3O5EA

Fk1 domain of fkbp51, crystal form vi
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
SPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 31
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5eA00
3KAHA 3O5IA 2RUQA 1FAPA 2RURA 2ZQVA 3O5GA 1YW5A 5HW8A 1FKIA 2MLXA 2ZQUA 1N1AA 1J4HA 4W9QA 2F2DA 3NRKA 4JFKA 2XP9A 1F8AB 3KACA 2RQSA 4J4NA 4GGQA 5GPGA 4DRNA 1QPFA 4NNRA 4TW6A 3UI6A 1TCOC 1FKSA 3JXVA 3UI4A 4DRHA 4QT2A 5DIUA 3IK8A 4DRMA 3B7XA 4DZ3A 2LGOA 3WH0A 1F40A 3PRBA 1FJDA 3UQBA 3NI6A 4QT3A 2L2SA 3KADA 2ZQSA 1KT1A 4JFJA 3O5JA 4R0XA 5HWCA 1Y0OA 1EQ3A 2K8IA 3KAFA 3PRDA 4U85A 3PA7A 2DG9A 2IF4A 5BXJA 1ROTA 2UZ5A 3UI5A 2PV2A 1EYMA 1HXVA 1NSGA 2XPAA 2XPBA 4ODLA 2LKNA 3LUOA 2ZR4A 4FN2A 2XP6A 1L1PA 2XP5A 3O5MA 2M08A 1T11A 1FKLA 3RFWA 3O5QA 3O5PA 2PPNA 2MNTA 3JYJA 5D75A 2KR7A 1D7JA 2PBCA 1FKGA 4DRIA 4TW8A 5HUAA 2MLZA 3FAPA 1BKFA 2RUDA 2ZR5A 4JFLA 3UQAA 3O5FA 2KFWA 3KAIA 4ODRA 1R9HA 5HW7A 2RSEA 3MDYB 3KAGA 2MLYA 2MPHA 5HT1A 2N87A 3UQIA 4LAYA 3O5KA 3KZ7A 1QPLA 2M1IA 3O5OA 1Q6HA 1Q6IA 1FKBA 1B6CA 2PPPA 3O5LA 2LJ4A 1FKFA 2D9FA 5HWBA 2VCDA 4JFIA 4U86A 1FKTA 1NMWA 4TW7A 4ODNA 3TC5A 1NMVA 4LAXA 2AWGA 1BL4A 4W9PA 5I98A 3VAWA 1P5QA 2XP8A 1FKDA 2FAPA 4ODPA 3O5DA 1QZ2A 3UF8A 2JZVA 4DRKA 3JYMA 2ZQTA 1YATA 1KT0A 4ODQA 2KO7A 2XP3A 1D6OA 5HW6A 4ODMA 3EY6A 4J4OA 4JYSA 3IKDA 4W9OA 4DRQA 5HTGA 1W26A 2OFNA 1PINA 3H9RB 3ODKA 2DG4A 1FD9A 4MGVA 1J6YA 3IKGA 1J4IA 2VN1A 2XP4A 4ODKA 4IQ2A 2PPOA 2PV3A 4N19A 2ITKA 4ODOA 4C02B 3IHZA 4BF8A 3O5EA 3OOBA 1M5YA 2PV1A 2Y78A 4QIBA 4DRJA 2Q5AA 1ROUA 3O5RA 1FKJA 1Q1CA 4DROA 4DT4A 1ZK6A 1FKRA 5HKGA 3KABA 4LAVA 4LAWA 1C9HA 2DG3A 4O2TA 1Q6UA 2RUCA 4IPXA 3RGCA 4DH0A 3NTPA 4G50A 5DITA 4FAPA 5DIVA 1FKKA 4DRPA 4TYOA 1ZCNA 3CGMA 1JNSA 4MSPA 2KE0A 3CGNA 3TDBA 2KGJA 3I6CA 1JVWA 4U84A 4TNSA 3TCZA 4G2PA 2F4EA 4DZ2A 1J4RA 2ZR6A 2LPVA 4JFMA 2FKEA 2KI3A 5J6EA 4TX0A 1FKHA 4ITZA 2M2AA 2F21A 1A7XA 3KCEA 4GIVA 1D7HA 2XP7A 1JNTA 1U79A 4DIPA 3GPKA 5B8IC 2MF9A 1PBKA 1D7IA 4IQCA
chains in the Genus database with same CATH superfamily
3KAHA 3O5IA 3O5GA 1NWTA 2ZQUA 3ALFA 1ZU8A 4W9QA 2XP9A 1F8AB 2PN0A 3KACA 5GPGA 1HKJA 1FKSA 3WD1A 4QT2A 1LQ0A 1FJDA 3WH0A 1OWQA 3UQBA 2L2SA 1RD6A 1Y0OA 2K8IA 1W1VA 1E15A 2B31A 5BXJA 1ROTA 2IUZA 2PV2A 1GPFA 4HBEA 1HXVA 4FN2A 5DEZA 1EIBA 1T11A 2O9OA 4MPKA 2KR7A 2A3CA 1FKGA 2A3BA 2A3EA 1BKFA 4Z2IA 3B8SA 3KAIA 5HW7A 3UQIA 3O5KA 1QPLA 3O5OA 3GU0A 2LJ4A 2D9FA 2P4VA 4U86A 1NMWA 2ETNA 3G6LA 1W1PA 4ODNA 4UDMA 5HBFA 4ODPA 3O5DA 1QZ2A 3JYMA 2ZQTA 3CHFA 2PI6A 4DWSD 4ODQA 3B9EA 2KO7A 2XP3A 5HW6A 4J4OA 4W9OA 2FDMA 1W26A 3WIJA 4MGVA 3RM4A 4N19A 4C02B 4AY1A 3IHZA 3OOBA 3PR9A 1ROUA 4WKAA 3RMEA 1CTNA 1E6ZA 2WM0A 4O2TA 4G50A 4FAPA 1LG2A 4TYOA 1O6IA 3TDBA 2KE0A 3AS2A 4ZPTR 3TCZA 1E9LA 2F4EA 4DZ2A 2LPVA 3ARWA 2KI3A 5J6EA 3CHDA 4ITZA 4TX0A 1HKKA 4WKFA 3CZ8A 1JNTA 1SYTA 1KFWA 2ZQVA 1HJWA 1NWUA 1LG1A 2MLXA 3AS0A 2F2DA 3NRKA 4J4NA 3BXWA 4MTVA 4DRNA 3FXYA 4DWSB 3UI4A 4WK9A 3IK8A 2LGOA 3NI6A 4QT3A 1H0GA 1KT1A 4JFJA 3O5JA 4R0XA 5HWCA 1E44A 3PRDA 3PA7A 3UI5A 3ARZA 1VF8A 3ARQA 1JNEA 2XPAA 2XPBA 4ODLA 4WIWA 4P8XA 2WK2A 1L1PA 4ZPWR 1NH6A 4Z2HA 2A3AA 2PPNA 5D75A 4DRIA 4TW8A 3AROA 2KFWA 3ARXA 1R9HA 3KAGA 2MPHA 1JNDA 4LAYA 1FFRA 2M1IA 1Q6IA 1TFVA 5HWBA 1WB0A 4JFIA 1FKTA 3TC5A 3WD0A 4W9PA 3AQUA 5I98A 1X6NA 3UF8A 1IX5A 1YATA 1KT0A 1K9TA 4IT4A 3H9RB 2OFNA 1PINA 2G41A 1FD9A 1GUVA 4ODKA 2ITKA 3O5EA 4P8VA 1M5YA 4NSBA 2Y78A 2Q5AA 1FKJA 4DT4A 1FKRA 3KABA 1C9HA 1Q6UA 3RGCA 1ZBCA 5DITA 1FKKA 5GPRA 1W9PA 1JNSA 1JVWA 1UR9A 3BMBA 4JFMA 4MNMA 4R5EA 4P8WA 1LL4A 4DWSA 1D7HA 2XP7A 2B5UB 1HJXA 4DIPA 5B8IC 1W1TA 1PBKA 3WL0A 4IQCA 2RUQA 1FAPA 4P8UA 1YW5A 3WQVA 5HW8A 1FKIA 1N1AA 2DSVA 2DT2A 4PTMA 4JFKA 4MNKA 2DT3A 2RQSA 4GGQA 3PRAA 1QPFA 3UI6A 4TW6A 1TCOC 1XHGA 4DRHA 4Z2JA 4DZ3A 1ITXA 3PRBA 1E6PA 1OGGA 3KAFA 1EDQA 5DF0A 4U85A 2DSUA 2DG9A 1EHNA 2UZ5A 4Z2GA 1EYMA 3ARVA 3RM9A 1W1YA 2EULA 3LUOA 1UR8A 2ZR4A 2M08A 1FKLA 3AS3A 3O5PA 1D7JA 2PBCA 1D2KA 5HUAA 2MLZA 3FAPA 2RUDA 4JFLA 4WJXA 3UQAA 2QF8A 2OLHA 3MDYB 3ARUA 2MLYA 2N87A 3ARYA 3KZ7A 1B6CA 1W9VA 1FKFA 2VCDA 1ZBKA 4L72B 4LGXA 4LAXA 4Z2KA 1P5QA 2XP8A 1FKDA 3QOKA 3FY1A 2O92A 4W5UA 1D6OA 5HTGA 3IKDA 4DRQA 1J6YA 3GTYX 3IKGA 1J4IA 2VN1A 4IQ2A 3AS1A 2G8ZA 2PPOA 1ZBWA 4ODOA 4WKHA 1LL6A 4Z2LA 2PV1A 4QIBA 4DRJA 1HKIA 1ZB5A 3O5RA 1Q1CA 4DROA 1ZK6A 4KR0B 5GQBA 4MAVA 3G6MA 2RUCA 4ML4A 1H0IA 5DIVA 1NWRA 4DRPA 1W9UA 4MSPA 1XRVA 2DT0A 3CGNA 4Q22A 3I6CA 4U84A 4TNSA 4G2PA 3WKZA 1X6LA 1FKHA 3WQWA 2M2AA 2F21A 3KCEA 3B9DA 1SR0A 3WD2A 1U79A 3GPKA 1E6RA 1GRJA 3ALGA 4LAWA 2RURA 3EIPA 4HBOA 3B9AA 4XAKA 1J4HA 4HARA 4NZCA 4NNRA 4IT6A 3JXVA 1OGBA 2DSWA 5DIUA 4DRMA 3B7XA 1F40A 4MNJA 3ARPA 3KADA 2YBTA 2ZQSA 1EQ3A 3ARSA 1FFQA 1ZBVA 1HKMA 4ZPVR 2IF4A 4S3JA 2DPEA 1NSGA 2WLZA 3WD3A 5JH8A 2LKNA 4DWSC 1WNOA 2XP6A 2XP5A 3O5MA 1GOIA 3RFWA 3O5QA 2F23A 1LJYA 2MNTA 3JYJA 4URIA 4S3KA 1E6NA 2ZR5A 1LL7A 3O5FA 3W4RA 1WAWA 2RSEA 2YBUA 5HT1A 4QZVB 1Q6HA 1FKBA 2PPPA 3O5LA 4Q7NA 4TW7A 1NMVA 2AWGA 1BL4A 3VAWA 3CHEA 2FAPA 1NWSA 4DRKA 2JZVA 4MNLA 1JCHB 3WL1A 4L3NA 3EY6A 4JYSA 4ODMA 1HJVA 1ZL1A 3ODKA 2DG4A 2WLYA 2XP4A 2AOSA 2PV3A 2DT1A 2ESCA 3RM8A 4BF8A 3WD4A 5HKGA 4LAVA 5DO2A 2DG3A 4KQZA 4ZS6A 4IPXA 4DH0A 3NTPA 3ARRA 2DSZA 1ZCNA 3CGMA 2KGJA 3CH9A 1J4RA 2ZR6A 2FKEA 3CHCA 1A7XA 4GIVA 3OA5A 2MF9A 1D7IA 4ODRA 3ARTA
chains in the Genus database with same CATH topology
3KAHA 3O5IA 3O5GA 1NWTA 2ZQUA 3ALFA 1ZU8A 4W9QA 2XP9A 1F8AB 3KACA 5GPGA 1HKJA 1FKSA 3WD1A 4QT2A 1LQ0A 1FJDA 3WH0A 1OWQA 3UQBA 2L2SA 1RD6A 1Y0OA 2K8IA 1W1VA 1E15A 2B31A 5BXJA 1ROTA 2IUZA 2PV2A 1GPFA 4HBEA 1HXVA 4FN2A 5DEZA 1EIBA 1T11A 2O9OA 4MPKA 2KR7A 2A3CA 1FKGA 2A3BA 2A3EA 1BKFA 4Z2IA 3B8SA 3KAIA 5HW7A 3UQIA 3O5KA 1QPLA 3O5OA 2LJ4A 2D9FA 4U86A 1NMWA 3G6LA 1W1PA 4ODNA 5HBFA 4ODPA 3O5DA 1QZ2A 3JYMA 2ZQTA 3CHFA 2PI6A 4DWSD 4ODQA 3B9EA 2KO7A 2XP3A 5HW6A 4J4OA 4W9OA 2FDMA 1W26A 3WIJA 4MGVA 3RM4A 4N19A 4C02B 4AY1A 3IHZA 3OOBA 3PR9A 1ROUA 4WKAA 3RMEA 1CTNA 1E6ZA 2WM0A 4O2TA 4G50A 4FAPA 1LG2A 4TYOA 1O6IA 3TDBA 2KE0A 3AS2A 4ZPTR 3TCZA 1E9LA 2F4EA 4DZ2A 2LPVA 3ARWA 2KI3A 5J6EA 3CHDA 4ITZA 4TX0A 1HKKA 4WKFA 3CZ8A 1JNTA 1SYTA 1KFWA 2ZQVA 1HJWA 1NWUA 1LG1A 2MLXA 3AS0A 2F2DA 3NRKA 4J4NA 3BXWA 4MTVA 4DRNA 3FXYA 4DWSB 3UI4A 4WK9A 3IK8A 2LGOA 3NI6A 4QT3A 1H0GA 1KT1A 4JFJA 3O5JA 4R0XA 5HWCA 3PRDA 3PA7A 3UI5A 3ARZA 1VF8A 3ARQA 1JNEA 2XPAA 2XPBA 4ODLA 4WIWA 4P8XA 2WK2A 1L1PA 4ZPWR 1NH6A 4Z2HA 2A3AA 2PPNA 5D75A 4DRIA 4TW8A 3AROA 2KFWA 3ARXA 1R9HA 3KAGA 2MPHA 1JNDA 4LAYA 1FFRA 2M1IA 1Q6IA 1TFVA 5HWBA 1WB0A 4JFIA 1FKTA 3TC5A 3WD0A 4W9PA 3AQUA 5I98A 1X6NA 3UF8A 1IX5A 1YATA 1KT0A 1K9TA 4IT4A 3H9RB 2OFNA 1PINA 2G41A 1FD9A 1GUVA 4ODKA 2ITKA 3O5EA 4P8VA 1M5YA 4NSBA 2Y78A 2Q5AA 1FKJA 4DT4A 1FKRA 3KABA 1C9HA 1Q6UA 3RGCA 1ZBCA 5DITA 1FKKA 5GPRA 1W9PA 1JNSA 1JVWA 1UR9A 4JFMA 4MNMA 4R5EA 4P8WA 1LL4A 4DWSA 1D7HA 2XP7A 1HJXA 4DIPA 5B8IC 1W1TA 1PBKA 3WL0A 4IQCA 2RUQA 1FAPA 4P8UA 1YW5A 3WQVA 5HW8A 1FKIA 1N1AA 2DSVA 2DT2A 4PTMA 4JFKA 4MNKA 2DT3A 2RQSA 4GGQA 3PRAA 1QPFA 3UI6A 4TW6A 1TCOC 1XHGA 4DRHA 4Z2JA 4DZ3A 1ITXA 3PRBA 1E6PA 1OGGA 3KAFA 1EDQA 5DF0A 4U85A 2DSUA 2DG9A 1EHNA 2UZ5A 4Z2GA 1EYMA 3ARVA 3RM9A 1W1YA 3LUOA 1UR8A 2ZR4A 2M08A 1FKLA 3AS3A 3O5PA 1D7JA 2PBCA 1D2KA 5HUAA 2MLZA 3FAPA 2RUDA 4JFLA 4WJXA 3UQAA 2QF8A 2OLHA 3MDYB 3ARUA 2MLYA 2N87A 3ARYA 3KZ7A 1B6CA 1W9VA 1FKFA 2VCDA 1ZBKA 4L72B 4LGXA 4LAXA 4Z2KA 1P5QA 2XP8A 1FKDA 3QOKA 3FY1A 2O92A 4W5UA 1D6OA 5HTGA 3IKDA 4DRQA 1J6YA 3IKGA 1J4IA 2VN1A 4IQ2A 3AS1A 2G8ZA 2PPOA 1ZBWA 4ODOA 4WKHA 1LL6A 4Z2LA 2PV1A 4QIBA 4DRJA 1HKIA 1ZB5A 3O5RA 1Q1CA 4DROA 1ZK6A 4KR0B 5GQBA 4MAVA 3G6MA 2RUCA 4ML4A 1H0IA 5DIVA 1NWRA 4DRPA 1W9UA 4MSPA 1XRVA 2DT0A 3CGNA 4Q22A 3I6CA 4U84A 4TNSA 4G2PA 3WKZA 1X6LA 1FKHA 3WQWA 2M2AA 2F21A 3KCEA 3B9DA 1SR0A 3WD2A 1U79A 3GPKA 1E6RA 3ALGA 4LAWA 2RURA 4HBOA 3B9AA 4XAKA 1J4HA 4HARA 4NZCA 4NNRA 4IT6A 3JXVA 1OGBA 2DSWA 5DIUA 4DRMA 3B7XA 1F40A 4MNJA 3ARPA 3KADA 2YBTA 2ZQSA 1EQ3A 3ARSA 1FFQA 1ZBVA 1HKMA 4ZPVR 2IF4A 4S3JA 2DPEA 1NSGA 2WLZA 3WD3A 5JH8A 2LKNA 4DWSC 1WNOA 2XP6A 2XP5A 3O5MA 1GOIA 3RFWA 3O5QA 1LJYA 2MNTA 3JYJA 4URIA 4S3KA 1E6NA 2ZR5A 1LL7A 3O5FA 3W4RA 1WAWA 2RSEA 2YBUA 5HT1A 4QZVB 1Q6HA 1FKBA 2PPPA 3O5LA 4Q7NA 4TW7A 1NMVA 2AWGA 1BL4A 3VAWA 3CHEA 2FAPA 1NWSA 4DRKA 2JZVA 4MNLA 3WL1A 4L3NA 3EY6A 4JYSA 4ODMA 1HJVA 1ZL1A 3ODKA 2DG4A 2WLYA 2XP4A 2AOSA 2PV3A 2DT1A 2ESCA 3RM8A 4BF8A 3WD4A 5HKGA 4LAVA 5DO2A 2DG3A 4KQZA 4ZS6A 4IPXA 4DH0A 3NTPA 3ARRA 2DSZA 1ZCNA 3CGMA 2KGJA 3CH9A 1J4RA 2ZR6A 2FKEA 3CHCA 1A7XA 4GIVA 3OA5A 2MF9A 1D7IA 4ODRA 3ARTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAH A;  3O5I A;  2RUQ A;  1FAP A;  2RUR A;  2ZQV A;  3O5G A;  1YW5 A;  5HW8 A;  1FKI A;  2MLX A;  2ZQU A;  1N1A A;  1J4H A;  4W9Q A;  2F2D A;  3NRK A;  4JFK A;  2XP9 A;  1F8A B;  3KAC A;  2RQS A;  4J4N A;  4GGQ A;  5GPG A;  4DRN A;  1QPF A;  4NNR A;  4TW6 A;  3UI6 A;  1TCO C;  1FKS A;  3JXV A;  3UI4 A;  4DRH A;  4QT2 A;  5DIU A;  3IK8 A;  4DRM A;  3B7X A;  4DZ3 A;  2LGO A;  3WH0 A;  1F40 A;  3PRB A;  1FJD A;  3UQB A;  3NI6 A;  4QT3 A;  2L2S A;  3KAD A;  2ZQS A;  1KT1 A;  4JFJ A;  3O5J A;  4R0X A;  5HWC A;  1Y0O A;  1EQ3 A;  2K8I A;  3KAF A;  3PRD A;  4U85 A;  3PA7 A;  2DG9 A;  2IF4 A;  5BXJ A;  1ROT A;  2UZ5 A;  3UI5 A;  2PV2 A;  1EYM A;  1HXV A;  1NSG A;  2XPA A;  2XPB A;  4ODL A;  2LKN A;  3LUO A;  2ZR4 A;  4FN2 A;  2XP6 A;  1L1P A;  2XP5 A;  3O5M A;  2M08 A;  1T11 A;  1FKL A;  3RFW A;  3O5Q A;  3O5P A;  2PPN A;  2MNT A;  3JYJ A;  5D75 A;  2KR7 A;  1D7J A;  2PBC A;  1FKG A;  4DRI A;  4TW8 A;  5HUA A;  2MLZ A;  3FAP A;  1BKF A;  2RUD A;  2ZR5 A;  4JFL A;  3UQA A;  3O5F A;  2KFW A;  3KAI A;  4ODR A;  1R9H A;  5HW7 A;  2RSE A;  3MDY B;  3KAG A;  2MLY A;  2MPH A;  5HT1 A;  2N87 A;  3UQI A;  4LAY A;  3O5K A;  3KZ7 A;  1QPL A;  2M1I A;  3O5O A;  1Q6H A;  1Q6I A;  1FKB A;  1B6C A;  2PPP A;  3O5L A;  2LJ4 A;  1FKF A;  2D9F A;  5HWB A;  2VCD A;  4JFI A;  4U86 A;  1FKT A;  1NMW A;  4TW7 A;  4ODN A;  3TC5 A;  1NMV A;  4LAX A;  2AWG A;  1BL4 A;  4W9P A;  5I98 A;  3VAW A;  1P5Q A;  2XP8 A;  1FKD A;  2FAP A;  4ODP A;  3O5D A;  1QZ2 A;  3UF8 A;  2JZV A;  4DRK A;  3JYM A;  2ZQT A;  1YAT A;  1KT0 A;  4ODQ A;  2KO7 A;  2XP3 A;  1D6O A;  5HW6 A;  4ODM A;  3EY6 A;  4J4O A;  4JYS A;  3IKD A;  4W9O A;  4DRQ A;  5HTG A;  1W26 A;  2OFN A;  1PIN A;  3H9R B;  3ODK A;  2DG4 A;  1FD9 A;  4MGV A;  1J6Y A;  3IKG A;  1J4I A;  2VN1 A;  2XP4 A;  4ODK A;  4IQ2 A;  2PPO A;  2PV3 A;  4N19 A;  2ITK A;  4ODO A;  4C02 B;  3IHZ A;  4BF8 A;  3O5E A;  3OOB A;  1M5Y A;  2PV1 A;  2Y78 A;  4QIB A;  4DRJ A;  2Q5A A;  1ROU A;  3O5R A;  1FKJ A;  1Q1C A;  4DRO A;  4DT4 A;  1ZK6 A;  1FKR A;  5HKG A;  3KAB A;  4LAV A;  4LAW A;  1C9H A;  2DG3 A;  4O2T A;  1Q6U A;  2RUC A;  4IPX A;  3RGC A;  4DH0 A;  3NTP A;  4G50 A;  5DIT A;  4FAP A;  5DIV A;  1FKK A;  4DRP A;  4TYO A;  1ZCN A;  3CGM A;  1JNS A;  4MSP A;  2KE0 A;  3CGN A;  3TDB A;  2KGJ A;  3I6C A;  1JVW A;  4U84 A;  4TNS A;  3TCZ A;  4G2P A;  2F4E A;  4DZ2 A;  1J4R A;  2ZR6 A;  2LPV A;  4JFM A;  2FKE A;  2KI3 A;  5J6E A;  4TX0 A;  1FKH A;  4ITZ A;  2M2A A;  2F21 A;  1A7X A;  3KCE A;  4GIV A;  1D7H A;  2XP7 A;  1JNT A;  1U79 A;  4DIP A;  3GPK A;  5B8I C;  2MF9 A;  1PBK A;  1D7I A;  4IQC A; 
#chains in the Genus database with same CATH topology
 3KAH A;  3O5I A;  3O5G A;  1NWT A;  2ZQU A;  3ALF A;  1ZU8 A;  4W9Q A;  2XP9 A;  1F8A B;  2PN0 A;  3KAC A;  5GPG A;  1HKJ A;  1FKS A;  3WD1 A;  4QT2 A;  1LQ0 A;  1FJD A;  3WH0 A;  1OWQ A;  3UQB A;  2L2S A;  1RD6 A;  1Y0O A;  2K8I A;  1W1V A;  1E15 A;  2B31 A;  5BXJ A;  1ROT A;  2IUZ A;  2PV2 A;  1GPF A;  4HBE A;  1HXV A;  4FN2 A;  5DEZ A;  1EIB A;  1T11 A;  2O9O A;  4MPK A;  2KR7 A;  2A3C A;  1FKG A;  2A3B A;  2A3E A;  1BKF A;  4Z2I A;  3B8S A;  3KAI A;  5HW7 A;  3UQI A;  3O5K A;  1QPL A;  3O5O A;  3GU0 A;  2LJ4 A;  2D9F A;  2P4V A;  4U86 A;  1NMW A;  2ETN A;  3G6L A;  1W1P A;  4ODN A;  4UDM A;  5HBF A;  4ODP A;  3O5D A;  1QZ2 A;  3JYM A;  2ZQT A;  3CHF A;  2PI6 A;  4DWS D;  4ODQ A;  3B9E A;  2KO7 A;  2XP3 A;  5HW6 A;  4J4O A;  4W9O A;  2FDM A;  1W26 A;  3WIJ A;  4MGV A;  3RM4 A;  4N19 A;  4C02 B;  4AY1 A;  3IHZ A;  3OOB A;  3PR9 A;  1ROU A;  4WKA A;  3RME A;  1CTN A;  1E6Z A;  2WM0 A;  4O2T A;  4G50 A;  4FAP A;  1LG2 A;  4TYO A;  1O6I A;  3TDB A;  2KE0 A;  3AS2 A;  4ZPT R;  3TCZ A;  1E9L A;  2F4E A;  4DZ2 A;  2LPV A;  3ARW A;  2KI3 A;  5J6E A;  3CHD A;  4ITZ A;  4TX0 A;  1HKK A;  4WKF A;  3CZ8 A;  1JNT A;  1SYT A;  1KFW A;  2ZQV A;  1HJW A;  1NWU A;  1LG1 A;  2MLX A;  3AS0 A;  2F2D A;  3NRK A;  4J4N A;  3BXW A;  4MTV A;  4DRN A;  3FXY A;  4DWS B;  3UI4 A;  4WK9 A;  3IK8 A;  2LGO A;  3NI6 A;  4QT3 A;  1H0G A;  1KT1 A;  4JFJ A;  3O5J A;  4R0X A;  5HWC A;  1E44 A;  3PRD A;  3PA7 A;  3UI5 A;  3ARZ A;  1VF8 A;  3ARQ A;  1JNE A;  2XPA A;  2XPB A;  4ODL A;  4WIW A;  4P8X A;  2WK2 A;  1L1P A;  4ZPW R;  1NH6 A;  4Z2H A;  2A3A A;  2PPN A;  5D75 A;  4DRI A;  4TW8 A;  3ARO A;  2KFW A;  3ARX A;  1R9H A;  3KAG A;  2MPH A;  1JND A;  4LAY A;  1FFR A;  2M1I A;  1Q6I A;  1TFV A;  5HWB A;  1WB0 A;  4JFI A;  1FKT A;  3TC5 A;  3WD0 A;  4W9P A;  3AQU A;  5I98 A;  1X6N A;  3UF8 A;  1IX5 A;  1YAT A;  1KT0 A;  1K9T A;  4IT4 A;  3H9R B;  2OFN A;  1PIN A;  2G41 A;  1FD9 A;  1GUV A;  4ODK A;  2ITK A;  3O5E A;  4P8V A;  1M5Y A;  4NSB A;  2Y78 A;  2Q5A A;  1FKJ A;  4DT4 A;  1FKR A;  3KAB A;  1C9H A;  1Q6U A;  3RGC A;  1ZBC A;  5DIT A;  1FKK A;  5GPR A;  1W9P A;  1JNS A;  1JVW A;  1UR9 A;  3BMB A;  4JFM A;  4MNM A;  4R5E A;  4P8W A;  1LL4 A;  4DWS A;  1D7H A;  2XP7 A;  2B5U B;  1HJX A;  4DIP A;  5B8I C;  1W1T A;  1PBK A;  3WL0 A;  4IQC A;  2RUQ A;  1FAP A;  4P8U A;  1YW5 A;  3WQV A;  5HW8 A;  1FKI A;  1N1A A;  2DSV A;  2DT2 A;  4PTM A;  4JFK A;  4MNK A;  2DT3 A;  2RQS A;  4GGQ A;  3PRA A;  1QPF A;  3UI6 A;  4TW6 A;  1TCO C;  1XHG A;  4DRH A;  4Z2J A;  4DZ3 A;  1ITX A;  3PRB A;  1E6P A;  1OGG A;  3KAF A;  1EDQ A;  5DF0 A;  4U85 A;  2DSU A;  2DG9 A;  1EHN A;  2UZ5 A;  4Z2G A;  1EYM A;  3ARV A;  3RM9 A;  1W1Y A;  2EUL A;  3LUO A;  1UR8 A;  2ZR4 A;  2M08 A;  1FKL A;  3AS3 A;  3O5P A;  1D7J A;  2PBC A;  1D2K A;  5HUA A;  2MLZ A;  3FAP A;  2RUD A;  4JFL A;  4WJX A;  3UQA A;  2QF8 A;  2OLH A;  3MDY B;  3ARU A;  2MLY A;  2N87 A;  3ARY A;  3KZ7 A;  1B6C A;  1W9V A;  1FKF A;  2VCD A;  1ZBK A;  4L72 B;  4LGX A;  4LAX A;  4Z2K A;  1P5Q A;  2XP8 A;  1FKD A;  3QOK A;  3FY1 A;  2O92 A;  4W5U A;  1D6O A;  5HTG A;  3IKD A;  4DRQ A;  1J6Y A;  3GTY X;  3IKG A;  1J4I A;  2VN1 A;  4IQ2 A;  3AS1 A;  2G8Z A;  2PPO A;  1ZBW A;  4ODO A;  4WKH A;  1LL6 A;  4Z2L A;  2PV1 A;  4QIB A;  4DRJ A;  1HKI A;  1ZB5 A;  3O5R A;  1Q1C A;  4DRO A;  1ZK6 A;  4KR0 B;  5GQB A;  4MAV A;  3G6M A;  2RUC A;  4ML4 A;  1H0I A;  5DIV A;  1NWR A;  4DRP A;  1W9U A;  4MSP A;  1XRV A;  2DT0 A;  3CGN A;  4Q22 A;  3I6C A;  4U84 A;  4TNS A;  4G2P A;  3WKZ A;  1X6L A;  1FKH A;  3WQW A;  2M2A A;  2F21 A;  3KCE A;  3B9D A;  1SR0 A;  3WD2 A;  1U79 A;  3GPK A;  1E6R A;  1GRJ A;  3ALG A;  4LAW A;  2RUR A;  3EIP A;  4HBO A;  3B9A A;  4XAK A;  1J4H A;  4HAR A;  4NZC A;  4NNR A;  4IT6 A;  3JXV A;  1OGB A;  2DSW A;  5DIU A;  4DRM A;  3B7X A;  1F40 A;  4MNJ A;  3ARP A;  3KAD A;  2YBT A;  2ZQS A;  1EQ3 A;  3ARS A;  1FFQ A;  1ZBV A;  1HKM A;  4ZPV R;  2IF4 A;  4S3J A;  2DPE A;  1NSG A;  2WLZ A;  3WD3 A;  5JH8 A;  2LKN A;  4DWS C;  1WNO A;  2XP6 A;  2XP5 A;  3O5M A;  1GOI A;  3RFW A;  3O5Q A;  2F23 A;  1LJY A;  2MNT A;  3JYJ A;  4URI A;  4S3K A;  1E6N A;  2ZR5 A;  1LL7 A;  3O5F A;  3W4R A;  1WAW A;  2RSE A;  2YBU A;  5HT1 A;  4QZV B;  1Q6H A;  1FKB A;  2PPP A;  3O5L A;  4Q7N A;  4TW7 A;  1NMV A;  2AWG A;  1BL4 A;  3VAW A;  3CHE A;  2FAP A;  1NWS A;  4DRK A;  2JZV A;  4MNL A;  1JCH B;  3WL1 A;  4L3N A;  3EY6 A;  4JYS A;  4ODM A;  1HJV A;  1ZL1 A;  3ODK A;  2DG4 A;  2WLY A;  2XP4 A;  2AOS A;  2PV3 A;  2DT1 A;  2ESC A;  3RM8 A;  4BF8 A;  3WD4 A;  5HKG A;  4LAV A;  5DO2 A;  2DG3 A;  4KQZ A;  4ZS6 A;  4IPX A;  4DH0 A;  3NTP A;  3ARR A;  2DSZ A;  1ZCN A;  3CGM A;  2KGJ A;  3CH9 A;  1J4R A;  2ZR6 A;  2FKE A;  3CHC A;  1A7X A;  4GIV A;  3OA5 A;  2MF9 A;  1D7I A;  4ODR A;  3ART A; 
#chains in the Genus database with same CATH homology
 3KAH A;  3O5I A;  3O5G A;  1NWT A;  2ZQU A;  3ALF A;  1ZU8 A;  4W9Q A;  2XP9 A;  1F8A B;  3KAC A;  5GPG A;  1HKJ A;  1FKS A;  3WD1 A;  4QT2 A;  1LQ0 A;  1FJD A;  3WH0 A;  1OWQ A;  3UQB A;  2L2S A;  1RD6 A;  1Y0O A;  2K8I A;  1W1V A;  1E15 A;  2B31 A;  5BXJ A;  1ROT A;  2IUZ A;  2PV2 A;  1GPF A;  4HBE A;  1HXV A;  4FN2 A;  5DEZ A;  1EIB A;  1T11 A;  2O9O A;  4MPK A;  2KR7 A;  2A3C A;  1FKG A;  2A3B A;  2A3E A;  1BKF A;  4Z2I A;  3B8S A;  3KAI A;  5HW7 A;  3UQI A;  3O5K A;  1QPL A;  3O5O A;  2LJ4 A;  2D9F A;  4U86 A;  1NMW A;  3G6L A;  1W1P A;  4ODN A;  5HBF A;  4ODP A;  3O5D A;  1QZ2 A;  3JYM A;  2ZQT A;  3CHF A;  2PI6 A;  4DWS D;  4ODQ A;  3B9E A;  2KO7 A;  2XP3 A;  5HW6 A;  4J4O A;  4W9O A;  2FDM A;  1W26 A;  3WIJ A;  4MGV A;  3RM4 A;  4N19 A;  4C02 B;  4AY1 A;  3IHZ A;  3OOB A;  3PR9 A;  1ROU A;  4WKA A;  3RME A;  1CTN A;  1E6Z A;  2WM0 A;  4O2T A;  4G50 A;  4FAP A;  1LG2 A;  4TYO A;  1O6I A;  3TDB A;  2KE0 A;  3AS2 A;  4ZPT R;  3TCZ A;  1E9L A;  2F4E A;  4DZ2 A;  2LPV A;  3ARW A;  2KI3 A;  5J6E A;  3CHD A;  4ITZ A;  4TX0 A;  1HKK A;  4WKF A;  3CZ8 A;  1JNT A;  1SYT A;  1KFW A;  2ZQV A;  1HJW A;  1NWU A;  1LG1 A;  2MLX A;  3AS0 A;  2F2D A;  3NRK A;  4J4N A;  3BXW A;  4MTV A;  4DRN A;  3FXY A;  4DWS B;  3UI4 A;  4WK9 A;  3IK8 A;  2LGO A;  3NI6 A;  4QT3 A;  1H0G A;  1KT1 A;  4JFJ A;  3O5J A;  4R0X A;  5HWC A;  3PRD A;  3PA7 A;  3UI5 A;  3ARZ A;  1VF8 A;  3ARQ A;  1JNE A;  2XPA A;  2XPB A;  4ODL A;  4WIW A;  4P8X A;  2WK2 A;  1L1P A;  4ZPW R;  1NH6 A;  4Z2H A;  2A3A A;  2PPN A;  5D75 A;  4DRI A;  4TW8 A;  3ARO A;  2KFW A;  3ARX A;  1R9H A;  3KAG A;  2MPH A;  1JND A;  4LAY A;  1FFR A;  2M1I A;  1Q6I A;  1TFV A;  5HWB A;  1WB0 A;  4JFI A;  1FKT A;  3TC5 A;  3WD0 A;  4W9P A;  3AQU A;  5I98 A;  1X6N A;  3UF8 A;  1IX5 A;  1YAT A;  1KT0 A;  1K9T A;  4IT4 A;  3H9R B;  2OFN A;  1PIN A;  2G41 A;  1FD9 A;  1GUV A;  4ODK A;  2ITK A;  3O5E A;  4P8V A;  1M5Y A;  4NSB A;  2Y78 A;  2Q5A A;  1FKJ A;  4DT4 A;  1FKR A;  3KAB A;  1C9H A;  1Q6U A;  3RGC A;  1ZBC A;  5DIT A;  1FKK A;  5GPR A;  1W9P A;  1JNS A;  1JVW A;  1UR9 A;  4JFM A;  4MNM A;  4R5E A;  4P8W A;  1LL4 A;  4DWS A;  1D7H A;  2XP7 A;  1HJX A;  4DIP A;  5B8I C;  1W1T A;  1PBK A;  3WL0 A;  4IQC A;  2RUQ A;  1FAP A;  4P8U A;  1YW5 A;  3WQV A;  5HW8 A;  1FKI A;  1N1A A;  2DSV A;  2DT2 A;  4PTM A;  4JFK A;  4MNK A;  2DT3 A;  2RQS A;  4GGQ A;  3PRA A;  1QPF A;  3UI6 A;  4TW6 A;  1TCO C;  1XHG A;  4DRH A;  4Z2J A;  4DZ3 A;  1ITX A;  3PRB A;  1E6P A;  1OGG A;  3KAF A;  1EDQ A;  5DF0 A;  4U85 A;  2DSU A;  2DG9 A;  1EHN A;  2UZ5 A;  4Z2G A;  1EYM A;  3ARV A;  3RM9 A;  1W1Y A;  3LUO A;  1UR8 A;  2ZR4 A;  2M08 A;  1FKL A;  3AS3 A;  3O5P A;  1D7J A;  2PBC A;  1D2K A;  5HUA A;  2MLZ A;  3FAP A;  2RUD A;  4JFL A;  4WJX A;  3UQA A;  2QF8 A;  2OLH A;  3MDY B;  3ARU A;  2MLY A;  2N87 A;  3ARY A;  3KZ7 A;  1B6C A;  1W9V A;  1FKF A;  2VCD A;  1ZBK A;  4L72 B;  4LGX A;  4LAX A;  4Z2K A;  1P5Q A;  2XP8 A;  1FKD A;  3QOK A;  3FY1 A;  2O92 A;  4W5U A;  1D6O A;  5HTG A;  3IKD A;  4DRQ A;  1J6Y A;  3IKG A;  1J4I A;  2VN1 A;  4IQ2 A;  3AS1 A;  2G8Z A;  2PPO A;  1ZBW A;  4ODO A;  4WKH A;  1LL6 A;  4Z2L A;  2PV1 A;  4QIB A;  4DRJ A;  1HKI A;  1ZB5 A;  3O5R A;  1Q1C A;  4DRO A;  1ZK6 A;  4KR0 B;  5GQB A;  4MAV A;  3G6M A;  2RUC A;  4ML4 A;  1H0I A;  5DIV A;  1NWR A;  4DRP A;  1W9U A;  4MSP A;  1XRV A;  2DT0 A;  3CGN A;  4Q22 A;  3I6C A;  4U84 A;  4TNS A;  4G2P A;  3WKZ A;  1X6L A;  1FKH A;  3WQW A;  2M2A A;  2F21 A;  3KCE A;  3B9D A;  1SR0 A;  3WD2 A;  1U79 A;  3GPK A;  1E6R A;  3ALG A;  4LAW A;  2RUR A;  4HBO A;  3B9A A;  4XAK A;  1J4H A;  4HAR A;  4NZC A;  4NNR A;  4IT6 A;  3JXV A;  1OGB A;  2DSW A;  5DIU A;  4DRM A;  3B7X A;  1F40 A;  4MNJ A;  3ARP A;  3KAD A;  2YBT A;  2ZQS A;  1EQ3 A;  3ARS A;  1FFQ A;  1ZBV A;  1HKM A;  4ZPV R;  2IF4 A;  4S3J A;  2DPE A;  1NSG A;  2WLZ A;  3WD3 A;  5JH8 A;  2LKN A;  4DWS C;  1WNO A;  2XP6 A;  2XP5 A;  3O5M A;  1GOI A;  3RFW A;  3O5Q A;  1LJY A;  2MNT A;  3JYJ A;  4URI A;  4S3K A;  1E6N A;  2ZR5 A;  1LL7 A;  3O5F A;  3W4R A;  1WAW A;  2RSE A;  2YBU A;  5HT1 A;  4QZV B;  1Q6H A;  1FKB A;  2PPP A;  3O5L A;  4Q7N A;  4TW7 A;  1NMV A;  2AWG A;  1BL4 A;  3VAW A;  3CHE A;  2FAP A;  1NWS A;  4DRK A;  2JZV A;  4MNL A;  3WL1 A;  4L3N A;  3EY6 A;  4JYS A;  4ODM A;  1HJV A;  1ZL1 A;  3ODK A;  2DG4 A;  2WLY A;  2XP4 A;  2AOS A;  2PV3 A;  2DT1 A;  2ESC A;  3RM8 A;  4BF8 A;  3WD4 A;  5HKG A;  4LAV A;  5DO2 A;  2DG3 A;  4KQZ A;  4ZS6 A;  4IPX A;  4DH0 A;  3NTP A;  3ARR A;  2DSZ A;  1ZCN A;  3CGM A;  2KGJ A;  3CH9 A;  1J4R A;  2ZR6 A;  2FKE A;  3CHC A;  1A7X A;  4GIV A;  3OA5 A;  2MF9 A;  1D7I A;  4ODR A;  3ART A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...