1D7JA

Fkbp complexed with 4-hydroxy-2-butanone
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of small ligand-FKBP complexes provide an estimate for hydrophobic interaction energies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
total genus 28
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1d7jA00
4DIPA 4C02B 4LAXA 1EQ3A 2PV1A 2PPNA 3KAIA 2XPAA 4QT3A 5HW8A 1FKKA 4LAYA 4GGQA 4BF8A 2UZ5A 4FN2A 1TCOC 2MLZA 5HTGA 2ZR4A 3UI6A 1JNTA 2KFWA 2LPVA 4NNRA 4MSPA 3O5DA 4W9OA 2KGJA 2L2SA 1T11A 1N1AA 2F4EA 3JYMA 5D75A 1Q6HA 3IKDA 1ZCNA 3O5EA 3EY6A 1FKFA 1A7XA 1J4IA 3KACA 5GPGA 4DRHA 2ZQVA 3RFWA 3B7XA 4JYSA 3IK8A 4TYOA 3O5QA 1BKFA 1KT0A 2PV2A 4U85A 5HWCA 1Q1CA 4DZ3A 2XPBA 3KAHA 3O5PA 3O5LA 2MLXA 1W26A 4DRIA 4R0XA 4IQ2A 4DRNA 4DROA 4ITZA 1C9HA 2XP3A 3UQAA 4TW6A 4ODKA 3RGCA 4TW8A 3TDBA 1JVWA 4DH0A 4JFJA 4GIVA 2DG4A 1ROUA 2MLYA 2M1IA 3TC5A 3UQBA 3IKGA 1FD9A 5HUAA 1R9HA 4O2TA 1Q6IA 2DG3A 3KZ7A 5HT1A 1HXVA 4TW7A 2RUCA 2VN1A 5DIVA 4DRPA 2VCDA 2XP9A 2KO7A 2ZR6A 5BXJA 1YATA 1L1PA 2M08A 2ZR5A 4MGVA 4ODLA 2Q5AA 1J4RA 4QT2A 2N87A 5DIUA 1FKTA 1FKHA 4ODRA 2OFNA 2RQSA 4W9PA 1PBKA 2LGOA 3O5RA 3PRDA 3JXVA 1Y0OA 1NMWA 4TNSA 1P5QA 4IQCA 4DRKA 1B6CA 2DG9A 3IHZA 2ZQSA 2KI3A 1FKLA 1FAPA 3O5IA 3O5JA 4ODQA 1BL4A 5DITA 1D7JA 2JZVA 1FKBA 1YW5A 2RURA 3KAGA 3O5OA 3O5FA 3ODKA 2PBCA 5HKGA 1QZ2A 2XP4A 2ZQUA 4DZ2A 1KT1A 2XP8A 2FAPA 3WH0A 1EYMA 3KADA 4J4NA 4ODNA 4ODMA 1FKIA 1PINA 2K8IA 4JFMA 3UF8A 5J6EA 3KCEA 1JNSA 5B8IC 4J4OA 1QPFA 1D7IA 4QIBA 1FKRA 2D9FA 2F21A 2XP5A 1M5YA 2MPHA 1FKJA 2F2DA 2PPOA 3MDYB 4G50A 1D7HA 2LKNA 2MNTA 4N19A 2AWGA 4TX0A 5HW6A 2FKEA 3UI4A 1U79A 3I6CA 3O5MA 3OOBA 3JYJA 1FKSA 4ODPA 2PPPA 4DRMA 4U84A 4FAPA 2M2AA 1FKDA 4IPXA 3KAFA 3LUOA 2Y78A 2LJ4A 3PRBA 3FAPA 1FJDA 4G2PA 4JFLA 3NI6A 1F8AB 2KE0A 4LAVA 3NTPA 1D6OA 4ODOA 1ROTA 1F40A 1NMVA 3UQIA 3CGMA 3H9RB 1J4HA 4U86A 3O5KA 4W9QA 3UI5A 1NSGA 3KABA 3GPKA 3NRKA 4JFIA 5HW7A 3PA7A 5I98A 4JFKA 2RUQA 2RSEA 4DRQA 1Q6UA 2KR7A 2XP6A 3CGNA 3VAWA 1J6YA 5HWBA 2ITKA 3O5GA 4LAWA 4DT4A 1FKGA 1QPLA 2PV3A 2ZQTA 2XP7A 1ZK6A 2MF9A 2RUDA 4DRJA 2IF4A 3TCZA
chains in the Genus database with same CATH superfamily
4DIPA 4C02B 1LL7A 4QT3A 4MNLA 4FN2A 3EIPA 2ZR4A 3UI6A 2LPVA 4W9OA 4MSPA 2WK2A 2F4EA 1N1AA 3JYMA 4NSBA 3IKDA 3O5EA 1HKMA 4DRHA 3B7XA 1HKJA 2WLYA 3FY1A 3G6MA 3IK8A 1BKFA 4DZ3A 2DT0A 2XPBA 1W1VA 2DT2A 3GTYX 3OA5A 4IQ2A 4DRNA 3RMEA 4ITZA 2XP3A 3UQAA 4TW6A 3RGCA 1JVWA 4GIVA 2MLYA 3TC5A 1FD9A 2VCDA 1NWUA 2XP9A 4WK9A 5DF0A 1YATA 5GQBA 1W1PA 2M08A 3ARSA 2Q5AA 1J4RA 2N87A 1FKTA 3ARRA 1PBKA 1ITXA 2LGOA 3JXVA 3WD1A 2OLHA 1P5QA 2DG9A 3QOKA 2ZQSA 1FKLA 3O5JA 3WD4A 3ODKA 3WL1A 2ZQUA 2O92A 1RD6A 1KT1A 5J6EA 4J4OA 4QIBA 1JNDA 2F21A 2XP5A 1M5YA 1X6NA 2PPOA 1LJYA 2MNTA 4Z2KA 2FKEA 3UI4A 1U79A 1IX5A 3O5MA 1KFWA 2M2AA 3LUOA 1FJDA 3FAPA 4HBEA 1HKKA 2KE0A 4KR0B 4Z2HA 1J4HA 1E6PA 4URIA 3NRKA 5HW7A 1E6RA 1E15A 3PA7A 2DT3A 2RSEA 4DRQA 1LG1A 1Q6UA 2XP6A 2ITKA 4LAWA 4DT4A 2ZQTA 2RUDA 3CHDA 4Q22A 4Z2JA 3WD0A 4IT4A 2EULA 4GGQA 4MAVA 4WKHA 1X6LA 4P8WA 1W9UA 3ALFA 4LGXA 5HBFA 5D75A 1ZB5A 1Q6HA 1ZCNA 1FKFA 1A7XA 5GPGA 2ZQVA 4S3KA 3GU0A 1CTNA 1Q1CA 3AQUA 4ML4A 1HJWA 3ALGA 1W26A 4R0XA 4ZPVR 4DROA 3B9DA 3PR9A 4ODKA 4TW8A 2YBTA 1VF8A 3UQBA 5DO2A 3IKGA 4MTVA 5HUAA 1LQ0A 5HT1A 2DG3A 3ARPA 1HXVA 4TW7A 2VN1A 5DIVA 2DSWA 1ZBKA 2QF8A 1LG2A 4ODLA 1H0GA 4MNKA 4QZVB 5DIUA 1JCHB 4PTMA 2DSUA 2B5UB 1FFRA 1E9LA 3O5RA 1E44A 1NMWA 4DRKA 2G8ZA 1B6CA 3ARZA 2KI3A 1H0IA 1FAPA 1SYTA 4W5UA 5GPRA 4Z2LA 4UDMA 2JZVA 1FKBA 2RURA 3O5FA 4DWSA 1LL6A 1QZ2A 1WNOA 4DZ2A 2A3EA 2XP8A 1XHGA 2FAPA 1W9PA 1FKIA 1PINA 3UF8A 1QPFA 1D7IA 1WAWA 1O6IA 4P8VA 1EHNA 2F2DA 3MDYB 4G50A 3CHFA 4DWSB 3OOBA 3JYJA 3WQVA 4U84A 4FAPA 1FKDA 2Y78A 1HKIA 3PRBA 4JFLA 3NI6A 4ODOA 1ROTA 2A3BA 4U86A 1NWTA 1NSGA 2F23A 1WB0A 4HBOA 3GPKA 3G6LA 5I98A 2RUQA 2YBUA 3CGNA 3VAWA 3ARVA 1NWSA 1UR8A 4MNJA 4DRJA 3B9AA 3AS3A 4Q7NA 1NH6A 3B9EA 4LAXA 2B31A 1EIBA 1EQ3A 2XPAA 5HW8A 1FKKA 4BF8A 2ETNA 1TCOC 2DT1A 2A3CA 4Z2GA 4NNRA 3O5DA 2KGJA 1HJXA 1GPFA 3EY6A 4P8XA 4IT6A 2P4VA 3KACA 3WQWA 3RFWA 1FFQA 4TYOA 2AOSA 4HARA 3O5PA 2MLXA 4DRIA 3WD3A 1W9VA 1OGGA 4WIWA 2WLZA 4DH0A 4MPKA 2DG4A 2DSZA 1R9HA 3WL0A 2ESCA 3KZ7A 3AS1A 4DRPA 2KO7A 2ZR6A 4DWSC 4QT2A 2G41A 1FKHA 4ODRA 2RQSA 4W9PA 4WKFA 1GUVA 3PRDA 1Y0OA 3IHZA 5DITA 1D7JA 3O5OA 2FDMA 4P8UA 3W4RA 4XAKA 3BXWA 3WH0A 4ZS6A 4J4NA 1D2KA 4JFMA 1JNSA 3KCEA 1GRJA 5B8IC 1FKRA 2D9FA 3ARQA 3PRAA 3WIJA 4KQZA 1D7HA 1SR0A 1FKSA 4DRMA 2O9OA 3RM8A 3KAFA 1JNEA 1OGBA 4LAVA 1F8AB 1ZBVA 1D6OA 1NMVA 3UQIA 3CGMA 3H9RB 4W9QA 3O5KA 3UI5A 1EDQA 3ARWA 1LL4A 2DPEA 4JFKA 1K9TA 2KR7A 3AS0A 1E6NA 1ZU8A 5HWBA 1FKGA 2PI6A 2XP7A 4L72B 1ZK6A 2MF9A 4L3NA 2IF4A 3TCZA 4ZPTR 2PV1A 2PPNA 3KAIA 3CH9A 3WD2A 4LAYA 4AY1A 2UZ5A 2MLZA 5HTGA 1JNTA 1OWQA 4R5EA 2KFWA 1ZBWA 2L2SA 2IUZA 1T11A 3AS2A 1E6ZA 1J4IA 4JYSA 3O5QA 1KT0A 2PV2A 4U85A 5HWCA 3RM9A 3CZ8A 3KAHA 1TFVA 5JH8A 1XRVA 3O5LA 2PN0A 3ARYA 3AROA 1C9HA 3ARXA 1GOIA 3TDBA 3FXYA 2WM0A 4JFJA 1ROUA 2M1IA 4NZCA 5DEZA 4O2TA 1Q6IA 3ARTA 2RUCA 1L1PA 5BXJA 1ZBCA 2ZR5A 1W1TA 4MGVA 4S3JA 4WKAA 2OFNA 3B8SA 3CHEA 3ARUA 4WJXA 4TNSA 4IQCA 4Z2IA 4ODQA 3O5IA 3BMBA 1BL4A 4MNMA 3KAGA 1YW5A 5HKGA 4ZPWR 2PBCA 2XP4A 1EYMA 3KADA 4ODNA 4ODMA 2K8IA 2MPHA 1FKJA 3WKZA 4N19A 4TX0A 2LKNA 5HW6A 2AWGA 3I6CA 4ODPA 3CHCA 2PPPA 1NWRA 4IPXA 1UR9A 2LJ4A 1W1YA 4G2PA 3NTPA 3RM4A 1F40A 3KABA 1HJVA 4JFIA 2DSVA 1ZL1A 4DWSD 1J6YA 3O5GA 1QPLA 2PV3A 2A3AA
chains in the Genus database with same CATH topology
4DIPA 4C02B 1LL7A 4QT3A 4MNLA 4FN2A 2ZR4A 3UI6A 2LPVA 4W9OA 4MSPA 2WK2A 2F4EA 1N1AA 3JYMA 4NSBA 3IKDA 3O5EA 1HKMA 4DRHA 3B7XA 1HKJA 2WLYA 3FY1A 3G6MA 3IK8A 1BKFA 4DZ3A 2DT0A 2XPBA 1W1VA 2DT2A 3OA5A 4IQ2A 4DRNA 3RMEA 4ITZA 2XP3A 3UQAA 4TW6A 3RGCA 1JVWA 4GIVA 2MLYA 3TC5A 1FD9A 2VCDA 1NWUA 2XP9A 4WK9A 5DF0A 1YATA 5GQBA 1W1PA 2M08A 3ARSA 2Q5AA 1J4RA 2N87A 1FKTA 3ARRA 1PBKA 1ITXA 2LGOA 3JXVA 3WD1A 2OLHA 1P5QA 2DG9A 2ZQSA 3QOKA 1FKLA 3O5JA 3WD4A 3ODKA 3WL1A 2ZQUA 2O92A 1RD6A 1KT1A 5J6EA 4J4OA 4QIBA 1JNDA 2F21A 2XP5A 1M5YA 1X6NA 2PPOA 1LJYA 2MNTA 4Z2KA 2FKEA 3UI4A 1U79A 1IX5A 3O5MA 1KFWA 2M2AA 3LUOA 1FJDA 3FAPA 4HBEA 1HKKA 2KE0A 4KR0B 4Z2HA 1J4HA 1E6PA 4URIA 3NRKA 5HW7A 1E6RA 1E15A 3PA7A 2DT3A 2RSEA 4DRQA 1LG1A 1Q6UA 2XP6A 2ITKA 4LAWA 4DT4A 2ZQTA 2RUDA 3CHDA 4Q22A 4Z2JA 3WD0A 4IT4A 4GGQA 4MAVA 4WKHA 1X6LA 4P8WA 1W9UA 3ALFA 4LGXA 5HBFA 5D75A 1ZB5A 1Q6HA 1ZCNA 1FKFA 1A7XA 5GPGA 2ZQVA 4S3KA 1CTNA 1Q1CA 3AQUA 4ML4A 1HJWA 3ALGA 1W26A 4R0XA 4ZPVR 4DROA 3B9DA 3PR9A 4ODKA 4TW8A 2YBTA 1VF8A 3UQBA 5DO2A 3IKGA 4MTVA 5HUAA 1LQ0A 5HT1A 2DG3A 3ARPA 1HXVA 4TW7A 2VN1A 5DIVA 2DSWA 1ZBKA 2QF8A 1LG2A 4ODLA 1H0GA 4MNKA 4QZVB 5DIUA 4PTMA 2DSUA 1FFRA 1E9LA 3O5RA 1NMWA 4DRKA 2G8ZA 1B6CA 3ARZA 2KI3A 1H0IA 1FAPA 1SYTA 4W5UA 5GPRA 4Z2LA 2JZVA 1FKBA 2RURA 3O5FA 4DWSA 1LL6A 1QZ2A 1WNOA 4DZ2A 2A3EA 2XP8A 1XHGA 2FAPA 1W9PA 1FKIA 1PINA 3UF8A 1QPFA 1D7IA 1WAWA 1O6IA 4P8VA 1EHNA 2F2DA 3MDYB 4G50A 3CHFA 4DWSB 3OOBA 3JYJA 3WQVA 4U84A 4FAPA 1FKDA 2Y78A 1HKIA 3PRBA 4JFLA 3NI6A 4ODOA 1ROTA 2A3BA 4U86A 1NWTA 1NSGA 3GPKA 1WB0A 4HBOA 3G6LA 5I98A 2RUQA 2YBUA 3CGNA 3VAWA 3ARVA 1NWSA 1UR8A 4MNJA 4DRJA 3B9AA 3AS3A 4Q7NA 1NH6A 3B9EA 4LAXA 2B31A 1EIBA 1EQ3A 2XPAA 5HW8A 1FKKA 4BF8A 1TCOC 2DT1A 2A3CA 4Z2GA 4NNRA 3O5DA 2KGJA 1HJXA 1GPFA 3EY6A 4P8XA 4IT6A 3KACA 3WQWA 3RFWA 1FFQA 4TYOA 2AOSA 4HARA 3O5PA 2MLXA 4DRIA 3WD3A 1W9VA 1OGGA 4WIWA 2WLZA 4DH0A 4MPKA 2DG4A 2DSZA 1R9HA 3WL0A 2ESCA 3KZ7A 3AS1A 4DRPA 2KO7A 2ZR6A 4DWSC 4QT2A 2G41A 1FKHA 4ODRA 2RQSA 4W9PA 4WKFA 1GUVA 3PRDA 1Y0OA 3IHZA 5DITA 1D7JA 3O5OA 2FDMA 4P8UA 3W4RA 4XAKA 3BXWA 3WH0A 4ZS6A 4J4NA 1D2KA 4JFMA 1JNSA 3KCEA 5B8IC 1FKRA 2D9FA 3ARQA 3PRAA 3WIJA 4KQZA 1D7HA 1SR0A 1FKSA 4DRMA 2O9OA 3RM8A 3KAFA 1JNEA 1OGBA 4LAVA 1F8AB 1ZBVA 1D6OA 1NMVA 3UQIA 3CGMA 3H9RB 4W9QA 3O5KA 3UI5A 1EDQA 3ARWA 1LL4A 2DPEA 4JFKA 1K9TA 2KR7A 3AS0A 1E6NA 1ZU8A 5HWBA 1FKGA 2PI6A 2XP7A 4L72B 1ZK6A 2MF9A 4L3NA 2IF4A 3TCZA 4ZPTR 2PV1A 2PPNA 3KAIA 3CH9A 3WD2A 4LAYA 4AY1A 2UZ5A 2MLZA 5HTGA 1JNTA 1OWQA 4R5EA 2KFWA 1ZBWA 2L2SA 2IUZA 1T11A 3AS2A 1E6ZA 1J4IA 4JYSA 3O5QA 1KT0A 2PV2A 4U85A 5HWCA 3RM9A 3CZ8A 3KAHA 1TFVA 5JH8A 1XRVA 3O5LA 3ARYA 3AROA 1C9HA 3ARXA 1GOIA 3TDBA 3FXYA 2WM0A 4JFJA 1ROUA 2M1IA 4NZCA 5DEZA 4O2TA 1Q6IA 3ARTA 2RUCA 1L1PA 5BXJA 1ZBCA 2ZR5A 1W1TA 4MGVA 4S3JA 4WKAA 2OFNA 3B8SA 3CHEA 3ARUA 4WJXA 4TNSA 4IQCA 4Z2IA 4ODQA 3O5IA 1BL4A 4MNMA 3KAGA 1YW5A 5HKGA 4ZPWR 2PBCA 2XP4A 1EYMA 3KADA 4ODNA 4ODMA 2K8IA 2MPHA 1FKJA 3WKZA 4N19A 4TX0A 2LKNA 5HW6A 2AWGA 3I6CA 4ODPA 3CHCA 2PPPA 1NWRA 4IPXA 1UR9A 2LJ4A 1W1YA 4G2PA 3NTPA 3RM4A 1F40A 3KABA 1HJVA 4JFIA 2DSVA 1ZL1A 4DWSD 1J6YA 3O5GA 1QPLA 2PV3A 2A3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DIP A;  4C02 B;  4LAX A;  1EQ3 A;  2PV1 A;  2PPN A;  3KAI A;  2XPA A;  4QT3 A;  5HW8 A;  1FKK A;  4LAY A;  4GGQ A;  4BF8 A;  2UZ5 A;  4FN2 A;  1TCO C;  2MLZ A;  5HTG A;  2ZR4 A;  3UI6 A;  1JNT A;  2KFW A;  2LPV A;  4NNR A;  4MSP A;  3O5D A;  4W9O A;  2KGJ A;  2L2S A;  1T11 A;  1N1A A;  2F4E A;  3JYM A;  5D75 A;  1Q6H A;  3IKD A;  1ZCN A;  3O5E A;  3EY6 A;  1FKF A;  1A7X A;  1J4I A;  3KAC A;  5GPG A;  4DRH A;  2ZQV A;  3RFW A;  3B7X A;  4JYS A;  3IK8 A;  4TYO A;  3O5Q A;  1BKF A;  1KT0 A;  2PV2 A;  4U85 A;  5HWC A;  1Q1C A;  4DZ3 A;  2XPB A;  3KAH A;  3O5P A;  3O5L A;  2MLX A;  1W26 A;  4DRI A;  4R0X A;  4IQ2 A;  4DRN A;  4DRO A;  4ITZ A;  1C9H A;  2XP3 A;  3UQA A;  4TW6 A;  4ODK A;  3RGC A;  4TW8 A;  3TDB A;  1JVW A;  4DH0 A;  4JFJ A;  4GIV A;  2DG4 A;  1ROU A;  2MLY A;  2M1I A;  3TC5 A;  3UQB A;  3IKG A;  1FD9 A;  5HUA A;  1R9H A;  4O2T A;  1Q6I A;  2DG3 A;  3KZ7 A;  5HT1 A;  1HXV A;  4TW7 A;  2RUC A;  2VN1 A;  5DIV A;  4DRP A;  2VCD A;  2XP9 A;  2KO7 A;  2ZR6 A;  5BXJ A;  1YAT A;  1L1P A;  2M08 A;  2ZR5 A;  4MGV A;  4ODL A;  2Q5A A;  1J4R A;  4QT2 A;  2N87 A;  5DIU A;  1FKT A;  1FKH A;  4ODR A;  2OFN A;  2RQS A;  4W9P A;  1PBK A;  2LGO A;  3O5R A;  3PRD A;  3JXV A;  1Y0O A;  1NMW A;  4TNS A;  1P5Q A;  4IQC A;  4DRK A;  1B6C A;  2DG9 A;  3IHZ A;  2ZQS A;  2KI3 A;  1FKL A;  1FAP A;  3O5I A;  3O5J A;  4ODQ A;  1BL4 A;  5DIT A;  1D7J A;  2JZV A;  1FKB A;  1YW5 A;  2RUR A;  3KAG A;  3O5O A;  3O5F A;  3ODK A;  2PBC A;  5HKG A;  1QZ2 A;  2XP4 A;  2ZQU A;  4DZ2 A;  1KT1 A;  2XP8 A;  2FAP A;  3WH0 A;  1EYM A;  3KAD A;  4J4N A;  4ODN A;  4ODM A;  1FKI A;  1PIN A;  2K8I A;  4JFM A;  3UF8 A;  5J6E A;  3KCE A;  1JNS A;  5B8I C;  4J4O A;  1QPF A;  1D7I A;  4QIB A;  1FKR A;  2D9F A;  2F21 A;  2XP5 A;  1M5Y A;  2MPH A;  1FKJ A;  2F2D A;  2PPO A;  3MDY B;  4G50 A;  1D7H A;  2LKN A;  2MNT A;  4N19 A;  2AWG A;  4TX0 A;  5HW6 A;  2FKE A;  3UI4 A;  1U79 A;  3I6C A;  3O5M A;  3OOB A;  3JYJ A;  1FKS A;  4ODP A;  2PPP A;  4DRM A;  4U84 A;  4FAP A;  2M2A A;  1FKD A;  4IPX A;  3KAF A;  3LUO A;  2Y78 A;  2LJ4 A;  3PRB A;  3FAP A;  1FJD A;  4G2P A;  4JFL A;  3NI6 A;  1F8A B;  2KE0 A;  4LAV A;  3NTP A;  1D6O A;  4ODO A;  1ROT A;  1F40 A;  1NMV A;  3UQI A;  3CGM A;  3H9R B;  1J4H A;  4U86 A;  3O5K A;  4W9Q A;  3UI5 A;  1NSG A;  3KAB A;  3GPK A;  3NRK A;  4JFI A;  5HW7 A;  3PA7 A;  5I98 A;  4JFK A;  2RUQ A;  2RSE A;  4DRQ A;  1Q6U A;  2KR7 A;  2XP6 A;  3CGN A;  3VAW A;  1J6Y A;  5HWB A;  2ITK A;  3O5G A;  4LAW A;  4DT4 A;  1FKG A;  1QPL A;  2PV3 A;  2ZQT A;  2XP7 A;  1ZK6 A;  2MF9 A;  2RUD A;  4DRJ A;  2IF4 A;  3TCZ A; 
#chains in the Genus database with same CATH topology
 4DIP A;  4C02 B;  1LL7 A;  4QT3 A;  4MNL A;  4FN2 A;  3EIP A;  2ZR4 A;  3UI6 A;  2LPV A;  4W9O A;  4MSP A;  2WK2 A;  2F4E A;  1N1A A;  3JYM A;  4NSB A;  3IKD A;  3O5E A;  1HKM A;  4DRH A;  3B7X A;  1HKJ A;  2WLY A;  3FY1 A;  3G6M A;  3IK8 A;  1BKF A;  4DZ3 A;  2DT0 A;  2XPB A;  1W1V A;  2DT2 A;  3GTY X;  3OA5 A;  4IQ2 A;  4DRN A;  3RME A;  4ITZ A;  2XP3 A;  3UQA A;  4TW6 A;  3RGC A;  1JVW A;  4GIV A;  2MLY A;  3TC5 A;  1FD9 A;  2VCD A;  1NWU A;  2XP9 A;  4WK9 A;  5DF0 A;  1YAT A;  5GQB A;  1W1P A;  2M08 A;  3ARS A;  2Q5A A;  1J4R A;  2N87 A;  1FKT A;  3ARR A;  1PBK A;  1ITX A;  2LGO A;  3JXV A;  3WD1 A;  2OLH A;  1P5Q A;  2DG9 A;  3QOK A;  2ZQS A;  1FKL A;  3O5J A;  3WD4 A;  3ODK A;  3WL1 A;  2ZQU A;  2O92 A;  1RD6 A;  1KT1 A;  5J6E A;  4J4O A;  4QIB A;  1JND A;  2F21 A;  2XP5 A;  1M5Y A;  1X6N A;  2PPO A;  1LJY A;  2MNT A;  4Z2K A;  2FKE A;  3UI4 A;  1U79 A;  1IX5 A;  3O5M A;  1KFW A;  2M2A A;  3LUO A;  1FJD A;  3FAP A;  4HBE A;  1HKK A;  2KE0 A;  4KR0 B;  4Z2H A;  1J4H A;  1E6P A;  4URI A;  3NRK A;  5HW7 A;  1E6R A;  1E15 A;  3PA7 A;  2DT3 A;  2RSE A;  4DRQ A;  1LG1 A;  1Q6U A;  2XP6 A;  2ITK A;  4LAW A;  4DT4 A;  2ZQT A;  2RUD A;  3CHD A;  4Q22 A;  4Z2J A;  3WD0 A;  4IT4 A;  2EUL A;  4GGQ A;  4MAV A;  4WKH A;  1X6L A;  4P8W A;  1W9U A;  3ALF A;  4LGX A;  5HBF A;  5D75 A;  1ZB5 A;  1Q6H A;  1ZCN A;  1FKF A;  1A7X A;  5GPG A;  2ZQV A;  4S3K A;  3GU0 A;  1CTN A;  1Q1C A;  3AQU A;  4ML4 A;  1HJW A;  3ALG A;  1W26 A;  4R0X A;  4ZPV R;  4DRO A;  3B9D A;  3PR9 A;  4ODK A;  4TW8 A;  2YBT A;  1VF8 A;  3UQB A;  5DO2 A;  3IKG A;  4MTV A;  5HUA A;  1LQ0 A;  5HT1 A;  2DG3 A;  3ARP A;  1HXV A;  4TW7 A;  2VN1 A;  5DIV A;  2DSW A;  1ZBK A;  2QF8 A;  1LG2 A;  4ODL A;  1H0G A;  4MNK A;  4QZV B;  5DIU A;  1JCH B;  4PTM A;  2DSU A;  2B5U B;  1FFR A;  1E9L A;  3O5R A;  1E44 A;  1NMW A;  4DRK A;  2G8Z A;  1B6C A;  3ARZ A;  2KI3 A;  1H0I A;  1FAP A;  1SYT A;  4W5U A;  5GPR A;  4Z2L A;  4UDM A;  2JZV A;  1FKB A;  2RUR A;  3O5F A;  4DWS A;  1LL6 A;  1QZ2 A;  1WNO A;  4DZ2 A;  2A3E A;  2XP8 A;  1XHG A;  2FAP A;  1W9P A;  1FKI A;  1PIN A;  3UF8 A;  1QPF A;  1D7I A;  1WAW A;  1O6I A;  4P8V A;  1EHN A;  2F2D A;  3MDY B;  4G50 A;  3CHF A;  4DWS B;  3OOB A;  3JYJ A;  3WQV A;  4U84 A;  4FAP A;  1FKD A;  2Y78 A;  1HKI A;  3PRB A;  4JFL A;  3NI6 A;  4ODO A;  1ROT A;  2A3B A;  4U86 A;  1NWT A;  1NSG A;  2F23 A;  1WB0 A;  4HBO A;  3GPK A;  3G6L A;  5I98 A;  2RUQ A;  2YBU A;  3CGN A;  3VAW A;  3ARV A;  1NWS A;  1UR8 A;  4MNJ A;  4DRJ A;  3B9A A;  3AS3 A;  4Q7N A;  1NH6 A;  3B9E A;  4LAX A;  2B31 A;  1EIB A;  1EQ3 A;  2XPA A;  5HW8 A;  1FKK A;  4BF8 A;  2ETN A;  1TCO C;  2DT1 A;  2A3C A;  4Z2G A;  4NNR A;  3O5D A;  2KGJ A;  1HJX A;  1GPF A;  3EY6 A;  4P8X A;  4IT6 A;  2P4V A;  3KAC A;  3WQW A;  3RFW A;  1FFQ A;  4TYO A;  2AOS A;  4HAR A;  3O5P A;  2MLX A;  4DRI A;  3WD3 A;  1W9V A;  1OGG A;  4WIW A;  2WLZ A;  4DH0 A;  4MPK A;  2DG4 A;  2DSZ A;  1R9H A;  3WL0 A;  2ESC A;  3KZ7 A;  3AS1 A;  4DRP A;  2KO7 A;  2ZR6 A;  4DWS C;  4QT2 A;  2G41 A;  1FKH A;  4ODR A;  2RQS A;  4W9P A;  4WKF A;  1GUV A;  3PRD A;  1Y0O A;  3IHZ A;  5DIT A;  1D7J A;  3O5O A;  2FDM A;  4P8U A;  3W4R A;  4XAK A;  3BXW A;  3WH0 A;  4ZS6 A;  4J4N A;  1D2K A;  4JFM A;  1JNS A;  3KCE A;  1GRJ A;  5B8I C;  1FKR A;  2D9F A;  3ARQ A;  3PRA A;  3WIJ A;  4KQZ A;  1D7H A;  1SR0 A;  1FKS A;  4DRM A;  2O9O A;  3RM8 A;  3KAF A;  1JNE A;  1OGB A;  4LAV A;  1F8A B;  1ZBV A;  1D6O A;  1NMV A;  3UQI A;  3CGM A;  3H9R B;  4W9Q A;  3O5K A;  3UI5 A;  1EDQ A;  3ARW A;  1LL4 A;  2DPE A;  4JFK A;  1K9T A;  2KR7 A;  3AS0 A;  1E6N A;  1ZU8 A;  5HWB A;  1FKG A;  2PI6 A;  2XP7 A;  4L72 B;  1ZK6 A;  2MF9 A;  4L3N A;  2IF4 A;  3TCZ A;  4ZPT R;  2PV1 A;  2PPN A;  3KAI A;  3CH9 A;  3WD2 A;  4LAY A;  4AY1 A;  2UZ5 A;  2MLZ A;  5HTG A;  1JNT A;  1OWQ A;  4R5E A;  2KFW A;  1ZBW A;  2L2S A;  2IUZ A;  1T11 A;  3AS2 A;  1E6Z A;  1J4I A;  4JYS A;  3O5Q A;  1KT0 A;  2PV2 A;  4U85 A;  5HWC A;  3RM9 A;  3CZ8 A;  3KAH A;  1TFV A;  5JH8 A;  1XRV A;  3O5L A;  2PN0 A;  3ARY A;  3ARO A;  1C9H A;  3ARX A;  1GOI A;  3TDB A;  3FXY A;  2WM0 A;  4JFJ A;  1ROU A;  2M1I A;  4NZC A;  5DEZ A;  4O2T A;  1Q6I A;  3ART A;  2RUC A;  1L1P A;  5BXJ A;  1ZBC A;  2ZR5 A;  1W1T A;  4MGV A;  4S3J A;  4WKA A;  2OFN A;  3B8S A;  3CHE A;  3ARU A;  4WJX A;  4TNS A;  4IQC A;  4Z2I A;  4ODQ A;  3O5I A;  3BMB A;  1BL4 A;  4MNM A;  3KAG A;  1YW5 A;  5HKG A;  4ZPW R;  2PBC A;  2XP4 A;  1EYM A;  3KAD A;  4ODN A;  4ODM A;  2K8I A;  2MPH A;  1FKJ A;  3WKZ A;  4N19 A;  4TX0 A;  2LKN A;  5HW6 A;  2AWG A;  3I6C A;  4ODP A;  3CHC A;  2PPP A;  1NWR A;  4IPX A;  1UR9 A;  2LJ4 A;  1W1Y A;  4G2P A;  3NTP A;  3RM4 A;  1F40 A;  3KAB A;  1HJV A;  4JFI A;  2DSV A;  1ZL1 A;  4DWS D;  1J6Y A;  3O5G A;  1QPL A;  2PV3 A;  2A3A A; 
#chains in the Genus database with same CATH homology
 4DIP A;  4C02 B;  1LL7 A;  4QT3 A;  4MNL A;  4FN2 A;  2ZR4 A;  3UI6 A;  2LPV A;  4W9O A;  4MSP A;  2WK2 A;  2F4E A;  1N1A A;  3JYM A;  4NSB A;  3IKD A;  3O5E A;  1HKM A;  4DRH A;  3B7X A;  1HKJ A;  2WLY A;  3FY1 A;  3G6M A;  3IK8 A;  1BKF A;  4DZ3 A;  2DT0 A;  2XPB A;  1W1V A;  2DT2 A;  3OA5 A;  4IQ2 A;  4DRN A;  3RME A;  4ITZ A;  2XP3 A;  3UQA A;  4TW6 A;  3RGC A;  1JVW A;  4GIV A;  2MLY A;  3TC5 A;  1FD9 A;  2VCD A;  1NWU A;  2XP9 A;  4WK9 A;  5DF0 A;  1YAT A;  5GQB A;  1W1P A;  2M08 A;  3ARS A;  2Q5A A;  1J4R A;  2N87 A;  1FKT A;  3ARR A;  1PBK A;  1ITX A;  2LGO A;  3JXV A;  3WD1 A;  2OLH A;  1P5Q A;  2DG9 A;  2ZQS A;  3QOK A;  1FKL A;  3O5J A;  3WD4 A;  3ODK A;  3WL1 A;  2ZQU A;  2O92 A;  1RD6 A;  1KT1 A;  5J6E A;  4J4O A;  4QIB A;  1JND A;  2F21 A;  2XP5 A;  1M5Y A;  1X6N A;  2PPO A;  1LJY A;  2MNT A;  4Z2K A;  2FKE A;  3UI4 A;  1U79 A;  1IX5 A;  3O5M A;  1KFW A;  2M2A A;  3LUO A;  1FJD A;  3FAP A;  4HBE A;  1HKK A;  2KE0 A;  4KR0 B;  4Z2H A;  1J4H A;  1E6P A;  4URI A;  3NRK A;  5HW7 A;  1E6R A;  1E15 A;  3PA7 A;  2DT3 A;  2RSE A;  4DRQ A;  1LG1 A;  1Q6U A;  2XP6 A;  2ITK A;  4LAW A;  4DT4 A;  2ZQT A;  2RUD A;  3CHD A;  4Q22 A;  4Z2J A;  3WD0 A;  4IT4 A;  4GGQ A;  4MAV A;  4WKH A;  1X6L A;  4P8W A;  1W9U A;  3ALF A;  4LGX A;  5HBF A;  5D75 A;  1ZB5 A;  1Q6H A;  1ZCN A;  1FKF A;  1A7X A;  5GPG A;  2ZQV A;  4S3K A;  1CTN A;  1Q1C A;  3AQU A;  4ML4 A;  1HJW A;  3ALG A;  1W26 A;  4R0X A;  4ZPV R;  4DRO A;  3B9D A;  3PR9 A;  4ODK A;  4TW8 A;  2YBT A;  1VF8 A;  3UQB A;  5DO2 A;  3IKG A;  4MTV A;  5HUA A;  1LQ0 A;  5HT1 A;  2DG3 A;  3ARP A;  1HXV A;  4TW7 A;  2VN1 A;  5DIV A;  2DSW A;  1ZBK A;  2QF8 A;  1LG2 A;  4ODL A;  1H0G A;  4MNK A;  4QZV B;  5DIU A;  4PTM A;  2DSU A;  1FFR A;  1E9L A;  3O5R A;  1NMW A;  4DRK A;  2G8Z A;  1B6C A;  3ARZ A;  2KI3 A;  1H0I A;  1FAP A;  1SYT A;  4W5U A;  5GPR A;  4Z2L A;  2JZV A;  1FKB A;  2RUR A;  3O5F A;  4DWS A;  1LL6 A;  1QZ2 A;  1WNO A;  4DZ2 A;  2A3E A;  2XP8 A;  1XHG A;  2FAP A;  1W9P A;  1FKI A;  1PIN A;  3UF8 A;  1QPF A;  1D7I A;  1WAW A;  1O6I A;  4P8V A;  1EHN A;  2F2D A;  3MDY B;  4G50 A;  3CHF A;  4DWS B;  3OOB A;  3JYJ A;  3WQV A;  4U84 A;  4FAP A;  1FKD A;  2Y78 A;  1HKI A;  3PRB A;  4JFL A;  3NI6 A;  4ODO A;  1ROT A;  2A3B A;  4U86 A;  1NWT A;  1NSG A;  3GPK A;  1WB0 A;  4HBO A;  3G6L A;  5I98 A;  2RUQ A;  2YBU A;  3CGN A;  3VAW A;  3ARV A;  1NWS A;  1UR8 A;  4MNJ A;  4DRJ A;  3B9A A;  3AS3 A;  4Q7N A;  1NH6 A;  3B9E A;  4LAX A;  2B31 A;  1EIB A;  1EQ3 A;  2XPA A;  5HW8 A;  1FKK A;  4BF8 A;  1TCO C;  2DT1 A;  2A3C A;  4Z2G A;  4NNR A;  3O5D A;  2KGJ A;  1HJX A;  1GPF A;  3EY6 A;  4P8X A;  4IT6 A;  3KAC A;  3WQW A;  3RFW A;  1FFQ A;  4TYO A;  2AOS A;  4HAR A;  3O5P A;  2MLX A;  4DRI A;  3WD3 A;  1W9V A;  1OGG A;  4WIW A;  2WLZ A;  4DH0 A;  4MPK A;  2DG4 A;  2DSZ A;  1R9H A;  3WL0 A;  2ESC A;  3KZ7 A;  3AS1 A;  4DRP A;  2KO7 A;  2ZR6 A;  4DWS C;  4QT2 A;  2G41 A;  1FKH A;  4ODR A;  2RQS A;  4W9P A;  4WKF A;  1GUV A;  3PRD A;  1Y0O A;  3IHZ A;  5DIT A;  1D7J A;  3O5O A;  2FDM A;  4P8U A;  3W4R A;  4XAK A;  3BXW A;  3WH0 A;  4ZS6 A;  4J4N A;  1D2K A;  4JFM A;  1JNS A;  3KCE A;  5B8I C;  1FKR A;  2D9F A;  3ARQ A;  3PRA A;  3WIJ A;  4KQZ A;  1D7H A;  1SR0 A;  1FKS A;  4DRM A;  2O9O A;  3RM8 A;  3KAF A;  1JNE A;  1OGB A;  4LAV A;  1F8A B;  1ZBV A;  1D6O A;  1NMV A;  3UQI A;  3CGM A;  3H9R B;  4W9Q A;  3O5K A;  3UI5 A;  1EDQ A;  3ARW A;  1LL4 A;  2DPE A;  4JFK A;  1K9T A;  2KR7 A;  3AS0 A;  1E6N A;  1ZU8 A;  5HWB A;  1FKG A;  2PI6 A;  2XP7 A;  4L72 B;  1ZK6 A;  2MF9 A;  4L3N A;  2IF4 A;  3TCZ A;  4ZPT R;  2PV1 A;  2PPN A;  3KAI A;  3CH9 A;  3WD2 A;  4LAY A;  4AY1 A;  2UZ5 A;  2MLZ A;  5HTG A;  1JNT A;  1OWQ A;  4R5E A;  2KFW A;  1ZBW A;  2L2S A;  2IUZ A;  1T11 A;  3AS2 A;  1E6Z A;  1J4I A;  4JYS A;  3O5Q A;  1KT0 A;  2PV2 A;  4U85 A;  5HWC A;  3RM9 A;  3CZ8 A;  3KAH A;  1TFV A;  5JH8 A;  1XRV A;  3O5L A;  3ARY A;  3ARO A;  1C9H A;  3ARX A;  1GOI A;  3TDB A;  3FXY A;  2WM0 A;  4JFJ A;  1ROU A;  2M1I A;  4NZC A;  5DEZ A;  4O2T A;  1Q6I A;  3ART A;  2RUC A;  1L1P A;  5BXJ A;  1ZBC A;  2ZR5 A;  1W1T A;  4MGV A;  4S3J A;  4WKA A;  2OFN A;  3B8S A;  3CHE A;  3ARU A;  4WJX A;  4TNS A;  4IQC A;  4Z2I A;  4ODQ A;  3O5I A;  1BL4 A;  4MNM A;  3KAG A;  1YW5 A;  5HKG A;  4ZPW R;  2PBC A;  2XP4 A;  1EYM A;  3KAD A;  4ODN A;  4ODM A;  2K8I A;  2MPH A;  1FKJ A;  3WKZ A;  4N19 A;  4TX0 A;  2LKN A;  5HW6 A;  2AWG A;  3I6C A;  4ODP A;  3CHC A;  2PPP A;  1NWR A;  4IPX A;  1UR9 A;  2LJ4 A;  1W1Y A;  4G2P A;  3NTP A;  3RM4 A;  1F40 A;  3KAB A;  1HJV A;  4JFI A;  2DSV A;  1ZL1 A;  4DWS D;  1J6Y A;  3O5G A;  1QPL A;  2PV3 A;  2A3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...