2VCDA

Solution structure of the fkbp-domain of legionella pneumophila mip in complex with rapamycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
FNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein MIP
publication title Solution structure of the Legionella pneumophila Mip-rapamycin complex.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila (strain philadelphia 1 / atcc 33152 /
molecule tags Isomerase
total genus 27
structure length 137
sequence length 137
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2vcdA02
3PA7A 5HW8A 3KAIA 1FJDA 4ODPA 1QPLA 3OOBA 4DRIA 2RSEA 3O5EA 3EY6A 3KCEA 4C02B 4LAXA 1A7XA 2XPAA 5J6EA 2PBCA 4LAWA 2ZQVA 2ZQUA 2LGOA 5D75A 2ZQTA 4U86A 2XP3A 2Y78A 3O5PA 1FAPA 2D9FA 3VAWA 2XP5A 3NRKA 4ODRA 2LPVA 2KR7A 2PPOA 1FKDA 2XP9A 1EYMA 1ROUA 1KT0A 2LKNA 5DIUA 3RFWA 1B6CA 2F21A 3I6CA 3O5RA 4R0XA 2LJ4A 3NTPA 4G2PA 2N87A 2RUCA 3JYJA 5HW6A 5HW7A 2MNTA 2XP7A 2ZR4A 3UI4A 4DIPA 1N1AA 2PV3A 3JYMA 1ZK6A 2XP4A 4DRHA 3ODKA 1U79A 4ITZA 4TW6A 3B7XA 1YATA 1YW5A 1NMVA 3IK8A 3O5LA 4ODLA 3GPKA 4TNSA 3O5KA 1BKFA 1FKJA 5BXJA 1Q1CA 1J4RA 2M2AA 3IKGA 1L1PA 4JFIA 2VCDA 2AWGA 2JZVA 2XPBA 3TCZA 4O2TA 4W9OA 3KZ7A 1ZCNA 2MLXA 2PV1A 3O5MA 4W9QA 2ITKA 4U85A 3O5OA 1W26A 3UF8A 4TW7A 2RURA 2M1IA 4GGQA 5HWCA 2XP8A 4MSPA 1JVWA 3LUOA 3O5QA 1FKLA 1FKHA 4IPXA 2DG4A 1JNTA 2K8IA 2MF9A 1Q6UA 4QT3A 4DRQA 2DG9A 3KADA 4DZ3A 3H9RB 1FKTA 2ZR5A 1FKGA 3PRBA 4J4NA 4ODKA 5HKGA 2ZQSA 3IKDA 4ODNA 4JFJA 3KAGA 4IQ2A 3FAPA 1QZ2A 1FKFA 2KGJA 3KAFA 1D7HA 2DG3A 3O5DA 4G50A 2M08A 4NNRA 4ODOA 4DRJA 4ODMA 4W9PA 5I98A 2KFWA 3UI5A 1FKRA 2KE0A 4IQCA 4BF8A 3CGMA 1R9HA 5DITA 4QIBA 2F2DA 2KI3A 3RGCA 2RUDA 3NI6A 1TCOC 1BL4A 3KABA 3TC5A 1D6OA 3WH0A 4DH0A 3KACA 4FAPA 2VN1A 1FD9A 4JFMA 1D7JA 1HXVA 4GIVA 4J4OA 2L2SA 5HT1A 1KT1A 2FKEA 1T11A 4JYSA 2KO7A 3KAHA 1FKSA 1PINA 1FKBA 2MPHA 3PRDA 4N19A 5GPGA 4DROA 3UQAA 4DZ2A 1FKKA 4MGVA 4JFLA 3TDBA 1Q6HA 1J6YA 3O5GA 1PBKA 4LAVA 5HTGA 2PPPA 2RQSA 1Q6IA 1M5YA 2Q5AA 4DRNA 2ZR6A 1F40A 4DRPA 5HUAA 4DT4A 2RUQA 1J4IA 3CGNA 1Y0OA 1QPFA 2F4EA 3O5IA 2MLZA 5B8IC 3O5JA 4JFKA 2FAPA 4ODQA 1F8AB 2XP6A 2PV2A 4TW8A 4U84A 5DIVA 1NMWA 1D7IA 3UQBA 1J4HA 4DRKA 1P5QA 4QT2A 3JXVA 4DRMA 1C9HA 2IF4A 3UQIA 2OFNA 4TX0A 2UZ5A 4LAYA 3O5FA 2PPNA 3MDYB 1JNSA 3UI6A 2MLYA 4FN2A 3IHZA 1NSGA 5HWBA 1EQ3A 4TYOA 1FKIA 1ROTA
chains in the Genus database with same CATH superfamily
3KAIA 2FDMA 1FJDA 4P8XA 3RM4A 4C02B 1A7XA 4QZVB 5J6EA 2PBCA 1RD6A 1ZU8A 5D75A 1ZBWA 2YBUA 2ZQTA 4Z2HA 3CH9A 2WLYA 2XP5A 3WD0A 4ODRA 2LPVA 3WKZA 2LKNA 1H0GA 1KFWA 1B6CA 4R0XA 3I6CA 3O5RA 4G2PA 3WD2A 2MNTA 3WQWA 4DRHA 1LL4A 1ZBCA 4ITZA 3GPKA 3O5KA 1BKFA 1FKJA 5BXJA 3IKGA 2DT1A 2JZVA 2OLHA 1LL6A 3TCZA 3WIJA 1K9TA 4UDMA 1ZCNA 1HKIA 2MLXA 2PV1A 4W9QA 3O5OA 1UR9A 3UF8A 3AS1A 1WAWA 2B5UB 3FY1A 3BMBA 1UR8A 2K8IA 4DRQA 1HJWA 3H9RB 3PRBA 1FKGA 4JFJA 3KAGA 4ODOA 2DSUA 4Q7NA 4ODMA 5I98A 1W9VA 1FKRA 1LG1A 5DF0A 3CHCA 3GTYX 1O6IA 2AOSA 2KI3A 5DO2A 3RGCA 4FAPA 1D6OA 3KACA 1FD9A 4J4OA 2A3EA 5GPGA 4JFLA 2G41A 1PBKA 4LAVA 5HTGA 2RQSA 3AROA 3OA5A 4DRNA 1Y0OA 3O5IA 3O5JA 4TW8A 4ODQA 3RM8A 4U84A 1ZBVA 1ZBKA 3JXVA 1W1PA 1C9HA 4DWSB 2OFNA 3B8SA 2PPNA 4FN2A 5HWBA 1FKIA 4IQ2A 5GQBA 3ARZA 2RSEA 4ZPVR 3O5EA 4PTMA 5GPRA 4LAXA 4MPKA 1E6ZA 2A3BA 4WKAA 2PN0A 4DWSA 2XP3A 2Y78A 2XP9A 1FKDA 3B9AA 1EYMA 1KT0A 3ARUA 1EIBA 2F21A 4WKHA 1ITXA 4MNKA 2LJ4A 5HW6A 2RUCA 2O9OA 1N1AA 3JYMA 1ZK6A 3WD3A 3B7XA 3IK8A 2AWGA 3ARRA 2XPBA 3ARYA 4W9OA 3KZ7A 3G6LA 1E6PA 3ARSA 4U85A 1GRJA 4HARA 2ETNA 4TW7A 2IUZA 2M1IA 1JVWA 3PRAA 2YBTA 2MF9A 4DZ3A 2WK2A 2G8ZA 5HKGA 4IT6A 3CHEA 1W1YA 3KAFA 4NNRA 1D7HA 1SYTA 3UI5A 4IQCA 3RMEA 1LJYA 2P4VA 1R9HA 2O92A 2F2DA 1HJVA 2DSZA 3TC5A 1CTNA 1TCOC 1IX5A 1NWUA 4GIVA 2L2SA 1T11A 3WD1A 4JYSA 2DPEA 4N19A 4DZ2A 4MGVA 3O5GA 3PR9A 1E6RA 1GOIA 4W5UA 3ARXA 1M5YA 2Q5AA 2ZR6A 5HUAA 4DT4A 1J4IA 1FFQA 5DIVA 1F8AB 2XP6A 1J4HA 1XRVA 4DWSD 4HBOA 2WM0A 2UZ5A 1HKJA 3AS0A 1GUVA 1ROTA 5HW8A 3CZ8A 1QPLA 1EHNA 3ARVA 3OOBA 4S3KA 4DRIA 4Z2GA 2LGOA 1JNDA 3O5PA 3VAWA 1FAPA 3B9DA 3RM9A 3ALFA 2KR7A 2EULA 1E6NA 1X6LA 1ROUA 5DIUA 2N87A 1FFRA 5HW7A 3ARWA 4DIPA 1ZL1A 2PV3A 2XP4A 3ODKA 4TW6A 1YATA 1YW5A 1NMVA 4ODLA 3ARTA 1Q1CA 4L72B 4ZPWR 3ARQA 1L1PA 2DT3A 3AS2A 4Z2IA 4O2TA 2ITKA 4Z2JA 2XP8A 1OGBA 3LUOA 4Z2LA 1FKHA 2DG4A 4QT3A 1Q6UA 4WIWA 4J4NA 4ODNA 4KR0B 3BXWA 2KGJA 1W1VA 2DG3A 3O5DA 4G50A 4DRJA 2M08A 5HBFA 4W9PA 1XHGA 3CHFA 4WKFA 2KE0A 4BF8A 1X6NA 4URIA 3FXYA 4NZCA 5DITA 4QIBA 1LG2A 4DWSC 1ZB5A 3NI6A 4DH0A 3KABA 1HXVA 5HT1A 1D2KA 4Z2KA 2FKEA 3GU0A 4LGXA 4MAVA 4ZPTR 1NH6A 2KO7A 1FKSA 1PINA 4DROA 4P8UA 3PRDA 3UQAA 1J6YA 1FKKA 3TDBA 2DT2A 1W1TA 4MNJA 1F40A 4DRPA 4MTVA 2F4EA 4WK9A 3WQVA 5HWCA 4JFKA 2FAPA 2PV2A 1NMWA 2A3AA 3UQBA 1P5QA 2A3CA 1W9PA 2IF4A 2ESCA 4TX0A 4L3NA 3MDYB 3W4RA 4AY1A 2MLYA 1NSGA 1SR0A 4TYOA 1EQ3A 3PA7A 4ODPA 3EY6A 1HJXA 3KCEA 5JH8A 2PI6A 2XPAA 4LAWA 2ZQVA 2ZQUA 4U86A 2D9FA 3NRKA 3WD4A 2PPOA 2B31A 3CHDA 4XAKA 4Q22A 1TFVA 4R5EA 3RFWA 1LL7A 2DSVA 3NTPA 3JYJA 1WB0A 1NWSA 1EDQA 2XP7A 2ZR4A 1VF8A 3UI4A 1E9LA 1U79A 3O5LA 4TNSA 4NSBA 3WL0A 3AS3A 4KQZA 1J4RA 2M2AA 4JFIA 2VCDA 1WNOA 1W9UA 5DEZA 3O5MA 4ZS6A 1W26A 2DT0A 4IT4A 2RURA 4GGQA 1OWQA 4MSPA 1E44A 3O5QA 1FKLA 4IPXA 1JNTA 1NWTA 2DG9A 3KADA 1FKTA 2ZR5A 4ODKA 2ZQSA 3IKDA 3FAPA 1QZ2A 1FKFA 1HKKA 3ARPA 2KFWA 4P8VA 3CGMA 4WJXA 1HKMA 4MNLA 4ML4A 2RUDA 1OGGA 1BL4A 3WH0A 2VN1A 4JFMA 4HBEA 1D7JA 3WL1A 2QF8A 3G6MA 1KT1A 3EIPA 1LQ0A 3KAHA 1FKBA 1E15A 2MPHA 1GPFA 1H0IA 1Q6HA 4S3JA 1JNEA 2PPPA 1Q6IA 4P8WA 2RUQA 3CGNA 3QOKA 1QPFA 2MLZA 5B8IC 1D7IA 3ALGA 3AQUA 4DRKA 2F23A 4QT2A 2DSWA 4DRMA 1NWRA 3UQIA 4LAYA 3O5FA 1JCHB 1JNSA 2WLZA 3B9EA 3UI6A 3IHZA 4MNMA
chains in the Genus database with same CATH topology
3KAIA 2FDMA 1FJDA 4P8XA 3RM4A 4C02B 1A7XA 4QZVB 5J6EA 2PBCA 1RD6A 1ZU8A 5D75A 1ZBWA 2YBUA 2ZQTA 4Z2HA 3CH9A 2WLYA 2XP5A 3WD0A 4ODRA 2LPVA 3WKZA 2LKNA 1H0GA 1KFWA 1B6CA 4R0XA 3I6CA 3O5RA 4G2PA 3WD2A 2MNTA 3WQWA 4DRHA 1LL4A 1ZBCA 4ITZA 3GPKA 3O5KA 1BKFA 1FKJA 5BXJA 3IKGA 2DT1A 2JZVA 2OLHA 1LL6A 3TCZA 3WIJA 1K9TA 1ZCNA 1HKIA 2MLXA 2PV1A 4W9QA 3O5OA 1UR9A 3UF8A 3AS1A 1WAWA 3FY1A 1UR8A 2K8IA 4DRQA 1HJWA 3H9RB 3PRBA 1FKGA 4JFJA 3KAGA 4ODOA 2DSUA 4Q7NA 4ODMA 5I98A 1W9VA 1FKRA 1LG1A 5DF0A 3CHCA 1O6IA 2AOSA 2KI3A 5DO2A 3RGCA 4FAPA 1D6OA 3KACA 1FD9A 4J4OA 2A3EA 5GPGA 4JFLA 2G41A 1PBKA 4LAVA 5HTGA 2RQSA 3AROA 3OA5A 4DRNA 1Y0OA 3O5IA 3O5JA 4TW8A 4ODQA 3RM8A 4U84A 1ZBVA 1ZBKA 3JXVA 1W1PA 1C9HA 4DWSB 2OFNA 3B8SA 2PPNA 4FN2A 5HWBA 1FKIA 4IQ2A 5GQBA 3ARZA 2RSEA 4ZPVR 3O5EA 4PTMA 5GPRA 4LAXA 4MPKA 1E6ZA 2A3BA 4WKAA 4DWSA 2XP3A 2Y78A 2XP9A 1FKDA 3B9AA 1EYMA 1KT0A 3ARUA 1EIBA 2F21A 4WKHA 1ITXA 4MNKA 2LJ4A 5HW6A 2RUCA 2O9OA 1N1AA 3JYMA 1ZK6A 3WD3A 3B7XA 3IK8A 2AWGA 3ARRA 2XPBA 3ARYA 4W9OA 3KZ7A 3G6LA 1E6PA 3ARSA 4U85A 4HARA 4TW7A 2IUZA 2M1IA 1JVWA 3PRAA 2YBTA 2MF9A 4DZ3A 2WK2A 2G8ZA 5HKGA 4IT6A 3CHEA 1W1YA 3KAFA 4NNRA 1D7HA 1SYTA 3UI5A 4IQCA 3RMEA 1LJYA 1R9HA 2O92A 2F2DA 1HJVA 2DSZA 3TC5A 1CTNA 1TCOC 1IX5A 1NWUA 4GIVA 2L2SA 1T11A 3WD1A 4JYSA 2DPEA 4N19A 4DZ2A 4MGVA 3O5GA 3PR9A 1E6RA 1GOIA 4W5UA 3ARXA 1M5YA 2Q5AA 2ZR6A 5HUAA 4DT4A 1J4IA 1FFQA 5DIVA 1F8AB 2XP6A 1J4HA 1XRVA 4DWSD 4HBOA 2WM0A 2UZ5A 1HKJA 3AS0A 1GUVA 1ROTA 5HW8A 3CZ8A 1QPLA 1EHNA 3ARVA 3OOBA 4S3KA 4DRIA 4Z2GA 2LGOA 1JNDA 3O5PA 3VAWA 1FAPA 3B9DA 3RM9A 3ALFA 2KR7A 1E6NA 1X6LA 1ROUA 5DIUA 2N87A 1FFRA 5HW7A 3ARWA 4DIPA 1ZL1A 2PV3A 2XP4A 3ODKA 4TW6A 1YATA 1YW5A 1NMVA 4ODLA 3ARTA 1Q1CA 4L72B 4ZPWR 3ARQA 1L1PA 2DT3A 3AS2A 4Z2IA 4O2TA 2ITKA 4Z2JA 2XP8A 1OGBA 3LUOA 4Z2LA 1FKHA 2DG4A 4QT3A 1Q6UA 4WIWA 4J4NA 4ODNA 4KR0B 3BXWA 2KGJA 1W1VA 2DG3A 3O5DA 4G50A 4DRJA 2M08A 5HBFA 4W9PA 1XHGA 3CHFA 4WKFA 2KE0A 4BF8A 1X6NA 4URIA 3FXYA 4NZCA 5DITA 4QIBA 1LG2A 4DWSC 1ZB5A 3NI6A 4DH0A 3KABA 1HXVA 5HT1A 1D2KA 4Z2KA 2FKEA 4LGXA 4MAVA 4ZPTR 1NH6A 2KO7A 1FKSA 1PINA 4DROA 4P8UA 3PRDA 3UQAA 1J6YA 1FKKA 3TDBA 2DT2A 1W1TA 4MNJA 1F40A 4DRPA 4MTVA 2F4EA 4WK9A 3WQVA 5HWCA 4JFKA 2FAPA 2PV2A 1NMWA 2A3AA 3UQBA 1P5QA 2A3CA 1W9PA 2IF4A 2ESCA 4TX0A 4L3NA 3MDYB 3W4RA 4AY1A 2MLYA 1NSGA 1SR0A 4TYOA 1EQ3A 3PA7A 4ODPA 3EY6A 1HJXA 3KCEA 5JH8A 2PI6A 2XPAA 4LAWA 2ZQVA 2ZQUA 4U86A 2D9FA 3NRKA 3WD4A 2PPOA 2B31A 3CHDA 4XAKA 4Q22A 1TFVA 4R5EA 3RFWA 1LL7A 2DSVA 3NTPA 3JYJA 1WB0A 1NWSA 1EDQA 2XP7A 2ZR4A 1VF8A 3UI4A 1E9LA 1U79A 3O5LA 4TNSA 4NSBA 3WL0A 3AS3A 4KQZA 1J4RA 2M2AA 4JFIA 2VCDA 1WNOA 1W9UA 5DEZA 3O5MA 4ZS6A 1W26A 2DT0A 4IT4A 2RURA 4GGQA 1OWQA 4MSPA 3O5QA 1FKLA 4IPXA 1JNTA 1NWTA 2DG9A 3KADA 1FKTA 2ZR5A 4ODKA 2ZQSA 3IKDA 3FAPA 1QZ2A 1FKFA 1HKKA 3ARPA 2KFWA 4P8VA 3CGMA 4WJXA 1HKMA 4MNLA 4ML4A 2RUDA 1OGGA 1BL4A 3WH0A 2VN1A 4JFMA 4HBEA 1D7JA 3WL1A 2QF8A 3G6MA 1KT1A 1LQ0A 3KAHA 1FKBA 1E15A 2MPHA 1GPFA 1H0IA 1Q6HA 4S3JA 1JNEA 2PPPA 1Q6IA 4P8WA 2RUQA 3CGNA 3QOKA 1QPFA 2MLZA 5B8IC 1D7IA 3ALGA 3AQUA 4DRKA 4QT2A 2DSWA 4DRMA 1NWRA 3UQIA 4LAYA 3O5FA 1JNSA 2WLZA 3B9EA 3UI6A 3IHZA 4MNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PA7 A;  5HW8 A;  3KAI A;  1FJD A;  4ODP A;  1QPL A;  3OOB A;  4DRI A;  2RSE A;  3O5E A;  3EY6 A;  3KCE A;  4C02 B;  4LAX A;  1A7X A;  2XPA A;  5J6E A;  2PBC A;  4LAW A;  2ZQV A;  2ZQU A;  2LGO A;  5D75 A;  2ZQT A;  4U86 A;  2XP3 A;  2Y78 A;  3O5P A;  1FAP A;  2D9F A;  3VAW A;  2XP5 A;  3NRK A;  4ODR A;  2LPV A;  2KR7 A;  2PPO A;  1FKD A;  2XP9 A;  1EYM A;  1ROU A;  1KT0 A;  2LKN A;  5DIU A;  3RFW A;  1B6C A;  2F21 A;  3I6C A;  3O5R A;  4R0X A;  2LJ4 A;  3NTP A;  4G2P A;  2N87 A;  2RUC A;  3JYJ A;  5HW6 A;  5HW7 A;  2MNT A;  2XP7 A;  2ZR4 A;  3UI4 A;  4DIP A;  1N1A A;  2PV3 A;  3JYM A;  1ZK6 A;  2XP4 A;  4DRH A;  3ODK A;  1U79 A;  4ITZ A;  4TW6 A;  3B7X A;  1YAT A;  1YW5 A;  1NMV A;  3IK8 A;  3O5L A;  4ODL A;  3GPK A;  4TNS A;  3O5K A;  1BKF A;  1FKJ A;  5BXJ A;  1Q1C A;  1J4R A;  2M2A A;  3IKG A;  1L1P A;  4JFI A;  2VCD A;  2AWG A;  2JZV A;  2XPB A;  3TCZ A;  4O2T A;  4W9O A;  3KZ7 A;  1ZCN A;  2MLX A;  2PV1 A;  3O5M A;  4W9Q A;  2ITK A;  4U85 A;  3O5O A;  1W26 A;  3UF8 A;  4TW7 A;  2RUR A;  2M1I A;  4GGQ A;  5HWC A;  2XP8 A;  4MSP A;  1JVW A;  3LUO A;  3O5Q A;  1FKL A;  1FKH A;  4IPX A;  2DG4 A;  1JNT A;  2K8I A;  2MF9 A;  1Q6U A;  4QT3 A;  4DRQ A;  2DG9 A;  3KAD A;  4DZ3 A;  3H9R B;  1FKT A;  2ZR5 A;  1FKG A;  3PRB A;  4J4N A;  4ODK A;  5HKG A;  2ZQS A;  3IKD A;  4ODN A;  4JFJ A;  3KAG A;  4IQ2 A;  3FAP A;  1QZ2 A;  1FKF A;  2KGJ A;  3KAF A;  1D7H A;  2DG3 A;  3O5D A;  4G50 A;  2M08 A;  4NNR A;  4ODO A;  4DRJ A;  4ODM A;  4W9P A;  5I98 A;  2KFW A;  3UI5 A;  1FKR A;  2KE0 A;  4IQC A;  4BF8 A;  3CGM A;  1R9H A;  5DIT A;  4QIB A;  2F2D A;  2KI3 A;  3RGC A;  2RUD A;  3NI6 A;  1TCO C;  1BL4 A;  3KAB A;  3TC5 A;  1D6O A;  3WH0 A;  4DH0 A;  3KAC A;  4FAP A;  2VN1 A;  1FD9 A;  4JFM A;  1D7J A;  1HXV A;  4GIV A;  4J4O A;  2L2S A;  5HT1 A;  1KT1 A;  2FKE A;  1T11 A;  4JYS A;  2KO7 A;  3KAH A;  1FKS A;  1PIN A;  1FKB A;  2MPH A;  3PRD A;  4N19 A;  5GPG A;  4DRO A;  3UQA A;  4DZ2 A;  1FKK A;  4MGV A;  4JFL A;  3TDB A;  1Q6H A;  1J6Y A;  3O5G A;  1PBK A;  4LAV A;  5HTG A;  2PPP A;  2RQS A;  1Q6I A;  1M5Y A;  2Q5A A;  4DRN A;  2ZR6 A;  1F40 A;  4DRP A;  5HUA A;  4DT4 A;  2RUQ A;  1J4I A;  3CGN A;  1Y0O A;  1QPF A;  2F4E A;  3O5I A;  2MLZ A;  5B8I C;  3O5J A;  4JFK A;  2FAP A;  4ODQ A;  1F8A B;  2XP6 A;  2PV2 A;  4TW8 A;  4U84 A;  5DIV A;  1NMW A;  1D7I A;  3UQB A;  1J4H A;  4DRK A;  1P5Q A;  4QT2 A;  3JXV A;  4DRM A;  1C9H A;  2IF4 A;  3UQI A;  2OFN A;  4TX0 A;  2UZ5 A;  4LAY A;  3O5F A;  2PPN A;  3MDY B;  1JNS A;  3UI6 A;  2MLY A;  4FN2 A;  3IHZ A;  1NSG A;  5HWB A;  1EQ3 A;  4TYO A;  1FKI A;  1ROT A; 
#chains in the Genus database with same CATH topology
 3KAI A;  2FDM A;  1FJD A;  4P8X A;  3RM4 A;  4C02 B;  1A7X A;  4QZV B;  5J6E A;  2PBC A;  1RD6 A;  1ZU8 A;  5D75 A;  1ZBW A;  2YBU A;  2ZQT A;  4Z2H A;  3CH9 A;  2WLY A;  2XP5 A;  3WD0 A;  4ODR A;  2LPV A;  3WKZ A;  2LKN A;  1H0G A;  1KFW A;  1B6C A;  4R0X A;  3I6C A;  3O5R A;  4G2P A;  3WD2 A;  2MNT A;  3WQW A;  4DRH A;  1LL4 A;  1ZBC A;  4ITZ A;  3GPK A;  3O5K A;  1BKF A;  1FKJ A;  5BXJ A;  3IKG A;  2DT1 A;  2JZV A;  2OLH A;  1LL6 A;  3TCZ A;  3WIJ A;  1K9T A;  4UDM A;  1ZCN A;  1HKI A;  2MLX A;  2PV1 A;  4W9Q A;  3O5O A;  1UR9 A;  3UF8 A;  3AS1 A;  1WAW A;  2B5U B;  3FY1 A;  3BMB A;  1UR8 A;  2K8I A;  4DRQ A;  1HJW A;  3H9R B;  3PRB A;  1FKG A;  4JFJ A;  3KAG A;  4ODO A;  2DSU A;  4Q7N A;  4ODM A;  5I98 A;  1W9V A;  1FKR A;  1LG1 A;  5DF0 A;  3CHC A;  3GTY X;  1O6I A;  2AOS A;  2KI3 A;  5DO2 A;  3RGC A;  4FAP A;  1D6O A;  3KAC A;  1FD9 A;  4J4O A;  2A3E A;  5GPG A;  4JFL A;  2G41 A;  1PBK A;  4LAV A;  5HTG A;  2RQS A;  3ARO A;  3OA5 A;  4DRN A;  1Y0O A;  3O5I A;  3O5J A;  4TW8 A;  4ODQ A;  3RM8 A;  4U84 A;  1ZBV A;  1ZBK A;  3JXV A;  1W1P A;  1C9H A;  4DWS B;  2OFN A;  3B8S A;  2PPN A;  4FN2 A;  5HWB A;  1FKI A;  4IQ2 A;  5GQB A;  3ARZ A;  2RSE A;  4ZPV R;  3O5E A;  4PTM A;  5GPR A;  4LAX A;  4MPK A;  1E6Z A;  2A3B A;  4WKA A;  2PN0 A;  4DWS A;  2XP3 A;  2Y78 A;  2XP9 A;  1FKD A;  3B9A A;  1EYM A;  1KT0 A;  3ARU A;  1EIB A;  2F21 A;  4WKH A;  1ITX A;  4MNK A;  2LJ4 A;  5HW6 A;  2RUC A;  2O9O A;  1N1A A;  3JYM A;  1ZK6 A;  3WD3 A;  3B7X A;  3IK8 A;  2AWG A;  3ARR A;  2XPB A;  3ARY A;  4W9O A;  3KZ7 A;  3G6L A;  1E6P A;  3ARS A;  4U85 A;  1GRJ A;  4HAR A;  2ETN A;  4TW7 A;  2IUZ A;  2M1I A;  1JVW A;  3PRA A;  2YBT A;  2MF9 A;  4DZ3 A;  2WK2 A;  2G8Z A;  5HKG A;  4IT6 A;  3CHE A;  1W1Y A;  3KAF A;  4NNR A;  1D7H A;  1SYT A;  3UI5 A;  4IQC A;  3RME A;  1LJY A;  2P4V A;  1R9H A;  2O92 A;  2F2D A;  1HJV A;  2DSZ A;  3TC5 A;  1CTN A;  1TCO C;  1IX5 A;  1NWU A;  4GIV A;  2L2S A;  1T11 A;  3WD1 A;  4JYS A;  2DPE A;  4N19 A;  4DZ2 A;  4MGV A;  3O5G A;  3PR9 A;  1E6R A;  1GOI A;  4W5U A;  3ARX A;  1M5Y A;  2Q5A A;  2ZR6 A;  5HUA A;  4DT4 A;  1J4I A;  1FFQ A;  5DIV A;  1F8A B;  2XP6 A;  1J4H A;  1XRV A;  4DWS D;  4HBO A;  2WM0 A;  2UZ5 A;  1HKJ A;  3AS0 A;  1GUV A;  1ROT A;  5HW8 A;  3CZ8 A;  1QPL A;  1EHN A;  3ARV A;  3OOB A;  4S3K A;  4DRI A;  4Z2G A;  2LGO A;  1JND A;  3O5P A;  3VAW A;  1FAP A;  3B9D A;  3RM9 A;  3ALF A;  2KR7 A;  2EUL A;  1E6N A;  1X6L A;  1ROU A;  5DIU A;  2N87 A;  1FFR A;  5HW7 A;  3ARW A;  4DIP A;  1ZL1 A;  2PV3 A;  2XP4 A;  3ODK A;  4TW6 A;  1YAT A;  1YW5 A;  1NMV A;  4ODL A;  3ART A;  1Q1C A;  4L72 B;  4ZPW R;  3ARQ A;  1L1P A;  2DT3 A;  3AS2 A;  4Z2I A;  4O2T A;  2ITK A;  4Z2J A;  2XP8 A;  1OGB A;  3LUO A;  4Z2L A;  1FKH A;  2DG4 A;  4QT3 A;  1Q6U A;  4WIW A;  4J4N A;  4ODN A;  4KR0 B;  3BXW A;  2KGJ A;  1W1V A;  2DG3 A;  3O5D A;  4G50 A;  4DRJ A;  2M08 A;  5HBF A;  4W9P A;  1XHG A;  3CHF A;  4WKF A;  2KE0 A;  4BF8 A;  1X6N A;  4URI A;  3FXY A;  4NZC A;  5DIT A;  4QIB A;  1LG2 A;  4DWS C;  1ZB5 A;  3NI6 A;  4DH0 A;  3KAB A;  1HXV A;  5HT1 A;  1D2K A;  4Z2K A;  2FKE A;  3GU0 A;  4LGX A;  4MAV A;  4ZPT R;  1NH6 A;  2KO7 A;  1FKS A;  1PIN A;  4DRO A;  4P8U A;  3PRD A;  3UQA A;  1J6Y A;  1FKK A;  3TDB A;  2DT2 A;  1W1T A;  4MNJ A;  1F40 A;  4DRP A;  4MTV A;  2F4E A;  4WK9 A;  3WQV A;  5HWC A;  4JFK A;  2FAP A;  2PV2 A;  1NMW A;  2A3A A;  3UQB A;  1P5Q A;  2A3C A;  1W9P A;  2IF4 A;  2ESC A;  4TX0 A;  4L3N A;  3MDY B;  3W4R A;  4AY1 A;  2MLY A;  1NSG A;  1SR0 A;  4TYO A;  1EQ3 A;  3PA7 A;  4ODP A;  3EY6 A;  1HJX A;  3KCE A;  5JH8 A;  2PI6 A;  2XPA A;  4LAW A;  2ZQV A;  2ZQU A;  4U86 A;  2D9F A;  3NRK A;  3WD4 A;  2PPO A;  2B31 A;  3CHD A;  4XAK A;  4Q22 A;  1TFV A;  4R5E A;  3RFW A;  1LL7 A;  2DSV A;  3NTP A;  3JYJ A;  1WB0 A;  1NWS A;  1EDQ A;  2XP7 A;  2ZR4 A;  1VF8 A;  3UI4 A;  1E9L A;  1U79 A;  3O5L A;  4TNS A;  4NSB A;  3WL0 A;  3AS3 A;  4KQZ A;  1J4R A;  2M2A A;  4JFI A;  2VCD A;  1WNO A;  1W9U A;  5DEZ A;  3O5M A;  4ZS6 A;  1W26 A;  2DT0 A;  4IT4 A;  2RUR A;  4GGQ A;  1OWQ A;  4MSP A;  1E44 A;  3O5Q A;  1FKL A;  4IPX A;  1JNT A;  1NWT A;  2DG9 A;  3KAD A;  1FKT A;  2ZR5 A;  4ODK A;  2ZQS A;  3IKD A;  3FAP A;  1QZ2 A;  1FKF A;  1HKK A;  3ARP A;  2KFW A;  4P8V A;  3CGM A;  4WJX A;  1HKM A;  4MNL A;  4ML4 A;  2RUD A;  1OGG A;  1BL4 A;  3WH0 A;  2VN1 A;  4JFM A;  4HBE A;  1D7J A;  3WL1 A;  2QF8 A;  3G6M A;  1KT1 A;  3EIP A;  1LQ0 A;  3KAH A;  1FKB A;  1E15 A;  2MPH A;  1GPF A;  1H0I A;  1Q6H A;  4S3J A;  1JNE A;  2PPP A;  1Q6I A;  4P8W A;  2RUQ A;  3CGN A;  3QOK A;  1QPF A;  2MLZ A;  5B8I C;  1D7I A;  3ALG A;  3AQU A;  4DRK A;  2F23 A;  4QT2 A;  2DSW A;  4DRM A;  1NWR A;  3UQI A;  4LAY A;  3O5F A;  1JCH B;  1JNS A;  2WLZ A;  3B9E A;  3UI6 A;  3IHZ A;  4MNM A; 
#chains in the Genus database with same CATH homology
 3KAI A;  2FDM A;  1FJD A;  4P8X A;  3RM4 A;  4C02 B;  1A7X A;  4QZV B;  5J6E A;  2PBC A;  1RD6 A;  1ZU8 A;  5D75 A;  1ZBW A;  2YBU A;  2ZQT A;  4Z2H A;  3CH9 A;  2WLY A;  2XP5 A;  3WD0 A;  4ODR A;  2LPV A;  3WKZ A;  2LKN A;  1H0G A;  1KFW A;  1B6C A;  4R0X A;  3I6C A;  3O5R A;  4G2P A;  3WD2 A;  2MNT A;  3WQW A;  4DRH A;  1LL4 A;  1ZBC A;  4ITZ A;  3GPK A;  3O5K A;  1BKF A;  1FKJ A;  5BXJ A;  3IKG A;  2DT1 A;  2JZV A;  2OLH A;  1LL6 A;  3TCZ A;  3WIJ A;  1K9T A;  1ZCN A;  1HKI A;  2MLX A;  2PV1 A;  4W9Q A;  3O5O A;  1UR9 A;  3UF8 A;  3AS1 A;  1WAW A;  3FY1 A;  1UR8 A;  2K8I A;  4DRQ A;  1HJW A;  3H9R B;  3PRB A;  1FKG A;  4JFJ A;  3KAG A;  4ODO A;  2DSU A;  4Q7N A;  4ODM A;  5I98 A;  1W9V A;  1FKR A;  1LG1 A;  5DF0 A;  3CHC A;  1O6I A;  2AOS A;  2KI3 A;  5DO2 A;  3RGC A;  4FAP A;  1D6O A;  3KAC A;  1FD9 A;  4J4O A;  2A3E A;  5GPG A;  4JFL A;  2G41 A;  1PBK A;  4LAV A;  5HTG A;  2RQS A;  3ARO A;  3OA5 A;  4DRN A;  1Y0O A;  3O5I A;  3O5J A;  4TW8 A;  4ODQ A;  3RM8 A;  4U84 A;  1ZBV A;  1ZBK A;  3JXV A;  1W1P A;  1C9H A;  4DWS B;  2OFN A;  3B8S A;  2PPN A;  4FN2 A;  5HWB A;  1FKI A;  4IQ2 A;  5GQB A;  3ARZ A;  2RSE A;  4ZPV R;  3O5E A;  4PTM A;  5GPR A;  4LAX A;  4MPK A;  1E6Z A;  2A3B A;  4WKA A;  4DWS A;  2XP3 A;  2Y78 A;  2XP9 A;  1FKD A;  3B9A A;  1EYM A;  1KT0 A;  3ARU A;  1EIB A;  2F21 A;  4WKH A;  1ITX A;  4MNK A;  2LJ4 A;  5HW6 A;  2RUC A;  2O9O A;  1N1A A;  3JYM A;  1ZK6 A;  3WD3 A;  3B7X A;  3IK8 A;  2AWG A;  3ARR A;  2XPB A;  3ARY A;  4W9O A;  3KZ7 A;  3G6L A;  1E6P A;  3ARS A;  4U85 A;  4HAR A;  4TW7 A;  2IUZ A;  2M1I A;  1JVW A;  3PRA A;  2YBT A;  2MF9 A;  4DZ3 A;  2WK2 A;  2G8Z A;  5HKG A;  4IT6 A;  3CHE A;  1W1Y A;  3KAF A;  4NNR A;  1D7H A;  1SYT A;  3UI5 A;  4IQC A;  3RME A;  1LJY A;  1R9H A;  2O92 A;  2F2D A;  1HJV A;  2DSZ A;  3TC5 A;  1CTN A;  1TCO C;  1IX5 A;  1NWU A;  4GIV A;  2L2S A;  1T11 A;  3WD1 A;  4JYS A;  2DPE A;  4N19 A;  4DZ2 A;  4MGV A;  3O5G A;  3PR9 A;  1E6R A;  1GOI A;  4W5U A;  3ARX A;  1M5Y A;  2Q5A A;  2ZR6 A;  5HUA A;  4DT4 A;  1J4I A;  1FFQ A;  5DIV A;  1F8A B;  2XP6 A;  1J4H A;  1XRV A;  4DWS D;  4HBO A;  2WM0 A;  2UZ5 A;  1HKJ A;  3AS0 A;  1GUV A;  1ROT A;  5HW8 A;  3CZ8 A;  1QPL A;  1EHN A;  3ARV A;  3OOB A;  4S3K A;  4DRI A;  4Z2G A;  2LGO A;  1JND A;  3O5P A;  3VAW A;  1FAP A;  3B9D A;  3RM9 A;  3ALF A;  2KR7 A;  1E6N A;  1X6L A;  1ROU A;  5DIU A;  2N87 A;  1FFR A;  5HW7 A;  3ARW A;  4DIP A;  1ZL1 A;  2PV3 A;  2XP4 A;  3ODK A;  4TW6 A;  1YAT A;  1YW5 A;  1NMV A;  4ODL A;  3ART A;  1Q1C A;  4L72 B;  4ZPW R;  3ARQ A;  1L1P A;  2DT3 A;  3AS2 A;  4Z2I A;  4O2T A;  2ITK A;  4Z2J A;  2XP8 A;  1OGB A;  3LUO A;  4Z2L A;  1FKH A;  2DG4 A;  4QT3 A;  1Q6U A;  4WIW A;  4J4N A;  4ODN A;  4KR0 B;  3BXW A;  2KGJ A;  1W1V A;  2DG3 A;  3O5D A;  4G50 A;  4DRJ A;  2M08 A;  5HBF A;  4W9P A;  1XHG A;  3CHF A;  4WKF A;  2KE0 A;  4BF8 A;  1X6N A;  4URI A;  3FXY A;  4NZC A;  5DIT A;  4QIB A;  1LG2 A;  4DWS C;  1ZB5 A;  3NI6 A;  4DH0 A;  3KAB A;  1HXV A;  5HT1 A;  1D2K A;  4Z2K A;  2FKE A;  4LGX A;  4MAV A;  4ZPT R;  1NH6 A;  2KO7 A;  1FKS A;  1PIN A;  4DRO A;  4P8U A;  3PRD A;  3UQA A;  1J6Y A;  1FKK A;  3TDB A;  2DT2 A;  1W1T A;  4MNJ A;  1F40 A;  4DRP A;  4MTV A;  2F4E A;  4WK9 A;  3WQV A;  5HWC A;  4JFK A;  2FAP A;  2PV2 A;  1NMW A;  2A3A A;  3UQB A;  1P5Q A;  2A3C A;  1W9P A;  2IF4 A;  2ESC A;  4TX0 A;  4L3N A;  3MDY B;  3W4R A;  4AY1 A;  2MLY A;  1NSG A;  1SR0 A;  4TYO A;  1EQ3 A;  3PA7 A;  4ODP A;  3EY6 A;  1HJX A;  3KCE A;  5JH8 A;  2PI6 A;  2XPA A;  4LAW A;  2ZQV A;  2ZQU A;  4U86 A;  2D9F A;  3NRK A;  3WD4 A;  2PPO A;  2B31 A;  3CHD A;  4XAK A;  4Q22 A;  1TFV A;  4R5E A;  3RFW A;  1LL7 A;  2DSV A;  3NTP A;  3JYJ A;  1WB0 A;  1NWS A;  1EDQ A;  2XP7 A;  2ZR4 A;  1VF8 A;  3UI4 A;  1E9L A;  1U79 A;  3O5L A;  4TNS A;  4NSB A;  3WL0 A;  3AS3 A;  4KQZ A;  1J4R A;  2M2A A;  4JFI A;  2VCD A;  1WNO A;  1W9U A;  5DEZ A;  3O5M A;  4ZS6 A;  1W26 A;  2DT0 A;  4IT4 A;  2RUR A;  4GGQ A;  1OWQ A;  4MSP A;  3O5Q A;  1FKL A;  4IPX A;  1JNT A;  1NWT A;  2DG9 A;  3KAD A;  1FKT A;  2ZR5 A;  4ODK A;  2ZQS A;  3IKD A;  3FAP A;  1QZ2 A;  1FKF A;  1HKK A;  3ARP A;  2KFW A;  4P8V A;  3CGM A;  4WJX A;  1HKM A;  4MNL A;  4ML4 A;  2RUD A;  1OGG A;  1BL4 A;  3WH0 A;  2VN1 A;  4JFM A;  4HBE A;  1D7J A;  3WL1 A;  2QF8 A;  3G6M A;  1KT1 A;  1LQ0 A;  3KAH A;  1FKB A;  1E15 A;  2MPH A;  1GPF A;  1H0I A;  1Q6H A;  4S3J A;  1JNE A;  2PPP A;  1Q6I A;  4P8W A;  2RUQ A;  3CGN A;  3QOK A;  1QPF A;  2MLZ A;  5B8I C;  1D7I A;  3ALG A;  3AQU A;  4DRK A;  4QT2 A;  2DSW A;  4DRM A;  1NWR A;  3UQI A;  4LAY A;  3O5F A;  1JNS A;  2WLZ A;  3B9E A;  3UI6 A;  3IHZ A;  4MNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...