3O5EA

Fk1 domain of fkbp51, crystal form vi
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
SPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 31
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5eA00
2F21A 1Q1CA 2LJ4A 3KABA 4DRMA 4G2PA 4DRNA 2ZQSA 1FAPA 2MLXA 3I6CA 1FJDA 1ZCNA 2Q5AA 5DIVA 1FKKA 1Q6UA 3O5RA 1PINA 4JFMA 4JFLA 5HW8A 1F40A 3B7XA 2DG9A 4U84A 2MPHA 3KACA 3RFWA 3WH0A 1A7XA 4LAYA 4FN2A 1M5YA 1PBKA 1NSGA 2PPOA 2XPAA 2XP3A 3MDYB 2AWGA 1FKBA 2M08A 3IKDA 3O5GA 3KCEA 2JZVA 2N87A 3NRKA 3KAGA 4TX0A 4DRIA 5HKGA 2IF4A 1QPFA 2XP9A 1JNTA 4DZ3A 2K8IA 4JFJA 3KZ7A 3TC5A 1ZK6A 2MF9A 2F4EA 2ZQUA 2XP7A 5BXJA 1F8AB 1FKFA 5D75A 5HTGA 2ZQTA 4W9QA 3TDBA 1QZ2A 2RUCA 4ODLA 4DZ2A 4MGVA 4LAWA 1FKLA 1T11A 4NNRA 1JVWA 2F2DA 2VN1A 4TW6A 3FAPA 4W9PA 3TCZA 4QT2A 4TNSA 1FKJA 1N1AA 2XP4A 3EY6A 4U86A 4BF8A 4LAVA 3UI6A 4DT4A 1FD9A 5HWBA 1D7JA 1W26A 2FKEA 3O5FA 3JXVA 2MLZA 2OFNA 3IKGA 1TCOC 2MNTA 2L2SA 2KE0A 2Y78A 2RQSA 1FKRA 3JYMA 3KADA 3UQIA 1FKIA 4R0XA 4DH0A 1ROUA 4GIVA 4QT3A 4DRPA 3O5QA 4TW8A 1YW5A 1FKSA 2ITKA 2RSEA 3PRBA 4DROA 2PBCA 4LAXA 4DRHA 1B6CA 2M2AA 2PPPA 1EQ3A 1HXVA 1FKTA 3O5JA 4IQCA 4O2TA 1BKFA 2MLYA 3VAWA 5B8IC 5HUAA 4JFKA 3UI5A 1Y0OA 1KT0A 4GGQA 2M1IA 3IHZA 4ODPA 2XP6A 1YATA 1QPLA 2RUDA 3IK8A 1FKGA 2XP8A 1JNSA 1L1PA 2KO7A 3UQBA 3UI4A 3LUOA 1J6YA 1J4HA 3H9RB 3O5IA 1EYMA 4JFIA 1Q6IA 1D7HA 4C02B 2D9FA 2LKNA 5J6EA 1R9HA 3NI6A 5HW6A 5DIUA 1ROTA 5HT1A 1U79A 4DRQA 4ITZA 2ZR4A 3JYJA 1D6OA 4J4NA 4ODNA 3O5EA 3O5LA 1C9HA 3OOBA 2LGOA 2ZQVA 2PV3A 4FAPA 4U85A 1KT1A 1FKDA 1J4RA 5HWCA 2LPVA 1FKHA 3CGMA 2XPBA 2KGJA 4G50A 4ODQA 3KAFA 5DITA 5GPGA 5I98A 2KR7A 2KI3A 4ODMA 3KAHA 2ZR5A 4IQ2A 2RUQA 3KAIA 3PA7A 4DRJA 4QIBA 3O5PA 2PV2A 1NMVA 2UZ5A 1J4IA 3GPKA 3O5DA 2PPNA 4MSPA 3CGNA 3O5KA 2FAPA 2DG4A 4N19A 2DG3A 3O5MA 4TW7A 4DRKA 1Q6HA 2PV1A 4ODOA 3RGCA 3NTPA 4J4OA 2XP5A 4IPXA 3UQAA 4DIPA 4ODKA 1P5QA 1D7IA 3ODKA 1BL4A 2ZR6A 3UF8A 3PRDA 4TYOA 4W9OA 4JYSA 1NMWA 2RURA 5HW7A 4ODRA 2KFWA 2VCDA 3O5OA
chains in the Genus database with same CATH superfamily
1E6PA 3KABA 4DRMA 4G2PA 4DRNA 5DEZA 1W9PA 2O92A 3I6CA 4MAVA 4Z2GA 1ITXA 1ZL1A 1PINA 2YBUA 4ZPTR 2DG9A 4Z2IA 4UDMA 1A7XA 4LAYA 3G6LA 2WK2A 4FN2A 4NSBA 4P8WA 1WAWA 2PPOA 2AWGA 1FKBA 3CHCA 1NWUA 3CHEA 2OLHA 4TX0A 2XP9A 4MPKA 2F4EA 2DT0A 1W9VA 2DSUA 4NNRA 1JVWA 2VN1A 2YBTA 4TNSA 1LQ0A 3RM8A 1E9LA 1N1AA 2XP4A 3BMBA 1W26A 1FFQA 3AQUA 3CZ8A 3IKGA 1TCOC 4R5EA 2MNTA 1ZBVA 2RQSA 3ARQA 4DH0A 1FKIA 4DWSB 1NH6A 1VF8A 3O5QA 5GPRA 1RD6A 4Q22A 3AS0A 2RSEA 1KFWA 3WD2A 4IT4A 3ARUA 1EIBA 1GPFA 4IQCA 4HARA 1ZBWA 4Q7NA 1SR0A 3WD3A 1OGBA 1GUVA 2A3BA 3WQWA 1YATA 2DPEA 3IK8A 3WL0A 3EIPA 4Z2KA 4DWSD 4MNJA 1J6YA 1CTNA 3ALGA 4L72B 4WK9A 5HT1A 4WJXA 3JYJA 4Z2HA 3O5EA 3O5LA 3CHFA 1H0GA 3WL1A 4U85A 1KT1A 4ODQA 2KI3A 4ODMA 3KAHA 2ZR5A 3PA7A 3BXWA 2A3CA 2PV2A 1NMVA 3WD0A 3GPKA 2PPNA 3CGNA 4N19A 4DRKA 3NTPA 4J4OA 2DSWA 4DIPA 3ODKA 1BL4A 3UF8A 3PRDA 1W1YA 2VCDA 5HBFA 3PRAA 2F21A 1ZBCA 5JH8A 4IT6A 2MLXA 4MNMA 1Q6UA 2A3EA 3O5RA 3B7XA 1IX5A 4U84A 1NWRA 3WKZA 1M5YA 1PBKA 1NSGA 1HKJA 2XPAA 1EHNA 4WKAA 3IKDA 1GRJA 2JZVA 2N87A 3KAGA 3WIJA 5HKGA 2IF4A 3RM4A 1JNTA 4DZ3A 2K8IA 2MF9A 2XP7A 1FKFA 5HTGA 3TDBA 4LAWA 4TW6A 2B5UB 4QT2A 3ARWA 3RMEA 2EULA 1D7JA 2FKEA 2MLZA 1WB0A 2L2SA 3QOKA 3UQIA 4R0XA 1ROUA 5DO2A 4DRPA 1W1TA 1ZBKA 4TW8A 1UR8A 3CHDA 2PBCA 2PPPA 1EQ3A 1HKKA 1FKTA 3O5JA 4L3NA 1SYTA 1LG1A 5HUAA 4JFKA 4P8XA 1KT0A 4S3JA 2ESCA 3IHZA 1E6RA 3H9RB 3O5IA 1EYMA 1Q6IA 1D7HA 4C02B 1H0IA 1R9HA 2QF8A 3NI6A 3W4RA 4PTMA 1LL7A 4ITZA 2ZR4A 4ODNA 1C9HA 4DWSA 4FAPA 5HWCA 3CGMA 2KR7A 1FFRA 4DRJA 1E15A 2UZ5A 1J4IA 4P8VA 2ETNA 1D2KA 1Q6HA 4ODOA 3ARSA 3ARYA 3UQAA 2XP5A 4IPXA 1NWSA 1D7IA 2ZR6A 3ALFA 4TYOA 4JYSA 5DF0A 5HW7A 2KFWA 3O5OA 3G6MA 1FAPA 1HJVA 1UR9A 2WLYA 4WKFA 1FJDA 2Q5AA 5DIVA 1LL6A 4JFLA 1F40A 3RFWA 2B31A 3WD4A 2DT3A 2XP3A 1WNOA 2M08A 3O5GA 2IUZA 3NRKA 1GOIA 4DRIA 4ZPWR 1QPFA 3KZ7A 3TC5A 1ZK6A 2ZQUA 5BXJA 1F8AB 5D75A 4KQZA 2ZQTA 4W9QA 4ODLA 4DZ2A 3ARRA 1X6NA 1FKLA 3TCZA 2AOSA 4W9PA 4S3KA 1ZB5A 1FKJA 4U86A 5GQBA 4ZS6A 4DT4A 1FD9A 5HWBA 1X6LA 3AS1A 3JXVA 2DSVA 1JNDA 1O6IA 2OFNA 1HJXA 2KE0A 4NZCA 1FKRA 3KADA 3B9AA 4GIVA 4QT3A 1E6ZA 1FKSA 1YW5A 1E44A 4LGXA 4LAXA 4WKHA 2G41A 3VAWA 3UI5A 1Y0OA 4GGQA 2XP6A 1FKGA 1JNSA 2KO7A 3B9DA 3UI4A 3LUOA 4JFIA 5J6EA 5HW6A 2DT2A 1ROTA 1U79A 1D6OA 4J4NA 2G8ZA 2PN0A 1JNEA 1J4RA 4DWSC 2LPVA 1FKHA 2F23A 3KAFA 4ML4A 1LG2A 4Z2JA 4IQ2A 3KAIA 4QIBA 4MNLA 3O5DA 3RM9A 1W1VA 2DG4A 2FAPA 3RGCA 2O9OA 1W1PA 1P5QA 4ZPVR 1NWTA 3OA5A 5I98A 3GU0A 1Q1CA 2LJ4A 4KR0B 3ARPA 2ZQSA 4HBOA 3ARZA 1ZCNA 1FKKA 1K9TA 4JFMA 5HW8A 2MPHA 3KACA 4MNKA 3WH0A 2PI6A 3MDYB 1XRVA 4Z2LA 3KCEA 4XAKA 4URIA 4JFJA 2A3AA 1QZ2A 2RUCA 2DSZA 4P8UA 3FY1A 4MGVA 1T11A 2F2DA 3FAPA 4HBEA 3EY6A 4BF8A 4LAVA 3ARTA 3UI6A 1HJWA 3O5FA 2Y78A 3JYMA 3AS2A 1LJYA 1ZU8A 3B9EA 2ITKA 3PRBA 1TFVA 3CH9A 4DROA 3ARXA 4DRHA 1B6CA 2M2AA 4MTVA 1HXVA 4O2TA 5B8IC 1BKFA 1W9UA 2MLYA 1E6NA 2WM0A 1OWQA 3PR9A 1OGGA 3AS3A 2M1IA 3AROA 4ODPA 2P4VA 3WQVA 2RUDA 1QPLA 1JCHB 2XP8A 1L1PA 3UQBA 1J4HA 3WD1A 2D9FA 2LKNA 5DIUA 1LL4A 4DRQA 3B8SA 3FXYA 3OOBA 2LGOA 2ZQVA 2PV3A 1FKDA 4G50A 3GTYX 3ARVA 2XPBA 2KGJA 5DITA 5GPGA 2RUQA 1HKMA 3O5PA 4MSPA 3O5KA 4AY1A 2DG3A 3O5MA 4TW7A 4W5UA 2PV1A 4QZVB 1XHGA 1EDQA 4ODKA 4WIWA 2FDMA 4W9OA 1NMWA 2RURA 1HKIA 4ODRA 2DT1A 2WLZA
chains in the Genus database with same CATH topology
1E6PA 3KABA 4DRMA 4G2PA 4DRNA 5DEZA 1W9PA 2O92A 3I6CA 4MAVA 4Z2GA 1ITXA 1ZL1A 1PINA 2YBUA 4ZPTR 2DG9A 4Z2IA 1A7XA 4LAYA 3G6LA 2WK2A 4FN2A 4NSBA 4P8WA 1WAWA 2PPOA 2AWGA 1FKBA 3CHCA 1NWUA 3CHEA 2OLHA 4TX0A 2XP9A 4MPKA 2F4EA 2DT0A 1W9VA 2DSUA 4NNRA 1JVWA 2VN1A 2YBTA 4TNSA 1LQ0A 3RM8A 1E9LA 1N1AA 2XP4A 1W26A 1FFQA 3AQUA 3CZ8A 3IKGA 1TCOC 4R5EA 2MNTA 1ZBVA 2RQSA 3ARQA 4DH0A 1FKIA 4DWSB 1NH6A 1VF8A 3O5QA 5GPRA 1RD6A 4Q22A 3AS0A 2RSEA 1KFWA 3WD2A 4IT4A 3ARUA 1EIBA 4IQCA 1GPFA 4HARA 1ZBWA 4Q7NA 1SR0A 3WD3A 1OGBA 1GUVA 2A3BA 3WQWA 1YATA 2DPEA 3IK8A 3WL0A 4Z2KA 4DWSD 4MNJA 1J6YA 1CTNA 3ALGA 4L72B 4WK9A 5HT1A 4WJXA 3JYJA 4Z2HA 3O5EA 3O5LA 3CHFA 1H0GA 3WL1A 4U85A 1KT1A 4ODQA 2KI3A 4ODMA 3KAHA 2ZR5A 3PA7A 3BXWA 2A3CA 2PV2A 1NMVA 3WD0A 3GPKA 2PPNA 3CGNA 4N19A 4DRKA 3NTPA 4J4OA 2DSWA 4DIPA 3ODKA 1BL4A 3UF8A 3PRDA 1W1YA 2VCDA 5HBFA 3PRAA 2F21A 1ZBCA 5JH8A 4IT6A 2MLXA 4MNMA 1Q6UA 2A3EA 3O5RA 3B7XA 1IX5A 4U84A 1NWRA 3WKZA 1M5YA 1PBKA 1NSGA 1HKJA 2XPAA 1EHNA 4WKAA 3IKDA 2JZVA 2N87A 3KAGA 3WIJA 5HKGA 2IF4A 3RM4A 1JNTA 4DZ3A 2K8IA 2MF9A 2XP7A 1FKFA 5HTGA 3TDBA 4LAWA 4TW6A 4QT2A 3ARWA 3RMEA 1D7JA 2FKEA 2MLZA 1WB0A 2L2SA 3QOKA 3UQIA 4R0XA 1ROUA 5DO2A 4DRPA 1W1TA 1ZBKA 4TW8A 1UR8A 3CHDA 2PBCA 2PPPA 1EQ3A 1HKKA 1FKTA 3O5JA 4L3NA 1SYTA 1LG1A 5HUAA 4JFKA 4P8XA 1KT0A 4S3JA 2ESCA 3IHZA 1E6RA 3H9RB 3O5IA 1EYMA 1Q6IA 1D7HA 4C02B 1H0IA 1R9HA 2QF8A 3NI6A 3W4RA 4PTMA 1LL7A 4ITZA 2ZR4A 4ODNA 1C9HA 4DWSA 4FAPA 5HWCA 3CGMA 2KR7A 1FFRA 4DRJA 1E15A 2UZ5A 1J4IA 4P8VA 1D2KA 1Q6HA 4ODOA 3ARSA 3ARYA 3UQAA 2XP5A 4IPXA 1NWSA 1D7IA 2ZR6A 3ALFA 4TYOA 4JYSA 5DF0A 5HW7A 2KFWA 3O5OA 3G6MA 1FAPA 1HJVA 1UR9A 2WLYA 4WKFA 1FJDA 2Q5AA 5DIVA 1LL6A 4JFLA 1F40A 3RFWA 2B31A 3WD4A 2DT3A 2XP3A 1WNOA 2M08A 3O5GA 2IUZA 3NRKA 1GOIA 4DRIA 4ZPWR 1QPFA 3KZ7A 3TC5A 1ZK6A 2ZQUA 5BXJA 1F8AB 5D75A 4KQZA 2ZQTA 4W9QA 4ODLA 4DZ2A 3ARRA 1X6NA 1FKLA 3TCZA 2AOSA 4W9PA 4S3KA 1ZB5A 1FKJA 4U86A 5GQBA 4ZS6A 4DT4A 1FD9A 5HWBA 1X6LA 3AS1A 3JXVA 2DSVA 1JNDA 1O6IA 2OFNA 1HJXA 2KE0A 4NZCA 1FKRA 3KADA 3B9AA 4GIVA 4QT3A 1E6ZA 1FKSA 1YW5A 4LGXA 4LAXA 4WKHA 2G41A 3VAWA 3UI5A 1Y0OA 4GGQA 2XP6A 1FKGA 1JNSA 2KO7A 3B9DA 3UI4A 3LUOA 4JFIA 5J6EA 5HW6A 2DT2A 1ROTA 1U79A 1D6OA 4J4NA 2G8ZA 1JNEA 1J4RA 4DWSC 2LPVA 1FKHA 3KAFA 4ML4A 1LG2A 4Z2JA 4IQ2A 3KAIA 4QIBA 4MNLA 3O5DA 3RM9A 1W1VA 2DG4A 2FAPA 3RGCA 2O9OA 1W1PA 1P5QA 4ZPVR 1NWTA 3OA5A 5I98A 1Q1CA 2LJ4A 4KR0B 3ARPA 2ZQSA 4HBOA 3ARZA 1ZCNA 1FKKA 1K9TA 4JFMA 5HW8A 2MPHA 3KACA 4MNKA 3WH0A 2PI6A 3MDYB 1XRVA 4Z2LA 3KCEA 4XAKA 4URIA 4JFJA 2A3AA 1QZ2A 2RUCA 2DSZA 4P8UA 3FY1A 4MGVA 1T11A 2F2DA 3FAPA 4HBEA 3EY6A 4BF8A 4LAVA 3ARTA 3UI6A 1HJWA 3O5FA 2Y78A 3JYMA 3AS2A 1LJYA 1ZU8A 3B9EA 2ITKA 3PRBA 1TFVA 3CH9A 4DROA 3ARXA 4DRHA 1B6CA 2M2AA 4MTVA 1HXVA 4O2TA 5B8IC 1BKFA 1W9UA 2MLYA 1E6NA 2WM0A 1OWQA 3PR9A 1OGGA 3AS3A 2M1IA 3AROA 4ODPA 3WQVA 2RUDA 1QPLA 2XP8A 1L1PA 3UQBA 1J4HA 3WD1A 2D9FA 2LKNA 5DIUA 1LL4A 4DRQA 3B8SA 3FXYA 3OOBA 2LGOA 2ZQVA 2PV3A 1FKDA 4G50A 3ARVA 2XPBA 2KGJA 5DITA 5GPGA 2RUQA 1HKMA 3O5PA 4MSPA 3O5KA 4AY1A 2DG3A 3O5MA 4TW7A 4W5UA 2PV1A 4QZVB 1XHGA 1EDQA 4ODKA 4WIWA 2FDMA 4W9OA 1NMWA 2RURA 1HKIA 4ODRA 2DT1A 2WLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F21 A;  1Q1C A;  2LJ4 A;  3KAB A;  4DRM A;  4G2P A;  4DRN A;  2ZQS A;  1FAP A;  2MLX A;  3I6C A;  1FJD A;  1ZCN A;  2Q5A A;  5DIV A;  1FKK A;  1Q6U A;  3O5R A;  1PIN A;  4JFM A;  4JFL A;  5HW8 A;  1F40 A;  3B7X A;  2DG9 A;  4U84 A;  2MPH A;  3KAC A;  3RFW A;  3WH0 A;  1A7X A;  4LAY A;  4FN2 A;  1M5Y A;  1PBK A;  1NSG A;  2PPO A;  2XPA A;  2XP3 A;  3MDY B;  2AWG A;  1FKB A;  2M08 A;  3IKD A;  3O5G A;  3KCE A;  2JZV A;  2N87 A;  3NRK A;  3KAG A;  4TX0 A;  4DRI A;  5HKG A;  2IF4 A;  1QPF A;  2XP9 A;  1JNT A;  4DZ3 A;  2K8I A;  4JFJ A;  3KZ7 A;  3TC5 A;  1ZK6 A;  2MF9 A;  2F4E A;  2ZQU A;  2XP7 A;  5BXJ A;  1F8A B;  1FKF A;  5D75 A;  5HTG A;  2ZQT A;  4W9Q A;  3TDB A;  1QZ2 A;  2RUC A;  4ODL A;  4DZ2 A;  4MGV A;  4LAW A;  1FKL A;  1T11 A;  4NNR A;  1JVW A;  2F2D A;  2VN1 A;  4TW6 A;  3FAP A;  4W9P A;  3TCZ A;  4QT2 A;  4TNS A;  1FKJ A;  1N1A A;  2XP4 A;  3EY6 A;  4U86 A;  4BF8 A;  4LAV A;  3UI6 A;  4DT4 A;  1FD9 A;  5HWB A;  1D7J A;  1W26 A;  2FKE A;  3O5F A;  3JXV A;  2MLZ A;  2OFN A;  3IKG A;  1TCO C;  2MNT A;  2L2S A;  2KE0 A;  2Y78 A;  2RQS A;  1FKR A;  3JYM A;  3KAD A;  3UQI A;  1FKI A;  4R0X A;  4DH0 A;  1ROU A;  4GIV A;  4QT3 A;  4DRP A;  3O5Q A;  4TW8 A;  1YW5 A;  1FKS A;  2ITK A;  2RSE A;  3PRB A;  4DRO A;  2PBC A;  4LAX A;  4DRH A;  1B6C A;  2M2A A;  2PPP A;  1EQ3 A;  1HXV A;  1FKT A;  3O5J A;  4IQC A;  4O2T A;  1BKF A;  2MLY A;  3VAW A;  5B8I C;  5HUA A;  4JFK A;  3UI5 A;  1Y0O A;  1KT0 A;  4GGQ A;  2M1I A;  3IHZ A;  4ODP A;  2XP6 A;  1YAT A;  1QPL A;  2RUD A;  3IK8 A;  1FKG A;  2XP8 A;  1JNS A;  1L1P A;  2KO7 A;  3UQB A;  3UI4 A;  3LUO A;  1J6Y A;  1J4H A;  3H9R B;  3O5I A;  1EYM A;  4JFI A;  1Q6I A;  1D7H A;  4C02 B;  2D9F A;  2LKN A;  5J6E A;  1R9H A;  3NI6 A;  5HW6 A;  5DIU A;  1ROT A;  5HT1 A;  1U79 A;  4DRQ A;  4ITZ A;  2ZR4 A;  3JYJ A;  1D6O A;  4J4N A;  4ODN A;  3O5E A;  3O5L A;  1C9H A;  3OOB A;  2LGO A;  2ZQV A;  2PV3 A;  4FAP A;  4U85 A;  1KT1 A;  1FKD A;  1J4R A;  5HWC A;  2LPV A;  1FKH A;  3CGM A;  2XPB A;  2KGJ A;  4G50 A;  4ODQ A;  3KAF A;  5DIT A;  5GPG A;  5I98 A;  2KR7 A;  2KI3 A;  4ODM A;  3KAH A;  2ZR5 A;  4IQ2 A;  2RUQ A;  3KAI A;  3PA7 A;  4DRJ A;  4QIB A;  3O5P A;  2PV2 A;  1NMV A;  2UZ5 A;  1J4I A;  3GPK A;  3O5D A;  2PPN A;  4MSP A;  3CGN A;  3O5K A;  2FAP A;  2DG4 A;  4N19 A;  2DG3 A;  3O5M A;  4TW7 A;  4DRK A;  1Q6H A;  2PV1 A;  4ODO A;  3RGC A;  3NTP A;  4J4O A;  2XP5 A;  4IPX A;  3UQA A;  4DIP A;  4ODK A;  1P5Q A;  1D7I A;  3ODK A;  1BL4 A;  2ZR6 A;  3UF8 A;  3PRD A;  4TYO A;  4W9O A;  4JYS A;  1NMW A;  2RUR A;  5HW7 A;  4ODR A;  2KFW A;  2VCD A;  3O5O A; 
#chains in the Genus database with same CATH topology
 1E6P A;  3KAB A;  4DRM A;  4G2P A;  4DRN A;  5DEZ A;  1W9P A;  2O92 A;  3I6C A;  4MAV A;  4Z2G A;  1ITX A;  1ZL1 A;  1PIN A;  2YBU A;  4ZPT R;  2DG9 A;  4Z2I A;  4UDM A;  1A7X A;  4LAY A;  3G6L A;  2WK2 A;  4FN2 A;  4NSB A;  4P8W A;  1WAW A;  2PPO A;  2AWG A;  1FKB A;  3CHC A;  1NWU A;  3CHE A;  2OLH A;  4TX0 A;  2XP9 A;  4MPK A;  2F4E A;  2DT0 A;  1W9V A;  2DSU A;  4NNR A;  1JVW A;  2VN1 A;  2YBT A;  4TNS A;  1LQ0 A;  3RM8 A;  1E9L A;  1N1A A;  2XP4 A;  3BMB A;  1W26 A;  1FFQ A;  3AQU A;  3CZ8 A;  3IKG A;  1TCO C;  4R5E A;  2MNT A;  1ZBV A;  2RQS A;  3ARQ A;  4DH0 A;  1FKI A;  4DWS B;  1NH6 A;  1VF8 A;  3O5Q A;  5GPR A;  1RD6 A;  4Q22 A;  3AS0 A;  2RSE A;  1KFW A;  3WD2 A;  4IT4 A;  3ARU A;  1EIB A;  1GPF A;  4IQC A;  4HAR A;  1ZBW A;  4Q7N A;  1SR0 A;  3WD3 A;  1OGB A;  1GUV A;  2A3B A;  3WQW A;  1YAT A;  2DPE A;  3IK8 A;  3WL0 A;  3EIP A;  4Z2K A;  4DWS D;  4MNJ A;  1J6Y A;  1CTN A;  3ALG A;  4L72 B;  4WK9 A;  5HT1 A;  4WJX A;  3JYJ A;  4Z2H A;  3O5E A;  3O5L A;  3CHF A;  1H0G A;  3WL1 A;  4U85 A;  1KT1 A;  4ODQ A;  2KI3 A;  4ODM A;  3KAH A;  2ZR5 A;  3PA7 A;  3BXW A;  2A3C A;  2PV2 A;  1NMV A;  3WD0 A;  3GPK A;  2PPN A;  3CGN A;  4N19 A;  4DRK A;  3NTP A;  4J4O A;  2DSW A;  4DIP A;  3ODK A;  1BL4 A;  3UF8 A;  3PRD A;  1W1Y A;  2VCD A;  5HBF A;  3PRA A;  2F21 A;  1ZBC A;  5JH8 A;  4IT6 A;  2MLX A;  4MNM A;  1Q6U A;  2A3E A;  3O5R A;  3B7X A;  1IX5 A;  4U84 A;  1NWR A;  3WKZ A;  1M5Y A;  1PBK A;  1NSG A;  1HKJ A;  2XPA A;  1EHN A;  4WKA A;  3IKD A;  1GRJ A;  2JZV A;  2N87 A;  3KAG A;  3WIJ A;  5HKG A;  2IF4 A;  3RM4 A;  1JNT A;  4DZ3 A;  2K8I A;  2MF9 A;  2XP7 A;  1FKF A;  5HTG A;  3TDB A;  4LAW A;  4TW6 A;  2B5U B;  4QT2 A;  3ARW A;  3RME A;  2EUL A;  1D7J A;  2FKE A;  2MLZ A;  1WB0 A;  2L2S A;  3QOK A;  3UQI A;  4R0X A;  1ROU A;  5DO2 A;  4DRP A;  1W1T A;  1ZBK A;  4TW8 A;  1UR8 A;  3CHD A;  2PBC A;  2PPP A;  1EQ3 A;  1HKK A;  1FKT A;  3O5J A;  4L3N A;  1SYT A;  1LG1 A;  5HUA A;  4JFK A;  4P8X A;  1KT0 A;  4S3J A;  2ESC A;  3IHZ A;  1E6R A;  3H9R B;  3O5I A;  1EYM A;  1Q6I A;  1D7H A;  4C02 B;  1H0I A;  1R9H A;  2QF8 A;  3NI6 A;  3W4R A;  4PTM A;  1LL7 A;  4ITZ A;  2ZR4 A;  4ODN A;  1C9H A;  4DWS A;  4FAP A;  5HWC A;  3CGM A;  2KR7 A;  1FFR A;  4DRJ A;  1E15 A;  2UZ5 A;  1J4I A;  4P8V A;  2ETN A;  1D2K A;  1Q6H A;  4ODO A;  3ARS A;  3ARY A;  3UQA A;  2XP5 A;  4IPX A;  1NWS A;  1D7I A;  2ZR6 A;  3ALF A;  4TYO A;  4JYS A;  5DF0 A;  5HW7 A;  2KFW A;  3O5O A;  3G6M A;  1FAP A;  1HJV A;  1UR9 A;  2WLY A;  4WKF A;  1FJD A;  2Q5A A;  5DIV A;  1LL6 A;  4JFL A;  1F40 A;  3RFW A;  2B31 A;  3WD4 A;  2DT3 A;  2XP3 A;  1WNO A;  2M08 A;  3O5G A;  2IUZ A;  3NRK A;  1GOI A;  4DRI A;  4ZPW R;  1QPF A;  3KZ7 A;  3TC5 A;  1ZK6 A;  2ZQU A;  5BXJ A;  1F8A B;  5D75 A;  4KQZ A;  2ZQT A;  4W9Q A;  4ODL A;  4DZ2 A;  3ARR A;  1X6N A;  1FKL A;  3TCZ A;  2AOS A;  4W9P A;  4S3K A;  1ZB5 A;  1FKJ A;  4U86 A;  5GQB A;  4ZS6 A;  4DT4 A;  1FD9 A;  5HWB A;  1X6L A;  3AS1 A;  3JXV A;  2DSV A;  1JND A;  1O6I A;  2OFN A;  1HJX A;  2KE0 A;  4NZC A;  1FKR A;  3KAD A;  3B9A A;  4GIV A;  4QT3 A;  1E6Z A;  1FKS A;  1YW5 A;  1E44 A;  4LGX A;  4LAX A;  4WKH A;  2G41 A;  3VAW A;  3UI5 A;  1Y0O A;  4GGQ A;  2XP6 A;  1FKG A;  1JNS A;  2KO7 A;  3B9D A;  3UI4 A;  3LUO A;  4JFI A;  5J6E A;  5HW6 A;  2DT2 A;  1ROT A;  1U79 A;  1D6O A;  4J4N A;  2G8Z A;  2PN0 A;  1JNE A;  1J4R A;  4DWS C;  2LPV A;  1FKH A;  2F23 A;  3KAF A;  4ML4 A;  1LG2 A;  4Z2J A;  4IQ2 A;  3KAI A;  4QIB A;  4MNL A;  3O5D A;  3RM9 A;  1W1V A;  2DG4 A;  2FAP A;  3RGC A;  2O9O A;  1W1P A;  1P5Q A;  4ZPV R;  1NWT A;  3OA5 A;  5I98 A;  3GU0 A;  1Q1C A;  2LJ4 A;  4KR0 B;  3ARP A;  2ZQS A;  4HBO A;  3ARZ A;  1ZCN A;  1FKK A;  1K9T A;  4JFM A;  5HW8 A;  2MPH A;  3KAC A;  4MNK A;  3WH0 A;  2PI6 A;  3MDY B;  1XRV A;  4Z2L A;  3KCE A;  4XAK A;  4URI A;  4JFJ A;  2A3A A;  1QZ2 A;  2RUC A;  2DSZ A;  4P8U A;  3FY1 A;  4MGV A;  1T11 A;  2F2D A;  3FAP A;  4HBE A;  3EY6 A;  4BF8 A;  4LAV A;  3ART A;  3UI6 A;  1HJW A;  3O5F A;  2Y78 A;  3JYM A;  3AS2 A;  1LJY A;  1ZU8 A;  3B9E A;  2ITK A;  3PRB A;  1TFV A;  3CH9 A;  4DRO A;  3ARX A;  4DRH A;  1B6C A;  2M2A A;  4MTV A;  1HXV A;  4O2T A;  5B8I C;  1BKF A;  1W9U A;  2MLY A;  1E6N A;  2WM0 A;  1OWQ A;  3PR9 A;  1OGG A;  3AS3 A;  2M1I A;  3ARO A;  4ODP A;  2P4V A;  3WQV A;  2RUD A;  1QPL A;  1JCH B;  2XP8 A;  1L1P A;  3UQB A;  1J4H A;  3WD1 A;  2D9F A;  2LKN A;  5DIU A;  1LL4 A;  4DRQ A;  3B8S A;  3FXY A;  3OOB A;  2LGO A;  2ZQV A;  2PV3 A;  1FKD A;  4G50 A;  3GTY X;  3ARV A;  2XPB A;  2KGJ A;  5DIT A;  5GPG A;  2RUQ A;  1HKM A;  3O5P A;  4MSP A;  3O5K A;  4AY1 A;  2DG3 A;  3O5M A;  4TW7 A;  4W5U A;  2PV1 A;  4QZV B;  1XHG A;  1EDQ A;  4ODK A;  4WIW A;  2FDM A;  4W9O A;  1NMW A;  2RUR A;  1HKI A;  4ODR A;  2DT1 A;  2WLZ A; 
#chains in the Genus database with same CATH homology
 1E6P A;  3KAB A;  4DRM A;  4G2P A;  4DRN A;  5DEZ A;  1W9P A;  2O92 A;  3I6C A;  4MAV A;  4Z2G A;  1ITX A;  1ZL1 A;  1PIN A;  2YBU A;  4ZPT R;  2DG9 A;  4Z2I A;  1A7X A;  4LAY A;  3G6L A;  2WK2 A;  4FN2 A;  4NSB A;  4P8W A;  1WAW A;  2PPO A;  2AWG A;  1FKB A;  3CHC A;  1NWU A;  3CHE A;  2OLH A;  4TX0 A;  2XP9 A;  4MPK A;  2F4E A;  2DT0 A;  1W9V A;  2DSU A;  4NNR A;  1JVW A;  2VN1 A;  2YBT A;  4TNS A;  1LQ0 A;  3RM8 A;  1E9L A;  1N1A A;  2XP4 A;  1W26 A;  1FFQ A;  3AQU A;  3CZ8 A;  3IKG A;  1TCO C;  4R5E A;  2MNT A;  1ZBV A;  2RQS A;  3ARQ A;  4DH0 A;  1FKI A;  4DWS B;  1NH6 A;  1VF8 A;  3O5Q A;  5GPR A;  1RD6 A;  4Q22 A;  3AS0 A;  2RSE A;  1KFW A;  3WD2 A;  4IT4 A;  3ARU A;  1EIB A;  4IQC A;  1GPF A;  4HAR A;  1ZBW A;  4Q7N A;  1SR0 A;  3WD3 A;  1OGB A;  1GUV A;  2A3B A;  3WQW A;  1YAT A;  2DPE A;  3IK8 A;  3WL0 A;  4Z2K A;  4DWS D;  4MNJ A;  1J6Y A;  1CTN A;  3ALG A;  4L72 B;  4WK9 A;  5HT1 A;  4WJX A;  3JYJ A;  4Z2H A;  3O5E A;  3O5L A;  3CHF A;  1H0G A;  3WL1 A;  4U85 A;  1KT1 A;  4ODQ A;  2KI3 A;  4ODM A;  3KAH A;  2ZR5 A;  3PA7 A;  3BXW A;  2A3C A;  2PV2 A;  1NMV A;  3WD0 A;  3GPK A;  2PPN A;  3CGN A;  4N19 A;  4DRK A;  3NTP A;  4J4O A;  2DSW A;  4DIP A;  3ODK A;  1BL4 A;  3UF8 A;  3PRD A;  1W1Y A;  2VCD A;  5HBF A;  3PRA A;  2F21 A;  1ZBC A;  5JH8 A;  4IT6 A;  2MLX A;  4MNM A;  1Q6U A;  2A3E A;  3O5R A;  3B7X A;  1IX5 A;  4U84 A;  1NWR A;  3WKZ A;  1M5Y A;  1PBK A;  1NSG A;  1HKJ A;  2XPA A;  1EHN A;  4WKA A;  3IKD A;  2JZV A;  2N87 A;  3KAG A;  3WIJ A;  5HKG A;  2IF4 A;  3RM4 A;  1JNT A;  4DZ3 A;  2K8I A;  2MF9 A;  2XP7 A;  1FKF A;  5HTG A;  3TDB A;  4LAW A;  4TW6 A;  4QT2 A;  3ARW A;  3RME A;  1D7J A;  2FKE A;  2MLZ A;  1WB0 A;  2L2S A;  3QOK A;  3UQI A;  4R0X A;  1ROU A;  5DO2 A;  4DRP A;  1W1T A;  1ZBK A;  4TW8 A;  1UR8 A;  3CHD A;  2PBC A;  2PPP A;  1EQ3 A;  1HKK A;  1FKT A;  3O5J A;  4L3N A;  1SYT A;  1LG1 A;  5HUA A;  4JFK A;  4P8X A;  1KT0 A;  4S3J A;  2ESC A;  3IHZ A;  1E6R A;  3H9R B;  3O5I A;  1EYM A;  1Q6I A;  1D7H A;  4C02 B;  1H0I A;  1R9H A;  2QF8 A;  3NI6 A;  3W4R A;  4PTM A;  1LL7 A;  4ITZ A;  2ZR4 A;  4ODN A;  1C9H A;  4DWS A;  4FAP A;  5HWC A;  3CGM A;  2KR7 A;  1FFR A;  4DRJ A;  1E15 A;  2UZ5 A;  1J4I A;  4P8V A;  1D2K A;  1Q6H A;  4ODO A;  3ARS A;  3ARY A;  3UQA A;  2XP5 A;  4IPX A;  1NWS A;  1D7I A;  2ZR6 A;  3ALF A;  4TYO A;  4JYS A;  5DF0 A;  5HW7 A;  2KFW A;  3O5O A;  3G6M A;  1FAP A;  1HJV A;  1UR9 A;  2WLY A;  4WKF A;  1FJD A;  2Q5A A;  5DIV A;  1LL6 A;  4JFL A;  1F40 A;  3RFW A;  2B31 A;  3WD4 A;  2DT3 A;  2XP3 A;  1WNO A;  2M08 A;  3O5G A;  2IUZ A;  3NRK A;  1GOI A;  4DRI A;  4ZPW R;  1QPF A;  3KZ7 A;  3TC5 A;  1ZK6 A;  2ZQU A;  5BXJ A;  1F8A B;  5D75 A;  4KQZ A;  2ZQT A;  4W9Q A;  4ODL A;  4DZ2 A;  3ARR A;  1X6N A;  1FKL A;  3TCZ A;  2AOS A;  4W9P A;  4S3K A;  1ZB5 A;  1FKJ A;  4U86 A;  5GQB A;  4ZS6 A;  4DT4 A;  1FD9 A;  5HWB A;  1X6L A;  3AS1 A;  3JXV A;  2DSV A;  1JND A;  1O6I A;  2OFN A;  1HJX A;  2KE0 A;  4NZC A;  1FKR A;  3KAD A;  3B9A A;  4GIV A;  4QT3 A;  1E6Z A;  1FKS A;  1YW5 A;  4LGX A;  4LAX A;  4WKH A;  2G41 A;  3VAW A;  3UI5 A;  1Y0O A;  4GGQ A;  2XP6 A;  1FKG A;  1JNS A;  2KO7 A;  3B9D A;  3UI4 A;  3LUO A;  4JFI A;  5J6E A;  5HW6 A;  2DT2 A;  1ROT A;  1U79 A;  1D6O A;  4J4N A;  2G8Z A;  1JNE A;  1J4R A;  4DWS C;  2LPV A;  1FKH A;  3KAF A;  4ML4 A;  1LG2 A;  4Z2J A;  4IQ2 A;  3KAI A;  4QIB A;  4MNL A;  3O5D A;  3RM9 A;  1W1V A;  2DG4 A;  2FAP A;  3RGC A;  2O9O A;  1W1P A;  1P5Q A;  4ZPV R;  1NWT A;  3OA5 A;  5I98 A;  1Q1C A;  2LJ4 A;  4KR0 B;  3ARP A;  2ZQS A;  4HBO A;  3ARZ A;  1ZCN A;  1FKK A;  1K9T A;  4JFM A;  5HW8 A;  2MPH A;  3KAC A;  4MNK A;  3WH0 A;  2PI6 A;  3MDY B;  1XRV A;  4Z2L A;  3KCE A;  4XAK A;  4URI A;  4JFJ A;  2A3A A;  1QZ2 A;  2RUC A;  2DSZ A;  4P8U A;  3FY1 A;  4MGV A;  1T11 A;  2F2D A;  3FAP A;  4HBE A;  3EY6 A;  4BF8 A;  4LAV A;  3ART A;  3UI6 A;  1HJW A;  3O5F A;  2Y78 A;  3JYM A;  3AS2 A;  1LJY A;  1ZU8 A;  3B9E A;  2ITK A;  3PRB A;  1TFV A;  3CH9 A;  4DRO A;  3ARX A;  4DRH A;  1B6C A;  2M2A A;  4MTV A;  1HXV A;  4O2T A;  5B8I C;  1BKF A;  1W9U A;  2MLY A;  1E6N A;  2WM0 A;  1OWQ A;  3PR9 A;  1OGG A;  3AS3 A;  2M1I A;  3ARO A;  4ODP A;  3WQV A;  2RUD A;  1QPL A;  2XP8 A;  1L1P A;  3UQB A;  1J4H A;  3WD1 A;  2D9F A;  2LKN A;  5DIU A;  1LL4 A;  4DRQ A;  3B8S A;  3FXY A;  3OOB A;  2LGO A;  2ZQV A;  2PV3 A;  1FKD A;  4G50 A;  3ARV A;  2XPB A;  2KGJ A;  5DIT A;  5GPG A;  2RUQ A;  1HKM A;  3O5P A;  4MSP A;  3O5K A;  4AY1 A;  2DG3 A;  3O5M A;  4TW7 A;  4W5U A;  2PV1 A;  4QZV B;  1XHG A;  1EDQ A;  4ODK A;  4WIW A;  2FDM A;  4W9O A;  1NMW A;  2RUR A;  1HKI A;  4ODR A;  2DT1 A;  2WLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...