1N1AA

Crystal structure of the n-terminal domain of human fkbp52
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
121
Chain Sequence
APLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP52
publication title Structure of the N-terminal domain of human FKBP52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 26
structure length 121
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1n1aA00
3FAPA 3NTPA 2PPOA 2XP8A 4TW8A 1ROUA 2D9FA 2JZVA 1TCOC 1J4HA 4W9QA 5D75A 3O5RA 2Q5AA 4JFLA 5HUAA 1EQ3A 2ZQTA 3ODKA 1NSGA 1PINA 3MDYB 4IQCA 5GPGA 4J4NA 5J6EA 4LAVA 2ZR6A 2XP4A 1BKFA 2KI3A 2XP6A 2PPNA 2RQSA 3KCEA 4JFKA 2L2SA 1FKIA 2MLYA 1FKSA 4N19A 1F40A 1T11A 2XPAA 1N1AA 3O5QA 3PRBA 2MF9A 5DITA 1FKFA 2DG4A 3GPKA 3KAHA 3KAFA 3O5GA 4IQ2A 4W9OA 4BF8A 5BXJA 3O5FA 1FD9A 1EYMA 1BL4A 4DRKA 3VAWA 1NMVA 1P5QA 3IHZA 4TX0A 4LAXA 1U79A 1FKJA 1J4RA 2XP3A 2ZQSA 4ODNA 4U85A 1ZK6A 2KGJA 3PA7A 2XP9A 2Y78A 2KO7A 3UQAA 2XPBA 2RUQA 1ZCNA 2AWGA 2RURA 5HKGA 4DRHA 3O5IA 2KR7A 4ODKA 4ODPA 3TC5A 1JNSA 3KAIA 3KABA 1ROTA 3IKGA 5HT1A 3NRKA 1Q1CA 3KADA 3TDBA 2FAPA 2XP7A 2M08A 4JYSA 4TYOA 3UI4A 2RUDA 1D7IA 2M2AA 1Q6UA 3I6CA 2K8IA 2DG3A 2VN1A 3H9RB 3RGCA 1FAPA 4DT4A 5B8IC 4DRQA 4DRIA 2F4EA 2PV2A 4MGVA 1J4IA 4JFIA 2LPVA 2LGOA 1Q6IA 4W9PA 3UI6A 4TW6A 4O2TA 2KFWA 2PV1A 3JYJA 1F8AB 2FKEA 1HXVA 4DZ3A 2OFNA 2RSEA 4ITZA 4J4OA 2MLXA 4DROA 4DRPA 3KZ7A 3O5JA 5HW8A 2VCDA 3B7XA 1D7HA 3O5MA 4NNRA 2F21A 5DIUA 1KT1A 2ZQVA 1FKKA 2RUCA 1PBKA 3TCZA 1NMWA 3LUOA 1D6OA 3NI6A 2MLZA 2N87A 1FKHA 2PBCA 4MSPA 4R0XA 4DZ2A 3UI5A 5HWCA 1M5YA 2UZ5A 4C02B 4GGQA 4IPXA 4GIVA 1QZ2A 2F2DA 1C9HA 2LKNA 1Y0OA 3WH0A 3UQIA 3UQBA 1FKRA 3O5DA 2ZQUA 1FKBA 3CGMA 4TNSA 4G2PA 4LAWA 4DRJA 1FKTA 3JXVA 5I98A 2MPHA 1A7XA 1J6YA 1L1PA 2PV3A 3EY6A 3O5OA 3KACA 1FKLA 3PRDA 1QPLA 3O5LA 2MNTA 1JNTA 5HWBA 4QT3A 4DH0A 3O5KA 2ITKA 2ZR4A 4JFJA 3O5EA 4QIBA 4FAPA 1FKDA 2PPPA 3O5PA 1JVWA 4DRMA 3KAGA 2DG9A 4TW7A 3RFWA 1Q6HA 2KE0A 4ODLA 4U84A 4ODQA 4DIPA 1W26A 1B6CA 3CGNA 5HW6A 4ODRA 4QT2A 1KT0A 5HW7A 1D7JA 4ODOA 4ODMA 4G50A 4JFMA 1YW5A 2IF4A 2LJ4A 1QPFA 1R9HA 2XP5A 4DRNA 4FN2A 3IK8A 4LAYA 4U86A 1FJDA 5HTGA 2M1IA 1YATA 3OOBA 3UF8A 5DIVA 2ZR5A 3IKDA 1FKGA 3JYMA
chains in the Genus database with same CATH superfamily
2AOSA 5HTGA 4W9QA 2Q5AA 1EQ3A 1NSGA 3WL1A 1VF8A 4MNKA 4W5UA 4LAVA 4DWSB 1EIBA 5DITA 1NH6A 1FKFA 4IQ2A 4MNLA 1HJWA 1LG2A 3VAWA 4NSBA 2WLZA 4Z2KA 1U79A 3RMEA 3RM4A 5DEZA 1X6LA 3PA7A 3B9AA 2Y78A 4IT6A 4ML4A 3UQAA 2XPBA 2RUQA 1W9VA 2RURA 2KR7A 3AROA 3AQUA 1W9UA 4IT4A 3G6MA 1ROTA 4LGXA 4UDMA 2PN0A 3QOKA 3RM8A 3UI4A 4Z2JA 1D2KA 3ARUA 4DWSA 2F4EA 2A3BA 4JFIA 1W1VA 2LGOA 3WD4A 1FFQA 3RM9A 4O2TA 2PV1A 1F8AB 2DSUA 1HXVA 4DZ3A 4DROA 2MLXA 1KFWA 2VCDA 3B7XA 4NNRA 4QZVB 2F21A 2ZQVA 1FKKA 3TCZA 2DT2A 4MAVA 4DZ2A 3UI5A 5HWCA 1LL6A 4GIVA 2DPEA 3AS0A 2LKNA 1ZBWA 1WB0A 4P8WA 1FKBA 2WM0A 3CGMA 4DRJA 5I98A 4WK9A 2EULA 1J6YA 1L1PA 3PRDA 4MTVA 1RD6A 3ARZA 4JFJA 3O5EA 4WKHA 3RFWA 2A3EA 5HW7A 4QT2A 1D7JA 3WD2A 2IF4A 2XP5A 2M1IA 3OOBA 3ALGA 3FAPA 3NTPA 3CHCA 4TW8A 1TCOC 1GOIA 3ARSA 4ZS6A 4IQCA 4S3JA 5GPGA 2DT1A 3ARPA 5J6EA 3KCEA 1BKFA 2RQSA 4N19A 1JNDA 3KAHA 5BXJA 4BF8A 3O5FA 1W1PA 3WD0A 1LL7A 1H0GA 1ZB5A 1BL4A 4NZCA 4DRKA 1NMVA 1IX5A 4XAKA 3IHZA 3ALFA 4LAXA 1FKJA 4ODNA 4U85A 3CHDA 1HJVA 1HKIA 2B5UB 4ODKA 4S3KA 3TC5A 3IKGA 1E6PA 1HJXA 2XP7A 3I6CA 2K8IA 2DG3A 2VN1A 3RGCA 4DT4A 3EIPA 4DRQA 3ARYA 2DSZA 3B9DA 4HBOA 1H0IA 4MGVA 1LQ0A 1J4IA 2QF8A 3ARWA 4MNMA 1LL4A 2KFWA 3JYJA 1FFRA 4WJXA 1FJDA 4J4OA 3O5JA 1KT1A 2RUCA 1PBKA 5GQBA 3LUOA 1D6OA 3NI6A 1FKHA 2PI6A 2UZ5A 4C02B 1JCHB 1OGBA 4GGQA 3PRAA 2F2DA 5HBFA 1Y0OA 4URIA 3UQBA 3O5DA 1FKTA 2DT3A 1NWTA 3EY6A 4Z2LA 3KACA 4Q22A 3WQWA 3O5LA 2MNTA 4QT3A 1CTNA 2ZR4A 4QIBA 3CHEA 1FKDA 3O5PA 1JVWA 4DRMA 3AS3A 3KAGA 2WK2A 5DO2A 4MNJA 1KT0A 4ODOA 2OLHA 4G50A 3CHFA 1YW5A 4FN2A 4DWSC 4WKFA 1YATA 3UF8A 1E15A 1FKGA 3JYMA 3GTYX 1EDQA 2XP8A 3UI6A 1ROUA 3O5RA 4JFLA 1SYTA 2ZQTA 3FY1A 3ODKA 1PINA 4R5EA 2G41A 2XP4A 2KI3A 1W1TA 2PPNA 4JFKA 2L2SA 1FKIA 1NWUA 2MLYA 3O5QA 3PRBA 2MF9A 2DG4A 1GPFA 1ZBCA 4MPKA 1TFVA 3G6LA 3ARRA 1P5QA 3WD1A 3AS2A 4TX0A 2ZQSA 2XP3A 1ZK6A 1HKJA 3FXYA 2YBUA 2A3CA 1ZCNA 2AWGA 5HKGA 1ZBKA 4DRHA 1UR9A 4ODPA 1K9TA 1LG1A 5HT1A 1Q1CA 3KADA 2FAPA 4JYSA 2M08A 3ARTA 2A3AA 1D7IA 3ARVA 1OWQA 1FAPA 1W9PA 3ARXA 3AS1A 5B8IC 3CH9A 1W1YA 2PV2A 2LPVA 2DSVA 4W9PA 5GPRA 1OGGA 4TW6A 1UR8A 1NWSA 2OFNA 3B8SA 4DRPA 3KZ7A 5DIUA 4Z2HA 1NMWA 2MLZA 2PBCA 4MSPA 4L3NA 1SR0A 2ETNA 1HKMA 1QZ2A 4Q7NA 4ZPTR 1E6ZA 3W4RA 1FKRA 2ZQUA 4TNSA 4G2PA 3WKZA 3JXVA 2MPHA 1O6IA 1A7XA 3O5OA 1FKLA 2ITKA 2B31A 4FAPA 2PPPA 4PTMA 2KE0A 4AY1A 4ODLA 1WAWA 4DIPA 1W26A 3CGNA 2IUZA 4HBEA 2LJ4A 1R9HA 5JH8A 3IK8A 4U86A 2ESCA 3WD3A 4KQZA 4WKAA 1ZBVA 1GUVA 2PPOA 4WIWA 2FDMA 2D9FA 2JZVA 4L72B 1J4HA 5D75A 5HUAA 3CZ8A 2DSWA 1ZU8A 3MDYB 4Z2IA 4J4NA 3WL0A 2ZR6A 2XP6A 1F40A 5DF0A 1FKSA 2WLYA 1T11A 2XPAA 1N1AA 4ZPVR 3WIJA 3GPKA 3O5GA 3KAFA 4W9OA 1EYMA 1FD9A 2O9OA 1LJYA 1E6NA 1EHNA 1J4RA 2KGJA 1ZL1A 1E44A 2XP9A 2KO7A 3BMBA 3O5IA 1JNSA 3KAIA 3KABA 4KR0B 2DT0A 3NRKA 1WNOA 3TDBA 4TYOA 1XHGA 2RUDA 2M2AA 1Q6UA 3H9RB 1ITXA 3PR9A 3WQVA 4DRIA 1X6NA 2G8ZA 2YBTA 4P8UA 3ARQA 1Q6IA 2FKEA 1JNEA 2RSEA 4ITZA 1NWRA 5HW8A 1E9LA 1GRJA 1D7HA 3O5MA 2P4VA 3B9EA 1HKKA 2N87A 4R0XA 3GU0A 1M5YA 4IPXA 4P8XA 1C9HA 3WH0A 3UQIA 3BXWA 4DWSD 4HARA 4Z2GA 4LAWA 1E6RA 2PV3A 4ZPWR 1QPLA 2F23A 1JNTA 5HWBA 4DH0A 3O5KA 4TW7A 2DG9A 2O92A 1Q6HA 4U84A 3OA5A 4ODQA 1B6CA 5HW6A 4ODRA 4ODMA 4JFMA 1XRVA 1QPFA 4DRNA 4LAYA 5DIVA 2ZR5A 3IKDA 4P8VA
chains in the Genus database with same CATH topology
2AOSA 5HTGA 4W9QA 2Q5AA 1EQ3A 1NSGA 3WL1A 1VF8A 4MNKA 4W5UA 4LAVA 4DWSB 1EIBA 5DITA 1NH6A 1FKFA 4IQ2A 4MNLA 1HJWA 1LG2A 3VAWA 4NSBA 2WLZA 4Z2KA 1U79A 3RMEA 3RM4A 5DEZA 1X6LA 3PA7A 3B9AA 2Y78A 4IT6A 4ML4A 3UQAA 2XPBA 2RUQA 1W9VA 2RURA 2KR7A 3AROA 3AQUA 1W9UA 4IT4A 3G6MA 1ROTA 4LGXA 3QOKA 3RM8A 3UI4A 4Z2JA 1D2KA 3ARUA 4DWSA 2F4EA 2A3BA 4JFIA 1W1VA 2LGOA 3WD4A 1FFQA 3RM9A 4O2TA 2PV1A 1F8AB 2DSUA 1HXVA 4DZ3A 4DROA 2MLXA 1KFWA 2VCDA 3B7XA 4NNRA 4QZVB 2F21A 2ZQVA 1FKKA 3TCZA 2DT2A 4MAVA 4DZ2A 3UI5A 5HWCA 1LL6A 4GIVA 2DPEA 3AS0A 2LKNA 1ZBWA 1WB0A 4P8WA 1FKBA 2WM0A 3CGMA 4DRJA 5I98A 4WK9A 1J6YA 1L1PA 3PRDA 4MTVA 1RD6A 3ARZA 4JFJA 3O5EA 4WKHA 3RFWA 2A3EA 5HW7A 4QT2A 1D7JA 3WD2A 2IF4A 2XP5A 2M1IA 3OOBA 3ALGA 3FAPA 3NTPA 3CHCA 4TW8A 1TCOC 1GOIA 3ARSA 4ZS6A 4IQCA 4S3JA 5GPGA 2DT1A 3ARPA 5J6EA 3KCEA 1BKFA 2RQSA 4N19A 1JNDA 3KAHA 5BXJA 4BF8A 3O5FA 1W1PA 3WD0A 1LL7A 1H0GA 1ZB5A 1BL4A 4NZCA 4DRKA 1NMVA 1IX5A 4XAKA 3IHZA 3ALFA 4LAXA 1FKJA 4ODNA 4U85A 3CHDA 1HJVA 1HKIA 4ODKA 4S3KA 3TC5A 3IKGA 1E6PA 1HJXA 2XP7A 3I6CA 2K8IA 2DG3A 2VN1A 3RGCA 4DT4A 4DRQA 3ARYA 2DSZA 3B9DA 4HBOA 1H0IA 4MGVA 1LQ0A 1J4IA 2QF8A 3ARWA 4MNMA 1LL4A 2KFWA 3JYJA 1FFRA 4WJXA 1FJDA 4J4OA 3O5JA 1KT1A 2RUCA 1PBKA 5GQBA 3LUOA 1D6OA 3NI6A 1FKHA 2PI6A 2UZ5A 4C02B 1OGBA 4GGQA 3PRAA 2F2DA 5HBFA 1Y0OA 4URIA 3UQBA 3O5DA 1FKTA 2DT3A 1NWTA 3EY6A 4Z2LA 3KACA 4Q22A 3WQWA 3O5LA 2MNTA 4QT3A 1CTNA 2ZR4A 4QIBA 3CHEA 1FKDA 3O5PA 1JVWA 4DRMA 3AS3A 3KAGA 2WK2A 5DO2A 4MNJA 1KT0A 4ODOA 2OLHA 4G50A 3CHFA 1YW5A 4FN2A 4DWSC 4WKFA 1YATA 3UF8A 1E15A 1FKGA 3JYMA 1EDQA 2XP8A 3UI6A 1ROUA 3O5RA 4JFLA 1SYTA 2ZQTA 3FY1A 3ODKA 1PINA 4R5EA 2G41A 2XP4A 2KI3A 1W1TA 2PPNA 4JFKA 2L2SA 1FKIA 1NWUA 2MLYA 3O5QA 3PRBA 2MF9A 2DG4A 1GPFA 1ZBCA 4MPKA 1TFVA 3G6LA 3ARRA 1P5QA 3WD1A 3AS2A 4TX0A 2ZQSA 2XP3A 1ZK6A 1HKJA 3FXYA 2YBUA 2A3CA 1ZCNA 2AWGA 5HKGA 1ZBKA 4DRHA 1UR9A 4ODPA 1K9TA 1LG1A 5HT1A 1Q1CA 3KADA 2FAPA 4JYSA 2M08A 3ARTA 2A3AA 1D7IA 3ARVA 1OWQA 1FAPA 1W9PA 3ARXA 3AS1A 5B8IC 3CH9A 1W1YA 2PV2A 2LPVA 2DSVA 4W9PA 5GPRA 1OGGA 4TW6A 1UR8A 1NWSA 2OFNA 3B8SA 4DRPA 3KZ7A 5DIUA 4Z2HA 1NMWA 2MLZA 2PBCA 4MSPA 4L3NA 1SR0A 1HKMA 1QZ2A 4Q7NA 4ZPTR 1E6ZA 3W4RA 1FKRA 2ZQUA 4TNSA 4G2PA 3WKZA 3JXVA 2MPHA 1O6IA 1A7XA 3O5OA 1FKLA 2ITKA 2B31A 4FAPA 2PPPA 4PTMA 2KE0A 4AY1A 4ODLA 1WAWA 4DIPA 1W26A 3CGNA 2IUZA 4HBEA 2LJ4A 1R9HA 5JH8A 3IK8A 4U86A 2ESCA 3WD3A 4KQZA 4WKAA 1ZBVA 1GUVA 2PPOA 4WIWA 2FDMA 2D9FA 2JZVA 4L72B 1J4HA 5D75A 5HUAA 3CZ8A 2DSWA 1ZU8A 3MDYB 4Z2IA 4J4NA 3WL0A 2ZR6A 2XP6A 1F40A 5DF0A 1FKSA 2WLYA 1T11A 2XPAA 1N1AA 4ZPVR 3WIJA 3GPKA 3O5GA 3KAFA 4W9OA 1EYMA 1FD9A 2O9OA 1LJYA 1E6NA 1EHNA 1J4RA 2KGJA 1ZL1A 2XP9A 2KO7A 3O5IA 1JNSA 3KAIA 3KABA 4KR0B 2DT0A 3NRKA 1WNOA 3TDBA 4TYOA 1XHGA 2RUDA 2M2AA 1Q6UA 3H9RB 1ITXA 3PR9A 3WQVA 4DRIA 1X6NA 2G8ZA 2YBTA 4P8UA 3ARQA 1Q6IA 2FKEA 1JNEA 2RSEA 4ITZA 1NWRA 5HW8A 1E9LA 1D7HA 3O5MA 3B9EA 1HKKA 2N87A 4R0XA 1M5YA 4IPXA 4P8XA 1C9HA 3WH0A 3UQIA 3BXWA 4DWSD 4HARA 4Z2GA 4LAWA 1E6RA 2PV3A 4ZPWR 1QPLA 1JNTA 5HWBA 4DH0A 3O5KA 4TW7A 2DG9A 2O92A 1Q6HA 4U84A 3OA5A 4ODQA 1B6CA 5HW6A 4ODRA 4ODMA 4JFMA 1XRVA 1QPFA 4DRNA 4LAYA 5DIVA 2ZR5A 3IKDA 4P8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAP A;  3NTP A;  2PPO A;  2XP8 A;  4TW8 A;  1ROU A;  2D9F A;  2JZV A;  1TCO C;  1J4H A;  4W9Q A;  5D75 A;  3O5R A;  2Q5A A;  4JFL A;  5HUA A;  1EQ3 A;  2ZQT A;  3ODK A;  1NSG A;  1PIN A;  3MDY B;  4IQC A;  5GPG A;  4J4N A;  5J6E A;  4LAV A;  2ZR6 A;  2XP4 A;  1BKF A;  2KI3 A;  2XP6 A;  2PPN A;  2RQS A;  3KCE A;  4JFK A;  2L2S A;  1FKI A;  2MLY A;  1FKS A;  4N19 A;  1F40 A;  1T11 A;  2XPA A;  1N1A A;  3O5Q A;  3PRB A;  2MF9 A;  5DIT A;  1FKF A;  2DG4 A;  3GPK A;  3KAH A;  3KAF A;  3O5G A;  4IQ2 A;  4W9O A;  4BF8 A;  5BXJ A;  3O5F A;  1FD9 A;  1EYM A;  1BL4 A;  4DRK A;  3VAW A;  1NMV A;  1P5Q A;  3IHZ A;  4TX0 A;  4LAX A;  1U79 A;  1FKJ A;  1J4R A;  2XP3 A;  2ZQS A;  4ODN A;  4U85 A;  1ZK6 A;  2KGJ A;  3PA7 A;  2XP9 A;  2Y78 A;  2KO7 A;  3UQA A;  2XPB A;  2RUQ A;  1ZCN A;  2AWG A;  2RUR A;  5HKG A;  4DRH A;  3O5I A;  2KR7 A;  4ODK A;  4ODP A;  3TC5 A;  1JNS A;  3KAI A;  3KAB A;  1ROT A;  3IKG A;  5HT1 A;  3NRK A;  1Q1C A;  3KAD A;  3TDB A;  2FAP A;  2XP7 A;  2M08 A;  4JYS A;  4TYO A;  3UI4 A;  2RUD A;  1D7I A;  2M2A A;  1Q6U A;  3I6C A;  2K8I A;  2DG3 A;  2VN1 A;  3H9R B;  3RGC A;  1FAP A;  4DT4 A;  5B8I C;  4DRQ A;  4DRI A;  2F4E A;  2PV2 A;  4MGV A;  1J4I A;  4JFI A;  2LPV A;  2LGO A;  1Q6I A;  4W9P A;  3UI6 A;  4TW6 A;  4O2T A;  2KFW A;  2PV1 A;  3JYJ A;  1F8A B;  2FKE A;  1HXV A;  4DZ3 A;  2OFN A;  2RSE A;  4ITZ A;  4J4O A;  2MLX A;  4DRO A;  4DRP A;  3KZ7 A;  3O5J A;  5HW8 A;  2VCD A;  3B7X A;  1D7H A;  3O5M A;  4NNR A;  2F21 A;  5DIU A;  1KT1 A;  2ZQV A;  1FKK A;  2RUC A;  1PBK A;  3TCZ A;  1NMW A;  3LUO A;  1D6O A;  3NI6 A;  2MLZ A;  2N87 A;  1FKH A;  2PBC A;  4MSP A;  4R0X A;  4DZ2 A;  3UI5 A;  5HWC A;  1M5Y A;  2UZ5 A;  4C02 B;  4GGQ A;  4IPX A;  4GIV A;  1QZ2 A;  2F2D A;  1C9H A;  2LKN A;  1Y0O A;  3WH0 A;  3UQI A;  3UQB A;  1FKR A;  3O5D A;  2ZQU A;  1FKB A;  3CGM A;  4TNS A;  4G2P A;  4LAW A;  4DRJ A;  1FKT A;  3JXV A;  5I98 A;  2MPH A;  1A7X A;  1J6Y A;  1L1P A;  2PV3 A;  3EY6 A;  3O5O A;  3KAC A;  1FKL A;  3PRD A;  1QPL A;  3O5L A;  2MNT A;  1JNT A;  5HWB A;  4QT3 A;  4DH0 A;  3O5K A;  2ITK A;  2ZR4 A;  4JFJ A;  3O5E A;  4QIB A;  4FAP A;  1FKD A;  2PPP A;  3O5P A;  1JVW A;  4DRM A;  3KAG A;  2DG9 A;  4TW7 A;  3RFW A;  1Q6H A;  2KE0 A;  4ODL A;  4U84 A;  4ODQ A;  4DIP A;  1W26 A;  1B6C A;  3CGN A;  5HW6 A;  4ODR A;  4QT2 A;  1KT0 A;  5HW7 A;  1D7J A;  4ODO A;  4ODM A;  4G50 A;  4JFM A;  1YW5 A;  2IF4 A;  2LJ4 A;  1QPF A;  1R9H A;  2XP5 A;  4DRN A;  4FN2 A;  3IK8 A;  4LAY A;  4U86 A;  1FJD A;  5HTG A;  2M1I A;  1YAT A;  3OOB A;  3UF8 A;  5DIV A;  2ZR5 A;  3IKD A;  1FKG A;  3JYM A; 
#chains in the Genus database with same CATH topology
 2AOS A;  5HTG A;  4W9Q A;  2Q5A A;  1EQ3 A;  1NSG A;  3WL1 A;  1VF8 A;  4MNK A;  4W5U A;  4LAV A;  4DWS B;  1EIB A;  5DIT A;  1NH6 A;  1FKF A;  4IQ2 A;  4MNL A;  1HJW A;  1LG2 A;  3VAW A;  4NSB A;  2WLZ A;  4Z2K A;  1U79 A;  3RME A;  3RM4 A;  5DEZ A;  1X6L A;  3PA7 A;  3B9A A;  2Y78 A;  4IT6 A;  4ML4 A;  3UQA A;  2XPB A;  2RUQ A;  1W9V A;  2RUR A;  2KR7 A;  3ARO A;  3AQU A;  1W9U A;  4IT4 A;  3G6M A;  1ROT A;  4LGX A;  4UDM A;  2PN0 A;  3QOK A;  3RM8 A;  3UI4 A;  4Z2J A;  1D2K A;  3ARU A;  4DWS A;  2F4E A;  2A3B A;  4JFI A;  1W1V A;  2LGO A;  3WD4 A;  1FFQ A;  3RM9 A;  4O2T A;  2PV1 A;  1F8A B;  2DSU A;  1HXV A;  4DZ3 A;  4DRO A;  2MLX A;  1KFW A;  2VCD A;  3B7X A;  4NNR A;  4QZV B;  2F21 A;  2ZQV A;  1FKK A;  3TCZ A;  2DT2 A;  4MAV A;  4DZ2 A;  3UI5 A;  5HWC A;  1LL6 A;  4GIV A;  2DPE A;  3AS0 A;  2LKN A;  1ZBW A;  1WB0 A;  4P8W A;  1FKB A;  2WM0 A;  3CGM A;  4DRJ A;  5I98 A;  4WK9 A;  2EUL A;  1J6Y A;  1L1P A;  3PRD A;  4MTV A;  1RD6 A;  3ARZ A;  4JFJ A;  3O5E A;  4WKH A;  3RFW A;  2A3E A;  5HW7 A;  4QT2 A;  1D7J A;  3WD2 A;  2IF4 A;  2XP5 A;  2M1I A;  3OOB A;  3ALG A;  3FAP A;  3NTP A;  3CHC A;  4TW8 A;  1TCO C;  1GOI A;  3ARS A;  4ZS6 A;  4IQC A;  4S3J A;  5GPG A;  2DT1 A;  3ARP A;  5J6E A;  3KCE A;  1BKF A;  2RQS A;  4N19 A;  1JND A;  3KAH A;  5BXJ A;  4BF8 A;  3O5F A;  1W1P A;  3WD0 A;  1LL7 A;  1H0G A;  1ZB5 A;  1BL4 A;  4NZC A;  4DRK A;  1NMV A;  1IX5 A;  4XAK A;  3IHZ A;  3ALF A;  4LAX A;  1FKJ A;  4ODN A;  4U85 A;  3CHD A;  1HJV A;  1HKI A;  2B5U B;  4ODK A;  4S3K A;  3TC5 A;  3IKG A;  1E6P A;  1HJX A;  2XP7 A;  3I6C A;  2K8I A;  2DG3 A;  2VN1 A;  3RGC A;  4DT4 A;  3EIP A;  4DRQ A;  3ARY A;  2DSZ A;  3B9D A;  4HBO A;  1H0I A;  4MGV A;  1LQ0 A;  1J4I A;  2QF8 A;  3ARW A;  4MNM A;  1LL4 A;  2KFW A;  3JYJ A;  1FFR A;  4WJX A;  1FJD A;  4J4O A;  3O5J A;  1KT1 A;  2RUC A;  1PBK A;  5GQB A;  3LUO A;  1D6O A;  3NI6 A;  1FKH A;  2PI6 A;  2UZ5 A;  4C02 B;  1JCH B;  1OGB A;  4GGQ A;  3PRA A;  2F2D A;  5HBF A;  1Y0O A;  4URI A;  3UQB A;  3O5D A;  1FKT A;  2DT3 A;  1NWT A;  3EY6 A;  4Z2L A;  3KAC A;  4Q22 A;  3WQW A;  3O5L A;  2MNT A;  4QT3 A;  1CTN A;  2ZR4 A;  4QIB A;  3CHE A;  1FKD A;  3O5P A;  1JVW A;  4DRM A;  3AS3 A;  3KAG A;  2WK2 A;  5DO2 A;  4MNJ A;  1KT0 A;  4ODO A;  2OLH A;  4G50 A;  3CHF A;  1YW5 A;  4FN2 A;  4DWS C;  4WKF A;  1YAT A;  3UF8 A;  1E15 A;  1FKG A;  3JYM A;  3GTY X;  1EDQ A;  2XP8 A;  3UI6 A;  1ROU A;  3O5R A;  4JFL A;  1SYT A;  2ZQT A;  3FY1 A;  3ODK A;  1PIN A;  4R5E A;  2G41 A;  2XP4 A;  2KI3 A;  1W1T A;  2PPN A;  4JFK A;  2L2S A;  1FKI A;  1NWU A;  2MLY A;  3O5Q A;  3PRB A;  2MF9 A;  2DG4 A;  1GPF A;  1ZBC A;  4MPK A;  1TFV A;  3G6L A;  3ARR A;  1P5Q A;  3WD1 A;  3AS2 A;  4TX0 A;  2ZQS A;  2XP3 A;  1ZK6 A;  1HKJ A;  3FXY A;  2YBU A;  2A3C A;  1ZCN A;  2AWG A;  5HKG A;  1ZBK A;  4DRH A;  1UR9 A;  4ODP A;  1K9T A;  1LG1 A;  5HT1 A;  1Q1C A;  3KAD A;  2FAP A;  4JYS A;  2M08 A;  3ART A;  2A3A A;  1D7I A;  3ARV A;  1OWQ A;  1FAP A;  1W9P A;  3ARX A;  3AS1 A;  5B8I C;  3CH9 A;  1W1Y A;  2PV2 A;  2LPV A;  2DSV A;  4W9P A;  5GPR A;  1OGG A;  4TW6 A;  1UR8 A;  1NWS A;  2OFN A;  3B8S A;  4DRP A;  3KZ7 A;  5DIU A;  4Z2H A;  1NMW A;  2MLZ A;  2PBC A;  4MSP A;  4L3N A;  1SR0 A;  2ETN A;  1HKM A;  1QZ2 A;  4Q7N A;  4ZPT R;  1E6Z A;  3W4R A;  1FKR A;  2ZQU A;  4TNS A;  4G2P A;  3WKZ A;  3JXV A;  2MPH A;  1O6I A;  1A7X A;  3O5O A;  1FKL A;  2ITK A;  2B31 A;  4FAP A;  2PPP A;  4PTM A;  2KE0 A;  4AY1 A;  4ODL A;  1WAW A;  4DIP A;  1W26 A;  3CGN A;  2IUZ A;  4HBE A;  2LJ4 A;  1R9H A;  5JH8 A;  3IK8 A;  4U86 A;  2ESC A;  3WD3 A;  4KQZ A;  4WKA A;  1ZBV A;  1GUV A;  2PPO A;  4WIW A;  2FDM A;  2D9F A;  2JZV A;  4L72 B;  1J4H A;  5D75 A;  5HUA A;  3CZ8 A;  2DSW A;  1ZU8 A;  3MDY B;  4Z2I A;  4J4N A;  3WL0 A;  2ZR6 A;  2XP6 A;  1F40 A;  5DF0 A;  1FKS A;  2WLY A;  1T11 A;  2XPA A;  1N1A A;  4ZPV R;  3WIJ A;  3GPK A;  3O5G A;  3KAF A;  4W9O A;  1EYM A;  1FD9 A;  2O9O A;  1LJY A;  1E6N A;  1EHN A;  1J4R A;  2KGJ A;  1ZL1 A;  1E44 A;  2XP9 A;  2KO7 A;  3BMB A;  3O5I A;  1JNS A;  3KAI A;  3KAB A;  4KR0 B;  2DT0 A;  3NRK A;  1WNO A;  3TDB A;  4TYO A;  1XHG A;  2RUD A;  2M2A A;  1Q6U A;  3H9R B;  1ITX A;  3PR9 A;  3WQV A;  4DRI A;  1X6N A;  2G8Z A;  2YBT A;  4P8U A;  3ARQ A;  1Q6I A;  2FKE A;  1JNE A;  2RSE A;  4ITZ A;  1NWR A;  5HW8 A;  1E9L A;  1GRJ A;  1D7H A;  3O5M A;  2P4V A;  3B9E A;  1HKK A;  2N87 A;  4R0X A;  3GU0 A;  1M5Y A;  4IPX A;  4P8X A;  1C9H A;  3WH0 A;  3UQI A;  3BXW A;  4DWS D;  4HAR A;  4Z2G A;  4LAW A;  1E6R A;  2PV3 A;  4ZPW R;  1QPL A;  2F23 A;  1JNT A;  5HWB A;  4DH0 A;  3O5K A;  4TW7 A;  2DG9 A;  2O92 A;  1Q6H A;  4U84 A;  3OA5 A;  4ODQ A;  1B6C A;  5HW6 A;  4ODR A;  4ODM A;  4JFM A;  1XRV A;  1QPF A;  4DRN A;  4LAY A;  5DIV A;  2ZR5 A;  3IKD A;  4P8V A; 
#chains in the Genus database with same CATH homology
 2AOS A;  5HTG A;  4W9Q A;  2Q5A A;  1EQ3 A;  1NSG A;  3WL1 A;  1VF8 A;  4MNK A;  4W5U A;  4LAV A;  4DWS B;  1EIB A;  5DIT A;  1NH6 A;  1FKF A;  4IQ2 A;  4MNL A;  1HJW A;  1LG2 A;  3VAW A;  4NSB A;  2WLZ A;  4Z2K A;  1U79 A;  3RME A;  3RM4 A;  5DEZ A;  1X6L A;  3PA7 A;  3B9A A;  2Y78 A;  4IT6 A;  4ML4 A;  3UQA A;  2XPB A;  2RUQ A;  1W9V A;  2RUR A;  2KR7 A;  3ARO A;  3AQU A;  1W9U A;  4IT4 A;  3G6M A;  1ROT A;  4LGX A;  3QOK A;  3RM8 A;  3UI4 A;  4Z2J A;  1D2K A;  3ARU A;  4DWS A;  2F4E A;  2A3B A;  4JFI A;  1W1V A;  2LGO A;  3WD4 A;  1FFQ A;  3RM9 A;  4O2T A;  2PV1 A;  1F8A B;  2DSU A;  1HXV A;  4DZ3 A;  4DRO A;  2MLX A;  1KFW A;  2VCD A;  3B7X A;  4NNR A;  4QZV B;  2F21 A;  2ZQV A;  1FKK A;  3TCZ A;  2DT2 A;  4MAV A;  4DZ2 A;  3UI5 A;  5HWC A;  1LL6 A;  4GIV A;  2DPE A;  3AS0 A;  2LKN A;  1ZBW A;  1WB0 A;  4P8W A;  1FKB A;  2WM0 A;  3CGM A;  4DRJ A;  5I98 A;  4WK9 A;  1J6Y A;  1L1P A;  3PRD A;  4MTV A;  1RD6 A;  3ARZ A;  4JFJ A;  3O5E A;  4WKH A;  3RFW A;  2A3E A;  5HW7 A;  4QT2 A;  1D7J A;  3WD2 A;  2IF4 A;  2XP5 A;  2M1I A;  3OOB A;  3ALG A;  3FAP A;  3NTP A;  3CHC A;  4TW8 A;  1TCO C;  1GOI A;  3ARS A;  4ZS6 A;  4IQC A;  4S3J A;  5GPG A;  2DT1 A;  3ARP A;  5J6E A;  3KCE A;  1BKF A;  2RQS A;  4N19 A;  1JND A;  3KAH A;  5BXJ A;  4BF8 A;  3O5F A;  1W1P A;  3WD0 A;  1LL7 A;  1H0G A;  1ZB5 A;  1BL4 A;  4NZC A;  4DRK A;  1NMV A;  1IX5 A;  4XAK A;  3IHZ A;  3ALF A;  4LAX A;  1FKJ A;  4ODN A;  4U85 A;  3CHD A;  1HJV A;  1HKI A;  4ODK A;  4S3K A;  3TC5 A;  3IKG A;  1E6P A;  1HJX A;  2XP7 A;  3I6C A;  2K8I A;  2DG3 A;  2VN1 A;  3RGC A;  4DT4 A;  4DRQ A;  3ARY A;  2DSZ A;  3B9D A;  4HBO A;  1H0I A;  4MGV A;  1LQ0 A;  1J4I A;  2QF8 A;  3ARW A;  4MNM A;  1LL4 A;  2KFW A;  3JYJ A;  1FFR A;  4WJX A;  1FJD A;  4J4O A;  3O5J A;  1KT1 A;  2RUC A;  1PBK A;  5GQB A;  3LUO A;  1D6O A;  3NI6 A;  1FKH A;  2PI6 A;  2UZ5 A;  4C02 B;  1OGB A;  4GGQ A;  3PRA A;  2F2D A;  5HBF A;  1Y0O A;  4URI A;  3UQB A;  3O5D A;  1FKT A;  2DT3 A;  1NWT A;  3EY6 A;  4Z2L A;  3KAC A;  4Q22 A;  3WQW A;  3O5L A;  2MNT A;  4QT3 A;  1CTN A;  2ZR4 A;  4QIB A;  3CHE A;  1FKD A;  3O5P A;  1JVW A;  4DRM A;  3AS3 A;  3KAG A;  2WK2 A;  5DO2 A;  4MNJ A;  1KT0 A;  4ODO A;  2OLH A;  4G50 A;  3CHF A;  1YW5 A;  4FN2 A;  4DWS C;  4WKF A;  1YAT A;  3UF8 A;  1E15 A;  1FKG A;  3JYM A;  1EDQ A;  2XP8 A;  3UI6 A;  1ROU A;  3O5R A;  4JFL A;  1SYT A;  2ZQT A;  3FY1 A;  3ODK A;  1PIN A;  4R5E A;  2G41 A;  2XP4 A;  2KI3 A;  1W1T A;  2PPN A;  4JFK A;  2L2S A;  1FKI A;  1NWU A;  2MLY A;  3O5Q A;  3PRB A;  2MF9 A;  2DG4 A;  1GPF A;  1ZBC A;  4MPK A;  1TFV A;  3G6L A;  3ARR A;  1P5Q A;  3WD1 A;  3AS2 A;  4TX0 A;  2ZQS A;  2XP3 A;  1ZK6 A;  1HKJ A;  3FXY A;  2YBU A;  2A3C A;  1ZCN A;  2AWG A;  5HKG A;  1ZBK A;  4DRH A;  1UR9 A;  4ODP A;  1K9T A;  1LG1 A;  5HT1 A;  1Q1C A;  3KAD A;  2FAP A;  4JYS A;  2M08 A;  3ART A;  2A3A A;  1D7I A;  3ARV A;  1OWQ A;  1FAP A;  1W9P A;  3ARX A;  3AS1 A;  5B8I C;  3CH9 A;  1W1Y A;  2PV2 A;  2LPV A;  2DSV A;  4W9P A;  5GPR A;  1OGG A;  4TW6 A;  1UR8 A;  1NWS A;  2OFN A;  3B8S A;  4DRP A;  3KZ7 A;  5DIU A;  4Z2H A;  1NMW A;  2MLZ A;  2PBC A;  4MSP A;  4L3N A;  1SR0 A;  1HKM A;  1QZ2 A;  4Q7N A;  4ZPT R;  1E6Z A;  3W4R A;  1FKR A;  2ZQU A;  4TNS A;  4G2P A;  3WKZ A;  3JXV A;  2MPH A;  1O6I A;  1A7X A;  3O5O A;  1FKL A;  2ITK A;  2B31 A;  4FAP A;  2PPP A;  4PTM A;  2KE0 A;  4AY1 A;  4ODL A;  1WAW A;  4DIP A;  1W26 A;  3CGN A;  2IUZ A;  4HBE A;  2LJ4 A;  1R9H A;  5JH8 A;  3IK8 A;  4U86 A;  2ESC A;  3WD3 A;  4KQZ A;  4WKA A;  1ZBV A;  1GUV A;  2PPO A;  4WIW A;  2FDM A;  2D9F A;  2JZV A;  4L72 B;  1J4H A;  5D75 A;  5HUA A;  3CZ8 A;  2DSW A;  1ZU8 A;  3MDY B;  4Z2I A;  4J4N A;  3WL0 A;  2ZR6 A;  2XP6 A;  1F40 A;  5DF0 A;  1FKS A;  2WLY A;  1T11 A;  2XPA A;  1N1A A;  4ZPV R;  3WIJ A;  3GPK A;  3O5G A;  3KAF A;  4W9O A;  1EYM A;  1FD9 A;  2O9O A;  1LJY A;  1E6N A;  1EHN A;  1J4R A;  2KGJ A;  1ZL1 A;  2XP9 A;  2KO7 A;  3O5I A;  1JNS A;  3KAI A;  3KAB A;  4KR0 B;  2DT0 A;  3NRK A;  1WNO A;  3TDB A;  4TYO A;  1XHG A;  2RUD A;  2M2A A;  1Q6U A;  3H9R B;  1ITX A;  3PR9 A;  3WQV A;  4DRI A;  1X6N A;  2G8Z A;  2YBT A;  4P8U A;  3ARQ A;  1Q6I A;  2FKE A;  1JNE A;  2RSE A;  4ITZ A;  1NWR A;  5HW8 A;  1E9L A;  1D7H A;  3O5M A;  3B9E A;  1HKK A;  2N87 A;  4R0X A;  1M5Y A;  4IPX A;  4P8X A;  1C9H A;  3WH0 A;  3UQI A;  3BXW A;  4DWS D;  4HAR A;  4Z2G A;  4LAW A;  1E6R A;  2PV3 A;  4ZPW R;  1QPL A;  1JNT A;  5HWB A;  4DH0 A;  3O5K A;  4TW7 A;  2DG9 A;  2O92 A;  1Q6H A;  4U84 A;  3OA5 A;  4ODQ A;  1B6C A;  5HW6 A;  4ODR A;  4ODM A;  4JFM A;  1XRV A;  1QPF A;  4DRN A;  4LAY A;  5DIV A;  2ZR5 A;  3IKD A;  4P8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...