1N1AA

Crystal structure of the n-terminal domain of human fkbp52
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
121
Chain Sequence
APLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N-terminal domain of human FKBP52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FKBP52
total genus 26
structure length 121
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1n1aA00
1A7XA 2UZ5A 3TCZA 1F40A 1QPFA 2DG4A 2F2DA 1U79A 3NTPA 1FKLA 1Y0OA 4TW7A 3WH0A 1KT1A 4ODLA 3UQAA 1C9HA 2MPHA 2LKNA 4FN2A 5HUAA 4R0XA 3KADA 2N87A 2KR7A 4TNSA 4TW6A 4JFJA 2Y78A 5B8IC 1D7IA 2XP8A 2L2SA 4W9OA 1BL4A 2M2AA 3IK8A 4DH0A 2ZR5A 2KE0A 4DRPA 5HWCA 1FKRA 1M5YA 4JFMA 2FKEA 4W9PA 1D7HA 1FKGA 1FKFA 2LJ4A 2PBCA 2RUQA 4U86A 1TCOC 4U84A 1FKSA 5BXJA 4IPXA 4W9QA 2F21A 1J4HA 2XP9A 5HW6A 3UI4A 4FAPA 4DT4A 4IQ2A 5I98A 3H9RB 1F8AB 2ZQSA 4JFIA 1Q1CA 1YW5A 4ODQA 2KFWA 3KABA 3UI6A 1J6YA 1L1PA 1P5QA 3O5EA 2JZVA 4ODKA 3MDYB 3I6CA 1FD9A 2M08A 2ZR4A 1J4IA 3KCEA 3TC5A 4C02B 2MNTA 3O5KA 3O5IA 1Q6UA 1ROUA 3RFWA 1FAPA 1QZ2A 1BKFA 3JXVA 2ZR6A 3IKDA 1PINA 2MF9A 3O5JA 3UQIA 3JYJA 5HWBA 4MSPA 2MLZA 3O5DA 2Q5AA 1FKBA 3O5QA 3O5MA 4ITZA 1NMWA 2PPOA 5D75A 5HTGA 3PRBA 4DZ2A 2RSEA 4TYOA 3OOBA 1FKIA 1J4RA 2OFNA 1D6OA 4ODOA 2LPVA 3VAWA 4U85A 1Q6HA 1FKTA 3O5RA 4DRHA 4LAWA 3KAIA 1R9HA 1ZK6A 2XP5A 4DZ3A 4DRIA 3JYMA 3KAFA 3KZ7A 4JYSA 1KT0A 4QIBA 5HT1A 2KI3A 2PV3A 4GGQA 4JFLA 3GPKA 2LGOA 1JNSA 1HXVA 1N1AA 2RURA 1T11A 3RGCA 2XP6A 3O5GA 4QT3A 4GIVA 2PPNA 2RUDA 4DRNA 4DROA 4G50A 2AWGA 2D9FA 4DRMA 2RQSA 4DRJA 2ZQVA 2IF4A 2RUCA 4J4OA 2XPAA 4LAVA 4LAYA 3UQBA 3O5FA 4BF8A 2VN1A 1JNTA 4JFKA 3ODKA 1EQ3A 1B6CA 1D7JA 1FKHA 2PV1A 1FKJA 2PPPA 3KAGA 2MLXA 5HKGA 4IQCA 4ODPA 3IHZA 3NI6A 4ODMA 4DIPA 1NSGA 5DIVA 4TW8A 1ZCNA 2DG3A 5DIUA 1Q6IA 2MLYA 1JVWA 4ODNA 3PA7A 2XPBA 3UI5A 2F4EA 4TX0A 2ZQTA 2K8IA 2PV2A 3EY6A 5HW8A 4MGVA 5DITA 4DRQA 1FKDA 3UF8A 2XP3A 3O5LA 1EYMA 3O5PA 4J4NA 1NMVA 3FAPA 2FAPA 3CGNA 5HW7A 1ROTA 3KACA 4O2TA 1FKKA 4DRKA 4ODRA 2M1IA 2VCDA 3O5OA 1YATA 2KGJA 2ZQUA 4NNRA 3PRDA 3NRKA 4LAXA 3B7XA 2ITKA 4QT2A 2KO7A 2XP7A 5J6EA 3CGMA 1W26A 3LUOA 3TDBA 5GPGA 2DG9A 1QPLA 4N19A 2XP4A 3KAHA 3IKGA 1PBKA 1FJDA 4G2PA
chains in the Genus database with same CATH superfamily
1A7XA 4ZPVR 1QPFA 2F2DA 3GU0A 4PTMA 1Y0OA 4P8VA 4ODLA 3UQAA 2LKNA 4R0XA 3KADA 4TNSA 2KR7A 2A3CA 5B8IC 1WNOA 2L2SA 2FDMA 2XP8A 4S3KA 3AS1A 1M5YA 1TFVA 4JFMA 1FKFA 1W1TA 3WQWA 1TCOC 1E15A 2AOSA 1K9TA 5HW6A 3UI4A 2B5UB 4WKFA 2DT2A 1YW5A 3UI6A 1RD6A 2JZVA 3CHCA 2M08A 2ZR4A 1X6NA 4IT6A 2MNTA 3OA5A 1FAPA 2WLZA 2O9OA 1HKIA 2ZR6A 3UQIA 3ARSA 3O5DA 3O5QA 1FKBA 3O5MA 1NMWA 2PPOA 5D75A 3AS3A 3PRBA 3GTYX 3VAWA 3JYMA 3CHEA 3KZ7A 1OGBA 3ARXA 4QIBA 1O6IA 2LGOA 2PPNA 4J4OA 1D2KA 2PI6A 1JNTA 1B6CA 2PPPA 2MLXA 2DT3A 2IUZA 4ODPA 1NWUA 1NSGA 1JVWA 4ODNA 1SR0A 2XPBA 3UI5A 3G6LA 1LL6A 2K8IA 2A3AA 2DPEA 4DWSC 1FKDA 3O5PA 4NSBA 5HW7A 4O2TA 4ODRA 3WD0A 2ZQUA 1W9PA 2G8ZA 1X6LA 2WLYA 3NRKA 2ITKA 4Q7NA 2XP7A 3LUOA 3WL0A 1ZBCA 3IKGA 1FJDA 4HBEA 1F40A 4TW7A 1KFWA 1U79A 1KT1A 4HBOA 1OWQA 2MPHA 3CHFA 2O92A 3WIJA 4W9OA 5HWCA 2ZR5A 1FKRA 2FKEA 1ZBWA 1JNEA 4U86A 3WKZA 4IQ2A 1E9LA 2A3EA 3H9RB 1F8AB 3KABA 4Z2LA 3ARZA 2B31A 4ZPTR 1W9VA 4ZPWR 1J4IA 4WKAA 1ROUA 3EIPA 3RFWA 3ARQA 1SYTA 3RM4A 3ARUA 1H0GA 4MSPA 1HJXA 3B9EA 3OOBA 2G41A 1FKTA 4DRHA 1W1VA 2XP5A 4DZ3A 3ALGA 1LG1A 5HT1A 3ARVA 2KI3A 3GPKA 3FY1A 1E6RA 2DSWA 4GIVA 4S3JA 4G50A 4DRMA 2DT0A 5DO2A 3WD2A 2IF4A 2RUCA 3ARPA 3CHDA 3G6MA 4L72B 1NWRA 4BF8A 1D7JA 2A3BA 5HKGA 4IQCA 3IHZA 1JCHB 3NI6A 4Z2GA 4URIA 4TW8A 2DG3A 3B9AA 4TX0A 2PV2A 3ALFA 4WKHA 3ARWA 5JH8A 2XP3A 3O5LA 1E6ZA 1GUVA 4J4NA 4AY1A 3WD1A 1NMVA 1W9UA 2FAPA 5HBFA 1ROTA 3KACA 1FFRA 2YBUA 3AQUA 2M1IA 2VCDA 3BMBA 3O5OA 2KGJA 3AROA 4NNRA 4L3NA 3PRDA 4LAXA 2KO7A 4P8UA 3B8SA 2DG9A 1HKMA 1QPLA 2XP4A 3KAHA 1PBKA 3WQVA 3QOKA 2UZ5A 3TCZA 2DG4A 3RM8A 2DSVA 1FKLA 3WH0A 1C9HA 1XRVA 1VF8A 3CH9A 2EULA 2N87A 1HJWA 1IX5A 2PN0A 2Y78A 1D7IA 3IK8A 2KE0A 4Z2IA 4DWSD 1ZBVA 3WL1A 3FXYA 1WB0A 4W9QA 1NWTA 1HKKA 2P4VA 4XAKA 4P8WA 2ZQSA 5DF0A 1J6YA 1GRJA 3BXWA 1L1PA 1P5QA 4ODKA 3MDYB 1ZL1A 4WJXA 1FD9A 3KCEA 2DT1A 3O5IA 1Q6UA 2QF8A 1BKFA 1ZB5A 1PINA 2MF9A 3O5JA 4Z2JA 3JYJA 2MLZA 3W4RA 2RSEA 1W1YA 1FKIA 4ODOA 1D6OA 5DEZA 4DWSB 3KAIA 3KAFA 1GPFA 2PV3A 4UDMA 4GGQA 1EHNA 4JFLA 3RM9A 4ZS6A 1N1AA 1WAWA 1T11A 2RURA 3O5GA 4QT3A 4DRNA 2RUDA 1GOIA 3ARRA 2AWGA 5GPRA 1W1PA 4DRJA 2ZQVA 3WD3A 4ML4A 2XPAA 4WIWA 4LAYA 3UQBA 3O5FA 4JFKA 1UR9A 3CZ8A 1FKHA 2PV1A 1FKJA 3KAGA 1LL4A 4Z2KA 3PA7A 2F4EA 4QZVB 5HW8A 4MGVA 5DITA 1HJVA 4DRQA 3AS2A 3UF8A 3FAPA 3CGNA 1FKKA 1ZU8A 4W5UA 4DRKA 1CTNA 1LG2A 1E6NA 4MNLA 4QT2A 3PRAA 4WK9A 1W26A 1E44A 3WD4A 5GPGA 2YBTA 4N19A 4G2PA 3NTPA 4R5EA 4MNMA 4FN2A 5HUAA 4TW6A 4JFJA 4MNKA 3PR9A 1BL4A 1OGGA 2ESCA 2M2AA 4DH0A 4DRPA 1EDQA 4W9PA 1D7HA 1FKGA 2LJ4A 2PBCA 4HARA 2RUQA 4U84A 1FKSA 4Q22A 4IPXA 5BXJA 2F21A 1J4HA 2XP9A 4NZCA 4FAPA 4DT4A 5I98A 4IT4A 4JFIA 3ARTA 1Q1CA 4ODQA 2KFWA 3O5EA 4KQZA 1FFQA 3AS0A 3I6CA 3TC5A 4C02B 3O5KA 4LGXA 4KR0B 4MAVA 1QZ2A 3JXVA 3IKDA 2F23A 5HWBA 1XHGA 2Q5AA 4MNJA 4ITZA 1ZBKA 5HTGA 3RMEA 4DZ2A 1E6PA 4TYOA 1ITXA 1J4RA 2LPVA 4U85A 1LJYA 1Q6HA 3O5RA 1JNDA 4LAWA 1R9HA 1ZK6A 4DRIA 4JYSA 1KT0A 3B9DA 1JNSA 1HXVA 3RGCA 2XP6A 4P8XA 4MTVA 4DROA 2D9FA 2RQSA 2WK2A 2OLHA 4LAVA 2VN1A 1EQ3A 3ODKA 5GQBA 3ARYA 2ETNA 1UR8A 2DSZA 4ODMA 4DIPA 5DIVA 1ZCNA 5DIUA 1Q6IA 2MLYA 4DWSA 2ZQTA 4MPKA 3EY6A 2WM0A 1NWSA 1EYMA 1EIBA 2DSUA 1LQ0A 1YATA 1HKJA 3B7XA 5J6EA 3CGMA 1H0IA 3TDBA 1NH6A 2OFNA 4Z2HA 1LL7A
chains in the Genus database with same CATH topology
1A7XA 4ZPVR 1QPFA 2F2DA 4PTMA 1Y0OA 4P8VA 4ODLA 3UQAA 2LKNA 4R0XA 3KADA 4TNSA 2KR7A 2A3CA 5B8IC 1WNOA 2L2SA 2FDMA 2XP8A 4S3KA 3AS1A 1M5YA 1TFVA 4JFMA 1FKFA 1W1TA 3WQWA 1TCOC 1E15A 2AOSA 1K9TA 5HW6A 3UI4A 4WKFA 2DT2A 1YW5A 3UI6A 1RD6A 2JZVA 3CHCA 2M08A 2ZR4A 1X6NA 4IT6A 2MNTA 3OA5A 1FAPA 2WLZA 2O9OA 1HKIA 2ZR6A 3UQIA 3ARSA 3O5DA 3O5QA 1FKBA 3O5MA 1NMWA 2PPOA 5D75A 3AS3A 3PRBA 3VAWA 3JYMA 3CHEA 3KZ7A 1OGBA 3ARXA 4QIBA 1O6IA 2LGOA 2PPNA 4J4OA 1D2KA 2PI6A 1JNTA 1B6CA 2PPPA 2MLXA 2DT3A 2IUZA 4ODPA 1NWUA 1NSGA 1JVWA 4ODNA 1SR0A 2XPBA 3UI5A 3G6LA 1LL6A 2K8IA 2A3AA 2DPEA 4DWSC 1FKDA 3O5PA 4NSBA 5HW7A 4O2TA 4ODRA 3WD0A 2ZQUA 1W9PA 2G8ZA 1X6LA 2WLYA 3NRKA 2ITKA 4Q7NA 2XP7A 3LUOA 3WL0A 1ZBCA 3IKGA 1FJDA 4HBEA 1F40A 4TW7A 1KFWA 1U79A 1KT1A 4HBOA 1OWQA 2MPHA 3CHFA 2O92A 3WIJA 4W9OA 5HWCA 2ZR5A 1FKRA 2FKEA 1ZBWA 1JNEA 4U86A 3WKZA 4IQ2A 1E9LA 2A3EA 3H9RB 1F8AB 3KABA 4Z2LA 3ARZA 2B31A 4ZPTR 1W9VA 4ZPWR 1J4IA 4WKAA 1ROUA 3RFWA 3ARQA 1SYTA 3RM4A 3ARUA 1H0GA 4MSPA 1HJXA 3B9EA 3OOBA 2G41A 1FKTA 4DRHA 1W1VA 2XP5A 4DZ3A 3ALGA 1LG1A 5HT1A 3ARVA 2KI3A 3GPKA 3FY1A 1E6RA 2DSWA 4GIVA 4S3JA 4G50A 4DRMA 2DT0A 5DO2A 3WD2A 2IF4A 2RUCA 3ARPA 3CHDA 3G6MA 4L72B 1NWRA 4BF8A 1D7JA 2A3BA 5HKGA 4IQCA 3IHZA 4Z2GA 3NI6A 4URIA 4TW8A 2DG3A 3B9AA 4TX0A 2PV2A 3ALFA 4WKHA 3ARWA 5JH8A 2XP3A 3O5LA 1E6ZA 1GUVA 4J4NA 4AY1A 3WD1A 1NMVA 1W9UA 2FAPA 5HBFA 1ROTA 3KACA 1FFRA 2YBUA 3AQUA 2M1IA 2VCDA 3O5OA 2KGJA 3AROA 4NNRA 4L3NA 3PRDA 4LAXA 2KO7A 4P8UA 3B8SA 2DG9A 1HKMA 1QPLA 2XP4A 3KAHA 1PBKA 3WQVA 3QOKA 2UZ5A 3TCZA 2DG4A 3RM8A 2DSVA 1FKLA 3WH0A 1C9HA 1XRVA 1VF8A 3CH9A 2N87A 1HJWA 1IX5A 2Y78A 1D7IA 3IK8A 2KE0A 4Z2IA 4DWSD 1ZBVA 3WL1A 3FXYA 1WB0A 4W9QA 1NWTA 1HKKA 4XAKA 4P8WA 2ZQSA 5DF0A 1J6YA 3BXWA 1L1PA 1P5QA 4ODKA 3MDYB 1ZL1A 4WJXA 1FD9A 3KCEA 2DT1A 3O5IA 1Q6UA 2QF8A 1BKFA 1ZB5A 1PINA 2MF9A 3O5JA 4Z2JA 3JYJA 2MLZA 3W4RA 2RSEA 1W1YA 1FKIA 2OFNA 4ODOA 1D6OA 5DEZA 4DWSB 3KAIA 3KAFA 1GPFA 2PV3A 4GGQA 1EHNA 4JFLA 3RM9A 4ZS6A 1N1AA 1WAWA 1T11A 2RURA 3O5GA 4QT3A 4DRNA 2RUDA 1GOIA 3ARRA 2AWGA 5GPRA 1W1PA 4DRJA 2ZQVA 3WD3A 4ML4A 2XPAA 4WIWA 4LAYA 3UQBA 3O5FA 4JFKA 1UR9A 3CZ8A 1FKHA 2PV1A 1FKJA 3KAGA 1LL4A 4Z2KA 3PA7A 2F4EA 4QZVB 5HW8A 4MGVA 5DITA 1HJVA 4DRQA 3AS2A 3UF8A 3FAPA 3CGNA 1FKKA 1ZU8A 4W5UA 4DRKA 1CTNA 1LG2A 1E6NA 4MNLA 4QT2A 3PRAA 4WK9A 1W26A 3WD4A 5GPGA 2YBTA 4N19A 4G2PA 3NTPA 4R5EA 4MNMA 4FN2A 5HUAA 4TW6A 4JFJA 4MNKA 3PR9A 1BL4A 1OGGA 2ESCA 2M2AA 4DH0A 4DRPA 1EDQA 4W9PA 1D7HA 1FKGA 2LJ4A 2PBCA 4HARA 2RUQA 4U84A 1FKSA 4Q22A 4IPXA 5BXJA 2F21A 1J4HA 2XP9A 4NZCA 4FAPA 4DT4A 5I98A 4IT4A 4JFIA 3ARTA 1Q1CA 4ODQA 2KFWA 3O5EA 4KQZA 1FFQA 3AS0A 3I6CA 3TC5A 4C02B 3O5KA 4LGXA 4KR0B 4MAVA 1QZ2A 3JXVA 3IKDA 5HWBA 1XHGA 2Q5AA 4MNJA 4ITZA 1ZBKA 5HTGA 3RMEA 4DZ2A 1E6PA 4TYOA 1ITXA 2LPVA 4U85A 1LJYA 1Q6HA 3O5RA 1JNDA 4LAWA 1R9HA 1ZK6A 4DRIA 4JYSA 1KT0A 3B9DA 1JNSA 1HXVA 3RGCA 2XP6A 4P8XA 4MTVA 4DROA 2D9FA 2RQSA 2WK2A 2OLHA 4LAVA 2VN1A 1EQ3A 3ODKA 5GQBA 3ARYA 4ODMA 1UR8A 2DSZA 4DIPA 5DIVA 1ZCNA 5DIUA 1Q6IA 2MLYA 4DWSA 2ZQTA 4MPKA 3EY6A 2WM0A 1NWSA 1EYMA 1EIBA 2DSUA 1LQ0A 1YATA 1HKJA 3B7XA 5J6EA 3CGMA 1H0IA 3TDBA 1NH6A 1J4RA 4Z2HA 1LL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7X A;  2UZ5 A;  3TCZ A;  1F40 A;  1QPF A;  2DG4 A;  2F2D A;  1U79 A;  3NTP A;  1FKL A;  1Y0O A;  4TW7 A;  3WH0 A;  1KT1 A;  4ODL A;  3UQA A;  1C9H A;  2MPH A;  2LKN A;  4FN2 A;  5HUA A;  4R0X A;  3KAD A;  2N87 A;  2KR7 A;  4TNS A;  4TW6 A;  4JFJ A;  2Y78 A;  5B8I C;  1D7I A;  2XP8 A;  2L2S A;  4W9O A;  1BL4 A;  2M2A A;  3IK8 A;  4DH0 A;  2ZR5 A;  2KE0 A;  4DRP A;  5HWC A;  1FKR A;  1M5Y A;  4JFM A;  2FKE A;  4W9P A;  1D7H A;  1FKG A;  1FKF A;  2LJ4 A;  2PBC A;  2RUQ A;  4U86 A;  1TCO C;  4U84 A;  1FKS A;  5BXJ A;  4IPX A;  4W9Q A;  2F21 A;  1J4H A;  2XP9 A;  5HW6 A;  3UI4 A;  4FAP A;  4DT4 A;  4IQ2 A;  5I98 A;  3H9R B;  1F8A B;  2ZQS A;  4JFI A;  1Q1C A;  1YW5 A;  4ODQ A;  2KFW A;  3KAB A;  3UI6 A;  1J6Y A;  1L1P A;  1P5Q A;  3O5E A;  2JZV A;  4ODK A;  3MDY B;  3I6C A;  1FD9 A;  2M08 A;  2ZR4 A;  1J4I A;  3KCE A;  3TC5 A;  4C02 B;  2MNT A;  3O5K A;  3O5I A;  1Q6U A;  1ROU A;  3RFW A;  1FAP A;  1QZ2 A;  1BKF A;  3JXV A;  2ZR6 A;  3IKD A;  1PIN A;  2MF9 A;  3O5J A;  3UQI A;  3JYJ A;  5HWB A;  4MSP A;  2MLZ A;  3O5D A;  2Q5A A;  1FKB A;  3O5Q A;  3O5M A;  4ITZ A;  1NMW A;  2PPO A;  5D75 A;  5HTG A;  3PRB A;  4DZ2 A;  2RSE A;  4TYO A;  3OOB A;  1FKI A;  1J4R A;  2OFN A;  1D6O A;  4ODO A;  2LPV A;  3VAW A;  4U85 A;  1Q6H A;  1FKT A;  3O5R A;  4DRH A;  4LAW A;  3KAI A;  1R9H A;  1ZK6 A;  2XP5 A;  4DZ3 A;  4DRI A;  3JYM A;  3KAF A;  3KZ7 A;  4JYS A;  1KT0 A;  4QIB A;  5HT1 A;  2KI3 A;  2PV3 A;  4GGQ A;  4JFL A;  3GPK A;  2LGO A;  1JNS A;  1HXV A;  1N1A A;  2RUR A;  1T11 A;  3RGC A;  2XP6 A;  3O5G A;  4QT3 A;  4GIV A;  2PPN A;  2RUD A;  4DRN A;  4DRO A;  4G50 A;  2AWG A;  2D9F A;  4DRM A;  2RQS A;  4DRJ A;  2ZQV A;  2IF4 A;  2RUC A;  4J4O A;  2XPA A;  4LAV A;  4LAY A;  3UQB A;  3O5F A;  4BF8 A;  2VN1 A;  1JNT A;  4JFK A;  3ODK A;  1EQ3 A;  1B6C A;  1D7J A;  1FKH A;  2PV1 A;  1FKJ A;  2PPP A;  3KAG A;  2MLX A;  5HKG A;  4IQC A;  4ODP A;  3IHZ A;  3NI6 A;  4ODM A;  4DIP A;  1NSG A;  5DIV A;  4TW8 A;  1ZCN A;  2DG3 A;  5DIU A;  1Q6I A;  2MLY A;  1JVW A;  4ODN A;  3PA7 A;  2XPB A;  3UI5 A;  2F4E A;  4TX0 A;  2ZQT A;  2K8I A;  2PV2 A;  3EY6 A;  5HW8 A;  4MGV A;  5DIT A;  4DRQ A;  1FKD A;  3UF8 A;  2XP3 A;  3O5L A;  1EYM A;  3O5P A;  4J4N A;  1NMV A;  3FAP A;  2FAP A;  3CGN A;  5HW7 A;  1ROT A;  3KAC A;  4O2T A;  1FKK A;  4DRK A;  4ODR A;  2M1I A;  2VCD A;  3O5O A;  1YAT A;  2KGJ A;  2ZQU A;  4NNR A;  3PRD A;  3NRK A;  4LAX A;  3B7X A;  2ITK A;  4QT2 A;  2KO7 A;  2XP7 A;  5J6E A;  3CGM A;  1W26 A;  3LUO A;  3TDB A;  5GPG A;  2DG9 A;  1QPL A;  4N19 A;  2XP4 A;  3KAH A;  3IKG A;  1PBK A;  1FJD A;  4G2P A; 
#chains in the Genus database with same CATH topology
 1A7X A;  4ZPV R;  1QPF A;  2F2D A;  3GU0 A;  4PTM A;  1Y0O A;  4P8V A;  4ODL A;  3UQA A;  2LKN A;  4R0X A;  3KAD A;  4TNS A;  2KR7 A;  2A3C A;  5B8I C;  1WNO A;  2L2S A;  2FDM A;  2XP8 A;  4S3K A;  3AS1 A;  1M5Y A;  1TFV A;  4JFM A;  1FKF A;  1W1T A;  3WQW A;  1TCO C;  1E15 A;  2AOS A;  1K9T A;  5HW6 A;  3UI4 A;  2B5U B;  4WKF A;  2DT2 A;  1YW5 A;  3UI6 A;  1RD6 A;  2JZV A;  3CHC A;  2M08 A;  2ZR4 A;  1X6N A;  4IT6 A;  2MNT A;  3OA5 A;  1FAP A;  2WLZ A;  2O9O A;  1HKI A;  2ZR6 A;  3UQI A;  3ARS A;  3O5D A;  3O5Q A;  1FKB A;  3O5M A;  1NMW A;  2PPO A;  5D75 A;  3AS3 A;  3PRB A;  3GTY X;  3VAW A;  3JYM A;  3CHE A;  3KZ7 A;  1OGB A;  3ARX A;  4QIB A;  1O6I A;  2LGO A;  2PPN A;  4J4O A;  1D2K A;  2PI6 A;  1JNT A;  1B6C A;  2PPP A;  2MLX A;  2DT3 A;  2IUZ A;  4ODP A;  1NWU A;  1NSG A;  1JVW A;  4ODN A;  1SR0 A;  2XPB A;  3UI5 A;  3G6L A;  1LL6 A;  2K8I A;  2A3A A;  2DPE A;  4DWS C;  1FKD A;  3O5P A;  4NSB A;  5HW7 A;  4O2T A;  4ODR A;  3WD0 A;  2ZQU A;  1W9P A;  2G8Z A;  1X6L A;  2WLY A;  3NRK A;  2ITK A;  4Q7N A;  2XP7 A;  3LUO A;  3WL0 A;  1ZBC A;  3IKG A;  1FJD A;  4HBE A;  1F40 A;  4TW7 A;  1KFW A;  1U79 A;  1KT1 A;  4HBO A;  1OWQ A;  2MPH A;  3CHF A;  2O92 A;  3WIJ A;  4W9O A;  5HWC A;  2ZR5 A;  1FKR A;  2FKE A;  1ZBW A;  1JNE A;  4U86 A;  3WKZ A;  4IQ2 A;  1E9L A;  2A3E A;  3H9R B;  1F8A B;  3KAB A;  4Z2L A;  3ARZ A;  2B31 A;  4ZPT R;  1W9V A;  4ZPW R;  1J4I A;  4WKA A;  1ROU A;  3EIP A;  3RFW A;  3ARQ A;  1SYT A;  3RM4 A;  3ARU A;  1H0G A;  4MSP A;  1HJX A;  3B9E A;  3OOB A;  2G41 A;  1FKT A;  4DRH A;  1W1V A;  2XP5 A;  4DZ3 A;  3ALG A;  1LG1 A;  5HT1 A;  3ARV A;  2KI3 A;  3GPK A;  3FY1 A;  1E6R A;  2DSW A;  4GIV A;  4S3J A;  4G50 A;  4DRM A;  2DT0 A;  5DO2 A;  3WD2 A;  2IF4 A;  2RUC A;  3ARP A;  3CHD A;  3G6M A;  4L72 B;  1NWR A;  4BF8 A;  1D7J A;  2A3B A;  5HKG A;  4IQC A;  3IHZ A;  1JCH B;  3NI6 A;  4Z2G A;  4URI A;  4TW8 A;  2DG3 A;  3B9A A;  4TX0 A;  2PV2 A;  3ALF A;  4WKH A;  3ARW A;  5JH8 A;  2XP3 A;  3O5L A;  1E6Z A;  1GUV A;  4J4N A;  4AY1 A;  3WD1 A;  1NMV A;  1W9U A;  2FAP A;  5HBF A;  1ROT A;  3KAC A;  1FFR A;  2YBU A;  3AQU A;  2M1I A;  2VCD A;  3BMB A;  3O5O A;  2KGJ A;  3ARO A;  4NNR A;  4L3N A;  3PRD A;  4LAX A;  2KO7 A;  4P8U A;  3B8S A;  2DG9 A;  1HKM A;  1QPL A;  2XP4 A;  3KAH A;  1PBK A;  3WQV A;  3QOK A;  2UZ5 A;  3TCZ A;  2DG4 A;  3RM8 A;  2DSV A;  1FKL A;  3WH0 A;  1C9H A;  1XRV A;  1VF8 A;  3CH9 A;  2EUL A;  2N87 A;  1HJW A;  1IX5 A;  2PN0 A;  2Y78 A;  1D7I A;  3IK8 A;  2KE0 A;  4Z2I A;  4DWS D;  1ZBV A;  3WL1 A;  3FXY A;  1WB0 A;  4W9Q A;  1NWT A;  1HKK A;  2P4V A;  4XAK A;  4P8W A;  2ZQS A;  5DF0 A;  1J6Y A;  1GRJ A;  3BXW A;  1L1P A;  1P5Q A;  4ODK A;  3MDY B;  1ZL1 A;  4WJX A;  1FD9 A;  3KCE A;  2DT1 A;  3O5I A;  1Q6U A;  2QF8 A;  1BKF A;  1ZB5 A;  1PIN A;  2MF9 A;  3O5J A;  4Z2J A;  3JYJ A;  2MLZ A;  3W4R A;  2RSE A;  1W1Y A;  1FKI A;  4ODO A;  1D6O A;  5DEZ A;  4DWS B;  3KAI A;  3KAF A;  1GPF A;  2PV3 A;  4UDM A;  4GGQ A;  1EHN A;  4JFL A;  3RM9 A;  4ZS6 A;  1N1A A;  1WAW A;  1T11 A;  2RUR A;  3O5G A;  4QT3 A;  4DRN A;  2RUD A;  1GOI A;  3ARR A;  2AWG A;  5GPR A;  1W1P A;  4DRJ A;  2ZQV A;  3WD3 A;  4ML4 A;  2XPA A;  4WIW A;  4LAY A;  3UQB A;  3O5F A;  4JFK A;  1UR9 A;  3CZ8 A;  1FKH A;  2PV1 A;  1FKJ A;  3KAG A;  1LL4 A;  4Z2K A;  3PA7 A;  2F4E A;  4QZV B;  5HW8 A;  4MGV A;  5DIT A;  1HJV A;  4DRQ A;  3AS2 A;  3UF8 A;  3FAP A;  3CGN A;  1FKK A;  1ZU8 A;  4W5U A;  4DRK A;  1CTN A;  1LG2 A;  1E6N A;  4MNL A;  4QT2 A;  3PRA A;  4WK9 A;  1W26 A;  1E44 A;  3WD4 A;  5GPG A;  2YBT A;  4N19 A;  4G2P A;  3NTP A;  4R5E A;  4MNM A;  4FN2 A;  5HUA A;  4TW6 A;  4JFJ A;  4MNK A;  3PR9 A;  1BL4 A;  1OGG A;  2ESC A;  2M2A A;  4DH0 A;  4DRP A;  1EDQ A;  4W9P A;  1D7H A;  1FKG A;  2LJ4 A;  2PBC A;  4HAR A;  2RUQ A;  4U84 A;  1FKS A;  4Q22 A;  4IPX A;  5BXJ A;  2F21 A;  1J4H A;  2XP9 A;  4NZC A;  4FAP A;  4DT4 A;  5I98 A;  4IT4 A;  4JFI A;  3ART A;  1Q1C A;  4ODQ A;  2KFW A;  3O5E A;  4KQZ A;  1FFQ A;  3AS0 A;  3I6C A;  3TC5 A;  4C02 B;  3O5K A;  4LGX A;  4KR0 B;  4MAV A;  1QZ2 A;  3JXV A;  3IKD A;  2F23 A;  5HWB A;  1XHG A;  2Q5A A;  4MNJ A;  4ITZ A;  1ZBK A;  5HTG A;  3RME A;  4DZ2 A;  1E6P A;  4TYO A;  1ITX A;  1J4R A;  2LPV A;  4U85 A;  1LJY A;  1Q6H A;  3O5R A;  1JND A;  4LAW A;  1R9H A;  1ZK6 A;  4DRI A;  4JYS A;  1KT0 A;  3B9D A;  1JNS A;  1HXV A;  3RGC A;  2XP6 A;  4P8X A;  4MTV A;  4DRO A;  2D9F A;  2RQS A;  2WK2 A;  2OLH A;  4LAV A;  2VN1 A;  1EQ3 A;  3ODK A;  5GQB A;  3ARY A;  2ETN A;  1UR8 A;  2DSZ A;  4ODM A;  4DIP A;  5DIV A;  1ZCN A;  5DIU A;  1Q6I A;  2MLY A;  4DWS A;  2ZQT A;  4MPK A;  3EY6 A;  2WM0 A;  1NWS A;  1EYM A;  1EIB A;  2DSU A;  1LQ0 A;  1YAT A;  1HKJ A;  3B7X A;  5J6E A;  3CGM A;  1H0I A;  3TDB A;  1NH6 A;  2OFN A;  4Z2H A;  1LL7 A; 
#chains in the Genus database with same CATH homology
 1A7X A;  4ZPV R;  1QPF A;  2F2D A;  4PTM A;  1Y0O A;  4P8V A;  4ODL A;  3UQA A;  2LKN A;  4R0X A;  3KAD A;  4TNS A;  2KR7 A;  2A3C A;  5B8I C;  1WNO A;  2L2S A;  2FDM A;  2XP8 A;  4S3K A;  3AS1 A;  1M5Y A;  1TFV A;  4JFM A;  1FKF A;  1W1T A;  3WQW A;  1TCO C;  1E15 A;  2AOS A;  1K9T A;  5HW6 A;  3UI4 A;  4WKF A;  2DT2 A;  1YW5 A;  3UI6 A;  1RD6 A;  2JZV A;  3CHC A;  2M08 A;  2ZR4 A;  1X6N A;  4IT6 A;  2MNT A;  3OA5 A;  1FAP A;  2WLZ A;  2O9O A;  1HKI A;  2ZR6 A;  3UQI A;  3ARS A;  3O5D A;  3O5Q A;  1FKB A;  3O5M A;  1NMW A;  2PPO A;  5D75 A;  3AS3 A;  3PRB A;  3VAW A;  3JYM A;  3CHE A;  3KZ7 A;  1OGB A;  3ARX A;  4QIB A;  1O6I A;  2LGO A;  2PPN A;  4J4O A;  1D2K A;  2PI6 A;  1JNT A;  1B6C A;  2PPP A;  2MLX A;  2DT3 A;  2IUZ A;  4ODP A;  1NWU A;  1NSG A;  1JVW A;  4ODN A;  1SR0 A;  2XPB A;  3UI5 A;  3G6L A;  1LL6 A;  2K8I A;  2A3A A;  2DPE A;  4DWS C;  1FKD A;  3O5P A;  4NSB A;  5HW7 A;  4O2T A;  4ODR A;  3WD0 A;  2ZQU A;  1W9P A;  2G8Z A;  1X6L A;  2WLY A;  3NRK A;  2ITK A;  4Q7N A;  2XP7 A;  3LUO A;  3WL0 A;  1ZBC A;  3IKG A;  1FJD A;  4HBE A;  1F40 A;  4TW7 A;  1KFW A;  1U79 A;  1KT1 A;  4HBO A;  1OWQ A;  2MPH A;  3CHF A;  2O92 A;  3WIJ A;  4W9O A;  5HWC A;  2ZR5 A;  1FKR A;  2FKE A;  1ZBW A;  1JNE A;  4U86 A;  3WKZ A;  4IQ2 A;  1E9L A;  2A3E A;  3H9R B;  1F8A B;  3KAB A;  4Z2L A;  3ARZ A;  2B31 A;  4ZPT R;  1W9V A;  4ZPW R;  1J4I A;  4WKA A;  1ROU A;  3RFW A;  3ARQ A;  1SYT A;  3RM4 A;  3ARU A;  1H0G A;  4MSP A;  1HJX A;  3B9E A;  3OOB A;  2G41 A;  1FKT A;  4DRH A;  1W1V A;  2XP5 A;  4DZ3 A;  3ALG A;  1LG1 A;  5HT1 A;  3ARV A;  2KI3 A;  3GPK A;  3FY1 A;  1E6R A;  2DSW A;  4GIV A;  4S3J A;  4G50 A;  4DRM A;  2DT0 A;  5DO2 A;  3WD2 A;  2IF4 A;  2RUC A;  3ARP A;  3CHD A;  3G6M A;  4L72 B;  1NWR A;  4BF8 A;  1D7J A;  2A3B A;  5HKG A;  4IQC A;  3IHZ A;  4Z2G A;  3NI6 A;  4URI A;  4TW8 A;  2DG3 A;  3B9A A;  4TX0 A;  2PV2 A;  3ALF A;  4WKH A;  3ARW A;  5JH8 A;  2XP3 A;  3O5L A;  1E6Z A;  1GUV A;  4J4N A;  4AY1 A;  3WD1 A;  1NMV A;  1W9U A;  2FAP A;  5HBF A;  1ROT A;  3KAC A;  1FFR A;  2YBU A;  3AQU A;  2M1I A;  2VCD A;  3O5O A;  2KGJ A;  3ARO A;  4NNR A;  4L3N A;  3PRD A;  4LAX A;  2KO7 A;  4P8U A;  3B8S A;  2DG9 A;  1HKM A;  1QPL A;  2XP4 A;  3KAH A;  1PBK A;  3WQV A;  3QOK A;  2UZ5 A;  3TCZ A;  2DG4 A;  3RM8 A;  2DSV A;  1FKL A;  3WH0 A;  1C9H A;  1XRV A;  1VF8 A;  3CH9 A;  2N87 A;  1HJW A;  1IX5 A;  2Y78 A;  1D7I A;  3IK8 A;  2KE0 A;  4Z2I A;  4DWS D;  1ZBV A;  3WL1 A;  3FXY A;  1WB0 A;  4W9Q A;  1NWT A;  1HKK A;  4XAK A;  4P8W A;  2ZQS A;  5DF0 A;  1J6Y A;  3BXW A;  1L1P A;  1P5Q A;  4ODK A;  3MDY B;  1ZL1 A;  4WJX A;  1FD9 A;  3KCE A;  2DT1 A;  3O5I A;  1Q6U A;  2QF8 A;  1BKF A;  1ZB5 A;  1PIN A;  2MF9 A;  3O5J A;  4Z2J A;  3JYJ A;  2MLZ A;  3W4R A;  2RSE A;  1W1Y A;  1FKI A;  2OFN A;  4ODO A;  1D6O A;  5DEZ A;  4DWS B;  3KAI A;  3KAF A;  1GPF A;  2PV3 A;  4GGQ A;  1EHN A;  4JFL A;  3RM9 A;  4ZS6 A;  1N1A A;  1WAW A;  1T11 A;  2RUR A;  3O5G A;  4QT3 A;  4DRN A;  2RUD A;  1GOI A;  3ARR A;  2AWG A;  5GPR A;  1W1P A;  4DRJ A;  2ZQV A;  3WD3 A;  4ML4 A;  2XPA A;  4WIW A;  4LAY A;  3UQB A;  3O5F A;  4JFK A;  1UR9 A;  3CZ8 A;  1FKH A;  2PV1 A;  1FKJ A;  3KAG A;  1LL4 A;  4Z2K A;  3PA7 A;  2F4E A;  4QZV B;  5HW8 A;  4MGV A;  5DIT A;  1HJV A;  4DRQ A;  3AS2 A;  3UF8 A;  3FAP A;  3CGN A;  1FKK A;  1ZU8 A;  4W5U A;  4DRK A;  1CTN A;  1LG2 A;  1E6N A;  4MNL A;  4QT2 A;  3PRA A;  4WK9 A;  1W26 A;  3WD4 A;  5GPG A;  2YBT A;  4N19 A;  4G2P A;  3NTP A;  4R5E A;  4MNM A;  4FN2 A;  5HUA A;  4TW6 A;  4JFJ A;  4MNK A;  3PR9 A;  1BL4 A;  1OGG A;  2ESC A;  2M2A A;  4DH0 A;  4DRP A;  1EDQ A;  4W9P A;  1D7H A;  1FKG A;  2LJ4 A;  2PBC A;  4HAR A;  2RUQ A;  4U84 A;  1FKS A;  4Q22 A;  4IPX A;  5BXJ A;  2F21 A;  1J4H A;  2XP9 A;  4NZC A;  4FAP A;  4DT4 A;  5I98 A;  4IT4 A;  4JFI A;  3ART A;  1Q1C A;  4ODQ A;  2KFW A;  3O5E A;  4KQZ A;  1FFQ A;  3AS0 A;  3I6C A;  3TC5 A;  4C02 B;  3O5K A;  4LGX A;  4KR0 B;  4MAV A;  1QZ2 A;  3JXV A;  3IKD A;  5HWB A;  1XHG A;  2Q5A A;  4MNJ A;  4ITZ A;  1ZBK A;  5HTG A;  3RME A;  4DZ2 A;  1E6P A;  4TYO A;  1ITX A;  2LPV A;  4U85 A;  1LJY A;  1Q6H A;  3O5R A;  1JND A;  4LAW A;  1R9H A;  1ZK6 A;  4DRI A;  4JYS A;  1KT0 A;  3B9D A;  1JNS A;  1HXV A;  3RGC A;  2XP6 A;  4P8X A;  4MTV A;  4DRO A;  2D9F A;  2RQS A;  2WK2 A;  2OLH A;  4LAV A;  2VN1 A;  1EQ3 A;  3ODK A;  5GQB A;  3ARY A;  4ODM A;  1UR8 A;  2DSZ A;  4DIP A;  5DIV A;  1ZCN A;  5DIU A;  1Q6I A;  2MLY A;  4DWS A;  2ZQT A;  4MPK A;  3EY6 A;  2WM0 A;  1NWS A;  1EYM A;  1EIB A;  2DSU A;  1LQ0 A;  1YAT A;  1HKJ A;  3B7X A;  5J6E A;  3CGM A;  1H0I A;  3TDB A;  1NH6 A;  1J4R A;  4Z2H A;  1LL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...