1D7JA

Fkbp complexed with 4-hydroxy-2-butanone
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
publication title X-ray structures of small ligand-FKBP complexes provide an estimate for hydrophobic interaction energies.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1d7jA00
2PPOA 4DRKA 2M2AA 2XPAA 3O5PA 3TDBA 2D9FA 3KAIA 1Q6HA 1FKSA 4LAXA 3UI4A 5HW8A 1FJDA 1EYMA 3LUOA 3NTPA 4MGVA 4TW6A 5HWBA 4TNSA 2RUQA 5I98A 1J4HA 5GPGA 2F4EA 4O2TA 3MDYB 4JYSA 2K8IA 3O5MA 4DROA 1T11A 3IKDA 2L2SA 3O5JA 3O5OA 2PPNA 5J6EA 3TC5A 2MLYA 4JFMA 4U86A 1FKRA 1FKJA 3KZ7A 2LKNA 3NRKA 4DZ2A 4DT4A 1Q1CA 1NMVA 3I6CA 3JYMA 4QT3A 3O5LA 2M1IA 2MNTA 3O5QA 5HWCA 1FKHA 1BL4A 2LJ4A 4W9PA 1YATA 2KR7A 2ZQUA 3KCEA 1Q6UA 1TCOC 2PPPA 3NI6A 1Y0OA 4DRJA 4GIVA 3H9RB 3O5DA 4ODOA 4DIPA 2MF9A 2PBCA 3IK8A 5BXJA 4MSPA 1P5QA 3UQIA 2Q5AA 1JNSA 3FAPA 3VAWA 4FN2A 1FKTA 3KADA 2ZQVA 2XPBA 3KAHA 4G50A 2KFWA 2XP5A 4TYOA 3WH0A 2JZVA 4J4NA 2UZ5A 1C9HA 4ODKA 3UF8A 4GGQA 2XP4A 4IPXA 4QIBA 2KE0A 1JNTA 2F21A 1W26A 1FKGA 4JFIA 1PINA 4ODNA 1PBKA 1FKLA 1Q6IA 2XP3A 4IQCA 4TW7A 5DITA 2PV2A 1QZ2A 4DRQA 2ZR5A 4ODLA 2OFNA 5HW6A 2DG3A 1A7XA 1R9HA 4FAPA 2M08A 1J6YA 2LGOA 2XP9A 3KACA 4JFLA 4ODQA 4TX0A 2PV3A 4ODMA 2XP7A 4ODPA 2AWGA 4U84A 1ROTA 4IQ2A 4DZ3A 3JXVA 1D7HA 3O5EA 2ZR4A 1J4RA 2N87A 2RSEA 3O5IA 2RQSA 4DRIA 1FAPA 1ROUA 2DG9A 4TW8A 3UI6A 1FKFA 4C02B 1M5YA 2MPHA 3CGMA 5DIUA 3RGCA 2MLXA 3UI5A 1QPLA 4W9QA 3RFWA 5HW7A 1KT1A 2Y78A 3O5GA 4J4OA 2RUCA 3GPKA 1KT0A 4DRPA 5HKGA 1NSGA 1FKDA 2PV1A 5B8IC 1NMWA 2ZQSA 5HUAA 1ZCNA 2KO7A 3UQBA 1FD9A 1N1AA 1BKFA 4DRNA 1F40A 2VN1A 3IHZA 2KI3A 5HT1A 2FAPA 2ZQTA 4N19A 1D7JA 3EY6A 2MLZA 2RURA 3KAGA 4G2PA 3KABA 1HXVA 1ZK6A 2LPVA 3IKGA 4QT2A 1YW5A 1L1PA 2XP8A 3O5RA 4JFKA 1B6CA 3ODKA 4LAYA 4R0XA 2VCDA 3TCZA 3O5FA 2KGJA 1QPFA 1J4IA 4NNRA 4W9OA 2IF4A 2DG4A 2FKEA 3JYJA 3PA7A 4DRHA 4ITZA 1D7IA 4DH0A 4LAWA 5HTGA 1D6OA 2XP6A 2ZR6A 3PRBA 3PRDA 4DRMA 2F2DA 5D75A 2RUDA 4BF8A 3OOBA 1EQ3A 4LAVA 1JVWA 1FKKA 4ODRA 1FKBA 1U79A 3CGNA 3O5KA 1F8AB 3UQAA 2ITKA 4U85A 5DIVA 3B7XA 1FKIA 3KAFA 4JFJA
chains in the Genus database with same CATH superfamily
2PPOA 5DO2A 1W1YA 2M2AA 2XPAA 3TDBA 5HW8A 3UI4A 1FKSA 3WD1A 5HWBA 2RUQA 5I98A 1J4HA 2F4EA 1FFQA 1TFVA 1E6ZA 1OWQA 3WD3A 2L2SA 3O5JA 3O5OA 2WLZA 4MNKA 2PI6A 1FKRA 4DZ2A 1JNEA 1NMVA 3I6CA 3JYMA 4Z2HA 1UR8A 1FKHA 3KCEA 5HWCA 4DZ3A 4GIVA 3GU0A 5BXJA 4R5EA 4MSPA 2ESCA 2B31A 3CH9A 3VAWA 1FKTA 2ZQVA 2G41A 3G6MA 3ARQA 3WH0A 1JNTA 2F21A 3WD2A 4KQZA 1LQ0A 1FKLA 4TW7A 2XP3A 1H0GA 2PV2A 4NZCA 1OGBA 1LL4A 2OFNA 4WKAA 2DG3A 4HBOA 4IT6A 4ODQA 2XP9A 3KACA 2XP7A 1WB0A 2AWGA 3B9AA 3WKZA 2RSEA 1ROUA 2DG9A 3UI6A 4C02B 5DIUA 3RGCA 1QPLA 4W9QA 5HW7A 1K9TA 1NSGA 1FKDA 1NMWA 4L72B 3B8SA 1UR9A 2F23A 1RD6A 1E6PA 5DF0A 4MNLA 2VN1A 5HT1A 2KI3A 4N19A 1D7JA 3EY6A 2MLZA 3KAGA 3KABA 2LPVA 4QT2A 4Q7NA 3WQVA 1EDQA 3ALGA 3O5FA 3WD0A 2KGJA 1HKJA 3EIPA 1QPFA 4NNRA 4W9OA 2IF4A 2ZR6A 2A3CA 4W5UA 3W4RA 3B9EA 1LL7A 3PR9A 4DWSC 1JVWA 5DEZA 1FKBA 3O5KA 4U85A 3B7XA 3WIJA 3KAFA 4JFJA 4DRKA 3O5PA 4L3NA 1E6NA 1FJDA 2G8ZA 4ZPVR 3G6LA 4TNSA 4JYSA 3O5MA 4DROA 1T11A 2P4VA 3IKDA 1D2KA 2PPNA 3ARYA 4U86A 3KZ7A 1Q1CA 2ETNA 2QF8A 3O5LA 3O5QA 1YATA 4QZVB 1TCOC 4DRJA 1Y0OA 2PBCA 3ARXA 3IK8A 4Z2KA 1P5QA 4Z2LA 1HJWA 3KAHA 2A3EA 2XPBA 3WL1A 2KFWA 4ZPTR 1LJYA 2JZVA 3AS3A 2UZ5A 1GRJA 2XP4A 4MAVA 1HKIA 1QZ2A 3QOKA 1EIBA 1ZB5A 1A7XA 1NWTA 1J6YA 1ZU8A 4AY1A 1JNDA 4ODMA 3BXWA 4U84A 1OGGA 1D7HA 3O5EA 2ZR4A 3ARPA 4NSBA 4TW8A 4WJXA 1SR0A 2MLXA 3O5GA 4J4OA 3ARUA 3WD4A 2DT1A 2RUCA 4DRPA 5B8IC 4WK9A 3UQBA 1N1AA 1BKFA 1LG2A 2FAPA 1ZK6A 3IKGA 3ARRA 3O5RA 4JFKA 1X6NA 4LGXA 2O9OA 3RM9A 2WLYA 3TCZA 1J4IA 3ARSA 3BMBA 2DG4A 4DWSB 1NH6A 3PRDA 2F2DA 1FKKA 4PTMA 4ODRA 1E44A 1U79A 3AQUA 3UQAA 2DT0A 1XRVA 1ZBWA 2ITKA 1FKIA 5DIVA 2WK2A 2DT2A 2D9FA 2YBUA 4LAXA 3ARVA 4MTVA 3LUOA 3ARWA 3NTPA 4IT4A 4O2TA 3MDYB 2K8IA 1H0IA 1O6IA 3AS2A 4ML4A 5J6EA 2DSWA 2MLYA 4JFMA 3TC5A 4S3KA 3CHFA 1KFWA 1E15A 2DPEA 1GUVA 4QT3A 2MNTA 2LJ4A 2KR7A 2ZQUA 1Q6UA 2PPPA 4ODOA 4DIPA 4MNMA 4KR0B 1IX5A 4FN2A 4G50A 2XP5A 4Q22A 1C9HA 3UF8A 4GGQA 1XHGA 4QIBA 1NWRA 2KE0A 2EULA 3ALFA 4JFIA 1PINA 4ODNA 5DITA 4IQCA 5GPRA 1HKKA 4Z2IA 2ZR5A 2DSZA 4ZS6A 4FAPA 4TX0A 4DWSA 4JFLA 2IUZA 4IQ2A 1W9PA 4Z2JA 3ARTA 1J4RA 4DRIA 1FAPA 3OA5A 1FKFA 1ZBCA 2MPHA 4UDMA 3CGMA 3UI5A 3RFWA 1KT1A 2Y78A 4URIA 4WKFA 1KT0A 1E9LA 2ZQSA 2A3AA 3CZ8A 4DRNA 2PN0A 1W1VA 2DSVA 2ZQTA 1LL6A 1VF8A 2OLHA 4Z2GA 4HARA 1B6CA 4S3JA 2VCDA 5JH8A 4WKHA 3WL0A 4DRHA 3CHEA 2FKEA 3PA7A 1EHNA 4LAWA 5HTGA 1X6LA 1GPFA 3WQWA 5D75A 4BF8A 2WM0A 4MNJA 3CGNA 2AOSA 2YBTA 3KAIA 1Q6HA 1ZBKA 4DWSD 1EYMA 4MGVA 4TW6A 1W9UA 5GPGA 5GQBA 1W1PA 1FKJA 2LKNA 3NRKA 4DT4A 1SYTA 2M1IA 3RMEA 2DT3A 1BL4A 4W9PA 3NI6A 3H9RB 3O5DA 2FDMA 2MF9A 3PRAA 3UQIA 1ZBVA 2Q5AA 1JNSA 3FAPA 4MPKA 3KADA 4HBEA 4TYOA 4J4NA 4ODKA 4IPXA 3AS1A 1W26A 1FKGA 4WIWA 3CHDA 1PBKA 1Q6IA 1E6RA 4DRQA 4ODLA 1HKMA 5HW6A 1FFRA 5HBFA 1HJVA 1R9HA 2M08A 2LGOA 2PV3A 4ODPA 1CTNA 4P8VA 1ROTA 3JXVA 4ZPWR 1GOIA 2N87A 3O5IA 2RQSA 3AROA 1WAWA 1M5YA 3ARZA 4XAKA 3GPKA 5HKGA 2PV1A 5HUAA 4P8XA 1LG1A 1ZCNA 3RM8A 2KO7A 1FD9A 3AS0A 1F40A 1W9VA 3IHZA 1ITXA 1NWSA 2RURA 4G2PA 1HXVA 1ZL1A 1YW5A 1L1PA 2XP8A 4LAYA 3ODKA 4R0XA 1NWUA 3B9DA 3JYJA 4P8WA 4ITZA 1D7IA 4DH0A 2B5UB 3CHCA 1D6OA 1WNOA 2XP6A 2O92A 3PRBA 2DSUA 4DRMA 2RUDA 1EQ3A 4LAVA 1W1TA 1JCHB 3GTYX 1F8AB 3RM4A 3FY1A 2A3BA 3OOBA 4P8UA 1HJXA 3FXYA
chains in the Genus database with same CATH topology
2PPOA 5DO2A 1W1YA 2M2AA 2XPAA 3TDBA 5HW8A 3UI4A 1FKSA 3WD1A 5HWBA 2RUQA 5I98A 1J4HA 2F4EA 1FFQA 1TFVA 1E6ZA 1OWQA 3WD3A 2L2SA 3O5JA 3O5OA 2WLZA 4MNKA 2PI6A 1FKRA 4DZ2A 1JNEA 1NMVA 3I6CA 3JYMA 4Z2HA 1UR8A 1FKHA 3KCEA 5HWCA 4DZ3A 4GIVA 5BXJA 4R5EA 4MSPA 2ESCA 2B31A 3CH9A 3VAWA 1FKTA 2ZQVA 2G41A 3G6MA 3ARQA 3WH0A 1JNTA 2F21A 3WD2A 4KQZA 1LQ0A 1FKLA 4TW7A 2XP3A 1H0GA 2PV2A 4NZCA 1OGBA 1LL4A 2OFNA 4WKAA 2DG3A 4HBOA 4IT6A 4ODQA 2XP9A 3KACA 2XP7A 1WB0A 2AWGA 3B9AA 3WKZA 2RSEA 1ROUA 2DG9A 3UI6A 4C02B 5DIUA 3RGCA 1QPLA 4W9QA 5HW7A 1K9TA 1NSGA 1FKDA 1NMWA 4L72B 3B8SA 1UR9A 1RD6A 1E6PA 5DF0A 4MNLA 2VN1A 5HT1A 2KI3A 4N19A 1D7JA 3EY6A 2MLZA 3KAGA 3KABA 2LPVA 4QT2A 4Q7NA 3WQVA 1EDQA 3ALGA 3O5FA 3WD0A 2KGJA 1HKJA 1QPFA 4NNRA 4W9OA 2IF4A 2ZR6A 2A3CA 4W5UA 3W4RA 3B9EA 1LL7A 3PR9A 4DWSC 1JVWA 5DEZA 1FKBA 3O5KA 4U85A 3B7XA 3WIJA 3KAFA 4JFJA 4DRKA 3O5PA 4L3NA 1E6NA 1FJDA 2G8ZA 4ZPVR 3G6LA 4TNSA 4JYSA 3O5MA 4DROA 1T11A 3IKDA 1D2KA 2PPNA 3ARYA 4U86A 3KZ7A 1Q1CA 2QF8A 3O5LA 3O5QA 1YATA 4QZVB 1TCOC 4DRJA 1Y0OA 2PBCA 3ARXA 3IK8A 4Z2KA 1P5QA 4Z2LA 1HJWA 3KAHA 2A3EA 2XPBA 3WL1A 2KFWA 4ZPTR 1LJYA 2JZVA 3AS3A 2UZ5A 2XP4A 4MAVA 1HKIA 1QZ2A 3QOKA 1EIBA 1ZB5A 1A7XA 1NWTA 1J6YA 1ZU8A 4AY1A 1JNDA 4ODMA 3BXWA 4U84A 1OGGA 1D7HA 3O5EA 2ZR4A 3ARPA 4NSBA 4TW8A 4WJXA 1SR0A 2MLXA 3O5GA 4J4OA 3ARUA 3WD4A 2DT1A 2RUCA 4DRPA 5B8IC 4WK9A 3UQBA 1N1AA 1BKFA 1LG2A 2FAPA 1ZK6A 3IKGA 3ARRA 3O5RA 4JFKA 1X6NA 4LGXA 2O9OA 3RM9A 2WLYA 3TCZA 1J4IA 3ARSA 2DG4A 4DWSB 1NH6A 3PRDA 2F2DA 1FKKA 4PTMA 4ODRA 1U79A 3AQUA 3UQAA 2DT0A 1XRVA 1ZBWA 2ITKA 1FKIA 5DIVA 2WK2A 2DT2A 2D9FA 2YBUA 4LAXA 3ARVA 4MTVA 3LUOA 3ARWA 3NTPA 4IT4A 4O2TA 3MDYB 2K8IA 1H0IA 1O6IA 3AS2A 4ML4A 5J6EA 2DSWA 2MLYA 4JFMA 3TC5A 4S3KA 3CHFA 1KFWA 1E15A 2DPEA 1GUVA 4QT3A 2MNTA 2LJ4A 2KR7A 2ZQUA 1Q6UA 2PPPA 4ODOA 4DIPA 4MNMA 4KR0B 1IX5A 4FN2A 4G50A 2XP5A 4Q22A 1C9HA 3UF8A 4GGQA 1XHGA 4QIBA 1NWRA 2KE0A 3ALFA 4JFIA 1PINA 4ODNA 5DITA 4IQCA 5GPRA 1HKKA 4Z2IA 2ZR5A 2DSZA 4ZS6A 4FAPA 4TX0A 4DWSA 4JFLA 2IUZA 4IQ2A 1W9PA 4Z2JA 3ARTA 1J4RA 4DRIA 1FAPA 3OA5A 1FKFA 1ZBCA 2MPHA 3CGMA 3UI5A 3RFWA 1KT1A 2Y78A 4URIA 4WKFA 1KT0A 1E9LA 2ZQSA 2A3AA 3CZ8A 4DRNA 1W1VA 2DSVA 2ZQTA 1LL6A 1VF8A 2OLHA 4Z2GA 4HARA 1B6CA 4S3JA 2VCDA 5JH8A 4WKHA 3WL0A 4DRHA 3CHEA 2FKEA 3PA7A 1EHNA 4LAWA 5HTGA 1X6LA 1GPFA 3WQWA 5D75A 4BF8A 2WM0A 4MNJA 3CGNA 2AOSA 2YBTA 3KAIA 1Q6HA 1ZBKA 4DWSD 1EYMA 4MGVA 4TW6A 1W9UA 5GPGA 5GQBA 1W1PA 1FKJA 2LKNA 3NRKA 4DT4A 1SYTA 2M1IA 3RMEA 2DT3A 1BL4A 4W9PA 3NI6A 3H9RB 3O5DA 2FDMA 2MF9A 3PRAA 3UQIA 1ZBVA 2Q5AA 1JNSA 3FAPA 4MPKA 3KADA 4HBEA 4TYOA 4J4NA 4ODKA 4IPXA 3AS1A 1W26A 1FKGA 4WIWA 3CHDA 1PBKA 1Q6IA 1E6RA 4DRQA 4ODLA 1HKMA 5HW6A 1FFRA 5HBFA 1HJVA 1R9HA 2M08A 2LGOA 2PV3A 4ODPA 1CTNA 4P8VA 1ROTA 3JXVA 4ZPWR 1GOIA 2N87A 3O5IA 2RQSA 3AROA 1WAWA 1M5YA 3ARZA 4XAKA 3GPKA 5HKGA 2PV1A 5HUAA 4P8XA 1LG1A 1ZCNA 3RM8A 2KO7A 1FD9A 3AS0A 1F40A 1W9VA 3IHZA 1ITXA 1NWSA 2RURA 4G2PA 1HXVA 1ZL1A 1YW5A 1L1PA 2XP8A 4LAYA 3ODKA 4R0XA 1NWUA 3B9DA 3JYJA 4P8WA 4ITZA 1D7IA 4DH0A 3CHCA 1D6OA 1WNOA 2XP6A 2O92A 3PRBA 2DSUA 4DRMA 2RUDA 1EQ3A 4LAVA 1W1TA 1F8AB 3RM4A 3FY1A 2A3BA 3OOBA 4P8UA 1HJXA 3FXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPO A;  4DRK A;  2M2A A;  2XPA A;  3O5P A;  3TDB A;  2D9F A;  3KAI A;  1Q6H A;  1FKS A;  4LAX A;  3UI4 A;  5HW8 A;  1FJD A;  1EYM A;  3LUO A;  3NTP A;  4MGV A;  4TW6 A;  5HWB A;  4TNS A;  2RUQ A;  5I98 A;  1J4H A;  5GPG A;  2F4E A;  4O2T A;  3MDY B;  4JYS A;  2K8I A;  3O5M A;  4DRO A;  1T11 A;  3IKD A;  2L2S A;  3O5J A;  3O5O A;  2PPN A;  5J6E A;  3TC5 A;  2MLY A;  4JFM A;  4U86 A;  1FKR A;  1FKJ A;  3KZ7 A;  2LKN A;  3NRK A;  4DZ2 A;  4DT4 A;  1Q1C A;  1NMV A;  3I6C A;  3JYM A;  4QT3 A;  3O5L A;  2M1I A;  2MNT A;  3O5Q A;  5HWC A;  1FKH A;  1BL4 A;  2LJ4 A;  4W9P A;  1YAT A;  2KR7 A;  2ZQU A;  3KCE A;  1Q6U A;  1TCO C;  2PPP A;  3NI6 A;  1Y0O A;  4DRJ A;  4GIV A;  3H9R B;  3O5D A;  4ODO A;  4DIP A;  2MF9 A;  2PBC A;  3IK8 A;  5BXJ A;  4MSP A;  1P5Q A;  3UQI A;  2Q5A A;  1JNS A;  3FAP A;  3VAW A;  4FN2 A;  1FKT A;  3KAD A;  2ZQV A;  2XPB A;  3KAH A;  4G50 A;  2KFW A;  2XP5 A;  4TYO A;  3WH0 A;  2JZV A;  4J4N A;  2UZ5 A;  1C9H A;  4ODK A;  3UF8 A;  4GGQ A;  2XP4 A;  4IPX A;  4QIB A;  2KE0 A;  1JNT A;  2F21 A;  1W26 A;  1FKG A;  4JFI A;  1PIN A;  4ODN A;  1PBK A;  1FKL A;  1Q6I A;  2XP3 A;  4IQC A;  4TW7 A;  5DIT A;  2PV2 A;  1QZ2 A;  4DRQ A;  2ZR5 A;  4ODL A;  2OFN A;  5HW6 A;  2DG3 A;  1A7X A;  1R9H A;  4FAP A;  2M08 A;  1J6Y A;  2LGO A;  2XP9 A;  3KAC A;  4JFL A;  4ODQ A;  4TX0 A;  2PV3 A;  4ODM A;  2XP7 A;  4ODP A;  2AWG A;  4U84 A;  1ROT A;  4IQ2 A;  4DZ3 A;  3JXV A;  1D7H A;  3O5E A;  2ZR4 A;  1J4R A;  2N87 A;  2RSE A;  3O5I A;  2RQS A;  4DRI A;  1FAP A;  1ROU A;  2DG9 A;  4TW8 A;  3UI6 A;  1FKF A;  4C02 B;  1M5Y A;  2MPH A;  3CGM A;  5DIU A;  3RGC A;  2MLX A;  3UI5 A;  1QPL A;  4W9Q A;  3RFW A;  5HW7 A;  1KT1 A;  2Y78 A;  3O5G A;  4J4O A;  2RUC A;  3GPK A;  1KT0 A;  4DRP A;  5HKG A;  1NSG A;  1FKD A;  2PV1 A;  5B8I C;  1NMW A;  2ZQS A;  5HUA A;  1ZCN A;  2KO7 A;  3UQB A;  1FD9 A;  1N1A A;  1BKF A;  4DRN A;  1F40 A;  2VN1 A;  3IHZ A;  2KI3 A;  5HT1 A;  2FAP A;  2ZQT A;  4N19 A;  1D7J A;  3EY6 A;  2MLZ A;  2RUR A;  3KAG A;  4G2P A;  3KAB A;  1HXV A;  1ZK6 A;  2LPV A;  3IKG A;  4QT2 A;  1YW5 A;  1L1P A;  2XP8 A;  3O5R A;  4JFK A;  1B6C A;  3ODK A;  4LAY A;  4R0X A;  2VCD A;  3TCZ A;  3O5F A;  2KGJ A;  1QPF A;  1J4I A;  4NNR A;  4W9O A;  2IF4 A;  2DG4 A;  2FKE A;  3JYJ A;  3PA7 A;  4DRH A;  4ITZ A;  1D7I A;  4DH0 A;  4LAW A;  5HTG A;  1D6O A;  2XP6 A;  2ZR6 A;  3PRB A;  3PRD A;  4DRM A;  2F2D A;  5D75 A;  2RUD A;  4BF8 A;  3OOB A;  1EQ3 A;  4LAV A;  1JVW A;  1FKK A;  4ODR A;  1FKB A;  1U79 A;  3CGN A;  3O5K A;  1F8A B;  3UQA A;  2ITK A;  4U85 A;  5DIV A;  3B7X A;  1FKI A;  3KAF A;  4JFJ A; 
#chains in the Genus database with same CATH topology
 2PPO A;  5DO2 A;  1W1Y A;  2M2A A;  2XPA A;  3TDB A;  5HW8 A;  3UI4 A;  1FKS A;  3WD1 A;  5HWB A;  2RUQ A;  5I98 A;  1J4H A;  2F4E A;  1FFQ A;  1TFV A;  1E6Z A;  1OWQ A;  3WD3 A;  2L2S A;  3O5J A;  3O5O A;  2WLZ A;  4MNK A;  2PI6 A;  1FKR A;  4DZ2 A;  1JNE A;  1NMV A;  3I6C A;  3JYM A;  4Z2H A;  1UR8 A;  1FKH A;  3KCE A;  5HWC A;  4DZ3 A;  4GIV A;  3GU0 A;  5BXJ A;  4R5E A;  4MSP A;  2ESC A;  2B31 A;  3CH9 A;  3VAW A;  1FKT A;  2ZQV A;  2G41 A;  3G6M A;  3ARQ A;  3WH0 A;  1JNT A;  2F21 A;  3WD2 A;  4KQZ A;  1LQ0 A;  1FKL A;  4TW7 A;  2XP3 A;  1H0G A;  2PV2 A;  4NZC A;  1OGB A;  1LL4 A;  2OFN A;  4WKA A;  2DG3 A;  4HBO A;  4IT6 A;  4ODQ A;  2XP9 A;  3KAC A;  2XP7 A;  1WB0 A;  2AWG A;  3B9A A;  3WKZ A;  2RSE A;  1ROU A;  2DG9 A;  3UI6 A;  4C02 B;  5DIU A;  3RGC A;  1QPL A;  4W9Q A;  5HW7 A;  1K9T A;  1NSG A;  1FKD A;  1NMW A;  4L72 B;  3B8S A;  1UR9 A;  2F23 A;  1RD6 A;  1E6P A;  5DF0 A;  4MNL A;  2VN1 A;  5HT1 A;  2KI3 A;  4N19 A;  1D7J A;  3EY6 A;  2MLZ A;  3KAG A;  3KAB A;  2LPV A;  4QT2 A;  4Q7N A;  3WQV A;  1EDQ A;  3ALG A;  3O5F A;  3WD0 A;  2KGJ A;  1HKJ A;  3EIP A;  1QPF A;  4NNR A;  4W9O A;  2IF4 A;  2ZR6 A;  2A3C A;  4W5U A;  3W4R A;  3B9E A;  1LL7 A;  3PR9 A;  4DWS C;  1JVW A;  5DEZ A;  1FKB A;  3O5K A;  4U85 A;  3B7X A;  3WIJ A;  3KAF A;  4JFJ A;  4DRK A;  3O5P A;  4L3N A;  1E6N A;  1FJD A;  2G8Z A;  4ZPV R;  3G6L A;  4TNS A;  4JYS A;  3O5M A;  4DRO A;  1T11 A;  2P4V A;  3IKD A;  1D2K A;  2PPN A;  3ARY A;  4U86 A;  3KZ7 A;  1Q1C A;  2ETN A;  2QF8 A;  3O5L A;  3O5Q A;  1YAT A;  4QZV B;  1TCO C;  4DRJ A;  1Y0O A;  2PBC A;  3ARX A;  3IK8 A;  4Z2K A;  1P5Q A;  4Z2L A;  1HJW A;  3KAH A;  2A3E A;  2XPB A;  3WL1 A;  2KFW A;  4ZPT R;  1LJY A;  2JZV A;  3AS3 A;  2UZ5 A;  1GRJ A;  2XP4 A;  4MAV A;  1HKI A;  1QZ2 A;  3QOK A;  1EIB A;  1ZB5 A;  1A7X A;  1NWT A;  1J6Y A;  1ZU8 A;  4AY1 A;  1JND A;  4ODM A;  3BXW A;  4U84 A;  1OGG A;  1D7H A;  3O5E A;  2ZR4 A;  3ARP A;  4NSB A;  4TW8 A;  4WJX A;  1SR0 A;  2MLX A;  3O5G A;  4J4O A;  3ARU A;  3WD4 A;  2DT1 A;  2RUC A;  4DRP A;  5B8I C;  4WK9 A;  3UQB A;  1N1A A;  1BKF A;  1LG2 A;  2FAP A;  1ZK6 A;  3IKG A;  3ARR A;  3O5R A;  4JFK A;  1X6N A;  4LGX A;  2O9O A;  3RM9 A;  2WLY A;  3TCZ A;  1J4I A;  3ARS A;  3BMB A;  2DG4 A;  4DWS B;  1NH6 A;  3PRD A;  2F2D A;  1FKK A;  4PTM A;  4ODR A;  1E44 A;  1U79 A;  3AQU A;  3UQA A;  2DT0 A;  1XRV A;  1ZBW A;  2ITK A;  1FKI A;  5DIV A;  2WK2 A;  2DT2 A;  2D9F A;  2YBU A;  4LAX A;  3ARV A;  4MTV A;  3LUO A;  3ARW A;  3NTP A;  4IT4 A;  4O2T A;  3MDY B;  2K8I A;  1H0I A;  1O6I A;  3AS2 A;  4ML4 A;  5J6E A;  2DSW A;  2MLY A;  4JFM A;  3TC5 A;  4S3K A;  3CHF A;  1KFW A;  1E15 A;  2DPE A;  1GUV A;  4QT3 A;  2MNT A;  2LJ4 A;  2KR7 A;  2ZQU A;  1Q6U A;  2PPP A;  4ODO A;  4DIP A;  4MNM A;  4KR0 B;  1IX5 A;  4FN2 A;  4G50 A;  2XP5 A;  4Q22 A;  1C9H A;  3UF8 A;  4GGQ A;  1XHG A;  4QIB A;  1NWR A;  2KE0 A;  2EUL A;  3ALF A;  4JFI A;  1PIN A;  4ODN A;  5DIT A;  4IQC A;  5GPR A;  1HKK A;  4Z2I A;  2ZR5 A;  2DSZ A;  4ZS6 A;  4FAP A;  4TX0 A;  4DWS A;  4JFL A;  2IUZ A;  4IQ2 A;  1W9P A;  4Z2J A;  3ART A;  1J4R A;  4DRI A;  1FAP A;  3OA5 A;  1FKF A;  1ZBC A;  2MPH A;  4UDM A;  3CGM A;  3UI5 A;  3RFW A;  1KT1 A;  2Y78 A;  4URI A;  4WKF A;  1KT0 A;  1E9L A;  2ZQS A;  2A3A A;  3CZ8 A;  4DRN A;  2PN0 A;  1W1V A;  2DSV A;  2ZQT A;  1LL6 A;  1VF8 A;  2OLH A;  4Z2G A;  4HAR A;  1B6C A;  4S3J A;  2VCD A;  5JH8 A;  4WKH A;  3WL0 A;  4DRH A;  3CHE A;  2FKE A;  3PA7 A;  1EHN A;  4LAW A;  5HTG A;  1X6L A;  1GPF A;  3WQW A;  5D75 A;  4BF8 A;  2WM0 A;  4MNJ A;  3CGN A;  2AOS A;  2YBT A;  3KAI A;  1Q6H A;  1ZBK A;  4DWS D;  1EYM A;  4MGV A;  4TW6 A;  1W9U A;  5GPG A;  5GQB A;  1W1P A;  1FKJ A;  2LKN A;  3NRK A;  4DT4 A;  1SYT A;  2M1I A;  3RME A;  2DT3 A;  1BL4 A;  4W9P A;  3NI6 A;  3H9R B;  3O5D A;  2FDM A;  2MF9 A;  3PRA A;  3UQI A;  1ZBV A;  2Q5A A;  1JNS A;  3FAP A;  4MPK A;  3KAD A;  4HBE A;  4TYO A;  4J4N A;  4ODK A;  4IPX A;  3AS1 A;  1W26 A;  1FKG A;  4WIW A;  3CHD A;  1PBK A;  1Q6I A;  1E6R A;  4DRQ A;  4ODL A;  1HKM A;  5HW6 A;  1FFR A;  5HBF A;  1HJV A;  1R9H A;  2M08 A;  2LGO A;  2PV3 A;  4ODP A;  1CTN A;  4P8V A;  1ROT A;  3JXV A;  4ZPW R;  1GOI A;  2N87 A;  3O5I A;  2RQS A;  3ARO A;  1WAW A;  1M5Y A;  3ARZ A;  4XAK A;  3GPK A;  5HKG A;  2PV1 A;  5HUA A;  4P8X A;  1LG1 A;  1ZCN A;  3RM8 A;  2KO7 A;  1FD9 A;  3AS0 A;  1F40 A;  1W9V A;  3IHZ A;  1ITX A;  1NWS A;  2RUR A;  4G2P A;  1HXV A;  1ZL1 A;  1YW5 A;  1L1P A;  2XP8 A;  4LAY A;  3ODK A;  4R0X A;  1NWU A;  3B9D A;  3JYJ A;  4P8W A;  4ITZ A;  1D7I A;  4DH0 A;  2B5U B;  3CHC A;  1D6O A;  1WNO A;  2XP6 A;  2O92 A;  3PRB A;  2DSU A;  4DRM A;  2RUD A;  1EQ3 A;  4LAV A;  1W1T A;  1JCH B;  3GTY X;  1F8A B;  3RM4 A;  3FY1 A;  2A3B A;  3OOB A;  4P8U A;  1HJX A;  3FXY A; 
#chains in the Genus database with same CATH homology
 2PPO A;  5DO2 A;  1W1Y A;  2M2A A;  2XPA A;  3TDB A;  5HW8 A;  3UI4 A;  1FKS A;  3WD1 A;  5HWB A;  2RUQ A;  5I98 A;  1J4H A;  2F4E A;  1FFQ A;  1TFV A;  1E6Z A;  1OWQ A;  3WD3 A;  2L2S A;  3O5J A;  3O5O A;  2WLZ A;  4MNK A;  2PI6 A;  1FKR A;  4DZ2 A;  1JNE A;  1NMV A;  3I6C A;  3JYM A;  4Z2H A;  1UR8 A;  1FKH A;  3KCE A;  5HWC A;  4DZ3 A;  4GIV A;  5BXJ A;  4R5E A;  4MSP A;  2ESC A;  2B31 A;  3CH9 A;  3VAW A;  1FKT A;  2ZQV A;  2G41 A;  3G6M A;  3ARQ A;  3WH0 A;  1JNT A;  2F21 A;  3WD2 A;  4KQZ A;  1LQ0 A;  1FKL A;  4TW7 A;  2XP3 A;  1H0G A;  2PV2 A;  4NZC A;  1OGB A;  1LL4 A;  2OFN A;  4WKA A;  2DG3 A;  4HBO A;  4IT6 A;  4ODQ A;  2XP9 A;  3KAC A;  2XP7 A;  1WB0 A;  2AWG A;  3B9A A;  3WKZ A;  2RSE A;  1ROU A;  2DG9 A;  3UI6 A;  4C02 B;  5DIU A;  3RGC A;  1QPL A;  4W9Q A;  5HW7 A;  1K9T A;  1NSG A;  1FKD A;  1NMW A;  4L72 B;  3B8S A;  1UR9 A;  1RD6 A;  1E6P A;  5DF0 A;  4MNL A;  2VN1 A;  5HT1 A;  2KI3 A;  4N19 A;  1D7J A;  3EY6 A;  2MLZ A;  3KAG A;  3KAB A;  2LPV A;  4QT2 A;  4Q7N A;  3WQV A;  1EDQ A;  3ALG A;  3O5F A;  3WD0 A;  2KGJ A;  1HKJ A;  1QPF A;  4NNR A;  4W9O A;  2IF4 A;  2ZR6 A;  2A3C A;  4W5U A;  3W4R A;  3B9E A;  1LL7 A;  3PR9 A;  4DWS C;  1JVW A;  5DEZ A;  1FKB A;  3O5K A;  4U85 A;  3B7X A;  3WIJ A;  3KAF A;  4JFJ A;  4DRK A;  3O5P A;  4L3N A;  1E6N A;  1FJD A;  2G8Z A;  4ZPV R;  3G6L A;  4TNS A;  4JYS A;  3O5M A;  4DRO A;  1T11 A;  3IKD A;  1D2K A;  2PPN A;  3ARY A;  4U86 A;  3KZ7 A;  1Q1C A;  2QF8 A;  3O5L A;  3O5Q A;  1YAT A;  4QZV B;  1TCO C;  4DRJ A;  1Y0O A;  2PBC A;  3ARX A;  3IK8 A;  4Z2K A;  1P5Q A;  4Z2L A;  1HJW A;  3KAH A;  2A3E A;  2XPB A;  3WL1 A;  2KFW A;  4ZPT R;  1LJY A;  2JZV A;  3AS3 A;  2UZ5 A;  2XP4 A;  4MAV A;  1HKI A;  1QZ2 A;  3QOK A;  1EIB A;  1ZB5 A;  1A7X A;  1NWT A;  1J6Y A;  1ZU8 A;  4AY1 A;  1JND A;  4ODM A;  3BXW A;  4U84 A;  1OGG A;  1D7H A;  3O5E A;  2ZR4 A;  3ARP A;  4NSB A;  4TW8 A;  4WJX A;  1SR0 A;  2MLX A;  3O5G A;  4J4O A;  3ARU A;  3WD4 A;  2DT1 A;  2RUC A;  4DRP A;  5B8I C;  4WK9 A;  3UQB A;  1N1A A;  1BKF A;  1LG2 A;  2FAP A;  1ZK6 A;  3IKG A;  3ARR A;  3O5R A;  4JFK A;  1X6N A;  4LGX A;  2O9O A;  3RM9 A;  2WLY A;  3TCZ A;  1J4I A;  3ARS A;  2DG4 A;  4DWS B;  1NH6 A;  3PRD A;  2F2D A;  1FKK A;  4PTM A;  4ODR A;  1U79 A;  3AQU A;  3UQA A;  2DT0 A;  1XRV A;  1ZBW A;  2ITK A;  1FKI A;  5DIV A;  2WK2 A;  2DT2 A;  2D9F A;  2YBU A;  4LAX A;  3ARV A;  4MTV A;  3LUO A;  3ARW A;  3NTP A;  4IT4 A;  4O2T A;  3MDY B;  2K8I A;  1H0I A;  1O6I A;  3AS2 A;  4ML4 A;  5J6E A;  2DSW A;  2MLY A;  4JFM A;  3TC5 A;  4S3K A;  3CHF A;  1KFW A;  1E15 A;  2DPE A;  1GUV A;  4QT3 A;  2MNT A;  2LJ4 A;  2KR7 A;  2ZQU A;  1Q6U A;  2PPP A;  4ODO A;  4DIP A;  4MNM A;  4KR0 B;  1IX5 A;  4FN2 A;  4G50 A;  2XP5 A;  4Q22 A;  1C9H A;  3UF8 A;  4GGQ A;  1XHG A;  4QIB A;  1NWR A;  2KE0 A;  3ALF A;  4JFI A;  1PIN A;  4ODN A;  5DIT A;  4IQC A;  5GPR A;  1HKK A;  4Z2I A;  2ZR5 A;  2DSZ A;  4ZS6 A;  4FAP A;  4TX0 A;  4DWS A;  4JFL A;  2IUZ A;  4IQ2 A;  1W9P A;  4Z2J A;  3ART A;  1J4R A;  4DRI A;  1FAP A;  3OA5 A;  1FKF A;  1ZBC A;  2MPH A;  3CGM A;  3UI5 A;  3RFW A;  1KT1 A;  2Y78 A;  4URI A;  4WKF A;  1KT0 A;  1E9L A;  2ZQS A;  2A3A A;  3CZ8 A;  4DRN A;  1W1V A;  2DSV A;  2ZQT A;  1LL6 A;  1VF8 A;  2OLH A;  4Z2G A;  4HAR A;  1B6C A;  4S3J A;  2VCD A;  5JH8 A;  4WKH A;  3WL0 A;  4DRH A;  3CHE A;  2FKE A;  3PA7 A;  1EHN A;  4LAW A;  5HTG A;  1X6L A;  1GPF A;  3WQW A;  5D75 A;  4BF8 A;  2WM0 A;  4MNJ A;  3CGN A;  2AOS A;  2YBT A;  3KAI A;  1Q6H A;  1ZBK A;  4DWS D;  1EYM A;  4MGV A;  4TW6 A;  1W9U A;  5GPG A;  5GQB A;  1W1P A;  1FKJ A;  2LKN A;  3NRK A;  4DT4 A;  1SYT A;  2M1I A;  3RME A;  2DT3 A;  1BL4 A;  4W9P A;  3NI6 A;  3H9R B;  3O5D A;  2FDM A;  2MF9 A;  3PRA A;  3UQI A;  1ZBV A;  2Q5A A;  1JNS A;  3FAP A;  4MPK A;  3KAD A;  4HBE A;  4TYO A;  4J4N A;  4ODK A;  4IPX A;  3AS1 A;  1W26 A;  1FKG A;  4WIW A;  3CHD A;  1PBK A;  1Q6I A;  1E6R A;  4DRQ A;  4ODL A;  1HKM A;  5HW6 A;  1FFR A;  5HBF A;  1HJV A;  1R9H A;  2M08 A;  2LGO A;  2PV3 A;  4ODP A;  1CTN A;  4P8V A;  1ROT A;  3JXV A;  4ZPW R;  1GOI A;  2N87 A;  3O5I A;  2RQS A;  3ARO A;  1WAW A;  1M5Y A;  3ARZ A;  4XAK A;  3GPK A;  5HKG A;  2PV1 A;  5HUA A;  4P8X A;  1LG1 A;  1ZCN A;  3RM8 A;  2KO7 A;  1FD9 A;  3AS0 A;  1F40 A;  1W9V A;  3IHZ A;  1ITX A;  1NWS A;  2RUR A;  4G2P A;  1HXV A;  1ZL1 A;  1YW5 A;  1L1P A;  2XP8 A;  4LAY A;  3ODK A;  4R0X A;  1NWU A;  3B9D A;  3JYJ A;  4P8W A;  4ITZ A;  1D7I A;  4DH0 A;  3CHC A;  1D6O A;  1WNO A;  2XP6 A;  2O92 A;  3PRB A;  2DSU A;  4DRM A;  2RUD A;  1EQ3 A;  4LAV A;  1W1T A;  1F8A B;  3RM4 A;  3FY1 A;  2A3B A;  3OOB A;  4P8U A;  1HJX A;  3FXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...