2VCDA

Solution structure of the fkbp-domain of legionella pneumophila mip in complex with rapamycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
FNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Outer membrane protein MIP
publication title Solution structure of the Legionella pneumophila Mip-rapamycin complex.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila (strain philadelphia 1 / atcc 33152 /
total genus 27
structure length 137
sequence length 137
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2vcdA02
1FKHA 1FKSA 1NMVA 2D9FA 2KGJA 3VAWA 1F40A 2M2AA 2Q5AA 1T11A 3UQIA 3UI5A 2MLXA 3MDYB 1FKBA 1R9HA 4DIPA 2PPNA 1QPLA 1EYMA 4J4NA 4JFMA 5I98A 4MGVA 2ZR5A 2N87A 3I6CA 3OOBA 2PV2A 1NSGA 4MSPA 1PINA 2ZQUA 2F2DA 4JYSA 2ZQVA 3JYJA 4GGQA 1J4HA 2DG3A 4JFKA 3ODKA 3CGNA 4N19A 4ITZA 3RGCA 4G50A 4LAWA 2FAPA 3NRKA 4IQCA 4DRIA 4U84A 2DG4A 3IKGA 4W9OA 1BKFA 4DZ2A 1FAPA 5DIVA 3KADA 1FKFA 4W9QA 1J6YA 2M08A 5J6EA 2ITKA 1Q1CA 1ZK6A 3CGMA 4DROA 3EY6A 4JFIA 4LAXA 2UZ5A 4QIBA 4ODKA 1ROUA 2ZQSA 2K8IA 2PBCA 2KO7A 2RURA 4J4OA 4TW8A 3WH0A 4BF8A 3KAIA 2XP7A 3O5KA 2RQSA 4C02B 1JNTA 1D7HA 2XP3A 2MPHA 3JXVA 2LPVA 3KCEA 4ODLA 2PPPA 4ODOA 1KT0A 3TC5A 4DRJA 4ODPA 2F21A 5D75A 4GIVA 4DRQA 2MLZA 4R0XA 1ZCNA 4G2PA 5HWCA 3IHZA 1ROTA 4O2TA 5DITA 2MF9A 2XP9A 5BXJA 4TW7A 2DG9A 3UI6A 2F4EA 2XP6A 4JFJA 3TDBA 2LKNA 3KAGA 4IPXA 1B6CA 5DIUA 1C9HA 3UF8A 1N1AA 2VN1A 2Y78A 3O5GA 2PPOA 2XPAA 3PRBA 2RUDA 4U86A 3O5OA 3LUOA 3UQBA 3O5MA 2XP5A 3NI6A 4LAVA 5HTGA 1FKRA 2JZVA 1YATA 3PA7A 4QT2A 3IK8A 3O5IA 1J4RA 2PV1A 5HUAA 2XP8A 3B7XA 5HW6A 1KT1A 2ZR6A 3KAHA 1F8AB 1FKKA 1L1PA 1FD9A 2IF4A 1TCOC 3O5JA 2PV3A 3O5FA 2XPBA 3O5DA 4ODQA 4LAYA 5HW7A 2OFNA 2ZQTA 4DRPA 1EQ3A 1M5YA 1Q6HA 2RUCA 4DT4A 3O5EA 3H9RB 1JVWA 4IQ2A 3RFWA 3UI4A 1FKGA 3UQAA 1FKJA 4FAPA 1U79A 2RUQA 2ZR4A 3O5QA 1HXVA 4TNSA 2MLYA 3KACA 3PRDA 1Q6IA 1P5QA 1FJDA 4TX0A 2VCDA 1BL4A 3NTPA 2MNTA 1J4IA 4QT3A 1Q6UA 5HKGA 4U85A 4DRKA 4DRHA 5B8IC 2XP4A 1JNSA 2KFWA 3TCZA 4DRMA 4TYOA 2KR7A 4ODNA 4TW6A 3KAFA 4DZ3A 2AWGA 4W9PA 1NMWA 5HT1A 4DRNA 1QPFA 1A7XA 2FKEA 2KE0A 2KI3A 3FAPA 3O5PA 3JYMA 1Y0OA 3O5RA 4FN2A 4ODRA 4ODMA 1D7JA 1FKLA 1FKIA 1FKTA 1YW5A 2M1IA 3KABA 4NNRA 1D6OA 1W26A 3GPKA 1D7IA 5HW8A 5GPGA 2LJ4A 2RSEA 1FKDA 2LGOA 1QZ2A 2L2SA 3IKDA 3O5LA 4JFLA 4DH0A 1PBKA 5HWBA 3KZ7A
chains in the Genus database with same CATH superfamily
2KGJA 1F40A 2M2AA 1HJXA 2DT2A 1R9HA 5I98A 3AS2A 1ZBKA 2N87A 4Q22A 2DT1A 2F2DA 4JYSA 2DG3A 3ARPA 3RGCA 4N19A 4ITZA 1OGGA 2OLHA 2FAPA 3NRKA 1NH6A 4ZPWR 1BKFA 4HBEA 3KADA 1FKFA 1H0IA 1X6NA 4HBOA 4W9QA 1E6NA 1Q1CA 1ZBWA 1ZK6A 1HKIA 4MTVA 4Z2JA 3ARZA 1ROUA 2ZQSA 2K8IA 2PBCA 1O6IA 2A3EA 3OA5A 2XP3A 4ODLA 2PPPA 3WD3A 1KT0A 4DRJA 2F21A 5D75A 2MLZA 4R0XA 3RMEA 1XRVA 5HWCA 1E44A 5DITA 4MNMA 1VF8A 2XP9A 5BXJA 1WAWA 3UF8A 3KAGA 2QF8A 1B6CA 3RM9A 1EIBA 2PPOA 2RUDA 3ARVA 3O5MA 3B9DA 5HTGA 4WJXA 2PV1A 5HUAA 3CZ8A 1KT1A 2ZR6A 3G6MA 3KAHA 4Z2KA 3WD1A 1L1PA 1LL7A 2IF4A 3O5JA 2PV3A 3O5FA 1OWQA 3BXWA 2ZQTA 1EQ3A 3CHEA 3ARQA 3H9RB 3AQUA 2ETNA 4MPKA 1U79A 1ZBVA 3AROA 2MLYA 1GRJA 4WKFA 1BL4A 4Z2IA 1ITXA 1FFQA 1LJYA 2KFWA 4DRMA 1EDQA 1ZBCA 3ARXA 3FAPA 3O5PA 3O5RA 4L72B 2O92A 1FKLA 4MNLA 1GUVA 1W26A 3ARSA 1NWTA 5HW8A 2LGOA 2L2SA 3WL0A 1PBKA 2DT3A 1ZL1A 1NMVA 2D9FA 3VAWA 1T11A 3UI5A 2MLXA 2F23A 2DPEA 3MDYB 1FKBA 1QPLA 1IX5A 1EYMA 1W9VA 4JFMA 4MGVA 2ZR5A 2PV2A 1NSGA 1PINA 2ZQUA 4GGQA 1J4HA 1W1TA 3CGNA 3ODKA 2B31A 4IQCA 4U84A 4KQZA 5DIVA 2M08A 3CGMA 4LAXA 1E9LA 3WD4A 3CHFA 2O9OA 3ALFA 4TW8A 2RURA 2KO7A 3ALGA 2A3CA 4C02B 1JCHB 1LG2A 4QZVB 2A3BA 1ZCNA 2WLYA 4G2PA 3PR9A 2WLZA 4S3KA 2EULA 1LL4A 4P8WA 3UI6A 2XP6A 3TDBA 1C9HA 1ZB5A 1N1AA 3O5GA 5DO2A 1HKMA 2XPAA 2IUZA 2XP5A 3NI6A 1FKRA 2JZVA 1YATA 3PA7A 4QT2A 3AS1A 3O5IA 5HW6A 4IT6A 4P8VA 5GPRA 1TCOC 2DT0A 1E15A 2XPBA 3B8SA 1M5YA 2RUCA 2G41A 4DT4A 3O5EA 4IT4A 1E6PA 4P8XA 1FKGA 1HXVA 1Q6IA 5DF0A 3NTPA 2MNTA 4QT3A 5B8IC 2XP4A 1JNSA 4Q7NA 3G6LA 3ARUA 2PN0A 1NMWA 3CHDA 1A7XA 4ODRA 2KI3A 4S3JA 4FN2A 1FKTA 1D6OA 1D7IA 5GPGA 3O5LA 1FKDA 1QZ2A 4DH0A 3IKDA 5HWBA 3KZ7A 4ML4A 1FKSA 4Z2LA 3UQIA 2PI6A 5DEZA 5JH8A 4DWSC 4DIPA 2PPNA 3I6CA 3JYJA 1W9UA 1GOIA 1WB0A 1W1VA 4DRIA 1JNEA 3FY1A 4DZ2A 1FAPA 2P4VA 4ZPVR 1SYTA 1X6LA 4R5EA 1UR8A 4JFIA 3CH9A 1SR0A 1NWRA 4ODKA 4J4OA 4QIBA 3FXYA 3WH0A 2FDMA 3KAIA 1JNTA 1HJWA 2MPHA 4HARA 4Z2GA 4ODPA 4GIVA 3CHCA 3IHZA 4O2TA 3WL1A 1LG1A 4AY1A 3BMBA 2DG9A 2F4EA 1XHGA 2YBTA 4JFJA 2LKNA 4IPXA 3AS0A 2Y78A 2A3AA 3PRBA 5GQBA 3LUOA 4ZS6A 4LAVA 4L3NA 1J4RA 2ESCA 2YBUA 2DSUA 3AS3A 1RD6A 1K9TA 1F8AB 1UR9A 2WK2A 4URIA 1GPFA 3O5DA 4LAYA 3WD2A 1NWSA 2OFNA 1CTNA 1Q6HA 1JVWA 3RFWA 4ZPTR 1FKJA 4FAPA 2ZR4A 3WD0A 4MNJA 4Z2HA 1E6ZA 1FJDA 1W9PA 3WQWA 1WNOA 1H0GA 4U85A 4P8UA 4DRHA 3TCZA 4TYOA 4ODNA 4TW6A 4DZ3A 2AWGA 4W9PA 5HT1A 4DRNA 1QPFA 2KE0A 1Y0OA 1JNDA 1YW5A 1FKIA 3KABA 4NNRA 4DWSA 3W4RA 3WIJA 2RSEA 4JFLA 5J6EA 4WK9A 4NSBA 4WKAA 1FKHA 2Q5AA 3B9AA 1HKJA 4KR0B 4UDMA 3B9EA 1KFWA 2G8ZA 4J4NA 3GU0A 3OOBA 3ARWA 4MSPA 2ZQVA 4JFKA 4G50A 4LAWA 2DG4A 3IKGA 4W9OA 3PRAA 4MNKA 1J6YA 3WQVA 2ITKA 4DROA 3EY6A 1OGBA 2UZ5A 4WKHA 4BF8A 1TFVA 2XP7A 2WM0A 3O5KA 2RQSA 1D7HA 3JXVA 3KCEA 2LPVA 4ODOA 3TC5A 4LGXA 3ARYA 4MAVA 1ROTA 3EIPA 2MF9A 4DWSD 4TW7A 5DIUA 1W1PA 2DSVA 2VN1A 2DSWA 4U86A 3O5OA 3UQBA 2B5UB 2AOSA 3IK8A 2XP8A 3B7XA 1E6RA 3ARTA 1D2KA 1FKKA 1FD9A 3WKZA 4ODQA 5HW7A 1EHNA 4DRPA 4PTMA 3ARRA 3RM8A 4IQ2A 3RM4A 3UQAA 1LL6A 2RUQA 2DSZA 3O5QA 3GTYX 4W5UA 4TNSA 3KACA 3PRDA 1W1YA 1P5QA 2VCDA 4NZCA 1J4IA 1Q6UA 4XAKA 5HKGA 4DRKA 1HKKA 1NWUA 2KR7A 3KAFA 1FFRA 3QOKA 2FKEA 3UI4A 3JYMA 4DRQA 4TX0A 4ODMA 1D7JA 5HBFA 1LQ0A 2M1IA 4DWSB 3GPKA 4WIWA 2LJ4A 1HJVA 1ZU8A
chains in the Genus database with same CATH topology
2KGJA 1F40A 2M2AA 1HJXA 2DT2A 1R9HA 5I98A 3AS2A 1ZBKA 2N87A 4Q22A 2DT1A 2F2DA 4JYSA 2DG3A 3ARPA 3RGCA 4N19A 4ITZA 1OGGA 2OLHA 2FAPA 3NRKA 1NH6A 4ZPWR 1BKFA 4HBEA 3KADA 1FKFA 1H0IA 1X6NA 4HBOA 4W9QA 1E6NA 1Q1CA 1ZBWA 1ZK6A 1HKIA 4MTVA 4Z2JA 3ARZA 1ROUA 2ZQSA 2K8IA 2PBCA 1O6IA 2A3EA 3OA5A 2XP3A 4ODLA 2PPPA 3WD3A 1KT0A 4DRJA 2F21A 5D75A 2MLZA 4R0XA 3RMEA 1XRVA 5HWCA 5DITA 4MNMA 1VF8A 2XP9A 5BXJA 1WAWA 3UF8A 3KAGA 2QF8A 1B6CA 3RM9A 1EIBA 2PPOA 2RUDA 3ARVA 3O5MA 3B9DA 5HTGA 4WJXA 2PV1A 5HUAA 3CZ8A 1KT1A 2ZR6A 3G6MA 3KAHA 4Z2KA 3WD1A 1L1PA 1LL7A 2IF4A 3O5JA 2PV3A 3O5FA 1OWQA 3BXWA 2ZQTA 1EQ3A 3CHEA 3ARQA 3H9RB 3AQUA 4MPKA 1U79A 1ZBVA 3AROA 2MLYA 4WKFA 1BL4A 4Z2IA 1ITXA 1FFQA 1LJYA 2KFWA 4DRMA 1EDQA 1ZBCA 3ARXA 3FAPA 3O5PA 3O5RA 4L72B 2O92A 1FKLA 4MNLA 1GUVA 1W26A 3ARSA 1NWTA 5HW8A 2LGOA 2L2SA 3WL0A 1PBKA 2DT3A 1ZL1A 1NMVA 2D9FA 3VAWA 1T11A 3UI5A 2MLXA 2DPEA 3MDYB 1FKBA 1QPLA 1IX5A 1EYMA 1W9VA 4JFMA 4MGVA 2ZR5A 2PV2A 1NSGA 1PINA 2ZQUA 4GGQA 1J4HA 1W1TA 3CGNA 3ODKA 2B31A 4IQCA 4U84A 4KQZA 5DIVA 2M08A 3CGMA 4LAXA 1E9LA 3WD4A 3CHFA 2O9OA 3ALFA 4TW8A 2RURA 2KO7A 3ALGA 2A3CA 4C02B 1LG2A 4QZVB 2A3BA 1ZCNA 2WLYA 4G2PA 3PR9A 2WLZA 4S3KA 1LL4A 4P8WA 3UI6A 2XP6A 3TDBA 1C9HA 1ZB5A 1N1AA 3O5GA 5DO2A 1HKMA 2XPAA 2IUZA 2XP5A 3NI6A 1FKRA 2JZVA 1YATA 3PA7A 4QT2A 3AS1A 3O5IA 5HW6A 4IT6A 4P8VA 5GPRA 1TCOC 2DT0A 1E15A 2XPBA 3B8SA 1M5YA 2RUCA 2G41A 4DT4A 3O5EA 4IT4A 1E6PA 4P8XA 1FKGA 1HXVA 1Q6IA 5DF0A 3NTPA 2MNTA 4QT3A 5B8IC 2XP4A 1JNSA 4Q7NA 3G6LA 3ARUA 1NMWA 3CHDA 1A7XA 4ODRA 2KI3A 4S3JA 4FN2A 1FKTA 1D6OA 1D7IA 5GPGA 3O5LA 1FKDA 1QZ2A 4DH0A 3IKDA 5HWBA 3KZ7A 4ML4A 1FKSA 4Z2LA 3UQIA 2PI6A 5DEZA 5JH8A 4DWSC 4DIPA 2PPNA 3I6CA 3JYJA 1W9UA 1GOIA 1WB0A 1W1VA 4DRIA 1JNEA 3FY1A 4DZ2A 1FAPA 4ZPVR 1SYTA 1X6LA 4R5EA 1UR8A 4JFIA 3CH9A 1SR0A 1NWRA 4ODKA 4J4OA 4QIBA 3FXYA 3WH0A 2FDMA 3KAIA 1JNTA 1HJWA 2MPHA 4HARA 4Z2GA 4ODPA 4GIVA 3CHCA 3IHZA 4O2TA 3WL1A 1LG1A 4AY1A 2DG9A 2F4EA 1XHGA 2YBTA 4JFJA 2LKNA 4IPXA 3AS0A 2Y78A 2A3AA 3PRBA 5GQBA 3LUOA 4ZS6A 4LAVA 4L3NA 1J4RA 2ESCA 2YBUA 2DSUA 3AS3A 1RD6A 1K9TA 1F8AB 1UR9A 2WK2A 4URIA 1GPFA 3O5DA 4LAYA 3WD2A 1NWSA 2OFNA 1CTNA 1Q6HA 1JVWA 3RFWA 4ZPTR 1FKJA 4FAPA 2ZR4A 3WD0A 4MNJA 4Z2HA 1E6ZA 1FJDA 1W9PA 3WQWA 1WNOA 1H0GA 4U85A 4P8UA 4DRHA 3TCZA 4TYOA 4ODNA 4TW6A 4DZ3A 2AWGA 4W9PA 5HT1A 4DRNA 1QPFA 2KE0A 1Y0OA 1JNDA 1YW5A 1FKIA 3KABA 4NNRA 4DWSA 3W4RA 3WIJA 2RSEA 4JFLA 5J6EA 4WK9A 4NSBA 4WKAA 1FKHA 2Q5AA 3B9AA 1HKJA 4KR0B 3B9EA 1KFWA 2G8ZA 4J4NA 3OOBA 3ARWA 4MSPA 2ZQVA 4JFKA 4G50A 4LAWA 2DG4A 3IKGA 4W9OA 3PRAA 4MNKA 1J6YA 3WQVA 2ITKA 4DROA 3EY6A 1OGBA 2UZ5A 4WKHA 4BF8A 1TFVA 2XP7A 2WM0A 3O5KA 2RQSA 1D7HA 3JXVA 3KCEA 2LPVA 4ODOA 3TC5A 4LGXA 3ARYA 4MAVA 1ROTA 4DWSD 2MF9A 4TW7A 5DIUA 1W1PA 2DSVA 2VN1A 2DSWA 4U86A 3O5OA 3UQBA 2AOSA 3IK8A 2XP8A 3B7XA 1E6RA 3ARTA 1D2KA 1FKKA 1FD9A 3WKZA 4ODQA 5HW7A 1EHNA 4DRPA 4PTMA 3ARRA 3RM8A 4IQ2A 3RM4A 3UQAA 1LL6A 2RUQA 2DSZA 3O5QA 4W5UA 4TNSA 3KACA 3PRDA 1W1YA 1P5QA 2VCDA 4NZCA 1J4IA 1Q6UA 4XAKA 5HKGA 4DRKA 1HKKA 1NWUA 2KR7A 3KAFA 1FFRA 3QOKA 2FKEA 3UI4A 3JYMA 4DRQA 4TX0A 4ODMA 1D7JA 5HBFA 1LQ0A 2M1IA 4DWSB 3GPKA 4WIWA 2LJ4A 1HJVA 1ZU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKH A;  1FKS A;  1NMV A;  2D9F A;  2KGJ A;  3VAW A;  1F40 A;  2M2A A;  2Q5A A;  1T11 A;  3UQI A;  3UI5 A;  2MLX A;  3MDY B;  1FKB A;  1R9H A;  4DIP A;  2PPN A;  1QPL A;  1EYM A;  4J4N A;  4JFM A;  5I98 A;  4MGV A;  2ZR5 A;  2N87 A;  3I6C A;  3OOB A;  2PV2 A;  1NSG A;  4MSP A;  1PIN A;  2ZQU A;  2F2D A;  4JYS A;  2ZQV A;  3JYJ A;  4GGQ A;  1J4H A;  2DG3 A;  4JFK A;  3ODK A;  3CGN A;  4N19 A;  4ITZ A;  3RGC A;  4G50 A;  4LAW A;  2FAP A;  3NRK A;  4IQC A;  4DRI A;  4U84 A;  2DG4 A;  3IKG A;  4W9O A;  1BKF A;  4DZ2 A;  1FAP A;  5DIV A;  3KAD A;  1FKF A;  4W9Q A;  1J6Y A;  2M08 A;  5J6E A;  2ITK A;  1Q1C A;  1ZK6 A;  3CGM A;  4DRO A;  3EY6 A;  4JFI A;  4LAX A;  2UZ5 A;  4QIB A;  4ODK A;  1ROU A;  2ZQS A;  2K8I A;  2PBC A;  2KO7 A;  2RUR A;  4J4O A;  4TW8 A;  3WH0 A;  4BF8 A;  3KAI A;  2XP7 A;  3O5K A;  2RQS A;  4C02 B;  1JNT A;  1D7H A;  2XP3 A;  2MPH A;  3JXV A;  2LPV A;  3KCE A;  4ODL A;  2PPP A;  4ODO A;  1KT0 A;  3TC5 A;  4DRJ A;  4ODP A;  2F21 A;  5D75 A;  4GIV A;  4DRQ A;  2MLZ A;  4R0X A;  1ZCN A;  4G2P A;  5HWC A;  3IHZ A;  1ROT A;  4O2T A;  5DIT A;  2MF9 A;  2XP9 A;  5BXJ A;  4TW7 A;  2DG9 A;  3UI6 A;  2F4E A;  2XP6 A;  4JFJ A;  3TDB A;  2LKN A;  3KAG A;  4IPX A;  1B6C A;  5DIU A;  1C9H A;  3UF8 A;  1N1A A;  2VN1 A;  2Y78 A;  3O5G A;  2PPO A;  2XPA A;  3PRB A;  2RUD A;  4U86 A;  3O5O A;  3LUO A;  3UQB A;  3O5M A;  2XP5 A;  3NI6 A;  4LAV A;  5HTG A;  1FKR A;  2JZV A;  1YAT A;  3PA7 A;  4QT2 A;  3IK8 A;  3O5I A;  1J4R A;  2PV1 A;  5HUA A;  2XP8 A;  3B7X A;  5HW6 A;  1KT1 A;  2ZR6 A;  3KAH A;  1F8A B;  1FKK A;  1L1P A;  1FD9 A;  2IF4 A;  1TCO C;  3O5J A;  2PV3 A;  3O5F A;  2XPB A;  3O5D A;  4ODQ A;  4LAY A;  5HW7 A;  2OFN A;  2ZQT A;  4DRP A;  1EQ3 A;  1M5Y A;  1Q6H A;  2RUC A;  4DT4 A;  3O5E A;  3H9R B;  1JVW A;  4IQ2 A;  3RFW A;  3UI4 A;  1FKG A;  3UQA A;  1FKJ A;  4FAP A;  1U79 A;  2RUQ A;  2ZR4 A;  3O5Q A;  1HXV A;  4TNS A;  2MLY A;  3KAC A;  3PRD A;  1Q6I A;  1P5Q A;  1FJD A;  4TX0 A;  2VCD A;  1BL4 A;  3NTP A;  2MNT A;  1J4I A;  4QT3 A;  1Q6U A;  5HKG A;  4U85 A;  4DRK A;  4DRH A;  5B8I C;  2XP4 A;  1JNS A;  2KFW A;  3TCZ A;  4DRM A;  4TYO A;  2KR7 A;  4ODN A;  4TW6 A;  3KAF A;  4DZ3 A;  2AWG A;  4W9P A;  1NMW A;  5HT1 A;  4DRN A;  1QPF A;  1A7X A;  2FKE A;  2KE0 A;  2KI3 A;  3FAP A;  3O5P A;  3JYM A;  1Y0O A;  3O5R A;  4FN2 A;  4ODR A;  4ODM A;  1D7J A;  1FKL A;  1FKI A;  1FKT A;  1YW5 A;  2M1I A;  3KAB A;  4NNR A;  1D6O A;  1W26 A;  3GPK A;  1D7I A;  5HW8 A;  5GPG A;  2LJ4 A;  2RSE A;  1FKD A;  2LGO A;  1QZ2 A;  2L2S A;  3IKD A;  3O5L A;  4JFL A;  4DH0 A;  1PBK A;  5HWB A;  3KZ7 A; 
#chains in the Genus database with same CATH topology
 2KGJ A;  1F40 A;  2M2A A;  1HJX A;  2DT2 A;  1R9H A;  5I98 A;  3AS2 A;  1ZBK A;  2N87 A;  4Q22 A;  2DT1 A;  2F2D A;  4JYS A;  2DG3 A;  3ARP A;  3RGC A;  4N19 A;  4ITZ A;  1OGG A;  2OLH A;  2FAP A;  3NRK A;  1NH6 A;  4ZPW R;  1BKF A;  4HBE A;  3KAD A;  1FKF A;  1H0I A;  1X6N A;  4HBO A;  4W9Q A;  1E6N A;  1Q1C A;  1ZBW A;  1ZK6 A;  1HKI A;  4MTV A;  4Z2J A;  3ARZ A;  1ROU A;  2ZQS A;  2K8I A;  2PBC A;  1O6I A;  2A3E A;  3OA5 A;  2XP3 A;  4ODL A;  2PPP A;  3WD3 A;  1KT0 A;  4DRJ A;  2F21 A;  5D75 A;  2MLZ A;  4R0X A;  3RME A;  1XRV A;  5HWC A;  1E44 A;  5DIT A;  4MNM A;  1VF8 A;  2XP9 A;  5BXJ A;  1WAW A;  3UF8 A;  3KAG A;  2QF8 A;  1B6C A;  3RM9 A;  1EIB A;  2PPO A;  2RUD A;  3ARV A;  3O5M A;  3B9D A;  5HTG A;  4WJX A;  2PV1 A;  5HUA A;  3CZ8 A;  1KT1 A;  2ZR6 A;  3G6M A;  3KAH A;  4Z2K A;  3WD1 A;  1L1P A;  1LL7 A;  2IF4 A;  3O5J A;  2PV3 A;  3O5F A;  1OWQ A;  3BXW A;  2ZQT A;  1EQ3 A;  3CHE A;  3ARQ A;  3H9R B;  3AQU A;  2ETN A;  4MPK A;  1U79 A;  1ZBV A;  3ARO A;  2MLY A;  1GRJ A;  4WKF A;  1BL4 A;  4Z2I A;  1ITX A;  1FFQ A;  1LJY A;  2KFW A;  4DRM A;  1EDQ A;  1ZBC A;  3ARX A;  3FAP A;  3O5P A;  3O5R A;  4L72 B;  2O92 A;  1FKL A;  4MNL A;  1GUV A;  1W26 A;  3ARS A;  1NWT A;  5HW8 A;  2LGO A;  2L2S A;  3WL0 A;  1PBK A;  2DT3 A;  1ZL1 A;  1NMV A;  2D9F A;  3VAW A;  1T11 A;  3UI5 A;  2MLX A;  2F23 A;  2DPE A;  3MDY B;  1FKB A;  1QPL A;  1IX5 A;  1EYM A;  1W9V A;  4JFM A;  4MGV A;  2ZR5 A;  2PV2 A;  1NSG A;  1PIN A;  2ZQU A;  4GGQ A;  1J4H A;  1W1T A;  3CGN A;  3ODK A;  2B31 A;  4IQC A;  4U84 A;  4KQZ A;  5DIV A;  2M08 A;  3CGM A;  4LAX A;  1E9L A;  3WD4 A;  3CHF A;  2O9O A;  3ALF A;  4TW8 A;  2RUR A;  2KO7 A;  3ALG A;  2A3C A;  4C02 B;  1JCH B;  1LG2 A;  4QZV B;  2A3B A;  1ZCN A;  2WLY A;  4G2P A;  3PR9 A;  2WLZ A;  4S3K A;  2EUL A;  1LL4 A;  4P8W A;  3UI6 A;  2XP6 A;  3TDB A;  1C9H A;  1ZB5 A;  1N1A A;  3O5G A;  5DO2 A;  1HKM A;  2XPA A;  2IUZ A;  2XP5 A;  3NI6 A;  1FKR A;  2JZV A;  1YAT A;  3PA7 A;  4QT2 A;  3AS1 A;  3O5I A;  5HW6 A;  4IT6 A;  4P8V A;  5GPR A;  1TCO C;  2DT0 A;  1E15 A;  2XPB A;  3B8S A;  1M5Y A;  2RUC A;  2G41 A;  4DT4 A;  3O5E A;  4IT4 A;  1E6P A;  4P8X A;  1FKG A;  1HXV A;  1Q6I A;  5DF0 A;  3NTP A;  2MNT A;  4QT3 A;  5B8I C;  2XP4 A;  1JNS A;  4Q7N A;  3G6L A;  3ARU A;  2PN0 A;  1NMW A;  3CHD A;  1A7X A;  4ODR A;  2KI3 A;  4S3J A;  4FN2 A;  1FKT A;  1D6O A;  1D7I A;  5GPG A;  3O5L A;  1FKD A;  1QZ2 A;  4DH0 A;  3IKD A;  5HWB A;  3KZ7 A;  4ML4 A;  1FKS A;  4Z2L A;  3UQI A;  2PI6 A;  5DEZ A;  5JH8 A;  4DWS C;  4DIP A;  2PPN A;  3I6C A;  3JYJ A;  1W9U A;  1GOI A;  1WB0 A;  1W1V A;  4DRI A;  1JNE A;  3FY1 A;  4DZ2 A;  1FAP A;  2P4V A;  4ZPV R;  1SYT A;  1X6L A;  4R5E A;  1UR8 A;  4JFI A;  3CH9 A;  1SR0 A;  1NWR A;  4ODK A;  4J4O A;  4QIB A;  3FXY A;  3WH0 A;  2FDM A;  3KAI A;  1JNT A;  1HJW A;  2MPH A;  4HAR A;  4Z2G A;  4ODP A;  4GIV A;  3CHC A;  3IHZ A;  4O2T A;  3WL1 A;  1LG1 A;  4AY1 A;  3BMB A;  2DG9 A;  2F4E A;  1XHG A;  2YBT A;  4JFJ A;  2LKN A;  4IPX A;  3AS0 A;  2Y78 A;  2A3A A;  3PRB A;  5GQB A;  3LUO A;  4ZS6 A;  4LAV A;  4L3N A;  1J4R A;  2ESC A;  2YBU A;  2DSU A;  3AS3 A;  1RD6 A;  1K9T A;  1F8A B;  1UR9 A;  2WK2 A;  4URI A;  1GPF A;  3O5D A;  4LAY A;  3WD2 A;  1NWS A;  2OFN A;  1CTN A;  1Q6H A;  1JVW A;  3RFW A;  4ZPT R;  1FKJ A;  4FAP A;  2ZR4 A;  3WD0 A;  4MNJ A;  4Z2H A;  1E6Z A;  1FJD A;  1W9P A;  3WQW A;  1WNO A;  1H0G A;  4U85 A;  4P8U A;  4DRH A;  3TCZ A;  4TYO A;  4ODN A;  4TW6 A;  4DZ3 A;  2AWG A;  4W9P A;  5HT1 A;  4DRN A;  1QPF A;  2KE0 A;  1Y0O A;  1JND A;  1YW5 A;  1FKI A;  3KAB A;  4NNR A;  4DWS A;  3W4R A;  3WIJ A;  2RSE A;  4JFL A;  5J6E A;  4WK9 A;  4NSB A;  4WKA A;  1FKH A;  2Q5A A;  3B9A A;  1HKJ A;  4KR0 B;  4UDM A;  3B9E A;  1KFW A;  2G8Z A;  4J4N A;  3GU0 A;  3OOB A;  3ARW A;  4MSP A;  2ZQV A;  4JFK A;  4G50 A;  4LAW A;  2DG4 A;  3IKG A;  4W9O A;  3PRA A;  4MNK A;  1J6Y A;  3WQV A;  2ITK A;  4DRO A;  3EY6 A;  1OGB A;  2UZ5 A;  4WKH A;  4BF8 A;  1TFV A;  2XP7 A;  2WM0 A;  3O5K A;  2RQS A;  1D7H A;  3JXV A;  3KCE A;  2LPV A;  4ODO A;  3TC5 A;  4LGX A;  3ARY A;  4MAV A;  1ROT A;  3EIP A;  2MF9 A;  4DWS D;  4TW7 A;  5DIU A;  1W1P A;  2DSV A;  2VN1 A;  2DSW A;  4U86 A;  3O5O A;  3UQB A;  2B5U B;  2AOS A;  3IK8 A;  2XP8 A;  3B7X A;  1E6R A;  3ART A;  1D2K A;  1FKK A;  1FD9 A;  3WKZ A;  4ODQ A;  5HW7 A;  1EHN A;  4DRP A;  4PTM A;  3ARR A;  3RM8 A;  4IQ2 A;  3RM4 A;  3UQA A;  1LL6 A;  2RUQ A;  2DSZ A;  3O5Q A;  3GTY X;  4W5U A;  4TNS A;  3KAC A;  3PRD A;  1W1Y A;  1P5Q A;  2VCD A;  4NZC A;  1J4I A;  1Q6U A;  4XAK A;  5HKG A;  4DRK A;  1HKK A;  1NWU A;  2KR7 A;  3KAF A;  1FFR A;  3QOK A;  2FKE A;  3UI4 A;  3JYM A;  4DRQ A;  4TX0 A;  4ODM A;  1D7J A;  5HBF A;  1LQ0 A;  2M1I A;  4DWS B;  3GPK A;  4WIW A;  2LJ4 A;  1HJV A;  1ZU8 A; 
#chains in the Genus database with same CATH homology
 2KGJ A;  1F40 A;  2M2A A;  1HJX A;  2DT2 A;  1R9H A;  5I98 A;  3AS2 A;  1ZBK A;  2N87 A;  4Q22 A;  2DT1 A;  2F2D A;  4JYS A;  2DG3 A;  3ARP A;  3RGC A;  4N19 A;  4ITZ A;  1OGG A;  2OLH A;  2FAP A;  3NRK A;  1NH6 A;  4ZPW R;  1BKF A;  4HBE A;  3KAD A;  1FKF A;  1H0I A;  1X6N A;  4HBO A;  4W9Q A;  1E6N A;  1Q1C A;  1ZBW A;  1ZK6 A;  1HKI A;  4MTV A;  4Z2J A;  3ARZ A;  1ROU A;  2ZQS A;  2K8I A;  2PBC A;  1O6I A;  2A3E A;  3OA5 A;  2XP3 A;  4ODL A;  2PPP A;  3WD3 A;  1KT0 A;  4DRJ A;  2F21 A;  5D75 A;  2MLZ A;  4R0X A;  3RME A;  1XRV A;  5HWC A;  5DIT A;  4MNM A;  1VF8 A;  2XP9 A;  5BXJ A;  1WAW A;  3UF8 A;  3KAG A;  2QF8 A;  1B6C A;  3RM9 A;  1EIB A;  2PPO A;  2RUD A;  3ARV A;  3O5M A;  3B9D A;  5HTG A;  4WJX A;  2PV1 A;  5HUA A;  3CZ8 A;  1KT1 A;  2ZR6 A;  3G6M A;  3KAH A;  4Z2K A;  3WD1 A;  1L1P A;  1LL7 A;  2IF4 A;  3O5J A;  2PV3 A;  3O5F A;  1OWQ A;  3BXW A;  2ZQT A;  1EQ3 A;  3CHE A;  3ARQ A;  3H9R B;  3AQU A;  4MPK A;  1U79 A;  1ZBV A;  3ARO A;  2MLY A;  4WKF A;  1BL4 A;  4Z2I A;  1ITX A;  1FFQ A;  1LJY A;  2KFW A;  4DRM A;  1EDQ A;  1ZBC A;  3ARX A;  3FAP A;  3O5P A;  3O5R A;  4L72 B;  2O92 A;  1FKL A;  4MNL A;  1GUV A;  1W26 A;  3ARS A;  1NWT A;  5HW8 A;  2LGO A;  2L2S A;  3WL0 A;  1PBK A;  2DT3 A;  1ZL1 A;  1NMV A;  2D9F A;  3VAW A;  1T11 A;  3UI5 A;  2MLX A;  2DPE A;  3MDY B;  1FKB A;  1QPL A;  1IX5 A;  1EYM A;  1W9V A;  4JFM A;  4MGV A;  2ZR5 A;  2PV2 A;  1NSG A;  1PIN A;  2ZQU A;  4GGQ A;  1J4H A;  1W1T A;  3CGN A;  3ODK A;  2B31 A;  4IQC A;  4U84 A;  4KQZ A;  5DIV A;  2M08 A;  3CGM A;  4LAX A;  1E9L A;  3WD4 A;  3CHF A;  2O9O A;  3ALF A;  4TW8 A;  2RUR A;  2KO7 A;  3ALG A;  2A3C A;  4C02 B;  1LG2 A;  4QZV B;  2A3B A;  1ZCN A;  2WLY A;  4G2P A;  3PR9 A;  2WLZ A;  4S3K A;  1LL4 A;  4P8W A;  3UI6 A;  2XP6 A;  3TDB A;  1C9H A;  1ZB5 A;  1N1A A;  3O5G A;  5DO2 A;  1HKM A;  2XPA A;  2IUZ A;  2XP5 A;  3NI6 A;  1FKR A;  2JZV A;  1YAT A;  3PA7 A;  4QT2 A;  3AS1 A;  3O5I A;  5HW6 A;  4IT6 A;  4P8V A;  5GPR A;  1TCO C;  2DT0 A;  1E15 A;  2XPB A;  3B8S A;  1M5Y A;  2RUC A;  2G41 A;  4DT4 A;  3O5E A;  4IT4 A;  1E6P A;  4P8X A;  1FKG A;  1HXV A;  1Q6I A;  5DF0 A;  3NTP A;  2MNT A;  4QT3 A;  5B8I C;  2XP4 A;  1JNS A;  4Q7N A;  3G6L A;  3ARU A;  1NMW A;  3CHD A;  1A7X A;  4ODR A;  2KI3 A;  4S3J A;  4FN2 A;  1FKT A;  1D6O A;  1D7I A;  5GPG A;  3O5L A;  1FKD A;  1QZ2 A;  4DH0 A;  3IKD A;  5HWB A;  3KZ7 A;  4ML4 A;  1FKS A;  4Z2L A;  3UQI A;  2PI6 A;  5DEZ A;  5JH8 A;  4DWS C;  4DIP A;  2PPN A;  3I6C A;  3JYJ A;  1W9U A;  1GOI A;  1WB0 A;  1W1V A;  4DRI A;  1JNE A;  3FY1 A;  4DZ2 A;  1FAP A;  4ZPV R;  1SYT A;  1X6L A;  4R5E A;  1UR8 A;  4JFI A;  3CH9 A;  1SR0 A;  1NWR A;  4ODK A;  4J4O A;  4QIB A;  3FXY A;  3WH0 A;  2FDM A;  3KAI A;  1JNT A;  1HJW A;  2MPH A;  4HAR A;  4Z2G A;  4ODP A;  4GIV A;  3CHC A;  3IHZ A;  4O2T A;  3WL1 A;  1LG1 A;  4AY1 A;  2DG9 A;  2F4E A;  1XHG A;  2YBT A;  4JFJ A;  2LKN A;  4IPX A;  3AS0 A;  2Y78 A;  2A3A A;  3PRB A;  5GQB A;  3LUO A;  4ZS6 A;  4LAV A;  4L3N A;  1J4R A;  2ESC A;  2YBU A;  2DSU A;  3AS3 A;  1RD6 A;  1K9T A;  1F8A B;  1UR9 A;  2WK2 A;  4URI A;  1GPF A;  3O5D A;  4LAY A;  3WD2 A;  1NWS A;  2OFN A;  1CTN A;  1Q6H A;  1JVW A;  3RFW A;  4ZPT R;  1FKJ A;  4FAP A;  2ZR4 A;  3WD0 A;  4MNJ A;  4Z2H A;  1E6Z A;  1FJD A;  1W9P A;  3WQW A;  1WNO A;  1H0G A;  4U85 A;  4P8U A;  4DRH A;  3TCZ A;  4TYO A;  4ODN A;  4TW6 A;  4DZ3 A;  2AWG A;  4W9P A;  5HT1 A;  4DRN A;  1QPF A;  2KE0 A;  1Y0O A;  1JND A;  1YW5 A;  1FKI A;  3KAB A;  4NNR A;  4DWS A;  3W4R A;  3WIJ A;  2RSE A;  4JFL A;  5J6E A;  4WK9 A;  4NSB A;  4WKA A;  1FKH A;  2Q5A A;  3B9A A;  1HKJ A;  4KR0 B;  3B9E A;  1KFW A;  2G8Z A;  4J4N A;  3OOB A;  3ARW A;  4MSP A;  2ZQV A;  4JFK A;  4G50 A;  4LAW A;  2DG4 A;  3IKG A;  4W9O A;  3PRA A;  4MNK A;  1J6Y A;  3WQV A;  2ITK A;  4DRO A;  3EY6 A;  1OGB A;  2UZ5 A;  4WKH A;  4BF8 A;  1TFV A;  2XP7 A;  2WM0 A;  3O5K A;  2RQS A;  1D7H A;  3JXV A;  3KCE A;  2LPV A;  4ODO A;  3TC5 A;  4LGX A;  3ARY A;  4MAV A;  1ROT A;  4DWS D;  2MF9 A;  4TW7 A;  5DIU A;  1W1P A;  2DSV A;  2VN1 A;  2DSW A;  4U86 A;  3O5O A;  3UQB A;  2AOS A;  3IK8 A;  2XP8 A;  3B7X A;  1E6R A;  3ART A;  1D2K A;  1FKK A;  1FD9 A;  3WKZ A;  4ODQ A;  5HW7 A;  1EHN A;  4DRP A;  4PTM A;  3ARR A;  3RM8 A;  4IQ2 A;  3RM4 A;  3UQA A;  1LL6 A;  2RUQ A;  2DSZ A;  3O5Q A;  4W5U A;  4TNS A;  3KAC A;  3PRD A;  1W1Y A;  1P5Q A;  2VCD A;  4NZC A;  1J4I A;  1Q6U A;  4XAK A;  5HKG A;  4DRK A;  1HKK A;  1NWU A;  2KR7 A;  3KAF A;  1FFR A;  3QOK A;  2FKE A;  3UI4 A;  3JYM A;  4DRQ A;  4TX0 A;  4ODM A;  1D7J A;  5HBF A;  1LQ0 A;  2M1I A;  4DWS B;  3GPK A;  4WIW A;  2LJ4 A;  1HJV A;  1ZU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...