1N1AA

Crystal structure of the n-terminal domain of human fkbp52
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
121
Chain Sequence
APLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N-terminal domain of human FKBP52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FKBP52
total genus 26
structure length 121
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1n1aA00
3PRBA 1EYMA 1NMWA 5B8IC 2XP3A 4ODRA 1FKLA 1D7IA 4O2TA 1J4HA 2ZQSA 1FKKA 4TW7A 3O5PA 1JNTA 2M2AA 3CGMA 2MPHA 3KACA 4LAWA 4W9QA 3UI6A 1HXVA 3O5QA 5HKGA 4DRQA 2DG9A 2RURA 2XP7A 3O5MA 3PA7A 2PBCA 4MGVA 4TW8A 3O5FA 4DRHA 2RUQA 3CGNA 3MDYB 1YW5A 4ODQA 1Y0OA 2M08A 4ODKA 2OFNA 3LUOA 3NI6A 5GPGA 4G50A 3GPKA 2KO7A 5HT1A 1P5QA 5D75A 4DT4A 1EQ3A 3TC5A 1FKRA 3TDBA 1J4IA 1T11A 2Q5AA 1A7XA 1FKDA 3H9RB 4DROA 5HW8A 1ROUA 4JFJA 2K8IA 1FKHA 3TCZA 4C02B 1PINA 4TNSA 2ZR5A 1ROTA 2F4EA 1Q1CA 2RQSA 4QIBA 1U79A 4IQCA 1NMVA 2MNTA 4W9PA 4DRKA 5HW6A 4JFKA 4JFMA 2MLXA 1KT1A 1QZ2A 5HW7A 1D7JA 1QPFA 3UQAA 4DIPA 3O5JA 2XP5A 3NRKA 1FKBA 4ITZA 4FN2A 4DRPA 1M5YA 1PBKA 2MF9A 2JZVA 1BL4A 1W26A 1YATA 2KGJA 2MLZA 2LPVA 1D7HA 3KABA 5BXJA 4DZ2A 4G2PA 4W9OA 3KADA 3UQIA 4FAPA 1F8AB 1Q6UA 3JYJA 4ODOA 2UZ5A 4U84A 3PRDA 2KFWA 3IK8A 3O5LA 2ITKA 2PPOA 5DITA 5DIVA 3VAWA 4NNRA 3ODKA 2VCDA 3FAPA 4IQ2A 1JNSA 1JVWA 5HUAA 1BKFA 3KAFA 2ZR4A 3IKGA 3O5GA 2PV2A 2ZQTA 2PV3A 2MLYA 4ODPA 3UI4A 4DRIA 4JFIA 5HTGA 2LGOA 1R9HA 3IHZA 2PPNA 3UF8A 2M1IA 5J6EA 3KAGA 4J4OA 1FKJA 2FKEA 4DRNA 2LKNA 1KT0A 2XP8A 1F40A 1FKIA 1FKTA 3I6CA 5DIUA 4IPXA 2FAPA 2XP6A 3KCEA 4JFLA 1ZCNA 1FD9A 4R0XA 1FKFA 2RUCA 3JXVA 3KAHA 4U86A 4TYOA 3UI5A 5I98A 2IF4A 2ZQVA 3B7XA 4TW6A 2KE0A 2KR7A 1C9HA 4LAVA 4DRMA 1Q6IA 4ODLA 2F2DA 3O5KA 1NSGA 2ZR6A 3KAIA 1FKSA 4GIVA 3NTPA 1J4RA 1Q6HA 3RFWA 4TX0A 1ZK6A 1QPLA 2XPBA 1TCOC 2PPPA 3O5RA 3RGCA 4U85A 4LAYA 2D9FA 1D6OA 2N87A 2PV1A 2XP9A 2RUDA 4J4NA 2RSEA 2LJ4A 1FAPA 1L1PA 2Y78A 2XPAA 4DZ3A 3O5IA 2L2SA 4MSPA 4ODMA 2AWGA 3O5DA 2VN1A 3EY6A 4QT3A 2ZQUA 4QT2A 3KZ7A 3O5OA 1N1AA 4ODNA 4BF8A 3IKDA 5HWCA 4LAXA 2XP4A 3JYMA 2DG4A 4DH0A 1J6YA 2DG3A 3OOBA 4GGQA 5HWBA 2F21A 3O5EA 2KI3A 1B6CA 1FKGA 4N19A 3WH0A 4DRJA 3UQBA 1FJDA 4JYSA
chains in the Genus database with same CATH superfamily
1EYMA 3WIJA 2A3BA 4TW7A 3O5PA 3WQVA 1LL7A 2DT1A 3UI6A 1E44A 4DRQA 4HARA 3RM9A 4WKAA 1ZU8A 3PA7A 4Z2HA 4LGXA 4XAKA 2RUQA 4P8UA 1YW5A 4HBOA 4ODQA 2M08A 4DWSB 3NI6A 3GPKA 2KO7A 2DPEA 1P5QA 5HT1A 3TC5A 2IUZA 4NSBA 4DROA 1FKDA 3ARYA 3CHFA 4WKHA 1U79A 4IQCA 4UDMA 4W9PA 5HW6A 2MLXA 4MNKA 5HW7A 3UQAA 1GUVA 3O5JA 4ITZA 1E6RA 4DRPA 1EHNA 1W26A 1YATA 2B5UB 2LPVA 5BXJA 1Q6UA 4URIA 3AS0A 4NNRA 2VCDA 4IQ2A 1ZB5A 1JVWA 1JNSA 1W1PA 1BKFA 4S3KA 4ODPA 3ARXA 3UI4A 4DRIA 1GRJA 2M1IA 5J6EA 4WJXA 2XP8A 1FKIA 4IPXA 2XP6A 2WK2A 4TYOA 4Z2GA 1C9HA 4DRMA 1NSGA 4GIVA 1TFVA 1JCHB 3ARSA 1W9PA 1QPLA 1TCOC 2PPPA 2P4VA 2D9FA 2EULA 2RUDA 4DZ3A 1HJWA 2L2SA 4MSPA 3WL1A 2AWGA 4QT2A 3KZ7A 4L72B 3O5OA 3ALFA 5DF0A 4BF8A 3B9AA 1ZBCA 1IX5A 2DG4A 3OOBA 4GGQA 1E6NA 1O6IA 3WH0A 4MGVA 1NWTA 3CHCA 2A3EA 1NMWA 5B8IC 4WK9A 4ODRA 1FKLA 4MNMA 1XHGA 1W1VA 3CGMA 4W9QA 3WD2A 1HXVA 1UR9A 3O5QA 1ZL1A 1CTNA 2RURA 3O5MA 2PBCA 3AS3A 2DSVA 4KR0B 3GU0A 3LUOA 4WKFA 1HKIA 3AS1A 1FKRA 4NZCA 1J4IA 1W9VA 1OWQA 2K8IA 2AOSA 4C02B 2ZR5A 1ROTA 4P8VA 4JFKA 2YBTA 3RMEA 1QPFA 4MNLA 4S3JA 3EIPA 1WAWA 2XP5A 1FKBA 1XRVA 1M5YA 2DT0A 1BL4A 2MLZA 2PN0A 1D7HA 1X6LA 4DZ2A 4FAPA 4L3NA 1WB0A 3B9EA 4U84A 4MNJA 1HKMA 1W1YA 3FAPA 2PV2A 5JH8A 3PR9A 5HTGA 1R9HA 4ZPTR 3UF8A 1FKJA 4DRNA 3AS2A 4W5UA 1F40A 5DIUA 1VF8A 3KCEA 4JFLA 1FD9A 4AY1A 1FKFA 2RUCA 3CHEA 1LQ0A 3JXVA 3KAHA 3UI5A 2ZQVA 3B7XA 3WD0A 2KE0A 2KR7A 4LAVA 1UR8A 3O5KA 2WLZA 3WD1A 1EDQA 1Q6HA 3RFWA 2XPBA 4IT6A 3ARZA 4Z2LA 3FXYA 4LAYA 1H0GA 3ARPA 1D6OA 2N87A 2PV1A 4J4NA 2RSEA 1HKJA 3O5IA 3O5DA 2VN1A 3ARVA 3QOKA 2DT2A 3AQUA 4ODNA 1GOIA 3O5EA 1FJDA 1B6CA 3ARRA 4JYSA 3PRBA 1E9LA 1D7IA 4QZVB 2ZQSA 2ETNA 1JNTA 3G6LA 3ARQA 1NWSA 1X6NA 1NWUA 3O5FA 3RM8A 1LG1A 4G50A 5D75A 1EQ3A 2Q5AA 5HW8A 1A7XA 1E6ZA 4JFJA 1FKHA 3TCZA 1PINA 5HBFA 2F4EA 4ZS6A 4Z2KA 2RQSA 1ZBVA 1OGBA 1OGGA 1WNOA 4DWSD 4JFMA 4MPKA 1QZ2A 1D7JA 5GPRA 4ZPVR 4Z2JA 3WQWA 4DIPA 2O92A 1FFRA 5GQBA 1PBKA 3ARWA 4Q22A 2MF9A 2KGJA 1HKKA 2F23A 4G2PA 4W9OA 3KADA 3UQIA 1F8AB 4DWSA 1JNDA 3JYJA 4ODOA 3PRDA 2KFWA 3IK8A 3O5LA 3VAWA 3CHDA 3ODKA 5HUAA 3PRAA 3KAFA 2ZR4A 3IKGA 2ESCA 2PV3A 3W4RA 2G8ZA 4Q7NA 2DSZA 2LGOA 4P8XA 3IHZA 2PPNA 3KAGA 4J4OA 4ML4A 5DEZA 1FKTA 4HBEA 1E6PA 4U86A 5I98A 2IF4A 4TW6A 1KFWA 2YBUA 4ODLA 2ZR6A 2A3CA 3KAIA 1FKSA 3RM4A 2FDMA 4MTVA 4TX0A 1H0IA 3RGCA 3O5RA 1FFQA 3CZ8A 4U85A 1JNEA 2XP9A 3B9DA 1L1PA 1ZBWA 3EY6A 2QF8A 2ZQUA 3WD3A 2OLHA 1D2KA 1E15A 3IKDA 5HWCA 2XP4A 4Z2IA 2DG3A 3B8SA 1ZBKA 4DRJA 3UQBA 2KI3A 4DWSC 2XP3A 1GPFA 4O2TA 1J4HA 1FKKA 1RD6A 2M2AA 4LAWA 2MPHA 3KACA 3WKZA 3WL0A 5HKGA 2DSUA 2DG9A 4TW8A 2XP7A 3FY1A 4P8WA 2WLYA 4DRHA 3CGNA 3MDYB 3G6MA 1Y0OA 2DT3A 4ODKA 2OFNA 5GPGA 2A3AA 4DT4A 3CH9A 3ARTA 3TDBA 1T11A 3H9RB 4IT4A 1ROUA 1K9TA 3ALGA 4WIWA 4TNSA 5DO2A 1Q1CA 2O9OA 4QIBA 4DRKA 1NMVA 2MNTA 3ARUA 1W9UA 1KT1A 2DSWA 3OA5A 3NRKA 4FN2A 3BMBA 3GTYX 2JZVA 1LL6A 1NH6A 3KABA 4R5EA 2UZ5A 2PI6A 2ITKA 1SYTA 2PPOA 5DITA 5DIVA 1ITXA 3O5GA 3WD4A 2ZQTA 2MLYA 4JFIA 4KQZA 4MAVA 1HJVA 2WM0A 1EIBA 4ZPWR 1NWRA 2FKEA 2G41A 2LKNA 1KT0A 1SR0A 3I6CA 1LL4A 2FAPA 1LG2A 1ZCNA 4R0XA 1LJYA 1Q6IA 2F2DA 3NTPA 3BXWA 1J4RA 1ZK6A 4PTMA 2B31A 1FAPA 2LJ4A 2Y78A 2XPAA 4ODMA 1HJXA 4QT3A 1N1AA 1W1TA 3JYMA 4LAXA 4DH0A 1J6YA 3AROA 5HWBA 2F21A 1FKGA 4N19A
chains in the Genus database with same CATH topology
1EYMA 3WIJA 2A3BA 4TW7A 3O5PA 3WQVA 1LL7A 2DT1A 3UI6A 4DRQA 4HARA 3RM9A 4WKAA 1ZU8A 3PA7A 4Z2HA 4LGXA 4XAKA 2RUQA 4P8UA 1YW5A 4HBOA 4ODQA 2M08A 4DWSB 3NI6A 3GPKA 2KO7A 2DPEA 1P5QA 5HT1A 3TC5A 2IUZA 4NSBA 4DROA 1FKDA 3ARYA 3CHFA 4WKHA 1U79A 4IQCA 4W9PA 5HW6A 2MLXA 4MNKA 5HW7A 3UQAA 1GUVA 3O5JA 4ITZA 1E6RA 4DRPA 1EHNA 1W26A 1YATA 2LPVA 5BXJA 1Q6UA 4URIA 3AS0A 4NNRA 2VCDA 4IQ2A 1ZB5A 1JVWA 1JNSA 1W1PA 1BKFA 4S3KA 4ODPA 3ARXA 3UI4A 4DRIA 2M1IA 5J6EA 4WJXA 2XP8A 1FKIA 4IPXA 2XP6A 2WK2A 4TYOA 4Z2GA 1C9HA 4DRMA 1NSGA 4GIVA 1TFVA 3ARSA 1W9PA 1QPLA 1TCOC 2PPPA 2D9FA 2RUDA 4DZ3A 1HJWA 2L2SA 4MSPA 3WL1A 2AWGA 4QT2A 3KZ7A 4L72B 3O5OA 3ALFA 5DF0A 4BF8A 3B9AA 1ZBCA 1IX5A 2DG4A 3OOBA 4GGQA 1E6NA 1O6IA 3WH0A 4MGVA 1NWTA 3CHCA 2A3EA 1NMWA 5B8IC 4WK9A 4ODRA 1FKLA 4MNMA 1XHGA 1W1VA 3CGMA 4W9QA 3WD2A 1HXVA 1UR9A 3O5QA 1ZL1A 1CTNA 2RURA 3O5MA 2PBCA 3AS3A 2DSVA 4KR0B 3LUOA 4WKFA 1HKIA 3AS1A 1FKRA 4NZCA 1J4IA 1W9VA 1OWQA 2K8IA 2AOSA 4C02B 2ZR5A 1ROTA 4P8VA 4JFKA 2YBTA 3RMEA 1QPFA 4MNLA 4S3JA 1WAWA 2XP5A 1FKBA 1XRVA 1M5YA 2DT0A 1BL4A 2MLZA 1D7HA 1X6LA 4DZ2A 4FAPA 4L3NA 1WB0A 3B9EA 4U84A 4MNJA 1HKMA 1W1YA 3FAPA 2PV2A 5JH8A 3PR9A 5HTGA 1R9HA 4ZPTR 3UF8A 1FKJA 4DRNA 3AS2A 4W5UA 1F40A 5DIUA 1VF8A 3KCEA 4JFLA 1FD9A 4AY1A 1FKFA 2RUCA 3CHEA 1LQ0A 3JXVA 3KAHA 3UI5A 2ZQVA 3B7XA 3WD0A 2KE0A 2KR7A 4LAVA 1UR8A 3O5KA 2WLZA 3WD1A 1EDQA 1Q6HA 3RFWA 2XPBA 4IT6A 3ARZA 4Z2LA 3FXYA 4LAYA 1H0GA 3ARPA 1D6OA 2N87A 2PV1A 4J4NA 2RSEA 1HKJA 3O5IA 3O5DA 2VN1A 3ARVA 3QOKA 2DT2A 3AQUA 4ODNA 1GOIA 3O5EA 1FJDA 1B6CA 3ARRA 4JYSA 3PRBA 1E9LA 1D7IA 4QZVB 2ZQSA 1JNTA 3G6LA 3ARQA 1NWSA 1X6NA 1NWUA 3O5FA 3RM8A 1LG1A 4G50A 5D75A 1EQ3A 2Q5AA 5HW8A 1A7XA 1E6ZA 4JFJA 1FKHA 3TCZA 1PINA 5HBFA 2F4EA 4ZS6A 4Z2KA 2RQSA 1ZBVA 1OGBA 1OGGA 1WNOA 4DWSD 4JFMA 4MPKA 1QZ2A 1D7JA 5GPRA 4ZPVR 4Z2JA 3WQWA 4DIPA 2O92A 1FFRA 5GQBA 1PBKA 3ARWA 4Q22A 2MF9A 2KGJA 1HKKA 4G2PA 4W9OA 3KADA 3UQIA 1F8AB 4DWSA 1JNDA 3JYJA 4ODOA 3PRDA 2KFWA 3IK8A 3O5LA 3VAWA 3CHDA 3ODKA 5HUAA 3PRAA 3KAFA 2ZR4A 3IKGA 2ESCA 2PV3A 3W4RA 2G8ZA 4Q7NA 2DSZA 2LGOA 4P8XA 3IHZA 2PPNA 3KAGA 4J4OA 4ML4A 5DEZA 1FKTA 4HBEA 1E6PA 4U86A 5I98A 2IF4A 4TW6A 1KFWA 2YBUA 4ODLA 2ZR6A 2A3CA 3KAIA 1FKSA 3RM4A 2FDMA 4MTVA 4TX0A 1H0IA 3RGCA 3O5RA 1FFQA 3CZ8A 4U85A 1JNEA 2XP9A 3B9DA 1L1PA 1ZBWA 3EY6A 2QF8A 2ZQUA 3WD3A 2OLHA 1D2KA 1E15A 3IKDA 5HWCA 2XP4A 4Z2IA 2DG3A 3B8SA 1ZBKA 4DRJA 3UQBA 2KI3A 4DWSC 2XP3A 1GPFA 4O2TA 1J4HA 1FKKA 1RD6A 2M2AA 4LAWA 2MPHA 3KACA 3WKZA 3WL0A 5HKGA 2DSUA 2DG9A 4TW8A 2XP7A 3FY1A 4P8WA 2WLYA 4DRHA 3CGNA 3MDYB 3G6MA 1Y0OA 2DT3A 4ODKA 2OFNA 5GPGA 2A3AA 4DT4A 3CH9A 3ARTA 3TDBA 1T11A 3H9RB 4IT4A 1ROUA 1K9TA 3ALGA 4WIWA 4TNSA 5DO2A 1Q1CA 2O9OA 4QIBA 4DRKA 1NMVA 2MNTA 3ARUA 1W9UA 1KT1A 2DSWA 3OA5A 3NRKA 4FN2A 2JZVA 1LL6A 1NH6A 3KABA 4R5EA 2UZ5A 2PI6A 2ITKA 1SYTA 2PPOA 5DITA 5DIVA 1ITXA 3O5GA 3WD4A 2ZQTA 2MLYA 4JFIA 4KQZA 4MAVA 1HJVA 2WM0A 1EIBA 4ZPWR 1NWRA 2FKEA 2G41A 2LKNA 1KT0A 1SR0A 3I6CA 1LL4A 2FAPA 1LG2A 1ZCNA 4R0XA 1LJYA 1Q6IA 2F2DA 3BXWA 3NTPA 1J4RA 1ZK6A 4PTMA 2B31A 1FAPA 2LJ4A 2Y78A 2XPAA 4ODMA 1HJXA 4QT3A 1N1AA 1W1TA 3JYMA 4LAXA 4DH0A 1J6YA 3AROA 5HWBA 2F21A 1FKGA 4N19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRB A;  1EYM A;  1NMW A;  5B8I C;  2XP3 A;  4ODR A;  1FKL A;  1D7I A;  4O2T A;  1J4H A;  2ZQS A;  1FKK A;  4TW7 A;  3O5P A;  1JNT A;  2M2A A;  3CGM A;  2MPH A;  3KAC A;  4LAW A;  4W9Q A;  3UI6 A;  1HXV A;  3O5Q A;  5HKG A;  4DRQ A;  2DG9 A;  2RUR A;  2XP7 A;  3O5M A;  3PA7 A;  2PBC A;  4MGV A;  4TW8 A;  3O5F A;  4DRH A;  2RUQ A;  3CGN A;  3MDY B;  1YW5 A;  4ODQ A;  1Y0O A;  2M08 A;  4ODK A;  2OFN A;  3LUO A;  3NI6 A;  5GPG A;  4G50 A;  3GPK A;  2KO7 A;  5HT1 A;  1P5Q A;  5D75 A;  4DT4 A;  1EQ3 A;  3TC5 A;  1FKR A;  3TDB A;  1J4I A;  1T11 A;  2Q5A A;  1A7X A;  1FKD A;  3H9R B;  4DRO A;  5HW8 A;  1ROU A;  4JFJ A;  2K8I A;  1FKH A;  3TCZ A;  4C02 B;  1PIN A;  4TNS A;  2ZR5 A;  1ROT A;  2F4E A;  1Q1C A;  2RQS A;  4QIB A;  1U79 A;  4IQC A;  1NMV A;  2MNT A;  4W9P A;  4DRK A;  5HW6 A;  4JFK A;  4JFM A;  2MLX A;  1KT1 A;  1QZ2 A;  5HW7 A;  1D7J A;  1QPF A;  3UQA A;  4DIP A;  3O5J A;  2XP5 A;  3NRK A;  1FKB A;  4ITZ A;  4FN2 A;  4DRP A;  1M5Y A;  1PBK A;  2MF9 A;  2JZV A;  1BL4 A;  1W26 A;  1YAT A;  2KGJ A;  2MLZ A;  2LPV A;  1D7H A;  3KAB A;  5BXJ A;  4DZ2 A;  4G2P A;  4W9O A;  3KAD A;  3UQI A;  4FAP A;  1F8A B;  1Q6U A;  3JYJ A;  4ODO A;  2UZ5 A;  4U84 A;  3PRD A;  2KFW A;  3IK8 A;  3O5L A;  2ITK A;  2PPO A;  5DIT A;  5DIV A;  3VAW A;  4NNR A;  3ODK A;  2VCD A;  3FAP A;  4IQ2 A;  1JNS A;  1JVW A;  5HUA A;  1BKF A;  3KAF A;  2ZR4 A;  3IKG A;  3O5G A;  2PV2 A;  2ZQT A;  2PV3 A;  2MLY A;  4ODP A;  3UI4 A;  4DRI A;  4JFI A;  5HTG A;  2LGO A;  1R9H A;  3IHZ A;  2PPN A;  3UF8 A;  2M1I A;  5J6E A;  3KAG A;  4J4O A;  1FKJ A;  2FKE A;  4DRN A;  2LKN A;  1KT0 A;  2XP8 A;  1F40 A;  1FKI A;  1FKT A;  3I6C A;  5DIU A;  4IPX A;  2FAP A;  2XP6 A;  3KCE A;  4JFL A;  1ZCN A;  1FD9 A;  4R0X A;  1FKF A;  2RUC A;  3JXV A;  3KAH A;  4U86 A;  4TYO A;  3UI5 A;  5I98 A;  2IF4 A;  2ZQV A;  3B7X A;  4TW6 A;  2KE0 A;  2KR7 A;  1C9H A;  4LAV A;  4DRM A;  1Q6I A;  4ODL A;  2F2D A;  3O5K A;  1NSG A;  2ZR6 A;  3KAI A;  1FKS A;  4GIV A;  3NTP A;  1J4R A;  1Q6H A;  3RFW A;  4TX0 A;  1ZK6 A;  1QPL A;  2XPB A;  1TCO C;  2PPP A;  3O5R A;  3RGC A;  4U85 A;  4LAY A;  2D9F A;  1D6O A;  2N87 A;  2PV1 A;  2XP9 A;  2RUD A;  4J4N A;  2RSE A;  2LJ4 A;  1FAP A;  1L1P A;  2Y78 A;  2XPA A;  4DZ3 A;  3O5I A;  2L2S A;  4MSP A;  4ODM A;  2AWG A;  3O5D A;  2VN1 A;  3EY6 A;  4QT3 A;  2ZQU A;  4QT2 A;  3KZ7 A;  3O5O A;  1N1A A;  4ODN A;  4BF8 A;  3IKD A;  5HWC A;  4LAX A;  2XP4 A;  3JYM A;  2DG4 A;  4DH0 A;  1J6Y A;  2DG3 A;  3OOB A;  4GGQ A;  5HWB A;  2F21 A;  3O5E A;  2KI3 A;  1B6C A;  1FKG A;  4N19 A;  3WH0 A;  4DRJ A;  3UQB A;  1FJD A;  4JYS A; 
#chains in the Genus database with same CATH topology
 1EYM A;  3WIJ A;  2A3B A;  4TW7 A;  3O5P A;  3WQV A;  1LL7 A;  2DT1 A;  3UI6 A;  1E44 A;  4DRQ A;  4HAR A;  3RM9 A;  4WKA A;  1ZU8 A;  3PA7 A;  4Z2H A;  4LGX A;  4XAK A;  2RUQ A;  4P8U A;  1YW5 A;  4HBO A;  4ODQ A;  2M08 A;  4DWS B;  3NI6 A;  3GPK A;  2KO7 A;  2DPE A;  1P5Q A;  5HT1 A;  3TC5 A;  2IUZ A;  4NSB A;  4DRO A;  1FKD A;  3ARY A;  3CHF A;  4WKH A;  1U79 A;  4IQC A;  4UDM A;  4W9P A;  5HW6 A;  2MLX A;  4MNK A;  5HW7 A;  3UQA A;  1GUV A;  3O5J A;  4ITZ A;  1E6R A;  4DRP A;  1EHN A;  1W26 A;  1YAT A;  2B5U B;  2LPV A;  5BXJ A;  1Q6U A;  4URI A;  3AS0 A;  4NNR A;  2VCD A;  4IQ2 A;  1ZB5 A;  1JVW A;  1JNS A;  1W1P A;  1BKF A;  4S3K A;  4ODP A;  3ARX A;  3UI4 A;  4DRI A;  1GRJ A;  2M1I A;  5J6E A;  4WJX A;  2XP8 A;  1FKI A;  4IPX A;  2XP6 A;  2WK2 A;  4TYO A;  4Z2G A;  1C9H A;  4DRM A;  1NSG A;  4GIV A;  1TFV A;  1JCH B;  3ARS A;  1W9P A;  1QPL A;  1TCO C;  2PPP A;  2P4V A;  2D9F A;  2EUL A;  2RUD A;  4DZ3 A;  1HJW A;  2L2S A;  4MSP A;  3WL1 A;  2AWG A;  4QT2 A;  3KZ7 A;  4L72 B;  3O5O A;  3ALF A;  5DF0 A;  4BF8 A;  3B9A A;  1ZBC A;  1IX5 A;  2DG4 A;  3OOB A;  4GGQ A;  1E6N A;  1O6I A;  3WH0 A;  4MGV A;  1NWT A;  3CHC A;  2A3E A;  1NMW A;  5B8I C;  4WK9 A;  4ODR A;  1FKL A;  4MNM A;  1XHG A;  1W1V A;  3CGM A;  4W9Q A;  3WD2 A;  1HXV A;  1UR9 A;  3O5Q A;  1ZL1 A;  1CTN A;  2RUR A;  3O5M A;  2PBC A;  3AS3 A;  2DSV A;  4KR0 B;  3GU0 A;  3LUO A;  4WKF A;  1HKI A;  3AS1 A;  1FKR A;  4NZC A;  1J4I A;  1W9V A;  1OWQ A;  2K8I A;  2AOS A;  4C02 B;  2ZR5 A;  1ROT A;  4P8V A;  4JFK A;  2YBT A;  3RME A;  1QPF A;  4MNL A;  4S3J A;  3EIP A;  1WAW A;  2XP5 A;  1FKB A;  1XRV A;  1M5Y A;  2DT0 A;  1BL4 A;  2MLZ A;  2PN0 A;  1D7H A;  1X6L A;  4DZ2 A;  4FAP A;  4L3N A;  1WB0 A;  3B9E A;  4U84 A;  4MNJ A;  1HKM A;  1W1Y A;  3FAP A;  2PV2 A;  5JH8 A;  3PR9 A;  5HTG A;  1R9H A;  4ZPT R;  3UF8 A;  1FKJ A;  4DRN A;  3AS2 A;  4W5U A;  1F40 A;  5DIU A;  1VF8 A;  3KCE A;  4JFL A;  1FD9 A;  4AY1 A;  1FKF A;  2RUC A;  3CHE A;  1LQ0 A;  3JXV A;  3KAH A;  3UI5 A;  2ZQV A;  3B7X A;  3WD0 A;  2KE0 A;  2KR7 A;  4LAV A;  1UR8 A;  3O5K A;  2WLZ A;  3WD1 A;  1EDQ A;  1Q6H A;  3RFW A;  2XPB A;  4IT6 A;  3ARZ A;  4Z2L A;  3FXY A;  4LAY A;  1H0G A;  3ARP A;  1D6O A;  2N87 A;  2PV1 A;  4J4N A;  2RSE A;  1HKJ A;  3O5I A;  3O5D A;  2VN1 A;  3ARV A;  3QOK A;  2DT2 A;  3AQU A;  4ODN A;  1GOI A;  3O5E A;  1FJD A;  1B6C A;  3ARR A;  4JYS A;  3PRB A;  1E9L A;  1D7I A;  4QZV B;  2ZQS A;  2ETN A;  1JNT A;  3G6L A;  3ARQ A;  1NWS A;  1X6N A;  1NWU A;  3O5F A;  3RM8 A;  1LG1 A;  4G50 A;  5D75 A;  1EQ3 A;  2Q5A A;  5HW8 A;  1A7X A;  1E6Z A;  4JFJ A;  1FKH A;  3TCZ A;  1PIN A;  5HBF A;  2F4E A;  4ZS6 A;  4Z2K A;  2RQS A;  1ZBV A;  1OGB A;  1OGG A;  1WNO A;  4DWS D;  4JFM A;  4MPK A;  1QZ2 A;  1D7J A;  5GPR A;  4ZPV R;  4Z2J A;  3WQW A;  4DIP A;  2O92 A;  1FFR A;  5GQB A;  1PBK A;  3ARW A;  4Q22 A;  2MF9 A;  2KGJ A;  1HKK A;  2F23 A;  4G2P A;  4W9O A;  3KAD A;  3UQI A;  1F8A B;  4DWS A;  1JND A;  3JYJ A;  4ODO A;  3PRD A;  2KFW A;  3IK8 A;  3O5L A;  3VAW A;  3CHD A;  3ODK A;  5HUA A;  3PRA A;  3KAF A;  2ZR4 A;  3IKG A;  2ESC A;  2PV3 A;  3W4R A;  2G8Z A;  4Q7N A;  2DSZ A;  2LGO A;  4P8X A;  3IHZ A;  2PPN A;  3KAG A;  4J4O A;  4ML4 A;  5DEZ A;  1FKT A;  4HBE A;  1E6P A;  4U86 A;  5I98 A;  2IF4 A;  4TW6 A;  1KFW A;  2YBU A;  4ODL A;  2ZR6 A;  2A3C A;  3KAI A;  1FKS A;  3RM4 A;  2FDM A;  4MTV A;  4TX0 A;  1H0I A;  3RGC A;  3O5R A;  1FFQ A;  3CZ8 A;  4U85 A;  1JNE A;  2XP9 A;  3B9D A;  1L1P A;  1ZBW A;  3EY6 A;  2QF8 A;  2ZQU A;  3WD3 A;  2OLH A;  1D2K A;  1E15 A;  3IKD A;  5HWC A;  2XP4 A;  4Z2I A;  2DG3 A;  3B8S A;  1ZBK A;  4DRJ A;  3UQB A;  2KI3 A;  4DWS C;  2XP3 A;  1GPF A;  4O2T A;  1J4H A;  1FKK A;  1RD6 A;  2M2A A;  4LAW A;  2MPH A;  3KAC A;  3WKZ A;  3WL0 A;  5HKG A;  2DSU A;  2DG9 A;  4TW8 A;  2XP7 A;  3FY1 A;  4P8W A;  2WLY A;  4DRH A;  3CGN A;  3MDY B;  3G6M A;  1Y0O A;  2DT3 A;  4ODK A;  2OFN A;  5GPG A;  2A3A A;  4DT4 A;  3CH9 A;  3ART A;  3TDB A;  1T11 A;  3H9R B;  4IT4 A;  1ROU A;  1K9T A;  3ALG A;  4WIW A;  4TNS A;  5DO2 A;  1Q1C A;  2O9O A;  4QIB A;  4DRK A;  1NMV A;  2MNT A;  3ARU A;  1W9U A;  1KT1 A;  2DSW A;  3OA5 A;  3NRK A;  4FN2 A;  3BMB A;  3GTY X;  2JZV A;  1LL6 A;  1NH6 A;  3KAB A;  4R5E A;  2UZ5 A;  2PI6 A;  2ITK A;  1SYT A;  2PPO A;  5DIT A;  5DIV A;  1ITX A;  3O5G A;  3WD4 A;  2ZQT A;  2MLY A;  4JFI A;  4KQZ A;  4MAV A;  1HJV A;  2WM0 A;  1EIB A;  4ZPW R;  1NWR A;  2FKE A;  2G41 A;  2LKN A;  1KT0 A;  1SR0 A;  3I6C A;  1LL4 A;  2FAP A;  1LG2 A;  1ZCN A;  4R0X A;  1LJY A;  1Q6I A;  2F2D A;  3NTP A;  3BXW A;  1J4R A;  1ZK6 A;  4PTM A;  2B31 A;  1FAP A;  2LJ4 A;  2Y78 A;  2XPA A;  4ODM A;  1HJX A;  4QT3 A;  1N1A A;  1W1T A;  3JYM A;  4LAX A;  4DH0 A;  1J6Y A;  3ARO A;  5HWB A;  2F21 A;  1FKG A;  4N19 A; 
#chains in the Genus database with same CATH homology
 1EYM A;  3WIJ A;  2A3B A;  4TW7 A;  3O5P A;  3WQV A;  1LL7 A;  2DT1 A;  3UI6 A;  4DRQ A;  4HAR A;  3RM9 A;  4WKA A;  1ZU8 A;  3PA7 A;  4Z2H A;  4LGX A;  4XAK A;  2RUQ A;  4P8U A;  1YW5 A;  4HBO A;  4ODQ A;  2M08 A;  4DWS B;  3NI6 A;  3GPK A;  2KO7 A;  2DPE A;  1P5Q A;  5HT1 A;  3TC5 A;  2IUZ A;  4NSB A;  4DRO A;  1FKD A;  3ARY A;  3CHF A;  4WKH A;  1U79 A;  4IQC A;  4W9P A;  5HW6 A;  2MLX A;  4MNK A;  5HW7 A;  3UQA A;  1GUV A;  3O5J A;  4ITZ A;  1E6R A;  4DRP A;  1EHN A;  1W26 A;  1YAT A;  2LPV A;  5BXJ A;  1Q6U A;  4URI A;  3AS0 A;  4NNR A;  2VCD A;  4IQ2 A;  1ZB5 A;  1JVW A;  1JNS A;  1W1P A;  1BKF A;  4S3K A;  4ODP A;  3ARX A;  3UI4 A;  4DRI A;  2M1I A;  5J6E A;  4WJX A;  2XP8 A;  1FKI A;  4IPX A;  2XP6 A;  2WK2 A;  4TYO A;  4Z2G A;  1C9H A;  4DRM A;  1NSG A;  4GIV A;  1TFV A;  3ARS A;  1W9P A;  1QPL A;  1TCO C;  2PPP A;  2D9F A;  2RUD A;  4DZ3 A;  1HJW A;  2L2S A;  4MSP A;  3WL1 A;  2AWG A;  4QT2 A;  3KZ7 A;  4L72 B;  3O5O A;  3ALF A;  5DF0 A;  4BF8 A;  3B9A A;  1ZBC A;  1IX5 A;  2DG4 A;  3OOB A;  4GGQ A;  1E6N A;  1O6I A;  3WH0 A;  4MGV A;  1NWT A;  3CHC A;  2A3E A;  1NMW A;  5B8I C;  4WK9 A;  4ODR A;  1FKL A;  4MNM A;  1XHG A;  1W1V A;  3CGM A;  4W9Q A;  3WD2 A;  1HXV A;  1UR9 A;  3O5Q A;  1ZL1 A;  1CTN A;  2RUR A;  3O5M A;  2PBC A;  3AS3 A;  2DSV A;  4KR0 B;  3LUO A;  4WKF A;  1HKI A;  3AS1 A;  1FKR A;  4NZC A;  1J4I A;  1W9V A;  1OWQ A;  2K8I A;  2AOS A;  4C02 B;  2ZR5 A;  1ROT A;  4P8V A;  4JFK A;  2YBT A;  3RME A;  1QPF A;  4MNL A;  4S3J A;  1WAW A;  2XP5 A;  1FKB A;  1XRV A;  1M5Y A;  2DT0 A;  1BL4 A;  2MLZ A;  1D7H A;  1X6L A;  4DZ2 A;  4FAP A;  4L3N A;  1WB0 A;  3B9E A;  4U84 A;  4MNJ A;  1HKM A;  1W1Y A;  3FAP A;  2PV2 A;  5JH8 A;  3PR9 A;  5HTG A;  1R9H A;  4ZPT R;  3UF8 A;  1FKJ A;  4DRN A;  3AS2 A;  4W5U A;  1F40 A;  5DIU A;  1VF8 A;  3KCE A;  4JFL A;  1FD9 A;  4AY1 A;  1FKF A;  2RUC A;  3CHE A;  1LQ0 A;  3JXV A;  3KAH A;  3UI5 A;  2ZQV A;  3B7X A;  3WD0 A;  2KE0 A;  2KR7 A;  4LAV A;  1UR8 A;  3O5K A;  2WLZ A;  3WD1 A;  1EDQ A;  1Q6H A;  3RFW A;  2XPB A;  4IT6 A;  3ARZ A;  4Z2L A;  3FXY A;  4LAY A;  1H0G A;  3ARP A;  1D6O A;  2N87 A;  2PV1 A;  4J4N A;  2RSE A;  1HKJ A;  3O5I A;  3O5D A;  2VN1 A;  3ARV A;  3QOK A;  2DT2 A;  3AQU A;  4ODN A;  1GOI A;  3O5E A;  1FJD A;  1B6C A;  3ARR A;  4JYS A;  3PRB A;  1E9L A;  1D7I A;  4QZV B;  2ZQS A;  1JNT A;  3G6L A;  3ARQ A;  1NWS A;  1X6N A;  1NWU A;  3O5F A;  3RM8 A;  1LG1 A;  4G50 A;  5D75 A;  1EQ3 A;  2Q5A A;  5HW8 A;  1A7X A;  1E6Z A;  4JFJ A;  1FKH A;  3TCZ A;  1PIN A;  5HBF A;  2F4E A;  4ZS6 A;  4Z2K A;  2RQS A;  1ZBV A;  1OGB A;  1OGG A;  1WNO A;  4DWS D;  4JFM A;  4MPK A;  1QZ2 A;  1D7J A;  5GPR A;  4ZPV R;  4Z2J A;  3WQW A;  4DIP A;  2O92 A;  1FFR A;  5GQB A;  1PBK A;  3ARW A;  4Q22 A;  2MF9 A;  2KGJ A;  1HKK A;  4G2P A;  4W9O A;  3KAD A;  3UQI A;  1F8A B;  4DWS A;  1JND A;  3JYJ A;  4ODO A;  3PRD A;  2KFW A;  3IK8 A;  3O5L A;  3VAW A;  3CHD A;  3ODK A;  5HUA A;  3PRA A;  3KAF A;  2ZR4 A;  3IKG A;  2ESC A;  2PV3 A;  3W4R A;  2G8Z A;  4Q7N A;  2DSZ A;  2LGO A;  4P8X A;  3IHZ A;  2PPN A;  3KAG A;  4J4O A;  4ML4 A;  5DEZ A;  1FKT A;  4HBE A;  1E6P A;  4U86 A;  5I98 A;  2IF4 A;  4TW6 A;  1KFW A;  2YBU A;  4ODL A;  2ZR6 A;  2A3C A;  3KAI A;  1FKS A;  3RM4 A;  2FDM A;  4MTV A;  4TX0 A;  1H0I A;  3RGC A;  3O5R A;  1FFQ A;  3CZ8 A;  4U85 A;  1JNE A;  2XP9 A;  3B9D A;  1L1P A;  1ZBW A;  3EY6 A;  2QF8 A;  2ZQU A;  3WD3 A;  2OLH A;  1D2K A;  1E15 A;  3IKD A;  5HWC A;  2XP4 A;  4Z2I A;  2DG3 A;  3B8S A;  1ZBK A;  4DRJ A;  3UQB A;  2KI3 A;  4DWS C;  2XP3 A;  1GPF A;  4O2T A;  1J4H A;  1FKK A;  1RD6 A;  2M2A A;  4LAW A;  2MPH A;  3KAC A;  3WKZ A;  3WL0 A;  5HKG A;  2DSU A;  2DG9 A;  4TW8 A;  2XP7 A;  3FY1 A;  4P8W A;  2WLY A;  4DRH A;  3CGN A;  3MDY B;  3G6M A;  1Y0O A;  2DT3 A;  4ODK A;  2OFN A;  5GPG A;  2A3A A;  4DT4 A;  3CH9 A;  3ART A;  3TDB A;  1T11 A;  3H9R B;  4IT4 A;  1ROU A;  1K9T A;  3ALG A;  4WIW A;  4TNS A;  5DO2 A;  1Q1C A;  2O9O A;  4QIB A;  4DRK A;  1NMV A;  2MNT A;  3ARU A;  1W9U A;  1KT1 A;  2DSW A;  3OA5 A;  3NRK A;  4FN2 A;  2JZV A;  1LL6 A;  1NH6 A;  3KAB A;  4R5E A;  2UZ5 A;  2PI6 A;  2ITK A;  1SYT A;  2PPO A;  5DIT A;  5DIV A;  1ITX A;  3O5G A;  3WD4 A;  2ZQT A;  2MLY A;  4JFI A;  4KQZ A;  4MAV A;  1HJV A;  2WM0 A;  1EIB A;  4ZPW R;  1NWR A;  2FKE A;  2G41 A;  2LKN A;  1KT0 A;  1SR0 A;  3I6C A;  1LL4 A;  2FAP A;  1LG2 A;  1ZCN A;  4R0X A;  1LJY A;  1Q6I A;  2F2D A;  3BXW A;  3NTP A;  1J4R A;  1ZK6 A;  4PTM A;  2B31 A;  1FAP A;  2LJ4 A;  2Y78 A;  2XPA A;  4ODM A;  1HJX A;  4QT3 A;  1N1A A;  1W1T A;  3JYM A;  4LAX A;  4DH0 A;  1J6Y A;  3ARO A;  5HWB A;  2F21 A;  1FKG A;  4N19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...