2VCDA

Solution structure of the fkbp-domain of legionella pneumophila mip in complex with rapamycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
b'FNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein MIP
publication title Solution structure of the Legionella pneumophila Mip-rapamycin complex.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila (strain philadelphia 1 / atcc 33152 /
molecule tags Isomerase
total genus 27
structure length 137
sequence length 137
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2vcdA02
2PBCA 4DRJA 4N19A 3TDBA 2DG9A 3O5LA 2VCDA 4FN2A 4ODMA 4TNSA 4MSPA 1A7XA 4BF8A 5B8IC 5HW8A 3O5QA 2XP5A 2XP8A 1J6YA 1FKLA 4W9QA 4J4OA 3O5JA 2F4EA 3UQBA 2PV2A 2RQSA 4C02B 1FKDA 2MPHA 4U84A 1QPLA 2KE0A 5DIUA 1FKGA 1T11A 1BKFA 1PBKA 1ZCNA 2VN1A 2ZQTA 3O5MA 4G2PA 4QT2A 5HW7A 4JFKA 4U85A 4DIPA 1JNTA 4DT4A 4U86A 4DRMA 5HWBA 1EQ3A 3TCZA 2ZR5A 1J4RA 4GGQA 4ODQA 2OFNA 3KADA 1C9HA 2MF9A 3O5FA 3FAPA 1M5YA 3B7XA 3O5KA 4QIBA 2PPNA 4FAPA 3NTPA 3UQIA 4DRIA 1YATA 2DG3A 1D7HA 2ZR4A 5DIVA 2PPOA 1B6CA 2MLYA 4JFLA 1FKTA 2UZ5A 4TW7A 3UF8A 1NMVA 4JYSA 1Y0OA 5BXJA 2LGOA 4JFJA 1ROUA 4ODLA 4MGVA 4W9OA 4DRQA 2XP7A 4R0XA 4W9PA 2LJ4A 1BL4A 3KAGA 2XP3A 1N1AA 5HW6A 3KZ7A 4ODNA 4TYOA 2F21A 3PRBA 4IQ2A 2F2DA 2ZQSA 4J4NA 2N87A 2FAPA 2RSEA 2XPAA 4TW8A 3NI6A 3KACA 3O5GA 3ODKA 5HWCA 2L2SA 1TCOC 1FAPA 1JVWA 1NSGA 2RUCA 3I6CA 3O5IA 4ODRA 1D7IA 1NMWA 3IKGA 4DZ3A 4GIVA 2KGJA 1ZK6A 3O5RA 3UI4A 1FKBA 3RFWA 2RUDA 1FKJA 2K8IA 2PV1A 3LUOA 4JFIA 4DRPA 1QPFA 1D7JA 3IHZA 2KO7A 4IQCA 4IPXA 1KT0A 2IF4A 4ITZA 1YW5A 2M2AA 2XP9A 4O2TA 5GPGA 4NNRA 1P5QA 3VAWA 1R9HA 2PV3A 4LAYA 3O5OA 1FKKA 3CGNA 2KFWA 3EY6A 2FKEA 3PRDA 4DROA 3WH0A 2XP6A 2ZQVA 3GPKA 1W26A 1FKHA 1F8AB 2JZVA 4DH0A 3O5PA 3O5EA 1L1PA 1FKSA 1EYMA 4TW6A 3UQAA 2MLXA 5DITA 5HUAA 1FJDA 4ODOA 1J4HA 3KABA 1Q1CA 3IKDA 3KCEA 3TC5A 2LPVA 1JNSA 3IK8A 3OOBA 4JFMA 5I98A 4ODKA 1FKFA 2AWGA 2LKNA 2Q5AA 1Q6HA 2PPPA 3CGMA 3RGCA 5HTGA 2KI3A 1FKRA 4LAVA 3JXVA 4DRHA 4QT3A 1F40A 1FKIA 3NRKA 1PINA 1HXVA 2ZR6A 2KR7A 1Q6IA 2M1IA 4DRKA 3MDYB 3JYJA 3UI6A 2MNTA 2XP4A 1D6OA 4TX0A 2DG4A 2D9FA 3UI5A 4DRNA 5J6EA 4LAXA 1J4IA 2Y78A 4G50A 4LAWA 2RUQA 3O5DA 1U79A 4ODPA 1Q6UA 3H9RB 2RURA 5HKGA 2XPBA 3KAFA 5D75A 5HT1A 3KAIA 1KT1A 2MLZA 2ITKA 2M08A 3KAHA 1ROTA 3PA7A 4DZ2A 1FD9A 1QZ2A 3JYMA 2ZQUA
chains in the Genus database with same CATH superfamily
4DRJA 2G8ZA 2DG9A 3O5LA 4FN2A 3ARSA 4MSPA 5HW8A 3O5QA 2XP8A 4W9QA 1FFRA 1W1YA 4QZVB 2FDMA 3AS1A 4UDMA 4HARA 1E6ZA 4JFKA 4U85A 4WK9A 4MNJA 5HWBA 1J4RA 4ODQA 1C9HA 3B7XA 4KQZA 1W9PA 2PPNA 3UQIA 2EULA 1D7HA 2ZR4A 5DIVA 2MLYA 4HBOA 2UZ5A 4WKAA 5BXJA 2LGOA 2O92A 4MGVA 1BL4A 3KAGA 4HBEA 1SYTA 4MNLA 4TYOA 4IQ2A 2A3BA 4L72B 2RSEA 2XPAA 3ODKA 2L2SA 2B31A 4ODRA 3QOKA 2PN0A 2DT2A 5HBFA 1FKBA 1IX5A 1NWUA 5DO2A 3LUOA 3FXYA 1D7JA 3B8SA 4IQCA 1EDQA 1KT0A 4Z2JA 4Z2HA 1KFWA 1YW5A 3GTYX 4O2TA 4NNRA 2DT3A 3VAWA 3CHEA 1D2KA 2DSUA 1HJXA 2KFWA 3CGNA 3ARQA 3WH0A 2ESCA 2JZVA 1EYMA 5DITA 1LJYA 1J4HA 3KABA 3IKDA 3TC5A 4PTMA 1E6NA 4MNKA 1JNSA 3OOBA 1HXVA 2LKNA 1ITXA 1Q6HA 3CGMA 1WNOA 1FKRA 3JXVA 4QT3A 1X6NA 3G6LA 4ZPWR 4DRKA 3MDYB 4Z2KA 3ALFA 4MNMA 5J6EA 4LAXA 2Y78A 3O5DA 1U79A 4ODPA 1GOIA 2AOSA 3CHFA 5HKGA 1UR8A 3KAFA 1W1TA 2A3AA 3KAHA 4DZ2A 1FD9A 1QZ2A 3ARWA 4MTVA 4N19A 4KR0B 4ODMA 5B8IC 3W4RA 1J6YA 1FKLA 3UQBA 3O5JA 3ARXA 1NWTA 2PV2A 2RQSA 4C02B 2MPHA 4U84A 1BKFA 1PBKA 1ZCNA 2VN1A 3ARRA 3O5MA 1JNTA 1W1VA 1FFQA 4P8WA 3O5FA 3O5KA 4QIBA 1LG1A 4DRIA 1FKTA 4TW7A 4XAKA 1NMVA 2XP7A 2LJ4A 2XP3A 1NH6A 3ARTA 3KZ7A 2F21A 2QF8A 4R5EA 2F2DA 2F23A 2WLZA 4J4NA 2N87A 3NI6A 2B5UB 3KACA 5JH8A 5HWCA 1FAPA 1NSGA 2RUCA 3I6CA 4Q7NA 4MPKA 1NMWA 1XHGA 2P4VA 3IKGA 4DZ3A 2KGJA 3UI4A 2PV1A 2IF4A 3CHCA 4ITZA 2M2AA 2XP9A 5GPGA 2PV3A 5GPRA 1ZBWA 4DROA 2ZQVA 1W26A 1F8AB 1L1PA 4TW6A 2MLXA 3B9AA 4L3NA 1VF8A 3PR9A 1Q1CA 3KCEA 4DWSB 2LPVA 3WD4A 1OGBA 3WD1A 1FKFA 2AWGA 5HTGA 3AS0A 4DRHA 4WJXA 1FKIA 1PINA 3CZ8A 2ZR6A 4WKHA 3UI6A 2DT0A 2XP4A 1HKKA 2DG4A 4AY1A 1J4IA 1Q6UA 3H9RB 3B9EA 2XPBA 3AROA 5HT1A 2M08A 1ROTA 1HKIA 4Z2IA 2YBUA 4ZS6A 1LL4A 2PBCA 1HJWA 3TDBA 2VCDA 4BF8A 1E6PA 2XP5A 4IT4A 4J4OA 2DPEA 1FKDA 2KE0A 1FKGA 1T11A 5HW7A 1JCHB 2ZQTA 4ML4A 4LGXA 4DRMA 3FY1A 3TCZA 3AS2A 2ZR5A 4DWSC 2OFNA 3KADA 1E9LA 2DT1A 3FAPA 1M5YA 3WD0A 1EHNA 1ZB5A 3G6MA 4P8VA 1H0IA 4URIA 1OWQA 1B6CA 4JFLA 4MAVA 4ODLA 4DRQA 1ZU8A 4DWSD 4W9PA 1K9TA 2DSZA 3PRBA 1SR0A 3CHDA 2FAPA 4TW8A 1GRJA 1RD6A 3O5GA 1O6IA 1ZK6A 1OGGA 3RM8A 3WIJA 1FKJA 1ZL1A 2K8IA 4JFIA 3IHZA 2KO7A 1ZBKA 1HKJA 2G41A 4LAYA 3O5OA 1FKKA 3EY6A 2FKEA 1W9UA 4Z2LA 1NWSA 2XP6A 4DH0A 3O5PA 3O5EA 1EIBA 1FKSA 4ZPTR 1HJVA 2ETNA 3UQAA 3WKZA 1XRVA 1JNEA 3ARYA 3IK8A 4JFMA 4ODKA 1NWRA 1GPFA 2PPPA 3WD2A 2A3CA 2KI3A 4LAVA 4S3JA 1UR9A 2YBTA 2KR7A 3JYJA 2MNTA 1D6OA 4DRNA 4LAWA 4G50A 3WQVA 2RUQA 3RM4A 3WQWA 3AQUA 5D75A 3KAIA 1KT1A 2ITKA 1ZBCA 2ZQUA 3AS3A 4S3KA 1LL6A 4TNSA 1A7XA 2IUZA 2F4EA 3ARPA 3UI5A 1QPLA 5DIUA 4QT2A 4G2PA 1WAWA 2WM0A 2DSWA 4DIPA 4DT4A 1W1PA 3WD3A 1EQ3A 2DSVA 4GGQA 2MF9A 3OA5A 4FAPA 3NTPA 5GQBA 1YATA 1CTNA 2DG3A 2PPOA 1JNDA 3UF8A 4JYSA 1Y0OA 4WIWA 3GU0A 4JFJA 1ROUA 4W9OA 4R0XA 1E15A 4Q22A 1N1AA 4P8XA 5HW6A 4ODNA 5DEZA 3WL0A 3RM9A 2ZQSA 4NSBA 4W5UA 4WKFA 3PRAA 1E44A 4DWSA 4Z2GA 1H0GA 1GUVA 1TCOC 3B9DA 1JVWA 3O5IA 1D7IA 1W9VA 4GIVA 3O5RA 3RFWA 2RUDA 4DRPA 2OLHA 1QPFA 4P8UA 2O9OA 4IPXA 5DF0A 1LL7A 1HKMA 3CH9A 1X6LA 1ZBVA 1P5QA 1R9HA 2A3EA 3WL1A 3PRDA 3ARUA 3GPKA 1FKHA 1LQ0A 5HUAA 1FJDA 4ODOA 4ZPVR 3RMEA 2PI6A 1LG2A 3EIPA 5I98A 2Q5AA 3RGCA 2WLYA 1F40A 3NRKA 1WB0A 2WK2A 1Q6IA 2M1IA 4IT6A 4TX0A 3ARVA 2D9FA 4NZCA 4U86A 3BXWA 1TFVA 3ALGA 1E6RA 2RURA 3ARZA 2MLZA 3PA7A 3BMBA 3JYMA
chains in the Genus database with same CATH topology
4DRJA 2G8ZA 2DG9A 3O5LA 4FN2A 3ARSA 4MSPA 5HW8A 3O5QA 2XP8A 4W9QA 1FFRA 1W1YA 4QZVB 2FDMA 3AS1A 4HARA 1E6ZA 4JFKA 4U85A 4WK9A 4MNJA 5HWBA 1J4RA 4ODQA 1C9HA 3B7XA 4KQZA 1W9PA 2PPNA 3UQIA 1D7HA 2ZR4A 5DIVA 2MLYA 4HBOA 2UZ5A 4WKAA 5BXJA 2LGOA 2O92A 4MGVA 1BL4A 3KAGA 4HBEA 1SYTA 4MNLA 4TYOA 4IQ2A 2A3BA 4L72B 2RSEA 2XPAA 3ODKA 2L2SA 2B31A 4ODRA 3QOKA 5HBFA 2DT2A 1FKBA 1IX5A 1NWUA 5DO2A 3LUOA 3FXYA 1D7JA 3B8SA 4IQCA 1EDQA 1KT0A 4Z2JA 4Z2HA 1KFWA 1YW5A 4O2TA 4NNRA 2DT3A 3VAWA 3CHEA 1D2KA 2DSUA 1HJXA 2KFWA 3CGNA 3ARQA 3WH0A 2ESCA 2JZVA 1EYMA 5DITA 1LJYA 1J4HA 3KABA 3IKDA 3TC5A 4PTMA 1E6NA 4MNKA 1JNSA 3OOBA 1HXVA 2LKNA 1ITXA 1Q6HA 3CGMA 1WNOA 1FKRA 3JXVA 4QT3A 1X6NA 3G6LA 4ZPWR 4DRKA 3MDYB 4Z2KA 3ALFA 4MNMA 5J6EA 4LAXA 2Y78A 3O5DA 1U79A 4ODPA 1GOIA 2AOSA 3CHFA 5HKGA 1UR8A 3KAFA 1W1TA 2A3AA 3KAHA 4DZ2A 1FD9A 1QZ2A 3ARWA 4MTVA 4N19A 4KR0B 4ODMA 5B8IC 3W4RA 1J6YA 1FKLA 3UQBA 3O5JA 3ARXA 1NWTA 2PV2A 2RQSA 4C02B 2MPHA 4U84A 1BKFA 1PBKA 1ZCNA 2VN1A 3ARRA 3O5MA 1JNTA 1W1VA 1FFQA 4P8WA 3O5FA 3O5KA 4QIBA 1LG1A 4DRIA 1FKTA 4TW7A 4XAKA 1NMVA 2XP7A 2LJ4A 2XP3A 1NH6A 3ARTA 3KZ7A 2F21A 2QF8A 4R5EA 2F2DA 2WLZA 4J4NA 2N87A 3NI6A 3KACA 5JH8A 5HWCA 1FAPA 1NSGA 2RUCA 3I6CA 4Q7NA 4MPKA 1NMWA 1XHGA 3IKGA 4DZ3A 2KGJA 3UI4A 2PV1A 2IF4A 3CHCA 4ITZA 2M2AA 2XP9A 5GPGA 2PV3A 5GPRA 1ZBWA 4DROA 2ZQVA 1W26A 1F8AB 1L1PA 4TW6A 2MLXA 3B9AA 4L3NA 1VF8A 3PR9A 1Q1CA 3KCEA 4DWSB 2LPVA 3WD4A 1OGBA 3WD1A 1FKFA 2AWGA 5HTGA 3AS0A 4DRHA 4WJXA 1FKIA 1PINA 3CZ8A 2ZR6A 4WKHA 3UI6A 2DT0A 2XP4A 1HKKA 2DG4A 4AY1A 1J4IA 1Q6UA 3H9RB 3B9EA 2XPBA 3AROA 5HT1A 2M08A 1ROTA 1HKIA 4Z2IA 2YBUA 4ZS6A 1LL4A 2PBCA 1HJWA 3TDBA 2VCDA 4BF8A 1E6PA 2XP5A 4IT4A 4J4OA 2DPEA 1FKDA 2KE0A 1FKGA 1T11A 5HW7A 2ZQTA 4ML4A 4LGXA 4DRMA 3FY1A 3TCZA 3AS2A 2ZR5A 4DWSC 2OFNA 3KADA 1E9LA 2DT1A 3FAPA 1M5YA 3WD0A 1EHNA 1ZB5A 3G6MA 4P8VA 1H0IA 4URIA 1OWQA 1B6CA 4JFLA 4MAVA 4ODLA 4DRQA 1ZU8A 4DWSD 4W9PA 1K9TA 2DSZA 3PRBA 1SR0A 3CHDA 2FAPA 4TW8A 1RD6A 3O5GA 1O6IA 1ZK6A 1OGGA 3RM8A 3WIJA 1FKJA 1ZL1A 2K8IA 4JFIA 3IHZA 2KO7A 1ZBKA 1HKJA 2G41A 4LAYA 3O5OA 1FKKA 3EY6A 2FKEA 1W9UA 4Z2LA 1NWSA 2XP6A 4DH0A 3O5PA 3O5EA 1EIBA 1FKSA 4ZPTR 1HJVA 3UQAA 3WKZA 1XRVA 1JNEA 3ARYA 3IK8A 4JFMA 4ODKA 1NWRA 1GPFA 2PPPA 3WD2A 2A3CA 2KI3A 4LAVA 4S3JA 1UR9A 2YBTA 2KR7A 3JYJA 2MNTA 1D6OA 4DRNA 4LAWA 4G50A 3WQVA 2RUQA 3RM4A 3WQWA 3AQUA 5D75A 3KAIA 1KT1A 2ITKA 1ZBCA 2ZQUA 3AS3A 4S3KA 1LL6A 4TNSA 1A7XA 2IUZA 2F4EA 3ARPA 3UI5A 1QPLA 5DIUA 4QT2A 4G2PA 1WAWA 2WM0A 2DSWA 4DIPA 4DT4A 1W1PA 3WD3A 1EQ3A 2DSVA 4GGQA 2MF9A 3OA5A 4FAPA 3NTPA 5GQBA 1YATA 1CTNA 2DG3A 2PPOA 1JNDA 3UF8A 4JYSA 1Y0OA 4WIWA 4JFJA 1ROUA 4W9OA 4R0XA 1E15A 4Q22A 1N1AA 4P8XA 5HW6A 4ODNA 5DEZA 3WL0A 3RM9A 2ZQSA 4NSBA 4W5UA 4WKFA 3PRAA 4DWSA 4Z2GA 1H0GA 1GUVA 1TCOC 3B9DA 1JVWA 3O5IA 1D7IA 1W9VA 4GIVA 3O5RA 3RFWA 2RUDA 4DRPA 2OLHA 1QPFA 4P8UA 2O9OA 4IPXA 5DF0A 1LL7A 1HKMA 3CH9A 1X6LA 1ZBVA 1P5QA 1R9HA 2A3EA 3WL1A 3PRDA 3ARUA 3GPKA 1FKHA 1LQ0A 5HUAA 1FJDA 4ODOA 4ZPVR 3RMEA 2PI6A 1LG2A 5I98A 2Q5AA 3RGCA 2WLYA 1F40A 3NRKA 1WB0A 2WK2A 1Q6IA 2M1IA 4IT6A 4TX0A 3ARVA 2D9FA 4NZCA 4U86A 3BXWA 1TFVA 3ALGA 1E6RA 2RURA 3ARZA 2MLZA 3PA7A 3JYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBC A;  4DRJ A;  4N19 A;  3TDB A;  2DG9 A;  3O5L A;  2VCD A;  4FN2 A;  4ODM A;  4TNS A;  4MSP A;  1A7X A;  4BF8 A;  5B8I C;  5HW8 A;  3O5Q A;  2XP5 A;  2XP8 A;  1J6Y A;  1FKL A;  4W9Q A;  4J4O A;  3O5J A;  2F4E A;  3UQB A;  2PV2 A;  2RQS A;  4C02 B;  1FKD A;  2MPH A;  4U84 A;  1QPL A;  2KE0 A;  5DIU A;  1FKG A;  1T11 A;  1BKF A;  1PBK A;  1ZCN A;  2VN1 A;  2ZQT A;  3O5M A;  4G2P A;  4QT2 A;  5HW7 A;  4JFK A;  4U85 A;  4DIP A;  1JNT A;  4DT4 A;  4U86 A;  4DRM A;  5HWB A;  1EQ3 A;  3TCZ A;  2ZR5 A;  1J4R A;  4GGQ A;  4ODQ A;  2OFN A;  3KAD A;  1C9H A;  2MF9 A;  3O5F A;  3FAP A;  1M5Y A;  3B7X A;  3O5K A;  4QIB A;  2PPN A;  4FAP A;  3NTP A;  3UQI A;  4DRI A;  1YAT A;  2DG3 A;  1D7H A;  2ZR4 A;  5DIV A;  2PPO A;  1B6C A;  2MLY A;  4JFL A;  1FKT A;  2UZ5 A;  4TW7 A;  3UF8 A;  1NMV A;  4JYS A;  1Y0O A;  5BXJ A;  2LGO A;  4JFJ A;  1ROU A;  4ODL A;  4MGV A;  4W9O A;  4DRQ A;  2XP7 A;  4R0X A;  4W9P A;  2LJ4 A;  1BL4 A;  3KAG A;  2XP3 A;  1N1A A;  5HW6 A;  3KZ7 A;  4ODN A;  4TYO A;  2F21 A;  3PRB A;  4IQ2 A;  2F2D A;  2ZQS A;  4J4N A;  2N87 A;  2FAP A;  2RSE A;  2XPA A;  4TW8 A;  3NI6 A;  3KAC A;  3O5G A;  3ODK A;  5HWC A;  2L2S A;  1TCO C;  1FAP A;  1JVW A;  1NSG A;  2RUC A;  3I6C A;  3O5I A;  4ODR A;  1D7I A;  1NMW A;  3IKG A;  4DZ3 A;  4GIV A;  2KGJ A;  1ZK6 A;  3O5R A;  3UI4 A;  1FKB A;  3RFW A;  2RUD A;  1FKJ A;  2K8I A;  2PV1 A;  3LUO A;  4JFI A;  4DRP A;  1QPF A;  1D7J A;  3IHZ A;  2KO7 A;  4IQC A;  4IPX A;  1KT0 A;  2IF4 A;  4ITZ A;  1YW5 A;  2M2A A;  2XP9 A;  4O2T A;  5GPG A;  4NNR A;  1P5Q A;  3VAW A;  1R9H A;  2PV3 A;  4LAY A;  3O5O A;  1FKK A;  3CGN A;  2KFW A;  3EY6 A;  2FKE A;  3PRD A;  4DRO A;  3WH0 A;  2XP6 A;  2ZQV A;  3GPK A;  1W26 A;  1FKH A;  1F8A B;  2JZV A;  4DH0 A;  3O5P A;  3O5E A;  1L1P A;  1FKS A;  1EYM A;  4TW6 A;  3UQA A;  2MLX A;  5DIT A;  5HUA A;  1FJD A;  4ODO A;  1J4H A;  3KAB A;  1Q1C A;  3IKD A;  3KCE A;  3TC5 A;  2LPV A;  1JNS A;  3IK8 A;  3OOB A;  4JFM A;  5I98 A;  4ODK A;  1FKF A;  2AWG A;  2LKN A;  2Q5A A;  1Q6H A;  2PPP A;  3CGM A;  3RGC A;  5HTG A;  2KI3 A;  1FKR A;  4LAV A;  3JXV A;  4DRH A;  4QT3 A;  1F40 A;  1FKI A;  3NRK A;  1PIN A;  1HXV A;  2ZR6 A;  2KR7 A;  1Q6I A;  2M1I A;  4DRK A;  3MDY B;  3JYJ A;  3UI6 A;  2MNT A;  2XP4 A;  1D6O A;  4TX0 A;  2DG4 A;  2D9F A;  3UI5 A;  4DRN A;  5J6E A;  4LAX A;  1J4I A;  2Y78 A;  4G50 A;  4LAW A;  2RUQ A;  3O5D A;  1U79 A;  4ODP A;  1Q6U A;  3H9R B;  2RUR A;  5HKG A;  2XPB A;  3KAF A;  5D75 A;  5HT1 A;  3KAI A;  1KT1 A;  2MLZ A;  2ITK A;  2M08 A;  3KAH A;  1ROT A;  3PA7 A;  4DZ2 A;  1FD9 A;  1QZ2 A;  3JYM A;  2ZQU A; 
#chains in the Genus database with same CATH topology
 4DRJ A;  2G8Z A;  2DG9 A;  3O5L A;  4FN2 A;  3ARS A;  4MSP A;  5HW8 A;  3O5Q A;  2XP8 A;  4W9Q A;  1FFR A;  1W1Y A;  4QZV B;  2FDM A;  3AS1 A;  4UDM A;  4HAR A;  1E6Z A;  4JFK A;  4U85 A;  4WK9 A;  4MNJ A;  5HWB A;  1J4R A;  4ODQ A;  1C9H A;  3B7X A;  4KQZ A;  1W9P A;  2PPN A;  3UQI A;  2EUL A;  1D7H A;  2ZR4 A;  5DIV A;  2MLY A;  4HBO A;  2UZ5 A;  4WKA A;  5BXJ A;  2LGO A;  2O92 A;  4MGV A;  1BL4 A;  3KAG A;  4HBE A;  1SYT A;  4MNL A;  4TYO A;  4IQ2 A;  2A3B A;  4L72 B;  2RSE A;  2XPA A;  3ODK A;  2L2S A;  2B31 A;  4ODR A;  3QOK A;  2PN0 A;  2DT2 A;  5HBF A;  1FKB A;  1IX5 A;  1NWU A;  5DO2 A;  3LUO A;  3FXY A;  1D7J A;  3B8S A;  4IQC A;  1EDQ A;  1KT0 A;  4Z2J A;  4Z2H A;  1KFW A;  1YW5 A;  3GTY X;  4O2T A;  4NNR A;  2DT3 A;  3VAW A;  3CHE A;  1D2K A;  2DSU A;  1HJX A;  2KFW A;  3CGN A;  3ARQ A;  3WH0 A;  2ESC A;  2JZV A;  1EYM A;  5DIT A;  1LJY A;  1J4H A;  3KAB A;  3IKD A;  3TC5 A;  4PTM A;  1E6N A;  4MNK A;  1JNS A;  3OOB A;  1HXV A;  2LKN A;  1ITX A;  1Q6H A;  3CGM A;  1WNO A;  1FKR A;  3JXV A;  4QT3 A;  1X6N A;  3G6L A;  4ZPW R;  4DRK A;  3MDY B;  4Z2K A;  3ALF A;  4MNM A;  5J6E A;  4LAX A;  2Y78 A;  3O5D A;  1U79 A;  4ODP A;  1GOI A;  2AOS A;  3CHF A;  5HKG A;  1UR8 A;  3KAF A;  1W1T A;  2A3A A;  3KAH A;  4DZ2 A;  1FD9 A;  1QZ2 A;  3ARW A;  4MTV A;  4N19 A;  4KR0 B;  4ODM A;  5B8I C;  3W4R A;  1J6Y A;  1FKL A;  3UQB A;  3O5J A;  3ARX A;  1NWT A;  2PV2 A;  2RQS A;  4C02 B;  2MPH A;  4U84 A;  1BKF A;  1PBK A;  1ZCN A;  2VN1 A;  3ARR A;  3O5M A;  1JNT A;  1W1V A;  1FFQ A;  4P8W A;  3O5F A;  3O5K A;  4QIB A;  1LG1 A;  4DRI A;  1FKT A;  4TW7 A;  4XAK A;  1NMV A;  2XP7 A;  2LJ4 A;  2XP3 A;  1NH6 A;  3ART A;  3KZ7 A;  2F21 A;  2QF8 A;  4R5E A;  2F2D A;  2F23 A;  2WLZ A;  4J4N A;  2N87 A;  3NI6 A;  2B5U B;  3KAC A;  5JH8 A;  5HWC A;  1FAP A;  1NSG A;  2RUC A;  3I6C A;  4Q7N A;  4MPK A;  1NMW A;  1XHG A;  2P4V A;  3IKG A;  4DZ3 A;  2KGJ A;  3UI4 A;  2PV1 A;  2IF4 A;  3CHC A;  4ITZ A;  2M2A A;  2XP9 A;  5GPG A;  2PV3 A;  5GPR A;  1ZBW A;  4DRO A;  2ZQV A;  1W26 A;  1F8A B;  1L1P A;  4TW6 A;  2MLX A;  3B9A A;  4L3N A;  1VF8 A;  3PR9 A;  1Q1C A;  3KCE A;  4DWS B;  2LPV A;  3WD4 A;  1OGB A;  3WD1 A;  1FKF A;  2AWG A;  5HTG A;  3AS0 A;  4DRH A;  4WJX A;  1FKI A;  1PIN A;  3CZ8 A;  2ZR6 A;  4WKH A;  3UI6 A;  2DT0 A;  2XP4 A;  1HKK A;  2DG4 A;  4AY1 A;  1J4I A;  1Q6U A;  3H9R B;  3B9E A;  2XPB A;  3ARO A;  5HT1 A;  2M08 A;  1ROT A;  1HKI A;  4Z2I A;  2YBU A;  4ZS6 A;  1LL4 A;  2PBC A;  1HJW A;  3TDB A;  2VCD A;  4BF8 A;  1E6P A;  2XP5 A;  4IT4 A;  4J4O A;  2DPE A;  1FKD A;  2KE0 A;  1FKG A;  1T11 A;  5HW7 A;  1JCH B;  2ZQT A;  4ML4 A;  4LGX A;  4DRM A;  3FY1 A;  3TCZ A;  3AS2 A;  2ZR5 A;  4DWS C;  2OFN A;  3KAD A;  1E9L A;  2DT1 A;  3FAP A;  1M5Y A;  3WD0 A;  1EHN A;  1ZB5 A;  3G6M A;  4P8V A;  1H0I A;  4URI A;  1OWQ A;  1B6C A;  4JFL A;  4MAV A;  4ODL A;  4DRQ A;  1ZU8 A;  4DWS D;  4W9P A;  1K9T A;  2DSZ A;  3PRB A;  1SR0 A;  3CHD A;  2FAP A;  4TW8 A;  1GRJ A;  1RD6 A;  3O5G A;  1O6I A;  1ZK6 A;  1OGG A;  3RM8 A;  3WIJ A;  1FKJ A;  1ZL1 A;  2K8I A;  4JFI A;  3IHZ A;  2KO7 A;  1ZBK A;  1HKJ A;  2G41 A;  4LAY A;  3O5O A;  1FKK A;  3EY6 A;  2FKE A;  1W9U A;  4Z2L A;  1NWS A;  2XP6 A;  4DH0 A;  3O5P A;  3O5E A;  1EIB A;  1FKS A;  4ZPT R;  1HJV A;  2ETN A;  3UQA A;  3WKZ A;  1XRV A;  1JNE A;  3ARY A;  3IK8 A;  4JFM A;  4ODK A;  1NWR A;  1GPF A;  2PPP A;  3WD2 A;  2A3C A;  2KI3 A;  4LAV A;  4S3J A;  1UR9 A;  2YBT A;  2KR7 A;  3JYJ A;  2MNT A;  1D6O A;  4DRN A;  4LAW A;  4G50 A;  3WQV A;  2RUQ A;  3RM4 A;  3WQW A;  3AQU A;  5D75 A;  3KAI A;  1KT1 A;  2ITK A;  1ZBC A;  2ZQU A;  3AS3 A;  4S3K A;  1LL6 A;  4TNS A;  1A7X A;  2IUZ A;  2F4E A;  3ARP A;  3UI5 A;  1QPL A;  5DIU A;  4QT2 A;  4G2P A;  1WAW A;  2WM0 A;  2DSW A;  4DIP A;  4DT4 A;  1W1P A;  3WD3 A;  1EQ3 A;  2DSV A;  4GGQ A;  2MF9 A;  3OA5 A;  4FAP A;  3NTP A;  5GQB A;  1YAT A;  1CTN A;  2DG3 A;  2PPO A;  1JND A;  3UF8 A;  4JYS A;  1Y0O A;  4WIW A;  3GU0 A;  4JFJ A;  1ROU A;  4W9O A;  4R0X A;  1E15 A;  4Q22 A;  1N1A A;  4P8X A;  5HW6 A;  4ODN A;  5DEZ A;  3WL0 A;  3RM9 A;  2ZQS A;  4NSB A;  4W5U A;  4WKF A;  3PRA A;  1E44 A;  4DWS A;  4Z2G A;  1H0G A;  1GUV A;  1TCO C;  3B9D A;  1JVW A;  3O5I A;  1D7I A;  1W9V A;  4GIV A;  3O5R A;  3RFW A;  2RUD A;  4DRP A;  2OLH A;  1QPF A;  4P8U A;  2O9O A;  4IPX A;  5DF0 A;  1LL7 A;  1HKM A;  3CH9 A;  1X6L A;  1ZBV A;  1P5Q A;  1R9H A;  2A3E A;  3WL1 A;  3PRD A;  3ARU A;  3GPK A;  1FKH A;  1LQ0 A;  5HUA A;  1FJD A;  4ODO A;  4ZPV R;  3RME A;  2PI6 A;  1LG2 A;  3EIP A;  5I98 A;  2Q5A A;  3RGC A;  2WLY A;  1F40 A;  3NRK A;  1WB0 A;  2WK2 A;  1Q6I A;  2M1I A;  4IT6 A;  4TX0 A;  3ARV A;  2D9F A;  4NZC A;  4U86 A;  3BXW A;  1TFV A;  3ALG A;  1E6R A;  2RUR A;  3ARZ A;  2MLZ A;  3PA7 A;  3BMB A;  3JYM A; 
#chains in the Genus database with same CATH homology
 4DRJ A;  2G8Z A;  2DG9 A;  3O5L A;  4FN2 A;  3ARS A;  4MSP A;  5HW8 A;  3O5Q A;  2XP8 A;  4W9Q A;  1FFR A;  1W1Y A;  4QZV B;  2FDM A;  3AS1 A;  4HAR A;  1E6Z A;  4JFK A;  4U85 A;  4WK9 A;  4MNJ A;  5HWB A;  1J4R A;  4ODQ A;  1C9H A;  3B7X A;  4KQZ A;  1W9P A;  2PPN A;  3UQI A;  1D7H A;  2ZR4 A;  5DIV A;  2MLY A;  4HBO A;  2UZ5 A;  4WKA A;  5BXJ A;  2LGO A;  2O92 A;  4MGV A;  1BL4 A;  3KAG A;  4HBE A;  1SYT A;  4MNL A;  4TYO A;  4IQ2 A;  2A3B A;  4L72 B;  2RSE A;  2XPA A;  3ODK A;  2L2S A;  2B31 A;  4ODR A;  3QOK A;  5HBF A;  2DT2 A;  1FKB A;  1IX5 A;  1NWU A;  5DO2 A;  3LUO A;  3FXY A;  1D7J A;  3B8S A;  4IQC A;  1EDQ A;  1KT0 A;  4Z2J A;  4Z2H A;  1KFW A;  1YW5 A;  4O2T A;  4NNR A;  2DT3 A;  3VAW A;  3CHE A;  1D2K A;  2DSU A;  1HJX A;  2KFW A;  3CGN A;  3ARQ A;  3WH0 A;  2ESC A;  2JZV A;  1EYM A;  5DIT A;  1LJY A;  1J4H A;  3KAB A;  3IKD A;  3TC5 A;  4PTM A;  1E6N A;  4MNK A;  1JNS A;  3OOB A;  1HXV A;  2LKN A;  1ITX A;  1Q6H A;  3CGM A;  1WNO A;  1FKR A;  3JXV A;  4QT3 A;  1X6N A;  3G6L A;  4ZPW R;  4DRK A;  3MDY B;  4Z2K A;  3ALF A;  4MNM A;  5J6E A;  4LAX A;  2Y78 A;  3O5D A;  1U79 A;  4ODP A;  1GOI A;  2AOS A;  3CHF A;  5HKG A;  1UR8 A;  3KAF A;  1W1T A;  2A3A A;  3KAH A;  4DZ2 A;  1FD9 A;  1QZ2 A;  3ARW A;  4MTV A;  4N19 A;  4KR0 B;  4ODM A;  5B8I C;  3W4R A;  1J6Y A;  1FKL A;  3UQB A;  3O5J A;  3ARX A;  1NWT A;  2PV2 A;  2RQS A;  4C02 B;  2MPH A;  4U84 A;  1BKF A;  1PBK A;  1ZCN A;  2VN1 A;  3ARR A;  3O5M A;  1JNT A;  1W1V A;  1FFQ A;  4P8W A;  3O5F A;  3O5K A;  4QIB A;  1LG1 A;  4DRI A;  1FKT A;  4TW7 A;  4XAK A;  1NMV A;  2XP7 A;  2LJ4 A;  2XP3 A;  1NH6 A;  3ART A;  3KZ7 A;  2F21 A;  2QF8 A;  4R5E A;  2F2D A;  2WLZ A;  4J4N A;  2N87 A;  3NI6 A;  3KAC A;  5JH8 A;  5HWC A;  1FAP A;  1NSG A;  2RUC A;  3I6C A;  4Q7N A;  4MPK A;  1NMW A;  1XHG A;  3IKG A;  4DZ3 A;  2KGJ A;  3UI4 A;  2PV1 A;  2IF4 A;  3CHC A;  4ITZ A;  2M2A A;  2XP9 A;  5GPG A;  2PV3 A;  5GPR A;  1ZBW A;  4DRO A;  2ZQV A;  1W26 A;  1F8A B;  1L1P A;  4TW6 A;  2MLX A;  3B9A A;  4L3N A;  1VF8 A;  3PR9 A;  1Q1C A;  3KCE A;  4DWS B;  2LPV A;  3WD4 A;  1OGB A;  3WD1 A;  1FKF A;  2AWG A;  5HTG A;  3AS0 A;  4DRH A;  4WJX A;  1FKI A;  1PIN A;  3CZ8 A;  2ZR6 A;  4WKH A;  3UI6 A;  2DT0 A;  2XP4 A;  1HKK A;  2DG4 A;  4AY1 A;  1J4I A;  1Q6U A;  3H9R B;  3B9E A;  2XPB A;  3ARO A;  5HT1 A;  2M08 A;  1ROT A;  1HKI A;  4Z2I A;  2YBU A;  4ZS6 A;  1LL4 A;  2PBC A;  1HJW A;  3TDB A;  2VCD A;  4BF8 A;  1E6P A;  2XP5 A;  4IT4 A;  4J4O A;  2DPE A;  1FKD A;  2KE0 A;  1FKG A;  1T11 A;  5HW7 A;  2ZQT A;  4ML4 A;  4LGX A;  4DRM A;  3FY1 A;  3TCZ A;  3AS2 A;  2ZR5 A;  4DWS C;  2OFN A;  3KAD A;  1E9L A;  2DT1 A;  3FAP A;  1M5Y A;  3WD0 A;  1EHN A;  1ZB5 A;  3G6M A;  4P8V A;  1H0I A;  4URI A;  1OWQ A;  1B6C A;  4JFL A;  4MAV A;  4ODL A;  4DRQ A;  1ZU8 A;  4DWS D;  4W9P A;  1K9T A;  2DSZ A;  3PRB A;  1SR0 A;  3CHD A;  2FAP A;  4TW8 A;  1RD6 A;  3O5G A;  1O6I A;  1ZK6 A;  1OGG A;  3RM8 A;  3WIJ A;  1FKJ A;  1ZL1 A;  2K8I A;  4JFI A;  3IHZ A;  2KO7 A;  1ZBK A;  1HKJ A;  2G41 A;  4LAY A;  3O5O A;  1FKK A;  3EY6 A;  2FKE A;  1W9U A;  4Z2L A;  1NWS A;  2XP6 A;  4DH0 A;  3O5P A;  3O5E A;  1EIB A;  1FKS A;  4ZPT R;  1HJV A;  3UQA A;  3WKZ A;  1XRV A;  1JNE A;  3ARY A;  3IK8 A;  4JFM A;  4ODK A;  1NWR A;  1GPF A;  2PPP A;  3WD2 A;  2A3C A;  2KI3 A;  4LAV A;  4S3J A;  1UR9 A;  2YBT A;  2KR7 A;  3JYJ A;  2MNT A;  1D6O A;  4DRN A;  4LAW A;  4G50 A;  3WQV A;  2RUQ A;  3RM4 A;  3WQW A;  3AQU A;  5D75 A;  3KAI A;  1KT1 A;  2ITK A;  1ZBC A;  2ZQU A;  3AS3 A;  4S3K A;  1LL6 A;  4TNS A;  1A7X A;  2IUZ A;  2F4E A;  3ARP A;  3UI5 A;  1QPL A;  5DIU A;  4QT2 A;  4G2P A;  1WAW A;  2WM0 A;  2DSW A;  4DIP A;  4DT4 A;  1W1P A;  3WD3 A;  1EQ3 A;  2DSV A;  4GGQ A;  2MF9 A;  3OA5 A;  4FAP A;  3NTP A;  5GQB A;  1YAT A;  1CTN A;  2DG3 A;  2PPO A;  1JND A;  3UF8 A;  4JYS A;  1Y0O A;  4WIW A;  4JFJ A;  1ROU A;  4W9O A;  4R0X A;  1E15 A;  4Q22 A;  1N1A A;  4P8X A;  5HW6 A;  4ODN A;  5DEZ A;  3WL0 A;  3RM9 A;  2ZQS A;  4NSB A;  4W5U A;  4WKF A;  3PRA A;  4DWS A;  4Z2G A;  1H0G A;  1GUV A;  1TCO C;  3B9D A;  1JVW A;  3O5I A;  1D7I A;  1W9V A;  4GIV A;  3O5R A;  3RFW A;  2RUD A;  4DRP A;  2OLH A;  1QPF A;  4P8U A;  2O9O A;  4IPX A;  5DF0 A;  1LL7 A;  1HKM A;  3CH9 A;  1X6L A;  1ZBV A;  1P5Q A;  1R9H A;  2A3E A;  3WL1 A;  3PRD A;  3ARU A;  3GPK A;  1FKH A;  1LQ0 A;  5HUA A;  1FJD A;  4ODO A;  4ZPV R;  3RME A;  2PI6 A;  1LG2 A;  5I98 A;  2Q5A A;  3RGC A;  2WLY A;  1F40 A;  3NRK A;  1WB0 A;  2WK2 A;  1Q6I A;  2M1I A;  4IT6 A;  4TX0 A;  3ARV A;  2D9F A;  4NZC A;  4U86 A;  3BXW A;  1TFV A;  3ALG A;  1E6R A;  2RUR A;  3ARZ A;  2MLZ A;  3PA7 A;  3JYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...