TE1A 3CH9A 4Z2GA 1UG6A 2J7CA 2X0YA 1G94A 4UNIA 4ACZB 1UH4A 1LL7A 1EO7A 3J7HA 7TAAA 1V3KA 5AYBA 3GXDA 6CGTA 4U3CA 3KL0A 2IUZA 3UCQA 5C70A
chains in the Genus database with same CATH superfamily
2YOCA 3UW6A 3T09A 4BI5A 1SFTA 3HIJA 3AYSA 3LU2A 3TOYA 1J0IA 2ZVRA 1OB0A 4XUGA 4AEOA 4EANA 3TK7A 4R7WA 1V6VA 3ODKA 1XYLA 4GUFA 4WJ8A 3UGVA 3TQVA 3T05A 3REQB 2FJUB 1B3YA 4DJFA 4EXBA 2F6KA 1Q6UA 1KFBA 3LERA 3UWZA 4TO8A 5DY3A 3H6OA 3CK5A 1JD7A 4R85A 3NO3A 2MPHA 4X2PA 1TR1A 2FZNA 3C8NA 3LS9A 1R3QA 3L12A 4RE4A 2ZR5A 1WO2A 3W75A 3WQ5A 2DT3A 3TOPA 2JKPA 3ZOAA 1UW9A 2J78A 3U7BA 3ARXA 1UMLA 2PF8A 1UJQA 2QPUA 2QW5A 4PMUA 3ITVA 1XP3A 1TQJA 3C2EA 3UFYA 5F7UA 3MVTA 2Y7DA 3I3BA 3OLDA 3NSNA 1MUMA 1TZZA 1DPMA 4AZIA 2E7FA 3L9CA 5FL1A 2J7DA 1O68A 5AHMA 3F4CA 1PZ1A 4ZE5A 1P7TA 4E2BA 1O94A 2WV8A 3GXMA 1C3FA 1XI3A 3AHTA 2PPNA 3GHUA 3CL6A 1ZNNA 3KDNA 2E4TA 4LAXA 3OW1A 1AD4A 1RCXB 1K4HA 2QULA 1RZMA 2DVTA 2E6FA 2DSKA 2CLFA 4MY8A 5D9NA 3IAPA 1L2QA 1MW3A 3W1TA 4PH6A 1BYDA 4P7LA 3IAQA 5HUOA 1LORA 2D2OA 1F3XA 4U4MA 3A4AA 3WD3A 1PZ2A 4YTSA 1CDGA 1DKWA 5HNRA 3LX9A 3A22A 3K2GA 2BLEA 3GVQA 3GHSA 2FGZA 3NNTA 1ZAHA 1CIUA 4GD0A 2BGQA 1MXDA 1ZAJA 4L3NA 1LQ0A 4EPKA 1PDZA 3VNYA 2XFFA 3H7VA 2AL2B 4IZGA 3UWWA 1UP0A 2WNQA 4GZJA 4NYUA 4WEVX 1G5AA 2X42A 5BOFA 5HQMA 5EMLA 3RCNA 3G8RA 5G1YA 1G4SA 4Q4OA 5BXRA 3L66A 4N7QA 3LTYA 1DXFA 3RU8X 5LNSA 1CPUA 2ZDSA 3AMKA 1H51A 2XVPA 2HK1A 2DZTA 3CTLA 3TWBA 3RJYA 3W2KA 3ARUA 1JZ8A 3AROA 1HF6A 1CGUA 4IT1A 1CZ1A 5LA0A 4H1ZA 5KSWA 2A4AA 3PNUA 3BMVA 2OO0A 1X6LA 1G9HA 2JEPA 4QJ4B 4QCEA 1UUQA 2R24A 3EY6A 3RK8A 4HARA 3GVGA 3HQ1A 4GYKA 2O9PA 3UY7A 4HK6A 1M5WA 3N34A 1H49A 3TJLA 4DYKA 4MUPA 2WCAA 3S1VA 4N02A 1TIMA 1EXPA 5I3DA 4RNIA 3RRXA 2E68A 4M6PA 1GVEA 3QV7A 5TAOA 1BF6A 1UHVA 4MZ1A 1J11A 4ZXLA 4NASA 3AI0A 4LFYA 5IHSA 4YYCA 4PTDA 3MYPA 3ZT6A 2B5UB 5CSSA 2J7EA 1V0KA 1TX2A 3CU2A 1AQHA 3KFTA 3WLLA 3SCUA 1D7JA 3QFWA 4JICA 1XLKA 2O9OA 4IFKB 4HU3A 1OFBA 2PDCA 4D6IA 5FJJA 5FOOA 2PRLA 3NGFA 1DJNA 4A35A 4MZYA 5DBUA 1MYRA 2IXVA 2TRSA 2FTPA 4M6QA 4FLSA 3CZLA 2E8ZA 1DBTA 4JS3A 3PHAA 4N6FA 3THQA 7REQB 5TIMA 3W22A 3W6LA 1GOOA 2WXDM 1CLKA 4FXSA 3SZ8A 2I5QA 1EIBA 1XF0A 3VIHA 1JYVA 4LAVA 3QYQA 2OFNA 3F4NA 3S2LA 4E3VA 4TV5A 3DFPA 3AXHA 1TWZA 3W7OA 4XAKA 1NP2A 3QZEA 4DH0A 3K8MA 1TWDA 4KPLA 2R1MA 4D72A 1OT1A 5DXXA 4RDYA 3DYPA 1O66A 2IPJA 3JZEA 5AC5A 3G1AA 1E55A 1W0MA 3M0JA 1PDYA 3NSXA 3C5QA 4UQEA 5IDIA 3MJMA 3N25A 1WZLA 4JCMA 1CXKA 4QT3A 3S47A 3PTKA 3N9KA 2Y88A 1W3JA 4X61A 1VBHA 1RH9A 3LEPA 3MP5A 4QRNA 4O16A 1M53A 3NZPA 2QUMA 4HHHA 4D6EA 4UZSA 3G22A 3K30A 3EWBX 4QLJA 3CHFA 1X39A 1VFTA 4H9TA 3GR8A 1JQVA 1MXGA 1LT8A 4LF2A 3N04A 1A5BA 2FKEA 4AWTA 1KLZA 2WVSA 3GVWA 1NOFA 1YTDA 3UGRA 3NO5A 2CZFA 4RV8A 1GKPA 1SM9A 3E5PA 3HF3A 3EWZA 5BMXA 1E1CA 5G2IA 3UETA 4ITZA 2J24A 3UQNA 4O13A 3PZMA 2QAPA 3VKBA 3BV7A 1E72M 1E15A 4Z1CA 2XU2A 3RDKA 1Q4NX 2X2YA 3ITGA 4B5VA 1K7FA 3OJGA 3B0YA 3M5XA 4HK7A 2DFAA 3M43A 3B05A 3FV9A 1JUKA 4MB5A 5K4ZA 1ITUA 3CHVA 1ZHAA 1DHPA 2PDUA 2CPUA 3WFZA 1W3IA 4Q22A 4A3UA 4LAOA 2PLJA 3B0VC 3MCNA 1V0MA 2G3MA 2CU0A 4NZ1A 2RSEA 2WVVB 1VD6A 2P10A 3BCFA 2NQ5A 2OOGA 1XH2A 3VAVA 2QPXA 3AO0A 2Y8VA 1JCTA 4RUBA 1YLVA 4NAFA 5DX7A 3NQAA 1BF2A 1QPOA 1OBAA 4H9ZA 1CLVA 2PCEA 2GGHA 4JTCA 4S38A 1X38A 4JNMA 4F2UA 2D2HA 3RGCA 3ABRA 2VX7A 1U1HA 3WN6A 5HPOA 1RK6A 3N2XA 3GG7A 4Y9NA 1NJJA 1AFSA 4CKQA 1QO5A 3BARA 2G96A 1TA3B 1XCXA 4L72B 3V16A 1UD8A 3VX0A 1SGJA 1KM6A 3KOFA 9RUBA 1W2PA 1SZRA 4CD6A 3WH0A 1FDJA 1HKJA 1W5MA 1T8XA 1SVDA 5E0FA 3MS8A 1KM1A 1BKFA 4AWSA 3FIGA 1K3UA 4ZOEA 4NAFB 4XISA 1RVGA 4ACYA 1WZAA 4F2TA 3H2FA 3CHCA 1FKJA 1GPFA 4BF8A 4C6BA 4D9PA 7CGTA 2CLOA 5G2WA 1ADOA 2V30A 5C55A 4UNKA 3UESA 4YWSA 1H0IA 3A12A 3BUVA 4AMCA 5HNNA 1P48A 2Z1BA 2KFWA 1TJ2A 4NQ1A 1QDSA 4PL1A 4FNSA 3MSYA 1XKYA 3TYAA 2VENA 1SO4A 3NOEA 3FK4A 2J8GA 5EMMA 7REQA 1E70M 4EAYA 2ZX7A 3OA5A 3LSBA 4IMDA 3KL5A 1MW1A 3P81A 4R34A 4YU1A 1LDCA 3QPYA 3TFXA 3USBA 3NI6A 1H5VA 1PWLA 2VZVA 2Z2UA 1ZENA 2SFPA 2D73A 1UROA 3FSTA 4DT4A 3PZUA 4REQA 5A2CA 2Y62A 4OHQA 2DZWA 3BLDA 3WLSA 1CNVA 4XK2A 2WNWA 1XLBA 3RRAA 1LBFA 5J04A 1I60A 3ICJA 1YXDA 4FS9A 2E6AA 1ML1A 2WC4A 1TKKA 3TAOA 3A9BA 1AZ1A 1FHVA 1N2VA 1B57A 4JFLA 3GUWA 1E6NA 2AAMA 4TV6A 1QI0A 5C2CA 2ZR4A 2PZ0A 4IOTA 4YN5A 2ZRZA 3NYDA 4MKNA 2WAGA 3PJTA 3TCSA 2PV1A 4B4HA 1QOPA 3S5SA 4NT0A 3U48A 5A6SA 2WWCA 3ZMRA 4U33A 1BWLA 2J25A 1J0YA 4HD5A 4NXKA 1HKWA 1JUEA 1W26A 5F2IA 3QH2A 4KFOA 1QI5A 4G50A 2PSNA 1T40A 2FZ8A 3DGBA 4GINA 4IP5A 1FRBA 3W26A 1TG7A 3MHUA 4WY0A 3QW4B 4IQJA 3GTYX 2C71A 3HO8A 3SQSA 1PIIA 1GVSA 4LT9A 2HMCA 1XG4A 2Q8ZA 3SN0A 1VBRA 4W8LA 2ZXBA 2OEKA 3UJSA 1SJAA 4K8EA 5FAJA 4AF0A 1CLXA 4EWJA 2WMIA 2Y6ZA 2OZ3A 3T0TA 2B7QA 4JFKA 3OVGA 1EJTC 1HJQA 1R9XA 3W01A 3TSBA 1W91A 3DX5A 6XIMA 4Q32A 4IIBA 4HZ7A 1FWRA 4XV0A 4NP7A 1JDDA 3LYEA 1MQPA 4XZBA 4K1WA 4HA0A 1NARA 4J1OA 4XKYA 2YJQA 3H21A 1J6YA 3SGUA 5LNWA 3EWYA 3TLQA 3NA8A 5DMLA 1JAEA 4ODMA 3ZVIA 1YRRA 4LF1A 3S9IA 2IKJA 4Q8UA 4I8YA 3NQBA 3OG3A 2FHCA 5H2ZA 5LHEA 1YXCA 1JXKA 3DGRA 4OJYA 1FKHA 1TPC1 1S5TA 4U2ZA 3NQ7A 2QDEA 5LIWX 1FKSA 2Z6JA 4O52A 1ZUAX 1G01A 3NM3A 2V81A 3B7XA 1H62A 3IS4A 4WK9A 1VB9A 1JPKA 2YCEA 6TAAA 4V33A 2PZNA 3WJSA 1XRSA 3VDBA 3P2VA 3N4AA 2GJNA 4AIBA 1RA0A 1F3WA 4O4WA 3GR7A 3THUA 2AMXA 4EX4A 1S3TC 4HBOA 3PK7A 3GAYA 2PRMA 3TYBA 4B3ZA 4C6CA 1VCVA 4YVPA 3VNDA 4IP7A 5CBJA 2ZXAA 1DORA 4ECLA 3UZZA 3MSDA 1CCWB 4HPGA 1T11A 1TIWA 4IQ2A 3W74A 1FWFC 3S1UA 5M17A 3S42A 2CLLA 3GAKA 4HMNA 3E0IA 4WDWA 1P1MA 3U5UA 1ODUA 2VRJA 1ITCA 1D7FA 1E6PA 2ZCGA 4HJWA 4TX8A 1OCQA 5K4XA 2AL2A 2UY2A 2AGKA 2QHAA 2O4QA 1FHLA 3AHYA 1A5NC 4TTUA 1UP3A 3NGJA 3QZ6A 4ADUA 2OKOA 5HMFA 3WD1A 2G3FA 2BY0A 3KWXA 4OECA 2PD5A 4J3ZA 3AIWA 1FH9A 2Z2AA 2PTDA 1M7JA 3RX2A 1KR0A 4DO6A 3STCA 3AZTA 3W7DA 4CGTA 3EX4A 1UWUA 3UBPC 1EC9A 4NZCA 2EAWA 4R33A 1KFKA 1J8VA 2QKFA 2ZUTA 5M3WA 5BW6A 3G1FA 3WBYA 2PDWA 3LA4A 1IR1A 3FJLA 1UD5A 1VJSA 4CNNA 1OCNA 2ACRA 4KCWA 2ZRVA 3L0NA 2XVKA 1OWQA 3WQ4A 3ECQA 1LT7A 2BB0A 2EPLX 1J4IA 3C2OA 3IJ9A 4W9PA 3VKDA 2REQA 1AMYA 4IIDA 3TCZA 1M1BA 3R0DA 3ARYA 3LXAA 1OGBA 1X96A 1YBQB 1GQNA 1TPFA 4X9SA 4MGGA 3OEXA 4A8IA 4AB4A 4UB9A 3RX3A 1DVJA 2ZWZA 5HBFA 4AEFA 3T55A 2CZVA 3VVGA 4AHPA 4CEUC 4K1GA 3EIPA 1ROUA 4WR3A 4J2MA 2Y8KA 4NNCA 3NAVA 4NJKA 2ZZ2A 2YX0A 4A3RA 1QNSA 5T9BG 4Z2JA 1PTAA 1D3GA 3PRBA 1OC7A 2GJPA 3AU6A 2XIJA 3I3EA 4UTWC 4A3QA 4PB5A 3ZXWA 3BVJA 4IGMA 2PTZA 3A3WA 3BMXA 3AIUA 1EPVA 1OY0A 5A6BD 4TIMA 3L5AA 1H5YA 3WQDA 1WAUA 4KCVA 3TQPA 5HJYA 1O5KA 1UC4A 2OQHA 4GUIA 1GWJA 4LS0A 2XINA 4HNTA 1F6KA 2FH8A 3WLPA 3WENA 4Z17A 3CBWA 4ZB5A 2CZ5A 4PRRA 2PODA 2GYIA 2Y4SA 3UZJA 1W1TA 2JF7A 3CZKA 3IIOA 1PUDA 2J47A 5FEXA 4DI8A 2ZX6A 4NZ5A 1EEPA 1PIFA 5MKGA 4TUFA 3GY1A 2V5DA 3LDVA 5FCZA 3LM3A 1K8ZA 3GH7A 3R7MA 3GXPA 1ONEA 2A7RA 2Z2BA 3BLKA 2Z00A 4MMWA 1UWTA 2EXOA 1E0XA 4LWWA 3BO9A 3N19B 4OV4A 2BFGA 3EB4A 4ZE4A 4Y9MA 4E8GA 3FEMA 1H4PA 3ARPA 3WH6A 3S3GA 4L6HA 1TZ7A 1KKRA 3M5VA 4HCLA 3GWQA 5CZSA 1PKMA 4UDMA 4B3LA 4Q6XA 3V1PA 3PZ9A 1OIFA 1O60A 4BWLC 2DZBA 4IUOA 2RUCA 5CJNA 3NEHA 3BQ6A 2CBIA 5E0KA 3CASA 7XIMA 1RSCA 2TSYA 3FNDA 4HK5A 3DERA 2INZA 2QPSA 4K37A 5HNTA 4MAZA 2E3ZA 4XG1A 4MVAA 5F2MA 4M1BA 2ZDRA 4UOJA 4H41A 1GZJA 1MI3A 4PB4A 2VOMA 1S2UA 1EUAA 3PTQA 2OYLA 3OO2A 3JU2A 3ES7A 4UFKA 1XSJA 3VNIA 4PC8A 4RV3A 4LJ3A 3PRDA 4WDTA 1MDLA 1XLCA 4LVGA 2PLMA 2H3DA 2E6YA 4JHMA 3HV9A 4WSKA 3D6NA 1FX6A 1D8WA 3VIKA 3S6TA 4W9TA 2E9LA 2C8NA 4MJ2A 5T9CE 3KBNA 4DRHA 2ICSA 1PBGA 1ZS2A 4GG9A 4B5WA 2QZRA 4GY7A 5I3GA 2WMFA 4GXPA 4UQBA 5BWFA 1J4RA 3BOLA 4AHQA 1PKYA 4JL2A 3VDCA 1VFSA 3GFXA 3GIYA 4CU7A 2YL6A 2EG6A 1Q3NA 3WH8A 3QM3A 3MCOA 1FKLA 4OU1A 3CT2A 2W67A 1A5CA 3ZVHB 3T2PA 1CGVA 3TDBA 4C5ZA 2YXXA 3MI3A 3DI1A 3B06A 2X8RA 1K7XA 2QCCA 1DP0A 2PCQA 1ZCCA 3G1SA 2QIIA 1EPXA 2QAFA 3M5ZA 5TF0A 5HDRA 4NJJA 1Q6OA 4I9AA 4BQ3A 3UNTA 1O95A 2OO6A 4W8AA 5I06A 1BEUA 3PA7A 2J62A 4INFA 2E9BA 3W7IA 1EYMA 1GORA 2NT1A 2QCLA 4HU0A 4PYSA 5ECUA 1XGEA 5DBTA 4HU8A 5AB3A 5CJMA 1XYAA 1BFNA 3FKKA 4XTIA 3FFSA 3OIHA 1PTGA 1U5VA 2V0TA 1N55A 4ALDA 4GIAA 6XIAA 4P8UA 2P8BA 3KBJA 3FOKA 1ISVA 2E1WA 2VYOA 1GKQA 1GVFA 2DV0A 4NX0A 3ARTA 5DANA 1Z7AA 1P7TB 4RKAA 5JH8A 4HU4A 4ERGA 1FCVA 3N73A 2VRKA 2VOTA 2GDVA 1GOIA 4P2VA 3UWQA 1EUNA 3XIMA 3QY7A 3M44A 2FMNA 4HGXA 3FS2A 3CT7A 4QJ3B 3NQGA 4L9YA 4ZQNA 4QSFA 5I3HA 2Y8UA 1RY0A 1JCHB 4JFJA 1H7WA 1GOWA 2A5HA 2HVMA 2YL9A 2NSXA 1DQWA 1QHOA 4B5NA 2PDBA 1MSSA 1ZY9A 3LRMA 3W9ZA 3KTCA 2BHUA 3T1GA 3GNNA 4QDPA 1WOAA 3AMCA 3T0AA 5C9WA 3FLUA 3UY8A 3CV1A 3GBDA 3DHPA 3IUDA 3PS7A 3N17A 3PWAA 3L7RA 3UZXA 5FJUA 1A4LA 4TVDA 1Z9AA 3LCXA 3BPWA 1XLMA 2V3EA 2VFHA 4Q8NA 2Y5SA 1YNQA 2H90A 1CB2A 1TUFA 4KWUA 1AJ2A 4U31A 3EB3A 2F38A 3RYSA 1MNZA 4AZCA 1WOBA 3B3DA 1EJ7L 1TCOC 4Q8TA 4KKXA 4EF9A 4J3XA 3CL8A 4UTMA 3N6HA 2JK2A 3W1AA 3GW0A 4CCCA 3D46A 4RZ5A 3LV5A 2OZ8A 3UJFA 4MPQA 3W0KA 1S39A 1PE1A 3WF1A 3E74A 1EJSC 2BXVA 1EZ2A 3VD9A 1F3TA 3H2OA 1W9XA 3VCNA 3K4AA 2OMAA 2WHLA 2XSAA 3KZPA 1KM2A 3ONBA 4Q6JA 1X8FA 2X1RA 4RW3A 2VGGA 1B3OA 1GNXA 1A5LC 1WPCA 2B7PA 2PDIA 3BAXA 3A4JA 3CL7A 4KEUA 1GQJA 3N14A 3LK6A 2G3JA 1DJYA 3KEHA 4PB3A 3P5YA 4BQ4A 3WF4A 3CHDA 1FVPA 2EPMX 4O10A 1F40A 3CV2A 2YBTA 4LXFA 4GYPC 3ZT7A 5AYXA 3S4TA 1A7XA 3IGHX 5BWAA 2J9XA 4CQAA 3WNNA 1UBSA 1ECQA 2HE8A 2PU0A 5AHLA 3R5EA 4LQ1A 1ONWA 1WXJA 4LAWA 3U6WA 3QPEA 5HKGA 1TV8A 3LCGA 2ETNA 2WZMA 4H83A 1J18A 2CXEA 3I7QA 2PDGA 3F2DA 4B9YA 1FDZA 3LHVA 1MQQA 3OA3A 3AS1A 1XIJA 4XAPA 2OLSA 5CPTA 3NQVA 2V9DA 3FN9A 3KS6A 1GJPA 4H2CA 4CNOA 4BFAA 1Z42A 5DCEA 1XLFA 5H91A 3WNOA 4CNUA 5B7ZA 5A8MA 3QHNA 3DHUA 2B7OA 2ADAA 4X0NA 3BSGA 2NSOA 3TW9A 5F2LA 1LZOA 4C6OA 1JZ6A 2LPVA 1BYCA 3ITOA 4ZGYA 4GYJA 1AW2A 1D3HA 4UFHA 4DLFA 1Q6IA 2ZA2A 2X7VA 3NO1A 2DT1A 3IJIA 3I6EA 4UTTC 4F0HA 1V6XA 4HBEA 5CPNA 5FF0A 2FVLA 2GK1A 3O5PA 1KXTA 3NL5A 5EYWA 4LANA 3B8UA 4Z1AA 4GI4A 4J35A 1DWJM 1RP8A 2D0FA 3EYPA 1WDPA 2Q5AA 1EQPA 3AIVA 3OQ8A 3O5JA 3MDWA 1PV8A 1RLDA 2QJNA 4HNNA 5HT1A 2VHLA 3T0DA 1Q6QA 4ODNA 1M3UA 1R9HA 2PS2A 4GUHA 1J0ZA 4L80A 5DXYA 3EWDA 4JTHA 5REQB 3NTYA 4GH3A 4LNCA 4Z08A 1NTHA 3IVUA 1AZ2A 4A3HA 4Q7IA 5CSUA 4MNMA 1JNDA 1VCGA 3VZYA 3AMGA 1E6XM 5EY5A 3MI2A 2VR4A 5F2GA 4WVXA 4PRWA 3CPRA 1OZMA 1M6JA 1Q6LA 2DUAA 2XJ7A 4JTDA 3IRSA 4KFNA 3PZVA 4E0CA 5B80A 2XPKA 3F5KA 3CB3A 3WLIA 4D8LA 1UBPC 5AHFA 2WMKA 1FCBA 4A8RA 1UPPA 3NPWA 4MZ8A 3QYSA 3S9ZA 1OJXA 2I9EA 3MSGA 1A80A 5A95A 3IGUA 2HXTA 4UTHA 1AODA 2XP4A 4WGXA 2PD9A 2RGLA 3DN5A 4QS5A 4DXKA 5BYWA 3Q65A 1FKGA 3IJ6A 3BGAA 1I2RA 1AL8A 1G69A 4UTTA 4DO4A 2OPJA 4LAMA 3GKAA 3PZOA 1XDJA 2ZICA 5A69A 1A5AA 1Y65A 4PODA 2QV5A 1GOXA 4O1BA 1FQ0A 4H8UA 2R1PA 3U5YA 2YXGA 2FVKA 3LENA 4N9BA 4X63A 4KCUA 3VE7A 1W9VA 4US5D 2VCAA 4TTGA 3SCTA 2WMJA 1CI1A 1RQHA 3G0UA 2I5IA 2XFRA 5BZAA 2CHOA 2Y2WA 4LALA 5FEWA 1WDWA 2J4GA 1T96A 1YADA 1IYXA 3QZAA 2DJXA 5I00A 2PAJA 2PWVA 1TFVA 2RDTA 4E8CA 3W2LA 3W86A 3KE0A 3TONA 5A2BA 4Z1YA 2VT0A 3MKVA 1F74A 3UR8A 4B2DA 3JS3A 5EBAA 2FGBA 2PI6A 3SSZA 3AIEA 3TP4A 5D2XA 3EOUA 2GGEA 2ATMA 1Q2RA 1O6IA 1Z44A 3VXGA 2NV1A 1FTXA 1I9CB 1O4UA 3RXZA 1BTCA 5CLTA 4YYFA 2GJLA 1PKLA 4JKKA 3DHDA 3G3DA 2GVYA 4H9VA 2WNNA 3N15A 3SJ3A 3PB2A 4KS0A 3PSVA 3NFUA 4DROA 1WXYA 1VQTA 2FZMA 1HKIA 4UNLA 4DY1A 4EXQA 1WDSA 2H3BA 4GGBA 4WQ6A 3BOFA 1FOBA 4A22A 3V0TA 5H8MA 1E5NA 4GC3A 1VAHA 3UQBA 4PBFA 1B4KA 2V67A 3AHVA 4W88A 2PPOA 4EF8A 1EF2A 4L5ZA 3KUMA 3AYTA 3SRDA 1F6PA 3GX9A 1TE1A 3CH9A 1UG6A 1G94A 3EPMA 1EO7A 4I7UA 3WYZA 4ZZ9A 1OC6A 7TAAA 2QCMA 4JD4A 3KL0A 5C70A 2BASA 3V36A 3UEQA 1R3WA 2Q8LA 1VPXA 4OQVA 5D8ZA 3O5DA 5DF0A 3UNDA 2J6VA 3WQEA 2BV9A 1XYBA 3CAKA 3KBWA 2VQTA 1ZQ5A 2PBCA 5TBOA 3PNZA 5D2YA 1E4NA 4RXFA 1W1IE 4C7DA 5HJXA 2BTMA 2P88A 3C4UA 2LKNA 1H7NA 2YCJA 2ANUA 2DW6A 3M7SA 3MCMA 1Q66A 2DSZA 4E4FA 4C6FA 2XIQA 2C14A 5CPLA 2WANA 3EKLA 3CZ8A 3B0PA 1W1PA 4NILA 3P7YA 1SUXA 2DP3A 4W9OA 4QJ5B 3M6YA 4WRHA 3ABSA 4YLWA 4QROA 2OYKA 3R10A 4JTUA 1TWSA 6REQA 3UU0A 4UQAA 3PBUA 1XICA 1BL4A 3AMDA 4XD6A 3QBUA 4EPDC 3NUKA 3B8VA 4QM1A 4PUMA 4NNRA 1QPRA 1PBKA 1GG1A 2V3GA 3EMQA 2QUNA 4LS2A 5JIPA 1YXYA 4XZHA 4A2RA 1BRLB 2BVWA 1E6SM 2JZVA 1FKFA 1XJBA 4JYSA 3W25A 1W56A 2OSYA 2ZX5A 3H23A 4PEKA 3DEQA 2WJFA 2GZXA 4B91A 2FIQA 3CWHA 3RLGA 4G1KA 3WQVA 2QNEA 1IHIA 3H9RB 3S2CA 1UWSA 3RFWA 1YE4A 4P61A 3HJEA 3IIVA 4Y7EA 1FWCC 1FKTA 1XQLA 1LBLA 1JIBA 3B8IA 3UXIA 5D9MA 4JNYA 3BAIA 1NDYA 1ICSA 1OX4A 3W3OA 3G24A 3VFLA 4L61A 3AISA 4R88A 2J13A 1GVRA 2BSLA 3QQ0A 3UI5A 3NZQA 2P0IA 2QJHA 1N8WA 1Q6CA 1KW1A 1L2UA 3TFCA 1RD5A 2DU2A 3EBVA 4ZS6A 1OABA 4J4OA 4LB3A 4C6EA 5M1TA 4HSOA 2Y24A 3T4CA 2GDUA 1XBYA 3G0XA 1J4EA 3V7PA 1S46A 3DFHA 5D32A 1PXGA 4ZB2A 3HGRA 1J93A 4I9JA 4K38A 3EA2A 2I9UA 5HNUA 2BDQA 1I2OA 4WSJA 4J2PA 3W84A 1UKOA 2BOFX 2Q02A 4Z2IA 3MMWA 3C3UA 1JPDX 1TYGA 3G1HA 4XAGA 4YTRA 2XVNA 3WL1A 4IJBA 2GVGA 5HUAA 3GDLA 5FAGA 1JULA 5AYZA 3D0CA 1FHDA 3ZFHA 2NVAA 1VFOA 4MJ4A 1TV3A 4MNLA 3GH4A 4DJDA 3SW6A 3W7NA 1LQAA 4LCRA 4RCXA 1J0HA 5AYIA 1UYQA 2O9TA 3BE7A 3M64A 1Z6KA 5T8GA 3R89A 1G1YA 3M5YA 1B31A 3W02A 4NNAA 4DXXA 1LM1A 3S5OA 4O11A 2XH4A 1U5HA 1CYGA 1ZAIA 3CZGA 3PVFA 3R6IA 1EQ3A 3TSMA 1B3VA 2VKZG 5BOEA 1E44A 2RURA 1JDEA 2XM2A 1P0NA 4FA3A 4MTVA 4NI3A 1U1JA 3VGGA 2EKCA 3APGA 4LEQA 4GE8A 1T0OA 3LCLA 2BG5A 3OBEA 2XN1A 2Y70A 3CTTA 1FWSA 3NCOA 5GNZA 1VEPA 4XTDA 2ZXQA 4HJFA 1B2YA 4HBKA 2F2KA 1TB3A 4PZVA 2N87A 1XXXA 2OU4A 2FKPA 4G7FA 3N2TA 1C8YA 1DE5A 3QF0A 4PTNA 3SCOA 1YMYA 2WPBA 2EG8A 4DUOA 3W7KA 4U5KA 1TREA 1H11A 1R86A 4JQ4A 3VFCA 3V0UA 4US5A 1C7TA 3GXNA 1ECEA 3CAVA 3DG3A 4HNLA 3HV8A 1FXQA 2BVDA 2OOFA 1GZGA 4JTRA 2C3ZA 1PZ0A 5CPMA 4XKYB 2OWWA 4GX9A 3EX6A 3W88A 4F0KA 3REQA 1YEYA 1OG0A 3H2NA 5FEZA 3F2CA 3P60A 2WQDA 1RD6A 3AIBA 3QY6A 1HO1A 4ZENA 1UQYA 2V3FA 4FIRA 2HTMA 4M7TA 3H7UA 1DTUA 4OBTA 4S3GA 3URAA 4ZPTR 1R46A 4LBUA 4GC4A 4E5TA 1UOZA 4YS1A 4H00A 4Q8OA 1IEIA 5K2ZA 3W81A 4C02B 5GVJA 4FOUA 2VVNA 5IFPA 4KETA 1OX4B 2UBPC 3BGJA 4XAFA 1KXQA 1KQZA 5D8WA 2MLYA 2YDQA 3PUGA 3UG8A 1SW0A 4A3YA 4QXIA 1EP3A 3NQDA 1R9YA 1JZ7A 1L8PA 3A21A 5TQLA 4IXXA 2FH6A 1H41A 2Y63A 3AJXA 3E0VA 1HW6A 3VIIA 2YYUA 2OZ0A 4MAVA 2DSVA 1L6SA 4ILSA 2WSYA 1U22A 5CC7A 3TJ4A 2DZPA 3SCRA 2E9MA 2KAUC 4JOMA 1FWJC 3TE9A 3NDYA 3SIMA 3EOSA 4H8VA 4GI8A 1JYWA 1MRQA 3L0KA 3GDTA 2ZTKA 4IQEA 4DAFA 4DYEA 1C7SA 3LXCA 3RLVA 1Q13A 1SFSA 2PFHA 3MO4A 1C9WA 3RF9A 1IR2A 5AHIA 2XP5A 1BWVA 4DN1A 3R8GA 3WJWA 1UUOA 1POJA 1W3NA 1W9PA 2RDUA 3PWIA 3L4ZA 4UOZA 3TQKA 4IF2A 3VOGA 2JIWA 2PWHA 4JIEA 3CLWA 5CZKA 3VGHA 1JCYA 4O50A 4GYPA 2E5BA 3DYMA 1JL8A 5CH9A 4C6JA 1IWAA 2WSRA 2DPEA 4GX8A 3MI6A 4L7ZA 5L6UA 2INEA 3ME3A 5L9FA 4HT3A 1A4MA 1IXOA 2TODA 4AVFA 3URBA 2CKRA 4GOAA 2QVHA 1LLWA 4QZVB 2GWGA 4ZO6A 3I6CA 4NZ4A 3U9IA 3WUFA 1KO0A 3FW6A 3G1VA 4Q4QA 5EU9A 1I75A 1V6UA 4PUEA 1QWKA 2ZZ1A 1THFD 3T07A 1KM4A 1HG3A 3NQFA 4QDMA 2C1HA 3IK4A 3BJSA 2W62A 4HCHA 3MHFA 4ZOBA 3C2YA 1LUCB 2QCHA 1TPEA 3ZYZA 2CITA 2Y1HA 3MANA 2XSBA 3TV8A 1MWOA 5C9UA 3L2LA 2RUSA 3HA1A 2DY3A 4UR8A 1XH1A 3V0SA 4Q8QA 3JYJA 3O0KA 1WDQA 4JTEA 4CQDA 2J77A 4JKMA 3C2FA 4IMCA 5T91A 4LUSA 2HWGA 3O5IA 2YLLA 1F4HA 1P1XA 3TJIA 1X6UA 1VEOA 3SUSA 5E93A 1X98A 4ES4A 3P80A 4I7VA 3WF0A 1RAKA 3N6JA 5EMKA 4XD4A 1L8NA 3UP8A 1JVWA 1E6RA 4GIRA 4F8XA 1EFZA 5D2VA 2V3DA 4ZSUA 3CXOA 3KCEA 2D1ZA 5FJPA 2O0TA 4YXGA 2F2HA 3GO2A 1UD6A 3IUIA 1I45A 1CGTA 1YTEA 5FF3A 2W66A 3T2OA 3SCQA 5CKSA 1VBGA 4L6DA 2D22A 5GJNA 1HP5A 1Z41A 3DKLA 4ZOCA 3E96A 3GYCA 1QNOA 1FDYA 1VGAA 3LBMA 2B0MA 3HGOA 3VINA 4JTJA 5HQEA 1O1HA 3WJYA 1IV8A 4HN8A 1E56A 5EMYA 4PUUA 1IT8A 3ONCA 3QR1A 3O6CA 2Z1SA 3W1PA 1IWPA 1BVNP 1B0IA 1F8IA 3DIPA 3CLMA 2RJHA 5CXPA 2C1GA 2C18A 4ODPA 3IWPA 4H9XA 1UD4A 1XDLA 5A1AA 2G95A 3T6CA 2YBUA 3VOFA 1OVDA 2YKKA 1GQKA 3GU9A 4H7VA 3QGVA 4KEZA 5CEWA 3R8RA 5JUVA 2HQAA 2WO5A 5F4WA 1BXBA 3GDBA 3DKJA 5DMNA 4P8XA 4HPXA 4AU0A 1D7KA 3TJXA 3O5EA 4JX4A 4WOQA 1VJIA 1IXPA 1UH2A 1DHKA 4M29A 1TJ0A 3V3WA 3WH7A 3SGZA 1XIHA 1SJDA 4DZ3A 1XFBA 1YPFA 2WMIB 3THCA 3IJ7A 4GI6A 1NELA 3CO8A 1TVPA 4MKVA 1OK6A 4JTTA 1OFPA 1J0KA 3H24A 2E09A 1B54A 3ZJKA 1QNVA 2XFWA 4GVIA 1MFVA 4HQVA 4X2RA 2E0PA 4C7GA 1ZK6A 2WZHA 4I5UA 1YPXA 2RGMA 3MUIA 4AMAA 3W27A 3QLLA 5DO2A 2BY3A 4XIAA 2CEQA 1S2WA 4K3ZA 5G4EA 3WL0A 3UZWA 4QP0A 2VC5A 1L6YA 1QNPA 5LGZA 3VX1A 3RMJA 4ODRA 3HQPA 2OT1A 3UA3A 1X7IA 1WX0A 1FY6A 1L6WA 4XZMX 3PJWA 3AS3A 2VZSA 2PDYA 1ADSA 1WDDA 5DT5A 3BL3A 1NSGA 4Q3MA 3STFA 1XDMA 2YSWA 5LHFA 3U4AA 3HBLA 1FKIA 2F21A 3QMTA 4ODQA 1FWTA 2OG9A 4XKMA 2FPTA 2AAAA 2R91A 5FF4A 4YL2A 4UFJA 4IPXA 1XINA 1YDNA 4OOZA 3ZJ7A 3NL2A 1KV5A 3FHAA 2B4GA 2FQIA 3UJEA 2KZHA 3O5QA 4DO7A 5AKQA 5LA1A 3HMJG 1BYBA 3SJNA 2PTYA 3RO6A 4FXRA 1BPLB 4IT6A 3GC2A 4M6VA 1HXJA 3BTNA 3CUHA 1BYAA 1XLLA 1VS1A 4ZXOA 3VIOA 2H6RA 3OGSA 4W85A 3MUY1 4PMOA 2DG9A 1XWYA 4O8AA 4GNJA 3PZQA 3Q37A 1DJIA 4NJGA 3S8HA 3G3MA 1U1UA 2O7SA 3AFBA 2YFOA 3RPDA 2CWXA 3IPWA 3W28A 2VDIA 3C0QA 3CPUA 1DWGM 1VBUA 1S2TA 3SCVA 5I23A 1E0WA 1XUUA 4RZ4A 4M8UA 5A6LA 2V69A 3UG5A 2W79A 4PUKA 4BK9A 1IT0A 1NF7A 4NHVA 1IF2A 4KRUA 4IIEA 3WK0A 3ZVHA 2J9YA 4NL1A 4JYEA 2PWGA 2YW3A 5F4XA 3TTQA 1CXLA 2WKGA 1LJYA 4GZ7A 4EACA 5KMYA 4E2OA 3LUOA 1Q63A 7ENLA 1UR4A 2VRQA 3G8EA 5G5IA 1CWYA 4DB7A 4GQRA 4PMDA 2V68A 3FVDA 3DC8A 1ZL1A 1G4PA 2Q6ZA 3QTGA 3R2GA 4LPCA 3SUVA 1RBLA 3O5MA 3PTDA 1TO3A 1R7OA 2BY1A 5BRQA 1JZ5A 2PA6A 3S2MA 3UXDA 1JF5A 5EBUA 3RO8A 3GSMA 3IJQA 1AL7A 1MQRA 2PP0A 2F6XA 2FFCA 4NI8A 1QI2A 3LCWA 3GNOA 5FJRA 3MV01 5C2XA 1KWKA 2A3EA 4FNQA 3DENA 2E25A 5LIXX 3SN1A 1E73M 3RM4A 3O7UA 2XPBA 2IW0A 2VFIA 4FX8A 1EGVA 5M5DA 2ACQA 3HPZA 3GVVA 2GJXB 1H1NA 3S46A 1ZJIA 5U7SA 1HFBA 1W5QA 3WBXA 4YTQA 3VMOA 3N9SA 4U10A 1QPKA 4KEVA 2ZQUA 1DYSA 1YNYA 2OQYA 1K1DA 3DBNA 4ODLA 2O56A 1QNRA 3CGMA 3H55A 2OSXA 1KKOA 1EC7A 4O12A 3CIWA 5U4NA 2X1UA 2CERA 3ZR4A 2ISFA 1UWAA 3A13A 4RL3A 3HM7A 1JQXA 1AVAA 3QR0A 2R9RA 4OVXA 5KEZA 2G4FA 1R3RA 3SGGA 3AUJA 2JKEA 1QI3A 2RAGA 3B4UA 3LI0A 4OZOA 2QJIA 3CQHA 1Y8BA 1H61A 1L0PA 2RDXA 4O15A 3DC0A 4UIOA 3OZPA 1M68A 2QXWA 1TV2A 4FF5A 2CHNA 3URNA 5CG7A 2P0OA 1Z8AA 2GJXA 1Y0OA 4O1CA 4C60A 2QCFA 2VQUA 2C15A 2YCKX 2EEXA 3E5BA 3Q4DA 1ME7A 4GXWA 4AG0A 3S1WA 2AQOA 3S0CA 1HKKA 3OZMA 1Q5MA 4B3KA 3TR2A 1NM9A 2E40A 3PFMA 4HB7A 2CFFA 1O12A 4DRIA 4TQTA 2ZTJA 4Y9PA 1NDVA 3TC6A 4FLRA 3P8IA 5ABTA 3CWOX 3BW2A 1KCXA 3FDKA 4HA1A 5DLCA 1S2AA 5I3JA 4NZFA 4MGVA 3QSTA 5C0QA 4IG2B 4B90A 2L2SA 2FZ9A 3LMZA 4PTWA 1C9DA 3T0BA 1BD0A 3CMJA 3TLLA 3WK3A 1J5SA 3C61A 3W6YA 2G0WA 2O4MA 1DJWA 4EVZA 2GSEA 4E6MA 2DIJA 3CH0A 4CVUA 1QT1A 4LC8A 4AZHA 1EOMA 2W4XA 1RHCA 2QGHA 1W8SA 5KZ6A 4Q33A 4GH1A 4N4PA 3TEVA 4ODKA 4NZ3A 5FJIA 4A29A 4W7VA 2GJRA 1HKMA 1D7HA 1LL6A 4B5SA 2XZ9A 2OVLA 4RK8A 2X41A 2XGIA 5E6ZA 1V51A 4G1NA 4HVXA 3GU0A 1VH7A 3VIGA 3NOYA 3MDYB 2ZZ7A 1LRNA 3FYOA 3ISIX 4Y8EA 3FA5A 3IEBA 5BXJA 4A8LA 2VUYA 3KHJA 2PWUA 1Q2SA 2R82A 1HJWA 3SCSA 4U85A 4RNJA 1VFLA 3G2GA 3EOLA 4N6EA 5ECVA 1V77A 4J7RA 8TIMA 1PX3A 2HJPA 3ELFA 1RY8A 3R13A 2D0GA 1EX1A 2Y5JA 4WJEA 1V08A 2K8IA 4QE1A 3XISA 2MLXA 5ABGA 5M2FX 2IQ0A 4RPQA 3B0UX 1E4MM 1XPGA 2D9FA 3LHWA 3CB8A 4L1WA 4JN6A 1TPDA 4G2DA 2W63A 4DQWA 4DM2A 4TXEA 1LOSA 4DI9A 3PUDA 4CNSA 4GY0A 4MNKA 3VUSA 3AS2A 4FAPA 1P5BA 3BLPX 1DJGA 2D0HA 1LLZA 4ORMA 5HW8A 1TMQA 1VRDA 5LNUA 4W9QA 3GQYA 4UC5A 4GXMA 5BXSA 2VWTA 1OFQA 3AICA 2NQHA 2WJDA 2XN0A 3TA9A 2V63A 3QRHA 3U2CA 4DWDA 3L21A 2XDFA 1NDWA 2HS8A 2QDDA 3OGVA 3F4DA 1WUEA 1R3TA 3WQWA 4BJHA 5AC8A 3RU6A 2GFTA 3C52A 1UR3M 3W70A 4FXJA 4PMYA 1JI2A 2XH0A 3KVLA 3G6MA 1RV8A 2WNZA 2IQTA 4IM4A 3P0XA 2UY3A 1OX5A 1O1ZA 3UR2A 5DN1A 3O6YX 2PGEA 1ZB5A 5JBDA 1JR1A 1A5SA 4CU8A 4QISA 3SO7A 2B31A 1UR9A 1H63A 3SY8A 1UA7A 4O18A 1EB3A 1IXNA 4TVUA 4FK9A 2JALA 3W2MA 3NPUA 2YIHA 3T0CA 3GXFA 1Q6DA 5K9CA 2OT0A 1FFRA 1P5QA 4LGXA 3LTPA 1TQXA 2VXNA 3PZGA 3I4EA 5CZ0A 2NWSA 3UCCA 3PP7A 2ONEA 3ZLHA 2NQ9A 3VOCA 1QRQA 1P0EA 2VO5A 1UOKA 4MYAA 4EE9A 2W9MA 4Y9AA 2DIKA 4AZ7A 1UWIA 2POTA 3T2QA 2WHKA 2V5JA 3WD2A 3CYJA 4ATLA 2ZZ3A 2INFA 3GDKA 5EMUA 5HMDA 3W1UA 5BROA 4X22A 4XSMA 3KZ7A 3GG8A 3SURA 3S6OA 3SBFA 3PBYA 2ZQTA 3LD5A 4GO8A 1I8JA 4MWAB 1REQA 3LMYA 3BLFA 3IV3A 5LKYA 2D20A 2QT3A 1K6AA 1QPNA 4FR6A 2POZA 4JY9A 2G37A 4AQLA 1OT2A 4QIBA 2QYGA 4MM1A 4PGLA 4NAEA 3SRHA 4GKLA 3KHDA 1HZYA 3W7EA 3DFTA 5J8LA 1ICQA 2W0UA 5PTDA 4QITA 2VX4A 4XWUA 2NXGA 3H2AA 3HOJA 3M1ZA 1ISZA 1X6NA 1OM0A 2G50A 3Q94A 4QAWA 4O4VA 4JTAA 2C91A 1QTWA 2DIEA 2GSJA 3C0JA 4TX6A 2VURA 5DELA 1SZNA 3LHTA 1FP8A 3PZTA 4ZR8A 3HQOA 4I6KA 2QV4A 2C19A 4KH2A 3VZXA 3PTMA 3IANA 4GY1A 3VZZA 2VR2A 3W1MA 3MUZ1 4O2TA 3S2JA 1OADA 1SZGA 3QC3A 3P0WA 3MW7A 3W7QA 1E71M 3GIQA 3WIJA 3BG5A 3SR7A 4BR1A 1REQB 1DQXA 2QMKA 3LGEA 3E6EA 2LLEA 1DOSA 1YKWA 4OBRA 4LUYA 3CM4A 3BC9A 3KAHA 2A3LA 2QQ6A 4CCDA 4QQ3A 4DRSA 4HCDA 4OGZA 4LYKA 4LAYA 3WLRA 1H1YA 4MIMA 2WWDA 4IQCA 1D8CA 2I17A 2WC3A 1SR0A 1WBHA 1A5UA 2Q09A 4F9JA 1QO2A 1XHGA 3DI0A 2PURA 3ITLA 2BWGA 4GISA 1JUBA 4GYFA 9XIMA 1T7LA 2DGAA 3NVTA 3VABA 3QW3A 3JRKA 1B6CA 1A3XA 1H3GA 4DBSA 7A3HA 2F2DA 3VOIA 4FOJA 3BCJA 4E4PA 2GVJA 3MKCA 4PCTA 4WHBA 4ZL1A 1W17A 2P3ZA 2IPGA 3HGSA 4C6MA 3EWUA 3W82A 3LLXA 1WA3A 3W38A 2Z25A 4M3PA 5AVNA 3ATZA 4EK7A 1JCJA 4QDWA 1XYZA 1T5AA 2ZE0A 4CVWA 4EKJA 1YDYA 4XQ6A 3GU1A 4XD3A 1UUMA 1WUFA 2OELA 1JGIA 3F5JA 1K9TA 3GC5A 4FF7A 4C6KA 4BWLA 1KGUA 3IKDA 1MZHA 4Z2KA 3WK1A 4DF2A 3P5ZA 3UYIA 3NDZA 1CTNA 4KR0B 3WEMA 3NZ1A 1A53A 2I57A 5EFDA 4AH7A 5D9PA 1XYFA 3U2EA 1EHAA 3LGGA 1F6YA 2B81A 2CIPA 3B8DA 2PTXA 4HTBA 3ERPA 4GIEA 1JDFA 1W5OA 1JZ3A 4MY1A 2AKZA 3SCPA 3ES8A 4D71A 3UQIA 4AD5A 1BWKA 1J6OA 1XRVA 1U5JA 1X1NA 1MVYA 4ODOA 1X1OA 5D09A 4ICMA 2V2DA 1R2TA 2DZAA 3N2CA 1E4IA 3BH4A 1EX5A 2PN0A 2PDMA 4GUJA 3MP3A 3CQKA 5HR7A 1LP6A 1A47A 3W1LA 4O17A 4JX5A 1XCWA 3W7PA 4XD5A 3LBCA 4KMQA 4FLQA 4DNHA 3WQFA 5I3IA 2CCRA 1C90A 4YNGA 1V5XA 2W6RA 4US6A 2Z7KA 3BURA 1VHNA 4DJDD 1E1FA 4EIVA 1BG4A 1PCKA 4D6CA 3W76A 2ZUMA 1K4GA 1MNSA 4PSPA 3RITA 4JQAA 4LNYA 1BKHA 3ARVA 3KRBA 5HWJA 3NQ8A 4O14A 4JDBA 4WKHA 3E38A 2MUCA 3NPVA 4WSHA 4PRTA 1TUXA 4IFRA 2A7NA 3V5OA 3R4IA 3A4XA 2ODOA 3BK0A 1LWHA 3GG1A 4HZ8A 2VD8A 3WDHA 3AZRA 3GPKA 2HE5A 4A6GA 5A6MA 2EJ1A 4G56A 2HBXA 3H7RA 1VZWA 9XIAA 2VEGA 4LAKA 1UA3A 5BCAA 1V0LA 4QQUA 3EGJA 3AJ7A 3EEZA 3KRZA 3T9PA 3KRUA 1OFDA 3O5FA 3WLKX 4JXCA 2EF9A 2TMDA 2OFJA 2FHFA 3H2CA 1X1ZA 5HWNA 3FVMA 2G3NA 5HATA 4Q8VA 2V8ZA 4IMGA 4M6UA 3H53A 4IJRA 4LAUA 2QJMA 5AFDA 2DEPA 4AD4A 2GVLA 3A4WA 5F4SA 1TJPA 3T08A 3WEZA 3GIPA 3HG5A 5KZMA 4JBRA 3FGCA 2MNRA 1EC8A 3S6DA 3GE7A 4PMZA 4OBSA 1A5MC 2VGFA 3HG4A 1ZBKA 4QNEA 2YDAA 4GBUA 3UXKA 3O2LA 3FYYA 1XC6A 1YATA 1GVQA 2XP3A 3KCJA 5C71A 4X60A 1RCOB 1JDAA 3LUTA 2I56A 3OODA 2VTFA 3TH6A 2JQXA 3W71A 4G6CA 5DCDA 1ZBWA 4D6DA 3PFRA 4Y96A 1ESWA 2CBJA 2V2CA 3HZ3A 4PE8A 2VEFA 3VGEA 4AWUA 3M47A 4XO6A 1GHSA 3CZEA 5REQA 1C29A 3T8QA 3NRKA 4Y2WA 1WKDA 3GZ3A 4YCOA 1W5NA 1FCUA 1SZFA 2CNCA 2FAPA 2W91A 2OQLA 1FKDA 1GOQA 4DWSC 1CXIA 3BG9A 2RHGA 3C0LA 1XLIA 5HMEA 4ATWA 2VFDA 1QHPA 4Z2GA 2X0YA 4UNIA 3EXTA 4ACZB 1UH4A 1BSLA 2HSAA 3J7HA 3TNBA 3PSWA 4RZ6A 4KIEA 2UZ5A 2ZE3A 4Y90A 3W7JA 4W8BA 1AJZA 4I5XA 2CLHA 4P7OA 4UTLA 1D2KA 4DZHA 5I02A 3EX3A 3MMUA 5J5DA 3DCPA 3KTSA 1GUVA 2ESCA 4HNCA 2PGWA 5BRBA 3WUBA 1QPQA 4HMDA 4N9CA 4R3UA 3KBSA 4CD5A 2D3NA 5RUBA 1R7AA 1OG6A 4ATDA 4JTQA 5BMWA 4JTLA 3UR5A 2PU1A 1FFQA 3EX2A 5E70A 2WZTA 2GQ8A 3E2SA 4C91A 4UWMA 4LH8A 4DBUA 2KI3A 4LU0A 1XSIA 3BSMA 4U2YA 4H7ZA 5AC4A 4LUJA 4ZA0A 4HZMA 3EKZA 3H2EA 2EQDA 2OR2A 1CXEA 3GDRA 1DIKA 3K1GA 2Y78A 3P3BA 1MDRA 4KFPA 5LXEA 1MEIA 4BI6A 3MSRA 4P7QA 1KCZA 2W27A 5HWCA 2JGQA 3CS2A 2Y89A 4W93A 1DEDA 4MKSA 1VIWA 1YE6A 4R9OA 1G6CA 4AZBA 4PTVA 4DRNA 1Q6RA 5BU9A 3KTXA 3OYZA 4LSBA 3P84A 3LHUA 1HJSA 5F1VA 2YDSA 4RDVA 1PHQA 1OD0A 2FJKA 3LTSA 4DAIA 2NV2A 2XH2A 1YDVA 1LRQA 4KGJA 4BEQA 3M0IA 1I2NA 1RUSA 5LA2A 7ODCA 3T44A 4YIWA 5I0DA 2WMGA 1XFCA 3AYVA 1E0VA 5IBXA 2DQXA 5KINA 1ZU8A 4ZCWA 4PCSA 3IJLA 3MO7A 1AG1O 3ZJ8A 5LNRA 1PKNA 1P0DA 3N29A 1W3HA 2WHMA 3CAQA 1FWEC 4ML9A 3PBMA 1LCOA 2A7PA 1TTPA 2YB1A 2A3HA 1GYLA 2FMOA 2X1IA 1V7AA 2XUCA 4LV4A 3N2MA 4MWAC 4Y8FA 5I03A 4ZODA 5IDZA 1O5XA 2Z1WA 1HP4A 3N9RA 4UFMA 4HYWA 2QMJA 1HVQA 3WFLA 3SEPA 3ZT5A 4LVBA 3GXIA 3TSDA 5I6SA 3N6QA 1S5MA 1EJRC 3R1ZA 3RCYA 2G8ZA 1XGDA 3N3TA 1PSCA 2AWGA 1EO5A 1UH3A 3VU2A 3F1QA 3TC5A 1M65A 1LLOA 4TW8A 3OU8A 3UF8A 1XM3A 4QEEA 3II1A 4W86A 3OHIA 4URIA 4IX2A 1JAKA 4GHRA 4N9DA 2JIEA 1JI1A 3NQ2A 2RDWA 3E1F1 1YX1A 1ISWA 2WJEA 4M7SA 1Q8JA 4CLMA 5D37A 2C16A 2H9AB 4R7JA 3AIQA 1EIXA 4J3VA 4R0XA 1QZ2A 3JUGA 1V4YA 2QCEA 2AQVA 1WZMA 5BNKA 4WZHA 2V5CA 3O3RA 3TW7A 3O5KA 5EKYA 3WDRA 4NIRA 4L4MA 4N42A 4LS1A 2HZGA 2NXHA 1Q8AA 2YZ5A 3INPA 1A3HA 4YPJA 4C6DA 1XBVA 1IT7A 3P14A 3CMGA 3FX4A 3AC0A 3TZFA 4W7WA 1LYXA 3VAWA 1ME9A 1AA1B 4KWWA 5GPGA 3BZGA 4UTIA 2NX1A 5LNVA 1KXHA 3WQOA 1MW0A 3FXGA 3QGAC 5CPSA 4ZTXA 1OQFA 2DSWA 2MF9A 3NSMA 3RIKA 1GONA 2CLEA 7TIMA 3EWXA 3VD3A 1GJWA 5HULA 4DIAA 1DWAM 3AIRA 3LSCA 4GIYA 5GJMA 2JFEX 3T8LA 3T42A 3ZSTA 2OODA 3PAOA 1B9ZA 3WUEA 2IMRA 1EJWC 3TTSA 4F0SA 1WDRA 4JHOA 2ZUUA 3E2RA 3N2OA 5CCZA 1GVIA 2VFGA 3F4VA 4Q8MA 1F8MA 2DZXA 3PG8A 5G4HC 3Q2DA 4JGDA 1H60A 3ARSA 4Q8WA 3NZGA 3LLFA 5H8PA 3OBAA 2BVYA 3QHMA 1US0A 2A2IA 2GOKA 2VX6A 4QSHA 4PUNA 2EPHA 1N8FA 3L5MA 4QT2A 1ME8A 5HR6A 4DRPA 1A3WA 4IL0A 1E43A 2FZDA 3EOEA 3WNPA 5AC6A 3BZJA 3GS6A 4FSAA 2ZA1A 3S83A 3SY5A 5LXXA 1XKJA 2WCGA 2V5LA 1HKVA 3M0MA 4ICCX 3JR2A 3UCDA 4QE4A 2JF6A 5EMJA 1YDOA 4ONVA 3CUIA 2Y7FA 1UR1A 1ZCOA 1FWAC 4A2SA 2QIWA 1IZCA 3R8HA 2ZQSA 3VDHA 3H70A 3ZJ6A 3BGGA 5GQBA 5A5WA 1US3A 5C9ZA 1KRBC 4D1JA 1XIBA 2YBVA 4B2DD 4J5NA 3FA4A 4DLMA 1R87A 2VDGA 4OV9A 4X9YA 3ZM8A 1WV2A 1KBJA 5KETA 3OOQA 3DECA 4BI7A 1FHUA 4XZIA 5BRPA 1YW1A 3PPHA 1ITQA 1XX1A 2VI0A 5GJPA 5IFTA 2YL5A 1WKFA 4U28A 3KAFA 2R1KA 1BLIA 4XBJA 4LUSB 3RGTA 1UKTA 4AY7A 4KF1A 3H8AA 2WZIA 4RXGA 1KCKA 2J6XA 4QG9A 4TX9A 3VD7A 3FCPA 2X2GA 1E4LA 2TPSA 2VM8A 3H26A 3KAIA 3BCDA 4DPQA 4ML4A 3DESA 1L1PA 3WLTA 4GFIA 3UI4A 3HURA 4K8GA 4YHEA 4M82A 4YVXA 1LF1A 1R0MA 3APYA 3M7WA 1QW9A 3R25A 1IEWA 2BZNA 1XL9A 3ABOA 4JIRA 4MNJA 5HANA 3XINA 4UTFA 3USZA 4HOXA 3D3FA 4HSHA 2Z28A 4IXHA 3BMBA 6A3HA 4QJ1A 2EBNA 4KQNA 2RKXA 1E0TA 2QVNA 5SWUA 2PGRA 2PLKA 4OKDA 1DXIA 4PMJA 3VMNA 1OFEA 5D2WA 4JEQA 4LVFA 4PBEA 4DBWA 1Q6GA 3EEGA 1NWRA 4D6GA 4JCLA 3WO8A 2AOSA 1VRXA 4UFIA 4MF4A 4QG6A 2YFNA 3WSUA 4DJDC 3KVJA 3HFTA 2KR7A 1HL9A 4H9YA 2CBVA 4UOQA 2I14A 5I7GA 3AS0A 3CGTA 1NEYA 4BQ2A 3IRDA 3E3HA 1H0GA 2WKJA 2BXZA 1BQCA 1W5PA 1ZJHA 3UG3A 2X05A 1XBZA 4JY8A 2V38A 5AHEA 1CB7B 3NWRA 3NZRA 4ASTA 5KZDA 3SRKA 1LUCA 2QCGA 1ITXA 4Z2HA 1RJQA 4IGHA 4H19A 3S5ZA 4ZFCA 2ZX9A 3MHGA 3CEUA 1QK0A 1HJUA 3PZIA 4W7UA 1JFXA 3HJZA 3EDDA 3SRFA 3DFYA 1UIPA 2QUUA 2YGYA 4Q4RA 1V02E 2ISSA 2WB5A 3S2NA 1KRCC 1ODZA 4K8HA 4OT7A 1KTCA 1DXEA 5KITA 1E5JA 5JVLA 1VIZA 1IX5A 5TNVA 3L23A 3BJTA 3M46A 1XLGA 1JD9A 2REQB 4NKCA 1IIHA 3ANYA 3MY9A 3GFZA 2ZADA 3QMSA 3ZR5A 1KQYA 2QS8A 4CD8A 3UD6A 1E40A 1H1ZA 1U30A 2YXOA 4V1XA 4JIPA 1Y5XA 4GVFA 5JIWA 2VL4A 4AZCB 4XBKA 4WF7A 3I7SA 2WVVA 1Y5WA 1TVNA 4LB4A 1GZ1A 2A3BA 1T8QA 4W5UA 4S39A 3BLEA 1SMAA 1EDTA 3QLDA 5DCBA 4KGLA 3E9AA 1JCLA 4TMCA 3CV6A 4K7YA 2CHRA 3WBWA 1Q6EA 3NYZA 4GZIA 4LY8A 1R30A 1VP5A 3I6TA 1F61A 2JEQA 2JE8A 3THDA 3S1GA 2ZC8A 1JZ2A 3PBWA 5DO8A 3IJ8A 4GMEA 3MUCA 5K9XA 3RR1A 1T41A 4IPLA 1XS2A 3QV8A 4FXFA 2CESA 4E4UA 4Q4SA 1QU4A 1L6GA 1TWIA 1EJXC 4UTUA 1UR0A 2DVXA 1XLHA 3F5LA 5KTLA 3GBEA 2OKTA 4QCFA 5I77A 4J4NA 3KX6A 2NVCA 1GJUA 4MSPA 3IKGA 3VNJA 3VC6A 5AOUA 1G4EA 2D2GA 3TC7A 3SCNA 5HW7A 2X1SA 4WY0B 4PA8A 4C6LA 1VPQA 3N1AA 3TIMA 3MBDA 2GQ3A 4F2BA 1Q4WA 3FKRA 2Z24A 4NX5A 2HV5A 1NH6A 3D5HA 2QCNA 3AXMA 3WDJA 1ICPA 1LBMA 1U83A 4OUIA 1I6NA 1GYMA 2IKHA 4DUVA 1KBBA 1OZQA 5CBIA 2MNTA 3R94A 3WMSA 2WC7A 2KO7A 3VCRA 3BQ5A 2YCLB 1AH0A 1M03A 4JIHA 3TW6A 5D03A 1PB0A 5A3HA 3EX1A 4MADA 1JRCA 4WGHA 4QS6A 3WLJA 3KOXA 1CX9A 1RJPA 4JHZA 1Q7QA 4P8WA 4KERA 4A21A 3TDFA 3SUUA 5FJOA 3BANA 2NQJA 3Q58A 5JH1A 2XN2A 1SW7A 3LBOA