3O5EA

Fk1 domain of fkbp51, crystal form vi
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
SPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 31
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5eA00
3H9RB 4FAPA 2MF9A 4R0XA 2IF4A 4DRPA 1A7XA 3IK8A 5J6EA 2MLZA 5HKGA 4ODNA 1ROTA 4QIBA 2F2DA 4DROA 4IPXA 1J4HA 1TCOC 1NMVA 2VN1A 1R9HA 2LJ4A 1B6CA 4J4OA 1KT1A 4DIPA 3UQAA 4NNRA 1FJDA 4DZ3A 2KE0A 2RUDA 3O5PA 5HWBA 2ZQUA 1P5QA 2DG4A 4DH0A 2XP7A 1D7IA 1Q6HA 2DG9A 2OFNA 5D75A 1JNSA 1Y0OA 1YW5A 2ZR4A 5HWCA 2RUCA 1FKKA 2VCDA 1FKHA 2RURA 1FKJA 2LGOA 3KABA 3GPKA 4BF8A 4JYSA 3KCEA 4TNSA 4LAWA 2K8IA 4DRMA 4FN2A 4DT4A 1L1PA 4GIVA 2KI3A 2M2AA 1EYMA 1PBKA 2ZQVA 2XP6A 1D7HA 4W9OA 4LAYA 3JXVA 4W9QA 3NI6A 4ITZA 4ODPA 3O5KA 2PV3A 4G2PA 2PV2A 3CGNA 2F21A 4DRHA 2XPAA 1C9HA 2JZVA 3TDBA 3VAWA 2PV1A 5BXJA 4DRQA 3KAFA 2ZQSA 4ODOA 1Q1CA 1QZ2A 2LPVA 3UQIA 3PRBA 1QPLA 3O5FA 1F40A 1ZK6A 4O2TA 1KT0A 5DIUA 3O5DA 4U85A 3RGCA 1FKFA 4DRJA 1FKBA 1FKTA 2XP8A 3MDYB 4IQ2A 1M5YA 3CGMA 4QT2A 5DITA 4JFKA 1JNTA 1FKSA 2PBCA 2XP4A 4W9PA 2ITKA 1ZCNA 3ODKA 1BKFA 3UI5A 4JFIA 3EY6A 1D6OA 2Y78A 1W26A 4JFMA 4TYOA 4U86A 3UF8A 3WH0A 2AWGA 2ZR6A 5B8IC 1J4IA 3O5IA 3KAHA 3LUOA 1BL4A 4LAVA 2XP5A 2MLXA 3O5JA 2DG3A 3IKDA 3PA7A 4DRIA 2RUQA 3TCZA 5HUAA 1HXVA 4LAXA 2N87A 4ODQA 3O5QA 2Q5AA 4TW7A 4J4NA 2RSEA 4MSPA 2XPBA 1T11A 3O5RA 2MPHA 4IQCA 4DZ2A 4ODMA 2D9FA 2M1IA 1FKDA 1D7JA 2KO7A 2MNTA 2ZQTA 4DRKA 1FKIA 3I6CA 4TW8A 4ODKA 4U84A 2KFWA 1FD9A 3IKGA 2KR7A 5DIVA 1JVWA 1N1AA 4G50A 4GGQA 4ODLA 2XP9A 1F8AB 3KACA 1FKGA 4QT3A 3UI4A 2FAPA 3KAGA 3PRDA 2M08A 5I98A 3OOBA 5HW8A 4JFLA 2PPNA 1EQ3A 3NTPA 1YATA 2PPPA 2LKNA 2RQSA 3UQBA 3JYMA 1FKRA 3JYJA 3O5EA 5HW6A 4JFJA 1Q6IA 2ZR5A 5HW7A 3KZ7A 3NRKA 2PPOA 5GPGA 3TC5A 3O5LA 3O5MA 3O5OA 2MLYA 1U79A 3UI6A 4ODRA 4N19A 3IHZA 4MGVA 4TW6A 2UZ5A 1NSGA 5HT1A 3KAIA 1FAPA 1NMWA 1J6YA 2L2SA 2F4EA 2KGJA 3FAPA 4DRNA 3KADA 3O5GA 3RFWA 1J4RA 5HTGA 4TX0A 4C02B 1FKLA 1PINA 2FKEA 1QPFA 1Q6UA 3B7XA 1ROUA 2XP3A
chains in the Genus database with same CATH superfamily
3FY1A 1XHGA 4ZS6A 4R0XA 3GTYX 1X6LA 1ROTA 2F2DA 1TCOC 1NMVA 1R9HA 4DIPA 1KT1A 1FJDA 5HWBA 4DH0A 5DO2A 2IUZA 1NWSA 1E6NA 3KCEA 3AS3A 4NZCA 1LG2A 4DRMA 4FN2A 4DT4A 1L1PA 4GIVA 2KI3A 2M2AA 1H0IA 2XP6A 4ZPVR 4LAYA 1HKKA 3ARWA 4WKHA 4W9QA 4ITZA 4URIA 4G2PA 3WD2A 2PV2A 1JCHB 2JZVA 3TDBA 4MTVA 2PV1A 3CHEA 1LG1A 2LPVA 3GU0A 3PRBA 3ALFA 1WB0A 3MDYB 1NWUA 4QT2A 3RM8A 2XP4A 2PBCA 1ZCNA 4WKAA 3ARSA 3EY6A 1D6OA 4ZPWR 1ITXA 4AY1A 5B8IC 1BL4A 1W9PA 3PA7A 2RUQA 2G8ZA 3TCZA 1E15A 2N87A 2A3CA 2XPBA 1HKIA 2D9FA 4DRKA 3ARYA 3I6CA 2O9OA 3ARQA 1UR9A 2KR7A 5DIVA 1JVWA 4DWSB 4QT3A 1JNEA 2XP9A 1FKGA 3PRDA 2M08A 3ARTA 3RM9A 4JFLA 2RQSA 4NSBA 1FKRA 4DWSD 1W9UA 2B31A 5HW6A 3ARPA 2ZR5A 5HW7A 4WKFA 3TC5A 2P4VA 4ODRA 2AOSA 1FAPA 2F4EA 3FAPA 3KADA 5HTGA 1GPFA 3W4RA 3AS2A 1WAWA 1FKLA 1QPFA 1Q6UA 1ROUA 2XP3A 3H9RB 4FAPA 3IK8A 4P8VA 5HKGA 4ODNA 4QIBA 4Z2GA 1HJWA 2VN1A 1HKMA 4MAVA 4NNRA 4DZ3A 3O5PA 1CTNA 2ZQUA 5JH8A 1D7IA 3BMBA 1YW5A 5HWCA 2RUCA 3B9EA 2VCDA 1FKHA 1E6PA 3AQUA 2K8IA 2DT0A 4QZVB 1EYMA 2ZQVA 4W9OA 1D7HA 1LL4A 2PI6A 4ODPA 3ARZA 1NWTA 2F21A 5BXJA 4ODOA 2ZQSA 3UQIA 5GQBA 4P8XA 1QPLA 1GOIA 3FXYA 3RMEA 4Z2JA 4O2TA 3RGCA 5DIUA 4HBEA 1FKFA 1FKBA 1FKTA 4IQ2A 4HARA 1M5YA 1LJYA 4JFKA 4W9PA 2ITKA 3ODKA 4JFIA 4TYOA 3UF8A 2ZR6A 3WQWA 3KAHA 2XP5A 2DSZA 3IKDA 4DRIA 3O5QA 2Q5AA 4TW7A 4J4NA 3WD4A 2RSEA 1GRJA 4ODMA 4WIWA 2M1IA 1FKDA 2KO7A 2KFWA 1FD9A 2PN0A 3WIJA 2FAPA 3ARUA 1ZB5A 2LKNA 3ALGA 3UQBA 2OLHA 2G41A 4JFJA 1HJXA 1Q6IA 1SR0A 3CHDA 1HJVA 3WL1A 2DT1A 3O5LA 3O5MA 3WL0A 2DT2A 1OWQA 3WQVA 1O6IA 4MGVA 1XRVA 4TW6A 3OA5A 1RD6A 1TFVA 3CH9A 1E44A 1K9TA 4C02B 4KQZA 2FKEA 4L72B 4KR0B 2QF8A 2MF9A 2ESCA 3CHCA 4IPXA 1J4HA 1KFWA 2LJ4A 1B6CA 2RUDA 1P5QA 2OFNA 1JNSA 1Y0OA 1FKKA 2RURA 1FKJA 2A3EA 2LGOA 3WD0A 4BF8A 4TNSA 4LAWA 2WLYA 4ML4A 1PBKA 1OGBA 3NI6A 4WK9A 2XPAA 2A3AA 3VAWA 1GUVA 1QZ2A 4Z2LA 4MPKA 1X6NA 3O5FA 1F40A 1ZK6A 2FDMA 3AROA 3O5DA 4U85A 4DRJA 1E6ZA 1SYTA 1NWRA 1FFQA 5DITA 1JNTA 1FKSA 2B5UB 4IT4A 1UR8A 3CHFA 3UI5A 4MNMA 4U86A 3WH0A 2AWGA 1J4IA 3O5IA 3AS1A 1W1YA 3LUOA 1ZBVA 4W5UA 4P8UA 4P8WA 2WM0A 1W1TA 4Q7NA 3WKZA 1HXVA 4LAXA 1EHNA 4DWSA 4DZ2A 1T11A 1D7JA 2MNTA 2DSUA 3B9DA 4ODKA 4U84A 4HBOA 1ZBCA 1IX5A 4Q22A 3KACA 1VF8A 2O92A 3KAGA 5I98A 4Z2HA 1ZBWA 3OOBA 3ARVA 1W9VA 1JNDA 3JYJA 3O5EA 2A3BA 1W1PA 2PPOA 5GPGA 4PTMA 1E6RA 2ETNA 3O5OA 4S3JA 3UI6A 1HKJA 4N19A 3EIPA 1WNOA 1NSGA 3KAIA 2YBTA 2L2SA 4DRNA 2KGJA 1ZL1A 3O5GA 1J4RA 3QOKA 3B7XA 4MNLA 2IF4A 4DRPA 1A7XA 5J6EA 2MLZA 4DROA 3B9AA 4J4OA 5HBFA 3UQAA 2DT3A 2KE0A 4ZPTR 2DG4A 2XP7A 2DG9A 1Q6HA 4Z2IA 2F23A 5D75A 2ZR4A 2WLZA 1FFRA 3KABA 3GPKA 4UDMA 4JYSA 1ZU8A 4XAKA 3ARRA 1NH6A 3WD3A 3JXVA 1LL6A 3O5KA 2PV3A 3CGNA 4DRHA 2WK2A 1C9HA 4DRQA 3KAFA 4R5EA 1Q1CA 1KT0A 3AS0A 4LGXA 4MNJA 2XP8A 2DSVA 3G6MA 3G6LA 3CGMA 1LL7A 1EDQA 2DPEA 3PRAA 1BKFA 4JFMA 2Y78A 1W26A 5DEZA 5GPRA 3PR9A 4Z2KA 4DWSC 3ARXA 4LAVA 2MLXA 4WJXA 3WD1A 3O5JA 2DG3A 5HUAA 3B8SA 4MNKA 4ODQA 4MSPA 1E9LA 1LQ0A 3O5RA 2DSWA 4IQCA 2MPHA 1OGGA 1W1VA 2ZQTA 1EIBA 1FKIA 4TW8A 4IT6A 3IKGA 4S3KA 1N1AA 4G50A 4GGQA 4ODLA 3BXWA 1F8AB 3RM4A 3UI4A 1ZBKA 5HW8A 2PPNA 1EQ3A 3NTPA 1YATA 2PPPA 3JYMA 4L3NA 3KZ7A 3NRKA 2MLYA 1U79A 3IHZA 2EULA 2UZ5A 5HT1A 1NMWA 1J6YA 1D2KA 3RFWA 4TX0A 5DF0A 2YBUA 1H0GA 1PINA 3CZ8A
chains in the Genus database with same CATH topology
3FY1A 1XHGA 4ZS6A 4R0XA 1X6LA 1ROTA 2F2DA 1TCOC 1NMVA 1R9HA 4DIPA 1KT1A 1FJDA 5HWBA 4DH0A 5DO2A 2IUZA 1NWSA 1E6NA 3KCEA 3AS3A 4NZCA 1LG2A 4DRMA 4FN2A 4DT4A 1L1PA 4GIVA 2KI3A 2M2AA 1H0IA 2XP6A 4ZPVR 4LAYA 1HKKA 3ARWA 4WKHA 4W9QA 4ITZA 4URIA 4G2PA 3WD2A 2PV2A 2JZVA 3TDBA 4MTVA 2PV1A 3CHEA 1LG1A 2LPVA 3PRBA 3ALFA 1WB0A 3MDYB 1NWUA 4QT2A 3RM8A 2XP4A 2PBCA 1ZCNA 4WKAA 3ARSA 3EY6A 1D6OA 4ZPWR 1ITXA 4AY1A 5B8IC 1BL4A 1W9PA 3PA7A 2RUQA 2G8ZA 3TCZA 1E15A 2N87A 2A3CA 2XPBA 1HKIA 2D9FA 4DRKA 3ARYA 3I6CA 2O9OA 3ARQA 1UR9A 2KR7A 5DIVA 1JVWA 4DWSB 4QT3A 1JNEA 2XP9A 1FKGA 3PRDA 2M08A 3ARTA 3RM9A 4JFLA 2RQSA 4NSBA 1FKRA 4DWSD 1W9UA 2B31A 5HW6A 3ARPA 2ZR5A 5HW7A 4WKFA 3TC5A 4ODRA 2AOSA 1FAPA 2F4EA 3FAPA 3KADA 5HTGA 1GPFA 3W4RA 3AS2A 1WAWA 1FKLA 1QPFA 1Q6UA 1ROUA 2XP3A 3H9RB 4FAPA 3IK8A 4P8VA 5HKGA 4ODNA 4QIBA 4Z2GA 1HJWA 2VN1A 1HKMA 4MAVA 4NNRA 4DZ3A 3O5PA 1CTNA 2ZQUA 5JH8A 1D7IA 1YW5A 5HWCA 2RUCA 3B9EA 2VCDA 1FKHA 1E6PA 3AQUA 2K8IA 2DT0A 4QZVB 1EYMA 2ZQVA 4W9OA 1D7HA 1LL4A 2PI6A 4ODPA 3ARZA 1NWTA 2F21A 5BXJA 4ODOA 2ZQSA 3UQIA 5GQBA 4P8XA 1QPLA 1GOIA 3FXYA 3RMEA 4Z2JA 4O2TA 3RGCA 5DIUA 4HBEA 1FKFA 1FKBA 1FKTA 4IQ2A 4HARA 1M5YA 1LJYA 4JFKA 4W9PA 2ITKA 3ODKA 4JFIA 4TYOA 3UF8A 2ZR6A 3WQWA 3KAHA 2XP5A 2DSZA 3IKDA 4DRIA 3O5QA 2Q5AA 4TW7A 4J4NA 3WD4A 2RSEA 4ODMA 4WIWA 2M1IA 1FKDA 2KO7A 2KFWA 1FD9A 3WIJA 2FAPA 3ARUA 1ZB5A 2LKNA 3ALGA 3UQBA 2OLHA 2G41A 4JFJA 1HJXA 1Q6IA 1SR0A 3CHDA 1HJVA 3WL1A 2DT1A 3O5LA 3O5MA 3WL0A 2DT2A 1OWQA 3WQVA 1O6IA 4MGVA 1XRVA 4TW6A 3OA5A 1RD6A 1TFVA 3CH9A 1K9TA 4C02B 4KQZA 2FKEA 4L72B 4KR0B 2QF8A 2MF9A 2ESCA 3CHCA 4IPXA 1J4HA 1KFWA 2LJ4A 1B6CA 2RUDA 1P5QA 2OFNA 1JNSA 1Y0OA 1FKKA 2RURA 1FKJA 2A3EA 2LGOA 3WD0A 4BF8A 4TNSA 4LAWA 2WLYA 4ML4A 1PBKA 1OGBA 3NI6A 4WK9A 2XPAA 2A3AA 3VAWA 1GUVA 1QZ2A 4Z2LA 4MPKA 1X6NA 3O5FA 1F40A 1ZK6A 2FDMA 3AROA 3O5DA 4U85A 4DRJA 1E6ZA 1SYTA 1NWRA 1FFQA 5DITA 1JNTA 1FKSA 4IT4A 1UR8A 3CHFA 3UI5A 4MNMA 4U86A 3WH0A 2AWGA 1J4IA 3O5IA 3AS1A 1W1YA 3LUOA 1ZBVA 4W5UA 4P8UA 4P8WA 2WM0A 1W1TA 4Q7NA 3WKZA 1HXVA 4LAXA 1EHNA 4DWSA 4DZ2A 1T11A 1D7JA 2MNTA 2DSUA 3B9DA 4ODKA 4U84A 4HBOA 1ZBCA 1IX5A 4Q22A 3KACA 1VF8A 2O92A 3KAGA 5I98A 4Z2HA 1ZBWA 3OOBA 3ARVA 1W9VA 1JNDA 3JYJA 3O5EA 2A3BA 1W1PA 2PPOA 5GPGA 4PTMA 1E6RA 3O5OA 4S3JA 3UI6A 1HKJA 4N19A 1WNOA 1NSGA 3KAIA 2YBTA 2L2SA 4DRNA 2KGJA 1ZL1A 3O5GA 1J4RA 3QOKA 3B7XA 4MNLA 2IF4A 4DRPA 1A7XA 5J6EA 2MLZA 4DROA 3B9AA 4J4OA 5HBFA 3UQAA 2DT3A 2KE0A 4ZPTR 2DG4A 2XP7A 2DG9A 1Q6HA 4Z2IA 5D75A 2ZR4A 2WLZA 1FFRA 3KABA 3GPKA 4JYSA 1ZU8A 4XAKA 3ARRA 1NH6A 3WD3A 3JXVA 1LL6A 3O5KA 2PV3A 3CGNA 4DRHA 2WK2A 1C9HA 4DRQA 3KAFA 4R5EA 1Q1CA 1KT0A 3AS0A 4LGXA 4MNJA 2XP8A 2DSVA 3G6MA 3G6LA 3CGMA 1LL7A 1EDQA 2DPEA 3PRAA 1BKFA 4JFMA 2Y78A 1W26A 5DEZA 5GPRA 3PR9A 4Z2KA 4DWSC 3ARXA 4LAVA 2MLXA 4WJXA 3WD1A 3O5JA 2DG3A 5HUAA 3B8SA 4MNKA 4ODQA 4MSPA 1E9LA 1LQ0A 3O5RA 2DSWA 4IQCA 2MPHA 1OGGA 1W1VA 2ZQTA 1EIBA 1FKIA 4TW8A 4IT6A 3IKGA 4S3KA 1N1AA 4G50A 4GGQA 4ODLA 3BXWA 1F8AB 3RM4A 3UI4A 1ZBKA 5HW8A 2PPNA 1EQ3A 3NTPA 1YATA 2PPPA 3JYMA 4L3NA 3KZ7A 3NRKA 2MLYA 1U79A 3IHZA 2UZ5A 5HT1A 1NMWA 1J6YA 1D2KA 3RFWA 4TX0A 5DF0A 2YBUA 1H0GA 1PINA 3CZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H9R B;  4FAP A;  2MF9 A;  4R0X A;  2IF4 A;  4DRP A;  1A7X A;  3IK8 A;  5J6E A;  2MLZ A;  5HKG A;  4ODN A;  1ROT A;  4QIB A;  2F2D A;  4DRO A;  4IPX A;  1J4H A;  1TCO C;  1NMV A;  2VN1 A;  1R9H A;  2LJ4 A;  1B6C A;  4J4O A;  1KT1 A;  4DIP A;  3UQA A;  4NNR A;  1FJD A;  4DZ3 A;  2KE0 A;  2RUD A;  3O5P A;  5HWB A;  2ZQU A;  1P5Q A;  2DG4 A;  4DH0 A;  2XP7 A;  1D7I A;  1Q6H A;  2DG9 A;  2OFN A;  5D75 A;  1JNS A;  1Y0O A;  1YW5 A;  2ZR4 A;  5HWC A;  2RUC A;  1FKK A;  2VCD A;  1FKH A;  2RUR A;  1FKJ A;  2LGO A;  3KAB A;  3GPK A;  4BF8 A;  4JYS A;  3KCE A;  4TNS A;  4LAW A;  2K8I A;  4DRM A;  4FN2 A;  4DT4 A;  1L1P A;  4GIV A;  2KI3 A;  2M2A A;  1EYM A;  1PBK A;  2ZQV A;  2XP6 A;  1D7H A;  4W9O A;  4LAY A;  3JXV A;  4W9Q A;  3NI6 A;  4ITZ A;  4ODP A;  3O5K A;  2PV3 A;  4G2P A;  2PV2 A;  3CGN A;  2F21 A;  4DRH A;  2XPA A;  1C9H A;  2JZV A;  3TDB A;  3VAW A;  2PV1 A;  5BXJ A;  4DRQ A;  3KAF A;  2ZQS A;  4ODO A;  1Q1C A;  1QZ2 A;  2LPV A;  3UQI A;  3PRB A;  1QPL A;  3O5F A;  1F40 A;  1ZK6 A;  4O2T A;  1KT0 A;  5DIU A;  3O5D A;  4U85 A;  3RGC A;  1FKF A;  4DRJ A;  1FKB A;  1FKT A;  2XP8 A;  3MDY B;  4IQ2 A;  1M5Y A;  3CGM A;  4QT2 A;  5DIT A;  4JFK A;  1JNT A;  1FKS A;  2PBC A;  2XP4 A;  4W9P A;  2ITK A;  1ZCN A;  3ODK A;  1BKF A;  3UI5 A;  4JFI A;  3EY6 A;  1D6O A;  2Y78 A;  1W26 A;  4JFM A;  4TYO A;  4U86 A;  3UF8 A;  3WH0 A;  2AWG A;  2ZR6 A;  5B8I C;  1J4I A;  3O5I A;  3KAH A;  3LUO A;  1BL4 A;  4LAV A;  2XP5 A;  2MLX A;  3O5J A;  2DG3 A;  3IKD A;  3PA7 A;  4DRI A;  2RUQ A;  3TCZ A;  5HUA A;  1HXV A;  4LAX A;  2N87 A;  4ODQ A;  3O5Q A;  2Q5A A;  4TW7 A;  4J4N A;  2RSE A;  4MSP A;  2XPB A;  1T11 A;  3O5R A;  2MPH A;  4IQC A;  4DZ2 A;  4ODM A;  2D9F A;  2M1I A;  1FKD A;  1D7J A;  2KO7 A;  2MNT A;  2ZQT A;  4DRK A;  1FKI A;  3I6C A;  4TW8 A;  4ODK A;  4U84 A;  2KFW A;  1FD9 A;  3IKG A;  2KR7 A;  5DIV A;  1JVW A;  1N1A A;  4G50 A;  4GGQ A;  4ODL A;  2XP9 A;  1F8A B;  3KAC A;  1FKG A;  4QT3 A;  3UI4 A;  2FAP A;  3KAG A;  3PRD A;  2M08 A;  5I98 A;  3OOB A;  5HW8 A;  4JFL A;  2PPN A;  1EQ3 A;  3NTP A;  1YAT A;  2PPP A;  2LKN A;  2RQS A;  3UQB A;  3JYM A;  1FKR A;  3JYJ A;  3O5E A;  5HW6 A;  4JFJ A;  1Q6I A;  2ZR5 A;  5HW7 A;  3KZ7 A;  3NRK A;  2PPO A;  5GPG A;  3TC5 A;  3O5L A;  3O5M A;  3O5O A;  2MLY A;  1U79 A;  3UI6 A;  4ODR A;  4N19 A;  3IHZ A;  4MGV A;  4TW6 A;  2UZ5 A;  1NSG A;  5HT1 A;  3KAI A;  1FAP A;  1NMW A;  1J6Y A;  2L2S A;  2F4E A;  2KGJ A;  3FAP A;  4DRN A;  3KAD A;  3O5G A;  3RFW A;  1J4R A;  5HTG A;  4TX0 A;  4C02 B;  1FKL A;  1PIN A;  2FKE A;  1QPF A;  1Q6U A;  3B7X A;  1ROU A;  2XP3 A; 
#chains in the Genus database with same CATH topology
 3FY1 A;  1XHG A;  4ZS6 A;  4R0X A;  3GTY X;  1X6L A;  1ROT A;  2F2D A;  1TCO C;  1NMV A;  1R9H A;  4DIP A;  1KT1 A;  1FJD A;  5HWB A;  4DH0 A;  5DO2 A;  2IUZ A;  1NWS A;  1E6N A;  3KCE A;  3AS3 A;  4NZC A;  1LG2 A;  4DRM A;  4FN2 A;  4DT4 A;  1L1P A;  4GIV A;  2KI3 A;  2M2A A;  1H0I A;  2XP6 A;  4ZPV R;  4LAY A;  1HKK A;  3ARW A;  4WKH A;  4W9Q A;  4ITZ A;  4URI A;  4G2P A;  3WD2 A;  2PV2 A;  1JCH B;  2JZV A;  3TDB A;  4MTV A;  2PV1 A;  3CHE A;  1LG1 A;  2LPV A;  3GU0 A;  3PRB A;  3ALF A;  1WB0 A;  3MDY B;  1NWU A;  4QT2 A;  3RM8 A;  2XP4 A;  2PBC A;  1ZCN A;  4WKA A;  3ARS A;  3EY6 A;  1D6O A;  4ZPW R;  1ITX A;  4AY1 A;  5B8I C;  1BL4 A;  1W9P A;  3PA7 A;  2RUQ A;  2G8Z A;  3TCZ A;  1E15 A;  2N87 A;  2A3C A;  2XPB A;  1HKI A;  2D9F A;  4DRK A;  3ARY A;  3I6C A;  2O9O A;  3ARQ A;  1UR9 A;  2KR7 A;  5DIV A;  1JVW A;  4DWS B;  4QT3 A;  1JNE A;  2XP9 A;  1FKG A;  3PRD A;  2M08 A;  3ART A;  3RM9 A;  4JFL A;  2RQS A;  4NSB A;  1FKR A;  4DWS D;  1W9U A;  2B31 A;  5HW6 A;  3ARP A;  2ZR5 A;  5HW7 A;  4WKF A;  3TC5 A;  2P4V A;  4ODR A;  2AOS A;  1FAP A;  2F4E A;  3FAP A;  3KAD A;  5HTG A;  1GPF A;  3W4R A;  3AS2 A;  1WAW A;  1FKL A;  1QPF A;  1Q6U A;  1ROU A;  2XP3 A;  3H9R B;  4FAP A;  3IK8 A;  4P8V A;  5HKG A;  4ODN A;  4QIB A;  4Z2G A;  1HJW A;  2VN1 A;  1HKM A;  4MAV A;  4NNR A;  4DZ3 A;  3O5P A;  1CTN A;  2ZQU A;  5JH8 A;  1D7I A;  3BMB A;  1YW5 A;  5HWC A;  2RUC A;  3B9E A;  2VCD A;  1FKH A;  1E6P A;  3AQU A;  2K8I A;  2DT0 A;  4QZV B;  1EYM A;  2ZQV A;  4W9O A;  1D7H A;  1LL4 A;  2PI6 A;  4ODP A;  3ARZ A;  1NWT A;  2F21 A;  5BXJ A;  4ODO A;  2ZQS A;  3UQI A;  5GQB A;  4P8X A;  1QPL A;  1GOI A;  3FXY A;  3RME A;  4Z2J A;  4O2T A;  3RGC A;  5DIU A;  4HBE A;  1FKF A;  1FKB A;  1FKT A;  4IQ2 A;  4HAR A;  1M5Y A;  1LJY A;  4JFK A;  4W9P A;  2ITK A;  3ODK A;  4JFI A;  4TYO A;  3UF8 A;  2ZR6 A;  3WQW A;  3KAH A;  2XP5 A;  2DSZ A;  3IKD A;  4DRI A;  3O5Q A;  2Q5A A;  4TW7 A;  4J4N A;  3WD4 A;  2RSE A;  1GRJ A;  4ODM A;  4WIW A;  2M1I A;  1FKD A;  2KO7 A;  2KFW A;  1FD9 A;  2PN0 A;  3WIJ A;  2FAP A;  3ARU A;  1ZB5 A;  2LKN A;  3ALG A;  3UQB A;  2OLH A;  2G41 A;  4JFJ A;  1HJX A;  1Q6I A;  1SR0 A;  3CHD A;  1HJV A;  3WL1 A;  2DT1 A;  3O5L A;  3O5M A;  3WL0 A;  2DT2 A;  1OWQ A;  3WQV A;  1O6I A;  4MGV A;  1XRV A;  4TW6 A;  3OA5 A;  1RD6 A;  1TFV A;  3CH9 A;  1E44 A;  1K9T A;  4C02 B;  4KQZ A;  2FKE A;  4L72 B;  4KR0 B;  2QF8 A;  2MF9 A;  2ESC A;  3CHC A;  4IPX A;  1J4H A;  1KFW A;  2LJ4 A;  1B6C A;  2RUD A;  1P5Q A;  2OFN A;  1JNS A;  1Y0O A;  1FKK A;  2RUR A;  1FKJ A;  2A3E A;  2LGO A;  3WD0 A;  4BF8 A;  4TNS A;  4LAW A;  2WLY A;  4ML4 A;  1PBK A;  1OGB A;  3NI6 A;  4WK9 A;  2XPA A;  2A3A A;  3VAW A;  1GUV A;  1QZ2 A;  4Z2L A;  4MPK A;  1X6N A;  3O5F A;  1F40 A;  1ZK6 A;  2FDM A;  3ARO A;  3O5D A;  4U85 A;  4DRJ A;  1E6Z A;  1SYT A;  1NWR A;  1FFQ A;  5DIT A;  1JNT A;  1FKS A;  2B5U B;  4IT4 A;  1UR8 A;  3CHF A;  3UI5 A;  4MNM A;  4U86 A;  3WH0 A;  2AWG A;  1J4I A;  3O5I A;  3AS1 A;  1W1Y A;  3LUO A;  1ZBV A;  4W5U A;  4P8U A;  4P8W A;  2WM0 A;  1W1T A;  4Q7N A;  3WKZ A;  1HXV A;  4LAX A;  1EHN A;  4DWS A;  4DZ2 A;  1T11 A;  1D7J A;  2MNT A;  2DSU A;  3B9D A;  4ODK A;  4U84 A;  4HBO A;  1ZBC A;  1IX5 A;  4Q22 A;  3KAC A;  1VF8 A;  2O92 A;  3KAG A;  5I98 A;  4Z2H A;  1ZBW A;  3OOB A;  3ARV A;  1W9V A;  1JND A;  3JYJ A;  3O5E A;  2A3B A;  1W1P A;  2PPO A;  5GPG A;  4PTM A;  1E6R A;  2ETN A;  3O5O A;  4S3J A;  3UI6 A;  1HKJ A;  4N19 A;  3EIP A;  1WNO A;  1NSG A;  3KAI A;  2YBT A;  2L2S A;  4DRN A;  2KGJ A;  1ZL1 A;  3O5G A;  1J4R A;  3QOK A;  3B7X A;  4MNL A;  2IF4 A;  4DRP A;  1A7X A;  5J6E A;  2MLZ A;  4DRO A;  3B9A A;  4J4O A;  5HBF A;  3UQA A;  2DT3 A;  2KE0 A;  4ZPT R;  2DG4 A;  2XP7 A;  2DG9 A;  1Q6H A;  4Z2I A;  2F23 A;  5D75 A;  2ZR4 A;  2WLZ A;  1FFR A;  3KAB A;  3GPK A;  4UDM A;  4JYS A;  1ZU8 A;  4XAK A;  3ARR A;  1NH6 A;  3WD3 A;  3JXV A;  1LL6 A;  3O5K A;  2PV3 A;  3CGN A;  4DRH A;  2WK2 A;  1C9H A;  4DRQ A;  3KAF A;  4R5E A;  1Q1C A;  1KT0 A;  3AS0 A;  4LGX A;  4MNJ A;  2XP8 A;  2DSV A;  3G6M A;  3G6L A;  3CGM A;  1LL7 A;  1EDQ A;  2DPE A;  3PRA A;  1BKF A;  4JFM A;  2Y78 A;  1W26 A;  5DEZ A;  5GPR A;  3PR9 A;  4Z2K A;  4DWS C;  3ARX A;  4LAV A;  2MLX A;  4WJX A;  3WD1 A;  3O5J A;  2DG3 A;  5HUA A;  3B8S A;  4MNK A;  4ODQ A;  4MSP A;  1E9L A;  1LQ0 A;  3O5R A;  2DSW A;  4IQC A;  2MPH A;  1OGG A;  1W1V A;  2ZQT A;  1EIB A;  1FKI A;  4TW8 A;  4IT6 A;  3IKG A;  4S3K A;  1N1A A;  4G50 A;  4GGQ A;  4ODL A;  3BXW A;  1F8A B;  3RM4 A;  3UI4 A;  1ZBK A;  5HW8 A;  2PPN A;  1EQ3 A;  3NTP A;  1YAT A;  2PPP A;  3JYM A;  4L3N A;  3KZ7 A;  3NRK A;  2MLY A;  1U79 A;  3IHZ A;  2EUL A;  2UZ5 A;  5HT1 A;  1NMW A;  1J6Y A;  1D2K A;  3RFW A;  4TX0 A;  5DF0 A;  2YBU A;  1H0G A;  1PIN A;  3CZ8 A; 
#chains in the Genus database with same CATH homology
 3FY1 A;  1XHG A;  4ZS6 A;  4R0X A;  1X6L A;  1ROT A;  2F2D A;  1TCO C;  1NMV A;  1R9H A;  4DIP A;  1KT1 A;  1FJD A;  5HWB A;  4DH0 A;  5DO2 A;  2IUZ A;  1NWS A;  1E6N A;  3KCE A;  3AS3 A;  4NZC A;  1LG2 A;  4DRM A;  4FN2 A;  4DT4 A;  1L1P A;  4GIV A;  2KI3 A;  2M2A A;  1H0I A;  2XP6 A;  4ZPV R;  4LAY A;  1HKK A;  3ARW A;  4WKH A;  4W9Q A;  4ITZ A;  4URI A;  4G2P A;  3WD2 A;  2PV2 A;  2JZV A;  3TDB A;  4MTV A;  2PV1 A;  3CHE A;  1LG1 A;  2LPV A;  3PRB A;  3ALF A;  1WB0 A;  3MDY B;  1NWU A;  4QT2 A;  3RM8 A;  2XP4 A;  2PBC A;  1ZCN A;  4WKA A;  3ARS A;  3EY6 A;  1D6O A;  4ZPW R;  1ITX A;  4AY1 A;  5B8I C;  1BL4 A;  1W9P A;  3PA7 A;  2RUQ A;  2G8Z A;  3TCZ A;  1E15 A;  2N87 A;  2A3C A;  2XPB A;  1HKI A;  2D9F A;  4DRK A;  3ARY A;  3I6C A;  2O9O A;  3ARQ A;  1UR9 A;  2KR7 A;  5DIV A;  1JVW A;  4DWS B;  4QT3 A;  1JNE A;  2XP9 A;  1FKG A;  3PRD A;  2M08 A;  3ART A;  3RM9 A;  4JFL A;  2RQS A;  4NSB A;  1FKR A;  4DWS D;  1W9U A;  2B31 A;  5HW6 A;  3ARP A;  2ZR5 A;  5HW7 A;  4WKF A;  3TC5 A;  4ODR A;  2AOS A;  1FAP A;  2F4E A;  3FAP A;  3KAD A;  5HTG A;  1GPF A;  3W4R A;  3AS2 A;  1WAW A;  1FKL A;  1QPF A;  1Q6U A;  1ROU A;  2XP3 A;  3H9R B;  4FAP A;  3IK8 A;  4P8V A;  5HKG A;  4ODN A;  4QIB A;  4Z2G A;  1HJW A;  2VN1 A;  1HKM A;  4MAV A;  4NNR A;  4DZ3 A;  3O5P A;  1CTN A;  2ZQU A;  5JH8 A;  1D7I A;  1YW5 A;  5HWC A;  2RUC A;  3B9E A;  2VCD A;  1FKH A;  1E6P A;  3AQU A;  2K8I A;  2DT0 A;  4QZV B;  1EYM A;  2ZQV A;  4W9O A;  1D7H A;  1LL4 A;  2PI6 A;  4ODP A;  3ARZ A;  1NWT A;  2F21 A;  5BXJ A;  4ODO A;  2ZQS A;  3UQI A;  5GQB A;  4P8X A;  1QPL A;  1GOI A;  3FXY A;  3RME A;  4Z2J A;  4O2T A;  3RGC A;  5DIU A;  4HBE A;  1FKF A;  1FKB A;  1FKT A;  4IQ2 A;  4HAR A;  1M5Y A;  1LJY A;  4JFK A;  4W9P A;  2ITK A;  3ODK A;  4JFI A;  4TYO A;  3UF8 A;  2ZR6 A;  3WQW A;  3KAH A;  2XP5 A;  2DSZ A;  3IKD A;  4DRI A;  3O5Q A;  2Q5A A;  4TW7 A;  4J4N A;  3WD4 A;  2RSE A;  4ODM A;  4WIW A;  2M1I A;  1FKD A;  2KO7 A;  2KFW A;  1FD9 A;  3WIJ A;  2FAP A;  3ARU A;  1ZB5 A;  2LKN A;  3ALG A;  3UQB A;  2OLH A;  2G41 A;  4JFJ A;  1HJX A;  1Q6I A;  1SR0 A;  3CHD A;  1HJV A;  3WL1 A;  2DT1 A;  3O5L A;  3O5M A;  3WL0 A;  2DT2 A;  1OWQ A;  3WQV A;  1O6I A;  4MGV A;  1XRV A;  4TW6 A;  3OA5 A;  1RD6 A;  1TFV A;  3CH9 A;  1K9T A;  4C02 B;  4KQZ A;  2FKE A;  4L72 B;  4KR0 B;  2QF8 A;  2MF9 A;  2ESC A;  3CHC A;  4IPX A;  1J4H A;  1KFW A;  2LJ4 A;  1B6C A;  2RUD A;  1P5Q A;  2OFN A;  1JNS A;  1Y0O A;  1FKK A;  2RUR A;  1FKJ A;  2A3E A;  2LGO A;  3WD0 A;  4BF8 A;  4TNS A;  4LAW A;  2WLY A;  4ML4 A;  1PBK A;  1OGB A;  3NI6 A;  4WK9 A;  2XPA A;  2A3A A;  3VAW A;  1GUV A;  1QZ2 A;  4Z2L A;  4MPK A;  1X6N A;  3O5F A;  1F40 A;  1ZK6 A;  2FDM A;  3ARO A;  3O5D A;  4U85 A;  4DRJ A;  1E6Z A;  1SYT A;  1NWR A;  1FFQ A;  5DIT A;  1JNT A;  1FKS A;  4IT4 A;  1UR8 A;  3CHF A;  3UI5 A;  4MNM A;  4U86 A;  3WH0 A;  2AWG A;  1J4I A;  3O5I A;  3AS1 A;  1W1Y A;  3LUO A;  1ZBV A;  4W5U A;  4P8U A;  4P8W A;  2WM0 A;  1W1T A;  4Q7N A;  3WKZ A;  1HXV A;  4LAX A;  1EHN A;  4DWS A;  4DZ2 A;  1T11 A;  1D7J A;  2MNT A;  2DSU A;  3B9D A;  4ODK A;  4U84 A;  4HBO A;  1ZBC A;  1IX5 A;  4Q22 A;  3KAC A;  1VF8 A;  2O92 A;  3KAG A;  5I98 A;  4Z2H A;  1ZBW A;  3OOB A;  3ARV A;  1W9V A;  1JND A;  3JYJ A;  3O5E A;  2A3B A;  1W1P A;  2PPO A;  5GPG A;  4PTM A;  1E6R A;  3O5O A;  4S3J A;  3UI6 A;  1HKJ A;  4N19 A;  1WNO A;  1NSG A;  3KAI A;  2YBT A;  2L2S A;  4DRN A;  2KGJ A;  1ZL1 A;  3O5G A;  1J4R A;  3QOK A;  3B7X A;  4MNL A;  2IF4 A;  4DRP A;  1A7X A;  5J6E A;  2MLZ A;  4DRO A;  3B9A A;  4J4O A;  5HBF A;  3UQA A;  2DT3 A;  2KE0 A;  4ZPT R;  2DG4 A;  2XP7 A;  2DG9 A;  1Q6H A;  4Z2I A;  5D75 A;  2ZR4 A;  2WLZ A;  1FFR A;  3KAB A;  3GPK A;  4JYS A;  1ZU8 A;  4XAK A;  3ARR A;  1NH6 A;  3WD3 A;  3JXV A;  1LL6 A;  3O5K A;  2PV3 A;  3CGN A;  4DRH A;  2WK2 A;  1C9H A;  4DRQ A;  3KAF A;  4R5E A;  1Q1C A;  1KT0 A;  3AS0 A;  4LGX A;  4MNJ A;  2XP8 A;  2DSV A;  3G6M A;  3G6L A;  3CGM A;  1LL7 A;  1EDQ A;  2DPE A;  3PRA A;  1BKF A;  4JFM A;  2Y78 A;  1W26 A;  5DEZ A;  5GPR A;  3PR9 A;  4Z2K A;  4DWS C;  3ARX A;  4LAV A;  2MLX A;  4WJX A;  3WD1 A;  3O5J A;  2DG3 A;  5HUA A;  3B8S A;  4MNK A;  4ODQ A;  4MSP A;  1E9L A;  1LQ0 A;  3O5R A;  2DSW A;  4IQC A;  2MPH A;  1OGG A;  1W1V A;  2ZQT A;  1EIB A;  1FKI A;  4TW8 A;  4IT6 A;  3IKG A;  4S3K A;  1N1A A;  4G50 A;  4GGQ A;  4ODL A;  3BXW A;  1F8A B;  3RM4 A;  3UI4 A;  1ZBK A;  5HW8 A;  2PPN A;  1EQ3 A;  3NTP A;  1YAT A;  2PPP A;  3JYM A;  4L3N A;  3KZ7 A;  3NRK A;  2MLY A;  1U79 A;  3IHZ A;  2UZ5 A;  5HT1 A;  1NMW A;  1J6Y A;  1D2K A;  3RFW A;  4TX0 A;  5DF0 A;  2YBU A;  1H0G A;  1PIN A;  3CZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...