1N1AA

Crystal structure of the n-terminal domain of human fkbp52
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
121
Chain Sequence
APLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FKBP52
publication title Structure of the N-terminal domain of human FKBP52.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 121
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1n1aA00
2FAPA 3KAHA 3O5EA 2RQSA 4QT2A 1Q6HA 1F40A 4IQ2A 3KADA 3UI5A 2XP7A 2ZQUA 2N87A 2ITKA 1JNTA 1T11A 1YW5A 2F2DA 5HKGA 1L1PA 1Q1CA 3CGNA 3KCEA 2RSEA 2ZQVA 4ODRA 4IQCA 4JFLA 3WH0A 1J6YA 4U85A 1Q6UA 2PV2A 2AWGA 3FAPA 4DH0A 2VCDA 2XP4A 4ODKA 4JFIA 1QPLA 2MLZA 4ODLA 4TW7A 3O5FA 4MSPA 4G50A 3UQIA 1NSGA 3RGCA 3ODKA 2M2AA 4LAXA 4ODOA 2VN1A 1ZCNA 3UI4A 2RURA 3EY6A 4U84A 3KZ7A 5HT1A 1QPFA 2LKNA 4J4NA 2LJ4A 1J4RA 3KABA 1ROUA 2ZR5A 2KGJA 5DIUA 1ROTA 2PV1A 4DRHA 2DG9A 2KR7A 4BF8A 3IKDA 4MGVA 4W9PA 4DRNA 5I98A 2XP3A 1D7JA 1FJDA 5D75A 3H9RB 5DIVA 3KAGA 4G2PA 2LGOA 3LUOA 3NI6A 1A7XA 3B7XA 3O5LA 3O5MA 2PV3A 3PRBA 2Q5AA 4JFKA 5HUAA 5HW8A 1F8AB 2IF4A 2K8IA 3MDYB 2KO7A 2MLYA 2PBCA 3KAIA 3UF8A 3O5PA 1QZ2A 4IPXA 4ITZA 4U86A 4DRKA 1KT0A 1FKIA 2RUQA 3NTPA 4DRMA 2M08A 2PPPA 4TYOA 1D6OA 1FKHA 1Y0OA 3IK8A 3O5OA 4LAWA 4TNSA 2ZQSA 3UQAA 1J4HA 3O5DA 2OFNA 4GIVA 4DZ2A 5HTGA 1YATA 2UZ5A 4J4OA 4DRQA 3IHZA 4C02B 3O5RA 4NNRA 2MNTA 2ZQTA 3KACA 4ODNA 4LAVA 1FKRA 2KI3A 3NRKA 5GPGA 1D7IA 1FD9A 3I6CA 5HW7A 4GGQA 1FKBA 1BKFA 2DG3A 1N1AA 4DROA 3GPKA 4LAYA 2MF9A 1EYMA 3JYJA 5J6EA 1ZK6A 1FKGA 2KE0A 2XPAA 3JXVA 4R0XA 5DITA 4DZ3A 4O2TA 3UQBA 1KT1A 2JZVA 4JYSA 1NMWA 4FN2A 1P5QA 2KFWA 3O5JA 4DIPA 2ZR6A 1B6CA 2D9FA 2LPVA 1FKLA 1PBKA 1U79A 4W9QA 5B8IC 1FKFA 3O5KA 1J4IA 4JFMA 5HWBA 5HWCA 1TCOC 3O5QA 3RFWA 2PPNA 3O5GA 3PA7A 4ODMA 1W26A 1JNSA 3KAFA 2MLXA 1FAPA 3O5IA 3TDBA 4DT4A 2Y78A 1PINA 1Q6IA 3UI6A 1HXVA 1FKDA 4W9OA 2RUCA 3PRDA 4QT3A 1C9HA 2XP6A 3IKGA 4ODPA 3JYMA 3CGMA 1FKJA 3TCZA 4FAPA 5BXJA 5HW6A 4JFJA 2PPOA 1NMVA 3OOBA 2XP5A 2XPBA 4ODQA 1R9HA 1BL4A 1FKTA 1D7HA 1M5YA 2XP8A 4QIBA 4DRPA 2F4EA 2ZR4A 1EQ3A 2MPHA 4TX0A 4DRIA 4N19A 2FKEA 2DG4A 3VAWA 3TC5A 4DRJA 2F21A 1FKKA 2XP9A 1JVWA 4TW8A 2M1IA 4TW6A 1FKSA 2L2SA 2RUDA
chains in the Genus database with same CATH superfamily
4Z2HA 1W1VA 1GOIA 1F40A 2ITKA 2F2DA 1ZL1A 1L1PA 3CGNA 2RSEA 2ZQVA 1E6NA 4IQCA 4DH0A 4ODKA 3O5FA 4MSPA 3RGCA 1W9PA 2YBTA 3WQVA 1ZU8A 4WJXA 4U84A 5HT1A 3KABA 1ROUA 1ROTA 2PV1A 1LG1A 4Z2KA 2XP3A 1LJYA 3H9RB 1H0GA 4G2PA 2PV3A 5HW8A 2KO7A 3KAIA 3O5PA 4IPXA 4U86A 3NTPA 3AS3A 1UR8A 1FKHA 2ZQSA 3O5DA 1VF8A 4DZ2A 3ARUA 1YATA 4DRQA 3EIPA 5HTGA 3CZ8A 3IHZA 3O5RA 4NNRA 3WIJA 4P8VA 1XRVA 3AS1A 3NRKA 5GPGA 1D7IA 1FD9A 5HW7A 4GGQA 1FKBA 4Z2LA 4LAYA 2DPEA 4Z2IA 5J6EA 2XPAA 3ARVA 3JXVA 4DZ3A 1KT1A 2JZVA 4JYSA 1NMWA 1JNEA 3AQUA 1TFVA 4MNJA 1U79A 5B8IC 3O5KA 1J4IA 5HWBA 4MPKA 3AROA 2DT1A 3TDBA 1OWQA 4P8WA 1RD6A 4W9OA 1HJVA 3PRDA 4ODPA 2ETNA 3JYMA 3CGMA 1FKJA 1ZBKA 1GRJA 3G6LA 5HW6A 2XP5A 3ARYA 1BL4A 1D7HA 1M5YA 2F4EA 1EQ3A 3ARRA 4DRIA 4N19A 4WK9A 2F21A 2WLZA 2XP9A 1HKJA 3ARSA 1FKSA 4Z2GA 3KAHA 4QT2A 3GU0A 3KADA 2ZQUA 2PI6A 5HKGA 5DF0A 4WKHA 4ODRA 4WIWA 4ML4A 3WH0A 3WD4A 4MAVA 4JFIA 1QPLA 1XHGA 4WKAA 1W9UA 2M2AA 4ODOA 4PTMA 2RURA 4URIA 3KZ7A 4S3JA 2F23A 4J4NA 2LJ4A 1J4RA 5JH8A 2ZR5A 1GPFA 3CHFA 4BF8A 2B31A 2G8ZA 4MGVA 1ZBWA 5I98A 3GTYX 1ITXA 1D7JA 1FJDA 5D75A 5DIVA 3O5LA 4Z2JA 1A7XA 3O5MA 1EIBA 5HUAA 3PRBA 4ZPWR 1HKMA 3WD1A 2K8IA 2MLYA 3B9AA 4ITZA 1KFWA 1KT0A 2RUQA 1OGGA 1Y0OA 3O5OA 1NWRA 3ALFA 4L3NA 4TNSA 4DWSD 3UQAA 4P8UA 2OFNA 3WD3A 4J4OA 1WNOA 4C02B 2MNTA 4ODNA 4LAVA 4DWSC 4XAKA 4AY1A 1BKFA 2DG3A 4MNLA 2DT3A 1FKGA 1O6IA 2ESCA 1P5QA 4HARA 2KFWA 2ZR6A 1B6CA 1FFQA 5HWCA 1TCOC 3RFWA 2PPNA 3O5GA 3PA7A 1W26A 1JNSA 2MLXA 1HKIA 3UI6A 3BXWA 2RUCA 5BXJA 2DSUA 1NWSA 4ODQA 1R9HA 3OA5A 1FKTA 4QIBA 2G41A 2A3EA 3PR9A 2MPHA 4IT6A 4HBOA 4KQZA 3TC5A 1FKKA 1X6LA 1JVWA 2L2SA 2RUDA 3O5EA 2RQSA 1JNDA 1JNTA 1T11A 1YW5A 5GQBA 3KCEA 3RMEA 4R5EA 4WKFA 3RM4A 4Q22A 2A3CA 4JFLA 1LL4A 1J6YA 4U85A 1Q6UA 2AWGA 3FAPA 2VCDA 2QF8A 3ARQA 4ODLA 4TW7A 4G50A 3UQIA 1NSGA 3ODKA 2VN1A 2LKNA 2OLHA 1ZBCA 2KGJA 5DIUA 1W1YA 1ZB5A 4DRNA 2DSVA 1LQ0A 3KAGA 3B9DA 1CTNA 2Q5AA 4JFKA 1UR9A 2PBCA 1FKIA 4DRMA 2M08A 1D6OA 1LL7A 3IK8A 4LAWA 1J4HA 2DT0A 1WB0A 1NWUA 2ZQTA 1FKRA 1D2KA 4Q7NA 3I6CA 1E44A 3GPKA 1EYMA 3BMBA 3CHDA 3JYJA 1E9LA 5HBFA 4R0XA 1W1TA 4O2TA 1K9TA 3O5JA 4DIPA 2D9FA 1FKLA 3FXYA 4NSBA 1SR0A 3RM9A 4ODMA 3ARXA 3WD0A 3KAFA 1FAPA 3O5IA 1H0IA 3CHEA 4DT4A 1Q6IA 2WLYA 1W9VA 4LGXA 2EULA 1FKDA 4QZVB 1EHNA 3RM8A 3CH9A 3ARTA 2XP6A 3FY1A 1E15A 4JFJA 1NMVA 3OOBA 4IT4A 3CHCA 2XP8A 3AS2A 4HBEA 1LG2A 1WAWA 2WM0A 2DG4A 3VAWA 3WL0A 2O92A 4DRJA 3B9EA 4S3KA 4TW8A 3W4RA 4TW6A 3ARWA 4KR0B 4NZCA 2FAPA 1HJXA 1Q6HA 4W5UA 4IQ2A 3UI5A 2XP7A 2N87A 5GPRA 1SYTA 2DSWA 1Q1CA 2FDMA 1LL6A 2PV2A 2XP4A 1NWTA 3QOKA 2MLZA 2B5UB 3UI4A 4LAXA 1ZCNA 1W1PA 3EY6A 4ZS6A 2O9OA 1QPFA 4UDMA 2DG9A 2KR7A 3IKDA 4W9PA 4ZPVR 1GUVA 2P4VA 3TCZA 2LGOA 3AS0A 3LUOA 3NI6A 3B7XA 3G6MA 5DEZA 1F8AB 2IF4A 3MDYB 2WK2A 3UF8A 4DRHA 1QZ2A 4DRKA 2YBUA 1HJWA 1E6ZA 2PPPA 4TYOA 4MTVA 2DSZA 1NH6A 4DWSA 4GIVA 2UZ5A 1X6NA 2DT2A 1ZBVA 3WKZA 3KACA 3WQWA 2KI3A 4L72B 4MNMA 3WL1A 1FFRA 2PN0A 1N1AA 4DROA 2MF9A 1OGBA 1ZK6A 2KE0A 3UQBA 1E6PA 5DITA 4FN2A 3ALGA 1EDQA 2LPVA 1HKKA 1PBKA 4W9QA 1FKFA 4JFMA 1E6RA 1IX5A 3ARPA 3O5QA 2AOSA 3PRAA 2Y78A 1PINA 1HXVA 4ZPTR 4QT3A 1C9HA 3IKGA 4FAPA 2PPOA 2IUZA 2A3BA 2XPBA 5DO2A 4DWSB 3B8SA 4DRPA 2ZR4A 1JCHB 3ARZA 4TX0A 2A3AA 2FKEA 4P8XA 3WD2A 4MNKA 2M1IA
chains in the Genus database with same CATH topology
4Z2HA 1W1VA 1GOIA 1F40A 2ITKA 2F2DA 1ZL1A 1L1PA 3CGNA 2RSEA 2ZQVA 1E6NA 4IQCA 4DH0A 4ODKA 3O5FA 4MSPA 3RGCA 1W9PA 2YBTA 3WQVA 1ZU8A 4WJXA 4U84A 5HT1A 3KABA 1ROUA 1ROTA 2PV1A 1LG1A 4Z2KA 2XP3A 1LJYA 3H9RB 1H0GA 4G2PA 2PV3A 5HW8A 2KO7A 3KAIA 3O5PA 4IPXA 4U86A 3NTPA 3AS3A 1UR8A 1FKHA 2ZQSA 3O5DA 1VF8A 4DZ2A 3ARUA 1YATA 4DRQA 5HTGA 3CZ8A 3IHZA 3O5RA 4NNRA 3WIJA 4P8VA 1XRVA 3AS1A 3NRKA 5GPGA 1D7IA 1FD9A 5HW7A 4GGQA 1FKBA 4Z2LA 4LAYA 2DPEA 4Z2IA 5J6EA 2XPAA 3ARVA 3JXVA 4DZ3A 1KT1A 2JZVA 4JYSA 1NMWA 1JNEA 3AQUA 1TFVA 4MNJA 1U79A 5B8IC 3O5KA 1J4IA 5HWBA 4MPKA 3AROA 2DT1A 3TDBA 1OWQA 4P8WA 1RD6A 4W9OA 1HJVA 3PRDA 4ODPA 3JYMA 3CGMA 1FKJA 1ZBKA 3G6LA 5HW6A 2XP5A 3ARYA 1BL4A 1D7HA 1M5YA 2F4EA 1EQ3A 3ARRA 4DRIA 4N19A 4WK9A 2F21A 2WLZA 2XP9A 1HKJA 3ARSA 1FKSA 4Z2GA 3KAHA 4QT2A 3KADA 2ZQUA 2PI6A 5HKGA 5DF0A 4WKHA 4ODRA 4WIWA 4ML4A 3WH0A 3WD4A 4MAVA 4JFIA 1QPLA 1XHGA 4WKAA 1W9UA 2M2AA 4ODOA 4PTMA 2RURA 4URIA 3KZ7A 4S3JA 4J4NA 2LJ4A 1J4RA 5JH8A 2ZR5A 1GPFA 3CHFA 4BF8A 2B31A 2G8ZA 4MGVA 1ZBWA 5I98A 1ITXA 1D7JA 1FJDA 5D75A 5DIVA 3O5LA 4Z2JA 1A7XA 3O5MA 1EIBA 5HUAA 3PRBA 4ZPWR 1HKMA 3WD1A 2K8IA 2MLYA 3B9AA 4ITZA 1KFWA 1KT0A 2RUQA 1OGGA 1Y0OA 3O5OA 1NWRA 3ALFA 4L3NA 4TNSA 4DWSD 3UQAA 4P8UA 2OFNA 3WD3A 4J4OA 1WNOA 4C02B 2MNTA 4ODNA 4LAVA 4DWSC 4XAKA 4AY1A 1BKFA 2DG3A 4MNLA 2DT3A 1FKGA 1O6IA 2ESCA 1P5QA 4HARA 2KFWA 2ZR6A 1B6CA 1FFQA 5HWCA 1TCOC 3RFWA 2PPNA 3O5GA 3PA7A 1W26A 1JNSA 2MLXA 1HKIA 3UI6A 3BXWA 2RUCA 5BXJA 2DSUA 1NWSA 4ODQA 1R9HA 3OA5A 1FKTA 4QIBA 2G41A 2A3EA 3PR9A 2MPHA 4IT6A 4HBOA 4KQZA 3TC5A 1FKKA 1X6LA 1JVWA 2L2SA 2RUDA 3O5EA 2RQSA 1JNDA 1JNTA 1T11A 1YW5A 5GQBA 3KCEA 3RMEA 4R5EA 4WKFA 3RM4A 4Q22A 2A3CA 4JFLA 1LL4A 1J6YA 4U85A 1Q6UA 2AWGA 3FAPA 2VCDA 2QF8A 3ARQA 4ODLA 4TW7A 4G50A 3UQIA 1NSGA 3ODKA 2VN1A 2LKNA 2OLHA 1ZBCA 2KGJA 5DIUA 1W1YA 1ZB5A 4DRNA 2DSVA 1LQ0A 3KAGA 3B9DA 1CTNA 2Q5AA 4JFKA 1UR9A 2PBCA 1FKIA 4DRMA 2M08A 1D6OA 1LL7A 3IK8A 4LAWA 1J4HA 2DT0A 1WB0A 1NWUA 2ZQTA 1FKRA 1D2KA 4Q7NA 3I6CA 3GPKA 1EYMA 3CHDA 5HBFA 1E9LA 3JYJA 4R0XA 1W1TA 4O2TA 1K9TA 3O5JA 4DIPA 2D9FA 1FKLA 3FXYA 4NSBA 1SR0A 3RM9A 4ODMA 3ARXA 3WD0A 3KAFA 1FAPA 3O5IA 1H0IA 3CHEA 4DT4A 1Q6IA 2WLYA 1W9VA 4LGXA 1FKDA 4QZVB 1EHNA 3RM8A 3CH9A 3ARTA 2XP6A 3FY1A 1E15A 4JFJA 1NMVA 3OOBA 4IT4A 3CHCA 2XP8A 3AS2A 4HBEA 1LG2A 1WAWA 2WM0A 2DG4A 3VAWA 3WL0A 2O92A 4DRJA 3B9EA 4S3KA 4TW8A 3W4RA 4TW6A 3ARWA 4KR0B 4NZCA 2FAPA 1HJXA 1Q6HA 4W5UA 4IQ2A 3UI5A 2XP7A 2N87A 5GPRA 1SYTA 2DSWA 1Q1CA 2FDMA 1LL6A 2PV2A 2XP4A 1NWTA 3QOKA 2MLZA 3UI4A 4LAXA 1ZCNA 1W1PA 3EY6A 4ZS6A 2O9OA 1QPFA 2DG9A 2KR7A 3IKDA 4W9PA 4ZPVR 1GUVA 3TCZA 2LGOA 3AS0A 3LUOA 3NI6A 3B7XA 3G6MA 5DEZA 1F8AB 2IF4A 3MDYB 2WK2A 3UF8A 4DRHA 1QZ2A 4DRKA 2YBUA 1HJWA 1E6ZA 2PPPA 4TYOA 4MTVA 2DSZA 1NH6A 4DWSA 4GIVA 2UZ5A 1X6NA 2DT2A 1ZBVA 3WKZA 3KACA 3WQWA 2KI3A 4L72B 4MNMA 3WL1A 1FFRA 1N1AA 4DROA 2MF9A 1OGBA 1ZK6A 2KE0A 3UQBA 1E6PA 5DITA 4FN2A 3ALGA 1EDQA 2LPVA 1HKKA 1PBKA 4W9QA 1FKFA 4JFMA 1E6RA 1IX5A 3ARPA 3O5QA 2AOSA 3PRAA 2Y78A 1PINA 1HXVA 4ZPTR 4QT3A 1C9HA 3IKGA 4FAPA 2PPOA 2IUZA 2A3BA 2XPBA 5DO2A 4DWSB 3B8SA 4DRPA 2ZR4A 3ARZA 4TX0A 2A3AA 2FKEA 4P8XA 3WD2A 4MNKA 2M1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAP A;  3KAH A;  3O5E A;  2RQS A;  4QT2 A;  1Q6H A;  1F40 A;  4IQ2 A;  3KAD A;  3UI5 A;  2XP7 A;  2ZQU A;  2N87 A;  2ITK A;  1JNT A;  1T11 A;  1YW5 A;  2F2D A;  5HKG A;  1L1P A;  1Q1C A;  3CGN A;  3KCE A;  2RSE A;  2ZQV A;  4ODR A;  4IQC A;  4JFL A;  3WH0 A;  1J6Y A;  4U85 A;  1Q6U A;  2PV2 A;  2AWG A;  3FAP A;  4DH0 A;  2VCD A;  2XP4 A;  4ODK A;  4JFI A;  1QPL A;  2MLZ A;  4ODL A;  4TW7 A;  3O5F A;  4MSP A;  4G50 A;  3UQI A;  1NSG A;  3RGC A;  3ODK A;  2M2A A;  4LAX A;  4ODO A;  2VN1 A;  1ZCN A;  3UI4 A;  2RUR A;  3EY6 A;  4U84 A;  3KZ7 A;  5HT1 A;  1QPF A;  2LKN A;  4J4N A;  2LJ4 A;  1J4R A;  3KAB A;  1ROU A;  2ZR5 A;  2KGJ A;  5DIU A;  1ROT A;  2PV1 A;  4DRH A;  2DG9 A;  2KR7 A;  4BF8 A;  3IKD A;  4MGV A;  4W9P A;  4DRN A;  5I98 A;  2XP3 A;  1D7J A;  1FJD A;  5D75 A;  3H9R B;  5DIV A;  3KAG A;  4G2P A;  2LGO A;  3LUO A;  3NI6 A;  1A7X A;  3B7X A;  3O5L A;  3O5M A;  2PV3 A;  3PRB A;  2Q5A A;  4JFK A;  5HUA A;  5HW8 A;  1F8A B;  2IF4 A;  2K8I A;  3MDY B;  2KO7 A;  2MLY A;  2PBC A;  3KAI A;  3UF8 A;  3O5P A;  1QZ2 A;  4IPX A;  4ITZ A;  4U86 A;  4DRK A;  1KT0 A;  1FKI A;  2RUQ A;  3NTP A;  4DRM A;  2M08 A;  2PPP A;  4TYO A;  1D6O A;  1FKH A;  1Y0O A;  3IK8 A;  3O5O A;  4LAW A;  4TNS A;  2ZQS A;  3UQA A;  1J4H A;  3O5D A;  2OFN A;  4GIV A;  4DZ2 A;  5HTG A;  1YAT A;  2UZ5 A;  4J4O A;  4DRQ A;  3IHZ A;  4C02 B;  3O5R A;  4NNR A;  2MNT A;  2ZQT A;  3KAC A;  4ODN A;  4LAV A;  1FKR A;  2KI3 A;  3NRK A;  5GPG A;  1D7I A;  1FD9 A;  3I6C A;  5HW7 A;  4GGQ A;  1FKB A;  1BKF A;  2DG3 A;  1N1A A;  4DRO A;  3GPK A;  4LAY A;  2MF9 A;  1EYM A;  3JYJ A;  5J6E A;  1ZK6 A;  1FKG A;  2KE0 A;  2XPA A;  3JXV A;  4R0X A;  5DIT A;  4DZ3 A;  4O2T A;  3UQB A;  1KT1 A;  2JZV A;  4JYS A;  1NMW A;  4FN2 A;  1P5Q A;  2KFW A;  3O5J A;  4DIP A;  2ZR6 A;  1B6C A;  2D9F A;  2LPV A;  1FKL A;  1PBK A;  1U79 A;  4W9Q A;  5B8I C;  1FKF A;  3O5K A;  1J4I A;  4JFM A;  5HWB A;  5HWC A;  1TCO C;  3O5Q A;  3RFW A;  2PPN A;  3O5G A;  3PA7 A;  4ODM A;  1W26 A;  1JNS A;  3KAF A;  2MLX A;  1FAP A;  3O5I A;  3TDB A;  4DT4 A;  2Y78 A;  1PIN A;  1Q6I A;  3UI6 A;  1HXV A;  1FKD A;  4W9O A;  2RUC A;  3PRD A;  4QT3 A;  1C9H A;  2XP6 A;  3IKG A;  4ODP A;  3JYM A;  3CGM A;  1FKJ A;  3TCZ A;  4FAP A;  5BXJ A;  5HW6 A;  4JFJ A;  2PPO A;  1NMV A;  3OOB A;  2XP5 A;  2XPB A;  4ODQ A;  1R9H A;  1BL4 A;  1FKT A;  1D7H A;  1M5Y A;  2XP8 A;  4QIB A;  4DRP A;  2F4E A;  2ZR4 A;  1EQ3 A;  2MPH A;  4TX0 A;  4DRI A;  4N19 A;  2FKE A;  2DG4 A;  3VAW A;  3TC5 A;  4DRJ A;  2F21 A;  1FKK A;  2XP9 A;  1JVW A;  4TW8 A;  2M1I A;  4TW6 A;  1FKS A;  2L2S A;  2RUD A; 
#chains in the Genus database with same CATH topology
 4Z2H A;  1W1V A;  1GOI A;  1F40 A;  2ITK A;  2F2D A;  1ZL1 A;  1L1P A;  3CGN A;  2RSE A;  2ZQV A;  1E6N A;  4IQC A;  4DH0 A;  4ODK A;  3O5F A;  4MSP A;  3RGC A;  1W9P A;  2YBT A;  3WQV A;  1ZU8 A;  4WJX A;  4U84 A;  5HT1 A;  3KAB A;  1ROU A;  1ROT A;  2PV1 A;  1LG1 A;  4Z2K A;  2XP3 A;  1LJY A;  3H9R B;  1H0G A;  4G2P A;  2PV3 A;  5HW8 A;  2KO7 A;  3KAI A;  3O5P A;  4IPX A;  4U86 A;  3NTP A;  3AS3 A;  1UR8 A;  1FKH A;  2ZQS A;  3O5D A;  1VF8 A;  4DZ2 A;  3ARU A;  1YAT A;  4DRQ A;  3EIP A;  5HTG A;  3CZ8 A;  3IHZ A;  3O5R A;  4NNR A;  3WIJ A;  4P8V A;  1XRV A;  3AS1 A;  3NRK A;  5GPG A;  1D7I A;  1FD9 A;  5HW7 A;  4GGQ A;  1FKB A;  4Z2L A;  4LAY A;  2DPE A;  4Z2I A;  5J6E A;  2XPA A;  3ARV A;  3JXV A;  4DZ3 A;  1KT1 A;  2JZV A;  4JYS A;  1NMW A;  1JNE A;  3AQU A;  1TFV A;  4MNJ A;  1U79 A;  5B8I C;  3O5K A;  1J4I A;  5HWB A;  4MPK A;  3ARO A;  2DT1 A;  3TDB A;  1OWQ A;  4P8W A;  1RD6 A;  4W9O A;  1HJV A;  3PRD A;  4ODP A;  2ETN A;  3JYM A;  3CGM A;  1FKJ A;  1ZBK A;  1GRJ A;  3G6L A;  5HW6 A;  2XP5 A;  3ARY A;  1BL4 A;  1D7H A;  1M5Y A;  2F4E A;  1EQ3 A;  3ARR A;  4DRI A;  4N19 A;  4WK9 A;  2F21 A;  2WLZ A;  2XP9 A;  1HKJ A;  3ARS A;  1FKS A;  4Z2G A;  3KAH A;  4QT2 A;  3GU0 A;  3KAD A;  2ZQU A;  2PI6 A;  5HKG A;  5DF0 A;  4WKH A;  4ODR A;  4WIW A;  4ML4 A;  3WH0 A;  3WD4 A;  4MAV A;  4JFI A;  1QPL A;  1XHG A;  4WKA A;  1W9U A;  2M2A A;  4ODO A;  4PTM A;  2RUR A;  4URI A;  3KZ7 A;  4S3J A;  2F23 A;  4J4N A;  2LJ4 A;  1J4R A;  5JH8 A;  2ZR5 A;  1GPF A;  3CHF A;  4BF8 A;  2B31 A;  2G8Z A;  4MGV A;  1ZBW A;  5I98 A;  3GTY X;  1ITX A;  1D7J A;  1FJD A;  5D75 A;  5DIV A;  3O5L A;  4Z2J A;  1A7X A;  3O5M A;  1EIB A;  5HUA A;  3PRB A;  4ZPW R;  1HKM A;  3WD1 A;  2K8I A;  2MLY A;  3B9A A;  4ITZ A;  1KFW A;  1KT0 A;  2RUQ A;  1OGG A;  1Y0O A;  3O5O A;  1NWR A;  3ALF A;  4L3N A;  4TNS A;  4DWS D;  3UQA A;  4P8U A;  2OFN A;  3WD3 A;  4J4O A;  1WNO A;  4C02 B;  2MNT A;  4ODN A;  4LAV A;  4DWS C;  4XAK A;  4AY1 A;  1BKF A;  2DG3 A;  4MNL A;  2DT3 A;  1FKG A;  1O6I A;  2ESC A;  1P5Q A;  4HAR A;  2KFW A;  2ZR6 A;  1B6C A;  1FFQ A;  5HWC A;  1TCO C;  3RFW A;  2PPN A;  3O5G A;  3PA7 A;  1W26 A;  1JNS A;  2MLX A;  1HKI A;  3UI6 A;  3BXW A;  2RUC A;  5BXJ A;  2DSU A;  1NWS A;  4ODQ A;  1R9H A;  3OA5 A;  1FKT A;  4QIB A;  2G41 A;  2A3E A;  3PR9 A;  2MPH A;  4IT6 A;  4HBO A;  4KQZ A;  3TC5 A;  1FKK A;  1X6L A;  1JVW A;  2L2S A;  2RUD A;  3O5E A;  2RQS A;  1JND A;  1JNT A;  1T11 A;  1YW5 A;  5GQB A;  3KCE A;  3RME A;  4R5E A;  4WKF A;  3RM4 A;  4Q22 A;  2A3C A;  4JFL A;  1LL4 A;  1J6Y A;  4U85 A;  1Q6U A;  2AWG A;  3FAP A;  2VCD A;  2QF8 A;  3ARQ A;  4ODL A;  4TW7 A;  4G50 A;  3UQI A;  1NSG A;  3ODK A;  2VN1 A;  2LKN A;  2OLH A;  1ZBC A;  2KGJ A;  5DIU A;  1W1Y A;  1ZB5 A;  4DRN A;  2DSV A;  1LQ0 A;  3KAG A;  3B9D A;  1CTN A;  2Q5A A;  4JFK A;  1UR9 A;  2PBC A;  1FKI A;  4DRM A;  2M08 A;  1D6O A;  1LL7 A;  3IK8 A;  4LAW A;  1J4H A;  2DT0 A;  1WB0 A;  1NWU A;  2ZQT A;  1FKR A;  1D2K A;  4Q7N A;  3I6C A;  1E44 A;  3GPK A;  1EYM A;  3BMB A;  3CHD A;  3JYJ A;  1E9L A;  5HBF A;  4R0X A;  1W1T A;  4O2T A;  1K9T A;  3O5J A;  4DIP A;  2D9F A;  1FKL A;  3FXY A;  4NSB A;  1SR0 A;  3RM9 A;  4ODM A;  3ARX A;  3WD0 A;  3KAF A;  1FAP A;  3O5I A;  1H0I A;  3CHE A;  4DT4 A;  1Q6I A;  2WLY A;  1W9V A;  4LGX A;  2EUL A;  1FKD A;  4QZV B;  1EHN A;  3RM8 A;  3CH9 A;  3ART A;  2XP6 A;  3FY1 A;  1E15 A;  4JFJ A;  1NMV A;  3OOB A;  4IT4 A;  3CHC A;  2XP8 A;  3AS2 A;  4HBE A;  1LG2 A;  1WAW A;  2WM0 A;  2DG4 A;  3VAW A;  3WL0 A;  2O92 A;  4DRJ A;  3B9E A;  4S3K A;  4TW8 A;  3W4R A;  4TW6 A;  3ARW A;  4KR0 B;  4NZC A;  2FAP A;  1HJX A;  1Q6H A;  4W5U A;  4IQ2 A;  3UI5 A;  2XP7 A;  2N87 A;  5GPR A;  1SYT A;  2DSW A;  1Q1C A;  2FDM A;  1LL6 A;  2PV2 A;  2XP4 A;  1NWT A;  3QOK A;  2MLZ A;  2B5U B;  3UI4 A;  4LAX A;  1ZCN A;  1W1P A;  3EY6 A;  4ZS6 A;  2O9O A;  1QPF A;  4UDM A;  2DG9 A;  2KR7 A;  3IKD A;  4W9P A;  4ZPV R;  1GUV A;  2P4V A;  3TCZ A;  2LGO A;  3AS0 A;  3LUO A;  3NI6 A;  3B7X A;  3G6M A;  5DEZ A;  1F8A B;  2IF4 A;  3MDY B;  2WK2 A;  3UF8 A;  4DRH A;  1QZ2 A;  4DRK A;  2YBU A;  1HJW A;  1E6Z A;  2PPP A;  4TYO A;  4MTV A;  2DSZ A;  1NH6 A;  4DWS A;  4GIV A;  2UZ5 A;  1X6N A;  2DT2 A;  1ZBV A;  3WKZ A;  3KAC A;  3WQW A;  2KI3 A;  4L72 B;  4MNM A;  3WL1 A;  1FFR A;  2PN0 A;  1N1A A;  4DRO A;  2MF9 A;  1OGB A;  1ZK6 A;  2KE0 A;  3UQB A;  1E6P A;  5DIT A;  4FN2 A;  3ALG A;  1EDQ A;  2LPV A;  1HKK A;  1PBK A;  4W9Q A;  1FKF A;  4JFM A;  1E6R A;  1IX5 A;  3ARP A;  3O5Q A;  2AOS A;  3PRA A;  2Y78 A;  1PIN A;  1HXV A;  4ZPT R;  4QT3 A;  1C9H A;  3IKG A;  4FAP A;  2PPO A;  2IUZ A;  2A3B A;  2XPB A;  5DO2 A;  4DWS B;  3B8S A;  4DRP A;  2ZR4 A;  1JCH B;  3ARZ A;  4TX0 A;  2A3A A;  2FKE A;  4P8X A;  3WD2 A;  4MNK A;  2M1I A; 
#chains in the Genus database with same CATH homology
 4Z2H A;  1W1V A;  1GOI A;  1F40 A;  2ITK A;  2F2D A;  1ZL1 A;  1L1P A;  3CGN A;  2RSE A;  2ZQV A;  1E6N A;  4IQC A;  4DH0 A;  4ODK A;  3O5F A;  4MSP A;  3RGC A;  1W9P A;  2YBT A;  3WQV A;  1ZU8 A;  4WJX A;  4U84 A;  5HT1 A;  3KAB A;  1ROU A;  1ROT A;  2PV1 A;  1LG1 A;  4Z2K A;  2XP3 A;  1LJY A;  3H9R B;  1H0G A;  4G2P A;  2PV3 A;  5HW8 A;  2KO7 A;  3KAI A;  3O5P A;  4IPX A;  4U86 A;  3NTP A;  3AS3 A;  1UR8 A;  1FKH A;  2ZQS A;  3O5D A;  1VF8 A;  4DZ2 A;  3ARU A;  1YAT A;  4DRQ A;  5HTG A;  3CZ8 A;  3IHZ A;  3O5R A;  4NNR A;  3WIJ A;  4P8V A;  1XRV A;  3AS1 A;  3NRK A;  5GPG A;  1D7I A;  1FD9 A;  5HW7 A;  4GGQ A;  1FKB A;  4Z2L A;  4LAY A;  2DPE A;  4Z2I A;  5J6E A;  2XPA A;  3ARV A;  3JXV A;  4DZ3 A;  1KT1 A;  2JZV A;  4JYS A;  1NMW A;  1JNE A;  3AQU A;  1TFV A;  4MNJ A;  1U79 A;  5B8I C;  3O5K A;  1J4I A;  5HWB A;  4MPK A;  3ARO A;  2DT1 A;  3TDB A;  1OWQ A;  4P8W A;  1RD6 A;  4W9O A;  1HJV A;  3PRD A;  4ODP A;  3JYM A;  3CGM A;  1FKJ A;  1ZBK A;  3G6L A;  5HW6 A;  2XP5 A;  3ARY A;  1BL4 A;  1D7H A;  1M5Y A;  2F4E A;  1EQ3 A;  3ARR A;  4DRI A;  4N19 A;  4WK9 A;  2F21 A;  2WLZ A;  2XP9 A;  1HKJ A;  3ARS A;  1FKS A;  4Z2G A;  3KAH A;  4QT2 A;  3KAD A;  2ZQU A;  2PI6 A;  5HKG A;  5DF0 A;  4WKH A;  4ODR A;  4WIW A;  4ML4 A;  3WH0 A;  3WD4 A;  4MAV A;  4JFI A;  1QPL A;  1XHG A;  4WKA A;  1W9U A;  2M2A A;  4ODO A;  4PTM A;  2RUR A;  4URI A;  3KZ7 A;  4S3J A;  4J4N A;  2LJ4 A;  1J4R A;  5JH8 A;  2ZR5 A;  1GPF A;  3CHF A;  4BF8 A;  2B31 A;  2G8Z A;  4MGV A;  1ZBW A;  5I98 A;  1ITX A;  1D7J A;  1FJD A;  5D75 A;  5DIV A;  3O5L A;  4Z2J A;  1A7X A;  3O5M A;  1EIB A;  5HUA A;  3PRB A;  4ZPW R;  1HKM A;  3WD1 A;  2K8I A;  2MLY A;  3B9A A;  4ITZ A;  1KFW A;  1KT0 A;  2RUQ A;  1OGG A;  1Y0O A;  3O5O A;  1NWR A;  3ALF A;  4L3N A;  4TNS A;  4DWS D;  3UQA A;  4P8U A;  2OFN A;  3WD3 A;  4J4O A;  1WNO A;  4C02 B;  2MNT A;  4ODN A;  4LAV A;  4DWS C;  4XAK A;  4AY1 A;  1BKF A;  2DG3 A;  4MNL A;  2DT3 A;  1FKG A;  1O6I A;  2ESC A;  1P5Q A;  4HAR A;  2KFW A;  2ZR6 A;  1B6C A;  1FFQ A;  5HWC A;  1TCO C;  3RFW A;  2PPN A;  3O5G A;  3PA7 A;  1W26 A;  1JNS A;  2MLX A;  1HKI A;  3UI6 A;  3BXW A;  2RUC A;  5BXJ A;  2DSU A;  1NWS A;  4ODQ A;  1R9H A;  3OA5 A;  1FKT A;  4QIB A;  2G41 A;  2A3E A;  3PR9 A;  2MPH A;  4IT6 A;  4HBO A;  4KQZ A;  3TC5 A;  1FKK A;  1X6L A;  1JVW A;  2L2S A;  2RUD A;  3O5E A;  2RQS A;  1JND A;  1JNT A;  1T11 A;  1YW5 A;  5GQB A;  3KCE A;  3RME A;  4R5E A;  4WKF A;  3RM4 A;  4Q22 A;  2A3C A;  4JFL A;  1LL4 A;  1J6Y A;  4U85 A;  1Q6U A;  2AWG A;  3FAP A;  2VCD A;  2QF8 A;  3ARQ A;  4ODL A;  4TW7 A;  4G50 A;  3UQI A;  1NSG A;  3ODK A;  2VN1 A;  2LKN A;  2OLH A;  1ZBC A;  2KGJ A;  5DIU A;  1W1Y A;  1ZB5 A;  4DRN A;  2DSV A;  1LQ0 A;  3KAG A;  3B9D A;  1CTN A;  2Q5A A;  4JFK A;  1UR9 A;  2PBC A;  1FKI A;  4DRM A;  2M08 A;  1D6O A;  1LL7 A;  3IK8 A;  4LAW A;  1J4H A;  2DT0 A;  1WB0 A;  1NWU A;  2ZQT A;  1FKR A;  1D2K A;  4Q7N A;  3I6C A;  3GPK A;  1EYM A;  3CHD A;  5HBF A;  1E9L A;  3JYJ A;  4R0X A;  1W1T A;  4O2T A;  1K9T A;  3O5J A;  4DIP A;  2D9F A;  1FKL A;  3FXY A;  4NSB A;  1SR0 A;  3RM9 A;  4ODM A;  3ARX A;  3WD0 A;  3KAF A;  1FAP A;  3O5I A;  1H0I A;  3CHE A;  4DT4 A;  1Q6I A;  2WLY A;  1W9V A;  4LGX A;  1FKD A;  4QZV B;  1EHN A;  3RM8 A;  3CH9 A;  3ART A;  2XP6 A;  3FY1 A;  1E15 A;  4JFJ A;  1NMV A;  3OOB A;  4IT4 A;  3CHC A;  2XP8 A;  3AS2 A;  4HBE A;  1LG2 A;  1WAW A;  2WM0 A;  2DG4 A;  3VAW A;  3WL0 A;  2O92 A;  4DRJ A;  3B9E A;  4S3K A;  4TW8 A;  3W4R A;  4TW6 A;  3ARW A;  4KR0 B;  4NZC A;  2FAP A;  1HJX A;  1Q6H A;  4W5U A;  4IQ2 A;  3UI5 A;  2XP7 A;  2N87 A;  5GPR A;  1SYT A;  2DSW A;  1Q1C A;  2FDM A;  1LL6 A;  2PV2 A;  2XP4 A;  1NWT A;  3QOK A;  2MLZ A;  3UI4 A;  4LAX A;  1ZCN A;  1W1P A;  3EY6 A;  4ZS6 A;  2O9O A;  1QPF A;  2DG9 A;  2KR7 A;  3IKD A;  4W9P A;  4ZPV R;  1GUV A;  3TCZ A;  2LGO A;  3AS0 A;  3LUO A;  3NI6 A;  3B7X A;  3G6M A;  5DEZ A;  1F8A B;  2IF4 A;  3MDY B;  2WK2 A;  3UF8 A;  4DRH A;  1QZ2 A;  4DRK A;  2YBU A;  1HJW A;  1E6Z A;  2PPP A;  4TYO A;  4MTV A;  2DSZ A;  1NH6 A;  4DWS A;  4GIV A;  2UZ5 A;  1X6N A;  2DT2 A;  1ZBV A;  3WKZ A;  3KAC A;  3WQW A;  2KI3 A;  4L72 B;  4MNM A;  3WL1 A;  1FFR A;  1N1A A;  4DRO A;  2MF9 A;  1OGB A;  1ZK6 A;  2KE0 A;  3UQB A;  1E6P A;  5DIT A;  4FN2 A;  3ALG A;  1EDQ A;  2LPV A;  1HKK A;  1PBK A;  4W9Q A;  1FKF A;  4JFM A;  1E6R A;  1IX5 A;  3ARP A;  3O5Q A;  2AOS A;  3PRA A;  2Y78 A;  1PIN A;  1HXV A;  4ZPT R;  4QT3 A;  1C9H A;  3IKG A;  4FAP A;  2PPO A;  2IUZ A;  2A3B A;  2XPB A;  5DO2 A;  4DWS B;  3B8S A;  4DRP A;  2ZR4 A;  3ARZ A;  4TX0 A;  2A3A A;  2FKE A;  4P8X A;  3WD2 A;  4MNK A;  2M1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...