2VCDA

Solution structure of the fkbp-domain of legionella pneumophila mip in complex with rapamycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
FNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Legionella pneumophila Mip-rapamycin complex.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila (strain philadelphia 1 / atcc 33152 /
molecule tags Isomerase
molecule keywords Outer membrane protein MIP
total genus 27
structure length 137
sequence length 137
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2vcdA02
1FKSA 4ODMA 4DRNA 2LGOA 3MDYB 5DITA 4JYSA 3O5FA 1Q6IA 2DG3A 1JNTA 3IKGA 1FKGA 1J4RA 1NSGA 2KGJA 2ZQVA 3I6CA 3PRDA 1KT0A 3TC5A 2RSEA 2PV3A 4TYOA 4DRJA 3O5DA 2ZQUA 5HUAA 1BL4A 1Q6UA 4GGQA 2LPVA 3KCEA 4JFLA 4TW6A 4ODKA 3O5JA 3O5IA 2M2AA 5I98A 3O5RA 5GPGA 2LKNA 3O5KA 1D7JA 2RUDA 3ODKA 4FN2A 3UQBA 4DRKA 3IK8A 1J4HA 2FKEA 4DH0A 2Y78A 4JFIA 3KAHA 5DIUA 4LAYA 2L2SA 2N87A 1Q1CA 3FAPA 4BF8A 1C9HA 3KACA 2FAPA 4FAPA 1U79A 3JYMA 4ODNA 4TX0A 5B8IC 5HWBA 3CGNA 4DIPA 4G2PA 2ZR5A 4G50A 1P5QA 4DZ3A 3KAGA 2M1IA 3NTPA 4ODQA 1FKFA 3TDBA 4IPXA 2XP6A 5HW7A 1Y0OA 2DG9A 2KFWA 2ZQSA 3H9RB 1Q6HA 3CGMA 1D7IA 2F4EA 3JYJA 3JXVA 2KI3A 1M5YA 3IKDA 2PV1A 4LAWA 1QPLA 2JZVA 4J4OA 4TNSA 2MLXA 5HKGA 1F40A 3O5QA 2PPPA 5HW8A 3KABA 2RUQA 4W9OA 5HT1A 1BKFA 4DRIA 5BXJA 2XP5A 1JVWA 1FJDA 4TW8A 1J6YA 3O5OA 4QIBA 2MNTA 2OFNA 2RQSA 2VCDA 3KZ7A 2XPBA 2ZR4A 1NMWA 4MGVA 4ITZA 4O2TA 4DRQA 2MPHA 1FKLA 1ROUA 3B7XA 4N19A 5HW6A 1HXVA 4MSPA 3KAFA 1B6CA 1YATA 4J4NA 1JNSA 3KADA 2LJ4A 1FKRA 1EYMA 1R9HA 1KT1A 4JFMA 3PA7A 3UI4A 2VN1A 4DRHA 4JFJA 4NNRA 3OOBA 4U84A 3NI6A 4LAXA 3TCZA 3UQIA 5J6EA 4ODPA 4DROA 1FKJA 5HTGA 1FKKA 3RGCA 2KE0A 3O5GA 2XP3A 5DIVA 1YW5A 2ZQTA 2PBCA 3UI6A 1F8AB 1ROTA 2PV2A 2XPAA 2XP8A 1EQ3A 2F21A 2K8IA 2IF4A 3O5MA 5HWCA 2KO7A 4QT2A 2ZR6A 4LAVA 2D9FA 4C02B 4DRPA 3KAIA 4ODOA 1QZ2A 1TCOC 4DT4A 1FAPA 3O5EA 1W26A 2M08A 4W9PA 1A7XA 1PINA 1FD9A 1FKDA 2DG4A 4IQ2A 1ZK6A 3PRBA 4IQCA 3UQAA 3LUOA 1L1PA 3NRKA 4ODRA 1D6OA 4JFKA 1D7HA 1T11A 2MLZA 1NMVA 4W9QA 2XP4A 4U85A 2RUCA 3RFWA 4R0XA 2RURA 1FKHA 2MLYA 2KR7A 5D75A 2XP7A 4QT3A 3GPKA 4GIVA 2UZ5A 3UF8A 3WH0A 1PBKA 2F2DA 2XP9A 1FKBA 3O5LA 1N1AA 4TW7A 3IHZA 1ZCNA 2MF9A 2ITKA 2PPOA 1QPFA 2Q5AA 4U86A 3UI5A 1J4IA 2PPNA 1FKIA 3O5PA 4DRMA 4DZ2A 3VAWA 3EY6A 1FKTA 2AWGA 4ODLA
chains in the Genus database with same CATH superfamily
2LGOA 1Q6IA 2WLYA 2DG3A 3WQVA 3ARSA 4Q22A 4WKFA 1FKGA 3PRDA 1NSGA 2ZQVA 4MPKA 2ZQUA 3G6LA 1BL4A 3O5JA 2M2AA 2LKNA 4L72B 4FN2A 3UQBA 2DPEA 5DIUA 4LAYA 1H0GA 4IT4A 1Q1CA 3FAPA 4BF8A 4NSBA 1GOIA 3ARPA 3B9DA 2DSZA 2ZR5A 1P5QA 1W1VA 4DZ3A 3TDBA 4IPXA 4KQZA 3QOKA 1Y0OA 2DG9A 2KFWA 5HW7A 3JYJA 5I98A 4LAWA 3IKDA 2PV1A 4J4OA 2MLXA 3ARWA 5HW8A 3B9AA 2RUQA 3KABA 5BXJA 1BKFA 2XP5A 1WAWA 4TW8A 2A3BA 4Z2LA 4QIBA 3CH9A 4W9OA 4ZPTR 5HBFA 1HKKA 4P8XA 1HJVA 1FKRA 1ZU8A 3OOBA 1ZL1A 3ARTA 5GQBA 5HTGA 3O5GA 1YW5A 2ZQTA 2PBCA 1ROTA 1EQ3A 2K8IA 2G41A 2WLZA 3EIPA 5DO2A 3KAIA 1QZ2A 1W26A 3BXWA 3WQWA 4W9PA 1A7XA 1PINA 1FD9A 4IQ2A 1ZK6A 3UQAA 1EIBA 2B31A 1T11A 3RM8A 4QZVB 1NH6A 4R0XA 4AY1A 2F23A 5D75A 3OA5A 1NWRA 2AOSA 2UZ5A 1W1TA 3O5LA 3GTYX 3AS1A 2DSWA 1FKTA 2AWGA 1E15A 1FKSA 4JYSA 1LL4A 3AS0A 4L3NA 1XRVA 2KGJA 4ZPWR 3TC5A 4HARA 2RSEA 1E6NA 1Q6UA 3WD3A 4NZCA 3O5IA 4P8VA 3RM9A 1J4HA 4JFIA 3KAHA 1LJYA 2N87A 2OLHA 3ARUA 2FAPA 4FAPA 3JYMA 3PRAA 1E9LA 4LGXA 5DEZA 3WD1A 3RMEA 3H9RB 3CGMA 2A3CA 3JXVA 1F40A 4TNSA 1ZBCA 1SYTA 4MNKA 3PR9A 2DT0A 5HT1A 4Z2HA 1FJDA 1J6YA 2XPBA 1NMWA 5HW6A 1ROUA 3B7XA 4MSPA 3AROA 1JNSA 1LG2A 3NI6A 3CHDA 1RD6A 1SR0A 3BMBA 4DROA 1NWTA 1X6NA 1OGBA 2XP3A 5DIVA 4W5UA 2PV2A 2XP8A 1K9TA 3ARRA 2WK2A 2KO7A 1E6RA 2ZR6A 2D9FA 4DWSD 4KR0B 4DT4A 1FAPA 3O5EA 1E44A 4HBEA 3PRBA 1W1PA 4IQCA 3NRKA 4ODRA 2MLZA 4W9QA 4U85A 1OWQA 2RUCA 2RURA 1W1YA 3B9EA 4MNMA 5JH8A 2G8ZA 3AQUA 4GIVA 4PTMA 2O92A 1ITXA 3O5PA 4DRMA 3VAWA 4IT6A 3WD0A 4ODLA 2A3AA 1D2KA 5DITA 3O5FA 1JNTA 2O9OA 3I6CA 1KT0A 2PV3A 3O5DA 1HKJA 5HUAA 4GGQA 3G6MA 1NWSA 2DSVA 3KCEA 4JFLA 4MNLA 4TW6A 5DF0A 1ZB5A 4UDMA 3O5KA 2RUDA 3FY1A 3ODKA 3IK8A 1UR9A 2FKEA 2Y78A 1HKMA 4Z2IA 1LL7A 1W9UA 2L2SA 3CHEA 3KACA 3ARXA 1U79A 4ODNA 5HWBA 3CGNA 4G2PA 4G50A 3B8SA 3NTPA 3WD4A 1FKFA 2XP6A 1Q6HA 1D7IA 2DT2A 2KI3A 1M5YA 1WNOA 1QPLA 2JZVA 1W9PA 3O5QA 2PPPA 3GU0A 3FXYA 1GUVA 3O5OA 1JNDA 2RQSA 2VCDA 1ZBWA 4MGVA 2ZR4A 4DRQA 1FKLA 1HXVA 1FFRA 4J4NA 3KADA 2LJ4A 5GPRA 1EYMA 1R9HA 1KT1A 1ZBKA 4JFMA 3PA7A 3UI4A 4WK9A 4JFJA 2ETNA 3AS2A 4LAXA 2YBTA 4ODPA 1FKJA 1FKKA 3RGCA 4ML4A 2DSUA 3UI6A 3WD2A 1HKIA 2PI6A 4QT2A 2FDMA 4C02B 4WKHA 3WKZA 2DT1A 2M08A 1GPFA 3CHCA 1XHGA 1FKDA 2DG4A 4ZS6A 1E6PA 1JNEA 1L1PA 3LUOA 4URIA 1W9VA 4HBOA 4JFKA 4ZPVR 1WB0A 2XP4A 3RM4A 4WJXA 4MAVA 2XP7A 4QT3A 1FFQA 4Q7NA 3GPKA 4MNJA 3WH0A 1PBKA 2XP9A 1E6ZA 1FKBA 1N1AA 4DWSB 2MF9A 4U86A 1QPFA 2Q5AA 4DZ2A 3UI5A 1J4IA 3EY6A 1D7JA 3ALFA 4ODMA 4DRNA 3MDYB 1HJXA 3IKGA 1J4RA 1VF8A 4DRJA 4TYOA 4Z2GA 1LG1A 2LPVA 4ODKA 3O5RA 5GPGA 4S3KA 3AS3A 4DRKA 2PN0A 4DH0A 2P4VA 1C9HA 4P8UA 5B8IC 4TX0A 4R5EA 4DIPA 1UR8A 2QF8A 2M1IA 2WM0A 3KAGA 4ODQA 3ARYA 2YBUA 1IX5A 1LQ0A 2A3EA 2ZQSA 2F4EA 5HKGA 4S3JA 1NWUA 1H0IA 4MTVA 4DRIA 1JVWA 1X6LA 3WIJA 4Z2JA 2MNTA 2OFNA 3KZ7A 1HJWA 4O2TA 3ALGA 4ITZA 2MPHA 4N19A 3KAFA 1B6CA 4WIWA 1YATA 4WKAA 3ARQA 2VN1A 4DRHA 3ARVA 3CZ8A 4NNRA 4U84A 3TCZA 3UQIA 5J6EA 1O6IA 1JCHB 2KE0A 1F8AB 2XPAA 2F21A 1LL6A 1ZBVA 2IF4A 1TFVA 2IUZA 3O5MA 5HWCA 4LAVA 4DRPA 4ODOA 1TCOC 1EDQA 2EULA 3WL1A 1KFWA 1OGGA 2B5UB 3W4RA 1D6OA 1D7HA 1NMVA 3RFWA 3WL0A 4P8WA 1FKHA 2MLYA 1EHNA 2DT3A 2KR7A 3ARZA 3UF8A 1GRJA 2F2DA 3CHFA 1CTNA 4DWSC 4XAKA 4TW7A 3IHZA 1ZCNA 2ITKA 2PPOA 2ESCA 2PPNA 1FKIA 4DWSA 4Z2KA
chains in the Genus database with same CATH topology
2LGOA 1Q6IA 2WLYA 2DG3A 3WQVA 3ARSA 4Q22A 4WKFA 1FKGA 3PRDA 1NSGA 2ZQVA 4MPKA 2ZQUA 3G6LA 1BL4A 3O5JA 2M2AA 2LKNA 4L72B 4FN2A 3UQBA 2DPEA 5DIUA 4LAYA 1H0GA 4IT4A 1Q1CA 3FAPA 4BF8A 4NSBA 1GOIA 3ARPA 3B9DA 2DSZA 2ZR5A 1P5QA 1W1VA 4DZ3A 3TDBA 4IPXA 4KQZA 3QOKA 1Y0OA 2DG9A 2KFWA 5HW7A 3JYJA 5I98A 4LAWA 3IKDA 2PV1A 4J4OA 2MLXA 3ARWA 5HW8A 3B9AA 2RUQA 3KABA 5BXJA 1BKFA 2XP5A 1WAWA 4TW8A 2A3BA 4Z2LA 4QIBA 3CH9A 4W9OA 4ZPTR 5HBFA 1HKKA 4P8XA 1HJVA 1FKRA 1ZU8A 3OOBA 1ZL1A 3ARTA 5GQBA 5HTGA 3O5GA 1YW5A 2ZQTA 2PBCA 1ROTA 1EQ3A 2K8IA 2G41A 2WLZA 5DO2A 3KAIA 1QZ2A 1W26A 3BXWA 3WQWA 4W9PA 1A7XA 1PINA 1FD9A 4IQ2A 1ZK6A 3UQAA 1EIBA 2B31A 1T11A 3RM8A 4QZVB 1NH6A 4R0XA 4AY1A 5D75A 3OA5A 1NWRA 2AOSA 2UZ5A 1W1TA 3O5LA 3AS1A 2DSWA 1FKTA 2AWGA 1E15A 1FKSA 4JYSA 1LL4A 3AS0A 4L3NA 1XRVA 2KGJA 4ZPWR 3TC5A 4HARA 2RSEA 1E6NA 1Q6UA 3WD3A 4NZCA 3O5IA 4P8VA 3RM9A 1J4HA 4JFIA 3KAHA 1LJYA 2N87A 2OLHA 3ARUA 2FAPA 4FAPA 3JYMA 3PRAA 1E9LA 4LGXA 5DEZA 3WD1A 3RMEA 3H9RB 3CGMA 2A3CA 3JXVA 1F40A 4TNSA 1ZBCA 1SYTA 4MNKA 3PR9A 2DT0A 5HT1A 4Z2HA 1FJDA 1J6YA 2XPBA 1NMWA 5HW6A 1ROUA 3B7XA 4MSPA 3AROA 1JNSA 1LG2A 3NI6A 3CHDA 1RD6A 1SR0A 4DROA 1NWTA 1X6NA 1OGBA 2XP3A 5DIVA 4W5UA 2PV2A 2XP8A 1K9TA 3ARRA 2WK2A 2KO7A 1E6RA 2ZR6A 2D9FA 4DWSD 4KR0B 4DT4A 1FAPA 3O5EA 4HBEA 3PRBA 1W1PA 4IQCA 3NRKA 4ODRA 2MLZA 4W9QA 4U85A 1OWQA 2RUCA 2RURA 1W1YA 3B9EA 4MNMA 5JH8A 2G8ZA 3AQUA 4GIVA 4PTMA 2O92A 1ITXA 3O5PA 4DRMA 3VAWA 4IT6A 3WD0A 4ODLA 2A3AA 1D2KA 5DITA 3O5FA 1JNTA 2O9OA 3I6CA 1KT0A 2PV3A 3O5DA 1HKJA 5HUAA 4GGQA 3G6MA 1NWSA 2DSVA 3KCEA 4JFLA 4MNLA 4TW6A 5DF0A 1ZB5A 3O5KA 2RUDA 3FY1A 3ODKA 3IK8A 1UR9A 2FKEA 2Y78A 1HKMA 4Z2IA 1LL7A 1W9UA 2L2SA 3CHEA 3KACA 3ARXA 1U79A 4ODNA 5HWBA 3CGNA 4G2PA 4G50A 3B8SA 3NTPA 3WD4A 1FKFA 2XP6A 1Q6HA 1D7IA 2DT2A 2KI3A 1M5YA 1WNOA 1QPLA 2JZVA 1W9PA 3O5QA 2PPPA 3FXYA 1GUVA 3O5OA 1JNDA 2RQSA 2VCDA 1ZBWA 4MGVA 2ZR4A 4DRQA 1FKLA 1HXVA 1FFRA 4J4NA 3KADA 2LJ4A 5GPRA 1EYMA 1R9HA 1KT1A 1ZBKA 4JFMA 3PA7A 3UI4A 4WK9A 4JFJA 3AS2A 4LAXA 2YBTA 4ODPA 1FKJA 1FKKA 3RGCA 4ML4A 2DSUA 3UI6A 3WD2A 1HKIA 2PI6A 4QT2A 2FDMA 4C02B 4WKHA 3WKZA 2DT1A 2M08A 1GPFA 3CHCA 1XHGA 1FKDA 2DG4A 4ZS6A 1E6PA 1JNEA 1L1PA 3LUOA 4URIA 1W9VA 4HBOA 4JFKA 4ZPVR 1WB0A 2XP4A 3RM4A 4WJXA 4MAVA 2XP7A 4QT3A 1FFQA 4Q7NA 3GPKA 4MNJA 3WH0A 1PBKA 2XP9A 1E6ZA 1FKBA 1N1AA 4DWSB 2MF9A 4U86A 1QPFA 2Q5AA 4DZ2A 3UI5A 1J4IA 3EY6A 1D7JA 3ALFA 4ODMA 4DRNA 3MDYB 1HJXA 3IKGA 1J4RA 1VF8A 4DRJA 4TYOA 4Z2GA 1LG1A 2LPVA 4ODKA 3O5RA 5GPGA 4S3KA 3AS3A 4DRKA 4DH0A 1C9HA 4P8UA 5B8IC 4TX0A 4R5EA 4DIPA 1UR8A 2QF8A 2M1IA 2WM0A 3KAGA 4ODQA 3ARYA 2YBUA 1IX5A 1LQ0A 2A3EA 2ZQSA 2F4EA 5HKGA 4S3JA 1NWUA 1H0IA 4MTVA 4DRIA 1JVWA 1X6LA 3WIJA 4Z2JA 2MNTA 2OFNA 3KZ7A 1HJWA 4O2TA 3ALGA 4ITZA 2MPHA 4N19A 3KAFA 1B6CA 4WIWA 1YATA 4WKAA 3ARQA 2VN1A 4DRHA 3ARVA 3CZ8A 4NNRA 4U84A 3TCZA 3UQIA 5J6EA 1O6IA 2KE0A 1F8AB 2XPAA 2F21A 1LL6A 1ZBVA 2IF4A 1TFVA 2IUZA 3O5MA 5HWCA 4LAVA 4DRPA 4ODOA 1TCOC 1EDQA 3WL1A 1KFWA 1OGGA 3W4RA 1D6OA 1D7HA 1NMVA 3RFWA 3WL0A 4P8WA 1FKHA 2MLYA 1EHNA 2DT3A 2KR7A 3ARZA 3UF8A 2F2DA 3CHFA 1CTNA 4DWSC 4XAKA 4TW7A 3IHZA 1ZCNA 2ITKA 2PPOA 2ESCA 2PPNA 1FKIA 4DWSA 4Z2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKS A;  4ODM A;  4DRN A;  2LGO A;  3MDY B;  5DIT A;  4JYS A;  3O5F A;  1Q6I A;  2DG3 A;  1JNT A;  3IKG A;  1FKG A;  1J4R A;  1NSG A;  2KGJ A;  2ZQV A;  3I6C A;  3PRD A;  1KT0 A;  3TC5 A;  2RSE A;  2PV3 A;  4TYO A;  4DRJ A;  3O5D A;  2ZQU A;  5HUA A;  1BL4 A;  1Q6U A;  4GGQ A;  2LPV A;  3KCE A;  4JFL A;  4TW6 A;  4ODK A;  3O5J A;  3O5I A;  2M2A A;  5I98 A;  3O5R A;  5GPG A;  2LKN A;  3O5K A;  1D7J A;  2RUD A;  3ODK A;  4FN2 A;  3UQB A;  4DRK A;  3IK8 A;  1J4H A;  2FKE A;  4DH0 A;  2Y78 A;  4JFI A;  3KAH A;  5DIU A;  4LAY A;  2L2S A;  2N87 A;  1Q1C A;  3FAP A;  4BF8 A;  1C9H A;  3KAC A;  2FAP A;  4FAP A;  1U79 A;  3JYM A;  4ODN A;  4TX0 A;  5B8I C;  5HWB A;  3CGN A;  4DIP A;  4G2P A;  2ZR5 A;  4G50 A;  1P5Q A;  4DZ3 A;  3KAG A;  2M1I A;  3NTP A;  4ODQ A;  1FKF A;  3TDB A;  4IPX A;  2XP6 A;  5HW7 A;  1Y0O A;  2DG9 A;  2KFW A;  2ZQS A;  3H9R B;  1Q6H A;  3CGM A;  1D7I A;  2F4E A;  3JYJ A;  3JXV A;  2KI3 A;  1M5Y A;  3IKD A;  2PV1 A;  4LAW A;  1QPL A;  2JZV A;  4J4O A;  4TNS A;  2MLX A;  5HKG A;  1F40 A;  3O5Q A;  2PPP A;  5HW8 A;  3KAB A;  2RUQ A;  4W9O A;  5HT1 A;  1BKF A;  4DRI A;  5BXJ A;  2XP5 A;  1JVW A;  1FJD A;  4TW8 A;  1J6Y A;  3O5O A;  4QIB A;  2MNT A;  2OFN A;  2RQS A;  2VCD A;  3KZ7 A;  2XPB A;  2ZR4 A;  1NMW A;  4MGV A;  4ITZ A;  4O2T A;  4DRQ A;  2MPH A;  1FKL A;  1ROU A;  3B7X A;  4N19 A;  5HW6 A;  1HXV A;  4MSP A;  3KAF A;  1B6C A;  1YAT A;  4J4N A;  1JNS A;  3KAD A;  2LJ4 A;  1FKR A;  1EYM A;  1R9H A;  1KT1 A;  4JFM A;  3PA7 A;  3UI4 A;  2VN1 A;  4DRH A;  4JFJ A;  4NNR A;  3OOB A;  4U84 A;  3NI6 A;  4LAX A;  3TCZ A;  3UQI A;  5J6E A;  4ODP A;  4DRO A;  1FKJ A;  5HTG A;  1FKK A;  3RGC A;  2KE0 A;  3O5G A;  2XP3 A;  5DIV A;  1YW5 A;  2ZQT A;  2PBC A;  3UI6 A;  1F8A B;  1ROT A;  2PV2 A;  2XPA A;  2XP8 A;  1EQ3 A;  2F21 A;  2K8I A;  2IF4 A;  3O5M A;  5HWC A;  2KO7 A;  4QT2 A;  2ZR6 A;  4LAV A;  2D9F A;  4C02 B;  4DRP A;  3KAI A;  4ODO A;  1QZ2 A;  1TCO C;  4DT4 A;  1FAP A;  3O5E A;  1W26 A;  2M08 A;  4W9P A;  1A7X A;  1PIN A;  1FD9 A;  1FKD A;  2DG4 A;  4IQ2 A;  1ZK6 A;  3PRB A;  4IQC A;  3UQA A;  3LUO A;  1L1P A;  3NRK A;  4ODR A;  1D6O A;  4JFK A;  1D7H A;  1T11 A;  2MLZ A;  1NMV A;  4W9Q A;  2XP4 A;  4U85 A;  2RUC A;  3RFW A;  4R0X A;  2RUR A;  1FKH A;  2MLY A;  2KR7 A;  5D75 A;  2XP7 A;  4QT3 A;  3GPK A;  4GIV A;  2UZ5 A;  3UF8 A;  3WH0 A;  1PBK A;  2F2D A;  2XP9 A;  1FKB A;  3O5L A;  1N1A A;  4TW7 A;  3IHZ A;  1ZCN A;  2MF9 A;  2ITK A;  2PPO A;  1QPF A;  2Q5A A;  4U86 A;  3UI5 A;  1J4I A;  2PPN A;  1FKI A;  3O5P A;  4DRM A;  4DZ2 A;  3VAW A;  3EY6 A;  1FKT A;  2AWG A;  4ODL A; 
#chains in the Genus database with same CATH topology
 2LGO A;  1Q6I A;  2WLY A;  2DG3 A;  3WQV A;  3ARS A;  4Q22 A;  4WKF A;  1FKG A;  3PRD A;  1NSG A;  2ZQV A;  4MPK A;  2ZQU A;  3G6L A;  1BL4 A;  3O5J A;  2M2A A;  2LKN A;  4L72 B;  4FN2 A;  3UQB A;  2DPE A;  5DIU A;  4LAY A;  1H0G A;  4IT4 A;  1Q1C A;  3FAP A;  4BF8 A;  4NSB A;  1GOI A;  3ARP A;  3B9D A;  2DSZ A;  2ZR5 A;  1P5Q A;  1W1V A;  4DZ3 A;  3TDB A;  4IPX A;  4KQZ A;  3QOK A;  1Y0O A;  2DG9 A;  2KFW A;  5HW7 A;  3JYJ A;  5I98 A;  4LAW A;  3IKD A;  2PV1 A;  4J4O A;  2MLX A;  3ARW A;  5HW8 A;  3B9A A;  2RUQ A;  3KAB A;  5BXJ A;  1BKF A;  2XP5 A;  1WAW A;  4TW8 A;  2A3B A;  4Z2L A;  4QIB A;  3CH9 A;  4W9O A;  4ZPT R;  5HBF A;  1HKK A;  4P8X A;  1HJV A;  1FKR A;  1ZU8 A;  3OOB A;  1ZL1 A;  3ART A;  5GQB A;  5HTG A;  3O5G A;  1YW5 A;  2ZQT A;  2PBC A;  1ROT A;  1EQ3 A;  2K8I A;  2G41 A;  2WLZ A;  3EIP A;  5DO2 A;  3KAI A;  1QZ2 A;  1W26 A;  3BXW A;  3WQW A;  4W9P A;  1A7X A;  1PIN A;  1FD9 A;  4IQ2 A;  1ZK6 A;  3UQA A;  1EIB A;  2B31 A;  1T11 A;  3RM8 A;  4QZV B;  1NH6 A;  4R0X A;  4AY1 A;  2F23 A;  5D75 A;  3OA5 A;  1NWR A;  2AOS A;  2UZ5 A;  1W1T A;  3O5L A;  3GTY X;  3AS1 A;  2DSW A;  1FKT A;  2AWG A;  1E15 A;  1FKS A;  4JYS A;  1LL4 A;  3AS0 A;  4L3N A;  1XRV A;  2KGJ A;  4ZPW R;  3TC5 A;  4HAR A;  2RSE A;  1E6N A;  1Q6U A;  3WD3 A;  4NZC A;  3O5I A;  4P8V A;  3RM9 A;  1J4H A;  4JFI A;  3KAH A;  1LJY A;  2N87 A;  2OLH A;  3ARU A;  2FAP A;  4FAP A;  3JYM A;  3PRA A;  1E9L A;  4LGX A;  5DEZ A;  3WD1 A;  3RME A;  3H9R B;  3CGM A;  2A3C A;  3JXV A;  1F40 A;  4TNS A;  1ZBC A;  1SYT A;  4MNK A;  3PR9 A;  2DT0 A;  5HT1 A;  4Z2H A;  1FJD A;  1J6Y A;  2XPB A;  1NMW A;  5HW6 A;  1ROU A;  3B7X A;  4MSP A;  3ARO A;  1JNS A;  1LG2 A;  3NI6 A;  3CHD A;  1RD6 A;  1SR0 A;  3BMB A;  4DRO A;  1NWT A;  1X6N A;  1OGB A;  2XP3 A;  5DIV A;  4W5U A;  2PV2 A;  2XP8 A;  1K9T A;  3ARR A;  2WK2 A;  2KO7 A;  1E6R A;  2ZR6 A;  2D9F A;  4DWS D;  4KR0 B;  4DT4 A;  1FAP A;  3O5E A;  1E44 A;  4HBE A;  3PRB A;  1W1P A;  4IQC A;  3NRK A;  4ODR A;  2MLZ A;  4W9Q A;  4U85 A;  1OWQ A;  2RUC A;  2RUR A;  1W1Y A;  3B9E A;  4MNM A;  5JH8 A;  2G8Z A;  3AQU A;  4GIV A;  4PTM A;  2O92 A;  1ITX A;  3O5P A;  4DRM A;  3VAW A;  4IT6 A;  3WD0 A;  4ODL A;  2A3A A;  1D2K A;  5DIT A;  3O5F A;  1JNT A;  2O9O A;  3I6C A;  1KT0 A;  2PV3 A;  3O5D A;  1HKJ A;  5HUA A;  4GGQ A;  3G6M A;  1NWS A;  2DSV A;  3KCE A;  4JFL A;  4MNL A;  4TW6 A;  5DF0 A;  1ZB5 A;  4UDM A;  3O5K A;  2RUD A;  3FY1 A;  3ODK A;  3IK8 A;  1UR9 A;  2FKE A;  2Y78 A;  1HKM A;  4Z2I A;  1LL7 A;  1W9U A;  2L2S A;  3CHE A;  3KAC A;  3ARX A;  1U79 A;  4ODN A;  5HWB A;  3CGN A;  4G2P A;  4G50 A;  3B8S A;  3NTP A;  3WD4 A;  1FKF A;  2XP6 A;  1Q6H A;  1D7I A;  2DT2 A;  2KI3 A;  1M5Y A;  1WNO A;  1QPL A;  2JZV A;  1W9P A;  3O5Q A;  2PPP A;  3GU0 A;  3FXY A;  1GUV A;  3O5O A;  1JND A;  2RQS A;  2VCD A;  1ZBW A;  4MGV A;  2ZR4 A;  4DRQ A;  1FKL A;  1HXV A;  1FFR A;  4J4N A;  3KAD A;  2LJ4 A;  5GPR A;  1EYM A;  1R9H A;  1KT1 A;  1ZBK A;  4JFM A;  3PA7 A;  3UI4 A;  4WK9 A;  4JFJ A;  2ETN A;  3AS2 A;  4LAX A;  2YBT A;  4ODP A;  1FKJ A;  1FKK A;  3RGC A;  4ML4 A;  2DSU A;  3UI6 A;  3WD2 A;  1HKI A;  2PI6 A;  4QT2 A;  2FDM A;  4C02 B;  4WKH A;  3WKZ A;  2DT1 A;  2M08 A;  1GPF A;  3CHC A;  1XHG A;  1FKD A;  2DG4 A;  4ZS6 A;  1E6P A;  1JNE A;  1L1P A;  3LUO A;  4URI A;  1W9V A;  4HBO A;  4JFK A;  4ZPV R;  1WB0 A;  2XP4 A;  3RM4 A;  4WJX A;  4MAV A;  2XP7 A;  4QT3 A;  1FFQ A;  4Q7N A;  3GPK A;  4MNJ A;  3WH0 A;  1PBK A;  2XP9 A;  1E6Z A;  1FKB A;  1N1A A;  4DWS B;  2MF9 A;  4U86 A;  1QPF A;  2Q5A A;  4DZ2 A;  3UI5 A;  1J4I A;  3EY6 A;  1D7J A;  3ALF A;  4ODM A;  4DRN A;  3MDY B;  1HJX A;  3IKG A;  1J4R A;  1VF8 A;  4DRJ A;  4TYO A;  4Z2G A;  1LG1 A;  2LPV A;  4ODK A;  3O5R A;  5GPG A;  4S3K A;  3AS3 A;  4DRK A;  2PN0 A;  4DH0 A;  2P4V A;  1C9H A;  4P8U A;  5B8I C;  4TX0 A;  4R5E A;  4DIP A;  1UR8 A;  2QF8 A;  2M1I A;  2WM0 A;  3KAG A;  4ODQ A;  3ARY A;  2YBU A;  1IX5 A;  1LQ0 A;  2A3E A;  2ZQS A;  2F4E A;  5HKG A;  4S3J A;  1NWU A;  1H0I A;  4MTV A;  4DRI A;  1JVW A;  1X6L A;  3WIJ A;  4Z2J A;  2MNT A;  2OFN A;  3KZ7 A;  1HJW A;  4O2T A;  3ALG A;  4ITZ A;  2MPH A;  4N19 A;  3KAF A;  1B6C A;  4WIW A;  1YAT A;  4WKA A;  3ARQ A;  2VN1 A;  4DRH A;  3ARV A;  3CZ8 A;  4NNR A;  4U84 A;  3TCZ A;  3UQI A;  5J6E A;  1O6I A;  1JCH B;  2KE0 A;  1F8A B;  2XPA A;  2F21 A;  1LL6 A;  1ZBV A;  2IF4 A;  1TFV A;  2IUZ A;  3O5M A;  5HWC A;  4LAV A;  4DRP A;  4ODO A;  1TCO C;  1EDQ A;  2EUL A;  3WL1 A;  1KFW A;  1OGG A;  2B5U B;  3W4R A;  1D6O A;  1D7H A;  1NMV A;  3RFW A;  3WL0 A;  4P8W A;  1FKH A;  2MLY A;  1EHN A;  2DT3 A;  2KR7 A;  3ARZ A;  3UF8 A;  1GRJ A;  2F2D A;  3CHF A;  1CTN A;  4DWS C;  4XAK A;  4TW7 A;  3IHZ A;  1ZCN A;  2ITK A;  2PPO A;  2ESC A;  2PPN A;  1FKI A;  4DWS A;  4Z2K A; 
#chains in the Genus database with same CATH homology
 2LGO A;  1Q6I A;  2WLY A;  2DG3 A;  3WQV A;  3ARS A;  4Q22 A;  4WKF A;  1FKG A;  3PRD A;  1NSG A;  2ZQV A;  4MPK A;  2ZQU A;  3G6L A;  1BL4 A;  3O5J A;  2M2A A;  2LKN A;  4L72 B;  4FN2 A;  3UQB A;  2DPE A;  5DIU A;  4LAY A;  1H0G A;  4IT4 A;  1Q1C A;  3FAP A;  4BF8 A;  4NSB A;  1GOI A;  3ARP A;  3B9D A;  2DSZ A;  2ZR5 A;  1P5Q A;  1W1V A;  4DZ3 A;  3TDB A;  4IPX A;  4KQZ A;  3QOK A;  1Y0O A;  2DG9 A;  2KFW A;  5HW7 A;  3JYJ A;  5I98 A;  4LAW A;  3IKD A;  2PV1 A;  4J4O A;  2MLX A;  3ARW A;  5HW8 A;  3B9A A;  2RUQ A;  3KAB A;  5BXJ A;  1BKF A;  2XP5 A;  1WAW A;  4TW8 A;  2A3B A;  4Z2L A;  4QIB A;  3CH9 A;  4W9O A;  4ZPT R;  5HBF A;  1HKK A;  4P8X A;  1HJV A;  1FKR A;  1ZU8 A;  3OOB A;  1ZL1 A;  3ART A;  5GQB A;  5HTG A;  3O5G A;  1YW5 A;  2ZQT A;  2PBC A;  1ROT A;  1EQ3 A;  2K8I A;  2G41 A;  2WLZ A;  5DO2 A;  3KAI A;  1QZ2 A;  1W26 A;  3BXW A;  3WQW A;  4W9P A;  1A7X A;  1PIN A;  1FD9 A;  4IQ2 A;  1ZK6 A;  3UQA A;  1EIB A;  2B31 A;  1T11 A;  3RM8 A;  4QZV B;  1NH6 A;  4R0X A;  4AY1 A;  5D75 A;  3OA5 A;  1NWR A;  2AOS A;  2UZ5 A;  1W1T A;  3O5L A;  3AS1 A;  2DSW A;  1FKT A;  2AWG A;  1E15 A;  1FKS A;  4JYS A;  1LL4 A;  3AS0 A;  4L3N A;  1XRV A;  2KGJ A;  4ZPW R;  3TC5 A;  4HAR A;  2RSE A;  1E6N A;  1Q6U A;  3WD3 A;  4NZC A;  3O5I A;  4P8V A;  3RM9 A;  1J4H A;  4JFI A;  3KAH A;  1LJY A;  2N87 A;  2OLH A;  3ARU A;  2FAP A;  4FAP A;  3JYM A;  3PRA A;  1E9L A;  4LGX A;  5DEZ A;  3WD1 A;  3RME A;  3H9R B;  3CGM A;  2A3C A;  3JXV A;  1F40 A;  4TNS A;  1ZBC A;  1SYT A;  4MNK A;  3PR9 A;  2DT0 A;  5HT1 A;  4Z2H A;  1FJD A;  1J6Y A;  2XPB A;  1NMW A;  5HW6 A;  1ROU A;  3B7X A;  4MSP A;  3ARO A;  1JNS A;  1LG2 A;  3NI6 A;  3CHD A;  1RD6 A;  1SR0 A;  4DRO A;  1NWT A;  1X6N A;  1OGB A;  2XP3 A;  5DIV A;  4W5U A;  2PV2 A;  2XP8 A;  1K9T A;  3ARR A;  2WK2 A;  2KO7 A;  1E6R A;  2ZR6 A;  2D9F A;  4DWS D;  4KR0 B;  4DT4 A;  1FAP A;  3O5E A;  4HBE A;  3PRB A;  1W1P A;  4IQC A;  3NRK A;  4ODR A;  2MLZ A;  4W9Q A;  4U85 A;  1OWQ A;  2RUC A;  2RUR A;  1W1Y A;  3B9E A;  4MNM A;  5JH8 A;  2G8Z A;  3AQU A;  4GIV A;  4PTM A;  2O92 A;  1ITX A;  3O5P A;  4DRM A;  3VAW A;  4IT6 A;  3WD0 A;  4ODL A;  2A3A A;  1D2K A;  5DIT A;  3O5F A;  1JNT A;  2O9O A;  3I6C A;  1KT0 A;  2PV3 A;  3O5D A;  1HKJ A;  5HUA A;  4GGQ A;  3G6M A;  1NWS A;  2DSV A;  3KCE A;  4JFL A;  4MNL A;  4TW6 A;  5DF0 A;  1ZB5 A;  3O5K A;  2RUD A;  3FY1 A;  3ODK A;  3IK8 A;  1UR9 A;  2FKE A;  2Y78 A;  1HKM A;  4Z2I A;  1LL7 A;  1W9U A;  2L2S A;  3CHE A;  3KAC A;  3ARX A;  1U79 A;  4ODN A;  5HWB A;  3CGN A;  4G2P A;  4G50 A;  3B8S A;  3NTP A;  3WD4 A;  1FKF A;  2XP6 A;  1Q6H A;  1D7I A;  2DT2 A;  2KI3 A;  1M5Y A;  1WNO A;  1QPL A;  2JZV A;  1W9P A;  3O5Q A;  2PPP A;  3FXY A;  1GUV A;  3O5O A;  1JND A;  2RQS A;  2VCD A;  1ZBW A;  4MGV A;  2ZR4 A;  4DRQ A;  1FKL A;  1HXV A;  1FFR A;  4J4N A;  3KAD A;  2LJ4 A;  5GPR A;  1EYM A;  1R9H A;  1KT1 A;  1ZBK A;  4JFM A;  3PA7 A;  3UI4 A;  4WK9 A;  4JFJ A;  3AS2 A;  4LAX A;  2YBT A;  4ODP A;  1FKJ A;  1FKK A;  3RGC A;  4ML4 A;  2DSU A;  3UI6 A;  3WD2 A;  1HKI A;  2PI6 A;  4QT2 A;  2FDM A;  4C02 B;  4WKH A;  3WKZ A;  2DT1 A;  2M08 A;  1GPF A;  3CHC A;  1XHG A;  1FKD A;  2DG4 A;  4ZS6 A;  1E6P A;  1JNE A;  1L1P A;  3LUO A;  4URI A;  1W9V A;  4HBO A;  4JFK A;  4ZPV R;  1WB0 A;  2XP4 A;  3RM4 A;  4WJX A;  4MAV A;  2XP7 A;  4QT3 A;  1FFQ A;  4Q7N A;  3GPK A;  4MNJ A;  3WH0 A;  1PBK A;  2XP9 A;  1E6Z A;  1FKB A;  1N1A A;  4DWS B;  2MF9 A;  4U86 A;  1QPF A;  2Q5A A;  4DZ2 A;  3UI5 A;  1J4I A;  3EY6 A;  1D7J A;  3ALF A;  4ODM A;  4DRN A;  3MDY B;  1HJX A;  3IKG A;  1J4R A;  1VF8 A;  4DRJ A;  4TYO A;  4Z2G A;  1LG1 A;  2LPV A;  4ODK A;  3O5R A;  5GPG A;  4S3K A;  3AS3 A;  4DRK A;  4DH0 A;  1C9H A;  4P8U A;  5B8I C;  4TX0 A;  4R5E A;  4DIP A;  1UR8 A;  2QF8 A;  2M1I A;  2WM0 A;  3KAG A;  4ODQ A;  3ARY A;  2YBU A;  1IX5 A;  1LQ0 A;  2A3E A;  2ZQS A;  2F4E A;  5HKG A;  4S3J A;  1NWU A;  1H0I A;  4MTV A;  4DRI A;  1JVW A;  1X6L A;  3WIJ A;  4Z2J A;  2MNT A;  2OFN A;  3KZ7 A;  1HJW A;  4O2T A;  3ALG A;  4ITZ A;  2MPH A;  4N19 A;  3KAF A;  1B6C A;  4WIW A;  1YAT A;  4WKA A;  3ARQ A;  2VN1 A;  4DRH A;  3ARV A;  3CZ8 A;  4NNR A;  4U84 A;  3TCZ A;  3UQI A;  5J6E A;  1O6I A;  2KE0 A;  1F8A B;  2XPA A;  2F21 A;  1LL6 A;  1ZBV A;  2IF4 A;  1TFV A;  2IUZ A;  3O5M A;  5HWC A;  4LAV A;  4DRP A;  4ODO A;  1TCO C;  1EDQ A;  3WL1 A;  1KFW A;  1OGG A;  3W4R A;  1D6O A;  1D7H A;  1NMV A;  3RFW A;  3WL0 A;  4P8W A;  1FKH A;  2MLY A;  1EHN A;  2DT3 A;  2KR7 A;  3ARZ A;  3UF8 A;  2F2D A;  3CHF A;  1CTN A;  4DWS C;  4XAK A;  4TW7 A;  3IHZ A;  1ZCN A;  2ITK A;  2PPO A;  2ESC A;  2PPN A;  1FKI A;  4DWS A;  4Z2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...