1N1AA

Crystal structure of the n-terminal domain of human fkbp52
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
121
Chain Sequence
APLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP52
publication title Structure of the N-terminal domain of human FKBP52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 26
structure length 121
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1n1aA00
2IF4A 5I98A 2KE0A 1Y0OA 3GPKA 3O5RA 3RFWA 4FAPA 2KI3A 3KAFA 2ITKA 2XP6A 1ZCNA 2KR7A 1KT1A 1QZ2A 1D7JA 2KGJA 1PBKA 2K8IA 1P5QA 3CGNA 4MGVA 2RURA 3TDBA 3MDYB 2PPNA 4JFLA 4DRHA 5J6EA 1BKFA 2ZQVA 4W9QA 3TC5A 4J4OA 4DZ3A 3O5FA 3O5EA 3O5OA 4LAYA 5HWBA 3EY6A 4DRPA 1JNSA 5B8IC 1B6CA 5D75A 2LPVA 1FAPA 4QIBA 5HUAA 3ODKA 1FKBA 1NSGA 2KO7A 2MLYA 3O5QA 4TW7A 4TX0A 2XPAA 1Q6UA 1W26A 3JXVA 2RSEA 1FJDA 3LUOA 1BL4A 1QPFA 1ROUA 2XP3A 1FKGA 2OFNA 2VCDA 2XP5A 3PRBA 2XPBA 4ODNA 5HT1A 4DT4A 2PV3A 2RUQA 3UI6A 1NMWA 3H9RB 4G50A 1TCOC 2PV1A 3KAHA 4LAWA 5BXJA 1J6YA 2PPOA 2M1IA 3I6CA 2XP7A 4O2TA 2Y78A 3KAGA 2RUCA 4BF8A 1J4RA 2Q5AA 1EYMA 2ZR5A 1J4IA 2PBCA 4ODMA 1D6OA 2MLXA 3NRKA 3O5KA 5HTGA 2M08A 3RGCA 5HWCA 1F40A 4JYSA 3NTPA 4DIPA 3O5LA 3KABA 3PRDA 1F8AB 2XP4A 5HW6A 2LJ4A 2ZQSA 3O5GA 4MSPA 1JNTA 2AWGA 2F2DA 4J4NA 4U86A 4U85A 3WH0A 2F21A 1N1AA 3FAPA 1T11A 3UQBA 3KACA 4TW8A 3KADA 2DG3A 1JVWA 4DRJA 4ODKA 2XP9A 4JFKA 4ODPA 3TCZA 3UI4A 2ZR6A 2RUDA 4ODQA 3UI5A 1HXVA 1Q1CA 4IQCA 4JFIA 2LKNA 4JFJA 1A7XA 1PINA 3KZ7A 2LGOA 1L1PA 2L2SA 1FKKA 1FKTA 2FKEA 4W9OA 5HKGA 4QT3A 1FKRA 1NMVA 4R0XA 2PPPA 4DRIA 1KT0A 2M2AA 4TW6A 2ZR4A 3B7XA 2RQSA 1C9HA 4LAXA 4DZ2A 1FKFA 1Q6IA 3IKDA 3JYJA 2MLZA 4JFMA 4ODRA 1D7IA 1R9HA 4ODLA 4N19A 2VN1A 3PA7A 4GIVA 4NNRA 4GGQA 2PV2A 1ZK6A 4IPXA 5GPGA 4QT2A 1FKDA 3CGMA 4C02B 1D7HA 2MF9A 5HW7A 4TNSA 4FN2A 2KFWA 1FD9A 3O5PA 5DIVA 4W9PA 3O5IA 1FKJA 2MNTA 2F4EA 2D9FA 4ODOA 1FKHA 4DRNA 2DG4A 3IHZA 3OOBA 3IKGA 3VAWA 3O5MA 2ZQTA 3JYMA 4IQ2A 2XP8A 4U84A 1FKSA 3UF8A 1M5YA 1YATA 1YW5A 1U79A 2JZVA 3O5JA 4ITZA 4DRMA 2ZQUA 2UZ5A 3IK8A 1FKLA 3UQAA 2DG9A 3O5DA 3NI6A 1FKIA 2N87A 5HW8A 1J4HA 4DRKA 3KAIA 4DRQA 4DH0A 1EQ3A 4TYOA 3UQIA 4LAVA 4G2PA 1QPLA 5DITA 2MPHA 5DIUA 1ROTA 3KCEA 2FAPA 1Q6HA 4DROA
chains in the Genus database with same CATH superfamily
2IF4A 3WD3A 1Y0OA 2G8ZA 4FAPA 2ITKA 1NWTA 1LG1A 1PBKA 1P5QA 3TDBA 3MDYB 2PPNA 1HJXA 4IT6A 5J6EA 1BKFA 4HARA 3O5FA 3O5EA 4HBOA 3ARXA 1UR9A 3OA5A 1JNSA 4DRPA 1FAPA 5HUAA 5I98A 3ODKA 3AQUA 1NSGA 3BMBA 3O5QA 2RSEA 4Z2JA 1QPFA 3PRBA 2XP3A 5HT1A 3UI5A 4LGXA 1WB0A 2RUQA 4G50A 4LAWA 1WNOA 3I6CA 2Y78A 3KAGA 4PTMA 2WLZA 2ZR5A 1NWUA 1D6OA 2DT0A 5HTGA 1F40A 3KABA 3PRDA 2A3AA 2A3CA 2LJ4A 1H0IA 3O5GA 4MSPA 1E6RA 4KR0B 5GPRA 2F21A 3FAPA 3B9AA 3UQBA 1OWQA 3CHEA 3WD4A 4TW8A 3KADA 4DRJA 4ODPA 1JNDA 4JFKA 3PRAA 5DEZA 3UI4A 4ODQA 3GU0A 4MTVA 2LKNA 2LGOA 2YBUA 4DWSA 2FKEA 5HKGA 1FKRA 1NMVA 1KT0A 3AS1A 1LL7A 4TW6A 1FKFA 1Q6IA 4JFMA 2MLZA 4GIVA 1K9TA 1GPFA 4GGQA 1FKDA 2ESCA 4P8WA 3CGMA 1D7HA 3QOKA 2B31A 5DO2A 4WJXA 3AS0A 1FFQA 3O5PA 5GQBA 4W9PA 1VF8A 3ARRA 4W5UA 3RMEA 4DRNA 2DSUA 3OOBA 4IT4A 3O5MA 1YW5A 5HBFA 3UQAA 4DRMA 2ZQUA 3IK8A 1HJVA 1FKIA 2PN0A 1E15A 4DH0A 1EQ3A 1X6NA 4MNMA 4TYOA 2IUZA 3WQWA 5DIUA 2A3EA 2FAPA 2YBTA 1JNEA 4DROA 3GPKA 2KI3A 3KAFA 2XP6A 1ZCNA 2DSVA 2KR7A 1KT1A 2DSWA 2K8IA 4MGVA 2RURA 4JFLA 1W9UA 1W1VA 4DZ3A 3O5OA 3CH9A 1FKBA 1GOIA 3LUOA 4DWSD 2G41A 2VCDA 2O92A 1HKMA 3AS3A 3H9RB 1TCOC 2DT3A 4WKAA 3ARUA 4BF8A 2Q5AA 1EYMA 2DSZA 4S3JA 2MLXA 3O5KA 1RD6A 3NTPA 3O5LA 1F8AB 4P8UA 2OLHA 5JH8A 1H0GA 4U86A 2F2DA 3WH0A 3WL1A 4MNKA 3KACA 1NH6A 2P4VA 1JVWA 4WK9A 1LL4A 2WK2A 1HXVA 1Q1CA 4JFIA 4JFJA 2PI6A 1A7XA 4WKHA 1UR8A 1L1PA 3B8SA 4NSBA 1W1TA 1ZU8A 4Z2KA 4R0XA 1XHGA 2ZR4A 1C9HA 1GUVA 3IKDA 4ODRA 1NWSA 2ETNA 2VN1A 3G6MA 4QT2A 2MF9A 5HW7A 4MNLA 1FD9A 3AROA 3G6LA 4ODOA 1X6LA 2F4EA 1EIBA 3WL0A 1W1PA 3IKGA 4IQ2A 1FKSA 1M5YA 2JZVA 3ALFA 2DG9A 1E44A 4DRQA 3FXYA 3CHCA 4Z2IA 3B9DA 2EULA 3KCEA 1SR0A 2KE0A 3EIPA 3O5RA 4QZVB 3RM4A 4URIA 4R5EA 3CGNA 3CHDA 4UDMA 3CHFA 3PR9A 1JCHB 3WQVA 4DRHA 4W9QA 4J4OA 1W1YA 3EY6A 1HKIA 1B6CA 4TW7A 4P8VA 2KO7A 2MLYA 1IX5A 2XPAA 4KQZA 1W26A 4Z2LA 1ZBWA 3ARVA 1TFVA 1OGGA 1EHNA 2WM0A 4U84A 2OFNA 2XP5A 5DF0A 1FFRA 2PV3A 1HKKA 3UI6A 2PV1A 1J6YA 3RM9A 2PPOA 2M1IA 2XP7A 4O2TA 3W4RA 2RUCA 4Q7NA 4NZCA 1HKJA 2PBCA 3RGCA 4JYSA 2WLYA 2XP4A 4Q22A 4MNJA 1JNTA 4J4NA 1N1AA 1T11A 2QF8A 4ZPTR 2A3BA 4ODKA 4ZS6A 4ZPWR 1ZB5A 3KZ7A 1ZBKA 1FKKA 3BXWA 2PPPA 3B7XA 3ARYA 2B5UB 3JYJA 1R9HA 4ODLA 1HJWA 3GTYX 4NNRA 2PV2A 1ZK6A 4IPXA 2DT2A 3ARSA 4FN2A 3AS2A 4AY1A 3VAWA 1W9PA 2XP8A 1SYTA 4WIWA 1LG2A 1ITXA 3O5DA 3NI6A 1J4HA 1ZBVA 3KAIA 4DRKA 4G2PA 4XAKA 4ZPVR 5DITA 2MPHA 1ROTA 1Q6HA 1LQ0A 4DWSB 4S3KA 3RFWA 1E6NA 1QZ2A 1D7JA 2KGJA 1OGBA 4WKFA 4HBEA 2ZQVA 3TC5A 4ML4A 2O9OA 3WD0A 4LAYA 5HWBA 5B8IC 5D75A 2LPVA 4QIBA 2DPEA 5HWCA 4TX0A 1Q6UA 3JXVA 1FJDA 1ZL1A 3WD2A 3ARPA 1BL4A 1ROUA 4DT4A 1FKGA 1LL6A 4ODNA 2XPBA 2DT1A 1E6ZA 3ARQA 3ARTA 1NMWA 5BXJA 3ARWA 3KAHA 1GRJA 3FY1A 3ARZA 1J4RA 1J4IA 4ODMA 3NRKA 2FDMA 2M08A 1E9LA 4DIPA 5HW6A 1D2KA 3WKZA 2ZQSA 4U85A 2AWGA 3ALGA 1W9VA 1XRVA 4MAVA 2DG3A 3CZ8A 4DWSC 2XP9A 3TCZA 3WD1A 3RM8A 2ZR6A 2RUDA 4Z2HA 4IQCA 1NWRA 1PINA 3B9EA 2L2SA 4L72B 1FKTA 1LJYA 4W9OA 1WAWA 4QT3A 4DRIA 4Z2GA 1E6PA 2M2AA 2RQSA 4LAXA 4DZ2A 1EDQA 1D7IA 1KFWA 4N19A 4P8XA 3PA7A 5GPGA 4C02B 4TNSA 4MPKA 2KFWA 5DIVA 3O5IA 1FKJA 2MNTA 2D9FA 1FKHA 2DG4A 3IHZA 2ZQTA 3JYMA 3UF8A 1YATA 1U79A 3O5JA 4ITZA 2UZ5A 1FKLA 4L3NA 2F23A 1CTNA 2N87A 5HW8A 1O6IA 3UQIA 4LAVA 1ZBCA 2AOSA 1QPLA 3WIJA
chains in the Genus database with same CATH topology
2IF4A 3WD3A 1Y0OA 2G8ZA 4FAPA 2ITKA 1NWTA 1LG1A 1PBKA 1P5QA 3TDBA 3MDYB 2PPNA 1HJXA 4IT6A 5J6EA 1BKFA 4HARA 3O5FA 3O5EA 4HBOA 3ARXA 1UR9A 3OA5A 1JNSA 4DRPA 1FAPA 5HUAA 5I98A 3ODKA 3AQUA 1NSGA 3O5QA 2RSEA 4Z2JA 1QPFA 3PRBA 2XP3A 5HT1A 3UI5A 4LGXA 1WB0A 2RUQA 4G50A 4LAWA 1WNOA 3I6CA 2Y78A 3KAGA 4PTMA 2WLZA 2ZR5A 1NWUA 1D6OA 2DT0A 5HTGA 1F40A 3KABA 3PRDA 2A3AA 2A3CA 2LJ4A 1H0IA 3O5GA 4MSPA 1E6RA 4KR0B 5GPRA 2F21A 3FAPA 3B9AA 3UQBA 1OWQA 3CHEA 3WD4A 4TW8A 3KADA 4DRJA 4ODPA 1JNDA 4JFKA 3PRAA 5DEZA 3UI4A 4ODQA 4MTVA 2LKNA 2LGOA 2YBUA 4DWSA 2FKEA 5HKGA 1FKRA 1NMVA 1KT0A 3AS1A 1LL7A 4TW6A 1FKFA 1Q6IA 4JFMA 2MLZA 4GIVA 1K9TA 1GPFA 4GGQA 1FKDA 2ESCA 4P8WA 3CGMA 1D7HA 3QOKA 2B31A 5DO2A 4WJXA 3AS0A 1FFQA 3O5PA 5GQBA 4W9PA 1VF8A 3ARRA 4W5UA 3RMEA 4DRNA 2DSUA 3OOBA 4IT4A 3O5MA 1YW5A 5HBFA 3UQAA 4DRMA 2ZQUA 3IK8A 1HJVA 1FKIA 1E15A 4DH0A 1EQ3A 1X6NA 4MNMA 4TYOA 2IUZA 3WQWA 5DIUA 2A3EA 2FAPA 2YBTA 1JNEA 4DROA 3GPKA 2KI3A 3KAFA 2XP6A 1ZCNA 2DSVA 2KR7A 1KT1A 2DSWA 2K8IA 4MGVA 2RURA 4JFLA 1W9UA 1W1VA 4DZ3A 3O5OA 3CH9A 1FKBA 1GOIA 3LUOA 4DWSD 2G41A 2VCDA 2O92A 1HKMA 3AS3A 3H9RB 1TCOC 2DT3A 4WKAA 3ARUA 4BF8A 2Q5AA 1EYMA 2DSZA 4S3JA 2MLXA 3O5KA 1RD6A 3NTPA 3O5LA 1F8AB 4P8UA 2OLHA 5JH8A 1H0GA 4U86A 2F2DA 3WH0A 3WL1A 4MNKA 3KACA 1NH6A 1JVWA 4WK9A 1LL4A 2WK2A 1HXVA 1Q1CA 4JFIA 4JFJA 2PI6A 1A7XA 4WKHA 1UR8A 1L1PA 3B8SA 4NSBA 1W1TA 1ZU8A 4Z2KA 4R0XA 1XHGA 2ZR4A 1C9HA 1GUVA 3IKDA 4ODRA 1NWSA 2VN1A 3G6MA 4QT2A 2MF9A 5HW7A 4MNLA 1FD9A 3AROA 3G6LA 4ODOA 1X6LA 2F4EA 1EIBA 3WL0A 1W1PA 3IKGA 4IQ2A 1FKSA 1M5YA 2JZVA 3ALFA 2DG9A 4DRQA 3FXYA 3CHCA 4Z2IA 3B9DA 3KCEA 1SR0A 2KE0A 3O5RA 4QZVB 3RM4A 4URIA 4R5EA 3CGNA 3CHDA 3CHFA 3PR9A 3WQVA 4DRHA 4W9QA 4J4OA 1W1YA 3EY6A 1HKIA 1B6CA 4TW7A 4P8VA 2KO7A 2MLYA 1IX5A 2XPAA 4KQZA 1W26A 4Z2LA 1ZBWA 3ARVA 1TFVA 1OGGA 1EHNA 2WM0A 4U84A 2OFNA 2XP5A 5DF0A 1FFRA 2PV3A 1HKKA 3UI6A 2PV1A 1J6YA 3RM9A 2PPOA 2M1IA 2XP7A 4O2TA 3W4RA 2RUCA 4Q7NA 4NZCA 1HKJA 2PBCA 3RGCA 4JYSA 2WLYA 2XP4A 4Q22A 4MNJA 1JNTA 4J4NA 1N1AA 1T11A 2QF8A 4ZPTR 2A3BA 4ODKA 4ZS6A 4ZPWR 1ZB5A 3KZ7A 1ZBKA 1FKKA 3BXWA 2PPPA 3B7XA 3ARYA 3JYJA 1R9HA 4ODLA 1HJWA 4NNRA 2PV2A 1ZK6A 4IPXA 2DT2A 3ARSA 4FN2A 3AS2A 4AY1A 3VAWA 1W9PA 2XP8A 1SYTA 4WIWA 1ITXA 1LG2A 3O5DA 3NI6A 1J4HA 1ZBVA 3KAIA 4DRKA 4G2PA 4XAKA 4ZPVR 5DITA 2MPHA 1ROTA 1Q6HA 1LQ0A 4DWSB 4S3KA 3RFWA 1E6NA 1QZ2A 1D7JA 2KGJA 1OGBA 4WKFA 4HBEA 2ZQVA 3TC5A 4ML4A 2O9OA 3WD0A 4LAYA 5HWBA 5B8IC 5D75A 2LPVA 4QIBA 2DPEA 5HWCA 4TX0A 1Q6UA 3JXVA 1FJDA 1ZL1A 3WD2A 3ARPA 1BL4A 1ROUA 4DT4A 1FKGA 1LL6A 4ODNA 2XPBA 2DT1A 1E6ZA 3ARQA 3ARTA 1NMWA 5BXJA 3ARWA 3KAHA 3FY1A 3ARZA 1J4RA 1J4IA 4ODMA 3NRKA 2FDMA 2M08A 1E9LA 4DIPA 5HW6A 1D2KA 3WKZA 2ZQSA 4U85A 2AWGA 3ALGA 1W9VA 1XRVA 4MAVA 2DG3A 3CZ8A 4DWSC 2XP9A 3TCZA 3WD1A 3RM8A 2ZR6A 2RUDA 4Z2HA 4IQCA 1NWRA 1PINA 3B9EA 2L2SA 4L72B 1FKTA 1LJYA 4W9OA 1WAWA 4QT3A 4DRIA 4Z2GA 1E6PA 2M2AA 2RQSA 4LAXA 4DZ2A 1EDQA 1D7IA 1KFWA 4N19A 4P8XA 3PA7A 5GPGA 4C02B 4TNSA 4MPKA 2KFWA 5DIVA 3O5IA 1FKJA 2MNTA 2D9FA 1FKHA 2DG4A 3IHZA 2ZQTA 3JYMA 3UF8A 1YATA 1U79A 3O5JA 4ITZA 2UZ5A 1FKLA 4L3NA 1CTNA 2N87A 5HW8A 1O6IA 3UQIA 4LAVA 1ZBCA 2AOSA 1QPLA 3WIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IF4 A;  5I98 A;  2KE0 A;  1Y0O A;  3GPK A;  3O5R A;  3RFW A;  4FAP A;  2KI3 A;  3KAF A;  2ITK A;  2XP6 A;  1ZCN A;  2KR7 A;  1KT1 A;  1QZ2 A;  1D7J A;  2KGJ A;  1PBK A;  2K8I A;  1P5Q A;  3CGN A;  4MGV A;  2RUR A;  3TDB A;  3MDY B;  2PPN A;  4JFL A;  4DRH A;  5J6E A;  1BKF A;  2ZQV A;  4W9Q A;  3TC5 A;  4J4O A;  4DZ3 A;  3O5F A;  3O5E A;  3O5O A;  4LAY A;  5HWB A;  3EY6 A;  4DRP A;  1JNS A;  5B8I C;  1B6C A;  5D75 A;  2LPV A;  1FAP A;  4QIB A;  5HUA A;  3ODK A;  1FKB A;  1NSG A;  2KO7 A;  2MLY A;  3O5Q A;  4TW7 A;  4TX0 A;  2XPA A;  1Q6U A;  1W26 A;  3JXV A;  2RSE A;  1FJD A;  3LUO A;  1BL4 A;  1QPF A;  1ROU A;  2XP3 A;  1FKG A;  2OFN A;  2VCD A;  2XP5 A;  3PRB A;  2XPB A;  4ODN A;  5HT1 A;  4DT4 A;  2PV3 A;  2RUQ A;  3UI6 A;  1NMW A;  3H9R B;  4G50 A;  1TCO C;  2PV1 A;  3KAH A;  4LAW A;  5BXJ A;  1J6Y A;  2PPO A;  2M1I A;  3I6C A;  2XP7 A;  4O2T A;  2Y78 A;  3KAG A;  2RUC A;  4BF8 A;  1J4R A;  2Q5A A;  1EYM A;  2ZR5 A;  1J4I A;  2PBC A;  4ODM A;  1D6O A;  2MLX A;  3NRK A;  3O5K A;  5HTG A;  2M08 A;  3RGC A;  5HWC A;  1F40 A;  4JYS A;  3NTP A;  4DIP A;  3O5L A;  3KAB A;  3PRD A;  1F8A B;  2XP4 A;  5HW6 A;  2LJ4 A;  2ZQS A;  3O5G A;  4MSP A;  1JNT A;  2AWG A;  2F2D A;  4J4N A;  4U86 A;  4U85 A;  3WH0 A;  2F21 A;  1N1A A;  3FAP A;  1T11 A;  3UQB A;  3KAC A;  4TW8 A;  3KAD A;  2DG3 A;  1JVW A;  4DRJ A;  4ODK A;  2XP9 A;  4JFK A;  4ODP A;  3TCZ A;  3UI4 A;  2ZR6 A;  2RUD A;  4ODQ A;  3UI5 A;  1HXV A;  1Q1C A;  4IQC A;  4JFI A;  2LKN A;  4JFJ A;  1A7X A;  1PIN A;  3KZ7 A;  2LGO A;  1L1P A;  2L2S A;  1FKK A;  1FKT A;  2FKE A;  4W9O A;  5HKG A;  4QT3 A;  1FKR A;  1NMV A;  4R0X A;  2PPP A;  4DRI A;  1KT0 A;  2M2A A;  4TW6 A;  2ZR4 A;  3B7X A;  2RQS A;  1C9H A;  4LAX A;  4DZ2 A;  1FKF A;  1Q6I A;  3IKD A;  3JYJ A;  2MLZ A;  4JFM A;  4ODR A;  1D7I A;  1R9H A;  4ODL A;  4N19 A;  2VN1 A;  3PA7 A;  4GIV A;  4NNR A;  4GGQ A;  2PV2 A;  1ZK6 A;  4IPX A;  5GPG A;  4QT2 A;  1FKD A;  3CGM A;  4C02 B;  1D7H A;  2MF9 A;  5HW7 A;  4TNS A;  4FN2 A;  2KFW A;  1FD9 A;  3O5P A;  5DIV A;  4W9P A;  3O5I A;  1FKJ A;  2MNT A;  2F4E A;  2D9F A;  4ODO A;  1FKH A;  4DRN A;  2DG4 A;  3IHZ A;  3OOB A;  3IKG A;  3VAW A;  3O5M A;  2ZQT A;  3JYM A;  4IQ2 A;  2XP8 A;  4U84 A;  1FKS A;  3UF8 A;  1M5Y A;  1YAT A;  1YW5 A;  1U79 A;  2JZV A;  3O5J A;  4ITZ A;  4DRM A;  2ZQU A;  2UZ5 A;  3IK8 A;  1FKL A;  3UQA A;  2DG9 A;  3O5D A;  3NI6 A;  1FKI A;  2N87 A;  5HW8 A;  1J4H A;  4DRK A;  3KAI A;  4DRQ A;  4DH0 A;  1EQ3 A;  4TYO A;  3UQI A;  4LAV A;  4G2P A;  1QPL A;  5DIT A;  2MPH A;  5DIU A;  1ROT A;  3KCE A;  2FAP A;  1Q6H A;  4DRO A; 
#chains in the Genus database with same CATH topology
 2IF4 A;  3WD3 A;  1Y0O A;  2G8Z A;  4FAP A;  2ITK A;  1NWT A;  1LG1 A;  1PBK A;  1P5Q A;  3TDB A;  3MDY B;  2PPN A;  1HJX A;  4IT6 A;  5J6E A;  1BKF A;  4HAR A;  3O5F A;  3O5E A;  4HBO A;  3ARX A;  1UR9 A;  3OA5 A;  1JNS A;  4DRP A;  1FAP A;  5HUA A;  5I98 A;  3ODK A;  3AQU A;  1NSG A;  3BMB A;  3O5Q A;  2RSE A;  4Z2J A;  1QPF A;  3PRB A;  2XP3 A;  5HT1 A;  3UI5 A;  4LGX A;  1WB0 A;  2RUQ A;  4G50 A;  4LAW A;  1WNO A;  3I6C A;  2Y78 A;  3KAG A;  4PTM A;  2WLZ A;  2ZR5 A;  1NWU A;  1D6O A;  2DT0 A;  5HTG A;  1F40 A;  3KAB A;  3PRD A;  2A3A A;  2A3C A;  2LJ4 A;  1H0I A;  3O5G A;  4MSP A;  1E6R A;  4KR0 B;  5GPR A;  2F21 A;  3FAP A;  3B9A A;  3UQB A;  1OWQ A;  3CHE A;  3WD4 A;  4TW8 A;  3KAD A;  4DRJ A;  4ODP A;  1JND A;  4JFK A;  3PRA A;  5DEZ A;  3UI4 A;  4ODQ A;  3GU0 A;  4MTV A;  2LKN A;  2LGO A;  2YBU A;  4DWS A;  2FKE A;  5HKG A;  1FKR A;  1NMV A;  1KT0 A;  3AS1 A;  1LL7 A;  4TW6 A;  1FKF A;  1Q6I A;  4JFM A;  2MLZ A;  4GIV A;  1K9T A;  1GPF A;  4GGQ A;  1FKD A;  2ESC A;  4P8W A;  3CGM A;  1D7H A;  3QOK A;  2B31 A;  5DO2 A;  4WJX A;  3AS0 A;  1FFQ A;  3O5P A;  5GQB A;  4W9P A;  1VF8 A;  3ARR A;  4W5U A;  3RME A;  4DRN A;  2DSU A;  3OOB A;  4IT4 A;  3O5M A;  1YW5 A;  5HBF A;  3UQA A;  4DRM A;  2ZQU A;  3IK8 A;  1HJV A;  1FKI A;  2PN0 A;  1E15 A;  4DH0 A;  1EQ3 A;  1X6N A;  4MNM A;  4TYO A;  2IUZ A;  3WQW A;  5DIU A;  2A3E A;  2FAP A;  2YBT A;  1JNE A;  4DRO A;  3GPK A;  2KI3 A;  3KAF A;  2XP6 A;  1ZCN A;  2DSV A;  2KR7 A;  1KT1 A;  2DSW A;  2K8I A;  4MGV A;  2RUR A;  4JFL A;  1W9U A;  1W1V A;  4DZ3 A;  3O5O A;  3CH9 A;  1FKB A;  1GOI A;  3LUO A;  4DWS D;  2G41 A;  2VCD A;  2O92 A;  1HKM A;  3AS3 A;  3H9R B;  1TCO C;  2DT3 A;  4WKA A;  3ARU A;  4BF8 A;  2Q5A A;  1EYM A;  2DSZ A;  4S3J A;  2MLX A;  3O5K A;  1RD6 A;  3NTP A;  3O5L A;  1F8A B;  4P8U A;  2OLH A;  5JH8 A;  1H0G A;  4U86 A;  2F2D A;  3WH0 A;  3WL1 A;  4MNK A;  3KAC A;  1NH6 A;  2P4V A;  1JVW A;  4WK9 A;  1LL4 A;  2WK2 A;  1HXV A;  1Q1C A;  4JFI A;  4JFJ A;  2PI6 A;  1A7X A;  4WKH A;  1UR8 A;  1L1P A;  3B8S A;  4NSB A;  1W1T A;  1ZU8 A;  4Z2K A;  4R0X A;  1XHG A;  2ZR4 A;  1C9H A;  1GUV A;  3IKD A;  4ODR A;  1NWS A;  2ETN A;  2VN1 A;  3G6M A;  4QT2 A;  2MF9 A;  5HW7 A;  4MNL A;  1FD9 A;  3ARO A;  3G6L A;  4ODO A;  1X6L A;  2F4E A;  1EIB A;  3WL0 A;  1W1P A;  3IKG A;  4IQ2 A;  1FKS A;  1M5Y A;  2JZV A;  3ALF A;  2DG9 A;  1E44 A;  4DRQ A;  3FXY A;  3CHC A;  4Z2I A;  3B9D A;  2EUL A;  3KCE A;  1SR0 A;  2KE0 A;  3EIP A;  3O5R A;  4QZV B;  3RM4 A;  4URI A;  4R5E A;  3CGN A;  3CHD A;  4UDM A;  3CHF A;  3PR9 A;  1JCH B;  3WQV A;  4DRH A;  4W9Q A;  4J4O A;  1W1Y A;  3EY6 A;  1HKI A;  1B6C A;  4TW7 A;  4P8V A;  2KO7 A;  2MLY A;  1IX5 A;  2XPA A;  4KQZ A;  1W26 A;  4Z2L A;  1ZBW A;  3ARV A;  1TFV A;  1OGG A;  1EHN A;  2WM0 A;  4U84 A;  2OFN A;  2XP5 A;  5DF0 A;  1FFR A;  2PV3 A;  1HKK A;  3UI6 A;  2PV1 A;  1J6Y A;  3RM9 A;  2PPO A;  2M1I A;  2XP7 A;  4O2T A;  3W4R A;  2RUC A;  4Q7N A;  4NZC A;  1HKJ A;  2PBC A;  3RGC A;  4JYS A;  2WLY A;  2XP4 A;  4Q22 A;  4MNJ A;  1JNT A;  4J4N A;  1N1A A;  1T11 A;  2QF8 A;  4ZPT R;  2A3B A;  4ODK A;  4ZS6 A;  4ZPW R;  1ZB5 A;  3KZ7 A;  1ZBK A;  1FKK A;  3BXW A;  2PPP A;  3B7X A;  3ARY A;  2B5U B;  3JYJ A;  1R9H A;  4ODL A;  1HJW A;  3GTY X;  4NNR A;  2PV2 A;  1ZK6 A;  4IPX A;  2DT2 A;  3ARS A;  4FN2 A;  3AS2 A;  4AY1 A;  3VAW A;  1W9P A;  2XP8 A;  1SYT A;  4WIW A;  1LG2 A;  1ITX A;  3O5D A;  3NI6 A;  1J4H A;  1ZBV A;  3KAI A;  4DRK A;  4G2P A;  4XAK A;  4ZPV R;  5DIT A;  2MPH A;  1ROT A;  1Q6H A;  1LQ0 A;  4DWS B;  4S3K A;  3RFW A;  1E6N A;  1QZ2 A;  1D7J A;  2KGJ A;  1OGB A;  4WKF A;  4HBE A;  2ZQV A;  3TC5 A;  4ML4 A;  2O9O A;  3WD0 A;  4LAY A;  5HWB A;  5B8I C;  5D75 A;  2LPV A;  4QIB A;  2DPE A;  5HWC A;  4TX0 A;  1Q6U A;  3JXV A;  1FJD A;  1ZL1 A;  3WD2 A;  3ARP A;  1BL4 A;  1ROU A;  4DT4 A;  1FKG A;  1LL6 A;  4ODN A;  2XPB A;  2DT1 A;  1E6Z A;  3ARQ A;  3ART A;  1NMW A;  5BXJ A;  3ARW A;  3KAH A;  1GRJ A;  3FY1 A;  3ARZ A;  1J4R A;  1J4I A;  4ODM A;  3NRK A;  2FDM A;  2M08 A;  1E9L A;  4DIP A;  5HW6 A;  1D2K A;  3WKZ A;  2ZQS A;  4U85 A;  2AWG A;  3ALG A;  1W9V A;  1XRV A;  4MAV A;  2DG3 A;  3CZ8 A;  4DWS C;  2XP9 A;  3TCZ A;  3WD1 A;  3RM8 A;  2ZR6 A;  2RUD A;  4Z2H A;  4IQC A;  1NWR A;  1PIN A;  3B9E A;  2L2S A;  4L72 B;  1FKT A;  1LJY A;  4W9O A;  1WAW A;  4QT3 A;  4DRI A;  4Z2G A;  1E6P A;  2M2A A;  2RQS A;  4LAX A;  4DZ2 A;  1EDQ A;  1D7I A;  1KFW A;  4N19 A;  4P8X A;  3PA7 A;  5GPG A;  4C02 B;  4TNS A;  4MPK A;  2KFW A;  5DIV A;  3O5I A;  1FKJ A;  2MNT A;  2D9F A;  1FKH A;  2DG4 A;  3IHZ A;  2ZQT A;  3JYM A;  3UF8 A;  1YAT A;  1U79 A;  3O5J A;  4ITZ A;  2UZ5 A;  1FKL A;  4L3N A;  2F23 A;  1CTN A;  2N87 A;  5HW8 A;  1O6I A;  3UQI A;  4LAV A;  1ZBC A;  2AOS A;  1QPL A;  3WIJ A; 
#chains in the Genus database with same CATH homology
 2IF4 A;  3WD3 A;  1Y0O A;  2G8Z A;  4FAP A;  2ITK A;  1NWT A;  1LG1 A;  1PBK A;  1P5Q A;  3TDB A;  3MDY B;  2PPN A;  1HJX A;  4IT6 A;  5J6E A;  1BKF A;  4HAR A;  3O5F A;  3O5E A;  4HBO A;  3ARX A;  1UR9 A;  3OA5 A;  1JNS A;  4DRP A;  1FAP A;  5HUA A;  5I98 A;  3ODK A;  3AQU A;  1NSG A;  3O5Q A;  2RSE A;  4Z2J A;  1QPF A;  3PRB A;  2XP3 A;  5HT1 A;  3UI5 A;  4LGX A;  1WB0 A;  2RUQ A;  4G50 A;  4LAW A;  1WNO A;  3I6C A;  2Y78 A;  3KAG A;  4PTM A;  2WLZ A;  2ZR5 A;  1NWU A;  1D6O A;  2DT0 A;  5HTG A;  1F40 A;  3KAB A;  3PRD A;  2A3A A;  2A3C A;  2LJ4 A;  1H0I A;  3O5G A;  4MSP A;  1E6R A;  4KR0 B;  5GPR A;  2F21 A;  3FAP A;  3B9A A;  3UQB A;  1OWQ A;  3CHE A;  3WD4 A;  4TW8 A;  3KAD A;  4DRJ A;  4ODP A;  1JND A;  4JFK A;  3PRA A;  5DEZ A;  3UI4 A;  4ODQ A;  4MTV A;  2LKN A;  2LGO A;  2YBU A;  4DWS A;  2FKE A;  5HKG A;  1FKR A;  1NMV A;  1KT0 A;  3AS1 A;  1LL7 A;  4TW6 A;  1FKF A;  1Q6I A;  4JFM A;  2MLZ A;  4GIV A;  1K9T A;  1GPF A;  4GGQ A;  1FKD A;  2ESC A;  4P8W A;  3CGM A;  1D7H A;  3QOK A;  2B31 A;  5DO2 A;  4WJX A;  3AS0 A;  1FFQ A;  3O5P A;  5GQB A;  4W9P A;  1VF8 A;  3ARR A;  4W5U A;  3RME A;  4DRN A;  2DSU A;  3OOB A;  4IT4 A;  3O5M A;  1YW5 A;  5HBF A;  3UQA A;  4DRM A;  2ZQU A;  3IK8 A;  1HJV A;  1FKI A;  1E15 A;  4DH0 A;  1EQ3 A;  1X6N A;  4MNM A;  4TYO A;  2IUZ A;  3WQW A;  5DIU A;  2A3E A;  2FAP A;  2YBT A;  1JNE A;  4DRO A;  3GPK A;  2KI3 A;  3KAF A;  2XP6 A;  1ZCN A;  2DSV A;  2KR7 A;  1KT1 A;  2DSW A;  2K8I A;  4MGV A;  2RUR A;  4JFL A;  1W9U A;  1W1V A;  4DZ3 A;  3O5O A;  3CH9 A;  1FKB A;  1GOI A;  3LUO A;  4DWS D;  2G41 A;  2VCD A;  2O92 A;  1HKM A;  3AS3 A;  3H9R B;  1TCO C;  2DT3 A;  4WKA A;  3ARU A;  4BF8 A;  2Q5A A;  1EYM A;  2DSZ A;  4S3J A;  2MLX A;  3O5K A;  1RD6 A;  3NTP A;  3O5L A;  1F8A B;  4P8U A;  2OLH A;  5JH8 A;  1H0G A;  4U86 A;  2F2D A;  3WH0 A;  3WL1 A;  4MNK A;  3KAC A;  1NH6 A;  1JVW A;  4WK9 A;  1LL4 A;  2WK2 A;  1HXV A;  1Q1C A;  4JFI A;  4JFJ A;  2PI6 A;  1A7X A;  4WKH A;  1UR8 A;  1L1P A;  3B8S A;  4NSB A;  1W1T A;  1ZU8 A;  4Z2K A;  4R0X A;  1XHG A;  2ZR4 A;  1C9H A;  1GUV A;  3IKD A;  4ODR A;  1NWS A;  2VN1 A;  3G6M A;  4QT2 A;  2MF9 A;  5HW7 A;  4MNL A;  1FD9 A;  3ARO A;  3G6L A;  4ODO A;  1X6L A;  2F4E A;  1EIB A;  3WL0 A;  1W1P A;  3IKG A;  4IQ2 A;  1FKS A;  1M5Y A;  2JZV A;  3ALF A;  2DG9 A;  4DRQ A;  3FXY A;  3CHC A;  4Z2I A;  3B9D A;  3KCE A;  1SR0 A;  2KE0 A;  3O5R A;  4QZV B;  3RM4 A;  4URI A;  4R5E A;  3CGN A;  3CHD A;  3CHF A;  3PR9 A;  3WQV A;  4DRH A;  4W9Q A;  4J4O A;  1W1Y A;  3EY6 A;  1HKI A;  1B6C A;  4TW7 A;  4P8V A;  2KO7 A;  2MLY A;  1IX5 A;  2XPA A;  4KQZ A;  1W26 A;  4Z2L A;  1ZBW A;  3ARV A;  1TFV A;  1OGG A;  1EHN A;  2WM0 A;  4U84 A;  2OFN A;  2XP5 A;  5DF0 A;  1FFR A;  2PV3 A;  1HKK A;  3UI6 A;  2PV1 A;  1J6Y A;  3RM9 A;  2PPO A;  2M1I A;  2XP7 A;  4O2T A;  3W4R A;  2RUC A;  4Q7N A;  4NZC A;  1HKJ A;  2PBC A;  3RGC A;  4JYS A;  2WLY A;  2XP4 A;  4Q22 A;  4MNJ A;  1JNT A;  4J4N A;  1N1A A;  1T11 A;  2QF8 A;  4ZPT R;  2A3B A;  4ODK A;  4ZS6 A;  4ZPW R;  1ZB5 A;  3KZ7 A;  1ZBK A;  1FKK A;  3BXW A;  2PPP A;  3B7X A;  3ARY A;  3JYJ A;  1R9H A;  4ODL A;  1HJW A;  4NNR A;  2PV2 A;  1ZK6 A;  4IPX A;  2DT2 A;  3ARS A;  4FN2 A;  3AS2 A;  4AY1 A;  3VAW A;  1W9P A;  2XP8 A;  1SYT A;  4WIW A;  1ITX A;  1LG2 A;  3O5D A;  3NI6 A;  1J4H A;  1ZBV A;  3KAI A;  4DRK A;  4G2P A;  4XAK A;  4ZPV R;  5DIT A;  2MPH A;  1ROT A;  1Q6H A;  1LQ0 A;  4DWS B;  4S3K A;  3RFW A;  1E6N A;  1QZ2 A;  1D7J A;  2KGJ A;  1OGB A;  4WKF A;  4HBE A;  2ZQV A;  3TC5 A;  4ML4 A;  2O9O A;  3WD0 A;  4LAY A;  5HWB A;  5B8I C;  5D75 A;  2LPV A;  4QIB A;  2DPE A;  5HWC A;  4TX0 A;  1Q6U A;  3JXV A;  1FJD A;  1ZL1 A;  3WD2 A;  3ARP A;  1BL4 A;  1ROU A;  4DT4 A;  1FKG A;  1LL6 A;  4ODN A;  2XPB A;  2DT1 A;  1E6Z A;  3ARQ A;  3ART A;  1NMW A;  5BXJ A;  3ARW A;  3KAH A;  3FY1 A;  3ARZ A;  1J4R A;  1J4I A;  4ODM A;  3NRK A;  2FDM A;  2M08 A;  1E9L A;  4DIP A;  5HW6 A;  1D2K A;  3WKZ A;  2ZQS A;  4U85 A;  2AWG A;  3ALG A;  1W9V A;  1XRV A;  4MAV A;  2DG3 A;  3CZ8 A;  4DWS C;  2XP9 A;  3TCZ A;  3WD1 A;  3RM8 A;  2ZR6 A;  2RUD A;  4Z2H A;  4IQC A;  1NWR A;  1PIN A;  3B9E A;  2L2S A;  4L72 B;  1FKT A;  1LJY A;  4W9O A;  1WAW A;  4QT3 A;  4DRI A;  4Z2G A;  1E6P A;  2M2A A;  2RQS A;  4LAX A;  4DZ2 A;  1EDQ A;  1D7I A;  1KFW A;  4N19 A;  4P8X A;  3PA7 A;  5GPG A;  4C02 B;  4TNS A;  4MPK A;  2KFW A;  5DIV A;  3O5I A;  1FKJ A;  2MNT A;  2D9F A;  1FKH A;  2DG4 A;  3IHZ A;  2ZQT A;  3JYM A;  3UF8 A;  1YAT A;  1U79 A;  3O5J A;  4ITZ A;  2UZ5 A;  1FKL A;  4L3N A;  1CTN A;  2N87 A;  5HW8 A;  1O6I A;  3UQI A;  4LAV A;  1ZBC A;  2AOS A;  1QPL A;  3WIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...