1D7JA

Fkbp complexed with 4-hydroxy-2-butanone
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
publication title X-ray structures of small ligand-FKBP complexes provide an estimate for hydrophobic interaction energies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 28
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1d7jA00
1JVWA 1FKRA 4U86A 2RSEA 4TNSA 5HT1A 1ROTA 4DROA 2RUQA 1FKFA 1R9HA 2M2AA 2XP7A 1NMWA 2Q5AA 4R0XA 2ZQSA 4LAWA 1Q1CA 4TW7A 3I6CA 1EYMA 4NNRA 2LJ4A 4DRNA 2LKNA 4QT2A 4ODRA 2Y78A 4ODKA 2XP4A 2DG3A 3KACA 2PV1A 2ZR4A 3OOBA 4W9OA 4MGVA 4ODNA 3O5MA 1T11A 3TDBA 3KAIA 3UI5A 1J4IA 2KE0A 3O5EA 3UF8A 4U85A 2M08A 3NI6A 3RGCA 3EY6A 4JFKA 1FKGA 1W26A 4TW8A 2KO7A 1FKJA 2OFNA 3JYJA 2XP9A 3JXVA 3IHZA 1HXVA 3O5IA 5HTGA 1D7IA 4N19A 3MDYB 1YW5A 3GPKA 4DRIA 1BL4A 2VCDA 4FAPA 1PBKA 2D9FA 4DZ2A 3O5GA 3O5LA 2MLZA 3PRDA 3O5OA 2VN1A 1Q6UA 1QPLA 5B8IC 1PINA 5BXJA 2KR7A 2ITKA 2KI3A 2PV3A 3H9RB 4IPXA 3PA7A 2ZQVA 2PBCA 1F8AB 3FAPA 2XP5A 4JFJA 1FKIA 4LAYA 3UQAA 1D7HA 4U84A 1NMVA 4TX0A 1JNTA 1KT1A 4DRKA 1FJDA 1ZCNA 1P5QA 2DG9A 2FAPA 3O5JA 4FN2A 3JYMA 3KADA 4C02B 5I98A 1FAPA 4G2PA 4JYSA 4DRMA 5J6EA 5GPGA 4DRJA 4ODOA 4QIBA 2L2SA 2MLXA 4IQCA 4MSPA 1Q6IA 3TC5A 3UI4A 3NRKA 2N87A 1FKBA 2PPNA 1M5YA 2DG4A 1Y0OA 2F21A 3NTPA 3UQBA 2JZVA 1J6YA 1J4RA 2PV2A 3KCEA 2KGJA 1FKDA 1QZ2A 4DRPA 5HWCA 1FKHA 1NSGA 4ODMA 2KFWA 1EQ3A 3KAFA 4ODQA 3O5FA 1ZK6A 2PPPA 3PRBA 4JFLA 1L1PA 4TYOA 2FKEA 1C9HA 3O5PA 2MPHA 1F40A 3KABA 5DITA 1FKTA 2MNTA 3IK8A 4LAXA 2ZR5A 5HWBA 1FKSA 3RFWA 1B6CA 1FKKA 1U79A 2MLYA 4DRQA 3KAHA 3LUOA 3IKGA 4JFMA 4TW6A 5D75A 4DIPA 4DRHA 3O5KA 2M1IA 1BKFA 2PPOA 3WH0A 3UQIA 1FKLA 4J4OA 2XP8A 4ODLA 1JNSA 2XPBA 4GIVA 1J4HA 5HW7A 1KT0A 2F4EA 2ZQTA 2K8IA 1FD9A 3TCZA 2UZ5A 4J4NA 5HKGA 3KZ7A 2RQSA 4W9QA 5HW6A 1A7XA 1Q6HA 4IQ2A 3VAWA 3O5RA 1D7JA 4ODPA 2RURA 4DZ3A 1QPFA 4O2TA 3CGNA 2XP3A 3IKDA 2LGOA 4QT3A 2ZR6A 1YATA 2AWGA 4W9PA 1D6OA 4DH0A 2IF4A 3KAGA 2ZQUA 2RUCA 2XP6A 3O5DA 4JFIA 5DIVA 2MF9A 3O5QA 1N1AA 3B7XA 4GGQA 2RUDA 4ITZA 4LAVA 3UI6A 2F2DA 3ODKA 5DIUA 4G50A 1ROUA 4BF8A 2LPVA 3CGMA 4DT4A 5HW8A 1TCOC 5HUAA 2XPAA
chains in the Genus database with same CATH superfamily
1FKRA 4U86A 4TNSA 4QZVB 2DPEA 5JH8A 4DWSC 2LJ4A 2ZR4A 3KAIA 3UI5A 1J4IA 1W9UA 3O5EA 4UDMA 3UF8A 2A3AA 3NI6A 3RGCA 1W26A 4TW8A 1FFQA 2A3BA 3CHDA 3JXVA 4DWSA 4W5UA 1HKKA 3ARZA 1E6ZA 1K9TA 3MDYB 1YW5A 3RM8A 4DRIA 2VCDA 4FAPA 3BMBA 2D9FA 3O5GA 3O5LA 3O5OA 1QPLA 1PINA 3H9RB 4IPXA 3WL0A 2WM0A 3FAPA 2XP5A 2DSVA 1E44A 1ITXA 1W9PA 4DRKA 4DRMA 4WJXA 3TC5A 1KFWA 1SR0A 1J4RA 2KGJA 1XHGA 3GU0A 3WD0A 2G8ZA 4DRPA 4ZS6A 4Z2GA 1EQ3A 2PN0A 2AOSA 2MPHA 4DWSB 3IK8A 3ARXA 2WLYA 3KAHA 5D75A 4JFMA 4DIPA 2P4VA 4S3KA 4Z2IA 4KQZA 1GRJA 1ZU8A 4KR0B 2WK2A 2XPBA 1IX5A 2YBTA 2A3CA 2UZ5A 1CTNA 2RQSA 3KZ7A 3O5RA 1HJVA 2LGOA 1LL4A 2B5UB 3O5QA 4GGQA 1NH6A 2F2DA 5DIUA 5HW8A 4BF8A 2DT1A 2ZQVA 4WKFA 4DRJA 1JVWA 4R0XA 2M2AA 3ALFA 5DF0A 2ZQSA 4LAWA 1Q1CA 3AS3A 1GOIA 1FFRA 4NNRA 4NZCA 4QT2A 4ODRA 1LG1A 1W1YA 4ODNA 2KE0A 1EIBA 2QF8A 4U85A 4HBOA 1W9VA 1FKJA 2OFNA 3JYJA 1TFVA 1HXVA 5HTGA 1D7IA 2ETNA 1WAWA 2OLHA 3GPKA 1PBKA 4DZ2A 1OGGA 3B8SA 2O9OA 2O92A 1ZBKA 1LG2A 1WB0A 2EULA 4LAYA 3UQAA 1JNTA 1FJDA 3WL1A 4FN2A 1FAPA 1D2KA 4ODOA 4IQCA 3EIPA 1LQ0A 1Q6IA 3NRKA 3W4RA 1OGBA 2F21A 3AS1A 4WKAA 2A3EA 2JZVA 1J6YA 3B9AA 1FKHA 1NSGA 4ODMA 4P8UA 3KAFA 4ODQA 1ZK6A 2PPPA 3PRBA 4JFLA 1L1PA 1NWUA 1C9HA 3WIJA 1ZB5A 3RFWA 1U79A 1HKMA 3GTYX 3WH0A 1W1PA 1JNEA 4L72B 4P8XA 1J4HA 1LL7A 3FXYA 5HW7A 2ZQTA 2K8IA 4J4NA 4W9QA 5HW6A 4IQ2A 1Q6HA 4ODPA 2RURA 3CGNA 2XP3A 1HJWA 1YATA 4MNLA 1D6OA 4W9PA 3KAGA 2ZQUA 3O5DA 5DIVA 2MF9A 2FDMA 4Q7NA 4LAVA 3UI6A 4ZPTR 4P8WA 4Z2JA 3ODKA 4DT4A 3TDBA 2DSUA 2RSEA 5HT1A 4MNMA 1UR8A 1R9HA 3ARSA 2Q5AA 3WD3A 3FY1A 1EDQA 3ARTA 4L3NA 4TW7A 3B9DA 1EYMA 2LKNA 1JNDA 3CZ8A 4W9OA 2PV1A 3OOBA 4MGVA 1T11A 4Z2KA 2IUZA 3G6MA 2M08A 3EY6A 4S3JA 3ARUA 1H0GA 4ZPVR 2ESCA 2XP9A 3IHZA 3O5IA 4WKHA 4N19A 4LGXA 1BL4A 2F23A 2MLZA 5B8IC 2KR7A 2DT0A 1F8AB 3PR9A 4JFJA 3RM9A 4MNJA 1D7HA 1GUVA 1ZL1A 1E6NA 4TX0A 1SYTA 1KT1A 1ZCNA 1P5QA 2DG9A 3O5JA 4C02B 5J6EA 5GPGA 4HBEA 2L2SA 2MLXA 1FKBA 3B9EA 2PPNA 1M5YA 1LJYA 2DG4A 1XRVA 2PV2A 3ARYA 1HJXA 1QZ2A 5DO2A 5HWCA 2KFWA 3PRAA 4Z2LA 2FKEA 3O5PA 1FKTA 4LAXA 1OWQA 1FKKA 2MLYA 4DRQA 3LUOA 4R5EA 3IKGA 4DRHA 3G6LA 3O5KA 4MTVA 3WD4A 4J4OA 1NWRA 1X6NA 4WK9A 3CHFA 4GIVA 4DWSD 3TCZA 5HKGA 4WIWA 1A7XA 5DEZA 1D7JA 5GPRA 1QPFA 4O2TA 5HBFA 3IKDA 4QT3A 1E9LA 3AS0A 2ZR6A 4URIA 2G41A 1LL6A 4DH0A 2XP6A 1NWSA 2B31A 3WD1A 1N1AA 3B7XA 2RUDA 4PTMA 1ROUA 5HUAA 2LPVA 3KABA 3CGMA 1TCOC 3KADA 1E15A 3RM4A 4IT6A 4MAVA 4AY1A 4P8VA 3WQVA 1HKIA 3AS2A 1ROTA 4DROA 4XAKA 2RUQA 1FKFA 2XP7A 1NMWA 1E6RA 4MNKA 2PI6A 3I6CA 1GPFA 4DRNA 3CHCA 3ALGA 4NSBA 2Y78A 4ODKA 2XP4A 2DG3A 3KACA 3WKZA 3O5MA 3ARRA 1H0IA 2WLZA 4JFKA 1FKGA 2KO7A 1VF8A 1UR9A 1E6PA 2DSWA 3RMEA 3PRDA 3QOKA 2VN1A 1Q6UA 3ARPA 5BXJA 2ITKA 2KI3A 2PV3A 3CH9A 3PA7A 2PBCA 3OA5A 4Q22A 1FKIA 1O6IA 4IT4A 4U84A 1NMVA 4HARA 3WQWA 3BXWA 3AROA 2FAPA 3JYMA 5I98A 5GQBA 4G2PA 4JYSA 4QIBA 4MSPA 3UI4A 2N87A 1Y0OA 1W1VA 3NTPA 3UQBA 1X6LA 3KCEA 1ZBWA 1FKDA 3O5FA 1NWTA 4TYOA 2DT3A 1F40A 5DITA 1JCHB 2MNTA 2YBUA 3ARVA 2ZR5A 5HWBA 1FKSA 1B6CA 4Z2HA 4TW6A 3WD2A 2M1IA 2DT2A 1BKFA 2PPOA 3UQIA 1FKLA 3ARWA 1ZBCA 2XP8A 4ODLA 1JNSA 1ZBVA 3AQUA 1EHNA 4ML4A 1KT0A 2F4EA 4MPKA 1FD9A 1WNOA 2DSZA 3VAWA 4DZ3A 1RD6A 4ZPWR 2AWGA 2IF4A 2RUCA 1W1TA 4JFIA 1HKJA 4ITZA 3CHEA 4G50A 3ARQA 2XPAA
chains in the Genus database with same CATH topology
1FKRA 4U86A 4TNSA 4QZVB 2DPEA 5JH8A 4DWSC 2LJ4A 2ZR4A 3KAIA 3UI5A 1J4IA 1W9UA 3O5EA 3UF8A 2A3AA 3NI6A 3RGCA 1W26A 4TW8A 1FFQA 2A3BA 3CHDA 3JXVA 4DWSA 4W5UA 1HKKA 3ARZA 1E6ZA 1K9TA 3MDYB 1YW5A 3RM8A 4DRIA 2VCDA 4FAPA 2D9FA 3O5GA 3O5LA 3O5OA 1QPLA 1PINA 3H9RB 4IPXA 3WL0A 2WM0A 3FAPA 2XP5A 2DSVA 1ITXA 1W9PA 4DRKA 4DRMA 4WJXA 3TC5A 1KFWA 1SR0A 1J4RA 2KGJA 1XHGA 3WD0A 2G8ZA 4DRPA 4ZS6A 4Z2GA 1EQ3A 2AOSA 2MPHA 4DWSB 3IK8A 3ARXA 2WLYA 3KAHA 5D75A 4JFMA 4DIPA 4S3KA 4Z2IA 4KQZA 1ZU8A 4KR0B 2WK2A 2XPBA 1IX5A 2YBTA 2A3CA 2UZ5A 1CTNA 2RQSA 3KZ7A 3O5RA 1HJVA 2LGOA 1LL4A 3O5QA 4GGQA 1NH6A 2F2DA 5DIUA 5HW8A 4BF8A 2DT1A 2ZQVA 4WKFA 4DRJA 1JVWA 4R0XA 2M2AA 3ALFA 5DF0A 2ZQSA 4LAWA 1Q1CA 3AS3A 1GOIA 1FFRA 4NNRA 4NZCA 4QT2A 4ODRA 1LG1A 1W1YA 4ODNA 2KE0A 1EIBA 2QF8A 4U85A 4HBOA 1W9VA 1FKJA 2OFNA 3JYJA 1TFVA 1HXVA 5HTGA 1D7IA 1WAWA 2OLHA 3GPKA 1PBKA 4DZ2A 1OGGA 3B8SA 2O9OA 2O92A 1ZBKA 1LG2A 1WB0A 4LAYA 3UQAA 1JNTA 1FJDA 3WL1A 4FN2A 1FAPA 1D2KA 4ODOA 4IQCA 1LQ0A 1Q6IA 3NRKA 3W4RA 1OGBA 2F21A 3AS1A 4WKAA 2A3EA 2JZVA 1J6YA 3B9AA 1FKHA 1NSGA 4ODMA 4P8UA 3KAFA 4ODQA 1ZK6A 2PPPA 3PRBA 4JFLA 1L1PA 1NWUA 1C9HA 3WIJA 1ZB5A 3RFWA 1U79A 1HKMA 3WH0A 1W1PA 1JNEA 4L72B 4P8XA 1J4HA 1LL7A 3FXYA 5HW7A 2ZQTA 2K8IA 4J4NA 4W9QA 5HW6A 4IQ2A 1Q6HA 4ODPA 2RURA 3CGNA 2XP3A 1HJWA 1YATA 4MNLA 1D6OA 4W9PA 3KAGA 2ZQUA 3O5DA 5DIVA 2MF9A 2FDMA 4Q7NA 4LAVA 3UI6A 4ZPTR 4P8WA 4Z2JA 3ODKA 4DT4A 3TDBA 2DSUA 2RSEA 5HT1A 4MNMA 1UR8A 1R9HA 3ARSA 2Q5AA 3WD3A 3FY1A 1EDQA 3ARTA 4L3NA 4TW7A 3B9DA 1EYMA 2LKNA 1JNDA 3CZ8A 4W9OA 2PV1A 3OOBA 4MGVA 1T11A 4Z2KA 2IUZA 3G6MA 2M08A 3EY6A 4S3JA 3ARUA 1H0GA 4ZPVR 2ESCA 2XP9A 3IHZA 3O5IA 4WKHA 4N19A 4LGXA 1BL4A 2MLZA 5B8IC 2KR7A 2DT0A 1F8AB 3PR9A 4JFJA 3RM9A 4MNJA 1D7HA 1GUVA 1ZL1A 1E6NA 4TX0A 1SYTA 1KT1A 1ZCNA 1P5QA 2DG9A 3O5JA 4C02B 5J6EA 5GPGA 4HBEA 2L2SA 2MLXA 1FKBA 3B9EA 2PPNA 1M5YA 1LJYA 2DG4A 1XRVA 2PV2A 3ARYA 1HJXA 1QZ2A 5DO2A 5HWCA 2KFWA 3PRAA 4Z2LA 2FKEA 3O5PA 1FKTA 4LAXA 1OWQA 1FKKA 2MLYA 4DRQA 3LUOA 4R5EA 3IKGA 4DRHA 3G6LA 3O5KA 4MTVA 3WD4A 4J4OA 1NWRA 1X6NA 4WK9A 3CHFA 4GIVA 4DWSD 3TCZA 5HKGA 4WIWA 1A7XA 5DEZA 1D7JA 5GPRA 1QPFA 4O2TA 5HBFA 3IKDA 4QT3A 1E9LA 3AS0A 2ZR6A 4URIA 2G41A 1LL6A 4DH0A 2XP6A 1NWSA 2B31A 3WD1A 1N1AA 3B7XA 2RUDA 4PTMA 1ROUA 5HUAA 2LPVA 3KABA 3CGMA 1TCOC 3KADA 1E15A 3RM4A 4IT6A 4MAVA 4AY1A 4P8VA 3WQVA 1HKIA 3AS2A 1ROTA 4DROA 4XAKA 2RUQA 1FKFA 2XP7A 1NMWA 1E6RA 4MNKA 2PI6A 3I6CA 1GPFA 4DRNA 3CHCA 3ALGA 4NSBA 2Y78A 4ODKA 2XP4A 2DG3A 3KACA 3WKZA 3O5MA 3ARRA 1H0IA 2WLZA 4JFKA 1FKGA 2KO7A 1VF8A 1UR9A 1E6PA 2DSWA 3RMEA 3PRDA 3QOKA 2VN1A 1Q6UA 3ARPA 5BXJA 2ITKA 2KI3A 2PV3A 3CH9A 3PA7A 2PBCA 3OA5A 4Q22A 1FKIA 1O6IA 4IT4A 4U84A 1NMVA 4HARA 3WQWA 3BXWA 3AROA 2FAPA 3JYMA 5I98A 5GQBA 4G2PA 4JYSA 4QIBA 4MSPA 3UI4A 2N87A 1Y0OA 1W1VA 3NTPA 3UQBA 1X6LA 3KCEA 1ZBWA 1FKDA 3O5FA 1NWTA 4TYOA 2DT3A 1F40A 5DITA 2MNTA 2YBUA 3ARVA 2ZR5A 5HWBA 1FKSA 1B6CA 4Z2HA 4TW6A 3WD2A 2M1IA 2DT2A 1BKFA 2PPOA 3UQIA 1FKLA 3ARWA 1ZBCA 2XP8A 4ODLA 1JNSA 1ZBVA 3AQUA 1EHNA 4ML4A 1KT0A 2F4EA 4MPKA 1FD9A 1WNOA 2DSZA 3VAWA 4DZ3A 1RD6A 4ZPWR 2AWGA 2IF4A 2RUCA 1W1TA 4JFIA 1HKJA 4ITZA 3CHEA 4G50A 3ARQA 2XPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVW A;  1FKR A;  4U86 A;  2RSE A;  4TNS A;  5HT1 A;  1ROT A;  4DRO A;  2RUQ A;  1FKF A;  1R9H A;  2M2A A;  2XP7 A;  1NMW A;  2Q5A A;  4R0X A;  2ZQS A;  4LAW A;  1Q1C A;  4TW7 A;  3I6C A;  1EYM A;  4NNR A;  2LJ4 A;  4DRN A;  2LKN A;  4QT2 A;  4ODR A;  2Y78 A;  4ODK A;  2XP4 A;  2DG3 A;  3KAC A;  2PV1 A;  2ZR4 A;  3OOB A;  4W9O A;  4MGV A;  4ODN A;  3O5M A;  1T11 A;  3TDB A;  3KAI A;  3UI5 A;  1J4I A;  2KE0 A;  3O5E A;  3UF8 A;  4U85 A;  2M08 A;  3NI6 A;  3RGC A;  3EY6 A;  4JFK A;  1FKG A;  1W26 A;  4TW8 A;  2KO7 A;  1FKJ A;  2OFN A;  3JYJ A;  2XP9 A;  3JXV A;  3IHZ A;  1HXV A;  3O5I A;  5HTG A;  1D7I A;  4N19 A;  3MDY B;  1YW5 A;  3GPK A;  4DRI A;  1BL4 A;  2VCD A;  4FAP A;  1PBK A;  2D9F A;  4DZ2 A;  3O5G A;  3O5L A;  2MLZ A;  3PRD A;  3O5O A;  2VN1 A;  1Q6U A;  1QPL A;  5B8I C;  1PIN A;  5BXJ A;  2KR7 A;  2ITK A;  2KI3 A;  2PV3 A;  3H9R B;  4IPX A;  3PA7 A;  2ZQV A;  2PBC A;  1F8A B;  3FAP A;  2XP5 A;  4JFJ A;  1FKI A;  4LAY A;  3UQA A;  1D7H A;  4U84 A;  1NMV A;  4TX0 A;  1JNT A;  1KT1 A;  4DRK A;  1FJD A;  1ZCN A;  1P5Q A;  2DG9 A;  2FAP A;  3O5J A;  4FN2 A;  3JYM A;  3KAD A;  4C02 B;  5I98 A;  1FAP A;  4G2P A;  4JYS A;  4DRM A;  5J6E A;  5GPG A;  4DRJ A;  4ODO A;  4QIB A;  2L2S A;  2MLX A;  4IQC A;  4MSP A;  1Q6I A;  3TC5 A;  3UI4 A;  3NRK A;  2N87 A;  1FKB A;  2PPN A;  1M5Y A;  2DG4 A;  1Y0O A;  2F21 A;  3NTP A;  3UQB A;  2JZV A;  1J6Y A;  1J4R A;  2PV2 A;  3KCE A;  2KGJ A;  1FKD A;  1QZ2 A;  4DRP A;  5HWC A;  1FKH A;  1NSG A;  4ODM A;  2KFW A;  1EQ3 A;  3KAF A;  4ODQ A;  3O5F A;  1ZK6 A;  2PPP A;  3PRB A;  4JFL A;  1L1P A;  4TYO A;  2FKE A;  1C9H A;  3O5P A;  2MPH A;  1F40 A;  3KAB A;  5DIT A;  1FKT A;  2MNT A;  3IK8 A;  4LAX A;  2ZR5 A;  5HWB A;  1FKS A;  3RFW A;  1B6C A;  1FKK A;  1U79 A;  2MLY A;  4DRQ A;  3KAH A;  3LUO A;  3IKG A;  4JFM A;  4TW6 A;  5D75 A;  4DIP A;  4DRH A;  3O5K A;  2M1I A;  1BKF A;  2PPO A;  3WH0 A;  3UQI A;  1FKL A;  4J4O A;  2XP8 A;  4ODL A;  1JNS A;  2XPB A;  4GIV A;  1J4H A;  5HW7 A;  1KT0 A;  2F4E A;  2ZQT A;  2K8I A;  1FD9 A;  3TCZ A;  2UZ5 A;  4J4N A;  5HKG A;  3KZ7 A;  2RQS A;  4W9Q A;  5HW6 A;  1A7X A;  1Q6H A;  4IQ2 A;  3VAW A;  3O5R A;  1D7J A;  4ODP A;  2RUR A;  4DZ3 A;  1QPF A;  4O2T A;  3CGN A;  2XP3 A;  3IKD A;  2LGO A;  4QT3 A;  2ZR6 A;  1YAT A;  2AWG A;  4W9P A;  1D6O A;  4DH0 A;  2IF4 A;  3KAG A;  2ZQU A;  2RUC A;  2XP6 A;  3O5D A;  4JFI A;  5DIV A;  2MF9 A;  3O5Q A;  1N1A A;  3B7X A;  4GGQ A;  2RUD A;  4ITZ A;  4LAV A;  3UI6 A;  2F2D A;  3ODK A;  5DIU A;  4G50 A;  1ROU A;  4BF8 A;  2LPV A;  3CGM A;  4DT4 A;  5HW8 A;  1TCO C;  5HUA A;  2XPA A; 
#chains in the Genus database with same CATH topology
 1FKR A;  4U86 A;  4TNS A;  4QZV B;  2DPE A;  5JH8 A;  4DWS C;  2LJ4 A;  2ZR4 A;  3KAI A;  3UI5 A;  1J4I A;  1W9U A;  3O5E A;  4UDM A;  3UF8 A;  2A3A A;  3NI6 A;  3RGC A;  1W26 A;  4TW8 A;  1FFQ A;  2A3B A;  3CHD A;  3JXV A;  4DWS A;  4W5U A;  1HKK A;  3ARZ A;  1E6Z A;  1K9T A;  3MDY B;  1YW5 A;  3RM8 A;  4DRI A;  2VCD A;  4FAP A;  3BMB A;  2D9F A;  3O5G A;  3O5L A;  3O5O A;  1QPL A;  1PIN A;  3H9R B;  4IPX A;  3WL0 A;  2WM0 A;  3FAP A;  2XP5 A;  2DSV A;  1E44 A;  1ITX A;  1W9P A;  4DRK A;  4DRM A;  4WJX A;  3TC5 A;  1KFW A;  1SR0 A;  1J4R A;  2KGJ A;  1XHG A;  3GU0 A;  3WD0 A;  2G8Z A;  4DRP A;  4ZS6 A;  4Z2G A;  1EQ3 A;  2PN0 A;  2AOS A;  2MPH A;  4DWS B;  3IK8 A;  3ARX A;  2WLY A;  3KAH A;  5D75 A;  4JFM A;  4DIP A;  2P4V A;  4S3K A;  4Z2I A;  4KQZ A;  1GRJ A;  1ZU8 A;  4KR0 B;  2WK2 A;  2XPB A;  1IX5 A;  2YBT A;  2A3C A;  2UZ5 A;  1CTN A;  2RQS A;  3KZ7 A;  3O5R A;  1HJV A;  2LGO A;  1LL4 A;  2B5U B;  3O5Q A;  4GGQ A;  1NH6 A;  2F2D A;  5DIU A;  5HW8 A;  4BF8 A;  2DT1 A;  2ZQV A;  4WKF A;  4DRJ A;  1JVW A;  4R0X A;  2M2A A;  3ALF A;  5DF0 A;  2ZQS A;  4LAW A;  1Q1C A;  3AS3 A;  1GOI A;  1FFR A;  4NNR A;  4NZC A;  4QT2 A;  4ODR A;  1LG1 A;  1W1Y A;  4ODN A;  2KE0 A;  1EIB A;  2QF8 A;  4U85 A;  4HBO A;  1W9V A;  1FKJ A;  2OFN A;  3JYJ A;  1TFV A;  1HXV A;  5HTG A;  1D7I A;  2ETN A;  1WAW A;  2OLH A;  3GPK A;  1PBK A;  4DZ2 A;  1OGG A;  3B8S A;  2O9O A;  2O92 A;  1ZBK A;  1LG2 A;  1WB0 A;  2EUL A;  4LAY A;  3UQA A;  1JNT A;  1FJD A;  3WL1 A;  4FN2 A;  1FAP A;  1D2K A;  4ODO A;  4IQC A;  3EIP A;  1LQ0 A;  1Q6I A;  3NRK A;  3W4R A;  1OGB A;  2F21 A;  3AS1 A;  4WKA A;  2A3E A;  2JZV A;  1J6Y A;  3B9A A;  1FKH A;  1NSG A;  4ODM A;  4P8U A;  3KAF A;  4ODQ A;  1ZK6 A;  2PPP A;  3PRB A;  4JFL A;  1L1P A;  1NWU A;  1C9H A;  3WIJ A;  1ZB5 A;  3RFW A;  1U79 A;  1HKM A;  3GTY X;  3WH0 A;  1W1P A;  1JNE A;  4L72 B;  4P8X A;  1J4H A;  1LL7 A;  3FXY A;  5HW7 A;  2ZQT A;  2K8I A;  4J4N A;  4W9Q A;  5HW6 A;  4IQ2 A;  1Q6H A;  4ODP A;  2RUR A;  3CGN A;  2XP3 A;  1HJW A;  1YAT A;  4MNL A;  1D6O A;  4W9P A;  3KAG A;  2ZQU A;  3O5D A;  5DIV A;  2MF9 A;  2FDM A;  4Q7N A;  4LAV A;  3UI6 A;  4ZPT R;  4P8W A;  4Z2J A;  3ODK A;  4DT4 A;  3TDB A;  2DSU A;  2RSE A;  5HT1 A;  4MNM A;  1UR8 A;  1R9H A;  3ARS A;  2Q5A A;  3WD3 A;  3FY1 A;  1EDQ A;  3ART A;  4L3N A;  4TW7 A;  3B9D A;  1EYM A;  2LKN A;  1JND A;  3CZ8 A;  4W9O A;  2PV1 A;  3OOB A;  4MGV A;  1T11 A;  4Z2K A;  2IUZ A;  3G6M A;  2M08 A;  3EY6 A;  4S3J A;  3ARU A;  1H0G A;  4ZPV R;  2ESC A;  2XP9 A;  3IHZ A;  3O5I A;  4WKH A;  4N19 A;  4LGX A;  1BL4 A;  2F23 A;  2MLZ A;  5B8I C;  2KR7 A;  2DT0 A;  1F8A B;  3PR9 A;  4JFJ A;  3RM9 A;  4MNJ A;  1D7H A;  1GUV A;  1ZL1 A;  1E6N A;  4TX0 A;  1SYT A;  1KT1 A;  1ZCN A;  1P5Q A;  2DG9 A;  3O5J A;  4C02 B;  5J6E A;  5GPG A;  4HBE A;  2L2S A;  2MLX A;  1FKB A;  3B9E A;  2PPN A;  1M5Y A;  1LJY A;  2DG4 A;  1XRV A;  2PV2 A;  3ARY A;  1HJX A;  1QZ2 A;  5DO2 A;  5HWC A;  2KFW A;  3PRA A;  4Z2L A;  2FKE A;  3O5P A;  1FKT A;  4LAX A;  1OWQ A;  1FKK A;  2MLY A;  4DRQ A;  3LUO A;  4R5E A;  3IKG A;  4DRH A;  3G6L A;  3O5K A;  4MTV A;  3WD4 A;  4J4O A;  1NWR A;  1X6N A;  4WK9 A;  3CHF A;  4GIV A;  4DWS D;  3TCZ A;  5HKG A;  4WIW A;  1A7X A;  5DEZ A;  1D7J A;  5GPR A;  1QPF A;  4O2T A;  5HBF A;  3IKD A;  4QT3 A;  1E9L A;  3AS0 A;  2ZR6 A;  4URI A;  2G41 A;  1LL6 A;  4DH0 A;  2XP6 A;  1NWS A;  2B31 A;  3WD1 A;  1N1A A;  3B7X A;  2RUD A;  4PTM A;  1ROU A;  5HUA A;  2LPV A;  3KAB A;  3CGM A;  1TCO C;  3KAD A;  1E15 A;  3RM4 A;  4IT6 A;  4MAV A;  4AY1 A;  4P8V A;  3WQV A;  1HKI A;  3AS2 A;  1ROT A;  4DRO A;  4XAK A;  2RUQ A;  1FKF A;  2XP7 A;  1NMW A;  1E6R A;  4MNK A;  2PI6 A;  3I6C A;  1GPF A;  4DRN A;  3CHC A;  3ALG A;  4NSB A;  2Y78 A;  4ODK A;  2XP4 A;  2DG3 A;  3KAC A;  3WKZ A;  3O5M A;  3ARR A;  1H0I A;  2WLZ A;  4JFK A;  1FKG A;  2KO7 A;  1VF8 A;  1UR9 A;  1E6P A;  2DSW A;  3RME A;  3PRD A;  3QOK A;  2VN1 A;  1Q6U A;  3ARP A;  5BXJ A;  2ITK A;  2KI3 A;  2PV3 A;  3CH9 A;  3PA7 A;  2PBC A;  3OA5 A;  4Q22 A;  1FKI A;  1O6I A;  4IT4 A;  4U84 A;  1NMV A;  4HAR A;  3WQW A;  3BXW A;  3ARO A;  2FAP A;  3JYM A;  5I98 A;  5GQB A;  4G2P A;  4JYS A;  4QIB A;  4MSP A;  3UI4 A;  2N87 A;  1Y0O A;  1W1V A;  3NTP A;  3UQB A;  1X6L A;  3KCE A;  1ZBW A;  1FKD A;  3O5F A;  1NWT A;  4TYO A;  2DT3 A;  1F40 A;  5DIT A;  1JCH B;  2MNT A;  2YBU A;  3ARV A;  2ZR5 A;  5HWB A;  1FKS A;  1B6C A;  4Z2H A;  4TW6 A;  3WD2 A;  2M1I A;  2DT2 A;  1BKF A;  2PPO A;  3UQI A;  1FKL A;  3ARW A;  1ZBC A;  2XP8 A;  4ODL A;  1JNS A;  1ZBV A;  3AQU A;  1EHN A;  4ML4 A;  1KT0 A;  2F4E A;  4MPK A;  1FD9 A;  1WNO A;  2DSZ A;  3VAW A;  4DZ3 A;  1RD6 A;  4ZPW R;  2AWG A;  2IF4 A;  2RUC A;  1W1T A;  4JFI A;  1HKJ A;  4ITZ A;  3CHE A;  4G50 A;  3ARQ A;  2XPA A; 
#chains in the Genus database with same CATH homology
 1FKR A;  4U86 A;  4TNS A;  4QZV B;  2DPE A;  5JH8 A;  4DWS C;  2LJ4 A;  2ZR4 A;  3KAI A;  3UI5 A;  1J4I A;  1W9U A;  3O5E A;  3UF8 A;  2A3A A;  3NI6 A;  3RGC A;  1W26 A;  4TW8 A;  1FFQ A;  2A3B A;  3CHD A;  3JXV A;  4DWS A;  4W5U A;  1HKK A;  3ARZ A;  1E6Z A;  1K9T A;  3MDY B;  1YW5 A;  3RM8 A;  4DRI A;  2VCD A;  4FAP A;  2D9F A;  3O5G A;  3O5L A;  3O5O A;  1QPL A;  1PIN A;  3H9R B;  4IPX A;  3WL0 A;  2WM0 A;  3FAP A;  2XP5 A;  2DSV A;  1ITX A;  1W9P A;  4DRK A;  4DRM A;  4WJX A;  3TC5 A;  1KFW A;  1SR0 A;  1J4R A;  2KGJ A;  1XHG A;  3WD0 A;  2G8Z A;  4DRP A;  4ZS6 A;  4Z2G A;  1EQ3 A;  2AOS A;  2MPH A;  4DWS B;  3IK8 A;  3ARX A;  2WLY A;  3KAH A;  5D75 A;  4JFM A;  4DIP A;  4S3K A;  4Z2I A;  4KQZ A;  1ZU8 A;  4KR0 B;  2WK2 A;  2XPB A;  1IX5 A;  2YBT A;  2A3C A;  2UZ5 A;  1CTN A;  2RQS A;  3KZ7 A;  3O5R A;  1HJV A;  2LGO A;  1LL4 A;  3O5Q A;  4GGQ A;  1NH6 A;  2F2D A;  5DIU A;  5HW8 A;  4BF8 A;  2DT1 A;  2ZQV A;  4WKF A;  4DRJ A;  1JVW A;  4R0X A;  2M2A A;  3ALF A;  5DF0 A;  2ZQS A;  4LAW A;  1Q1C A;  3AS3 A;  1GOI A;  1FFR A;  4NNR A;  4NZC A;  4QT2 A;  4ODR A;  1LG1 A;  1W1Y A;  4ODN A;  2KE0 A;  1EIB A;  2QF8 A;  4U85 A;  4HBO A;  1W9V A;  1FKJ A;  2OFN A;  3JYJ A;  1TFV A;  1HXV A;  5HTG A;  1D7I A;  1WAW A;  2OLH A;  3GPK A;  1PBK A;  4DZ2 A;  1OGG A;  3B8S A;  2O9O A;  2O92 A;  1ZBK A;  1LG2 A;  1WB0 A;  4LAY A;  3UQA A;  1JNT A;  1FJD A;  3WL1 A;  4FN2 A;  1FAP A;  1D2K A;  4ODO A;  4IQC A;  1LQ0 A;  1Q6I A;  3NRK A;  3W4R A;  1OGB A;  2F21 A;  3AS1 A;  4WKA A;  2A3E A;  2JZV A;  1J6Y A;  3B9A A;  1FKH A;  1NSG A;  4ODM A;  4P8U A;  3KAF A;  4ODQ A;  1ZK6 A;  2PPP A;  3PRB A;  4JFL A;  1L1P A;  1NWU A;  1C9H A;  3WIJ A;  1ZB5 A;  3RFW A;  1U79 A;  1HKM A;  3WH0 A;  1W1P A;  1JNE A;  4L72 B;  4P8X A;  1J4H A;  1LL7 A;  3FXY A;  5HW7 A;  2ZQT A;  2K8I A;  4J4N A;  4W9Q A;  5HW6 A;  4IQ2 A;  1Q6H A;  4ODP A;  2RUR A;  3CGN A;  2XP3 A;  1HJW A;  1YAT A;  4MNL A;  1D6O A;  4W9P A;  3KAG A;  2ZQU A;  3O5D A;  5DIV A;  2MF9 A;  2FDM A;  4Q7N A;  4LAV A;  3UI6 A;  4ZPT R;  4P8W A;  4Z2J A;  3ODK A;  4DT4 A;  3TDB A;  2DSU A;  2RSE A;  5HT1 A;  4MNM A;  1UR8 A;  1R9H A;  3ARS A;  2Q5A A;  3WD3 A;  3FY1 A;  1EDQ A;  3ART A;  4L3N A;  4TW7 A;  3B9D A;  1EYM A;  2LKN A;  1JND A;  3CZ8 A;  4W9O A;  2PV1 A;  3OOB A;  4MGV A;  1T11 A;  4Z2K A;  2IUZ A;  3G6M A;  2M08 A;  3EY6 A;  4S3J A;  3ARU A;  1H0G A;  4ZPV R;  2ESC A;  2XP9 A;  3IHZ A;  3O5I A;  4WKH A;  4N19 A;  4LGX A;  1BL4 A;  2MLZ A;  5B8I C;  2KR7 A;  2DT0 A;  1F8A B;  3PR9 A;  4JFJ A;  3RM9 A;  4MNJ A;  1D7H A;  1GUV A;  1ZL1 A;  1E6N A;  4TX0 A;  1SYT A;  1KT1 A;  1ZCN A;  1P5Q A;  2DG9 A;  3O5J A;  4C02 B;  5J6E A;  5GPG A;  4HBE A;  2L2S A;  2MLX A;  1FKB A;  3B9E A;  2PPN A;  1M5Y A;  1LJY A;  2DG4 A;  1XRV A;  2PV2 A;  3ARY A;  1HJX A;  1QZ2 A;  5DO2 A;  5HWC A;  2KFW A;  3PRA A;  4Z2L A;  2FKE A;  3O5P A;  1FKT A;  4LAX A;  1OWQ A;  1FKK A;  2MLY A;  4DRQ A;  3LUO A;  4R5E A;  3IKG A;  4DRH A;  3G6L A;  3O5K A;  4MTV A;  3WD4 A;  4J4O A;  1NWR A;  1X6N A;  4WK9 A;  3CHF A;  4GIV A;  4DWS D;  3TCZ A;  5HKG A;  4WIW A;  1A7X A;  5DEZ A;  1D7J A;  5GPR A;  1QPF A;  4O2T A;  5HBF A;  3IKD A;  4QT3 A;  1E9L A;  3AS0 A;  2ZR6 A;  4URI A;  2G41 A;  1LL6 A;  4DH0 A;  2XP6 A;  1NWS A;  2B31 A;  3WD1 A;  1N1A A;  3B7X A;  2RUD A;  4PTM A;  1ROU A;  5HUA A;  2LPV A;  3KAB A;  3CGM A;  1TCO C;  3KAD A;  1E15 A;  3RM4 A;  4IT6 A;  4MAV A;  4AY1 A;  4P8V A;  3WQV A;  1HKI A;  3AS2 A;  1ROT A;  4DRO A;  4XAK A;  2RUQ A;  1FKF A;  2XP7 A;  1NMW A;  1E6R A;  4MNK A;  2PI6 A;  3I6C A;  1GPF A;  4DRN A;  3CHC A;  3ALG A;  4NSB A;  2Y78 A;  4ODK A;  2XP4 A;  2DG3 A;  3KAC A;  3WKZ A;  3O5M A;  3ARR A;  1H0I A;  2WLZ A;  4JFK A;  1FKG A;  2KO7 A;  1VF8 A;  1UR9 A;  1E6P A;  2DSW A;  3RME A;  3PRD A;  3QOK A;  2VN1 A;  1Q6U A;  3ARP A;  5BXJ A;  2ITK A;  2KI3 A;  2PV3 A;  3CH9 A;  3PA7 A;  2PBC A;  3OA5 A;  4Q22 A;  1FKI A;  1O6I A;  4IT4 A;  4U84 A;  1NMV A;  4HAR A;  3WQW A;  3BXW A;  3ARO A;  2FAP A;  3JYM A;  5I98 A;  5GQB A;  4G2P A;  4JYS A;  4QIB A;  4MSP A;  3UI4 A;  2N87 A;  1Y0O A;  1W1V A;  3NTP A;  3UQB A;  1X6L A;  3KCE A;  1ZBW A;  1FKD A;  3O5F A;  1NWT A;  4TYO A;  2DT3 A;  1F40 A;  5DIT A;  2MNT A;  2YBU A;  3ARV A;  2ZR5 A;  5HWB A;  1FKS A;  1B6C A;  4Z2H A;  4TW6 A;  3WD2 A;  2M1I A;  2DT2 A;  1BKF A;  2PPO A;  3UQI A;  1FKL A;  3ARW A;  1ZBC A;  2XP8 A;  4ODL A;  1JNS A;  1ZBV A;  3AQU A;  1EHN A;  4ML4 A;  1KT0 A;  2F4E A;  4MPK A;  1FD9 A;  1WNO A;  2DSZ A;  3VAW A;  4DZ3 A;  1RD6 A;  4ZPW R;  2AWG A;  2IF4 A;  2RUC A;  1W1T A;  4JFI A;  1HKJ A;  4ITZ A;  3CHE A;  4G50 A;  3ARQ A;  2XPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...