2VCDA

Solution structure of the fkbp-domain of legionella pneumophila mip in complex with rapamycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
FNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Legionella pneumophila Mip-rapamycin complex.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila (strain philadelphia 1 / atcc 33152 /
molecule tags Isomerase
molecule keywords Outer membrane protein MIP
total genus 27
structure length 137
sequence length 137
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2vcdA02
2LGOA 2PPPA 5HTGA 1PINA 1FKLA 3JYJA 4JFMA 5HWCA 4QT2A 2AWGA 4U85A 4ITZA 3UQIA 4MGVA 1ZK6A 2FKEA 1FKDA 1Q6IA 4JFJA 2F4EA 2KO7A 5DIUA 1BL4A 3JXVA 3UI5A 1NSGA 1N1AA 2RURA 3O5QA 3NI6A 4G2PA 1QPLA 3KACA 1FKBA 3UF8A 4DRPA 3O5DA 2M1IA 2Y78A 1A7XA 3IKGA 4ODKA 3O5PA 3FAPA 2ZR6A 3IHZA 2PV3A 2KE0A 1BKFA 2ZQSA 5DITA 3O5GA 3O5JA 3KAFA 1NMVA 2MLXA 4C02B 4DRKA 2UZ5A 2DG3A 1T11A 2PV1A 3NRKA 5HWBA 5J6EA 4LAXA 2RUQA 4ODRA 2ITKA 4ODPA 2PPNA 1EQ3A 4DZ2A 5B8IC 4W9QA 1ZCNA 1Q1CA 2KI3A 1JNTA 5GPGA 2RSEA 4J4OA 4QT3A 4DRNA 4TW8A 3UQAA 3EY6A 3UI6A 5BXJA 3MDYB 4LAWA 1P5QA 1HXVA 1FKTA 2RUDA 4TW7A 3KCEA 4N19A 2KFWA 1YATA 3WH0A 4DRJA 2DG4A 2XP5A 2XPAA 4MSPA 3KZ7A 2M2AA 4ODOA 2MNTA 5HW8A 2LJ4A 1W26A 2F2DA 1L1PA 1Y0OA 5HW7A 3KAGA 3KABA 2ZR5A 3O5KA 1D7HA 1NMWA 1R9HA 3O5EA 3I6CA 4DRHA 3UQBA 4LAVA 1FKRA 3NTPA 2OFNA 4TW6A 2VCDA 2XP4A 3O5FA 2XP7A 3B7XA 3IKDA 1J6YA 1JNSA 3O5OA 4JYSA 4DH0A 5HKGA 2RQSA 2XP8A 2JZVA 1FKHA 1D7JA 4TNSA 4DT4A 4ODNA 3PRDA 1F40A 4ODMA 3PRBA 1B6CA 4U84A 4J4NA 4U86A 3KADA 4ODQA 1QZ2A 1U79A 1JVWA 2M08A 2PBCA 5I98A 1FKGA 1FKFA 1KT0A 1FKJA 2FAPA 2ZR4A 3JYMA 3KAHA 1ROTA 2MLYA 3TDBA 3TCZA 4QIBA 2XPBA 4W9PA 2KR7A 4NNRA 2Q5AA 4ODLA 4FAPA 2F21A 1J4RA 1PBKA 3KAIA 3O5LA 4IQCA 4DRMA 2K8IA 2RUCA 4LAYA 2LPVA 1J4IA 2VN1A 2XP6A 3CGMA 2N87A 5HUAA 1FJDA 2MPHA 4TX0A 3H9RB 1Q6UA 3O5MA 1TCOC 2MLZA 1J4HA 2ZQUA 4JFIA 4O2TA 1F8AB 2D9FA 2IF4A 4GIVA 1FKSA 4IPXA 4DZ3A 2XP3A 4TYOA 2L2SA 4DRIA 2PPOA 1EYMA 3IK8A 2MF9A 1KT1A 1QPFA 3LUOA 2ZQTA 4JFLA 4R0XA 5DIVA 3UI4A 3VAWA 3OOBA 1FAPA 4BF8A 4IQ2A 2ZQVA 3PA7A 4DIPA 2PV2A 4G50A 4DROA 3CGNA 3O5RA 5D75A 3RGCA 1M5YA 1Q6HA 4W9OA 1FD9A 4FN2A 4JFKA 1D7IA 1FKIA 2KGJA 5HT1A 1D6OA 3GPKA 2XP9A 1ROUA 2DG9A 5HW6A 1YW5A 1C9HA 2LKNA 3RFWA 3ODKA 3O5IA 4DRQA 3TC5A 4GGQA 1FKKA
chains in the Genus database with same CATH superfamily
1HJVA 1FKLA 4UDMA 3ALGA 2AWGA 4U85A 4L3NA 1FKDA 4JFJA 2KO7A 5DIUA 1N1AA 3UF8A 2M1IA 2Y78A 1A7XA 4IT6A 1LG1A 1W1VA 1ZBKA 1LQ0A 2ZR6A 5DO2A 4ZS6A 2KE0A 2ZQSA 5DITA 1HKJA 3O5GA 3KAFA 2B5UB 2A3AA 3B9DA 3NRKA 4ODPA 2PPNA 1JNEA 2QF8A 4J4OA 4TW8A 3UQAA 3EY6A 1ZBWA 3CHFA 2RUDA 4DRJA 4N19A 1YATA 3KZ7A 3FXYA 5HW7A 3KABA 1K9TA 3ARTA 3O5EA 3UQBA 1FKRA 3RM9A 2DSUA 4TW6A 2VCDA 3ARVA 2RQSA 2JZVA 4ZPTR 1FKHA 4DT4A 3PRDA 3PR9A 3CHDA 3KADA 1ZBCA 2DSWA 3AROA 4MNJA 3ARWA 3WL0A 1FKJA 3ARRA 4HARA 3TDBA 5DF0A 3TCZA 4QIBA 4WIWA 2Q5AA 4FAPA 4KQZA 1H0GA 3B9AA 4LAYA 4ZPVR 2MPHA 1Q6UA 3O5MA 1TCOC 2ZQUA 1W9UA 4DZ3A 3ARZA 1EYMA 4DWSD 5DIVA 4BF8A 4Q22A 1VF8A 2PV2A 3AS3A 4DWSC 4P8UA 4Z2IA 1Q6HA 1ROUA 1W1TA 2DG9A 2WK2A 3WKZA 1FKKA 5HTGA 5HWCA 3JYJA 4MGVA 1ZK6A 3WD0A 2F4EA 4LGXA 1SR0A 4MNKA 1QPLA 3KACA 4WKHA 3IKGA 4ODKA 1UR8A 3O5PA 4WKFA 3WQVA 1E6RA 4ZPWR 2EULA 3PRAA 4QZVB 1LJYA 1ZCNA 2IUZA 2RSEA 4MAVA 3UI6A 2DT0A 1P5QA 1GUVA 3WH0A 3WL1A 4WK9A 2DG4A 2XP5A 2XPAA 4MSPA 4ODOA 3RM4A 4KR0B 5HW8A 2F2DA 1Y0OA 3W4RA 3KAGA 1HKKA 1NMWA 1J6YA 4R5EA 2XP7A 1JNSA 1ZL1A 3O5OA 4Q7NA 4IT4A 4ODNA 3PRBA 1JVWA 2PBCA 3AS2A 1ITXA 3JYMA 1ZB5A 2FAPA 3B8SA 4MPKA 1W9PA 3CHCA 2F21A 1J4RA 1PBKA 1JNDA 2LPVA 1J4IA 2XP6A 3CGMA 1EDQA 2O9OA 5HUAA 2DSZA 2MLZA 2D9FA 2IF4A 4TYOA 2PPOA 4JFLA 2MF9A 1QPFA 3LUOA 2DSVA 1FAPA 2ZQVA 1WAWA 3PA7A 3WD4A 4ML4A 1M5YA 1D7IA 1E6PA 1LL6A 1LL7A 1NWSA 4DRQA 4Z2JA 3TC5A 4GGQA 4HBEA 4MNMA 2LGOA 1PINA 1LL4A 3ARYA 4JFMA 3CH9A 4QT2A 4ITZA 3B9EA 3UQIA 2FKEA 1Q6IA 1O6IA 3UI5A 3JXVA 1NSGA 2RURA 4DRPA 1H0IA 2YBUA 1NWUA 3IHZA 2PV3A 3BMBA 1BKFA 3GTYX 3O5JA 1NMVA 4C02B 4S3JA 4DRKA 2UZ5A 5HWBA 1T11A 1WNOA 5J6EA 4LAXA 2RUQA 4ODRA 1EIBA 2ITKA 1EQ3A 3AS1A 4PTMA 1E9LA 2O92A 4W9QA 1Q1CA 2KI3A 1OWQA 1JNTA 2DT3A 3WQWA 1W1PA 5HBFA 4QT3A 3RM8A 5BXJA 4HBOA 3ARPA 3CZ8A 1HXVA 1RD6A 3BXWA 2KFWA 1FFQA 4Z2LA 2M2AA 5GPRA 2FDMA 4DWSB 2MNTA 2OLHA 1W26A 1L1PA 3O5KA 1D7HA 4DRHA 3I6CA 1CTNA 2OFNA 2XP4A 3B7XA 4JYSA 2AOSA 3CHEA 4DH0A 3GU0A 3RMEA 4TNSA 4ODMA 4U84A 2PI6A 4U86A 1QZ2A 2M08A 1FKGA 1FKFA 1KT0A 4L72B 2WLZA 1ROTA 2MLYA 2A3BA 2G8ZA 2XPBA 1GRJA 4ODLA 4NSBA 1IX5A 1HJXA 1D2KA 1OGBA 4WKAA 4DRMA 2RUCA 1UR9A 1XRVA 1JCHB 1WB0A 3AS0A 4W5UA 3H9RB 1F8AB 4GIVA 4IPXA 1FKSA 1X6LA 2XP3A 2L2SA 3IK8A 1KT1A 2DT1A 2DT2A 3OOBA 1HKIA 4G50A 4DROA 5D75A 3WD3A 4W9OA 4FN2A 4JFKA 3ARXA 2G41A 5HT1A 4Z2GA 1ZU8A 1D6OA 2A3CA 2XP9A 3OA5A 5HW6A 3ODKA 3O5IA 4O2TA 1E6ZA 2PN0A 4WJXA 2PPPA 1GOIA 4AY1A 2B31A 3ALFA 1BL4A 3WD1A 1HKMA 1GPFA 3O5QA 3NI6A 4G2PA 1FKBA 3O5DA 1SYTA 3ARQA 3FAPA 1EHNA 4P8VA 2MLXA 2DG3A 2PV1A 4MNLA 4DZ2A 5B8IC 4P8XA 5GPGA 4DRNA 3QOKA 2ESCA 3MDYB 4LAWA 1FKTA 4TW7A 3EIPA 3KCEA 4Z2HA 3WD2A 3AQUA 2LJ4A 1TFVA 2ZR5A 2P4VA 4URIA 1R9HA 4LAVA 3NTPA 1OGGA 2F23A 3O5FA 3IKDA 5HKGA 2XP8A 3ARUA 1D7JA 2YBTA 4DWSA 1B6CA 4J4NA 2WM0A 4NZCA 2A3EA 4ODQA 1U79A 5I98A 1XHGA 3KAHA 2ZR4A 3FY1A 1E15A 1KFWA 1X6NA 4W9PA 2ETNA 2KR7A 4NNRA 1LG2A 1HJWA 2WLYA 3KAIA 3O5LA 4IQCA 2K8IA 4S3KA 3G6MA 1W9VA 2VN1A 2N87A 1FJDA 4TX0A 1NWTA 1FFRA 4JFIA 1J4HA 4MTVA 4DRIA 5DEZA 1NH6A 3VAWA 1F40A 2ZQTA 4R0XA 3UI4A 3ARSA 4Z2KA 4IQ2A 4P8WA 4DIPA 1E44A 3CGNA 3O5RA 3RGCA 1FD9A 3WIJA 4XAKA 2DPEA 1W1YA 1FKIA 2KGJA 5GQBA 1E6NA 3GPKA 3G6LA 1YW5A 1C9HA 1NWRA 1ZBVA 2LKNA 3RFWA 5JH8A
chains in the Genus database with same CATH topology
1HJVA 1FKLA 3ALGA 2AWGA 4U85A 4L3NA 1FKDA 4JFJA 2KO7A 5DIUA 1N1AA 3UF8A 2M1IA 2Y78A 1A7XA 4IT6A 1LG1A 1W1VA 1ZBKA 1LQ0A 2ZR6A 5DO2A 4ZS6A 2KE0A 2ZQSA 5DITA 1HKJA 3O5GA 3KAFA 2A3AA 3B9DA 3NRKA 4ODPA 2PPNA 1JNEA 2QF8A 4J4OA 4TW8A 3UQAA 3EY6A 1ZBWA 3CHFA 2RUDA 4DRJA 4N19A 1YATA 3KZ7A 3FXYA 5HW7A 3KABA 1K9TA 3ARTA 3O5EA 3UQBA 1FKRA 3RM9A 2DSUA 4TW6A 2VCDA 3ARVA 2RQSA 2JZVA 4ZPTR 1FKHA 4DT4A 3PRDA 3PR9A 3CHDA 3KADA 1ZBCA 2DSWA 3AROA 4MNJA 3ARWA 3WL0A 1FKJA 3ARRA 4HARA 3TDBA 5DF0A 3TCZA 4QIBA 4WIWA 2Q5AA 4FAPA 4KQZA 1H0GA 3B9AA 4LAYA 4ZPVR 2MPHA 1Q6UA 3O5MA 1TCOC 2ZQUA 1W9UA 4DZ3A 3ARZA 1EYMA 4DWSD 5DIVA 4BF8A 4Q22A 1VF8A 2PV2A 3AS3A 4DWSC 4P8UA 4Z2IA 1Q6HA 1ROUA 1W1TA 2DG9A 2WK2A 3WKZA 1FKKA 5HTGA 5HWCA 3JYJA 4MGVA 1ZK6A 3WD0A 2F4EA 4LGXA 1SR0A 4MNKA 1QPLA 3KACA 4WKHA 3IKGA 4ODKA 1UR8A 3O5PA 4WKFA 3WQVA 1E6RA 4ZPWR 3PRAA 4QZVB 1LJYA 1ZCNA 2IUZA 2RSEA 4MAVA 3UI6A 2DT0A 1P5QA 1GUVA 3WH0A 3WL1A 4WK9A 2DG4A 2XP5A 2XPAA 4MSPA 4ODOA 3RM4A 4KR0B 5HW8A 2F2DA 1Y0OA 3W4RA 3KAGA 1HKKA 1NMWA 1J6YA 4R5EA 2XP7A 1JNSA 1ZL1A 3O5OA 4Q7NA 4IT4A 4ODNA 3PRBA 1JVWA 2PBCA 3AS2A 1ITXA 3JYMA 1ZB5A 2FAPA 3B8SA 4MPKA 1W9PA 3CHCA 2F21A 1J4RA 1PBKA 1JNDA 2LPVA 1J4IA 2XP6A 3CGMA 1EDQA 2O9OA 5HUAA 2DSZA 2MLZA 2D9FA 2IF4A 4TYOA 2PPOA 4JFLA 2MF9A 1QPFA 3LUOA 2DSVA 1FAPA 2ZQVA 1WAWA 3PA7A 3WD4A 4ML4A 1M5YA 1D7IA 1E6PA 1LL6A 1LL7A 1NWSA 4DRQA 4Z2JA 3TC5A 4GGQA 4HBEA 4MNMA 2LGOA 1PINA 1LL4A 3ARYA 4JFMA 3CH9A 4QT2A 4ITZA 3B9EA 3UQIA 2FKEA 1Q6IA 1O6IA 3UI5A 3JXVA 1NSGA 2RURA 4DRPA 1H0IA 2YBUA 1NWUA 3IHZA 2PV3A 1BKFA 3O5JA 1NMVA 4C02B 4S3JA 4DRKA 2UZ5A 5HWBA 1T11A 1WNOA 5J6EA 4LAXA 2RUQA 4ODRA 1EIBA 2ITKA 1EQ3A 3AS1A 4PTMA 1E9LA 2O92A 4W9QA 1Q1CA 2KI3A 1OWQA 1JNTA 2DT3A 3WQWA 1W1PA 5HBFA 4QT3A 3RM8A 5BXJA 4HBOA 3ARPA 3CZ8A 1HXVA 1RD6A 3BXWA 2KFWA 1FFQA 4Z2LA 2M2AA 5GPRA 2FDMA 4DWSB 2MNTA 2OLHA 1W26A 1L1PA 3O5KA 1D7HA 4DRHA 3I6CA 1CTNA 2OFNA 2XP4A 3B7XA 4JYSA 2AOSA 3CHEA 4DH0A 3RMEA 4TNSA 4ODMA 4U84A 2PI6A 4U86A 1QZ2A 2M08A 1FKGA 1FKFA 1KT0A 4L72B 2WLZA 1ROTA 2MLYA 2A3BA 2G8ZA 2XPBA 4ODLA 4NSBA 1IX5A 1HJXA 1D2KA 1OGBA 4WKAA 4DRMA 2RUCA 1UR9A 1XRVA 1WB0A 3AS0A 4W5UA 3H9RB 1F8AB 4GIVA 4IPXA 1FKSA 1X6LA 2XP3A 2L2SA 3IK8A 1KT1A 2DT1A 2DT2A 3OOBA 1HKIA 4G50A 4DROA 5D75A 3WD3A 4W9OA 4FN2A 4JFKA 3ARXA 2G41A 5HT1A 4Z2GA 1ZU8A 1D6OA 2A3CA 2XP9A 3OA5A 5HW6A 3ODKA 3O5IA 4O2TA 1E6ZA 4WJXA 2PPPA 1GOIA 4AY1A 2B31A 3ALFA 1BL4A 3WD1A 1HKMA 1GPFA 3O5QA 3NI6A 4G2PA 1FKBA 3O5DA 1SYTA 3ARQA 3FAPA 1EHNA 4P8VA 2MLXA 2DG3A 2PV1A 4MNLA 4DZ2A 5B8IC 4P8XA 5GPGA 4DRNA 3QOKA 2ESCA 3MDYB 4LAWA 1FKTA 4TW7A 3KCEA 4Z2HA 3WD2A 3AQUA 2LJ4A 1TFVA 2ZR5A 4URIA 1R9HA 4LAVA 3NTPA 1OGGA 3O5FA 3IKDA 5HKGA 2XP8A 3ARUA 1D7JA 2YBTA 4DWSA 1B6CA 4J4NA 2WM0A 4NZCA 2A3EA 4ODQA 1U79A 5I98A 1XHGA 3KAHA 2ZR4A 3FY1A 1E15A 1KFWA 1X6NA 4W9PA 2KR7A 4NNRA 1LG2A 1HJWA 2WLYA 3KAIA 3O5LA 4IQCA 2K8IA 4S3KA 3G6MA 1W9VA 2VN1A 2N87A 1FJDA 4TX0A 1NWTA 1FFRA 4JFIA 1J4HA 4MTVA 4DRIA 5DEZA 1NH6A 3VAWA 1F40A 2ZQTA 4R0XA 3UI4A 3ARSA 4Z2KA 4IQ2A 4P8WA 4DIPA 3CGNA 3O5RA 3RGCA 1FD9A 3WIJA 4XAKA 2DPEA 1W1YA 1FKIA 2KGJA 5GQBA 1E6NA 3GPKA 3G6LA 1YW5A 1C9HA 1NWRA 1ZBVA 2LKNA 3RFWA 5JH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGO A;  2PPP A;  5HTG A;  1PIN A;  1FKL A;  3JYJ A;  4JFM A;  5HWC A;  4QT2 A;  2AWG A;  4U85 A;  4ITZ A;  3UQI A;  4MGV A;  1ZK6 A;  2FKE A;  1FKD A;  1Q6I A;  4JFJ A;  2F4E A;  2KO7 A;  5DIU A;  1BL4 A;  3JXV A;  3UI5 A;  1NSG A;  1N1A A;  2RUR A;  3O5Q A;  3NI6 A;  4G2P A;  1QPL A;  3KAC A;  1FKB A;  3UF8 A;  4DRP A;  3O5D A;  2M1I A;  2Y78 A;  1A7X A;  3IKG A;  4ODK A;  3O5P A;  3FAP A;  2ZR6 A;  3IHZ A;  2PV3 A;  2KE0 A;  1BKF A;  2ZQS A;  5DIT A;  3O5G A;  3O5J A;  3KAF A;  1NMV A;  2MLX A;  4C02 B;  4DRK A;  2UZ5 A;  2DG3 A;  1T11 A;  2PV1 A;  3NRK A;  5HWB A;  5J6E A;  4LAX A;  2RUQ A;  4ODR A;  2ITK A;  4ODP A;  2PPN A;  1EQ3 A;  4DZ2 A;  5B8I C;  4W9Q A;  1ZCN A;  1Q1C A;  2KI3 A;  1JNT A;  5GPG A;  2RSE A;  4J4O A;  4QT3 A;  4DRN A;  4TW8 A;  3UQA A;  3EY6 A;  3UI6 A;  5BXJ A;  3MDY B;  4LAW A;  1P5Q A;  1HXV A;  1FKT A;  2RUD A;  4TW7 A;  3KCE A;  4N19 A;  2KFW A;  1YAT A;  3WH0 A;  4DRJ A;  2DG4 A;  2XP5 A;  2XPA A;  4MSP A;  3KZ7 A;  2M2A A;  4ODO A;  2MNT A;  5HW8 A;  2LJ4 A;  1W26 A;  2F2D A;  1L1P A;  1Y0O A;  5HW7 A;  3KAG A;  3KAB A;  2ZR5 A;  3O5K A;  1D7H A;  1NMW A;  1R9H A;  3O5E A;  3I6C A;  4DRH A;  3UQB A;  4LAV A;  1FKR A;  3NTP A;  2OFN A;  4TW6 A;  2VCD A;  2XP4 A;  3O5F A;  2XP7 A;  3B7X A;  3IKD A;  1J6Y A;  1JNS A;  3O5O A;  4JYS A;  4DH0 A;  5HKG A;  2RQS A;  2XP8 A;  2JZV A;  1FKH A;  1D7J A;  4TNS A;  4DT4 A;  4ODN A;  3PRD A;  1F40 A;  4ODM A;  3PRB A;  1B6C A;  4U84 A;  4J4N A;  4U86 A;  3KAD A;  4ODQ A;  1QZ2 A;  1U79 A;  1JVW A;  2M08 A;  2PBC A;  5I98 A;  1FKG A;  1FKF A;  1KT0 A;  1FKJ A;  2FAP A;  2ZR4 A;  3JYM A;  3KAH A;  1ROT A;  2MLY A;  3TDB A;  3TCZ A;  4QIB A;  2XPB A;  4W9P A;  2KR7 A;  4NNR A;  2Q5A A;  4ODL A;  4FAP A;  2F21 A;  1J4R A;  1PBK A;  3KAI A;  3O5L A;  4IQC A;  4DRM A;  2K8I A;  2RUC A;  4LAY A;  2LPV A;  1J4I A;  2VN1 A;  2XP6 A;  3CGM A;  2N87 A;  5HUA A;  1FJD A;  2MPH A;  4TX0 A;  3H9R B;  1Q6U A;  3O5M A;  1TCO C;  2MLZ A;  1J4H A;  2ZQU A;  4JFI A;  4O2T A;  1F8A B;  2D9F A;  2IF4 A;  4GIV A;  1FKS A;  4IPX A;  4DZ3 A;  2XP3 A;  4TYO A;  2L2S A;  4DRI A;  2PPO A;  1EYM A;  3IK8 A;  2MF9 A;  1KT1 A;  1QPF A;  3LUO A;  2ZQT A;  4JFL A;  4R0X A;  5DIV A;  3UI4 A;  3VAW A;  3OOB A;  1FAP A;  4BF8 A;  4IQ2 A;  2ZQV A;  3PA7 A;  4DIP A;  2PV2 A;  4G50 A;  4DRO A;  3CGN A;  3O5R A;  5D75 A;  3RGC A;  1M5Y A;  1Q6H A;  4W9O A;  1FD9 A;  4FN2 A;  4JFK A;  1D7I A;  1FKI A;  2KGJ A;  5HT1 A;  1D6O A;  3GPK A;  2XP9 A;  1ROU A;  2DG9 A;  5HW6 A;  1YW5 A;  1C9H A;  2LKN A;  3RFW A;  3ODK A;  3O5I A;  4DRQ A;  3TC5 A;  4GGQ A;  1FKK A; 
#chains in the Genus database with same CATH topology
 1HJV A;  1FKL A;  4UDM A;  3ALG A;  2AWG A;  4U85 A;  4L3N A;  1FKD A;  4JFJ A;  2KO7 A;  5DIU A;  1N1A A;  3UF8 A;  2M1I A;  2Y78 A;  1A7X A;  4IT6 A;  1LG1 A;  1W1V A;  1ZBK A;  1LQ0 A;  2ZR6 A;  5DO2 A;  4ZS6 A;  2KE0 A;  2ZQS A;  5DIT A;  1HKJ A;  3O5G A;  3KAF A;  2B5U B;  2A3A A;  3B9D A;  3NRK A;  4ODP A;  2PPN A;  1JNE A;  2QF8 A;  4J4O A;  4TW8 A;  3UQA A;  3EY6 A;  1ZBW A;  3CHF A;  2RUD A;  4DRJ A;  4N19 A;  1YAT A;  3KZ7 A;  3FXY A;  5HW7 A;  3KAB A;  1K9T A;  3ART A;  3O5E A;  3UQB A;  1FKR A;  3RM9 A;  2DSU A;  4TW6 A;  2VCD A;  3ARV A;  2RQS A;  2JZV A;  4ZPT R;  1FKH A;  4DT4 A;  3PRD A;  3PR9 A;  3CHD A;  3KAD A;  1ZBC A;  2DSW A;  3ARO A;  4MNJ A;  3ARW A;  3WL0 A;  1FKJ A;  3ARR A;  4HAR A;  3TDB A;  5DF0 A;  3TCZ A;  4QIB A;  4WIW A;  2Q5A A;  4FAP A;  4KQZ A;  1H0G A;  3B9A A;  4LAY A;  4ZPV R;  2MPH A;  1Q6U A;  3O5M A;  1TCO C;  2ZQU A;  1W9U A;  4DZ3 A;  3ARZ A;  1EYM A;  4DWS D;  5DIV A;  4BF8 A;  4Q22 A;  1VF8 A;  2PV2 A;  3AS3 A;  4DWS C;  4P8U A;  4Z2I A;  1Q6H A;  1ROU A;  1W1T A;  2DG9 A;  2WK2 A;  3WKZ A;  1FKK A;  5HTG A;  5HWC A;  3JYJ A;  4MGV A;  1ZK6 A;  3WD0 A;  2F4E A;  4LGX A;  1SR0 A;  4MNK A;  1QPL A;  3KAC A;  4WKH A;  3IKG A;  4ODK A;  1UR8 A;  3O5P A;  4WKF A;  3WQV A;  1E6R A;  4ZPW R;  2EUL A;  3PRA A;  4QZV B;  1LJY A;  1ZCN A;  2IUZ A;  2RSE A;  4MAV A;  3UI6 A;  2DT0 A;  1P5Q A;  1GUV A;  3WH0 A;  3WL1 A;  4WK9 A;  2DG4 A;  2XP5 A;  2XPA A;  4MSP A;  4ODO A;  3RM4 A;  4KR0 B;  5HW8 A;  2F2D A;  1Y0O A;  3W4R A;  3KAG A;  1HKK A;  1NMW A;  1J6Y A;  4R5E A;  2XP7 A;  1JNS A;  1ZL1 A;  3O5O A;  4Q7N A;  4IT4 A;  4ODN A;  3PRB A;  1JVW A;  2PBC A;  3AS2 A;  1ITX A;  3JYM A;  1ZB5 A;  2FAP A;  3B8S A;  4MPK A;  1W9P A;  3CHC A;  2F21 A;  1J4R A;  1PBK A;  1JND A;  2LPV A;  1J4I A;  2XP6 A;  3CGM A;  1EDQ A;  2O9O A;  5HUA A;  2DSZ A;  2MLZ A;  2D9F A;  2IF4 A;  4TYO A;  2PPO A;  4JFL A;  2MF9 A;  1QPF A;  3LUO A;  2DSV A;  1FAP A;  2ZQV A;  1WAW A;  3PA7 A;  3WD4 A;  4ML4 A;  1M5Y A;  1D7I A;  1E6P A;  1LL6 A;  1LL7 A;  1NWS A;  4DRQ A;  4Z2J A;  3TC5 A;  4GGQ A;  4HBE A;  4MNM A;  2LGO A;  1PIN A;  1LL4 A;  3ARY A;  4JFM A;  3CH9 A;  4QT2 A;  4ITZ A;  3B9E A;  3UQI A;  2FKE A;  1Q6I A;  1O6I A;  3UI5 A;  3JXV A;  1NSG A;  2RUR A;  4DRP A;  1H0I A;  2YBU A;  1NWU A;  3IHZ A;  2PV3 A;  3BMB A;  1BKF A;  3GTY X;  3O5J A;  1NMV A;  4C02 B;  4S3J A;  4DRK A;  2UZ5 A;  5HWB A;  1T11 A;  1WNO A;  5J6E A;  4LAX A;  2RUQ A;  4ODR A;  1EIB A;  2ITK A;  1EQ3 A;  3AS1 A;  4PTM A;  1E9L A;  2O92 A;  4W9Q A;  1Q1C A;  2KI3 A;  1OWQ A;  1JNT A;  2DT3 A;  3WQW A;  1W1P A;  5HBF A;  4QT3 A;  3RM8 A;  5BXJ A;  4HBO A;  3ARP A;  3CZ8 A;  1HXV A;  1RD6 A;  3BXW A;  2KFW A;  1FFQ A;  4Z2L A;  2M2A A;  5GPR A;  2FDM A;  4DWS B;  2MNT A;  2OLH A;  1W26 A;  1L1P A;  3O5K A;  1D7H A;  4DRH A;  3I6C A;  1CTN A;  2OFN A;  2XP4 A;  3B7X A;  4JYS A;  2AOS A;  3CHE A;  4DH0 A;  3GU0 A;  3RME A;  4TNS A;  4ODM A;  4U84 A;  2PI6 A;  4U86 A;  1QZ2 A;  2M08 A;  1FKG A;  1FKF A;  1KT0 A;  4L72 B;  2WLZ A;  1ROT A;  2MLY A;  2A3B A;  2G8Z A;  2XPB A;  1GRJ A;  4ODL A;  4NSB A;  1IX5 A;  1HJX A;  1D2K A;  1OGB A;  4WKA A;  4DRM A;  2RUC A;  1UR9 A;  1XRV A;  1JCH B;  1WB0 A;  3AS0 A;  4W5U A;  3H9R B;  1F8A B;  4GIV A;  4IPX A;  1FKS A;  1X6L A;  2XP3 A;  2L2S A;  3IK8 A;  1KT1 A;  2DT1 A;  2DT2 A;  3OOB A;  1HKI A;  4G50 A;  4DRO A;  5D75 A;  3WD3 A;  4W9O A;  4FN2 A;  4JFK A;  3ARX A;  2G41 A;  5HT1 A;  4Z2G A;  1ZU8 A;  1D6O A;  2A3C A;  2XP9 A;  3OA5 A;  5HW6 A;  3ODK A;  3O5I A;  4O2T A;  1E6Z A;  2PN0 A;  4WJX A;  2PPP A;  1GOI A;  4AY1 A;  2B31 A;  3ALF A;  1BL4 A;  3WD1 A;  1HKM A;  1GPF A;  3O5Q A;  3NI6 A;  4G2P A;  1FKB A;  3O5D A;  1SYT A;  3ARQ A;  3FAP A;  1EHN A;  4P8V A;  2MLX A;  2DG3 A;  2PV1 A;  4MNL A;  4DZ2 A;  5B8I C;  4P8X A;  5GPG A;  4DRN A;  3QOK A;  2ESC A;  3MDY B;  4LAW A;  1FKT A;  4TW7 A;  3EIP A;  3KCE A;  4Z2H A;  3WD2 A;  3AQU A;  2LJ4 A;  1TFV A;  2ZR5 A;  2P4V A;  4URI A;  1R9H A;  4LAV A;  3NTP A;  1OGG A;  2F23 A;  3O5F A;  3IKD A;  5HKG A;  2XP8 A;  3ARU A;  1D7J A;  2YBT A;  4DWS A;  1B6C A;  4J4N A;  2WM0 A;  4NZC A;  2A3E A;  4ODQ A;  1U79 A;  5I98 A;  1XHG A;  3KAH A;  2ZR4 A;  3FY1 A;  1E15 A;  1KFW A;  1X6N A;  4W9P A;  2ETN A;  2KR7 A;  4NNR A;  1LG2 A;  1HJW A;  2WLY A;  3KAI A;  3O5L A;  4IQC A;  2K8I A;  4S3K A;  3G6M A;  1W9V A;  2VN1 A;  2N87 A;  1FJD A;  4TX0 A;  1NWT A;  1FFR A;  4JFI A;  1J4H A;  4MTV A;  4DRI A;  5DEZ A;  1NH6 A;  3VAW A;  1F40 A;  2ZQT A;  4R0X A;  3UI4 A;  3ARS A;  4Z2K A;  4IQ2 A;  4P8W A;  4DIP A;  1E44 A;  3CGN A;  3O5R A;  3RGC A;  1FD9 A;  3WIJ A;  4XAK A;  2DPE A;  1W1Y A;  1FKI A;  2KGJ A;  5GQB A;  1E6N A;  3GPK A;  3G6L A;  1YW5 A;  1C9H A;  1NWR A;  1ZBV A;  2LKN A;  3RFW A;  5JH8 A; 
#chains in the Genus database with same CATH homology
 1HJV A;  1FKL A;  3ALG A;  2AWG A;  4U85 A;  4L3N A;  1FKD A;  4JFJ A;  2KO7 A;  5DIU A;  1N1A A;  3UF8 A;  2M1I A;  2Y78 A;  1A7X A;  4IT6 A;  1LG1 A;  1W1V A;  1ZBK A;  1LQ0 A;  2ZR6 A;  5DO2 A;  4ZS6 A;  2KE0 A;  2ZQS A;  5DIT A;  1HKJ A;  3O5G A;  3KAF A;  2A3A A;  3B9D A;  3NRK A;  4ODP A;  2PPN A;  1JNE A;  2QF8 A;  4J4O A;  4TW8 A;  3UQA A;  3EY6 A;  1ZBW A;  3CHF A;  2RUD A;  4DRJ A;  4N19 A;  1YAT A;  3KZ7 A;  3FXY A;  5HW7 A;  3KAB A;  1K9T A;  3ART A;  3O5E A;  3UQB A;  1FKR A;  3RM9 A;  2DSU A;  4TW6 A;  2VCD A;  3ARV A;  2RQS A;  2JZV A;  4ZPT R;  1FKH A;  4DT4 A;  3PRD A;  3PR9 A;  3CHD A;  3KAD A;  1ZBC A;  2DSW A;  3ARO A;  4MNJ A;  3ARW A;  3WL0 A;  1FKJ A;  3ARR A;  4HAR A;  3TDB A;  5DF0 A;  3TCZ A;  4QIB A;  4WIW A;  2Q5A A;  4FAP A;  4KQZ A;  1H0G A;  3B9A A;  4LAY A;  4ZPV R;  2MPH A;  1Q6U A;  3O5M A;  1TCO C;  2ZQU A;  1W9U A;  4DZ3 A;  3ARZ A;  1EYM A;  4DWS D;  5DIV A;  4BF8 A;  4Q22 A;  1VF8 A;  2PV2 A;  3AS3 A;  4DWS C;  4P8U A;  4Z2I A;  1Q6H A;  1ROU A;  1W1T A;  2DG9 A;  2WK2 A;  3WKZ A;  1FKK A;  5HTG A;  5HWC A;  3JYJ A;  4MGV A;  1ZK6 A;  3WD0 A;  2F4E A;  4LGX A;  1SR0 A;  4MNK A;  1QPL A;  3KAC A;  4WKH A;  3IKG A;  4ODK A;  1UR8 A;  3O5P A;  4WKF A;  3WQV A;  1E6R A;  4ZPW R;  3PRA A;  4QZV B;  1LJY A;  1ZCN A;  2IUZ A;  2RSE A;  4MAV A;  3UI6 A;  2DT0 A;  1P5Q A;  1GUV A;  3WH0 A;  3WL1 A;  4WK9 A;  2DG4 A;  2XP5 A;  2XPA A;  4MSP A;  4ODO A;  3RM4 A;  4KR0 B;  5HW8 A;  2F2D A;  1Y0O A;  3W4R A;  3KAG A;  1HKK A;  1NMW A;  1J6Y A;  4R5E A;  2XP7 A;  1JNS A;  1ZL1 A;  3O5O A;  4Q7N A;  4IT4 A;  4ODN A;  3PRB A;  1JVW A;  2PBC A;  3AS2 A;  1ITX A;  3JYM A;  1ZB5 A;  2FAP A;  3B8S A;  4MPK A;  1W9P A;  3CHC A;  2F21 A;  1J4R A;  1PBK A;  1JND A;  2LPV A;  1J4I A;  2XP6 A;  3CGM A;  1EDQ A;  2O9O A;  5HUA A;  2DSZ A;  2MLZ A;  2D9F A;  2IF4 A;  4TYO A;  2PPO A;  4JFL A;  2MF9 A;  1QPF A;  3LUO A;  2DSV A;  1FAP A;  2ZQV A;  1WAW A;  3PA7 A;  3WD4 A;  4ML4 A;  1M5Y A;  1D7I A;  1E6P A;  1LL6 A;  1LL7 A;  1NWS A;  4DRQ A;  4Z2J A;  3TC5 A;  4GGQ A;  4HBE A;  4MNM A;  2LGO A;  1PIN A;  1LL4 A;  3ARY A;  4JFM A;  3CH9 A;  4QT2 A;  4ITZ A;  3B9E A;  3UQI A;  2FKE A;  1Q6I A;  1O6I A;  3UI5 A;  3JXV A;  1NSG A;  2RUR A;  4DRP A;  1H0I A;  2YBU A;  1NWU A;  3IHZ A;  2PV3 A;  1BKF A;  3O5J A;  1NMV A;  4C02 B;  4S3J A;  4DRK A;  2UZ5 A;  5HWB A;  1T11 A;  1WNO A;  5J6E A;  4LAX A;  2RUQ A;  4ODR A;  1EIB A;  2ITK A;  1EQ3 A;  3AS1 A;  4PTM A;  1E9L A;  2O92 A;  4W9Q A;  1Q1C A;  2KI3 A;  1OWQ A;  1JNT A;  2DT3 A;  3WQW A;  1W1P A;  5HBF A;  4QT3 A;  3RM8 A;  5BXJ A;  4HBO A;  3ARP A;  3CZ8 A;  1HXV A;  1RD6 A;  3BXW A;  2KFW A;  1FFQ A;  4Z2L A;  2M2A A;  5GPR A;  2FDM A;  4DWS B;  2MNT A;  2OLH A;  1W26 A;  1L1P A;  3O5K A;  1D7H A;  4DRH A;  3I6C A;  1CTN A;  2OFN A;  2XP4 A;  3B7X A;  4JYS A;  2AOS A;  3CHE A;  4DH0 A;  3RME A;  4TNS A;  4ODM A;  4U84 A;  2PI6 A;  4U86 A;  1QZ2 A;  2M08 A;  1FKG A;  1FKF A;  1KT0 A;  4L72 B;  2WLZ A;  1ROT A;  2MLY A;  2A3B A;  2G8Z A;  2XPB A;  4ODL A;  4NSB A;  1IX5 A;  1HJX A;  1D2K A;  1OGB A;  4WKA A;  4DRM A;  2RUC A;  1UR9 A;  1XRV A;  1WB0 A;  3AS0 A;  4W5U A;  3H9R B;  1F8A B;  4GIV A;  4IPX A;  1FKS A;  1X6L A;  2XP3 A;  2L2S A;  3IK8 A;  1KT1 A;  2DT1 A;  2DT2 A;  3OOB A;  1HKI A;  4G50 A;  4DRO A;  5D75 A;  3WD3 A;  4W9O A;  4FN2 A;  4JFK A;  3ARX A;  2G41 A;  5HT1 A;  4Z2G A;  1ZU8 A;  1D6O A;  2A3C A;  2XP9 A;  3OA5 A;  5HW6 A;  3ODK A;  3O5I A;  4O2T A;  1E6Z A;  4WJX A;  2PPP A;  1GOI A;  4AY1 A;  2B31 A;  3ALF A;  1BL4 A;  3WD1 A;  1HKM A;  1GPF A;  3O5Q A;  3NI6 A;  4G2P A;  1FKB A;  3O5D A;  1SYT A;  3ARQ A;  3FAP A;  1EHN A;  4P8V A;  2MLX A;  2DG3 A;  2PV1 A;  4MNL A;  4DZ2 A;  5B8I C;  4P8X A;  5GPG A;  4DRN A;  3QOK A;  2ESC A;  3MDY B;  4LAW A;  1FKT A;  4TW7 A;  3KCE A;  4Z2H A;  3WD2 A;  3AQU A;  2LJ4 A;  1TFV A;  2ZR5 A;  4URI A;  1R9H A;  4LAV A;  3NTP A;  1OGG A;  3O5F A;  3IKD A;  5HKG A;  2XP8 A;  3ARU A;  1D7J A;  2YBT A;  4DWS A;  1B6C A;  4J4N A;  2WM0 A;  4NZC A;  2A3E A;  4ODQ A;  1U79 A;  5I98 A;  1XHG A;  3KAH A;  2ZR4 A;  3FY1 A;  1E15 A;  1KFW A;  1X6N A;  4W9P A;  2KR7 A;  4NNR A;  1LG2 A;  1HJW A;  2WLY A;  3KAI A;  3O5L A;  4IQC A;  2K8I A;  4S3K A;  3G6M A;  1W9V A;  2VN1 A;  2N87 A;  1FJD A;  4TX0 A;  1NWT A;  1FFR A;  4JFI A;  1J4H A;  4MTV A;  4DRI A;  5DEZ A;  1NH6 A;  3VAW A;  1F40 A;  2ZQT A;  4R0X A;  3UI4 A;  3ARS A;  4Z2K A;  4IQ2 A;  4P8W A;  4DIP A;  3CGN A;  3O5R A;  3RGC A;  1FD9 A;  3WIJ A;  4XAK A;  2DPE A;  1W1Y A;  1FKI A;  2KGJ A;  5GQB A;  1E6N A;  3GPK A;  3G6L A;  1YW5 A;  1C9H A;  1NWR A;  1ZBV A;  2LKN A;  3RFW A;  5JH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...