1D7JA

Fkbp complexed with 4-hydroxy-2-butanone
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of small ligand-FKBP complexes provide an estimate for hydrophobic interaction energies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
total genus 28
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1d7jA00
1NMWA 3O5OA 1J4HA 1ROUA 2F4EA 4DRIA 3KABA 4QIBA 4R0XA 1J4IA 2ZQSA 3IK8A 1FKIA 1Q6IA 1HXVA 1D7IA 1Q6UA 3O5GA 4ODKA 3UQIA 5DIVA 2ZR4A 1NMVA 3VAWA 1FKLA 3B7XA 1ZCNA 2AWGA 4DZ2A 1N1AA 2XP9A 4U84A 3O5QA 3O5JA 4O2TA 4JFKA 1F8AB 5J6EA 1FKJA 4QT3A 4JYSA 4W9PA 1C9HA 4LAWA 4ODPA 5D75A 4DRKA 1FKRA 2XP6A 3TC5A 1FKTA 3UI4A 4TYOA 1FKHA 2KFWA 2FKEA 3O5FA 4QT2A 5HW6A 3PRDA 2LPVA 4IQ2A 5HT1A 4DRQA 3IKGA 1J6YA 3UQBA 2RURA 3KCEA 4LAVA 5HWBA 2M2AA 1D7JA 2XPAA 3KZ7A 5HTGA 3PA7A 4DRNA 4LAYA 3CGMA 3ODKA 1FKKA 1FAPA 3RFWA 2N87A 1QZ2A 4DRPA 1YW5A 5HW7A 2L2SA 2UZ5A 5BXJA 3JYJA 2OFNA 3RGCA 4FAPA 1M5YA 3I6CA 3O5IA 2XP8A 1FKGA 2JZVA 2FAPA 2RUCA 3JXVA 2PPOA 3O5RA 2DG3A 2PV2A 4J4NA 4JFIA 3UF8A 1FD9A 1Q1CA 2Q5AA 3KAFA 3PRBA 4IQCA 3MDYB 2RUDA 3UI5A 4BF8A 2LKNA 1Y0OA 2PBCA 3KACA 1F40A 1BKFA 4TNSA 3CGNA 4ODNA 4G50A 2M08A 2ZQTA 4W9OA 1TCOC 2DG4A 3O5LA 4TX0A 1KT1A 3TCZA 1BL4A 3O5PA 4ODOA 4IPXA 4DIPA 1QPLA 1YATA 4U85A 3JYMA 2PPNA 5I98A 3NRKA 5HUAA 4MSPA 1ZK6A 3KADA 4DH0A 2ITKA 2XP5A 2ZR6A 3KAIA 2PPPA 4DRJA 3OOBA 3UQAA 5HKGA 1NSGA 3H9RB 1QPFA 4TW7A 2MLYA 4ODLA 3UI6A 4JFLA 2RSEA 4DT4A 2DG9A 2XP7A 3TDBA 2MLXA 3NI6A 2VCDA 2D9FA 3KAGA 3LUOA 2KGJA 4C02B 2M1IA 5HW8A 2XP4A 1JNTA 1D7HA 4JFMA 1EQ3A 4JFJA 2XPBA 2KR7A 2K8IA 1FKFA 2LGOA 1U79A 3NTPA 2KE0A 4N19A 2MPHA 3FAPA 3IKDA 3O5DA 1P5QA 2F2DA 4GGQA 5DIUA 2IF4A 4DROA 5HWCA 2F21A 4ITZA 5B8IC 1R9HA 2RUQA 5DITA 4DRHA 2Y78A 1L1PA 4W9QA 1KT0A 4G2PA 2ZQVA 4J4OA 4DRMA 4ODRA 1D6OA 1FKBA 3O5EA 2LJ4A 2KO7A 1B6CA 2RQSA 1ROTA 3WH0A 4DZ3A 1W26A 1FJDA 2PV1A 2XP3A 2PV3A 1T11A 2MNTA 4GIVA 4LAXA 1A7XA 1EYMA 4MGVA 2MLZA 1JNSA 2ZR5A 2MF9A 1FKDA 2KI3A 4U86A 5GPGA 3KAHA 1JVWA 4NNRA 2ZQUA 3O5MA 2VN1A 1FKSA 1Q6HA 3EY6A 3GPKA 1PBKA 4TW8A 3O5KA 1J4RA 4ODMA 1PINA 3IHZA 4ODQA 4FN2A 4TW6A
chains in the Genus database with same CATH superfamily
3BMBA 2F4EA 4Z2JA 4R0XA 1HKKA 1FKIA 5DIVA 2ZR4A 3B7XA 2A3BA 3ARRA 3O5JA 4JFKA 4JYSA 1D2KA 4ODPA 4DRKA 3TC5A 1FKTA 3UI4A 3O5FA 4QT2A 4XAKA 5DO2A 3CHDA 2A3CA 2LPVA 4IQ2A 3WIJA 2ESCA 3IKGA 1W9PA 1D7JA 3PA7A 2PN0A 3CGMA 3ODKA 1YW5A 4S3KA 4IT6A 3JXVA 4J4NA 5JH8A 3O5RA 1Q1CA 2Q5AA 3UI5A 3G6MA 1F40A 1HKJA 4TNSA 2ZQTA 4MAVA 1ZBWA 1HJWA 3TCZA 1E6PA 2DT2A 1SR0A 1YATA 3FXYA 2O9OA 3NRKA 5HUAA 1LL6A 3AS0A 3KAIA 4DRJA 3WD1A 1QPFA 2WM0A 2MLYA 4MNJA 1UR8A 5DF0A 4ML4A 2YBTA 3ARVA 2XP7A 1ZU8A 3TDBA 3NI6A 1GOIA 3LUOA 2XP4A 3ARZA 4W5UA 2XPBA 5HBFA 2LGOA 4ZPVR 2KE0A 1P5QA 4GGQA 4Q7NA 1FFQA 5DEZA 4L3NA 3ARXA 1L1PA 4W9QA 2ZQVA 1E6ZA 4DRMA 2LJ4A 2RQSA 4MPKA 2PV1A 2XP3A 4URIA 1EIBA 4GIVA 2MNTA 3B9EA 1GPFA 4LAXA 1EYMA 3WD3A 3KAHA 2WLZA 1JVWA 2ETNA 3O5MA 1Q6HA 1XHGA 1JNEA 1W9UA 1PINA 3CH9A 4HBOA 3O5OA 4WJXA 4Z2LA 3RM8A 3IK8A 1HXVA 1Q6IA 1Q6UA 4PTMA 3CZ8A 1FKLA 1N1AA 2XP9A 1W9VA 3WD4A 4W9PA 1ZB5A 5D75A 1GRJA 1HKMA 3QOKA 5HW6A 3WQVA 5HT1A 3ARWA 2RURA 3KCEA 4LAVA 1E15A 2OLHA 3WL1A 1FKKA 2N87A 5HW7A 2L2SA 4AY1A 5BXJA 1XRVA 3JYJA 4FAPA 2IUZA 4NNRA 3O5IA 3WD2A 2FAPA 4WKHA 3PRBA 3ARPA 3MDYB 2LKNA 2PBCA 3KACA 1E44A 1BKFA 4ODNA 3B9DA 4G50A 2M08A 4WIWA 2DT1A 2WLYA 3CHFA 4R5EA 2DG4A 3O5LA 3CHCA 1ITXA 3O5PA 4ODOA 1ZBCA 4DIPA 3WQWA 3JYMA 1JNDA 2B31A 2PPNA 4ZPWR 1IX5A 3KADA 2ITKA 3H9RB 4TW7A 2DG9A 1TFVA 2D9FA 2EULA 5HW8A 2F23A 1EQ3A 2K8IA 3WKZA 1HJXA 2MPHA 3FAPA 3IKDA 5HWCA 1EDQA 5B8IC 4DWSA 3WL0A 2RUQA 3GU0A 4DRHA 1K9TA 4G2PA 4MTVA 4WKFA 1NWRA 1D6OA 1FKBA 3O5EA 1E9LA 2KO7A 3WH0A 4NZCA 1JNSA 1A7XA 4MNLA 2MF9A 2KI3A 2DPEA 4Q22A 4MNKA 3RM4A 1FKSA 4TW8A 1E6RA 1H0IA 1J4RA 4WK9A 3AROA 3IHZA 4ODQA 4FN2A 5GPRA 1HKIA 1NMWA 4DWSC 1J4HA 1ROUA 4DRIA 3KABA 4QIBA 4ZS6A 1J4IA 1O6IA 3UQIA 1RD6A 1NMVA 3VAWA 3PRAA 1HJVA 1LG1A 4O2TA 1F8AB 4QT3A 1C9HA 4QZVB 1JCHB 3EIPA 4DWSB 3PRDA 4DRQA 4HARA 1J6YA 3WD0A 5HWBA 1NWUA 1NH6A 3G6LA 2G8ZA 1FAPA 3RFWA 3ARTA 1QZ2A 4DRPA 2UZ5A 1M5YA 1LG2A 3I6CA 3UQBA 2JZVA 2PPOA 3B9AA 3UF8A 1FD9A 4IQCA 3KAFA 2RUDA 4P8VA 1Y0OA 3CGNA 2YBUA 1SYTA 4NSBA 4TX0A 1BL4A 1QPLA 1ZBVA 4U85A 2DSZA 4DH0A 1NWSA 2XP5A 2PPPA 5HKGA 3B8SA 2DSVA 4ODLA 3ARUA 2RSEA 2QF8A 1W1YA 4KR0B 4Z2IA 3KAGA 1H0GA 1ZL1A 1JNTA 1D7HA 2G41A 4JFJA 4DWSD 1OGGA 1U79A 4N19A 1FFRA 1X6LA 3O5DA 4DROA 2F2DA 3AS3A 2IF4A 2F21A 5DITA 3AS2A 1LL7A 4Z2HA 1ZBKA 2DT0A 4ODRA 4C02B 1B6CA 1FJDA 3ALGA 4LGXA 3BXWA 1LL4A 4HBEA 1FKDA 4U86A 5GPGA 2ZQUA 1W1TA 2VN1A 3PR9A 3EY6A 3GPKA 3O5KA 4ODMA 1LQ0A 1WAWA 1X6NA 1VF8A 2ZQSA 1D7IA 3O5GA 4ODKA 1E6NA 4DZ2A 1WNOA 1ZCNA 2AWGA 4U84A 3AQUA 2B5UB 3O5QA 3ARYA 5J6EA 1FKJA 1FKRA 4LAWA 4Z2GA 2XP6A 4TYOA 1FKHA 2KFWA 2FKEA 3RMEA 1UR9A 4L72B 1KFWA 2O92A 2M2AA 2FDMA 2XPAA 3KZ7A 5HTGA 4DRNA 4LAYA 1NWTA 2OFNA 3RGCA 2XP8A 1FKGA 2RUCA 1GUVA 2DG3A 2PV2A 4JFIA 4BF8A 1WB0A 2DT3A 3ALFA 1LJYA 2A3AA 4P8UA 4W9OA 1TCOC 1KT1A 2A3EA 1W1PA 1EHNA 4IPXA 2P4VA 4WKAA 5I98A 4MSPA 1W1VA 1ZK6A 4MNMA 2ZR6A 3UQAA 3OOBA 1NSGA 3UI6A 1OGBA 4JFLA 3FY1A 4DT4A 2MLXA 3ARSA 2VCDA 4IT4A 2DSUA 5GQBA 3W4RA 2KGJA 4S3JA 2M1IA 4KQZA 4JFMA 2AOSA 4P8WA 2KR7A 3AS1A 1FKFA 3NTPA 4UDMA 1OWQA 4ZPTR 5DIUA 1CTNA 4P8XA 4ITZA 3GTYX 1R9HA 2DSWA 2Y78A 4Z2KA 1KT0A 3RM9A 4J4OA 4DZ3A 1ROTA 3OA5A 1W26A 2PV3A 1T11A 4MGVA 2MLZA 2ZR5A 3CHEA 2PI6A 2WK2A 1PBKA 4TW6A 3ARQA
chains in the Genus database with same CATH topology
2F4EA 4Z2JA 4R0XA 1HKKA 1FKIA 5DIVA 2ZR4A 3B7XA 2A3BA 3ARRA 3O5JA 4JFKA 4JYSA 1D2KA 4ODPA 4DRKA 3TC5A 1FKTA 3UI4A 3O5FA 4QT2A 4XAKA 5DO2A 3CHDA 2A3CA 2LPVA 4IQ2A 3WIJA 2ESCA 3IKGA 1W9PA 1D7JA 3PA7A 3CGMA 3ODKA 1YW5A 4S3KA 4IT6A 3JXVA 4J4NA 5JH8A 3O5RA 1Q1CA 2Q5AA 3UI5A 3G6MA 1F40A 1HKJA 4TNSA 2ZQTA 4MAVA 1ZBWA 1HJWA 3TCZA 1E6PA 2DT2A 1SR0A 1YATA 3FXYA 2O9OA 3NRKA 5HUAA 1LL6A 3AS0A 3KAIA 4DRJA 3WD1A 1QPFA 2WM0A 2MLYA 4MNJA 1UR8A 5DF0A 4ML4A 2YBTA 3ARVA 2XP7A 1ZU8A 3TDBA 3NI6A 1GOIA 3LUOA 2XP4A 3ARZA 4W5UA 2XPBA 5HBFA 2LGOA 4ZPVR 2KE0A 1P5QA 4GGQA 4Q7NA 1FFQA 5DEZA 4L3NA 3ARXA 1L1PA 4W9QA 2ZQVA 1E6ZA 4DRMA 2LJ4A 2RQSA 4MPKA 2PV1A 2XP3A 4URIA 1EIBA 4GIVA 2MNTA 3B9EA 1GPFA 4LAXA 1EYMA 3WD3A 3KAHA 2WLZA 1JVWA 3O5MA 1Q6HA 1XHGA 1JNEA 1W9UA 1PINA 3CH9A 4HBOA 3O5OA 4WJXA 4Z2LA 3RM8A 3IK8A 1HXVA 1Q6IA 1Q6UA 4PTMA 3CZ8A 1FKLA 1N1AA 2XP9A 1W9VA 3WD4A 4W9PA 1ZB5A 5D75A 1HKMA 3QOKA 5HW6A 3WQVA 5HT1A 3ARWA 2RURA 3KCEA 4LAVA 1E15A 2OLHA 3WL1A 1FKKA 2N87A 5HW7A 2L2SA 4AY1A 5BXJA 1XRVA 3JYJA 4FAPA 2IUZA 4NNRA 3O5IA 3WD2A 2FAPA 4WKHA 3PRBA 3ARPA 3MDYB 2LKNA 2PBCA 3KACA 1BKFA 4ODNA 3B9DA 4G50A 2M08A 4WIWA 2DT1A 2WLYA 3CHFA 4R5EA 2DG4A 3O5LA 3CHCA 1ITXA 3O5PA 4ODOA 1ZBCA 4DIPA 3WQWA 3JYMA 1JNDA 2B31A 2PPNA 4ZPWR 1IX5A 3KADA 2ITKA 3H9RB 4TW7A 2DG9A 1TFVA 2D9FA 5HW8A 1EQ3A 2K8IA 3WKZA 1HJXA 2MPHA 3FAPA 3IKDA 5HWCA 1EDQA 5B8IC 4DWSA 3WL0A 2RUQA 4DRHA 1K9TA 4G2PA 4MTVA 4WKFA 1NWRA 1D6OA 1FKBA 3O5EA 1E9LA 2KO7A 3WH0A 4NZCA 1JNSA 1A7XA 4MNLA 2MF9A 2KI3A 2DPEA 4Q22A 4MNKA 3RM4A 1FKSA 4TW8A 1E6RA 1H0IA 1J4RA 4WK9A 3AROA 3IHZA 4ODQA 4FN2A 5GPRA 1HKIA 1NMWA 4DWSC 1J4HA 1ROUA 4DRIA 3KABA 4QIBA 4ZS6A 1J4IA 1O6IA 3UQIA 1RD6A 1NMVA 3VAWA 3PRAA 1HJVA 1LG1A 4O2TA 1F8AB 4QT3A 1C9HA 4QZVB 4DWSB 3PRDA 4DRQA 4HARA 1J6YA 3WD0A 5HWBA 1NWUA 1NH6A 3G6LA 2G8ZA 1FAPA 3RFWA 3ARTA 1QZ2A 4DRPA 2UZ5A 1M5YA 1LG2A 3I6CA 3UQBA 2JZVA 2PPOA 3B9AA 3UF8A 1FD9A 4IQCA 3KAFA 2RUDA 4P8VA 1Y0OA 3CGNA 2YBUA 1SYTA 4NSBA 4TX0A 1BL4A 1QPLA 1ZBVA 4U85A 2DSZA 4DH0A 1NWSA 2XP5A 2PPPA 5HKGA 3B8SA 2DSVA 4ODLA 3ARUA 2RSEA 2QF8A 1W1YA 4KR0B 4Z2IA 3KAGA 1H0GA 1ZL1A 1JNTA 1D7HA 2G41A 4JFJA 4DWSD 1OGGA 1U79A 4N19A 1FFRA 1X6LA 3O5DA 4DROA 2F2DA 3AS3A 2IF4A 2F21A 5DITA 3AS2A 1LL7A 4Z2HA 1ZBKA 2DT0A 4ODRA 4C02B 1B6CA 1FJDA 3ALGA 4LGXA 3BXWA 1LL4A 4HBEA 1FKDA 4U86A 5GPGA 2ZQUA 1W1TA 2VN1A 3PR9A 3EY6A 3GPKA 3O5KA 4ODMA 1LQ0A 1WAWA 1X6NA 1VF8A 2ZQSA 1D7IA 3O5GA 4ODKA 1E6NA 4DZ2A 1WNOA 1ZCNA 2AWGA 4U84A 3AQUA 3O5QA 3ARYA 5J6EA 1FKJA 1FKRA 4LAWA 4Z2GA 2XP6A 4TYOA 1FKHA 2KFWA 2FKEA 3RMEA 1UR9A 4L72B 1KFWA 2O92A 2M2AA 2FDMA 2XPAA 3KZ7A 5HTGA 4DRNA 4LAYA 1NWTA 2OFNA 3RGCA 2XP8A 1FKGA 2RUCA 1GUVA 2DG3A 4JFIA 2PV2A 4BF8A 1WB0A 2DT3A 3ALFA 1LJYA 2A3AA 4P8UA 4W9OA 1TCOC 1KT1A 2A3EA 1W1PA 1EHNA 4IPXA 4WKAA 5I98A 4MSPA 1W1VA 1ZK6A 4MNMA 2ZR6A 3UQAA 3OOBA 1NSGA 3UI6A 1OGBA 4JFLA 3FY1A 4DT4A 2MLXA 3ARSA 2VCDA 4IT4A 2DSUA 5GQBA 3W4RA 2KGJA 4S3JA 2M1IA 4KQZA 4JFMA 2AOSA 4P8WA 2KR7A 3AS1A 1FKFA 3NTPA 1OWQA 4ZPTR 5DIUA 1CTNA 4P8XA 4ITZA 1R9HA 2DSWA 2Y78A 4Z2KA 1KT0A 3RM9A 4J4OA 4DZ3A 1ROTA 3OA5A 1W26A 2PV3A 1T11A 4MGVA 2MLZA 2ZR5A 3CHEA 2PI6A 2WK2A 1PBKA 4TW6A 3ARQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NMW A;  3O5O A;  1J4H A;  1ROU A;  2F4E A;  4DRI A;  3KAB A;  4QIB A;  4R0X A;  1J4I A;  2ZQS A;  3IK8 A;  1FKI A;  1Q6I A;  1HXV A;  1D7I A;  1Q6U A;  3O5G A;  4ODK A;  3UQI A;  5DIV A;  2ZR4 A;  1NMV A;  3VAW A;  1FKL A;  3B7X A;  1ZCN A;  2AWG A;  4DZ2 A;  1N1A A;  2XP9 A;  4U84 A;  3O5Q A;  3O5J A;  4O2T A;  4JFK A;  1F8A B;  5J6E A;  1FKJ A;  4QT3 A;  4JYS A;  4W9P A;  1C9H A;  4LAW A;  4ODP A;  5D75 A;  4DRK A;  1FKR A;  2XP6 A;  3TC5 A;  1FKT A;  3UI4 A;  4TYO A;  1FKH A;  2KFW A;  2FKE A;  3O5F A;  4QT2 A;  5HW6 A;  3PRD A;  2LPV A;  4IQ2 A;  5HT1 A;  4DRQ A;  3IKG A;  1J6Y A;  3UQB A;  2RUR A;  3KCE A;  4LAV A;  5HWB A;  2M2A A;  1D7J A;  2XPA A;  3KZ7 A;  5HTG A;  3PA7 A;  4DRN A;  4LAY A;  3CGM A;  3ODK A;  1FKK A;  1FAP A;  3RFW A;  2N87 A;  1QZ2 A;  4DRP A;  1YW5 A;  5HW7 A;  2L2S A;  2UZ5 A;  5BXJ A;  3JYJ A;  2OFN A;  3RGC A;  4FAP A;  1M5Y A;  3I6C A;  3O5I A;  2XP8 A;  1FKG A;  2JZV A;  2FAP A;  2RUC A;  3JXV A;  2PPO A;  3O5R A;  2DG3 A;  2PV2 A;  4J4N A;  4JFI A;  3UF8 A;  1FD9 A;  1Q1C A;  2Q5A A;  3KAF A;  3PRB A;  4IQC A;  3MDY B;  2RUD A;  3UI5 A;  4BF8 A;  2LKN A;  1Y0O A;  2PBC A;  3KAC A;  1F40 A;  1BKF A;  4TNS A;  3CGN A;  4ODN A;  4G50 A;  2M08 A;  2ZQT A;  4W9O A;  1TCO C;  2DG4 A;  3O5L A;  4TX0 A;  1KT1 A;  3TCZ A;  1BL4 A;  3O5P A;  4ODO A;  4IPX A;  4DIP A;  1QPL A;  1YAT A;  4U85 A;  3JYM A;  2PPN A;  5I98 A;  3NRK A;  5HUA A;  4MSP A;  1ZK6 A;  3KAD A;  4DH0 A;  2ITK A;  2XP5 A;  2ZR6 A;  3KAI A;  2PPP A;  4DRJ A;  3OOB A;  3UQA A;  5HKG A;  1NSG A;  3H9R B;  1QPF A;  4TW7 A;  2MLY A;  4ODL A;  3UI6 A;  4JFL A;  2RSE A;  4DT4 A;  2DG9 A;  2XP7 A;  3TDB A;  2MLX A;  3NI6 A;  2VCD A;  2D9F A;  3KAG A;  3LUO A;  2KGJ A;  4C02 B;  2M1I A;  5HW8 A;  2XP4 A;  1JNT A;  1D7H A;  4JFM A;  1EQ3 A;  4JFJ A;  2XPB A;  2KR7 A;  2K8I A;  1FKF A;  2LGO A;  1U79 A;  3NTP A;  2KE0 A;  4N19 A;  2MPH A;  3FAP A;  3IKD A;  3O5D A;  1P5Q A;  2F2D A;  4GGQ A;  5DIU A;  2IF4 A;  4DRO A;  5HWC A;  2F21 A;  4ITZ A;  5B8I C;  1R9H A;  2RUQ A;  5DIT A;  4DRH A;  2Y78 A;  1L1P A;  4W9Q A;  1KT0 A;  4G2P A;  2ZQV A;  4J4O A;  4DRM A;  4ODR A;  1D6O A;  1FKB A;  3O5E A;  2LJ4 A;  2KO7 A;  1B6C A;  2RQS A;  1ROT A;  3WH0 A;  4DZ3 A;  1W26 A;  1FJD A;  2PV1 A;  2XP3 A;  2PV3 A;  1T11 A;  2MNT A;  4GIV A;  4LAX A;  1A7X A;  1EYM A;  4MGV A;  2MLZ A;  1JNS A;  2ZR5 A;  2MF9 A;  1FKD A;  2KI3 A;  4U86 A;  5GPG A;  3KAH A;  1JVW A;  4NNR A;  2ZQU A;  3O5M A;  2VN1 A;  1FKS A;  1Q6H A;  3EY6 A;  3GPK A;  1PBK A;  4TW8 A;  3O5K A;  1J4R A;  4ODM A;  1PIN A;  3IHZ A;  4ODQ A;  4FN2 A;  4TW6 A; 
#chains in the Genus database with same CATH topology
 3BMB A;  2F4E A;  4Z2J A;  4R0X A;  1HKK A;  1FKI A;  5DIV A;  2ZR4 A;  3B7X A;  2A3B A;  3ARR A;  3O5J A;  4JFK A;  4JYS A;  1D2K A;  4ODP A;  4DRK A;  3TC5 A;  1FKT A;  3UI4 A;  3O5F A;  4QT2 A;  4XAK A;  5DO2 A;  3CHD A;  2A3C A;  2LPV A;  4IQ2 A;  3WIJ A;  2ESC A;  3IKG A;  1W9P A;  1D7J A;  3PA7 A;  2PN0 A;  3CGM A;  3ODK A;  1YW5 A;  4S3K A;  4IT6 A;  3JXV A;  4J4N A;  5JH8 A;  3O5R A;  1Q1C A;  2Q5A A;  3UI5 A;  3G6M A;  1F40 A;  1HKJ A;  4TNS A;  2ZQT A;  4MAV A;  1ZBW A;  1HJW A;  3TCZ A;  1E6P A;  2DT2 A;  1SR0 A;  1YAT A;  3FXY A;  2O9O A;  3NRK A;  5HUA A;  1LL6 A;  3AS0 A;  3KAI A;  4DRJ A;  3WD1 A;  1QPF A;  2WM0 A;  2MLY A;  4MNJ A;  1UR8 A;  5DF0 A;  4ML4 A;  2YBT A;  3ARV A;  2XP7 A;  1ZU8 A;  3TDB A;  3NI6 A;  1GOI A;  3LUO A;  2XP4 A;  3ARZ A;  4W5U A;  2XPB A;  5HBF A;  2LGO A;  4ZPV R;  2KE0 A;  1P5Q A;  4GGQ A;  4Q7N A;  1FFQ A;  5DEZ A;  4L3N A;  3ARX A;  1L1P A;  4W9Q A;  2ZQV A;  1E6Z A;  4DRM A;  2LJ4 A;  2RQS A;  4MPK A;  2PV1 A;  2XP3 A;  4URI A;  1EIB A;  4GIV A;  2MNT A;  3B9E A;  1GPF A;  4LAX A;  1EYM A;  3WD3 A;  3KAH A;  2WLZ A;  1JVW A;  2ETN A;  3O5M A;  1Q6H A;  1XHG A;  1JNE A;  1W9U A;  1PIN A;  3CH9 A;  4HBO A;  3O5O A;  4WJX A;  4Z2L A;  3RM8 A;  3IK8 A;  1HXV A;  1Q6I A;  1Q6U A;  4PTM A;  3CZ8 A;  1FKL A;  1N1A A;  2XP9 A;  1W9V A;  3WD4 A;  4W9P A;  1ZB5 A;  5D75 A;  1GRJ A;  1HKM A;  3QOK A;  5HW6 A;  3WQV A;  5HT1 A;  3ARW A;  2RUR A;  3KCE A;  4LAV A;  1E15 A;  2OLH A;  3WL1 A;  1FKK A;  2N87 A;  5HW7 A;  2L2S A;  4AY1 A;  5BXJ A;  1XRV A;  3JYJ A;  4FAP A;  2IUZ A;  4NNR A;  3O5I A;  3WD2 A;  2FAP A;  4WKH A;  3PRB A;  3ARP A;  3MDY B;  2LKN A;  2PBC A;  3KAC A;  1E44 A;  1BKF A;  4ODN A;  3B9D A;  4G50 A;  2M08 A;  4WIW A;  2DT1 A;  2WLY A;  3CHF A;  4R5E A;  2DG4 A;  3O5L A;  3CHC A;  1ITX A;  3O5P A;  4ODO A;  1ZBC A;  4DIP A;  3WQW A;  3JYM A;  1JND A;  2B31 A;  2PPN A;  4ZPW R;  1IX5 A;  3KAD A;  2ITK A;  3H9R B;  4TW7 A;  2DG9 A;  1TFV A;  2D9F A;  2EUL A;  5HW8 A;  2F23 A;  1EQ3 A;  2K8I A;  3WKZ A;  1HJX A;  2MPH A;  3FAP A;  3IKD A;  5HWC A;  1EDQ A;  5B8I C;  4DWS A;  3WL0 A;  2RUQ A;  3GU0 A;  4DRH A;  1K9T A;  4G2P A;  4MTV A;  4WKF A;  1NWR A;  1D6O A;  1FKB A;  3O5E A;  1E9L A;  2KO7 A;  3WH0 A;  4NZC A;  1JNS A;  1A7X A;  4MNL A;  2MF9 A;  2KI3 A;  2DPE A;  4Q22 A;  4MNK A;  3RM4 A;  1FKS A;  4TW8 A;  1E6R A;  1H0I A;  1J4R A;  4WK9 A;  3ARO A;  3IHZ A;  4ODQ A;  4FN2 A;  5GPR A;  1HKI A;  1NMW A;  4DWS C;  1J4H A;  1ROU A;  4DRI A;  3KAB A;  4QIB A;  4ZS6 A;  1J4I A;  1O6I A;  3UQI A;  1RD6 A;  1NMV A;  3VAW A;  3PRA A;  1HJV A;  1LG1 A;  4O2T A;  1F8A B;  4QT3 A;  1C9H A;  4QZV B;  1JCH B;  3EIP A;  4DWS B;  3PRD A;  4DRQ A;  4HAR A;  1J6Y A;  3WD0 A;  5HWB A;  1NWU A;  1NH6 A;  3G6L A;  2G8Z A;  1FAP A;  3RFW A;  3ART A;  1QZ2 A;  4DRP A;  2UZ5 A;  1M5Y A;  1LG2 A;  3I6C A;  3UQB A;  2JZV A;  2PPO A;  3B9A A;  3UF8 A;  1FD9 A;  4IQC A;  3KAF A;  2RUD A;  4P8V A;  1Y0O A;  3CGN A;  2YBU A;  1SYT A;  4NSB A;  4TX0 A;  1BL4 A;  1QPL A;  1ZBV A;  4U85 A;  2DSZ A;  4DH0 A;  1NWS A;  2XP5 A;  2PPP A;  5HKG A;  3B8S A;  2DSV A;  4ODL A;  3ARU A;  2RSE A;  2QF8 A;  1W1Y A;  4KR0 B;  4Z2I A;  3KAG A;  1H0G A;  1ZL1 A;  1JNT A;  1D7H A;  2G41 A;  4JFJ A;  4DWS D;  1OGG A;  1U79 A;  4N19 A;  1FFR A;  1X6L A;  3O5D A;  4DRO A;  2F2D A;  3AS3 A;  2IF4 A;  2F21 A;  5DIT A;  3AS2 A;  1LL7 A;  4Z2H A;  1ZBK A;  2DT0 A;  4ODR A;  4C02 B;  1B6C A;  1FJD A;  3ALG A;  4LGX A;  3BXW A;  1LL4 A;  4HBE A;  1FKD A;  4U86 A;  5GPG A;  2ZQU A;  1W1T A;  2VN1 A;  3PR9 A;  3EY6 A;  3GPK A;  3O5K A;  4ODM A;  1LQ0 A;  1WAW A;  1X6N A;  1VF8 A;  2ZQS A;  1D7I A;  3O5G A;  4ODK A;  1E6N A;  4DZ2 A;  1WNO A;  1ZCN A;  2AWG A;  4U84 A;  3AQU A;  2B5U B;  3O5Q A;  3ARY A;  5J6E A;  1FKJ A;  1FKR A;  4LAW A;  4Z2G A;  2XP6 A;  4TYO A;  1FKH A;  2KFW A;  2FKE A;  3RME A;  1UR9 A;  4L72 B;  1KFW A;  2O92 A;  2M2A A;  2FDM A;  2XPA A;  3KZ7 A;  5HTG A;  4DRN A;  4LAY A;  1NWT A;  2OFN A;  3RGC A;  2XP8 A;  1FKG A;  2RUC A;  1GUV A;  2DG3 A;  2PV2 A;  4JFI A;  4BF8 A;  1WB0 A;  2DT3 A;  3ALF A;  1LJY A;  2A3A A;  4P8U A;  4W9O A;  1TCO C;  1KT1 A;  2A3E A;  1W1P A;  1EHN A;  4IPX A;  2P4V A;  4WKA A;  5I98 A;  4MSP A;  1W1V A;  1ZK6 A;  4MNM A;  2ZR6 A;  3UQA A;  3OOB A;  1NSG A;  3UI6 A;  1OGB A;  4JFL A;  3FY1 A;  4DT4 A;  2MLX A;  3ARS A;  2VCD A;  4IT4 A;  2DSU A;  5GQB A;  3W4R A;  2KGJ A;  4S3J A;  2M1I A;  4KQZ A;  4JFM A;  2AOS A;  4P8W A;  2KR7 A;  3AS1 A;  1FKF A;  3NTP A;  4UDM A;  1OWQ A;  4ZPT R;  5DIU A;  1CTN A;  4P8X A;  4ITZ A;  3GTY X;  1R9H A;  2DSW A;  2Y78 A;  4Z2K A;  1KT0 A;  3RM9 A;  4J4O A;  4DZ3 A;  1ROT A;  3OA5 A;  1W26 A;  2PV3 A;  1T11 A;  4MGV A;  2MLZ A;  2ZR5 A;  3CHE A;  2PI6 A;  2WK2 A;  1PBK A;  4TW6 A;  3ARQ A; 
#chains in the Genus database with same CATH homology
 2F4E A;  4Z2J A;  4R0X A;  1HKK A;  1FKI A;  5DIV A;  2ZR4 A;  3B7X A;  2A3B A;  3ARR A;  3O5J A;  4JFK A;  4JYS A;  1D2K A;  4ODP A;  4DRK A;  3TC5 A;  1FKT A;  3UI4 A;  3O5F A;  4QT2 A;  4XAK A;  5DO2 A;  3CHD A;  2A3C A;  2LPV A;  4IQ2 A;  3WIJ A;  2ESC A;  3IKG A;  1W9P A;  1D7J A;  3PA7 A;  3CGM A;  3ODK A;  1YW5 A;  4S3K A;  4IT6 A;  3JXV A;  4J4N A;  5JH8 A;  3O5R A;  1Q1C A;  2Q5A A;  3UI5 A;  3G6M A;  1F40 A;  1HKJ A;  4TNS A;  2ZQT A;  4MAV A;  1ZBW A;  1HJW A;  3TCZ A;  1E6P A;  2DT2 A;  1SR0 A;  1YAT A;  3FXY A;  2O9O A;  3NRK A;  5HUA A;  1LL6 A;  3AS0 A;  3KAI A;  4DRJ A;  3WD1 A;  1QPF A;  2WM0 A;  2MLY A;  4MNJ A;  1UR8 A;  5DF0 A;  4ML4 A;  2YBT A;  3ARV A;  2XP7 A;  1ZU8 A;  3TDB A;  3NI6 A;  1GOI A;  3LUO A;  2XP4 A;  3ARZ A;  4W5U A;  2XPB A;  5HBF A;  2LGO A;  4ZPV R;  2KE0 A;  1P5Q A;  4GGQ A;  4Q7N A;  1FFQ A;  5DEZ A;  4L3N A;  3ARX A;  1L1P A;  4W9Q A;  2ZQV A;  1E6Z A;  4DRM A;  2LJ4 A;  2RQS A;  4MPK A;  2PV1 A;  2XP3 A;  4URI A;  1EIB A;  4GIV A;  2MNT A;  3B9E A;  1GPF A;  4LAX A;  1EYM A;  3WD3 A;  3KAH A;  2WLZ A;  1JVW A;  3O5M A;  1Q6H A;  1XHG A;  1JNE A;  1W9U A;  1PIN A;  3CH9 A;  4HBO A;  3O5O A;  4WJX A;  4Z2L A;  3RM8 A;  3IK8 A;  1HXV A;  1Q6I A;  1Q6U A;  4PTM A;  3CZ8 A;  1FKL A;  1N1A A;  2XP9 A;  1W9V A;  3WD4 A;  4W9P A;  1ZB5 A;  5D75 A;  1HKM A;  3QOK A;  5HW6 A;  3WQV A;  5HT1 A;  3ARW A;  2RUR A;  3KCE A;  4LAV A;  1E15 A;  2OLH A;  3WL1 A;  1FKK A;  2N87 A;  5HW7 A;  2L2S A;  4AY1 A;  5BXJ A;  1XRV A;  3JYJ A;  4FAP A;  2IUZ A;  4NNR A;  3O5I A;  3WD2 A;  2FAP A;  4WKH A;  3PRB A;  3ARP A;  3MDY B;  2LKN A;  2PBC A;  3KAC A;  1BKF A;  4ODN A;  3B9D A;  4G50 A;  2M08 A;  4WIW A;  2DT1 A;  2WLY A;  3CHF A;  4R5E A;  2DG4 A;  3O5L A;  3CHC A;  1ITX A;  3O5P A;  4ODO A;  1ZBC A;  4DIP A;  3WQW A;  3JYM A;  1JND A;  2B31 A;  2PPN A;  4ZPW R;  1IX5 A;  3KAD A;  2ITK A;  3H9R B;  4TW7 A;  2DG9 A;  1TFV A;  2D9F A;  5HW8 A;  1EQ3 A;  2K8I A;  3WKZ A;  1HJX A;  2MPH A;  3FAP A;  3IKD A;  5HWC A;  1EDQ A;  5B8I C;  4DWS A;  3WL0 A;  2RUQ A;  4DRH A;  1K9T A;  4G2P A;  4MTV A;  4WKF A;  1NWR A;  1D6O A;  1FKB A;  3O5E A;  1E9L A;  2KO7 A;  3WH0 A;  4NZC A;  1JNS A;  1A7X A;  4MNL A;  2MF9 A;  2KI3 A;  2DPE A;  4Q22 A;  4MNK A;  3RM4 A;  1FKS A;  4TW8 A;  1E6R A;  1H0I A;  1J4R A;  4WK9 A;  3ARO A;  3IHZ A;  4ODQ A;  4FN2 A;  5GPR A;  1HKI A;  1NMW A;  4DWS C;  1J4H A;  1ROU A;  4DRI A;  3KAB A;  4QIB A;  4ZS6 A;  1J4I A;  1O6I A;  3UQI A;  1RD6 A;  1NMV A;  3VAW A;  3PRA A;  1HJV A;  1LG1 A;  4O2T A;  1F8A B;  4QT3 A;  1C9H A;  4QZV B;  4DWS B;  3PRD A;  4DRQ A;  4HAR A;  1J6Y A;  3WD0 A;  5HWB A;  1NWU A;  1NH6 A;  3G6L A;  2G8Z A;  1FAP A;  3RFW A;  3ART A;  1QZ2 A;  4DRP A;  2UZ5 A;  1M5Y A;  1LG2 A;  3I6C A;  3UQB A;  2JZV A;  2PPO A;  3B9A A;  3UF8 A;  1FD9 A;  4IQC A;  3KAF A;  2RUD A;  4P8V A;  1Y0O A;  3CGN A;  2YBU A;  1SYT A;  4NSB A;  4TX0 A;  1BL4 A;  1QPL A;  1ZBV A;  4U85 A;  2DSZ A;  4DH0 A;  1NWS A;  2XP5 A;  2PPP A;  5HKG A;  3B8S A;  2DSV A;  4ODL A;  3ARU A;  2RSE A;  2QF8 A;  1W1Y A;  4KR0 B;  4Z2I A;  3KAG A;  1H0G A;  1ZL1 A;  1JNT A;  1D7H A;  2G41 A;  4JFJ A;  4DWS D;  1OGG A;  1U79 A;  4N19 A;  1FFR A;  1X6L A;  3O5D A;  4DRO A;  2F2D A;  3AS3 A;  2IF4 A;  2F21 A;  5DIT A;  3AS2 A;  1LL7 A;  4Z2H A;  1ZBK A;  2DT0 A;  4ODR A;  4C02 B;  1B6C A;  1FJD A;  3ALG A;  4LGX A;  3BXW A;  1LL4 A;  4HBE A;  1FKD A;  4U86 A;  5GPG A;  2ZQU A;  1W1T A;  2VN1 A;  3PR9 A;  3EY6 A;  3GPK A;  3O5K A;  4ODM A;  1LQ0 A;  1WAW A;  1X6N A;  1VF8 A;  2ZQS A;  1D7I A;  3O5G A;  4ODK A;  1E6N A;  4DZ2 A;  1WNO A;  1ZCN A;  2AWG A;  4U84 A;  3AQU A;  3O5Q A;  3ARY A;  5J6E A;  1FKJ A;  1FKR A;  4LAW A;  4Z2G A;  2XP6 A;  4TYO A;  1FKH A;  2KFW A;  2FKE A;  3RME A;  1UR9 A;  4L72 B;  1KFW A;  2O92 A;  2M2A A;  2FDM A;  2XPA A;  3KZ7 A;  5HTG A;  4DRN A;  4LAY A;  1NWT A;  2OFN A;  3RGC A;  2XP8 A;  1FKG A;  2RUC A;  1GUV A;  2DG3 A;  4JFI A;  2PV2 A;  4BF8 A;  1WB0 A;  2DT3 A;  3ALF A;  1LJY A;  2A3A A;  4P8U A;  4W9O A;  1TCO C;  1KT1 A;  2A3E A;  1W1P A;  1EHN A;  4IPX A;  4WKA A;  5I98 A;  4MSP A;  1W1V A;  1ZK6 A;  4MNM A;  2ZR6 A;  3UQA A;  3OOB A;  1NSG A;  3UI6 A;  1OGB A;  4JFL A;  3FY1 A;  4DT4 A;  2MLX A;  3ARS A;  2VCD A;  4IT4 A;  2DSU A;  5GQB A;  3W4R A;  2KGJ A;  4S3J A;  2M1I A;  4KQZ A;  4JFM A;  2AOS A;  4P8W A;  2KR7 A;  3AS1 A;  1FKF A;  3NTP A;  1OWQ A;  4ZPT R;  5DIU A;  1CTN A;  4P8X A;  4ITZ A;  1R9H A;  2DSW A;  2Y78 A;  4Z2K A;  1KT0 A;  3RM9 A;  4J4O A;  4DZ3 A;  1ROT A;  3OA5 A;  1W26 A;  2PV3 A;  1T11 A;  4MGV A;  2MLZ A;  2ZR5 A;  3CHE A;  2PI6 A;  2WK2 A;  1PBK A;  4TW6 A;  3ARQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...