2VCDA

Solution structure of the fkbp-domain of legionella pneumophila mip in complex with rapamycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
FNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein MIP
publication title Solution structure of the Legionella pneumophila Mip-rapamycin complex.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila (strain philadelphia 1 / atcc 33152 /
molecule tags Isomerase
total genus 27
structure length 137
sequence length 137
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2vcdA02
5HW8A 2PPPA 3O5QA 2F21A 5D75A 2ZR4A 3TC5A 3B7XA 3UF8A 3O5KA 4N19A 1NSGA 2FKEA 1F40A 2PV3A 2OFNA 1EQ3A 1BL4A 4GIVA 3NRKA 2F4EA 2XP3A 4ITZA 4J4OA 3KZ7A 5GPGA 1KT0A 3KAFA 3O5EA 3O5FA 2LJ4A 4W9QA 1Q6HA 2ZQVA 1FKTA 1R9HA 2L2SA 5DIVA 3KAIA 3UI5A 4MSPA 4TW7A 3GPKA 4QT2A 1D7JA 4JFKA 2KFWA 5HWBA 2PPNA 3PRDA 2MLZA 4ODRA 4QT3A 3EY6A 3RFWA 5HW6A 2MLYA 1W26A 3IK8A 1C9HA 1JVWA 3O5LA 2D9FA 5HKGA 1J6YA 4O2TA 3NI6A 2DG9A 3PRBA 4DH0A 1BKFA 1EYMA 5HTGA 4TW8A 4DRQA 2MLXA 3RGCA 1FKHA 2M1IA 3JXVA 4ODQA 5J6EA 2RQSA 2IF4A 3IKGA 1FD9A 3KAHA 5DIUA 1B6CA 1D7IA 1QPLA 2PV1A 4G50A 3O5GA 2DG4A 2KGJA 1FKRA 2ZQTA 4BF8A 4DRHA 1FKGA 3JYJA 4GGQA 4JFJA 5DITA 1FJDA 2DG3A 1J4RA 3IKDA 4IQ2A 3TDBA 3KAGA 4DRIA 5B8IC 1P5QA 4TYOA 4U86A 2M2AA 1FKDA 2XP9A 1J4HA 5HW7A 2Y78A 2RUQA 2RURA 1PINA 4J4NA 2XP8A 4W9PA 1L1PA 1FKBA 1D6OA 1FKFA 3O5RA 3O5IA 2LGOA 2ZR6A 1ZK6A 2LPVA 4FN2A 4JFLA 4U84A 1Q6UA 2Q5AA 4LAVA 3UI4A 2JZVA 1F8AB 2ZQSA 5BXJA 2MPHA 3CGMA 1Q1CA 4ODOA 4U85A 1NMVA 3TCZA 2RUDA 3VAWA 4ODMA 3OOBA 1ROTA 3JYMA 4JFIA 3UQBA 3O5JA 3MDYB 1FKJA 4DRNA 2XPBA 4DIPA 4DT4A 2M08A 1YATA 4DROA 4JFMA 2MNTA 2XP6A 2KE0A 4IQCA 3KCEA 3NTPA 2K8IA 3O5PA 4LAXA 4MGVA 1Q6IA 2KO7A 5HUAA 4DRJA 5HT1A 2RUCA 4DRKA 1A7XA 2ITKA 2KI3A 2RSEA 3O5OA 3LUOA 2XP7A 1FKIA 1ZCNA 4LAWA 4W9OA 1FKLA 4DZ2A 1TCOC 1QZ2A 2PBCA 2UZ5A 2PPOA 1ROUA 3H9RB 5I98A 2MF9A 3PA7A 1N1AA 1QPFA 2ZR5A 4TX0A 2FAPA 3I6CA 4NNRA 1M5YA 3O5DA 4DRMA 1HXVA 2AWGA 1PBKA 1FKKA 4LAYA 1JNSA 4TNSA 1U79A 1J4IA 3O5MA 4TW6A 3UQIA 2XP5A 4IPXA 4C02B 4ODKA 4FAPA 4G2PA 1D7HA 2LKNA 3UQAA 1YW5A 2F2DA 1FAPA 4QIBA 3KADA 2ZQUA 3KABA 4ODNA 3UI6A 1FKSA 2N87A 4DZ3A 4ODLA 2VCDA 3WH0A 2KR7A 1T11A 2VN1A 3CGNA 3FAPA 3IHZA 4JYSA 3KACA 4R0XA 2XPAA 2PV2A 3ODKA 1NMWA 1JNTA 4ODPA 5HWCA 2XP4A 1KT1A 1Y0OA 4DRPA
chains in the Genus database with same CATH superfamily
5HW8A 2F21A 3UF8A 1NSGA 1OGGA 1O6IA 4ZS6A 1EQ3A 1BL4A 1ZU8A 2PI6A 2LJ4A 1FKTA 1R9HA 2L2SA 4R5EA 3BXWA 4MSPA 1NWUA 4QT2A 3RM9A 2MLYA 4ZPWR 1JVWA 1FFQA 2DT3A 2B5UB 5HKGA 1J6YA 4DH0A 4MPKA 3G6LA 1W9VA 1SR0A 1ZBKA 4ODQA 5JH8A 2A3BA 2KGJA 1VF8A 4MAVA 4DRHA 1FKGA 4JFJA 1KFWA 3ARVA 3IKDA 4IQ2A 3ARTA 1FKDA 1ZBWA 2XP9A 1J4HA 2RUQA 2XP8A 4W9PA 1FKFA 4S3JA 4JFLA 1OWQA 4LAVA 1E15A 3WD4A 3CGMA 4U85A 3TCZA 3OOBA 4JFIA 4MNKA 3O5JA 1EHNA 1W1VA 4MNMA 1YATA 2XP6A 2P4VA 3KCEA 2K8IA 4MGVA 4P8WA 5HUAA 2KO7A 3LUOA 4W9OA 3FXYA 1GUVA 5I98A 2PPOA 1ROUA 1QPFA 3AROA 4Z2LA 1D2KA 4P8VA 1H0IA 1XHGA 2AWGA 1HKMA 1OGBA 4QZVB 1FKKA 1JNSA 4L72B 3O5MA 4Z2GA 4C02B 2XP5A 4ODKA 1ITXA 3UQAA 1FAPA 4QIBA 2ZQUA 4ML4A 4W5UA 4Q7NA 4ODLA 3CGNA 3KACA 2XPAA 2PV2A 4ODPA 2DSVA 1KT1A 4DWSC 2PV3A 3WL0A 1X6LA 1E6NA 2DPEA 2DSWA 2F4EA 1XRVA 2XP3A 3KZ7A 3EIPA 3GTYX 3KAFA 1Q6HA 2ZQVA 5DIVA 3W4RA 2DSZA 4URIA 1LG1A 3OA5A 4MTVA 3EY6A 5HW6A 4DWSB 1W26A 3IK8A 3NI6A 2DG9A 1BKFA 2A3CA 4DRQA 1FKHA 3JXVA 5J6EA 3IKGA 3KAHA 1FD9A 1NH6A 2DG4A 1X6NA 3ARXA 3WD2A 3PRAA 1CTNA 3ARSA 4NZCA 2DT1A 4MNLA 3WIJA 5B8IC 3AS2A 3CHEA 3AS3A 1W1YA 3WD0A 3RM4A 1UR8A 1PINA 1SYTA 1HKKA 3O5RA 2ZR6A 3UI4A 5BXJA 1JCHB 2G8ZA 4ODMA 3MDYB 1E9LA 1FKJA 3ARRA 3B9EA 4DRNA 2B31A 4DWSA 2ESCA 3WD3A 4DROA 4LGXA 4JFMA 5GQBA 4IQCA 4IT6A 4KQZA 1E6ZA 2RUCA 5HBFA 4HBEA 3O5OA 4LAWA 1ZCNA 1FFRA 4WIWA 4DRPA 2QF8A 2MF9A 1N1AA 3WD1A 2ZR5A 4TX0A 1LL6A 4NNRA 1NWRA 1J4IA 2O92A 4G2PA 1NWTA 2LKNA 2WM0A 1YW5A 2F2DA 4Z2IA 3ARZA 5GPRA 2A3EA 1FKSA 2DT2A 3WH0A 4AY1A 1WAWA 2VN1A 1LJYA 3FAPA 4JYSA 4R0XA 3ODKA 1JNTA 1ZL1A 3ARYA 2XP4A 4WKHA 1UR9A 3TC5A 3FY1A 3O5KA 4N19A 1HKIA 4ZPVR 2FKEA 1F40A 3WQVA 4Z2KA 2OFNA 4ITZA 4J4OA 4L3NA 1KT0A 4Z2HA 4HARA 3KAIA 1NWSA 3GPKA 4JFKA 2KFWA 2PPNA 2MLZA 4ODRA 4QT3A 3ARQA 3RFWA 1LG2A 3CHDA 3BMBA 4NSBA 2AOSA 1C9HA 3O5LA 4O2TA 3PRBA 4IT4A 4TW8A 3B9AA 3RGCA 2M1IA 3CHFA 2RQSA 1B6CA 1QPLA 4G50A 3CH9A 4S3KA 2ZQTA 4BF8A 4GGQA 1FJDA 2DG3A 1J4RA 3TDBA 3B8SA 3KAGA 4DRIA 1P5QA 4TYOA 4U86A 2M2AA 1HJXA 5HW7A 5DF0A 3ALGA 2Y78A 1W1TA 1D6OA 3O5IA 4MNJA 2LGOA 1Q6UA 3WKZA 2JZVA 1Q1CA 4ODOA 1NMVA 3WL1A 2RUDA 3VAWA 3UQBA 3JYMA 4WK9A 2XPBA 2WK2A 1LL4A 2M08A 2MNTA 2KE0A 1E6PA 3O5PA 4LAXA 1WB0A 1Q6IA 4DRJA 5HT1A 1ZB5A 2ITKA 2XP7A 3G6MA 1FKLA 3ALFA 3AQUA 2UZ5A 5DO2A 1JNEA 3RM8A 2FAPA 4P8UA 3O5DA 1HXVA 1E6RA 4WJXA 4TNSA 4TW6A 4FAPA 3UQIA 1HJVA 3KADA 3KABA 4ODNA 1ZBVA 2FDMA 3UI6A 1GOIA 2WLZA 1T11A 3IHZA 4PTMA 1NMWA 2PPPA 1H0GA 3AS1A 3O5QA 4XAKA 5D75A 1GPFA 2ZR4A 3B7XA 3ARWA 4GIVA 3NRKA 5GPGA 3O5EA 4DRKA 3O5FA 4W9QA 1WNOA 3UI5A 4TW7A 1D7JA 5HWBA 3PRDA 4HBOA 4Q22A 2D9FA 1EYMA 5HTGA 2MLXA 3ARPA 2IF4A 5DIUA 1D7IA 3CHCA 2PV1A 3O5GA 2F23A 1K9TA 1FKRA 3B9DA 3JYJA 5DITA 2YBUA 4KR0B 1W1PA 1W9PA 3QOKA 2ETNA 3RMEA 3CZ8A 1W9UA 3ARUA 1IX5A 2RURA 4J4NA 1L1PA 1HJWA 1FKBA 1ZK6A 2LPVA 4FN2A 4U84A 5DEZA 2Q5AA 3WQWA 1F8AB 2ZQSA 4UDMA 3AS0A 2MPHA 2G41A 2WLYA 4Z2JA 1ROTA 4DIPA 4DT4A 3NTPA 2A3AA 2OLHA 1A7XA 2KI3A 2RSEA 1LQ0A 1FKIA 1GRJA 4DZ2A 1TCOC 1QZ2A 2PBCA 3H9RB 4WKFA 2IUZA 3PA7A 4DWSD 1HKJA 3I6CA 1M5YA 2DT0A 1JNDA 4WKAA 4DRMA 2O9OA 1E44A 2PN0A 1PBKA 4LAYA 1TFVA 1U79A 4IPXA 1D7HA 1EDQA 2YBTA 1RD6A 4P8XA 2N87A 1LL7A 4DZ3A 2VCDA 3GU0A 1ZBCA 2KR7A 2EULA 1EIBA 2DSUA 5HWCA 1Y0OA 3PR9A 4ZPTR
chains in the Genus database with same CATH topology
5HW8A 2F21A 3UF8A 1NSGA 1OGGA 1O6IA 4ZS6A 1EQ3A 1BL4A 1ZU8A 2PI6A 2LJ4A 1FKTA 1R9HA 2L2SA 4R5EA 3BXWA 4MSPA 1NWUA 4QT2A 3RM9A 2MLYA 4ZPWR 1JVWA 1FFQA 2DT3A 5HKGA 1J6YA 4DH0A 4MPKA 3G6LA 1W9VA 1SR0A 1ZBKA 4ODQA 5JH8A 2A3BA 2KGJA 1VF8A 4MAVA 4DRHA 1FKGA 4JFJA 1KFWA 3ARVA 3IKDA 4IQ2A 3ARTA 1FKDA 1ZBWA 2XP9A 1J4HA 2RUQA 2XP8A 4W9PA 1FKFA 4S3JA 4JFLA 1OWQA 4LAVA 1E15A 3WD4A 3CGMA 4U85A 3TCZA 3OOBA 4JFIA 4MNKA 3O5JA 1EHNA 1W1VA 4MNMA 1YATA 2XP6A 3KCEA 2K8IA 4MGVA 4P8WA 5HUAA 2KO7A 3LUOA 4W9OA 3FXYA 1GUVA 5I98A 2PPOA 1ROUA 1QPFA 3AROA 4Z2LA 1D2KA 4P8VA 1H0IA 1XHGA 2AWGA 1HKMA 1OGBA 4QZVB 1FKKA 1JNSA 4L72B 3O5MA 4Z2GA 4C02B 2XP5A 4ODKA 1ITXA 3UQAA 1FAPA 4QIBA 2ZQUA 4ML4A 4W5UA 4Q7NA 4ODLA 3CGNA 3KACA 2XPAA 2PV2A 4ODPA 2DSVA 1KT1A 4DWSC 2PV3A 3WL0A 1X6LA 1E6NA 2DPEA 2DSWA 2F4EA 1XRVA 2XP3A 3KZ7A 3KAFA 1Q6HA 2ZQVA 5DIVA 3W4RA 2DSZA 4URIA 1LG1A 3OA5A 4MTVA 3EY6A 5HW6A 4DWSB 1W26A 3IK8A 3NI6A 2DG9A 1BKFA 2A3CA 4DRQA 1FKHA 3JXVA 5J6EA 3IKGA 3KAHA 1FD9A 1NH6A 2DG4A 1X6NA 3ARXA 3WD2A 3PRAA 1CTNA 3ARSA 4NZCA 2DT1A 4MNLA 3WIJA 5B8IC 3AS2A 3CHEA 3AS3A 1W1YA 3WD0A 3RM4A 1UR8A 1PINA 1SYTA 1HKKA 3O5RA 2ZR6A 3UI4A 5BXJA 2G8ZA 4ODMA 3MDYB 1E9LA 1FKJA 3ARRA 3B9EA 4DRNA 2B31A 4DWSA 2ESCA 3WD3A 4DROA 4LGXA 4JFMA 5GQBA 4IQCA 4IT6A 4KQZA 1E6ZA 2RUCA 5HBFA 4HBEA 3O5OA 4LAWA 1ZCNA 1FFRA 4WIWA 4DRPA 2QF8A 2MF9A 1N1AA 3WD1A 2ZR5A 4TX0A 1LL6A 4NNRA 1NWRA 1J4IA 2O92A 4G2PA 1NWTA 2LKNA 2WM0A 1YW5A 2F2DA 4Z2IA 3ARZA 5GPRA 2A3EA 1FKSA 2DT2A 3WH0A 4AY1A 1WAWA 2VN1A 1LJYA 3FAPA 4JYSA 4R0XA 3ODKA 1JNTA 1ZL1A 3ARYA 2XP4A 4WKHA 1UR9A 3TC5A 3FY1A 3O5KA 4N19A 1HKIA 4ZPVR 2FKEA 1F40A 3WQVA 4Z2KA 2OFNA 4ITZA 4J4OA 4L3NA 1KT0A 4Z2HA 4HARA 3KAIA 1NWSA 3GPKA 4JFKA 2KFWA 2PPNA 2MLZA 4ODRA 4QT3A 3ARQA 3RFWA 1LG2A 3CHDA 4NSBA 2AOSA 1C9HA 3O5LA 4O2TA 3PRBA 4IT4A 4TW8A 3B9AA 3RGCA 2M1IA 3CHFA 2RQSA 1B6CA 1QPLA 4G50A 3CH9A 4S3KA 2ZQTA 4BF8A 4GGQA 1FJDA 2DG3A 1J4RA 3TDBA 3B8SA 3KAGA 4DRIA 1P5QA 4TYOA 4U86A 2M2AA 1HJXA 5HW7A 5DF0A 3ALGA 2Y78A 1W1TA 1D6OA 3O5IA 4MNJA 2LGOA 1Q6UA 3WKZA 2JZVA 1Q1CA 4ODOA 1NMVA 3WL1A 2RUDA 3VAWA 3UQBA 3JYMA 4WK9A 2XPBA 2WK2A 1LL4A 2M08A 2MNTA 2KE0A 1E6PA 3O5PA 4LAXA 1WB0A 1Q6IA 4DRJA 5HT1A 1ZB5A 2ITKA 2XP7A 3G6MA 1FKLA 3ALFA 3AQUA 2UZ5A 5DO2A 1JNEA 3RM8A 2FAPA 4P8UA 3O5DA 1HXVA 1E6RA 4WJXA 4TNSA 4TW6A 4FAPA 3UQIA 1HJVA 3KADA 3KABA 4ODNA 1ZBVA 2FDMA 3UI6A 1GOIA 2WLZA 1T11A 3IHZA 4PTMA 1NMWA 2PPPA 1H0GA 3AS1A 3O5QA 4XAKA 5D75A 1GPFA 2ZR4A 3B7XA 3ARWA 4GIVA 3NRKA 5GPGA 3O5EA 4DRKA 3O5FA 4W9QA 1WNOA 3UI5A 4TW7A 1D7JA 5HWBA 3PRDA 4HBOA 4Q22A 2D9FA 1EYMA 5HTGA 2MLXA 3ARPA 2IF4A 5DIUA 1D7IA 3CHCA 2PV1A 3O5GA 1K9TA 1FKRA 3B9DA 3JYJA 5DITA 2YBUA 4KR0B 1W1PA 1W9PA 3QOKA 3RMEA 3CZ8A 1W9UA 3ARUA 1IX5A 2RURA 4J4NA 1L1PA 1HJWA 1FKBA 1ZK6A 2LPVA 4FN2A 4U84A 5DEZA 2Q5AA 3WQWA 1F8AB 2ZQSA 3AS0A 2MPHA 2G41A 2WLYA 4Z2JA 1ROTA 4DIPA 4DT4A 3NTPA 2A3AA 2OLHA 1A7XA 2KI3A 2RSEA 1LQ0A 1FKIA 4DZ2A 1TCOC 1QZ2A 2PBCA 3H9RB 4WKFA 2IUZA 3PA7A 4DWSD 1HKJA 3I6CA 1M5YA 2DT0A 1JNDA 4WKAA 4DRMA 2O9OA 1PBKA 4LAYA 1TFVA 1U79A 4IPXA 1D7HA 1EDQA 2YBTA 1RD6A 4P8XA 2N87A 1LL7A 4DZ3A 2VCDA 1ZBCA 2KR7A 1EIBA 2DSUA 5HWCA 1Y0OA 3PR9A 4ZPTR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HW8 A;  2PPP A;  3O5Q A;  2F21 A;  5D75 A;  2ZR4 A;  3TC5 A;  3B7X A;  3UF8 A;  3O5K A;  4N19 A;  1NSG A;  2FKE A;  1F40 A;  2PV3 A;  2OFN A;  1EQ3 A;  1BL4 A;  4GIV A;  3NRK A;  2F4E A;  2XP3 A;  4ITZ A;  4J4O A;  3KZ7 A;  5GPG A;  1KT0 A;  3KAF A;  3O5E A;  3O5F A;  2LJ4 A;  4W9Q A;  1Q6H A;  2ZQV A;  1FKT A;  1R9H A;  2L2S A;  5DIV A;  3KAI A;  3UI5 A;  4MSP A;  4TW7 A;  3GPK A;  4QT2 A;  1D7J A;  4JFK A;  2KFW A;  5HWB A;  2PPN A;  3PRD A;  2MLZ A;  4ODR A;  4QT3 A;  3EY6 A;  3RFW A;  5HW6 A;  2MLY A;  1W26 A;  3IK8 A;  1C9H A;  1JVW A;  3O5L A;  2D9F A;  5HKG A;  1J6Y A;  4O2T A;  3NI6 A;  2DG9 A;  3PRB A;  4DH0 A;  1BKF A;  1EYM A;  5HTG A;  4TW8 A;  4DRQ A;  2MLX A;  3RGC A;  1FKH A;  2M1I A;  3JXV A;  4ODQ A;  5J6E A;  2RQS A;  2IF4 A;  3IKG A;  1FD9 A;  3KAH A;  5DIU A;  1B6C A;  1D7I A;  1QPL A;  2PV1 A;  4G50 A;  3O5G A;  2DG4 A;  2KGJ A;  1FKR A;  2ZQT A;  4BF8 A;  4DRH A;  1FKG A;  3JYJ A;  4GGQ A;  4JFJ A;  5DIT A;  1FJD A;  2DG3 A;  1J4R A;  3IKD A;  4IQ2 A;  3TDB A;  3KAG A;  4DRI A;  5B8I C;  1P5Q A;  4TYO A;  4U86 A;  2M2A A;  1FKD A;  2XP9 A;  1J4H A;  5HW7 A;  2Y78 A;  2RUQ A;  2RUR A;  1PIN A;  4J4N A;  2XP8 A;  4W9P A;  1L1P A;  1FKB A;  1D6O A;  1FKF A;  3O5R A;  3O5I A;  2LGO A;  2ZR6 A;  1ZK6 A;  2LPV A;  4FN2 A;  4JFL A;  4U84 A;  1Q6U A;  2Q5A A;  4LAV A;  3UI4 A;  2JZV A;  1F8A B;  2ZQS A;  5BXJ A;  2MPH A;  3CGM A;  1Q1C A;  4ODO A;  4U85 A;  1NMV A;  3TCZ A;  2RUD A;  3VAW A;  4ODM A;  3OOB A;  1ROT A;  3JYM A;  4JFI A;  3UQB A;  3O5J A;  3MDY B;  1FKJ A;  4DRN A;  2XPB A;  4DIP A;  4DT4 A;  2M08 A;  1YAT A;  4DRO A;  4JFM A;  2MNT A;  2XP6 A;  2KE0 A;  4IQC A;  3KCE A;  3NTP A;  2K8I A;  3O5P A;  4LAX A;  4MGV A;  1Q6I A;  2KO7 A;  5HUA A;  4DRJ A;  5HT1 A;  2RUC A;  4DRK A;  1A7X A;  2ITK A;  2KI3 A;  2RSE A;  3O5O A;  3LUO A;  2XP7 A;  1FKI A;  1ZCN A;  4LAW A;  4W9O A;  1FKL A;  4DZ2 A;  1TCO C;  1QZ2 A;  2PBC A;  2UZ5 A;  2PPO A;  1ROU A;  3H9R B;  5I98 A;  2MF9 A;  3PA7 A;  1N1A A;  1QPF A;  2ZR5 A;  4TX0 A;  2FAP A;  3I6C A;  4NNR A;  1M5Y A;  3O5D A;  4DRM A;  1HXV A;  2AWG A;  1PBK A;  1FKK A;  4LAY A;  1JNS A;  4TNS A;  1U79 A;  1J4I A;  3O5M A;  4TW6 A;  3UQI A;  2XP5 A;  4IPX A;  4C02 B;  4ODK A;  4FAP A;  4G2P A;  1D7H A;  2LKN A;  3UQA A;  1YW5 A;  2F2D A;  1FAP A;  4QIB A;  3KAD A;  2ZQU A;  3KAB A;  4ODN A;  3UI6 A;  1FKS A;  2N87 A;  4DZ3 A;  4ODL A;  2VCD A;  3WH0 A;  2KR7 A;  1T11 A;  2VN1 A;  3CGN A;  3FAP A;  3IHZ A;  4JYS A;  3KAC A;  4R0X A;  2XPA A;  2PV2 A;  3ODK A;  1NMW A;  1JNT A;  4ODP A;  5HWC A;  2XP4 A;  1KT1 A;  1Y0O A;  4DRP A; 
#chains in the Genus database with same CATH topology
 5HW8 A;  2F21 A;  3UF8 A;  1NSG A;  1OGG A;  1O6I A;  4ZS6 A;  1EQ3 A;  1BL4 A;  1ZU8 A;  2PI6 A;  2LJ4 A;  1FKT A;  1R9H A;  2L2S A;  4R5E A;  3BXW A;  4MSP A;  1NWU A;  4QT2 A;  3RM9 A;  2MLY A;  4ZPW R;  1JVW A;  1FFQ A;  2DT3 A;  2B5U B;  5HKG A;  1J6Y A;  4DH0 A;  4MPK A;  3G6L A;  1W9V A;  1SR0 A;  1ZBK A;  4ODQ A;  5JH8 A;  2A3B A;  2KGJ A;  1VF8 A;  4MAV A;  4DRH A;  1FKG A;  4JFJ A;  1KFW A;  3ARV A;  3IKD A;  4IQ2 A;  3ART A;  1FKD A;  1ZBW A;  2XP9 A;  1J4H A;  2RUQ A;  2XP8 A;  4W9P A;  1FKF A;  4S3J A;  4JFL A;  1OWQ A;  4LAV A;  1E15 A;  3WD4 A;  3CGM A;  4U85 A;  3TCZ A;  3OOB A;  4JFI A;  4MNK A;  3O5J A;  1EHN A;  1W1V A;  4MNM A;  1YAT A;  2XP6 A;  2P4V A;  3KCE A;  2K8I A;  4MGV A;  4P8W A;  5HUA A;  2KO7 A;  3LUO A;  4W9O A;  3FXY A;  1GUV A;  5I98 A;  2PPO A;  1ROU A;  1QPF A;  3ARO A;  4Z2L A;  1D2K A;  4P8V A;  1H0I A;  1XHG A;  2AWG A;  1HKM A;  1OGB A;  4QZV B;  1FKK A;  1JNS A;  4L72 B;  3O5M A;  4Z2G A;  4C02 B;  2XP5 A;  4ODK A;  1ITX A;  3UQA A;  1FAP A;  4QIB A;  2ZQU A;  4ML4 A;  4W5U A;  4Q7N A;  4ODL A;  3CGN A;  3KAC A;  2XPA A;  2PV2 A;  4ODP A;  2DSV A;  1KT1 A;  4DWS C;  2PV3 A;  3WL0 A;  1X6L A;  1E6N A;  2DPE A;  2DSW A;  2F4E A;  1XRV A;  2XP3 A;  3KZ7 A;  3EIP A;  3GTY X;  3KAF A;  1Q6H A;  2ZQV A;  5DIV A;  3W4R A;  2DSZ A;  4URI A;  1LG1 A;  3OA5 A;  4MTV A;  3EY6 A;  5HW6 A;  4DWS B;  1W26 A;  3IK8 A;  3NI6 A;  2DG9 A;  1BKF A;  2A3C A;  4DRQ A;  1FKH A;  3JXV A;  5J6E A;  3IKG A;  3KAH A;  1FD9 A;  1NH6 A;  2DG4 A;  1X6N A;  3ARX A;  3WD2 A;  3PRA A;  1CTN A;  3ARS A;  4NZC A;  2DT1 A;  4MNL A;  3WIJ A;  5B8I C;  3AS2 A;  3CHE A;  3AS3 A;  1W1Y A;  3WD0 A;  3RM4 A;  1UR8 A;  1PIN A;  1SYT A;  1HKK A;  3O5R A;  2ZR6 A;  3UI4 A;  5BXJ A;  1JCH B;  2G8Z A;  4ODM A;  3MDY B;  1E9L A;  1FKJ A;  3ARR A;  3B9E A;  4DRN A;  2B31 A;  4DWS A;  2ESC A;  3WD3 A;  4DRO A;  4LGX A;  4JFM A;  5GQB A;  4IQC A;  4IT6 A;  4KQZ A;  1E6Z A;  2RUC A;  5HBF A;  4HBE A;  3O5O A;  4LAW A;  1ZCN A;  1FFR A;  4WIW A;  4DRP A;  2QF8 A;  2MF9 A;  1N1A A;  3WD1 A;  2ZR5 A;  4TX0 A;  1LL6 A;  4NNR A;  1NWR A;  1J4I A;  2O92 A;  4G2P A;  1NWT A;  2LKN A;  2WM0 A;  1YW5 A;  2F2D A;  4Z2I A;  3ARZ A;  5GPR A;  2A3E A;  1FKS A;  2DT2 A;  3WH0 A;  4AY1 A;  1WAW A;  2VN1 A;  1LJY A;  3FAP A;  4JYS A;  4R0X A;  3ODK A;  1JNT A;  1ZL1 A;  3ARY A;  2XP4 A;  4WKH A;  1UR9 A;  3TC5 A;  3FY1 A;  3O5K A;  4N19 A;  1HKI A;  4ZPV R;  2FKE A;  1F40 A;  3WQV A;  4Z2K A;  2OFN A;  4ITZ A;  4J4O A;  4L3N A;  1KT0 A;  4Z2H A;  4HAR A;  3KAI A;  1NWS A;  3GPK A;  4JFK A;  2KFW A;  2PPN A;  2MLZ A;  4ODR A;  4QT3 A;  3ARQ A;  3RFW A;  1LG2 A;  3CHD A;  3BMB A;  4NSB A;  2AOS A;  1C9H A;  3O5L A;  4O2T A;  3PRB A;  4IT4 A;  4TW8 A;  3B9A A;  3RGC A;  2M1I A;  3CHF A;  2RQS A;  1B6C A;  1QPL A;  4G50 A;  3CH9 A;  4S3K A;  2ZQT A;  4BF8 A;  4GGQ A;  1FJD A;  2DG3 A;  1J4R A;  3TDB A;  3B8S A;  3KAG A;  4DRI A;  1P5Q A;  4TYO A;  4U86 A;  2M2A A;  1HJX A;  5HW7 A;  5DF0 A;  3ALG A;  2Y78 A;  1W1T A;  1D6O A;  3O5I A;  4MNJ A;  2LGO A;  1Q6U A;  3WKZ A;  2JZV A;  1Q1C A;  4ODO A;  1NMV A;  3WL1 A;  2RUD A;  3VAW A;  3UQB A;  3JYM A;  4WK9 A;  2XPB A;  2WK2 A;  1LL4 A;  2M08 A;  2MNT A;  2KE0 A;  1E6P A;  3O5P A;  4LAX A;  1WB0 A;  1Q6I A;  4DRJ A;  5HT1 A;  1ZB5 A;  2ITK A;  2XP7 A;  3G6M A;  1FKL A;  3ALF A;  3AQU A;  2UZ5 A;  5DO2 A;  1JNE A;  3RM8 A;  2FAP A;  4P8U A;  3O5D A;  1HXV A;  1E6R A;  4WJX A;  4TNS A;  4TW6 A;  4FAP A;  3UQI A;  1HJV A;  3KAD A;  3KAB A;  4ODN A;  1ZBV A;  2FDM A;  3UI6 A;  1GOI A;  2WLZ A;  1T11 A;  3IHZ A;  4PTM A;  1NMW A;  2PPP A;  1H0G A;  3AS1 A;  3O5Q A;  4XAK A;  5D75 A;  1GPF A;  2ZR4 A;  3B7X A;  3ARW A;  4GIV A;  3NRK A;  5GPG A;  3O5E A;  4DRK A;  3O5F A;  4W9Q A;  1WNO A;  3UI5 A;  4TW7 A;  1D7J A;  5HWB A;  3PRD A;  4HBO A;  4Q22 A;  2D9F A;  1EYM A;  5HTG A;  2MLX A;  3ARP A;  2IF4 A;  5DIU A;  1D7I A;  3CHC A;  2PV1 A;  3O5G A;  2F23 A;  1K9T A;  1FKR A;  3B9D A;  3JYJ A;  5DIT A;  2YBU A;  4KR0 B;  1W1P A;  1W9P A;  3QOK A;  2ETN A;  3RME A;  3CZ8 A;  1W9U A;  3ARU A;  1IX5 A;  2RUR A;  4J4N A;  1L1P A;  1HJW A;  1FKB A;  1ZK6 A;  2LPV A;  4FN2 A;  4U84 A;  5DEZ A;  2Q5A A;  3WQW A;  1F8A B;  2ZQS A;  4UDM A;  3AS0 A;  2MPH A;  2G41 A;  2WLY A;  4Z2J A;  1ROT A;  4DIP A;  4DT4 A;  3NTP A;  2A3A A;  2OLH A;  1A7X A;  2KI3 A;  2RSE A;  1LQ0 A;  1FKI A;  1GRJ A;  4DZ2 A;  1TCO C;  1QZ2 A;  2PBC A;  3H9R B;  4WKF A;  2IUZ A;  3PA7 A;  4DWS D;  1HKJ A;  3I6C A;  1M5Y A;  2DT0 A;  1JND A;  4WKA A;  4DRM A;  2O9O A;  1E44 A;  2PN0 A;  1PBK A;  4LAY A;  1TFV A;  1U79 A;  4IPX A;  1D7H A;  1EDQ A;  2YBT A;  1RD6 A;  4P8X A;  2N87 A;  1LL7 A;  4DZ3 A;  2VCD A;  3GU0 A;  1ZBC A;  2KR7 A;  2EUL A;  1EIB A;  2DSU A;  5HWC A;  1Y0O A;  3PR9 A;  4ZPT R; 
#chains in the Genus database with same CATH homology
 5HW8 A;  2F21 A;  3UF8 A;  1NSG A;  1OGG A;  1O6I A;  4ZS6 A;  1EQ3 A;  1BL4 A;  1ZU8 A;  2PI6 A;  2LJ4 A;  1FKT A;  1R9H A;  2L2S A;  4R5E A;  3BXW A;  4MSP A;  1NWU A;  4QT2 A;  3RM9 A;  2MLY A;  4ZPW R;  1JVW A;  1FFQ A;  2DT3 A;  5HKG A;  1J6Y A;  4DH0 A;  4MPK A;  3G6L A;  1W9V A;  1SR0 A;  1ZBK A;  4ODQ A;  5JH8 A;  2A3B A;  2KGJ A;  1VF8 A;  4MAV A;  4DRH A;  1FKG A;  4JFJ A;  1KFW A;  3ARV A;  3IKD A;  4IQ2 A;  3ART A;  1FKD A;  1ZBW A;  2XP9 A;  1J4H A;  2RUQ A;  2XP8 A;  4W9P A;  1FKF A;  4S3J A;  4JFL A;  1OWQ A;  4LAV A;  1E15 A;  3WD4 A;  3CGM A;  4U85 A;  3TCZ A;  3OOB A;  4JFI A;  4MNK A;  3O5J A;  1EHN A;  1W1V A;  4MNM A;  1YAT A;  2XP6 A;  3KCE A;  2K8I A;  4MGV A;  4P8W A;  5HUA A;  2KO7 A;  3LUO A;  4W9O A;  3FXY A;  1GUV A;  5I98 A;  2PPO A;  1ROU A;  1QPF A;  3ARO A;  4Z2L A;  1D2K A;  4P8V A;  1H0I A;  1XHG A;  2AWG A;  1HKM A;  1OGB A;  4QZV B;  1FKK A;  1JNS A;  4L72 B;  3O5M A;  4Z2G A;  4C02 B;  2XP5 A;  4ODK A;  1ITX A;  3UQA A;  1FAP A;  4QIB A;  2ZQU A;  4ML4 A;  4W5U A;  4Q7N A;  4ODL A;  3CGN A;  3KAC A;  2XPA A;  2PV2 A;  4ODP A;  2DSV A;  1KT1 A;  4DWS C;  2PV3 A;  3WL0 A;  1X6L A;  1E6N A;  2DPE A;  2DSW A;  2F4E A;  1XRV A;  2XP3 A;  3KZ7 A;  3KAF A;  1Q6H A;  2ZQV A;  5DIV A;  3W4R A;  2DSZ A;  4URI A;  1LG1 A;  3OA5 A;  4MTV A;  3EY6 A;  5HW6 A;  4DWS B;  1W26 A;  3IK8 A;  3NI6 A;  2DG9 A;  1BKF A;  2A3C A;  4DRQ A;  1FKH A;  3JXV A;  5J6E A;  3IKG A;  3KAH A;  1FD9 A;  1NH6 A;  2DG4 A;  1X6N A;  3ARX A;  3WD2 A;  3PRA A;  1CTN A;  3ARS A;  4NZC A;  2DT1 A;  4MNL A;  3WIJ A;  5B8I C;  3AS2 A;  3CHE A;  3AS3 A;  1W1Y A;  3WD0 A;  3RM4 A;  1UR8 A;  1PIN A;  1SYT A;  1HKK A;  3O5R A;  2ZR6 A;  3UI4 A;  5BXJ A;  2G8Z A;  4ODM A;  3MDY B;  1E9L A;  1FKJ A;  3ARR A;  3B9E A;  4DRN A;  2B31 A;  4DWS A;  2ESC A;  3WD3 A;  4DRO A;  4LGX A;  4JFM A;  5GQB A;  4IQC A;  4IT6 A;  4KQZ A;  1E6Z A;  2RUC A;  5HBF A;  4HBE A;  3O5O A;  4LAW A;  1ZCN A;  1FFR A;  4WIW A;  4DRP A;  2QF8 A;  2MF9 A;  1N1A A;  3WD1 A;  2ZR5 A;  4TX0 A;  1LL6 A;  4NNR A;  1NWR A;  1J4I A;  2O92 A;  4G2P A;  1NWT A;  2LKN A;  2WM0 A;  1YW5 A;  2F2D A;  4Z2I A;  3ARZ A;  5GPR A;  2A3E A;  1FKS A;  2DT2 A;  3WH0 A;  4AY1 A;  1WAW A;  2VN1 A;  1LJY A;  3FAP A;  4JYS A;  4R0X A;  3ODK A;  1JNT A;  1ZL1 A;  3ARY A;  2XP4 A;  4WKH A;  1UR9 A;  3TC5 A;  3FY1 A;  3O5K A;  4N19 A;  1HKI A;  4ZPV R;  2FKE A;  1F40 A;  3WQV A;  4Z2K A;  2OFN A;  4ITZ A;  4J4O A;  4L3N A;  1KT0 A;  4Z2H A;  4HAR A;  3KAI A;  1NWS A;  3GPK A;  4JFK A;  2KFW A;  2PPN A;  2MLZ A;  4ODR A;  4QT3 A;  3ARQ A;  3RFW A;  1LG2 A;  3CHD A;  4NSB A;  2AOS A;  1C9H A;  3O5L A;  4O2T A;  3PRB A;  4IT4 A;  4TW8 A;  3B9A A;  3RGC A;  2M1I A;  3CHF A;  2RQS A;  1B6C A;  1QPL A;  4G50 A;  3CH9 A;  4S3K A;  2ZQT A;  4BF8 A;  4GGQ A;  1FJD A;  2DG3 A;  1J4R A;  3TDB A;  3B8S A;  3KAG A;  4DRI A;  1P5Q A;  4TYO A;  4U86 A;  2M2A A;  1HJX A;  5HW7 A;  5DF0 A;  3ALG A;  2Y78 A;  1W1T A;  1D6O A;  3O5I A;  4MNJ A;  2LGO A;  1Q6U A;  3WKZ A;  2JZV A;  1Q1C A;  4ODO A;  1NMV A;  3WL1 A;  2RUD A;  3VAW A;  3UQB A;  3JYM A;  4WK9 A;  2XPB A;  2WK2 A;  1LL4 A;  2M08 A;  2MNT A;  2KE0 A;  1E6P A;  3O5P A;  4LAX A;  1WB0 A;  1Q6I A;  4DRJ A;  5HT1 A;  1ZB5 A;  2ITK A;  2XP7 A;  3G6M A;  1FKL A;  3ALF A;  3AQU A;  2UZ5 A;  5DO2 A;  1JNE A;  3RM8 A;  2FAP A;  4P8U A;  3O5D A;  1HXV A;  1E6R A;  4WJX A;  4TNS A;  4TW6 A;  4FAP A;  3UQI A;  1HJV A;  3KAD A;  3KAB A;  4ODN A;  1ZBV A;  2FDM A;  3UI6 A;  1GOI A;  2WLZ A;  1T11 A;  3IHZ A;  4PTM A;  1NMW A;  2PPP A;  1H0G A;  3AS1 A;  3O5Q A;  4XAK A;  5D75 A;  1GPF A;  2ZR4 A;  3B7X A;  3ARW A;  4GIV A;  3NRK A;  5GPG A;  3O5E A;  4DRK A;  3O5F A;  4W9Q A;  1WNO A;  3UI5 A;  4TW7 A;  1D7J A;  5HWB A;  3PRD A;  4HBO A;  4Q22 A;  2D9F A;  1EYM A;  5HTG A;  2MLX A;  3ARP A;  2IF4 A;  5DIU A;  1D7I A;  3CHC A;  2PV1 A;  3O5G A;  1K9T A;  1FKR A;  3B9D A;  3JYJ A;  5DIT A;  2YBU A;  4KR0 B;  1W1P A;  1W9P A;  3QOK A;  3RME A;  3CZ8 A;  1W9U A;  3ARU A;  1IX5 A;  2RUR A;  4J4N A;  1L1P A;  1HJW A;  1FKB A;  1ZK6 A;  2LPV A;  4FN2 A;  4U84 A;  5DEZ A;  2Q5A A;  3WQW A;  1F8A B;  2ZQS A;  3AS0 A;  2MPH A;  2G41 A;  2WLY A;  4Z2J A;  1ROT A;  4DIP A;  4DT4 A;  3NTP A;  2A3A A;  2OLH A;  1A7X A;  2KI3 A;  2RSE A;  1LQ0 A;  1FKI A;  4DZ2 A;  1TCO C;  1QZ2 A;  2PBC A;  3H9R B;  4WKF A;  2IUZ A;  3PA7 A;  4DWS D;  1HKJ A;  3I6C A;  1M5Y A;  2DT0 A;  1JND A;  4WKA A;  4DRM A;  2O9O A;  1PBK A;  4LAY A;  1TFV A;  1U79 A;  4IPX A;  1D7H A;  1EDQ A;  2YBT A;  1RD6 A;  4P8X A;  2N87 A;  1LL7 A;  4DZ3 A;  2VCD A;  1ZBC A;  2KR7 A;  1EIB A;  2DSU A;  5HWC A;  1Y0O A;  3PR9 A;  4ZPT R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...