1D7JA

Fkbp complexed with 4-hydroxy-2-butanone
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
publication title X-ray structures of small ligand-FKBP complexes provide an estimate for hydrophobic interaction energies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 28
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1d7jA00
2PV2A 3JYMA 3O5LA 4TNSA 1BKFA 2FAPA 3VAWA 1FKSA 1Q6HA 2L2SA 3IK8A 2DG3A 3FAPA 4TYOA 4JFJA 1JVWA 3RGCA 1T11A 5B8IC 3O5GA 2RUCA 3TC5A 5BXJA 4DRJA 2MLZA 3O5JA 1JNSA 2OFNA 3GPKA 4GIVA 1EYMA 1FKHA 3WH0A 3NI6A 2RQSA 3JXVA 3O5FA 2MLXA 1U79A 3ODKA 3KACA 3UI6A 4DRMA 2PV1A 1FKLA 2MLYA 2MF9A 2ZQUA 3KABA 1D7HA 4JFIA 1QZ2A 3H9RB 4DT4A 1ROTA 2XP4A 3CGNA 4N19A 3KZ7A 1FKIA 3KADA 2ZR4A 4LAYA 3IKGA 1ROUA 4U86A 4W9QA 2K8IA 2RSEA 5HUAA 4ODMA 4JYSA 3NTPA 4TW7A 2ZQVA 3KCEA 1P5QA 2RUQA 2VN1A 4O2TA 3UI4A 5I98A 4W9PA 2XP5A 2LKNA 2RUDA 4ODPA 1D7IA 3O5EA 1L1PA 4DROA 3O5OA 4ITZA 4QIBA 1R9HA 5HT1A 4W9OA 3RFWA 2PPPA 2F4EA 1PINA 4LAWA 4ODRA 1NMVA 3O5MA 3UQBA 1HXVA 1FKRA 2KGJA 4NNRA 2F2DA 1FAPA 3I6CA 1PBKA 2M1IA 1FKDA 2KI3A 2LJ4A 1FD9A 2N87A 2KE0A 2XP7A 2LGOA 2Y78A 4MGVA 3KAGA 4U85A 1N1AA 1FKFA 2M08A 3EY6A 3OOBA 3PA7A 3MDYB 1EQ3A 5HWCA 1J4RA 3PRDA 1BL4A 1J6YA 1F40A 1KT0A 1QPFA 2ITKA 4LAXA 1ZCNA 3LUOA 3UQAA 2JZVA 5HW6A 5HTGA 4ODQA 3NRKA 3UI5A 2MNTA 2UZ5A 1B6CA 1Y0OA 4JFMA 4MSPA 2XP3A 1M5YA 2XP8A 2XP6A 3UQIA 2DG9A 1FKJA 4R0XA 5GPGA 1Q6IA 4J4NA 2F21A 4BF8A 1YATA 3KAHA 4DRHA 2ZQTA 2ZQSA 1D7JA 3CGMA 2RURA 4J4OA 2XPAA 5DITA 4ODKA 2VCDA 5HWBA 3KAIA 4DRKA 2XPBA 1Q6UA 3O5QA 4ODOA 1A7XA 1J4IA 2M2AA 3KAFA 3O5PA 4TX0A 4DRIA 5J6EA 2PPNA 4TW8A 4JFKA 4DZ2A 2KO7A 1FJDA 4QT3A 1FKGA 2ZR6A 2AWGA 5DIVA 1NSGA 1D6OA 2LPVA 4G50A 4JFLA 4ODLA 4FAPA 4GGQA 1J4HA 1NMWA 3IHZA 1KT1A 4DH0A 1F8AB 1FKTA 1ZK6A 2XP9A 4IQ2A 2IF4A 4U84A 4C02B 1FKBA 4DRQA 4DZ3A 4G2PA 4DRNA 1FKKA 3IKDA 4DRPA 3JYJA 1TCOC 5D75A 2ZR5A 1C9HA 2FKEA 3B7XA 1Q1CA 2MPHA 2DG4A 4IPXA 5DIUA 3TCZA 1JNTA 3PRBA 4FN2A 4LAVA 5HKGA 2PPOA 2D9FA 3O5DA 2PBCA 4DIPA 1W26A 2KR7A 4IQCA 3TDBA 3O5KA 1YW5A 2PV3A 3UF8A 4TW6A 5HW7A 4QT2A 5HW8A 4ODNA 3O5RA 3O5IA 1QPLA 2KFWA 2Q5AA
chains in the Genus database with same CATH superfamily
3GTYX 3WD3A 2B5UB 3JYMA 1BKFA 1LJYA 2L2SA 4HBEA 3RM9A 3FAPA 4P8XA 1LQ0A 3TC5A 2OFNA 3GPKA 4L3NA 3WH0A 3O5FA 1U79A 3WL1A 3KACA 1E15A 2DSZA 1FKLA 3KABA 4MNKA 3WD1A 2A3BA 2EULA 3CHDA 1QZ2A 2DSVA 3KZ7A 4W9QA 2K8IA 5HUAA 4JYSA 3NTPA 2VN1A 1OWQA 4O2TA 2DT3A 2XP5A 2RUDA 1TFVA 3O5EA 1LL7A 2WM0A 1CTNA 1NMVA 1FKRA 1FFRA 2KGJA 2F2DA 1PBKA 2N87A 1HKIA 4DZ3A 4Q7NA 4Z2LA 2M08A 5HWCA 4XAKA 1ZU8A 1BL4A 1O6IA 1KT0A 4UDMA 4LAXA 3WD4A 4ODQA 3WD0A 3UI5A 2UZ5A 1B6CA 4MSPA 4LGXA 1M5YA 2DG9A 1FKJA 4MNMA 4J4NA 1W9UA 1YATA 2ZQTA 4ODKA 3KAIA 1W9PA 1LG1A 1A7XA 3EIPA 3KAFA 4DRIA 5J6EA 2PPNA 3G6LA 1H0GA 2AWGA 2ETNA 4FAPA 4G50A 4ODLA 1J4HA 1LG2A 3IHZA 1HJWA 4URIA 1F8AB 1ZK6A 4IQ2A 2IF4A 4U84A 1FKBA 4G2PA 4DRNA 3ARRA 3JYJA 1K9TA 3WD2A 4MNLA 2MPHA 4IPXA 3RM4A 4PTMA 1JNEA 4DIPA 4Z2IA 2KR7A 1IX5A 1ZBWA 5HW7A 1QPLA 1HXVA 2Q5AA 1OGGA 3O5LA 3VAWA 1FKSA 3WIJA 4WIWA 4TYOA 1X6LA 4JFJA 3WL0A 3RGCA 1T11A 4MTVA 5B8IC 3O5GA 2YBUA 5BXJA 1WAWA 3O5JA 4WKAA 3WKZA 2DSWA 3WQWA 4ZPWR 3NI6A 3JXVA 2RQSA 3BXWA 1VF8A 2A3EA 2MLYA 1E6RA 2P4VA 1D7HA 4ZPTR 1ROTA 4N19A 3ALFA 4U86A 2ZR4A 2G41A 2RSEA 4P8VA 4Z2GA 4TW7A 3QOKA 4W9PA 1NWRA 2LKNA 1D7IA 1L1PA 4DROA 2PN0A 4R5EA 4DWSB 1R9HA 3RFWA 2F4EA 4NSBA 3PRAA 4P8WA 2A3AA 3I6CA 4KR0B 2M1IA 2YBTA 1FD9A 2XP7A 4P8UA 1FKFA 3MDYB 3PRDA 1W9VA 3RM8A 3LUOA 1ZBKA 4L72B 5HW6A 4Z2KA 1Y0OA 4JFMA 1EDQA 4R0XA 1HJXA 2AOSA 1FFQA 3KAHA 1EIBA 1ZBVA 1D7JA 1NWTA 3PR9A 4DRKA 1Q6UA 3O5QA 3W4RA 2M2AA 3CHCA 3ARPA 4DZ2A 3ARQA 2KO7A 1FJDA 2ZR6A 4JFLA 4ZPVR 4DH0A 2DT2A 2WLYA 1FKKA 1SR0A 2IUZA 1TCOC 5D75A 1Q1CA 1GPFA 5DIUA 4LAVA 2PPOA 2PV3A 4QT2A 4ODNA 3O5IA 3TCZA 2KFWA 3O5DA 2PV2A 4WJXA 4TNSA 2FAPA 1Q6HA 3IK8A 2DG3A 1JVWA 3AS1A 4IT4A 2MLZA 1JNSA 1GUVA 1W1VA 4GIVA 1EYMA 1FKHA 1GOIA 3ARZA 3G6MA 3ODKA 4WKHA 1HJVA 4Z2HA 1JNDA 1W1YA 4DRMA 2MF9A 4JFIA 3B9DA 4DT4A 2XP4A 3CGNA 1FKIA 3KADA 3IKGA 1ROUA 1ZB5A 3ARYA 4ODMA 2ZQVA 3UI4A 3AS2A 4S3KA 4ODPA 3CHEA 4ZS6A 3O5OA 4ML4A 4LAWA 1PINA 1D2KA 3O5MA 1ITXA 4W9OA 2KE0A 2LGOA 3B9EA 3EY6A 2QF8A 3OOBA 1EQ3A 1RD6A 1J4RA 5GQBA 1J6YA 1F40A 2DPEA 1HKJA 4AY1A 3UQAA 2JZVA 3CHFA 5HTGA 1JCHB 2MNTA 1E6NA 2A3CA 2XP6A 3UQIA 5GPGA 1GRJA 4BF8A 3ARXA 2ZQSA 5JH8A 1ZL1A 2VCDA 1E6PA 4WKFA 5HWBA 2OLHA 4ODOA 3ARWA 1J4IA 4Z2JA 5DF0A 4JFKA 2PI6A 1FKGA 5DIVA 4GGQA 1KT1A 2G8ZA 5DEZA 4C02B 3IKDA 1W1PA 2ZR5A 4DWSD 2FKEA 4MPKA 3FXYA 1JNTA 3PRBA 1HKMA 2D9FA 1W26A 3TDBA 3O5KA 1LL6A 4MAVA 1NWSA 5DO2A 4W5UA 2RUCA 4DRJA 1NWUA 1XRVA 1HKKA 1NH6A 2MLXA 3UI6A 2WLZA 2PV1A 3AQUA 2ZQUA 3GU0A 1W1TA 3H9RB 4HARA 4QZVB 4S3JA 4WK9A 4LAYA 4MNJA 3AS0A 2DSUA 3KCEA 1P5QA 2RUQA 3ARTA 5I98A 3FY1A 4ITZA 4QIBA 5HT1A 2PPPA 3RMEA 3B8SA 4ODRA 3UQBA 4NNRA 1H0IA 3CH9A 1FAPA 1WNOA 1FKDA 2KI3A 2LJ4A 4MGVA 2Y78A 4U85A 3KAGA 1N1AA 3PA7A 1UR9A 2F23A 3ALGA 3ARUA 2DT1A 1QPFA 1E9LA 2ITKA 2O92A 1ZCNA 4NZCA 1KFWA 4DWSA 3NRKA 2DT0A 3ARSA 1LL4A 4IT6A 2XP3A 2FDMA 2XP8A 1SYTA 1Q6IA 4Q22A 2O9OA 3CZ8A 2F21A 2B31A 4DRHA 3CGMA 1XHGA 2RURA 4J4OA 2XPAA 5DITA 5HBFA 2XPBA 4KQZA 3ARVA 3AROA 3AS3A 3O5PA 4TX0A 4TW8A 1OGBA 5GPRA 2ESCA 1X6NA 4QT3A 1E44A 1NSGA 1D6OA 2LPVA 1UR8A 1NMWA 4DWSC 1FKTA 2XP9A 5HKGA 4DRQA 2WK2A 4DRPA 3OA5A 3WQVA 1C9HA 3B7XA 3BMBA 2DG4A 4FN2A 1E6ZA 2PBCA 4IQCA 1ZBCA 1WB0A 1YW5A 1EHNA 3UF8A 4TW6A 3B9AA 5HW8A 3O5RA 4HBOA
chains in the Genus database with same CATH topology
3WD3A 3JYMA 1BKFA 1LJYA 2L2SA 4HBEA 3RM9A 3FAPA 4P8XA 1LQ0A 3TC5A 2OFNA 3GPKA 4L3NA 3WH0A 3O5FA 1U79A 3WL1A 3KACA 1E15A 2DSZA 1FKLA 3KABA 4MNKA 3WD1A 2A3BA 3CHDA 1QZ2A 2DSVA 3KZ7A 4W9QA 2K8IA 5HUAA 4JYSA 3NTPA 2VN1A 1OWQA 4O2TA 2DT3A 2XP5A 2RUDA 1TFVA 3O5EA 1LL7A 2WM0A 1CTNA 1NMVA 1FKRA 1FFRA 2KGJA 2F2DA 1PBKA 2N87A 1HKIA 4DZ3A 4Q7NA 4Z2LA 2M08A 5HWCA 4XAKA 1ZU8A 1BL4A 1O6IA 1KT0A 4LAXA 3WD4A 4ODQA 3WD0A 3UI5A 2UZ5A 1B6CA 4MSPA 4LGXA 1M5YA 2DG9A 1FKJA 4MNMA 4J4NA 1W9UA 1YATA 2ZQTA 4ODKA 3KAIA 1W9PA 1LG1A 1A7XA 3KAFA 4DRIA 5J6EA 2PPNA 3G6LA 1H0GA 2AWGA 4FAPA 4G50A 4ODLA 1J4HA 1LG2A 3IHZA 1HJWA 4URIA 1F8AB 1ZK6A 4IQ2A 2IF4A 4U84A 1FKBA 4G2PA 4DRNA 3ARRA 3JYJA 1K9TA 3WD2A 4MNLA 2MPHA 4IPXA 3RM4A 4PTMA 1JNEA 4DIPA 4Z2IA 2KR7A 1IX5A 1ZBWA 5HW7A 1QPLA 1HXVA 2Q5AA 1OGGA 3O5LA 3VAWA 1FKSA 3WIJA 4WIWA 4TYOA 1X6LA 4JFJA 3WL0A 3RGCA 1T11A 4MTVA 5B8IC 3O5GA 2YBUA 5BXJA 1WAWA 3O5JA 4WKAA 3WKZA 2DSWA 3WQWA 4ZPWR 3NI6A 3JXVA 2RQSA 3BXWA 1VF8A 2A3EA 2MLYA 1E6RA 1D7HA 4ZPTR 1ROTA 4N19A 3ALFA 4U86A 2ZR4A 2G41A 2RSEA 4P8VA 4Z2GA 4TW7A 3QOKA 4W9PA 1NWRA 2LKNA 1D7IA 1L1PA 4DROA 4R5EA 4DWSB 1R9HA 3RFWA 2F4EA 4NSBA 3PRAA 4P8WA 2A3AA 3I6CA 4KR0B 2M1IA 2YBTA 1FD9A 2XP7A 4P8UA 1FKFA 3MDYB 3PRDA 1W9VA 3RM8A 3LUOA 1ZBKA 4L72B 5HW6A 4Z2KA 1Y0OA 4JFMA 1EDQA 4R0XA 1HJXA 2AOSA 1FFQA 3KAHA 1EIBA 1ZBVA 1D7JA 1NWTA 3PR9A 4DRKA 1Q6UA 3O5QA 3W4RA 2M2AA 3CHCA 3ARPA 4DZ2A 3ARQA 2KO7A 1FJDA 2ZR6A 4JFLA 4ZPVR 4DH0A 2DT2A 2WLYA 1FKKA 1SR0A 2IUZA 1TCOC 5D75A 1Q1CA 1GPFA 5DIUA 4LAVA 2PPOA 2PV3A 4QT2A 4ODNA 3O5IA 3TCZA 3O5DA 2KFWA 2PV2A 4WJXA 4TNSA 2FAPA 1Q6HA 3IK8A 2DG3A 1JVWA 3AS1A 4IT4A 2MLZA 1JNSA 1GUVA 1W1VA 4GIVA 1EYMA 1FKHA 1GOIA 3ARZA 3G6MA 3ODKA 4WKHA 1HJVA 4Z2HA 1JNDA 1W1YA 4DRMA 2MF9A 4JFIA 3B9DA 4DT4A 2XP4A 3CGNA 1FKIA 3KADA 3IKGA 1ROUA 1ZB5A 3ARYA 4ODMA 2ZQVA 3UI4A 3AS2A 4S3KA 4ODPA 3CHEA 4ZS6A 3O5OA 4ML4A 4LAWA 1PINA 1D2KA 3O5MA 1ITXA 4W9OA 2KE0A 2LGOA 3B9EA 3EY6A 2QF8A 3OOBA 1EQ3A 1RD6A 1J4RA 5GQBA 1J6YA 1F40A 2DPEA 1HKJA 4AY1A 3UQAA 2JZVA 3CHFA 5HTGA 2MNTA 1E6NA 2A3CA 2XP6A 3UQIA 5GPGA 4BF8A 3ARXA 2ZQSA 5JH8A 1ZL1A 2VCDA 1E6PA 4WKFA 5HWBA 2OLHA 4ODOA 3ARWA 1J4IA 4Z2JA 5DF0A 4JFKA 2PI6A 1FKGA 5DIVA 4GGQA 1KT1A 2G8ZA 5DEZA 4C02B 3IKDA 1W1PA 2ZR5A 4DWSD 2FKEA 4MPKA 3FXYA 1JNTA 3PRBA 1HKMA 2D9FA 1W26A 3TDBA 3O5KA 1LL6A 4MAVA 1NWSA 5DO2A 4W5UA 2RUCA 4DRJA 1NWUA 1XRVA 1HKKA 1NH6A 2MLXA 3UI6A 2WLZA 2PV1A 3AQUA 2ZQUA 1W1TA 3H9RB 4HARA 4QZVB 4S3JA 4WK9A 4LAYA 4MNJA 3AS0A 2DSUA 3KCEA 1P5QA 2RUQA 3ARTA 5I98A 3FY1A 4ITZA 4QIBA 5HT1A 2PPPA 3RMEA 3B8SA 4ODRA 3UQBA 4NNRA 1H0IA 3CH9A 1FAPA 1WNOA 1FKDA 2KI3A 2LJ4A 4MGVA 2Y78A 4U85A 3KAGA 1N1AA 3PA7A 1UR9A 3ALGA 3ARUA 2DT1A 1QPFA 1E9LA 2ITKA 2O92A 1ZCNA 4NZCA 1KFWA 4DWSA 3NRKA 2DT0A 3ARSA 1LL4A 4IT6A 2XP3A 2FDMA 2XP8A 1SYTA 1Q6IA 4Q22A 2O9OA 3CZ8A 2F21A 2B31A 4DRHA 3CGMA 1XHGA 2RURA 4J4OA 2XPAA 5DITA 5HBFA 2XPBA 4KQZA 3ARVA 3AROA 3AS3A 3O5PA 4TX0A 4TW8A 1OGBA 5GPRA 2ESCA 1X6NA 4QT3A 1NSGA 1D6OA 2LPVA 1UR8A 1NMWA 4DWSC 1FKTA 2XP9A 5HKGA 4DRQA 2WK2A 4DRPA 3OA5A 3WQVA 1C9HA 3B7XA 2DG4A 4FN2A 1E6ZA 2PBCA 4IQCA 1ZBCA 1WB0A 1YW5A 1EHNA 3UF8A 4TW6A 3B9AA 5HW8A 3O5RA 4HBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PV2 A;  3JYM A;  3O5L A;  4TNS A;  1BKF A;  2FAP A;  3VAW A;  1FKS A;  1Q6H A;  2L2S A;  3IK8 A;  2DG3 A;  3FAP A;  4TYO A;  4JFJ A;  1JVW A;  3RGC A;  1T11 A;  5B8I C;  3O5G A;  2RUC A;  3TC5 A;  5BXJ A;  4DRJ A;  2MLZ A;  3O5J A;  1JNS A;  2OFN A;  3GPK A;  4GIV A;  1EYM A;  1FKH A;  3WH0 A;  3NI6 A;  2RQS A;  3JXV A;  3O5F A;  2MLX A;  1U79 A;  3ODK A;  3KAC A;  3UI6 A;  4DRM A;  2PV1 A;  1FKL A;  2MLY A;  2MF9 A;  2ZQU A;  3KAB A;  1D7H A;  4JFI A;  1QZ2 A;  3H9R B;  4DT4 A;  1ROT A;  2XP4 A;  3CGN A;  4N19 A;  3KZ7 A;  1FKI A;  3KAD A;  2ZR4 A;  4LAY A;  3IKG A;  1ROU A;  4U86 A;  4W9Q A;  2K8I A;  2RSE A;  5HUA A;  4ODM A;  4JYS A;  3NTP A;  4TW7 A;  2ZQV A;  3KCE A;  1P5Q A;  2RUQ A;  2VN1 A;  4O2T A;  3UI4 A;  5I98 A;  4W9P A;  2XP5 A;  2LKN A;  2RUD A;  4ODP A;  1D7I A;  3O5E A;  1L1P A;  4DRO A;  3O5O A;  4ITZ A;  4QIB A;  1R9H A;  5HT1 A;  4W9O A;  3RFW A;  2PPP A;  2F4E A;  1PIN A;  4LAW A;  4ODR A;  1NMV A;  3O5M A;  3UQB A;  1HXV A;  1FKR A;  2KGJ A;  4NNR A;  2F2D A;  1FAP A;  3I6C A;  1PBK A;  2M1I A;  1FKD A;  2KI3 A;  2LJ4 A;  1FD9 A;  2N87 A;  2KE0 A;  2XP7 A;  2LGO A;  2Y78 A;  4MGV A;  3KAG A;  4U85 A;  1N1A A;  1FKF A;  2M08 A;  3EY6 A;  3OOB A;  3PA7 A;  3MDY B;  1EQ3 A;  5HWC A;  1J4R A;  3PRD A;  1BL4 A;  1J6Y A;  1F40 A;  1KT0 A;  1QPF A;  2ITK A;  4LAX A;  1ZCN A;  3LUO A;  3UQA A;  2JZV A;  5HW6 A;  5HTG A;  4ODQ A;  3NRK A;  3UI5 A;  2MNT A;  2UZ5 A;  1B6C A;  1Y0O A;  4JFM A;  4MSP A;  2XP3 A;  1M5Y A;  2XP8 A;  2XP6 A;  3UQI A;  2DG9 A;  1FKJ A;  4R0X A;  5GPG A;  1Q6I A;  4J4N A;  2F21 A;  4BF8 A;  1YAT A;  3KAH A;  4DRH A;  2ZQT A;  2ZQS A;  1D7J A;  3CGM A;  2RUR A;  4J4O A;  2XPA A;  5DIT A;  4ODK A;  2VCD A;  5HWB A;  3KAI A;  4DRK A;  2XPB A;  1Q6U A;  3O5Q A;  4ODO A;  1A7X A;  1J4I A;  2M2A A;  3KAF A;  3O5P A;  4TX0 A;  4DRI A;  5J6E A;  2PPN A;  4TW8 A;  4JFK A;  4DZ2 A;  2KO7 A;  1FJD A;  4QT3 A;  1FKG A;  2ZR6 A;  2AWG A;  5DIV A;  1NSG A;  1D6O A;  2LPV A;  4G50 A;  4JFL A;  4ODL A;  4FAP A;  4GGQ A;  1J4H A;  1NMW A;  3IHZ A;  1KT1 A;  4DH0 A;  1F8A B;  1FKT A;  1ZK6 A;  2XP9 A;  4IQ2 A;  2IF4 A;  4U84 A;  4C02 B;  1FKB A;  4DRQ A;  4DZ3 A;  4G2P A;  4DRN A;  1FKK A;  3IKD A;  4DRP A;  3JYJ A;  1TCO C;  5D75 A;  2ZR5 A;  1C9H A;  2FKE A;  3B7X A;  1Q1C A;  2MPH A;  2DG4 A;  4IPX A;  5DIU A;  3TCZ A;  1JNT A;  3PRB A;  4FN2 A;  4LAV A;  5HKG A;  2PPO A;  2D9F A;  3O5D A;  2PBC A;  4DIP A;  1W26 A;  2KR7 A;  4IQC A;  3TDB A;  3O5K A;  1YW5 A;  2PV3 A;  3UF8 A;  4TW6 A;  5HW7 A;  4QT2 A;  5HW8 A;  4ODN A;  3O5R A;  3O5I A;  1QPL A;  2KFW A;  2Q5A A; 
#chains in the Genus database with same CATH topology
 3GTY X;  3WD3 A;  2B5U B;  3JYM A;  1BKF A;  1LJY A;  2L2S A;  4HBE A;  3RM9 A;  3FAP A;  4P8X A;  1LQ0 A;  3TC5 A;  2OFN A;  3GPK A;  4L3N A;  3WH0 A;  3O5F A;  1U79 A;  3WL1 A;  3KAC A;  1E15 A;  2DSZ A;  1FKL A;  3KAB A;  4MNK A;  3WD1 A;  2A3B A;  2EUL A;  3CHD A;  1QZ2 A;  2DSV A;  3KZ7 A;  4W9Q A;  2K8I A;  5HUA A;  4JYS A;  3NTP A;  2VN1 A;  1OWQ A;  4O2T A;  2DT3 A;  2XP5 A;  2RUD A;  1TFV A;  3O5E A;  1LL7 A;  2WM0 A;  1CTN A;  1NMV A;  1FKR A;  1FFR A;  2KGJ A;  2F2D A;  1PBK A;  2N87 A;  1HKI A;  4DZ3 A;  4Q7N A;  4Z2L A;  2M08 A;  5HWC A;  4XAK A;  1ZU8 A;  1BL4 A;  1O6I A;  1KT0 A;  4UDM A;  4LAX A;  3WD4 A;  4ODQ A;  3WD0 A;  3UI5 A;  2UZ5 A;  1B6C A;  4MSP A;  4LGX A;  1M5Y A;  2DG9 A;  1FKJ A;  4MNM A;  4J4N A;  1W9U A;  1YAT A;  2ZQT A;  4ODK A;  3KAI A;  1W9P A;  1LG1 A;  1A7X A;  3EIP A;  3KAF A;  4DRI A;  5J6E A;  2PPN A;  3G6L A;  1H0G A;  2AWG A;  2ETN A;  4FAP A;  4G50 A;  4ODL A;  1J4H A;  1LG2 A;  3IHZ A;  1HJW A;  4URI A;  1F8A B;  1ZK6 A;  4IQ2 A;  2IF4 A;  4U84 A;  1FKB A;  4G2P A;  4DRN A;  3ARR A;  3JYJ A;  1K9T A;  3WD2 A;  4MNL A;  2MPH A;  4IPX A;  3RM4 A;  4PTM A;  1JNE A;  4DIP A;  4Z2I A;  2KR7 A;  1IX5 A;  1ZBW A;  5HW7 A;  1QPL A;  1HXV A;  2Q5A A;  1OGG A;  3O5L A;  3VAW A;  1FKS A;  3WIJ A;  4WIW A;  4TYO A;  1X6L A;  4JFJ A;  3WL0 A;  3RGC A;  1T11 A;  4MTV A;  5B8I C;  3O5G A;  2YBU A;  5BXJ A;  1WAW A;  3O5J A;  4WKA A;  3WKZ A;  2DSW A;  3WQW A;  4ZPW R;  3NI6 A;  3JXV A;  2RQS A;  3BXW A;  1VF8 A;  2A3E A;  2MLY A;  1E6R A;  2P4V A;  1D7H A;  4ZPT R;  1ROT A;  4N19 A;  3ALF A;  4U86 A;  2ZR4 A;  2G41 A;  2RSE A;  4P8V A;  4Z2G A;  4TW7 A;  3QOK A;  4W9P A;  1NWR A;  2LKN A;  1D7I A;  1L1P A;  4DRO A;  2PN0 A;  4R5E A;  4DWS B;  1R9H A;  3RFW A;  2F4E A;  4NSB A;  3PRA A;  4P8W A;  2A3A A;  3I6C A;  4KR0 B;  2M1I A;  2YBT A;  1FD9 A;  2XP7 A;  4P8U A;  1FKF A;  3MDY B;  3PRD A;  1W9V A;  3RM8 A;  3LUO A;  1ZBK A;  4L72 B;  5HW6 A;  4Z2K A;  1Y0O A;  4JFM A;  1EDQ A;  4R0X A;  1HJX A;  2AOS A;  1FFQ A;  3KAH A;  1EIB A;  1ZBV A;  1D7J A;  1NWT A;  3PR9 A;  4DRK A;  1Q6U A;  3O5Q A;  3W4R A;  2M2A A;  3CHC A;  3ARP A;  4DZ2 A;  3ARQ A;  2KO7 A;  1FJD A;  2ZR6 A;  4JFL A;  4ZPV R;  4DH0 A;  2DT2 A;  2WLY A;  1FKK A;  1SR0 A;  2IUZ A;  1TCO C;  5D75 A;  1Q1C A;  1GPF A;  5DIU A;  4LAV A;  2PPO A;  2PV3 A;  4QT2 A;  4ODN A;  3O5I A;  3TCZ A;  2KFW A;  3O5D A;  2PV2 A;  4WJX A;  4TNS A;  2FAP A;  1Q6H A;  3IK8 A;  2DG3 A;  1JVW A;  3AS1 A;  4IT4 A;  2MLZ A;  1JNS A;  1GUV A;  1W1V A;  4GIV A;  1EYM A;  1FKH A;  1GOI A;  3ARZ A;  3G6M A;  3ODK A;  4WKH A;  1HJV A;  4Z2H A;  1JND A;  1W1Y A;  4DRM A;  2MF9 A;  4JFI A;  3B9D A;  4DT4 A;  2XP4 A;  3CGN A;  1FKI A;  3KAD A;  3IKG A;  1ROU A;  1ZB5 A;  3ARY A;  4ODM A;  2ZQV A;  3UI4 A;  3AS2 A;  4S3K A;  4ODP A;  3CHE A;  4ZS6 A;  3O5O A;  4ML4 A;  4LAW A;  1PIN A;  1D2K A;  3O5M A;  1ITX A;  4W9O A;  2KE0 A;  2LGO A;  3B9E A;  3EY6 A;  2QF8 A;  3OOB A;  1EQ3 A;  1RD6 A;  1J4R A;  5GQB A;  1J6Y A;  1F40 A;  2DPE A;  1HKJ A;  4AY1 A;  3UQA A;  2JZV A;  3CHF A;  5HTG A;  1JCH B;  2MNT A;  1E6N A;  2A3C A;  2XP6 A;  3UQI A;  5GPG A;  1GRJ A;  4BF8 A;  3ARX A;  2ZQS A;  5JH8 A;  1ZL1 A;  2VCD A;  1E6P A;  4WKF A;  5HWB A;  2OLH A;  4ODO A;  3ARW A;  1J4I A;  4Z2J A;  5DF0 A;  4JFK A;  2PI6 A;  1FKG A;  5DIV A;  4GGQ A;  1KT1 A;  2G8Z A;  5DEZ A;  4C02 B;  3IKD A;  1W1P A;  2ZR5 A;  4DWS D;  2FKE A;  4MPK A;  3FXY A;  1JNT A;  3PRB A;  1HKM A;  2D9F A;  1W26 A;  3TDB A;  3O5K A;  1LL6 A;  4MAV A;  1NWS A;  5DO2 A;  4W5U A;  2RUC A;  4DRJ A;  1NWU A;  1XRV A;  1HKK A;  1NH6 A;  2MLX A;  3UI6 A;  2WLZ A;  2PV1 A;  3AQU A;  2ZQU A;  3GU0 A;  1W1T A;  3H9R B;  4HAR A;  4QZV B;  4S3J A;  4WK9 A;  4LAY A;  4MNJ A;  3AS0 A;  2DSU A;  3KCE A;  1P5Q A;  2RUQ A;  3ART A;  5I98 A;  3FY1 A;  4ITZ A;  4QIB A;  5HT1 A;  2PPP A;  3RME A;  3B8S A;  4ODR A;  3UQB A;  4NNR A;  1H0I A;  3CH9 A;  1FAP A;  1WNO A;  1FKD A;  2KI3 A;  2LJ4 A;  4MGV A;  2Y78 A;  4U85 A;  3KAG A;  1N1A A;  3PA7 A;  1UR9 A;  2F23 A;  3ALG A;  3ARU A;  2DT1 A;  1QPF A;  1E9L A;  2ITK A;  2O92 A;  1ZCN A;  4NZC A;  1KFW A;  4DWS A;  3NRK A;  2DT0 A;  3ARS A;  1LL4 A;  4IT6 A;  2XP3 A;  2FDM A;  2XP8 A;  1SYT A;  1Q6I A;  4Q22 A;  2O9O A;  3CZ8 A;  2F21 A;  2B31 A;  4DRH A;  3CGM A;  1XHG A;  2RUR A;  4J4O A;  2XPA A;  5DIT A;  5HBF A;  2XPB A;  4KQZ A;  3ARV A;  3ARO A;  3AS3 A;  3O5P A;  4TX0 A;  4TW8 A;  1OGB A;  5GPR A;  2ESC A;  1X6N A;  4QT3 A;  1E44 A;  1NSG A;  1D6O A;  2LPV A;  1UR8 A;  1NMW A;  4DWS C;  1FKT A;  2XP9 A;  5HKG A;  4DRQ A;  2WK2 A;  4DRP A;  3OA5 A;  3WQV A;  1C9H A;  3B7X A;  3BMB A;  2DG4 A;  4FN2 A;  1E6Z A;  2PBC A;  4IQC A;  1ZBC A;  1WB0 A;  1YW5 A;  1EHN A;  3UF8 A;  4TW6 A;  3B9A A;  5HW8 A;  3O5R A;  4HBO A; 
#chains in the Genus database with same CATH homology
 3WD3 A;  3JYM A;  1BKF A;  1LJY A;  2L2S A;  4HBE A;  3RM9 A;  3FAP A;  4P8X A;  1LQ0 A;  3TC5 A;  2OFN A;  3GPK A;  4L3N A;  3WH0 A;  3O5F A;  1U79 A;  3WL1 A;  3KAC A;  1E15 A;  2DSZ A;  1FKL A;  3KAB A;  4MNK A;  3WD1 A;  2A3B A;  3CHD A;  1QZ2 A;  2DSV A;  3KZ7 A;  4W9Q A;  2K8I A;  5HUA A;  4JYS A;  3NTP A;  2VN1 A;  1OWQ A;  4O2T A;  2DT3 A;  2XP5 A;  2RUD A;  1TFV A;  3O5E A;  1LL7 A;  2WM0 A;  1CTN A;  1NMV A;  1FKR A;  1FFR A;  2KGJ A;  2F2D A;  1PBK A;  2N87 A;  1HKI A;  4DZ3 A;  4Q7N A;  4Z2L A;  2M08 A;  5HWC A;  4XAK A;  1ZU8 A;  1BL4 A;  1O6I A;  1KT0 A;  4LAX A;  3WD4 A;  4ODQ A;  3WD0 A;  3UI5 A;  2UZ5 A;  1B6C A;  4MSP A;  4LGX A;  1M5Y A;  2DG9 A;  1FKJ A;  4MNM A;  4J4N A;  1W9U A;  1YAT A;  2ZQT A;  4ODK A;  3KAI A;  1W9P A;  1LG1 A;  1A7X A;  3KAF A;  4DRI A;  5J6E A;  2PPN A;  3G6L A;  1H0G A;  2AWG A;  4FAP A;  4G50 A;  4ODL A;  1J4H A;  1LG2 A;  3IHZ A;  1HJW A;  4URI A;  1F8A B;  1ZK6 A;  4IQ2 A;  2IF4 A;  4U84 A;  1FKB A;  4G2P A;  4DRN A;  3ARR A;  3JYJ A;  1K9T A;  3WD2 A;  4MNL A;  2MPH A;  4IPX A;  3RM4 A;  4PTM A;  1JNE A;  4DIP A;  4Z2I A;  2KR7 A;  1IX5 A;  1ZBW A;  5HW7 A;  1QPL A;  1HXV A;  2Q5A A;  1OGG A;  3O5L A;  3VAW A;  1FKS A;  3WIJ A;  4WIW A;  4TYO A;  1X6L A;  4JFJ A;  3WL0 A;  3RGC A;  1T11 A;  4MTV A;  5B8I C;  3O5G A;  2YBU A;  5BXJ A;  1WAW A;  3O5J A;  4WKA A;  3WKZ A;  2DSW A;  3WQW A;  4ZPW R;  3NI6 A;  3JXV A;  2RQS A;  3BXW A;  1VF8 A;  2A3E A;  2MLY A;  1E6R A;  1D7H A;  4ZPT R;  1ROT A;  4N19 A;  3ALF A;  4U86 A;  2ZR4 A;  2G41 A;  2RSE A;  4P8V A;  4Z2G A;  4TW7 A;  3QOK A;  4W9P A;  1NWR A;  2LKN A;  1D7I A;  1L1P A;  4DRO A;  4R5E A;  4DWS B;  1R9H A;  3RFW A;  2F4E A;  4NSB A;  3PRA A;  4P8W A;  2A3A A;  3I6C A;  4KR0 B;  2M1I A;  2YBT A;  1FD9 A;  2XP7 A;  4P8U A;  1FKF A;  3MDY B;  3PRD A;  1W9V A;  3RM8 A;  3LUO A;  1ZBK A;  4L72 B;  5HW6 A;  4Z2K A;  1Y0O A;  4JFM A;  1EDQ A;  4R0X A;  1HJX A;  2AOS A;  1FFQ A;  3KAH A;  1EIB A;  1ZBV A;  1D7J A;  1NWT A;  3PR9 A;  4DRK A;  1Q6U A;  3O5Q A;  3W4R A;  2M2A A;  3CHC A;  3ARP A;  4DZ2 A;  3ARQ A;  2KO7 A;  1FJD A;  2ZR6 A;  4JFL A;  4ZPV R;  4DH0 A;  2DT2 A;  2WLY A;  1FKK A;  1SR0 A;  2IUZ A;  1TCO C;  5D75 A;  1Q1C A;  1GPF A;  5DIU A;  4LAV A;  2PPO A;  2PV3 A;  4QT2 A;  4ODN A;  3O5I A;  3TCZ A;  3O5D A;  2KFW A;  2PV2 A;  4WJX A;  4TNS A;  2FAP A;  1Q6H A;  3IK8 A;  2DG3 A;  1JVW A;  3AS1 A;  4IT4 A;  2MLZ A;  1JNS A;  1GUV A;  1W1V A;  4GIV A;  1EYM A;  1FKH A;  1GOI A;  3ARZ A;  3G6M A;  3ODK A;  4WKH A;  1HJV A;  4Z2H A;  1JND A;  1W1Y A;  4DRM A;  2MF9 A;  4JFI A;  3B9D A;  4DT4 A;  2XP4 A;  3CGN A;  1FKI A;  3KAD A;  3IKG A;  1ROU A;  1ZB5 A;  3ARY A;  4ODM A;  2ZQV A;  3UI4 A;  3AS2 A;  4S3K A;  4ODP A;  3CHE A;  4ZS6 A;  3O5O A;  4ML4 A;  4LAW A;  1PIN A;  1D2K A;  3O5M A;  1ITX A;  4W9O A;  2KE0 A;  2LGO A;  3B9E A;  3EY6 A;  2QF8 A;  3OOB A;  1EQ3 A;  1RD6 A;  1J4R A;  5GQB A;  1J6Y A;  1F40 A;  2DPE A;  1HKJ A;  4AY1 A;  3UQA A;  2JZV A;  3CHF A;  5HTG A;  2MNT A;  1E6N A;  2A3C A;  2XP6 A;  3UQI A;  5GPG A;  4BF8 A;  3ARX A;  2ZQS A;  5JH8 A;  1ZL1 A;  2VCD A;  1E6P A;  4WKF A;  5HWB A;  2OLH A;  4ODO A;  3ARW A;  1J4I A;  4Z2J A;  5DF0 A;  4JFK A;  2PI6 A;  1FKG A;  5DIV A;  4GGQ A;  1KT1 A;  2G8Z A;  5DEZ A;  4C02 B;  3IKD A;  1W1P A;  2ZR5 A;  4DWS D;  2FKE A;  4MPK A;  3FXY A;  1JNT A;  3PRB A;  1HKM A;  2D9F A;  1W26 A;  3TDB A;  3O5K A;  1LL6 A;  4MAV A;  1NWS A;  5DO2 A;  4W5U A;  2RUC A;  4DRJ A;  1NWU A;  1XRV A;  1HKK A;  1NH6 A;  2MLX A;  3UI6 A;  2WLZ A;  2PV1 A;  3AQU A;  2ZQU A;  1W1T A;  3H9R B;  4HAR A;  4QZV B;  4S3J A;  4WK9 A;  4LAY A;  4MNJ A;  3AS0 A;  2DSU A;  3KCE A;  1P5Q A;  2RUQ A;  3ART A;  5I98 A;  3FY1 A;  4ITZ A;  4QIB A;  5HT1 A;  2PPP A;  3RME A;  3B8S A;  4ODR A;  3UQB A;  4NNR A;  1H0I A;  3CH9 A;  1FAP A;  1WNO A;  1FKD A;  2KI3 A;  2LJ4 A;  4MGV A;  2Y78 A;  4U85 A;  3KAG A;  1N1A A;  3PA7 A;  1UR9 A;  3ALG A;  3ARU A;  2DT1 A;  1QPF A;  1E9L A;  2ITK A;  2O92 A;  1ZCN A;  4NZC A;  1KFW A;  4DWS A;  3NRK A;  2DT0 A;  3ARS A;  1LL4 A;  4IT6 A;  2XP3 A;  2FDM A;  2XP8 A;  1SYT A;  1Q6I A;  4Q22 A;  2O9O A;  3CZ8 A;  2F21 A;  2B31 A;  4DRH A;  3CGM A;  1XHG A;  2RUR A;  4J4O A;  2XPA A;  5DIT A;  5HBF A;  2XPB A;  4KQZ A;  3ARV A;  3ARO A;  3AS3 A;  3O5P A;  4TX0 A;  4TW8 A;  1OGB A;  5GPR A;  2ESC A;  1X6N A;  4QT3 A;  1NSG A;  1D6O A;  2LPV A;  1UR8 A;  1NMW A;  4DWS C;  1FKT A;  2XP9 A;  5HKG A;  4DRQ A;  2WK2 A;  4DRP A;  3OA5 A;  3WQV A;  1C9H A;  3B7X A;  2DG4 A;  4FN2 A;  1E6Z A;  2PBC A;  4IQC A;  1ZBC A;  1WB0 A;  1YW5 A;  1EHN A;  3UF8 A;  4TW6 A;  3B9A A;  5HW8 A;  3O5R A;  4HBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...