3O5EA

Fk1 domain of fkbp51, crystal form vi
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
b'SPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 31
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5eA00
4LAXA 4DT4A 1FKBA 4JFLA 2KGJA 4JFJA 2XPBA 1BKFA 1ZK6A 3O5OA 1Y0OA 4TYOA 2MLYA 4R0XA 4DRKA 2VN1A 3TC5A 5DIVA 1YW5A 4IQ2A 3B7XA 4W9QA 3WH0A 1FD9A 1PINA 3EY6A 2PPPA 5HW6A 3UF8A 3KAHA 2F2DA 4TW6A 2MPHA 4QIBA 2XP5A 2PBCA 2PV1A 2XP7A 3JXVA 4JFIA 2RSEA 4ODOA 4DZ2A 5HWCA 3UQBA 2OFNA 2LJ4A 2L2SA 2ITKA 2DG4A 3O5JA 3NI6A 2ZQSA 3KAFA 4GGQA 1J4RA 2KI3A 1Q6IA 5J6EA 1U79A 3NTPA 4J4OA 5HTGA 1QZ2A 4LAWA 3KABA 4MGVA 3RFWA 1J6YA 1JVWA 3KAIA 3O5QA 4FN2A 4DIPA 5BXJA 2MNTA 1ROTA 1FKGA 2N87A 1R9HA 2M08A 4LAVA 2PPNA 4NNRA 4DRQA 3UQIA 1ROUA 5B8IC 1EQ3A 1N1AA 4DZ3A 2XP9A 3VAWA 1FJDA 1P5QA 4TW8A 2MLXA 1FKSA 1FAPA 2F21A 3KAGA 4QT2A 3PRDA 4C02B 2ZR4A 2XP4A 3ODKA 2KFWA 1FKJA 2PV3A 5GPGA 3TCZA 4TW7A 4QT3A 3UI4A 1KT1A 2RQSA 1FKFA 3O5PA 2XP8A 2LGOA 1KT0A 2M1IA 4N19A 1J4HA 1W26A 3UI5A 3LUOA 3PA7A 1B6CA 2KE0A 4IQCA 5HKGA 1QPLA 5HWBA 1NMVA 2XPAA 1F8AB 3NRKA 1L1PA 3I6CA 2Q5AA 2RUQA 4O2TA 1FKTA 2D9FA 4U86A 1NMWA 2KO7A 4ODPA 1FKIA 3IK8A 4DRJA 2DG9A 4DRPA 2LPVA 2F4EA 4G2PA 1NSGA 4FAPA 2ZR5A 3JYJA 5HW8A 1A7XA 4IPXA 3O5DA 1M5YA 2DG3A 3UQAA 1D7IA 1Q6UA 2XP6A 3FAPA 3IHZA 2RUDA 1D6OA 3JYMA 3CGMA 4ODQA 1FKHA 1T11A 1HXVA 3KZ7A 4LAYA 4U84A 3CGNA 2ZQTA 4ODMA 4TX0A 4DH0A 2XP3A 2VCDA 2Y78A 1QPFA 2LKNA 4MSPA 1J4IA 3O5FA 4DRMA 3O5GA 2PPOA 2AWGA 3GPKA 4ODLA 5D75A 5HUAA 4BF8A 3O5EA 2M2AA 3H9RB 3KADA 2ZQVA 1FKLA 4JFMA 5I98A 1PBKA 1BL4A 1Q1CA 2UZ5A 2KR7A 2ZQUA 4ODKA 1FKRA 4W9PA 1EYMA 3OOBA 2ZR6A 5DIUA 5DITA 1ZCNA 1D7HA 4JYSA 1FKKA 4DRHA 2PV2A 3O5RA 3PRBA 4JFKA 5HT1A 1Q6HA 3O5LA 4GIVA 3KCEA 4J4NA 2MLZA 4DROA 1F40A 2JZVA 4TNSA 4W9OA 4G50A 2FAPA 5HW7A 2MF9A 4ODNA 4U85A 1TCOC 3IKGA 1JNSA 2K8IA 1YATA 1JNTA 3RGCA 2RUCA 3O5MA 1C9HA 3MDYB 1FKDA 3O5IA 2FKEA 3KACA 4ODRA 3UI6A 4DRNA 2IF4A 2RURA 3O5KA 4DRIA 3IKDA 4ITZA 3TDBA 1D7JA
chains in the Genus database with same CATH superfamily
4DT4A 3GTYX 2O9OA 4HBEA 3O5OA 1Y0OA 4R0XA 3TC5A 5DIVA 4W9QA 1UR9A 3CHDA 5DF0A 1W1TA 4TW6A 2PV1A 4Z2GA 3UQBA 2LJ4A 3O5JA 2DG4A 3FXYA 1LL6A 3KAFA 2O92A 1NWRA 2KI3A 3ARYA 1U79A 1XHGA 4WJXA 1H0GA 3O5QA 4DIPA 2MNTA 2N87A 4NNRA 3AQUA 5GQBA 3BXWA 3CHCA 5B8IC 1EQ3A 4DZ3A 1P5QA 1ZU8A 1WAWA 4C02B 5GPGA 4W5UA 4P8XA 4TW7A 4Q7NA 4PTMA 3UI5A 1E6ZA 3PA7A 4IQCA 2KE0A 1ZBCA 1NMVA 3RM9A 1F8AB 2OLHA 1W1YA 2Q5AA 5JH8A 2RUQA 4DRJA 4DRPA 2DT1A 2F4EA 5HW8A 1A7XA 1K9TA 1W9VA 5GPRA 2YBTA 2DG3A 1GUVA 3JYMA 1FKHA 1JNDA 4LAYA 2G8ZA 2VCDA 3ARPA 4ZPTR 4MSPA 4WK9A 2EULA 2AWGA 4ODLA 3WD4A 5HUAA 1KFWA 2ZQVA 5I98A 1BL4A 2UZ5A 2A3CA 4DWSD 1EYMA 5DEZA 3G6MA 3O5RA 3PRBA 1Q6HA 4GIVA 2MLZA 3ARQA 2JZVA 2DSVA 3G6LA 4TNSA 4G50A 2FAPA 3B9EA 2MF9A 3AS0A 1TCOC 4ZPWR 2RUCA 3MDYB 3UI6A 2FKEA 3ARWA 2B5UB 4NSBA 3TDBA 5HW6A 4LAXA 4JFJA 1BKFA 1ZK6A 2WLZA 4DRKA 1CTNA 2A3AA 2VN1A 3OA5A 3B7XA 2B31A 1PINA 3EY6A 1ZB5A 2F2DA 2MPHA 2XP7A 3JXVA 3WIJA 1FFRA 1LL4A 4ODOA 4WKHA 5HWCA 2OFNA 2L2SA 2ZQSA 3ARXA 4GGQA 3ALGA 1ZBWA 3KABA 1J6YA 2DSZA 2WM0A 2M08A 5HBFA 1ROUA 4Z2JA 4TW8A 1FAPA 2A3EA 3KAGA 4QT2A 2ZR4A 2XP4A 3ODKA 2KFWA 1XRVA 2PV3A 3TCZA 2ETNA 4QT3A 1KT1A 2RQSA 1O6IA 2LGOA 4N19A 3LUOA 3AROA 1B6CA 4UDMA 5HKGA 2DT3A 4ZPVR 1OGGA 1E44A 1FKTA 4U86A 1NMWA 2KO7A 4ODPA 1FKIA 1VF8A 1WB0A 2ZR5A 4Z2IA 4IPXA 1M5YA 4Z2HA 1D7IA 2XP6A 3IHZA 4ODQA 1OWQA 1GPFA 3CGNA 2ZQTA 1LJYA 1QPFA 2LKNA 4DRMA 3PRAA 1W1PA 1ZL1A 1NWUA 4BF8A 3RM4A 3KADA 4AY1A 4JFMA 2PN0A 1HJWA 1FKRA 5DIUA 5DITA 2PI6A 4JYSA 1W1VA 4JFKA 4DROA 1LL7A 2P4VA 3WQWA 2AOSA 3WQVA 3ARVA 1F40A 1FFQA 1D2KA 3RMEA 4ODNA 3IKGA 1JNSA 2K8IA 3QOKA 1JNTA 3RGCA 4Q22A 1JNEA 2IF4A 2RURA 3O5KA 1RD6A 3CHFA 1LQ0A 4S3KA 1FKBA 2KGJA 4XAKA 4IQ2A 3CHEA 1OGBA 1FD9A 3W4RA 2PPPA 1X6NA 3KAHA 4QIBA 3AS3A 4ZS6A 3ARRA 2RSEA 1ZBKA 3ARUA 4DZ2A 4MNLA 2ITKA 3NI6A 4DWSC 1J4RA 1Q6IA 5J6EA 4J4OA 5HTGA 4P8VA 4LAWA 3RFWA 1EDQA 1E9LA 4FN2A 3WL1A 5BXJA 1HKMA 1R9HA 2WK2A 3PR9A 4DRQA 4R5EA 1N1AA 2XP9A 4Z2KA 1EHNA 3CZ8A 4Z2LA 2F21A 4NZCA 3PRDA 3ARTA 1FKFA 2XP8A 1KT0A 1J4HA 1ITXA 1X6LA 2IUZA 1NH6A 2XPAA 3NRKA 1L1PA 1SYTA 1W9UA 3IK8A 4P8WA 1NSGA 1HJVA 3O5DA 5DO2A 3AS1A 1Q6UA 3ALFA 3CGMA 4MNKA 1HXVA 1E15A 3B9DA 3KZ7A 3CH9A 4U84A 4TX0A 4DH0A 4ODMA 2XP3A 4MTVA 1H0IA 4DWSA 1HKKA 2PPOA 3O5EA 2M2AA 3ARSA 1SR0A 4URIA 1PBKA 2KR7A 2A3BA 4W9PA 3OOBA 2ZR6A 4DRHA 1FKKA 2PV2A 5HT1A 3O5LA 2DPEA 3KCEA 4J4NA 3WD0A 5HW7A 1YATA 4L72B 3O5IA 1C9HA 4HBOA 3EIPA 2DSUA 4HARA 3IKDA 4ITZA 3WD3A 4WKAA 4JFLA 3RM8A 2XPBA 4TYOA 2MLYA 2DT0A 1YW5A 4QZVB 3WH0A 4LGXA 3UF8A 2DSWA 1W9PA 2XP5A 4MNJA 2PBCA 4WIWA 4JFIA 1LG2A 1UR8A 3NTPA 1QZ2A 4MGVA 1JVWA 3KAIA 1IX5A 1ROTA 1FKGA 4LAVA 1NWSA 2F23A 2PPNA 1WNOA 3UQIA 3VAWA 1EIBA 1FJDA 2G41A 2MLXA 1FKSA 3B9AA 4MNMA 1E6PA 1FKJA 4IT6A 3UQAA 3UI4A 2DT2A 3O5PA 2M1IA 1NWTA 1W26A 1HKJA 1QPLA 1HKIA 5HWBA 1GRJA 4KQZA 1GOIA 3ARZA 1ZBVA 3I6CA 3WL0A 4L3NA 4IT4A 4O2TA 2D9FA 2QF8A 2DG9A 2LPVA 1TFVA 4G2PA 4FAPA 3JYJA 3WD1A 3FAPA 1JCHB 2RUDA 1D6OA 4MPKA 1T11A 2Y78A 3GU0A 3AS2A 2FDMA 3FY1A 1J4IA 3O5FA 3O5GA 3GPKA 5D75A 3H9RB 1LG1A 1E6RA 1FKLA 4MAVA 4P8UA 4DWSB 1Q1CA 4ML4A 2ESCA 2WLYA 1HJXA 2ZQUA 4ODKA 1E6NA 1ZCNA 1D7HA 3BMBA 4W9OA 3B8SA 3WD2A 4U85A 2YBUA 4WKFA 3O5MA 4ODRA 1FKDA 4DRNA 3KACA 3WKZA 4S3JA 4KR0B 4DRIA 1D7JA
chains in the Genus database with same CATH topology
4DT4A 2O9OA 4HBEA 3O5OA 1Y0OA 4R0XA 3TC5A 5DIVA 4W9QA 1UR9A 3CHDA 5DF0A 1W1TA 4TW6A 2PV1A 4Z2GA 3UQBA 2LJ4A 3O5JA 2DG4A 3FXYA 1LL6A 3KAFA 2O92A 1NWRA 2KI3A 3ARYA 1U79A 1XHGA 4WJXA 1H0GA 3O5QA 4DIPA 2MNTA 2N87A 4NNRA 3AQUA 5GQBA 3BXWA 3CHCA 5B8IC 1EQ3A 4DZ3A 1P5QA 1ZU8A 1WAWA 4C02B 5GPGA 4W5UA 4P8XA 4TW7A 4Q7NA 4PTMA 3UI5A 1E6ZA 3PA7A 4IQCA 2KE0A 1ZBCA 1NMVA 3RM9A 1F8AB 2OLHA 1W1YA 2Q5AA 5JH8A 2RUQA 4DRJA 4DRPA 2DT1A 2F4EA 5HW8A 1A7XA 1K9TA 1W9VA 5GPRA 2YBTA 2DG3A 1GUVA 3JYMA 1FKHA 1JNDA 4LAYA 2G8ZA 2VCDA 3ARPA 4ZPTR 4MSPA 4WK9A 2AWGA 4ODLA 3WD4A 5HUAA 1KFWA 2ZQVA 5I98A 1BL4A 2UZ5A 2A3CA 4DWSD 1EYMA 5DEZA 3G6MA 3O5RA 3PRBA 1Q6HA 4GIVA 2MLZA 3ARQA 2JZVA 2DSVA 3G6LA 4TNSA 4G50A 2FAPA 3B9EA 2MF9A 3AS0A 1TCOC 4ZPWR 2RUCA 3MDYB 3UI6A 2FKEA 3ARWA 4NSBA 3TDBA 5HW6A 4LAXA 4JFJA 1BKFA 1ZK6A 2WLZA 4DRKA 1CTNA 2A3AA 2VN1A 3OA5A 3B7XA 2B31A 1PINA 3EY6A 1ZB5A 2F2DA 2MPHA 2XP7A 3JXVA 3WIJA 1FFRA 1LL4A 4ODOA 4WKHA 5HWCA 2OFNA 2L2SA 2ZQSA 3ARXA 4GGQA 3ALGA 1ZBWA 3KABA 1J6YA 2DSZA 2WM0A 2M08A 5HBFA 1ROUA 4Z2JA 4TW8A 1FAPA 2A3EA 3KAGA 4QT2A 2ZR4A 2XP4A 3ODKA 2KFWA 1XRVA 2PV3A 3TCZA 4QT3A 1KT1A 2RQSA 1O6IA 2LGOA 4N19A 3LUOA 3AROA 1B6CA 5HKGA 2DT3A 4ZPVR 1OGGA 1FKTA 4U86A 1NMWA 2KO7A 4ODPA 1FKIA 1VF8A 1WB0A 2ZR5A 4Z2IA 4IPXA 1M5YA 4Z2HA 1D7IA 2XP6A 3IHZA 4ODQA 1OWQA 1GPFA 3CGNA 2ZQTA 1LJYA 1QPFA 2LKNA 4DRMA 3PRAA 1W1PA 1ZL1A 1NWUA 4BF8A 3RM4A 3KADA 4AY1A 4JFMA 1HJWA 1FKRA 5DIUA 5DITA 2PI6A 4JYSA 1W1VA 4JFKA 4DROA 1LL7A 3WQVA 3WQWA 2AOSA 1F40A 3ARVA 1FFQA 1D2KA 3RMEA 4ODNA 3IKGA 1JNSA 2K8IA 3QOKA 1JNTA 3RGCA 4Q22A 1JNEA 2IF4A 2RURA 3O5KA 1RD6A 3CHFA 1LQ0A 4S3KA 1FKBA 2KGJA 4XAKA 4IQ2A 3CHEA 1OGBA 1FD9A 3W4RA 2PPPA 1X6NA 3KAHA 4QIBA 3AS3A 4ZS6A 3ARRA 2RSEA 1ZBKA 3ARUA 4DZ2A 4MNLA 2ITKA 3NI6A 4DWSC 1J4RA 1Q6IA 5J6EA 4J4OA 5HTGA 4P8VA 4LAWA 3RFWA 1EDQA 1E9LA 4FN2A 3WL1A 5BXJA 1HKMA 1R9HA 2WK2A 3PR9A 4DRQA 4R5EA 1N1AA 2XP9A 4Z2KA 1EHNA 3CZ8A 4Z2LA 2F21A 4NZCA 3PRDA 3ARTA 1FKFA 2XP8A 1KT0A 1J4HA 1ITXA 1X6LA 2IUZA 1NH6A 2XPAA 3NRKA 1L1PA 1SYTA 1W9UA 3IK8A 4P8WA 1NSGA 1HJVA 3O5DA 5DO2A 3AS1A 1Q6UA 3ALFA 3CGMA 4MNKA 1HXVA 1E15A 3B9DA 3KZ7A 3CH9A 4U84A 4TX0A 4DH0A 4ODMA 2XP3A 4MTVA 1H0IA 4DWSA 1HKKA 2PPOA 3O5EA 2M2AA 3ARSA 1SR0A 4URIA 1PBKA 2KR7A 2A3BA 4W9PA 3OOBA 2ZR6A 4DRHA 1FKKA 2PV2A 5HT1A 3O5LA 2DPEA 3KCEA 4J4NA 3WD0A 5HW7A 1YATA 4L72B 3O5IA 1C9HA 4HBOA 2DSUA 4HARA 3IKDA 4ITZA 3WD3A 4WKAA 4JFLA 3RM8A 2XPBA 4TYOA 2MLYA 2DT0A 1YW5A 4QZVB 3WH0A 4LGXA 3UF8A 2DSWA 1W9PA 2XP5A 4MNJA 2PBCA 4WIWA 4JFIA 1LG2A 1UR8A 3NTPA 1QZ2A 4MGVA 1JVWA 3KAIA 1IX5A 1ROTA 1FKGA 4LAVA 1NWSA 2PPNA 1WNOA 3UQIA 3VAWA 1EIBA 1FJDA 2G41A 2MLXA 1FKSA 3B9AA 4MNMA 1E6PA 1FKJA 4IT6A 3UQAA 3UI4A 2DT2A 3O5PA 2M1IA 1NWTA 1W26A 1HKJA 1QPLA 1HKIA 5HWBA 4KQZA 1GOIA 3ARZA 1ZBVA 3I6CA 3WL0A 4L3NA 4IT4A 4O2TA 2D9FA 2QF8A 2DG9A 2LPVA 1TFVA 4G2PA 4FAPA 3JYJA 3WD1A 3FAPA 2RUDA 1D6OA 4MPKA 1T11A 2Y78A 3AS2A 2FDMA 3FY1A 1J4IA 3O5FA 3O5GA 3GPKA 5D75A 3H9RB 1LG1A 1E6RA 1FKLA 4MAVA 4P8UA 4DWSB 1Q1CA 4ML4A 2ESCA 2WLYA 1HJXA 2ZQUA 4ODKA 1E6NA 1ZCNA 1D7HA 4W9OA 3B8SA 3WD2A 4U85A 2YBUA 4WKFA 3O5MA 4ODRA 1FKDA 4DRNA 3KACA 3WKZA 4S3JA 4KR0B 4DRIA 1D7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAX A;  4DT4 A;  1FKB A;  4JFL A;  2KGJ A;  4JFJ A;  2XPB A;  1BKF A;  1ZK6 A;  3O5O A;  1Y0O A;  4TYO A;  2MLY A;  4R0X A;  4DRK A;  2VN1 A;  3TC5 A;  5DIV A;  1YW5 A;  4IQ2 A;  3B7X A;  4W9Q A;  3WH0 A;  1FD9 A;  1PIN A;  3EY6 A;  2PPP A;  5HW6 A;  3UF8 A;  3KAH A;  2F2D A;  4TW6 A;  2MPH A;  4QIB A;  2XP5 A;  2PBC A;  2PV1 A;  2XP7 A;  3JXV A;  4JFI A;  2RSE A;  4ODO A;  4DZ2 A;  5HWC A;  3UQB A;  2OFN A;  2LJ4 A;  2L2S A;  2ITK A;  2DG4 A;  3O5J A;  3NI6 A;  2ZQS A;  3KAF A;  4GGQ A;  1J4R A;  2KI3 A;  1Q6I A;  5J6E A;  1U79 A;  3NTP A;  4J4O A;  5HTG A;  1QZ2 A;  4LAW A;  3KAB A;  4MGV A;  3RFW A;  1J6Y A;  1JVW A;  3KAI A;  3O5Q A;  4FN2 A;  4DIP A;  5BXJ A;  2MNT A;  1ROT A;  1FKG A;  2N87 A;  1R9H A;  2M08 A;  4LAV A;  2PPN A;  4NNR A;  4DRQ A;  3UQI A;  1ROU A;  5B8I C;  1EQ3 A;  1N1A A;  4DZ3 A;  2XP9 A;  3VAW A;  1FJD A;  1P5Q A;  4TW8 A;  2MLX A;  1FKS A;  1FAP A;  2F21 A;  3KAG A;  4QT2 A;  3PRD A;  4C02 B;  2ZR4 A;  2XP4 A;  3ODK A;  2KFW A;  1FKJ A;  2PV3 A;  5GPG A;  3TCZ A;  4TW7 A;  4QT3 A;  3UI4 A;  1KT1 A;  2RQS A;  1FKF A;  3O5P A;  2XP8 A;  2LGO A;  1KT0 A;  2M1I A;  4N19 A;  1J4H A;  1W26 A;  3UI5 A;  3LUO A;  3PA7 A;  1B6C A;  2KE0 A;  4IQC A;  5HKG A;  1QPL A;  5HWB A;  1NMV A;  2XPA A;  1F8A B;  3NRK A;  1L1P A;  3I6C A;  2Q5A A;  2RUQ A;  4O2T A;  1FKT A;  2D9F A;  4U86 A;  1NMW A;  2KO7 A;  4ODP A;  1FKI A;  3IK8 A;  4DRJ A;  2DG9 A;  4DRP A;  2LPV A;  2F4E A;  4G2P A;  1NSG A;  4FAP A;  2ZR5 A;  3JYJ A;  5HW8 A;  1A7X A;  4IPX A;  3O5D A;  1M5Y A;  2DG3 A;  3UQA A;  1D7I A;  1Q6U A;  2XP6 A;  3FAP A;  3IHZ A;  2RUD A;  1D6O A;  3JYM A;  3CGM A;  4ODQ A;  1FKH A;  1T11 A;  1HXV A;  3KZ7 A;  4LAY A;  4U84 A;  3CGN A;  2ZQT A;  4ODM A;  4TX0 A;  4DH0 A;  2XP3 A;  2VCD A;  2Y78 A;  1QPF A;  2LKN A;  4MSP A;  1J4I A;  3O5F A;  4DRM A;  3O5G A;  2PPO A;  2AWG A;  3GPK A;  4ODL A;  5D75 A;  5HUA A;  4BF8 A;  3O5E A;  2M2A A;  3H9R B;  3KAD A;  2ZQV A;  1FKL A;  4JFM A;  5I98 A;  1PBK A;  1BL4 A;  1Q1C A;  2UZ5 A;  2KR7 A;  2ZQU A;  4ODK A;  1FKR A;  4W9P A;  1EYM A;  3OOB A;  2ZR6 A;  5DIU A;  5DIT A;  1ZCN A;  1D7H A;  4JYS A;  1FKK A;  4DRH A;  2PV2 A;  3O5R A;  3PRB A;  4JFK A;  5HT1 A;  1Q6H A;  3O5L A;  4GIV A;  3KCE A;  4J4N A;  2MLZ A;  4DRO A;  1F40 A;  2JZV A;  4TNS A;  4W9O A;  4G50 A;  2FAP A;  5HW7 A;  2MF9 A;  4ODN A;  4U85 A;  1TCO C;  3IKG A;  1JNS A;  2K8I A;  1YAT A;  1JNT A;  3RGC A;  2RUC A;  3O5M A;  1C9H A;  3MDY B;  1FKD A;  3O5I A;  2FKE A;  3KAC A;  4ODR A;  3UI6 A;  4DRN A;  2IF4 A;  2RUR A;  3O5K A;  4DRI A;  3IKD A;  4ITZ A;  3TDB A;  1D7J A; 
#chains in the Genus database with same CATH topology
 4DT4 A;  3GTY X;  2O9O A;  4HBE A;  3O5O A;  1Y0O A;  4R0X A;  3TC5 A;  5DIV A;  4W9Q A;  1UR9 A;  3CHD A;  5DF0 A;  1W1T A;  4TW6 A;  2PV1 A;  4Z2G A;  3UQB A;  2LJ4 A;  3O5J A;  2DG4 A;  3FXY A;  1LL6 A;  3KAF A;  2O92 A;  1NWR A;  2KI3 A;  3ARY A;  1U79 A;  1XHG A;  4WJX A;  1H0G A;  3O5Q A;  4DIP A;  2MNT A;  2N87 A;  4NNR A;  3AQU A;  5GQB A;  3BXW A;  3CHC A;  5B8I C;  1EQ3 A;  4DZ3 A;  1P5Q A;  1ZU8 A;  1WAW A;  4C02 B;  5GPG A;  4W5U A;  4P8X A;  4TW7 A;  4Q7N A;  4PTM A;  3UI5 A;  1E6Z A;  3PA7 A;  4IQC A;  2KE0 A;  1ZBC A;  1NMV A;  3RM9 A;  1F8A B;  2OLH A;  1W1Y A;  2Q5A A;  5JH8 A;  2RUQ A;  4DRJ A;  4DRP A;  2DT1 A;  2F4E A;  5HW8 A;  1A7X A;  1K9T A;  1W9V A;  5GPR A;  2YBT A;  2DG3 A;  1GUV A;  3JYM A;  1FKH A;  1JND A;  4LAY A;  2G8Z A;  2VCD A;  3ARP A;  4ZPT R;  4MSP A;  4WK9 A;  2EUL A;  2AWG A;  4ODL A;  3WD4 A;  5HUA A;  1KFW A;  2ZQV A;  5I98 A;  1BL4 A;  2UZ5 A;  2A3C A;  4DWS D;  1EYM A;  5DEZ A;  3G6M A;  3O5R A;  3PRB A;  1Q6H A;  4GIV A;  2MLZ A;  3ARQ A;  2JZV A;  2DSV A;  3G6L A;  4TNS A;  4G50 A;  2FAP A;  3B9E A;  2MF9 A;  3AS0 A;  1TCO C;  4ZPW R;  2RUC A;  3MDY B;  3UI6 A;  2FKE A;  3ARW A;  2B5U B;  4NSB A;  3TDB A;  5HW6 A;  4LAX A;  4JFJ A;  1BKF A;  1ZK6 A;  2WLZ A;  4DRK A;  1CTN A;  2A3A A;  2VN1 A;  3OA5 A;  3B7X A;  2B31 A;  1PIN A;  3EY6 A;  1ZB5 A;  2F2D A;  2MPH A;  2XP7 A;  3JXV A;  3WIJ A;  1FFR A;  1LL4 A;  4ODO A;  4WKH A;  5HWC A;  2OFN A;  2L2S A;  2ZQS A;  3ARX A;  4GGQ A;  3ALG A;  1ZBW A;  3KAB A;  1J6Y A;  2DSZ A;  2WM0 A;  2M08 A;  5HBF A;  1ROU A;  4Z2J A;  4TW8 A;  1FAP A;  2A3E A;  3KAG A;  4QT2 A;  2ZR4 A;  2XP4 A;  3ODK A;  2KFW A;  1XRV A;  2PV3 A;  3TCZ A;  2ETN A;  4QT3 A;  1KT1 A;  2RQS A;  1O6I A;  2LGO A;  4N19 A;  3LUO A;  3ARO A;  1B6C A;  4UDM A;  5HKG A;  2DT3 A;  4ZPV R;  1OGG A;  1E44 A;  1FKT A;  4U86 A;  1NMW A;  2KO7 A;  4ODP A;  1FKI A;  1VF8 A;  1WB0 A;  2ZR5 A;  4Z2I A;  4IPX A;  1M5Y A;  4Z2H A;  1D7I A;  2XP6 A;  3IHZ A;  4ODQ A;  1OWQ A;  1GPF A;  3CGN A;  2ZQT A;  1LJY A;  1QPF A;  2LKN A;  4DRM A;  3PRA A;  1W1P A;  1ZL1 A;  1NWU A;  4BF8 A;  3RM4 A;  3KAD A;  4AY1 A;  4JFM A;  2PN0 A;  1HJW A;  1FKR A;  5DIU A;  5DIT A;  2PI6 A;  4JYS A;  1W1V A;  4JFK A;  4DRO A;  1LL7 A;  2P4V A;  3WQW A;  2AOS A;  3WQV A;  3ARV A;  1F40 A;  1FFQ A;  1D2K A;  3RME A;  4ODN A;  3IKG A;  1JNS A;  2K8I A;  3QOK A;  1JNT A;  3RGC A;  4Q22 A;  1JNE A;  2IF4 A;  2RUR A;  3O5K A;  1RD6 A;  3CHF A;  1LQ0 A;  4S3K A;  1FKB A;  2KGJ A;  4XAK A;  4IQ2 A;  3CHE A;  1OGB A;  1FD9 A;  3W4R A;  2PPP A;  1X6N A;  3KAH A;  4QIB A;  3AS3 A;  4ZS6 A;  3ARR A;  2RSE A;  1ZBK A;  3ARU A;  4DZ2 A;  4MNL A;  2ITK A;  3NI6 A;  4DWS C;  1J4R A;  1Q6I A;  5J6E A;  4J4O A;  5HTG A;  4P8V A;  4LAW A;  3RFW A;  1EDQ A;  1E9L A;  4FN2 A;  3WL1 A;  5BXJ A;  1HKM A;  1R9H A;  2WK2 A;  3PR9 A;  4DRQ A;  4R5E A;  1N1A A;  2XP9 A;  4Z2K A;  1EHN A;  3CZ8 A;  4Z2L A;  2F21 A;  4NZC A;  3PRD A;  3ART A;  1FKF A;  2XP8 A;  1KT0 A;  1J4H A;  1ITX A;  1X6L A;  2IUZ A;  1NH6 A;  2XPA A;  3NRK A;  1L1P A;  1SYT A;  1W9U A;  3IK8 A;  4P8W A;  1NSG A;  1HJV A;  3O5D A;  5DO2 A;  3AS1 A;  1Q6U A;  3ALF A;  3CGM A;  4MNK A;  1HXV A;  1E15 A;  3B9D A;  3KZ7 A;  3CH9 A;  4U84 A;  4TX0 A;  4DH0 A;  4ODM A;  2XP3 A;  4MTV A;  1H0I A;  4DWS A;  1HKK A;  2PPO A;  3O5E A;  2M2A A;  3ARS A;  1SR0 A;  4URI A;  1PBK A;  2KR7 A;  2A3B A;  4W9P A;  3OOB A;  2ZR6 A;  4DRH A;  1FKK A;  2PV2 A;  5HT1 A;  3O5L A;  2DPE A;  3KCE A;  4J4N A;  3WD0 A;  5HW7 A;  1YAT A;  4L72 B;  3O5I A;  1C9H A;  4HBO A;  3EIP A;  2DSU A;  4HAR A;  3IKD A;  4ITZ A;  3WD3 A;  4WKA A;  4JFL A;  3RM8 A;  2XPB A;  4TYO A;  2MLY A;  2DT0 A;  1YW5 A;  4QZV B;  3WH0 A;  4LGX A;  3UF8 A;  2DSW A;  1W9P A;  2XP5 A;  4MNJ A;  2PBC A;  4WIW A;  4JFI A;  1LG2 A;  1UR8 A;  3NTP A;  1QZ2 A;  4MGV A;  1JVW A;  3KAI A;  1IX5 A;  1ROT A;  1FKG A;  4LAV A;  1NWS A;  2F23 A;  2PPN A;  1WNO A;  3UQI A;  3VAW A;  1EIB A;  1FJD A;  2G41 A;  2MLX A;  1FKS A;  3B9A A;  4MNM A;  1E6P A;  1FKJ A;  4IT6 A;  3UQA A;  3UI4 A;  2DT2 A;  3O5P A;  2M1I A;  1NWT A;  1W26 A;  1HKJ A;  1QPL A;  1HKI A;  5HWB A;  1GRJ A;  4KQZ A;  1GOI A;  3ARZ A;  1ZBV A;  3I6C A;  3WL0 A;  4L3N A;  4IT4 A;  4O2T A;  2D9F A;  2QF8 A;  2DG9 A;  2LPV A;  1TFV A;  4G2P A;  4FAP A;  3JYJ A;  3WD1 A;  3FAP A;  1JCH B;  2RUD A;  1D6O A;  4MPK A;  1T11 A;  2Y78 A;  3GU0 A;  3AS2 A;  2FDM A;  3FY1 A;  1J4I A;  3O5F A;  3O5G A;  3GPK A;  5D75 A;  3H9R B;  1LG1 A;  1E6R A;  1FKL A;  4MAV A;  4P8U A;  4DWS B;  1Q1C A;  4ML4 A;  2ESC A;  2WLY A;  1HJX A;  2ZQU A;  4ODK A;  1E6N A;  1ZCN A;  1D7H A;  3BMB A;  4W9O A;  3B8S A;  3WD2 A;  4U85 A;  2YBU A;  4WKF A;  3O5M A;  4ODR A;  1FKD A;  4DRN A;  3KAC A;  3WKZ A;  4S3J A;  4KR0 B;  4DRI A;  1D7J A; 
#chains in the Genus database with same CATH homology
 4DT4 A;  2O9O A;  4HBE A;  3O5O A;  1Y0O A;  4R0X A;  3TC5 A;  5DIV A;  4W9Q A;  1UR9 A;  3CHD A;  5DF0 A;  1W1T A;  4TW6 A;  2PV1 A;  4Z2G A;  3UQB A;  2LJ4 A;  3O5J A;  2DG4 A;  3FXY A;  1LL6 A;  3KAF A;  2O92 A;  1NWR A;  2KI3 A;  3ARY A;  1U79 A;  1XHG A;  4WJX A;  1H0G A;  3O5Q A;  4DIP A;  2MNT A;  2N87 A;  4NNR A;  3AQU A;  5GQB A;  3BXW A;  3CHC A;  5B8I C;  1EQ3 A;  4DZ3 A;  1P5Q A;  1ZU8 A;  1WAW A;  4C02 B;  5GPG A;  4W5U A;  4P8X A;  4TW7 A;  4Q7N A;  4PTM A;  3UI5 A;  1E6Z A;  3PA7 A;  4IQC A;  2KE0 A;  1ZBC A;  1NMV A;  3RM9 A;  1F8A B;  2OLH A;  1W1Y A;  2Q5A A;  5JH8 A;  2RUQ A;  4DRJ A;  4DRP A;  2DT1 A;  2F4E A;  5HW8 A;  1A7X A;  1K9T A;  1W9V A;  5GPR A;  2YBT A;  2DG3 A;  1GUV A;  3JYM A;  1FKH A;  1JND A;  4LAY A;  2G8Z A;  2VCD A;  3ARP A;  4ZPT R;  4MSP A;  4WK9 A;  2AWG A;  4ODL A;  3WD4 A;  5HUA A;  1KFW A;  2ZQV A;  5I98 A;  1BL4 A;  2UZ5 A;  2A3C A;  4DWS D;  1EYM A;  5DEZ A;  3G6M A;  3O5R A;  3PRB A;  1Q6H A;  4GIV A;  2MLZ A;  3ARQ A;  2JZV A;  2DSV A;  3G6L A;  4TNS A;  4G50 A;  2FAP A;  3B9E A;  2MF9 A;  3AS0 A;  1TCO C;  4ZPW R;  2RUC A;  3MDY B;  3UI6 A;  2FKE A;  3ARW A;  4NSB A;  3TDB A;  5HW6 A;  4LAX A;  4JFJ A;  1BKF A;  1ZK6 A;  2WLZ A;  4DRK A;  1CTN A;  2A3A A;  2VN1 A;  3OA5 A;  3B7X A;  2B31 A;  1PIN A;  3EY6 A;  1ZB5 A;  2F2D A;  2MPH A;  2XP7 A;  3JXV A;  3WIJ A;  1FFR A;  1LL4 A;  4ODO A;  4WKH A;  5HWC A;  2OFN A;  2L2S A;  2ZQS A;  3ARX A;  4GGQ A;  3ALG A;  1ZBW A;  3KAB A;  1J6Y A;  2DSZ A;  2WM0 A;  2M08 A;  5HBF A;  1ROU A;  4Z2J A;  4TW8 A;  1FAP A;  2A3E A;  3KAG A;  4QT2 A;  2ZR4 A;  2XP4 A;  3ODK A;  2KFW A;  1XRV A;  2PV3 A;  3TCZ A;  4QT3 A;  1KT1 A;  2RQS A;  1O6I A;  2LGO A;  4N19 A;  3LUO A;  3ARO A;  1B6C A;  5HKG A;  2DT3 A;  4ZPV R;  1OGG A;  1FKT A;  4U86 A;  1NMW A;  2KO7 A;  4ODP A;  1FKI A;  1VF8 A;  1WB0 A;  2ZR5 A;  4Z2I A;  4IPX A;  1M5Y A;  4Z2H A;  1D7I A;  2XP6 A;  3IHZ A;  4ODQ A;  1OWQ A;  1GPF A;  3CGN A;  2ZQT A;  1LJY A;  1QPF A;  2LKN A;  4DRM A;  3PRA A;  1W1P A;  1ZL1 A;  1NWU A;  4BF8 A;  3RM4 A;  3KAD A;  4AY1 A;  4JFM A;  1HJW A;  1FKR A;  5DIU A;  5DIT A;  2PI6 A;  4JYS A;  1W1V A;  4JFK A;  4DRO A;  1LL7 A;  3WQV A;  3WQW A;  2AOS A;  1F40 A;  3ARV A;  1FFQ A;  1D2K A;  3RME A;  4ODN A;  3IKG A;  1JNS A;  2K8I A;  3QOK A;  1JNT A;  3RGC A;  4Q22 A;  1JNE A;  2IF4 A;  2RUR A;  3O5K A;  1RD6 A;  3CHF A;  1LQ0 A;  4S3K A;  1FKB A;  2KGJ A;  4XAK A;  4IQ2 A;  3CHE A;  1OGB A;  1FD9 A;  3W4R A;  2PPP A;  1X6N A;  3KAH A;  4QIB A;  3AS3 A;  4ZS6 A;  3ARR A;  2RSE A;  1ZBK A;  3ARU A;  4DZ2 A;  4MNL A;  2ITK A;  3NI6 A;  4DWS C;  1J4R A;  1Q6I A;  5J6E A;  4J4O A;  5HTG A;  4P8V A;  4LAW A;  3RFW A;  1EDQ A;  1E9L A;  4FN2 A;  3WL1 A;  5BXJ A;  1HKM A;  1R9H A;  2WK2 A;  3PR9 A;  4DRQ A;  4R5E A;  1N1A A;  2XP9 A;  4Z2K A;  1EHN A;  3CZ8 A;  4Z2L A;  2F21 A;  4NZC A;  3PRD A;  3ART A;  1FKF A;  2XP8 A;  1KT0 A;  1J4H A;  1ITX A;  1X6L A;  2IUZ A;  1NH6 A;  2XPA A;  3NRK A;  1L1P A;  1SYT A;  1W9U A;  3IK8 A;  4P8W A;  1NSG A;  1HJV A;  3O5D A;  5DO2 A;  3AS1 A;  1Q6U A;  3ALF A;  3CGM A;  4MNK A;  1HXV A;  1E15 A;  3B9D A;  3KZ7 A;  3CH9 A;  4U84 A;  4TX0 A;  4DH0 A;  4ODM A;  2XP3 A;  4MTV A;  1H0I A;  4DWS A;  1HKK A;  2PPO A;  3O5E A;  2M2A A;  3ARS A;  1SR0 A;  4URI A;  1PBK A;  2KR7 A;  2A3B A;  4W9P A;  3OOB A;  2ZR6 A;  4DRH A;  1FKK A;  2PV2 A;  5HT1 A;  3O5L A;  2DPE A;  3KCE A;  4J4N A;  3WD0 A;  5HW7 A;  1YAT A;  4L72 B;  3O5I A;  1C9H A;  4HBO A;  2DSU A;  4HAR A;  3IKD A;  4ITZ A;  3WD3 A;  4WKA A;  4JFL A;  3RM8 A;  2XPB A;  4TYO A;  2MLY A;  2DT0 A;  1YW5 A;  4QZV B;  3WH0 A;  4LGX A;  3UF8 A;  2DSW A;  1W9P A;  2XP5 A;  4MNJ A;  2PBC A;  4WIW A;  4JFI A;  1LG2 A;  1UR8 A;  3NTP A;  1QZ2 A;  4MGV A;  1JVW A;  3KAI A;  1IX5 A;  1ROT A;  1FKG A;  4LAV A;  1NWS A;  2PPN A;  1WNO A;  3UQI A;  3VAW A;  1EIB A;  1FJD A;  2G41 A;  2MLX A;  1FKS A;  3B9A A;  4MNM A;  1E6P A;  1FKJ A;  4IT6 A;  3UQA A;  3UI4 A;  2DT2 A;  3O5P A;  2M1I A;  1NWT A;  1W26 A;  1HKJ A;  1QPL A;  1HKI A;  5HWB A;  4KQZ A;  1GOI A;  3ARZ A;  1ZBV A;  3I6C A;  3WL0 A;  4L3N A;  4IT4 A;  4O2T A;  2D9F A;  2QF8 A;  2DG9 A;  2LPV A;  1TFV A;  4G2P A;  4FAP A;  3JYJ A;  3WD1 A;  3FAP A;  2RUD A;  1D6O A;  4MPK A;  1T11 A;  2Y78 A;  3AS2 A;  2FDM A;  3FY1 A;  1J4I A;  3O5F A;  3O5G A;  3GPK A;  5D75 A;  3H9R B;  1LG1 A;  1E6R A;  1FKL A;  4MAV A;  4P8U A;  4DWS B;  1Q1C A;  4ML4 A;  2ESC A;  2WLY A;  1HJX A;  2ZQU A;  4ODK A;  1E6N A;  1ZCN A;  1D7H A;  4W9O A;  3B8S A;  3WD2 A;  4U85 A;  2YBU A;  4WKF A;  3O5M A;  4ODR A;  1FKD A;  4DRN A;  3KAC A;  3WKZ A;  4S3J A;  4KR0 B;  4DRI A;  1D7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...