3O5EA

Fk1 domain of fkbp51, crystal form vi
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
SPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5eA00
3O5LA 4JFKA 1F40A 4DZ3A 1FKSA 2DG9A 2LGOA 1FD9A 4J4OA 1Q1CA 4DRNA 4JFJA 4MSPA 4TW8A 4W9PA 4LAYA 4ODLA 4LAVA 5HT1A 1FKKA 2MLZA 1U79A 2AWGA 3RFWA 2ZQSA 2ZQTA 4ODKA 3IK8A 3O5EA 3UQBA 4ITZA 5HWCA 3O5GA 1J4HA 2DG3A 3KADA 4ODOA 1JNTA 5DITA 4FAPA 2PPNA 1D6OA 4DRQA 5BXJA 2MF9A 3B7XA 1FKIA 1KT1A 1FKJA 4DRKA 1NSGA 1BKFA 2F4EA 3JYMA 2JZVA 4DRMA 4ODNA 3WH0A 4DRJA 4DRIA 2ITKA 2DG4A 2KI3A 4G2PA 2F21A 4W9QA 1FKHA 1FJDA 2M1IA 1BL4A 1D7HA 5GPGA 1P5QA 3H9RB 2PV2A 2MLXA 5D75A 1YATA 4C02B 1N1AA 1ZK6A 4LAWA 4TW6A 2PPPA 2FAPA 1HXVA 5HW8A 5DIVA 5B8IC 4DH0A 2KFWA 2IF4A 3MDYB 3KAIA 4TNSA 2PV3A 2LKNA 2XP5A 5DIUA 3PRBA 2XP8A 3PRDA 1EYMA 3KACA 4FN2A 4N19A 1NMVA 4LAXA 3KABA 2ZR4A 2ZR6A 3KAFA 3FAPA 4O2TA 2UZ5A 3CGNA 3O5OA 2XPAA 3IKDA 4ODPA 2XP6A 2MPHA 1QZ2A 5HW7A 3NRKA 2RUQA 1T11A 1Q6IA 3UI5A 3VAWA 3UQIA 3I6CA 1J4IA 3PA7A 4ODQA 2PBCA 3NI6A 1FKFA 1B6CA 1PBKA 2XPBA 4ODRA 1FKLA 2KE0A 1J4RA 3RGCA 2PPOA 1FKDA 4TYOA 5I98A 5J6EA 1FKRA 4GGQA 1L1PA 4GIVA 4U85A 3O5FA 3TCZA 4JFLA 4QT2A 2VCDA 1FKBA 2ZQUA 4DZ2A 3CGMA 3UQAA 2D9FA 3O5PA 4ODMA 2XP9A 1ROUA 1EQ3A 1A7XA 2RSEA 3ODKA 1D7JA 4JFMA 1C9HA 2RUCA 2LJ4A 4J4NA 2LPVA 3KAHA 3O5KA 4QIBA 2PV1A 4IQCA 1TCOC 1FAPA 4JFIA 3UI4A 4QT3A 2KO7A 2F2DA 3IHZA 5HWBA 3TC5A 3OOBA 3TDBA 2ZR5A 1D7IA 5HUAA 2N87A 2XP3A 4TW7A 4TX0A 2XP7A 2RURA 1R9HA 1QPFA 2MLYA 3KZ7A 2XP4A 3O5MA 3GPKA 2RQSA 3KAGA 1JNSA 1FKGA 1J6YA 1JVWA 2FKEA 3EY6A 2KGJA 3O5IA 3O5RA 3KCEA 1Q6UA 3O5QA 2M2AA 4IPXA 4DRPA 4MGVA 1FKTA 1Y0OA 4JYSA 5HKGA 4BF8A 3O5DA 1W26A 2KR7A 3JXVA 4W9OA 4U86A 4NNRA 4G50A 1ZCNA 3O5JA 4U84A 4DIPA 4DROA 2OFNA 5HTGA 1F8AB 4DRHA 1M5YA 3IKGA 2RUDA 1PINA 3JYJA 3LUOA 2VN1A 1Q6HA 5HW6A 1ROTA 1YW5A 2M08A 2MNTA 2ZQVA 2L2SA 1KT0A 4R0XA 2K8IA 3UF8A 1NMWA 2Y78A 3NTPA 3UI6A 4DT4A 4IQ2A 1QPLA 2Q5AA
chains in the Genus database with same CATH superfamily
1EHNA 2DSVA 4XAKA 2LGOA 2WLYA 4DRNA 3ARTA 2DSZA 4R5EA 1X6LA 3KADA 4ODOA 3RMEA 2MF9A 3ALFA 3B7XA 1FKIA 1CTNA 1FKJA 4WK9A 2F4EA 2IUZA 4DRMA 4ODNA 4ZPTR 4MNLA 3PRAA 1BL4A 1YATA 4TW6A 4P8VA 5B8IC 4DH0A 3PRBA 2WK2A 1EYMA 3KACA 1E6NA 1NMVA 4LAXA 1UR8A 3KABA 2ZR4A 3ARSA 4O2TA 4MNJA 2DPEA 1QZ2A 4S3KA 3ARQA 1Q6IA 1E6PA 3I6CA 3NI6A 1FKFA 3RGCA 1FKLA 1FKDA 4TYOA 1HKMA 1RD6A 4Z2IA 5I98A 3WD0A 4GIVA 4QT2A 2G8ZA 4DZ2A 1VF8A 2D9FA 4ODMA 3ODKA 1D7JA 2RUCA 3W4RA 2LJ4A 3O5KA 4IQCA 1OGBA 4WJXA 4MTVA 4HBOA 3QOKA 1LL7A 2ZR5A 5HUAA 2MLYA 4LGXA 1E6RA 3O5MA 1JNSA 1ZBKA 4W5UA 1J6YA 2FKEA 3EY6A 1Q6UA 3O5QA 2M2AA 3FY1A 4L3NA 1NH6A 1XRVA 4BF8A 3CHFA 1JNEA 3ARWA 4DRHA 1M5YA 3G6MA 1PINA 1HJVA 3JYJA 2VN1A 1ROTA 2DSWA 3ARPA 2MNTA 1KT0A 1LL6A 1NMWA 4IQ2A 3CH9A 2Q5AA 5HTGA 3ARUA 4Z2LA 2P4VA 1Q1CA 4J4OA 1HJXA 4TW8A 4W9PA 5DEZA 4L72B 1U79A 1UR9A 2A3BA 4QZVB 4FAPA 5DITA 1D6OA 1E15A 1KT1A 4Q22A 4MNMA 3BMBA 2M1IA 1WB0A 2PV2A 2MLXA 5D75A 4Q7NA 3WD2A 3AS1A 2WLZA 5DIVA 5HBFA 1ZL1A 2IF4A 2PV3A 5DIUA 4FN2A 4WIWA 3AS2A 5DF0A 3KAFA 3UI6A 3O5OA 5DO2A 4AY1A 2XP6A 3NRKA 4IT6A 1ZU8A 3UQIA 4DWSC 2PBCA 4ODRA 3CZ8A 1FKRA 3RM8A 4NZCA 4JFLA 4WKFA 2VCDA 2ZQUA 1EQ3A 1LQ0A 2RSEA 4JFMA 4QIBA 1GRJA 3IHZA 2F2DA 2G41A 3TC5A 3OOBA 4ZS6A 4KR0B 4TX0A 2RURA 1QPFA 2O9OA 2OLHA 1LL4A 3RM9A 1JVWA 3ARVA 3PR9A 2KGJA 3KCEA 1EIBA 4MGVA 1Y0OA 5HKGA 3O5DA 2KR7A 1LG1A 1ITXA 4DIPA 2FDMA 2OFNA 3WL0A 2RUDA 1IX5A 3LUOA 4MAVA 1Q6HA 3WQVA 2L2SA 1ZBWA 4R0XA 2K8IA 2Y78A 4ZPVR 2O92A 1LJYA 1QPLA 1JCHB 4P8UA 1W9VA 3WQWA 1JNDA 4Z2JA 4Z2GA 1FD9A 1NWSA 1ZB5A 1X6NA 4MSPA 1GOIA 4WKAA 4ODLA 2ETNA 4LAVA 3RFWA 1HKIA 2ZQTA 4ODKA 1K9TA 4ITZA 2DG3A 1JNTA 2PPNA 4S3JA 3AS0A 1BKFA 4Z2HA 3WH0A 4DRIA 2DG4A 4KQZA 2DT0A 1NWTA 3EIPA 1FJDA 3WD4A 3H9RB 5GQBA 4C02B 1ZK6A 4LAWA 1HXVA 2FAPA 5HW8A 2YBTA 2LKNA 1HKJA 2XP5A 1GPFA 2XP8A 3PRDA 3GU0A 2ZR6A 3FAPA 2UZ5A 3CGNA 3B9AA 3IKDA 1KFWA 2A3AA 1E9LA 3VAWA 1PBKA 2XPBA 4HARA 2PPOA 5J6EA 4GGQA 1EDQA 1LG2A 3TCZA 2QF8A 1FKBA 3UQAA 4IT4A 1ROUA 4UDMA 1A7XA 1C9HA 2F23A 2LPVA 3KAHA 1TCOC 4JFIA 3UI4A 1WAWA 4QT3A 2KO7A 4NSBA 3TDBA 2DT3A 1D7IA 2N87A 1W1PA 2RQSA 3KAGA 1NWUA 1SYTA 1TFVA 2EULA 3O5RA 1W1VA 4P8XA 2PI6A 4MPKA 4JYSA 1HJWA 1W26A 3JXVA 4W9OA 4NNRA 1ZCNA 3O5JA 2YBUA 1H0GA 3AQUA 1WNOA 5HW6A 1W1TA 1YW5A 1NWRA 3GTYX 3NTPA 1F40A 2A3EA 3RM4A 3O5LA 3BXWA 4JFKA 4DZ3A 2DSUA 1FKSA 2DG9A 4WKHA 5GPRA 4JFJA 2DT1A 4DWSD 4LAYA 5HT1A 3B9EA 3CHEA 3OA5A 1FKKA 2MLZA 2AWGA 2ZQSA 3UQBA 3IK8A 3O5EA 5HWCA 3O5GA 1J4HA 4HBEA 1ZBCA 4DRQA 5BXJA 4PTMA 3CHCA 4DRKA 1NSGA 3JYMA 2JZVA 4DRJA 4Z2KA 2ITKA 2KI3A 4G2PA 2F21A 4W9QA 1FKHA 3B8SA 1D7HA 5GPGA 1P5QA 1SR0A 1N1AA 2PPPA 1XHGA 2KFWA 3ALGA 3MDYB 2DT2A 3KAIA 4TNSA 2B31A 2B5UB 4URIA 2A3CA 4N19A 3AROA 4ODPA 3WKZA 2XPAA 4DWSB 3WIJA 2MPHA 5HW7A 2RUQA 3ARYA 1T11A 1ZBVA 3UI5A 4DWSA 1J4IA 3PA7A 4ODQA 1B6CA 3WL1A 1OWQA 1HKKA 2KE0A 1J4RA 1L1PA 1E6ZA 1GUVA 1FFRA 1E44A 5JH8A 4U85A 3O5FA 1W9PA 1FFQA 3CGMA 4P8WA 3O5PA 2AOSA 4J4NA 2PV1A 3FXYA 1FAPA 3ARRA 5HWBA 3AS3A 1D2KA 4ML4A 3WD3A 2XP3A 4TW7A 2XP7A 2ESCA 1R9HA 1W1YA 3KZ7A 2XP4A 2WM0A 3GPKA 1FKGA 3O5IA 4DRPA 4IPXA 1O6IA 3ARZA 1FKTA 1H0IA 4U86A 3CHDA 4G50A 4U84A 1OGGA 4DROA 1F8AB 3ARXA 3IKGA 4ZPWR 3B9DA 1W9UA 3WD1A 2M08A 2PN0A 4MNKA 2ZQVA 3G6LA 3UF8A 4DT4A 2XP9A
chains in the Genus database with same CATH topology
1EHNA 2DSVA 4XAKA 2LGOA 2WLYA 4DRNA 3ARTA 2DSZA 4R5EA 1X6LA 3KADA 4ODOA 3RMEA 2MF9A 3ALFA 3B7XA 1FKIA 1CTNA 1FKJA 4WK9A 2F4EA 2IUZA 4DRMA 4ODNA 4ZPTR 4MNLA 3PRAA 1BL4A 1YATA 4TW6A 4P8VA 5B8IC 4DH0A 3PRBA 2WK2A 1EYMA 3KACA 1E6NA 1NMVA 4LAXA 1UR8A 3KABA 2ZR4A 3ARSA 4O2TA 4MNJA 2DPEA 1QZ2A 4S3KA 3ARQA 1Q6IA 1E6PA 3I6CA 3NI6A 1FKFA 3RGCA 1FKLA 1FKDA 4TYOA 1HKMA 1RD6A 4Z2IA 5I98A 3WD0A 4GIVA 4QT2A 2G8ZA 4DZ2A 1VF8A 2D9FA 4ODMA 3ODKA 1D7JA 2RUCA 3W4RA 2LJ4A 3O5KA 4IQCA 1OGBA 4WJXA 4MTVA 4HBOA 3QOKA 1LL7A 2ZR5A 5HUAA 2MLYA 4LGXA 1E6RA 3O5MA 1JNSA 1ZBKA 4W5UA 1J6YA 2FKEA 3EY6A 1Q6UA 3O5QA 2M2AA 3FY1A 4L3NA 1NH6A 1XRVA 4BF8A 3CHFA 1JNEA 3ARWA 4DRHA 1M5YA 3G6MA 1PINA 1HJVA 3JYJA 2VN1A 1ROTA 2DSWA 3ARPA 2MNTA 1KT0A 1LL6A 1NMWA 4IQ2A 3CH9A 2Q5AA 5HTGA 3ARUA 4Z2LA 4J4OA 1Q1CA 1HJXA 4TW8A 4W9PA 5DEZA 4L72B 1U79A 1UR9A 2A3BA 4QZVB 4FAPA 5DITA 1D6OA 1E15A 1KT1A 4Q22A 4MNMA 2M1IA 1WB0A 2PV2A 2MLXA 5D75A 4Q7NA 3WD2A 3AS1A 2WLZA 5DIVA 5HBFA 1ZL1A 2IF4A 2PV3A 5DIUA 4FN2A 4WIWA 3AS2A 5DF0A 3KAFA 3UI6A 3O5OA 5DO2A 4AY1A 2XP6A 3NRKA 4IT6A 1ZU8A 3UQIA 4DWSC 2PBCA 4ODRA 3CZ8A 1FKRA 3RM8A 4NZCA 4JFLA 4WKFA 2VCDA 2ZQUA 1EQ3A 1LQ0A 2RSEA 4JFMA 4QIBA 3IHZA 2F2DA 2G41A 3TC5A 3OOBA 4ZS6A 4KR0B 4TX0A 2RURA 1QPFA 2O9OA 2OLHA 1LL4A 3RM9A 1JVWA 3ARVA 3PR9A 2KGJA 3KCEA 1EIBA 4MGVA 1Y0OA 5HKGA 3O5DA 2KR7A 1LG1A 1ITXA 4DIPA 2FDMA 2OFNA 3WL0A 2RUDA 1IX5A 3LUOA 4MAVA 1Q6HA 3WQVA 2L2SA 1ZBWA 4R0XA 2K8IA 2Y78A 4ZPVR 2O92A 1LJYA 1QPLA 4P8UA 1W9VA 3WQWA 1JNDA 4Z2JA 4Z2GA 1FD9A 1NWSA 1ZB5A 1X6NA 4MSPA 1GOIA 4WKAA 4ODLA 4LAVA 3RFWA 1HKIA 2ZQTA 4ODKA 1K9TA 4ITZA 2DG3A 1JNTA 2PPNA 4S3JA 3AS0A 1BKFA 4Z2HA 3WH0A 4DRIA 2DG4A 4KQZA 2DT0A 1NWTA 1FJDA 3WD4A 3H9RB 5GQBA 4C02B 1ZK6A 4LAWA 1HXVA 2FAPA 5HW8A 2YBTA 2LKNA 1HKJA 2XP5A 1GPFA 2XP8A 3PRDA 2ZR6A 3FAPA 2UZ5A 3CGNA 3B9AA 3IKDA 1KFWA 2A3AA 1E9LA 3VAWA 1PBKA 2XPBA 4HARA 2PPOA 5J6EA 4GGQA 1EDQA 1LG2A 3TCZA 2QF8A 1FKBA 3UQAA 4IT4A 1ROUA 1A7XA 1C9HA 2LPVA 3KAHA 1TCOC 4JFIA 3UI4A 1WAWA 4QT3A 2KO7A 4NSBA 3TDBA 2DT3A 1D7IA 2N87A 1W1PA 2RQSA 3KAGA 1NWUA 1SYTA 1TFVA 3O5RA 1W1VA 4P8XA 2PI6A 4MPKA 4JYSA 1HJWA 1W26A 3JXVA 4W9OA 4NNRA 1ZCNA 3O5JA 2YBUA 1H0GA 3AQUA 1WNOA 5HW6A 1W1TA 1YW5A 1NWRA 3NTPA 1F40A 2A3EA 3RM4A 3O5LA 3BXWA 4JFKA 4DZ3A 2DSUA 1FKSA 2DG9A 4WKHA 5GPRA 4JFJA 2DT1A 4DWSD 4LAYA 5HT1A 3B9EA 3CHEA 3OA5A 1FKKA 2MLZA 2AWGA 2ZQSA 3UQBA 3IK8A 3O5EA 5HWCA 3O5GA 1J4HA 4HBEA 1ZBCA 4DRQA 5BXJA 4PTMA 3CHCA 4DRKA 1NSGA 3JYMA 2JZVA 4DRJA 4Z2KA 2ITKA 2KI3A 4G2PA 2F21A 4W9QA 1FKHA 3B8SA 1D7HA 5GPGA 1P5QA 1SR0A 1N1AA 2PPPA 1XHGA 2KFWA 3ALGA 3MDYB 2DT2A 3KAIA 4TNSA 2B31A 4URIA 2A3CA 4N19A 3AROA 4ODPA 3WKZA 2XPAA 4DWSB 3WIJA 2MPHA 5HW7A 2RUQA 3ARYA 1T11A 1ZBVA 3UI5A 4DWSA 1J4IA 3PA7A 4ODQA 1B6CA 3WL1A 1OWQA 1HKKA 2KE0A 1J4RA 1L1PA 1E6ZA 1GUVA 1FFRA 5JH8A 4U85A 3O5FA 1W9PA 1FFQA 3CGMA 4P8WA 3O5PA 2AOSA 4J4NA 2PV1A 3FXYA 1FAPA 3ARRA 5HWBA 3AS3A 1D2KA 4ML4A 3WD3A 2XP3A 4TW7A 2XP7A 2ESCA 1R9HA 1W1YA 3KZ7A 2XP4A 2WM0A 3GPKA 1FKGA 3O5IA 4DRPA 4IPXA 1O6IA 3ARZA 1FKTA 1H0IA 4U86A 3CHDA 4G50A 4U84A 1OGGA 4DROA 1F8AB 3ARXA 3IKGA 4ZPWR 3B9DA 1W9UA 3WD1A 2M08A 4MNKA 2ZQVA 3G6LA 3UF8A 4DT4A 2XP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5L A;  4JFK A;  1F40 A;  4DZ3 A;  1FKS A;  2DG9 A;  2LGO A;  1FD9 A;  4J4O A;  1Q1C A;  4DRN A;  4JFJ A;  4MSP A;  4TW8 A;  4W9P A;  4LAY A;  4ODL A;  4LAV A;  5HT1 A;  1FKK A;  2MLZ A;  1U79 A;  2AWG A;  3RFW A;  2ZQS A;  2ZQT A;  4ODK A;  3IK8 A;  3O5E A;  3UQB A;  4ITZ A;  5HWC A;  3O5G A;  1J4H A;  2DG3 A;  3KAD A;  4ODO A;  1JNT A;  5DIT A;  4FAP A;  2PPN A;  1D6O A;  4DRQ A;  5BXJ A;  2MF9 A;  3B7X A;  1FKI A;  1KT1 A;  1FKJ A;  4DRK A;  1NSG A;  1BKF A;  2F4E A;  3JYM A;  2JZV A;  4DRM A;  4ODN A;  3WH0 A;  4DRJ A;  4DRI A;  2ITK A;  2DG4 A;  2KI3 A;  4G2P A;  2F21 A;  4W9Q A;  1FKH A;  1FJD A;  2M1I A;  1BL4 A;  1D7H A;  5GPG A;  1P5Q A;  3H9R B;  2PV2 A;  2MLX A;  5D75 A;  1YAT A;  4C02 B;  1N1A A;  1ZK6 A;  4LAW A;  4TW6 A;  2PPP A;  2FAP A;  1HXV A;  5HW8 A;  5DIV A;  5B8I C;  4DH0 A;  2KFW A;  2IF4 A;  3MDY B;  3KAI A;  4TNS A;  2PV3 A;  2LKN A;  2XP5 A;  5DIU A;  3PRB A;  2XP8 A;  3PRD A;  1EYM A;  3KAC A;  4FN2 A;  4N19 A;  1NMV A;  4LAX A;  3KAB A;  2ZR4 A;  2ZR6 A;  3KAF A;  3FAP A;  4O2T A;  2UZ5 A;  3CGN A;  3O5O A;  2XPA A;  3IKD A;  4ODP A;  2XP6 A;  2MPH A;  1QZ2 A;  5HW7 A;  3NRK A;  2RUQ A;  1T11 A;  1Q6I A;  3UI5 A;  3VAW A;  3UQI A;  3I6C A;  1J4I A;  3PA7 A;  4ODQ A;  2PBC A;  3NI6 A;  1FKF A;  1B6C A;  1PBK A;  2XPB A;  4ODR A;  1FKL A;  2KE0 A;  1J4R A;  3RGC A;  2PPO A;  1FKD A;  4TYO A;  5I98 A;  5J6E A;  1FKR A;  4GGQ A;  1L1P A;  4GIV A;  4U85 A;  3O5F A;  3TCZ A;  4JFL A;  4QT2 A;  2VCD A;  1FKB A;  2ZQU A;  4DZ2 A;  3CGM A;  3UQA A;  2D9F A;  3O5P A;  4ODM A;  2XP9 A;  1ROU A;  1EQ3 A;  1A7X A;  2RSE A;  3ODK A;  1D7J A;  4JFM A;  1C9H A;  2RUC A;  2LJ4 A;  4J4N A;  2LPV A;  3KAH A;  3O5K A;  4QIB A;  2PV1 A;  4IQC A;  1TCO C;  1FAP A;  4JFI A;  3UI4 A;  4QT3 A;  2KO7 A;  2F2D A;  3IHZ A;  5HWB A;  3TC5 A;  3OOB A;  3TDB A;  2ZR5 A;  1D7I A;  5HUA A;  2N87 A;  2XP3 A;  4TW7 A;  4TX0 A;  2XP7 A;  2RUR A;  1R9H A;  1QPF A;  2MLY A;  3KZ7 A;  2XP4 A;  3O5M A;  3GPK A;  2RQS A;  3KAG A;  1JNS A;  1FKG A;  1J6Y A;  1JVW A;  2FKE A;  3EY6 A;  2KGJ A;  3O5I A;  3O5R A;  3KCE A;  1Q6U A;  3O5Q A;  2M2A A;  4IPX A;  4DRP A;  4MGV A;  1FKT A;  1Y0O A;  4JYS A;  5HKG A;  4BF8 A;  3O5D A;  1W26 A;  2KR7 A;  3JXV A;  4W9O A;  4U86 A;  4NNR A;  4G50 A;  1ZCN A;  3O5J A;  4U84 A;  4DIP A;  4DRO A;  2OFN A;  5HTG A;  1F8A B;  4DRH A;  1M5Y A;  3IKG A;  2RUD A;  1PIN A;  3JYJ A;  3LUO A;  2VN1 A;  1Q6H A;  5HW6 A;  1ROT A;  1YW5 A;  2M08 A;  2MNT A;  2ZQV A;  2L2S A;  1KT0 A;  4R0X A;  2K8I A;  3UF8 A;  1NMW A;  2Y78 A;  3NTP A;  3UI6 A;  4DT4 A;  4IQ2 A;  1QPL A;  2Q5A A; 
#chains in the Genus database with same CATH topology
 1EHN A;  2DSV A;  4XAK A;  2LGO A;  2WLY A;  4DRN A;  3ART A;  2DSZ A;  4R5E A;  1X6L A;  3KAD A;  4ODO A;  3RME A;  2MF9 A;  3ALF A;  3B7X A;  1FKI A;  1CTN A;  1FKJ A;  4WK9 A;  2F4E A;  2IUZ A;  4DRM A;  4ODN A;  4ZPT R;  4MNL A;  3PRA A;  1BL4 A;  1YAT A;  4TW6 A;  4P8V A;  5B8I C;  4DH0 A;  3PRB A;  2WK2 A;  1EYM A;  3KAC A;  1E6N A;  1NMV A;  4LAX A;  1UR8 A;  3KAB A;  2ZR4 A;  3ARS A;  4O2T A;  4MNJ A;  2DPE A;  1QZ2 A;  4S3K A;  3ARQ A;  1Q6I A;  1E6P A;  3I6C A;  3NI6 A;  1FKF A;  3RGC A;  1FKL A;  1FKD A;  4TYO A;  1HKM A;  1RD6 A;  4Z2I A;  5I98 A;  3WD0 A;  4GIV A;  4QT2 A;  2G8Z A;  4DZ2 A;  1VF8 A;  2D9F A;  4ODM A;  3ODK A;  1D7J A;  2RUC A;  3W4R A;  2LJ4 A;  3O5K A;  4IQC A;  1OGB A;  4WJX A;  4MTV A;  4HBO A;  3QOK A;  1LL7 A;  2ZR5 A;  5HUA A;  2MLY A;  4LGX A;  1E6R A;  3O5M A;  1JNS A;  1ZBK A;  4W5U A;  1J6Y A;  2FKE A;  3EY6 A;  1Q6U A;  3O5Q A;  2M2A A;  3FY1 A;  4L3N A;  1NH6 A;  1XRV A;  4BF8 A;  3CHF A;  1JNE A;  3ARW A;  4DRH A;  1M5Y A;  3G6M A;  1PIN A;  1HJV A;  3JYJ A;  2VN1 A;  1ROT A;  2DSW A;  3ARP A;  2MNT A;  1KT0 A;  1LL6 A;  1NMW A;  4IQ2 A;  3CH9 A;  2Q5A A;  5HTG A;  3ARU A;  4Z2L A;  2P4V A;  1Q1C A;  4J4O A;  1HJX A;  4TW8 A;  4W9P A;  5DEZ A;  4L72 B;  1U79 A;  1UR9 A;  2A3B A;  4QZV B;  4FAP A;  5DIT A;  1D6O A;  1E15 A;  1KT1 A;  4Q22 A;  4MNM A;  3BMB A;  2M1I A;  1WB0 A;  2PV2 A;  2MLX A;  5D75 A;  4Q7N A;  3WD2 A;  3AS1 A;  2WLZ A;  5DIV A;  5HBF A;  1ZL1 A;  2IF4 A;  2PV3 A;  5DIU A;  4FN2 A;  4WIW A;  3AS2 A;  5DF0 A;  3KAF A;  3UI6 A;  3O5O A;  5DO2 A;  4AY1 A;  2XP6 A;  3NRK A;  4IT6 A;  1ZU8 A;  3UQI A;  4DWS C;  2PBC A;  4ODR A;  3CZ8 A;  1FKR A;  3RM8 A;  4NZC A;  4JFL A;  4WKF A;  2VCD A;  2ZQU A;  1EQ3 A;  1LQ0 A;  2RSE A;  4JFM A;  4QIB A;  1GRJ A;  3IHZ A;  2F2D A;  2G41 A;  3TC5 A;  3OOB A;  4ZS6 A;  4KR0 B;  4TX0 A;  2RUR A;  1QPF A;  2O9O A;  2OLH A;  1LL4 A;  3RM9 A;  1JVW A;  3ARV A;  3PR9 A;  2KGJ A;  3KCE A;  1EIB A;  4MGV A;  1Y0O A;  5HKG A;  3O5D A;  2KR7 A;  1LG1 A;  1ITX A;  4DIP A;  2FDM A;  2OFN A;  3WL0 A;  2RUD A;  1IX5 A;  3LUO A;  4MAV A;  1Q6H A;  3WQV A;  2L2S A;  1ZBW A;  4R0X A;  2K8I A;  2Y78 A;  4ZPV R;  2O92 A;  1LJY A;  1QPL A;  1JCH B;  4P8U A;  1W9V A;  3WQW A;  1JND A;  4Z2J A;  4Z2G A;  1FD9 A;  1NWS A;  1ZB5 A;  1X6N A;  4MSP A;  1GOI A;  4WKA A;  4ODL A;  2ETN A;  4LAV A;  3RFW A;  1HKI A;  2ZQT A;  4ODK A;  1K9T A;  4ITZ A;  2DG3 A;  1JNT A;  2PPN A;  4S3J A;  3AS0 A;  1BKF A;  4Z2H A;  3WH0 A;  4DRI A;  2DG4 A;  4KQZ A;  2DT0 A;  1NWT A;  3EIP A;  1FJD A;  3WD4 A;  3H9R B;  5GQB A;  4C02 B;  1ZK6 A;  4LAW A;  1HXV A;  2FAP A;  5HW8 A;  2YBT A;  2LKN A;  1HKJ A;  2XP5 A;  1GPF A;  2XP8 A;  3PRD A;  3GU0 A;  2ZR6 A;  3FAP A;  2UZ5 A;  3CGN A;  3B9A A;  3IKD A;  1KFW A;  2A3A A;  1E9L A;  3VAW A;  1PBK A;  2XPB A;  4HAR A;  2PPO A;  5J6E A;  4GGQ A;  1EDQ A;  1LG2 A;  3TCZ A;  2QF8 A;  1FKB A;  3UQA A;  4IT4 A;  1ROU A;  4UDM A;  1A7X A;  1C9H A;  2F23 A;  2LPV A;  3KAH A;  1TCO C;  4JFI A;  3UI4 A;  1WAW A;  4QT3 A;  2KO7 A;  4NSB A;  3TDB A;  2DT3 A;  1D7I A;  2N87 A;  1W1P A;  2RQS A;  3KAG A;  1NWU A;  1SYT A;  1TFV A;  2EUL A;  3O5R A;  1W1V A;  4P8X A;  2PI6 A;  4MPK A;  4JYS A;  1HJW A;  1W26 A;  3JXV A;  4W9O A;  4NNR A;  1ZCN A;  3O5J A;  2YBU A;  1H0G A;  3AQU A;  1WNO A;  5HW6 A;  1W1T A;  1YW5 A;  1NWR A;  3GTY X;  3NTP A;  1F40 A;  2A3E A;  3RM4 A;  3O5L A;  3BXW A;  4JFK A;  4DZ3 A;  2DSU A;  1FKS A;  2DG9 A;  4WKH A;  5GPR A;  4JFJ A;  2DT1 A;  4DWS D;  4LAY A;  5HT1 A;  3B9E A;  3CHE A;  3OA5 A;  1FKK A;  2MLZ A;  2AWG A;  2ZQS A;  3UQB A;  3IK8 A;  3O5E A;  5HWC A;  3O5G A;  1J4H A;  4HBE A;  1ZBC A;  4DRQ A;  5BXJ A;  4PTM A;  3CHC A;  4DRK A;  1NSG A;  3JYM A;  2JZV A;  4DRJ A;  4Z2K A;  2ITK A;  2KI3 A;  4G2P A;  2F21 A;  4W9Q A;  1FKH A;  3B8S A;  1D7H A;  5GPG A;  1P5Q A;  1SR0 A;  1N1A A;  2PPP A;  1XHG A;  2KFW A;  3ALG A;  3MDY B;  2DT2 A;  3KAI A;  4TNS A;  2B31 A;  2B5U B;  4URI A;  2A3C A;  4N19 A;  3ARO A;  4ODP A;  3WKZ A;  2XPA A;  4DWS B;  3WIJ A;  2MPH A;  5HW7 A;  2RUQ A;  3ARY A;  1T11 A;  1ZBV A;  3UI5 A;  4DWS A;  1J4I A;  3PA7 A;  4ODQ A;  1B6C A;  3WL1 A;  1OWQ A;  1HKK A;  2KE0 A;  1J4R A;  1L1P A;  1E6Z A;  1GUV A;  1FFR A;  1E44 A;  5JH8 A;  4U85 A;  3O5F A;  1W9P A;  1FFQ A;  3CGM A;  4P8W A;  3O5P A;  2AOS A;  4J4N A;  2PV1 A;  3FXY A;  1FAP A;  3ARR A;  5HWB A;  3AS3 A;  1D2K A;  4ML4 A;  3WD3 A;  2XP3 A;  4TW7 A;  2XP7 A;  2ESC A;  1R9H A;  1W1Y A;  3KZ7 A;  2XP4 A;  2WM0 A;  3GPK A;  1FKG A;  3O5I A;  4DRP A;  4IPX A;  1O6I A;  3ARZ A;  1FKT A;  1H0I A;  4U86 A;  3CHD A;  4G50 A;  4U84 A;  1OGG A;  4DRO A;  1F8A B;  3ARX A;  3IKG A;  4ZPW R;  3B9D A;  1W9U A;  3WD1 A;  2M08 A;  2PN0 A;  4MNK A;  2ZQV A;  3G6L A;  3UF8 A;  4DT4 A;  2XP9 A; 
#chains in the Genus database with same CATH homology
 1EHN A;  2DSV A;  4XAK A;  2LGO A;  2WLY A;  4DRN A;  3ART A;  2DSZ A;  4R5E A;  1X6L A;  3KAD A;  4ODO A;  3RME A;  2MF9 A;  3ALF A;  3B7X A;  1FKI A;  1CTN A;  1FKJ A;  4WK9 A;  2F4E A;  2IUZ A;  4DRM A;  4ODN A;  4ZPT R;  4MNL A;  3PRA A;  1BL4 A;  1YAT A;  4TW6 A;  4P8V A;  5B8I C;  4DH0 A;  3PRB A;  2WK2 A;  1EYM A;  3KAC A;  1E6N A;  1NMV A;  4LAX A;  1UR8 A;  3KAB A;  2ZR4 A;  3ARS A;  4O2T A;  4MNJ A;  2DPE A;  1QZ2 A;  4S3K A;  3ARQ A;  1Q6I A;  1E6P A;  3I6C A;  3NI6 A;  1FKF A;  3RGC A;  1FKL A;  1FKD A;  4TYO A;  1HKM A;  1RD6 A;  4Z2I A;  5I98 A;  3WD0 A;  4GIV A;  4QT2 A;  2G8Z A;  4DZ2 A;  1VF8 A;  2D9F A;  4ODM A;  3ODK A;  1D7J A;  2RUC A;  3W4R A;  2LJ4 A;  3O5K A;  4IQC A;  1OGB A;  4WJX A;  4MTV A;  4HBO A;  3QOK A;  1LL7 A;  2ZR5 A;  5HUA A;  2MLY A;  4LGX A;  1E6R A;  3O5M A;  1JNS A;  1ZBK A;  4W5U A;  1J6Y A;  2FKE A;  3EY6 A;  1Q6U A;  3O5Q A;  2M2A A;  3FY1 A;  4L3N A;  1NH6 A;  1XRV A;  4BF8 A;  3CHF A;  1JNE A;  3ARW A;  4DRH A;  1M5Y A;  3G6M A;  1PIN A;  1HJV A;  3JYJ A;  2VN1 A;  1ROT A;  2DSW A;  3ARP A;  2MNT A;  1KT0 A;  1LL6 A;  1NMW A;  4IQ2 A;  3CH9 A;  2Q5A A;  5HTG A;  3ARU A;  4Z2L A;  4J4O A;  1Q1C A;  1HJX A;  4TW8 A;  4W9P A;  5DEZ A;  4L72 B;  1U79 A;  1UR9 A;  2A3B A;  4QZV B;  4FAP A;  5DIT A;  1D6O A;  1E15 A;  1KT1 A;  4Q22 A;  4MNM A;  2M1I A;  1WB0 A;  2PV2 A;  2MLX A;  5D75 A;  4Q7N A;  3WD2 A;  3AS1 A;  2WLZ A;  5DIV A;  5HBF A;  1ZL1 A;  2IF4 A;  2PV3 A;  5DIU A;  4FN2 A;  4WIW A;  3AS2 A;  5DF0 A;  3KAF A;  3UI6 A;  3O5O A;  5DO2 A;  4AY1 A;  2XP6 A;  3NRK A;  4IT6 A;  1ZU8 A;  3UQI A;  4DWS C;  2PBC A;  4ODR A;  3CZ8 A;  1FKR A;  3RM8 A;  4NZC A;  4JFL A;  4WKF A;  2VCD A;  2ZQU A;  1EQ3 A;  1LQ0 A;  2RSE A;  4JFM A;  4QIB A;  3IHZ A;  2F2D A;  2G41 A;  3TC5 A;  3OOB A;  4ZS6 A;  4KR0 B;  4TX0 A;  2RUR A;  1QPF A;  2O9O A;  2OLH A;  1LL4 A;  3RM9 A;  1JVW A;  3ARV A;  3PR9 A;  2KGJ A;  3KCE A;  1EIB A;  4MGV A;  1Y0O A;  5HKG A;  3O5D A;  2KR7 A;  1LG1 A;  1ITX A;  4DIP A;  2FDM A;  2OFN A;  3WL0 A;  2RUD A;  1IX5 A;  3LUO A;  4MAV A;  1Q6H A;  3WQV A;  2L2S A;  1ZBW A;  4R0X A;  2K8I A;  2Y78 A;  4ZPV R;  2O92 A;  1LJY A;  1QPL A;  4P8U A;  1W9V A;  3WQW A;  1JND A;  4Z2J A;  4Z2G A;  1FD9 A;  1NWS A;  1ZB5 A;  1X6N A;  4MSP A;  1GOI A;  4WKA A;  4ODL A;  4LAV A;  3RFW A;  1HKI A;  2ZQT A;  4ODK A;  1K9T A;  4ITZ A;  2DG3 A;  1JNT A;  2PPN A;  4S3J A;  3AS0 A;  1BKF A;  4Z2H A;  3WH0 A;  4DRI A;  2DG4 A;  4KQZ A;  2DT0 A;  1NWT A;  1FJD A;  3WD4 A;  3H9R B;  5GQB A;  4C02 B;  1ZK6 A;  4LAW A;  1HXV A;  2FAP A;  5HW8 A;  2YBT A;  2LKN A;  1HKJ A;  2XP5 A;  1GPF A;  2XP8 A;  3PRD A;  2ZR6 A;  3FAP A;  2UZ5 A;  3CGN A;  3B9A A;  3IKD A;  1KFW A;  2A3A A;  1E9L A;  3VAW A;  1PBK A;  2XPB A;  4HAR A;  2PPO A;  5J6E A;  4GGQ A;  1EDQ A;  1LG2 A;  3TCZ A;  2QF8 A;  1FKB A;  3UQA A;  4IT4 A;  1ROU A;  1A7X A;  1C9H A;  2LPV A;  3KAH A;  1TCO C;  4JFI A;  3UI4 A;  1WAW A;  4QT3 A;  2KO7 A;  4NSB A;  3TDB A;  2DT3 A;  1D7I A;  2N87 A;  1W1P A;  2RQS A;  3KAG A;  1NWU A;  1SYT A;  1TFV A;  3O5R A;  1W1V A;  4P8X A;  2PI6 A;  4MPK A;  4JYS A;  1HJW A;  1W26 A;  3JXV A;  4W9O A;  4NNR A;  1ZCN A;  3O5J A;  2YBU A;  1H0G A;  3AQU A;  1WNO A;  5HW6 A;  1W1T A;  1YW5 A;  1NWR A;  3NTP A;  1F40 A;  2A3E A;  3RM4 A;  3O5L A;  3BXW A;  4JFK A;  4DZ3 A;  2DSU A;  1FKS A;  2DG9 A;  4WKH A;  5GPR A;  4JFJ A;  2DT1 A;  4DWS D;  4LAY A;  5HT1 A;  3B9E A;  3CHE A;  3OA5 A;  1FKK A;  2MLZ A;  2AWG A;  2ZQS A;  3UQB A;  3IK8 A;  3O5E A;  5HWC A;  3O5G A;  1J4H A;  4HBE A;  1ZBC A;  4DRQ A;  5BXJ A;  4PTM A;  3CHC A;  4DRK A;  1NSG A;  3JYM A;  2JZV A;  4DRJ A;  4Z2K A;  2ITK A;  2KI3 A;  4G2P A;  2F21 A;  4W9Q A;  1FKH A;  3B8S A;  1D7H A;  5GPG A;  1P5Q A;  1SR0 A;  1N1A A;  2PPP A;  1XHG A;  2KFW A;  3ALG A;  3MDY B;  2DT2 A;  3KAI A;  4TNS A;  2B31 A;  4URI A;  2A3C A;  4N19 A;  3ARO A;  4ODP A;  3WKZ A;  2XPA A;  4DWS B;  3WIJ A;  2MPH A;  5HW7 A;  2RUQ A;  3ARY A;  1T11 A;  1ZBV A;  3UI5 A;  4DWS A;  1J4I A;  3PA7 A;  4ODQ A;  1B6C A;  3WL1 A;  1OWQ A;  1HKK A;  2KE0 A;  1J4R A;  1L1P A;  1E6Z A;  1GUV A;  1FFR A;  5JH8 A;  4U85 A;  3O5F A;  1W9P A;  1FFQ A;  3CGM A;  4P8W A;  3O5P A;  2AOS A;  4J4N A;  2PV1 A;  3FXY A;  1FAP A;  3ARR A;  5HWB A;  3AS3 A;  1D2K A;  4ML4 A;  3WD3 A;  2XP3 A;  4TW7 A;  2XP7 A;  2ESC A;  1R9H A;  1W1Y A;  3KZ7 A;  2XP4 A;  2WM0 A;  3GPK A;  1FKG A;  3O5I A;  4DRP A;  4IPX A;  1O6I A;  3ARZ A;  1FKT A;  1H0I A;  4U86 A;  3CHD A;  4G50 A;  4U84 A;  1OGG A;  4DRO A;  1F8A B;  3ARX A;  3IKG A;  4ZPW R;  3B9D A;  1W9U A;  3WD1 A;  2M08 A;  4MNK A;  2ZQV A;  3G6L A;  3UF8 A;  4DT4 A;  2XP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...