1FKBA

Atomic structure of the rapamycin human immunophilin fkbp-12 complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Structure of the Rapamycin Human Immunophilin Fkbp-12 Complex
pubmed rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506 BINDING PROTEIN
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkbA00
3IKGA 4JFJA 1Q6UA 4U86A 4DRNA 2FAPA 5HW7A 3WH0A 1FKFA 5D75A 2ZR5A 1T11A 4ODNA 2KO7A 3OOBA 3CGMA 4LAXA 1JNSA 1FKIA 4U85A 1Q6HA 3KZ7A 2RUCA 4R0XA 4DRPA 4FAPA 4GGQA 1FKTA 3KAFA 3O5EA 4ODQA 4DIPA 1EQ3A 1J4IA 2VN1A 2RSEA 5HT1A 4J4OA 4IPXA 1EYMA 1NMWA 3IKDA 5HTGA 5J6EA 1D7JA 2XP3A 3MDYB 3UI6A 2MLXA 2OFNA 2M08A 1FKJA 1KT1A 2LJ4A 4G2PA 2XPAA 3UI5A 1FKRA 1ROTA 2M2AA 2ZQSA 4QIBA 5HUAA 3TCZA 2MNTA 2ZR4A 3KACA 2KR7A 3O5OA 2RUQA 4ODMA 4DRIA 1D7HA 4JFKA 3UI4A 3EY6A 3NI6A 4QT3A 2D9FA 4DRKA 2PPPA 3PA7A 2N87A 1W26A 1FKHA 2JZVA 3PRDA 4BF8A 1FKKA 5HW6A 4ITZA 2RUDA 2XP9A 2K8IA 4G50A 3O5FA 4TX0A 4TW6A 2XP8A 3UQAA 5GPGA 2F4EA 2IF4A 1PBKA 1FKDA 3FAPA 2PPOA 2XP4A 3KADA 1L1PA 3UQBA 1FAPA 3CGNA 4JFMA 2ZQTA 1C9HA 3GPKA 4C02B 1HXVA 4ODPA 1A7XA 4DRJA 1F8AB 1Y0OA 2DG4A 2PV1A 3O5KA 1P5QA 4GIVA 3VAWA 3O5JA 3TC5A 2PV2A 2XP7A 2AWGA 5DITA 4JFIA 1ZK6A 5HKGA 4LAVA 2KGJA 1NMVA 1YW5A 1QPLA 1Q6IA 2KFWA 4JFLA 1D6OA 4IQ2A 1FKSA 2Y78A 3NTPA 4ODLA 2KI3A 4DRMA 3KAIA 1J4HA 5DIUA 4DROA 1J4RA 3IK8A 2LGOA 3B7XA 3ODKA 1FKBA 3KAGA 5DIVA 3O5MA 3UF8A 5B8IC 5BXJA 1JVWA 2LKNA 4TW7A 3O5IA 3TDBA 4DZ2A 5I98A 2F21A 3KCEA 4ODKA 2MF9A 3O5GA 1J6YA 2MLZA 2XPBA 4QT2A 2PBCA 1F40A 1YATA 2PPNA 4LAYA 4JYSA 2UZ5A 2VCDA 3UQIA 1ZCNA 4DRQA 3I6CA 4LAWA 4O2TA 3NRKA 2RQSA 3O5DA 1FKLA 1Q1CA 4TNSA 4DT4A 1QPFA 2ZQUA 3JYJA 4W9QA 3KAHA 2MPHA 1D7IA 2XP5A 3JXVA 3O5QA 4IQCA 4MSPA 4N19A 3RGCA 1BL4A 1QZ2A 2DG9A 2F2DA 2DG3A 2PV3A 2L2SA 3H9RB 1NSGA 2FKEA 4FN2A 4TW8A 4DRHA 1FJDA 2LPVA 3IHZA 4ODRA 2M1IA 1TCOC 2ITKA 1U79A 4NNRA 2ZQVA 3LUOA 3O5PA 4W9PA 1N1AA 1FKGA 1R9HA 2KE0A 2Q5AA 1M5YA 3KABA 4MGVA 3PRBA 3JYMA 1KT0A 4TYOA 4W9OA 2XP6A 4U84A 3RFWA 3O5RA 4DZ3A 5HWCA 1FD9A 1ROUA 4J4NA 1BKFA 5HW8A 1JNTA 3O5LA 5HWBA 4DH0A 2RURA 1B6CA 2ZR6A 2MLYA 4ODOA 1PINA
chains in the Genus database with same CATH superfamily
1W9UA 1E9LA 3IKGA 5HW7A 4U86A 4MNMA 4Q22A 2PN0A 4HARA 2ZR5A 1T11A 3CGMA 3AS0A 4FAPA 4GGQA 4DIPA 1J4IA 1NMWA 3IKDA 3AQUA 1LQ0A 3ARSA 4ML4A 1FKJA 2LJ4A 2XPAA 2M2AA 1GRJA 4QIBA 2WK2A 4ZPTR 4P8UA 4JFKA 3NI6A 2N87A 1FKHA 3PRDA 4URIA 5GPRA 2XP9A 2K8IA 2DSUA 1HJVA 2WLZA 3CHEA 1E15A 3AS3A 1HXVA 4ODPA 4DRJA 3ARWA 2PV1A 1P5QA 3ARRA 3TC5A 4JFIA 4S3KA 2P4VA 4LAVA 4W5UA 2KGJA 1YW5A 4DWSB 3NTPA 4P8WA 3ODKA 3UF8A 1NWTA 1JVWA 4KQZA 5I98A 4Q7NA 2MF9A 1LJYA 2XPBA 1LL7A 1CTNA 2VCDA 3CHDA 3UQIA 1JCHB 3CH9A 1W1VA 1Q1CA 3O5DA 1QPFA 4W9QA 2A3EA 1D7IA 2XP5A 1HKJA 3JXVA 3O5QA 3UQAA 1HKMA 3H9RB 3PR9A 4WK9A 3B9EA 1NSGA 4TW8A 2DT2A 4DWSC 2M1IA 1TCOC 1NH6A 2B31A 3O5PA 4R5EA 1FKGA 3WQWA 3KABA 1SR0A 1M5YA 5HWBA 3RFWA 1KT0A 5HWCA 2XP6A 4U84A 1FD9A 1ROUA 1BKFA 2G41A 4MAVA 4DH0A 1B6CA 3IHZA 1PINA 4JFJA 2FAPA 3WD1A 3W4RA 4ODNA 3OOBA 1JNSA 3ALGA 3KZ7A 2RUCA 4R0XA 4DRPA 1FKTA 3O5EA 3B8SA 1X6LA 4MPKA 4ODQA 1E6ZA 2RSEA 1LG1A 1EYMA 1HKKA 1LL6A 4Z2GA 2O92A 1E6NA 2XP3A 3B9DA 4G2PA 3UI5A 3ARXA 3TCZA 2ZR4A 4ODMA 4DRKA 1EIBA 2RUDA 1VF8A 4TW6A 4TX0A 2XP8A 3FY1A 4IT4A 5GQBA 1PBKA 3FAPA 2A3BA 1XRVA 3WD2A 3UQBA 3CGNA 3GPKA 3BXWA 4C02B 1ZB5A 2ESCA 2DSWA 1E6RA 4GIVA 1ZBCA 1EHNA 1ZBVA 2PV2A 3CHCA 3WL0A 2AWGA 1E44A 4WKFA 2DSZA 3WL1A 3AS2A 4KR0B 4ODLA 3IK8A 2LGOA 4WIWA 3B7XA 1D2KA 5BXJA 2LKNA 3WD3A 4DZ2A 1HJWA 4MNLA 3OA5A 1TFVA 1J6YA 2PBCA 1F40A 3RM8A 4LAYA 4S3JA 3NRKA 1FFQA 1WAWA 1ZBKA 4N19A 1BL4A 2PV3A 1GUVA 3ALFA 4DRHA 1FJDA 2LPVA 3WQVA 3QOKA 1NWRA 2Q5AA 4W9OA 2QF8A 3JYMA 4Z2JA 4DZ3A 4O2TA 2ZR6A 4Z2LA 2DSVA 2B5UB 3G6MA 4DRNA 1Q6UA 3WH0A 1FKFA 3ARTA 5HBFA 3RM4A 1FKIA 4U85A 1Q6HA 1SYTA 1KFWA 3EIPA 3ARQA 1EQ3A 2VN1A 3ARVA 4IPXA 4Z2IA 5J6EA 1D7JA 4HBEA 2MLXA 1KT1A 4MNJA 2ZQSA 2IUZA 3WKZA 1OGGA 2MNTA 1GOIA 3KACA 2KR7A 1JNDA 3AROA 4L72B 4QZVB 4DRIA 2PI6A 3UI4A 4QT3A 2D9FA 3PA7A 3WD0A 1W26A 1FKKA 4ITZA 4G50A 5GPGA 2AOSA 1FKDA 1W9VA 4MNKA 2PPOA 2XP4A 2F23A 3KADA 4ZPWR 4JFMA 3PRAA 1A7XA 3O5KA 3GU0A 1OGBA 3RM9A 4NSBA 3WD4A 3VAWA 3O5JA 1UR8A 4WKAA 2XP7A 2DT1A 1IX5A 1UR9A 2OLHA 5HKGA 4P8VA 1QPLA 4NZCA 1Q6IA 4IQ2A 2KI3A 4DRMA 3KAIA 1RD6A 5DIUA 4DROA 1J4RA 3O5MA 5B8IC 4TW7A 3TDBA 2F21A 3KCEA 3O5GA 2PPNA 2DPEA 1ZCNA 1H0GA 3I6CA 2RQSA 2EULA 4DT4A 1LG2A 1EDQA 4TNSA 3KAHA 2MPHA 2WM0A 1H0IA 4PTMA 4IQCA 4MSPA 1QZ2A 2DG9A 2F2DA 2DG3A 5JH8A 2ITKA 1U79A 2ZQVA 4W9PA 1N1AA 2KE0A 4L3NA 3CZ8A 4MGVA 1WNOA 4TYOA 4AY1A 1FFRA 3O5RA 5HW8A 3O5LA 1GPFA 4ODOA 3ARZA 5D75A 2DT0A 2KO7A 1W9PA 4LAXA 1ZU8A 3G6LA 3GTYX 3ARUA 3KAFA 5HT1A 1E6PA 3ARPA 4J4OA 1XHGA 3AS1A 5HTGA 5DEZA 3BMBA 3MDYB 4DWSA 3UI6A 3WIJA 2OFNA 2M08A 1FKRA 1ROTA 1W1YA 5HUAA 4MTVA 4WKHA 1WB0A 2A3CA 3O5OA 1OWQA 1JNEA 2RUQA 1D7HA 3EY6A 4XAKA 5HW6A 2PPPA 4LGXA 1HJXA 2JZVA 1K9TA 1ZL1A 2WLYA 5DF0A 3RMEA 4WJXA 3O5FA 2F4EA 2IF4A 4P8XA 5DO2A 1L1PA 1FAPA 4HBOA 2ZQTA 1C9HA 1F8AB 1Y0OA 2DG4A 2FDMA 4Z2KA 4DWSD 3B9AA 4Z2HA 5DITA 1ZK6A 2DT3A 2O9OA 3CHFA 1NMVA 1X6NA 4JFLA 2KFWA 1D6OA 1FKSA 2Y78A 1J4HA 1FKBA 3KAGA 5DIVA 3O5IA 4ZPVR 1W1TA 2A3AA 1NWUA 4ODKA 2MLZA 1O6IA 4QT2A 1YATA 2G8ZA 4JYSA 2UZ5A 4DRQA 4LAWA 1FKLA 2ZQUA 3JYJA 1ITXA 3RGCA 4FN2A 2L2SA 2FKEA 1W1PA 4ODRA 1LL4A 4NNRA 3ARYA 3LUOA 1R9HA 1HKIA 2YBUA 4IT6A 4UDMA 3FXYA 3PRBA 2YBTA 1NWSA 2ETNA 1ZBWA 4J4NA 1JNTA 2RURA 4BF8A 2MLYA 4ZS6A
chains in the Genus database with same CATH topology
1W9UA 1E9LA 3IKGA 5HW7A 4U86A 4MNMA 4Q22A 4HARA 2ZR5A 1T11A 3CGMA 3AS0A 4FAPA 4GGQA 4DIPA 1J4IA 1NMWA 3IKDA 3AQUA 1LQ0A 3ARSA 4ML4A 1FKJA 2LJ4A 2XPAA 2M2AA 4QIBA 2WK2A 4ZPTR 4P8UA 4JFKA 3NI6A 2N87A 1FKHA 3PRDA 4URIA 5GPRA 2XP9A 2K8IA 2DSUA 1HJVA 2WLZA 3CHEA 1E15A 3AS3A 1HXVA 4ODPA 4DRJA 3ARWA 2PV1A 1P5QA 3ARRA 3TC5A 4JFIA 4S3KA 4LAVA 4W5UA 2KGJA 1YW5A 4DWSB 3NTPA 4P8WA 3ODKA 3UF8A 1NWTA 1JVWA 4KQZA 5I98A 4Q7NA 2MF9A 1LJYA 2XPBA 1LL7A 1CTNA 2VCDA 3CHDA 3UQIA 3CH9A 1W1VA 1Q1CA 3O5DA 1QPFA 4W9QA 2A3EA 1D7IA 2XP5A 1HKJA 3JXVA 3O5QA 3UQAA 1HKMA 3H9RB 3PR9A 4WK9A 3B9EA 1NSGA 4TW8A 2DT2A 4DWSC 2M1IA 1TCOC 1NH6A 2B31A 3O5PA 4R5EA 1FKGA 3WQWA 3KABA 1SR0A 1M5YA 5HWBA 3RFWA 1KT0A 5HWCA 2XP6A 4U84A 1FD9A 1ROUA 1BKFA 2G41A 4MAVA 4DH0A 1B6CA 3IHZA 1PINA 4JFJA 2FAPA 3WD1A 3W4RA 4ODNA 3OOBA 1JNSA 3ALGA 3KZ7A 2RUCA 4R0XA 4DRPA 1FKTA 3O5EA 3B8SA 1X6LA 4MPKA 4ODQA 1E6ZA 2RSEA 1LG1A 1EYMA 1HKKA 1LL6A 4Z2GA 2O92A 1E6NA 2XP3A 3B9DA 4G2PA 3UI5A 3ARXA 3TCZA 2ZR4A 4ODMA 4DRKA 1EIBA 2RUDA 1VF8A 4TW6A 4TX0A 2XP8A 3FY1A 4IT4A 5GQBA 1PBKA 3FAPA 2A3BA 1XRVA 3WD2A 3UQBA 3CGNA 3GPKA 3BXWA 4C02B 1ZB5A 2ESCA 2DSWA 1E6RA 4GIVA 1ZBCA 1EHNA 1ZBVA 2PV2A 3CHCA 3WL0A 2AWGA 4WKFA 2DSZA 3WL1A 3AS2A 4KR0B 4ODLA 3IK8A 2LGOA 4WIWA 3B7XA 1D2KA 5BXJA 2LKNA 3WD3A 4DZ2A 1HJWA 4MNLA 3OA5A 1TFVA 1J6YA 2PBCA 1F40A 3RM8A 4LAYA 4S3JA 3NRKA 1FFQA 1WAWA 1ZBKA 4N19A 1BL4A 2PV3A 1GUVA 3ALFA 4DRHA 1FJDA 2LPVA 3WQVA 3QOKA 1NWRA 2Q5AA 4W9OA 2QF8A 3JYMA 4Z2JA 4DZ3A 4O2TA 2ZR6A 4Z2LA 2DSVA 3G6MA 4DRNA 1Q6UA 3WH0A 1FKFA 3ARTA 5HBFA 3RM4A 1FKIA 4U85A 1Q6HA 1SYTA 1KFWA 3ARQA 1EQ3A 2VN1A 3ARVA 4IPXA 4Z2IA 5J6EA 1D7JA 4HBEA 2MLXA 1KT1A 4MNJA 2ZQSA 2IUZA 3WKZA 1OGGA 2MNTA 1GOIA 3KACA 2KR7A 1JNDA 3AROA 4L72B 4QZVB 4DRIA 2PI6A 3UI4A 4QT3A 2D9FA 3PA7A 3WD0A 1W26A 1FKKA 4ITZA 4G50A 5GPGA 2AOSA 1FKDA 1W9VA 4MNKA 2PPOA 2XP4A 3KADA 4ZPWR 4JFMA 3PRAA 1A7XA 3O5KA 1OGBA 3RM9A 4NSBA 3WD4A 3VAWA 3O5JA 1UR8A 4WKAA 2XP7A 2DT1A 1IX5A 1UR9A 2OLHA 5HKGA 4P8VA 1QPLA 4NZCA 1Q6IA 4IQ2A 2KI3A 4DRMA 3KAIA 1RD6A 5DIUA 4DROA 1J4RA 3O5MA 5B8IC 4TW7A 3TDBA 2F21A 3KCEA 3O5GA 2PPNA 2DPEA 1ZCNA 1H0GA 3I6CA 2RQSA 4DT4A 1LG2A 1EDQA 4TNSA 3KAHA 2MPHA 2WM0A 1H0IA 4PTMA 4IQCA 4MSPA 1QZ2A 2DG9A 2F2DA 2DG3A 5JH8A 2ITKA 1U79A 2ZQVA 4W9PA 1N1AA 2KE0A 4L3NA 3CZ8A 4MGVA 1WNOA 4TYOA 4AY1A 1FFRA 3O5RA 5HW8A 3O5LA 1GPFA 4ODOA 3ARZA 5D75A 2DT0A 2KO7A 1W9PA 4LAXA 1ZU8A 3G6LA 3ARUA 3KAFA 5HT1A 1E6PA 3ARPA 4J4OA 1XHGA 3AS1A 5HTGA 5DEZA 3MDYB 4DWSA 3UI6A 3WIJA 2OFNA 2M08A 1FKRA 1ROTA 1W1YA 5HUAA 4MTVA 4WKHA 1WB0A 2A3CA 3O5OA 1OWQA 1JNEA 2RUQA 1D7HA 3EY6A 4XAKA 5HW6A 2PPPA 4LGXA 1HJXA 2JZVA 1K9TA 1ZL1A 2WLYA 5DF0A 3RMEA 4WJXA 3O5FA 2F4EA 2IF4A 4P8XA 5DO2A 1L1PA 1FAPA 4HBOA 2ZQTA 1C9HA 1F8AB 1Y0OA 2DG4A 2FDMA 4Z2KA 4DWSD 3B9AA 4Z2HA 5DITA 1ZK6A 2DT3A 2O9OA 3CHFA 1NMVA 1X6NA 4JFLA 2KFWA 1D6OA 1FKSA 2Y78A 1J4HA 1FKBA 3KAGA 5DIVA 3O5IA 4ZPVR 1W1TA 2A3AA 1NWUA 4ODKA 2MLZA 1O6IA 4QT2A 1YATA 2G8ZA 4JYSA 2UZ5A 4DRQA 4LAWA 1FKLA 2ZQUA 3JYJA 1ITXA 3RGCA 4FN2A 2L2SA 2FKEA 1W1PA 4ODRA 1LL4A 4NNRA 3ARYA 3LUOA 1R9HA 1HKIA 2YBUA 4IT6A 3FXYA 3PRBA 2YBTA 1NWSA 1ZBWA 4J4NA 1JNTA 2RURA 4BF8A 2MLYA 4ZS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IKG A;  4JFJ A;  1Q6U A;  4U86 A;  4DRN A;  2FAP A;  5HW7 A;  3WH0 A;  1FKF A;  5D75 A;  2ZR5 A;  1T11 A;  4ODN A;  2KO7 A;  3OOB A;  3CGM A;  4LAX A;  1JNS A;  1FKI A;  4U85 A;  1Q6H A;  3KZ7 A;  2RUC A;  4R0X A;  4DRP A;  4FAP A;  4GGQ A;  1FKT A;  3KAF A;  3O5E A;  4ODQ A;  4DIP A;  1EQ3 A;  1J4I A;  2VN1 A;  2RSE A;  5HT1 A;  4J4O A;  4IPX A;  1EYM A;  1NMW A;  3IKD A;  5HTG A;  5J6E A;  1D7J A;  2XP3 A;  3MDY B;  3UI6 A;  2MLX A;  2OFN A;  2M08 A;  1FKJ A;  1KT1 A;  2LJ4 A;  4G2P A;  2XPA A;  3UI5 A;  1FKR A;  1ROT A;  2M2A A;  2ZQS A;  4QIB A;  5HUA A;  3TCZ A;  2MNT A;  2ZR4 A;  3KAC A;  2KR7 A;  3O5O A;  2RUQ A;  4ODM A;  4DRI A;  1D7H A;  4JFK A;  3UI4 A;  3EY6 A;  3NI6 A;  4QT3 A;  2D9F A;  4DRK A;  2PPP A;  3PA7 A;  2N87 A;  1W26 A;  1FKH A;  2JZV A;  3PRD A;  4BF8 A;  1FKK A;  5HW6 A;  4ITZ A;  2RUD A;  2XP9 A;  2K8I A;  4G50 A;  3O5F A;  4TX0 A;  4TW6 A;  2XP8 A;  3UQA A;  5GPG A;  2F4E A;  2IF4 A;  1PBK A;  1FKD A;  3FAP A;  2PPO A;  2XP4 A;  3KAD A;  1L1P A;  3UQB A;  1FAP A;  3CGN A;  4JFM A;  2ZQT A;  1C9H A;  3GPK A;  4C02 B;  1HXV A;  4ODP A;  1A7X A;  4DRJ A;  1F8A B;  1Y0O A;  2DG4 A;  2PV1 A;  3O5K A;  1P5Q A;  4GIV A;  3VAW A;  3O5J A;  3TC5 A;  2PV2 A;  2XP7 A;  2AWG A;  5DIT A;  4JFI A;  1ZK6 A;  5HKG A;  4LAV A;  2KGJ A;  1NMV A;  1YW5 A;  1QPL A;  1Q6I A;  2KFW A;  4JFL A;  1D6O A;  4IQ2 A;  1FKS A;  2Y78 A;  3NTP A;  4ODL A;  2KI3 A;  4DRM A;  3KAI A;  1J4H A;  5DIU A;  4DRO A;  1J4R A;  3IK8 A;  2LGO A;  3B7X A;  3ODK A;  1FKB A;  3KAG A;  5DIV A;  3O5M A;  3UF8 A;  5B8I C;  5BXJ A;  1JVW A;  2LKN A;  4TW7 A;  3O5I A;  3TDB A;  4DZ2 A;  5I98 A;  2F21 A;  3KCE A;  4ODK A;  2MF9 A;  3O5G A;  1J6Y A;  2MLZ A;  2XPB A;  4QT2 A;  2PBC A;  1F40 A;  1YAT A;  2PPN A;  4LAY A;  4JYS A;  2UZ5 A;  2VCD A;  3UQI A;  1ZCN A;  4DRQ A;  3I6C A;  4LAW A;  4O2T A;  3NRK A;  2RQS A;  3O5D A;  1FKL A;  1Q1C A;  4TNS A;  4DT4 A;  1QPF A;  2ZQU A;  3JYJ A;  4W9Q A;  3KAH A;  2MPH A;  1D7I A;  2XP5 A;  3JXV A;  3O5Q A;  4IQC A;  4MSP A;  4N19 A;  3RGC A;  1BL4 A;  1QZ2 A;  2DG9 A;  2F2D A;  2DG3 A;  2PV3 A;  2L2S A;  3H9R B;  1NSG A;  2FKE A;  4FN2 A;  4TW8 A;  4DRH A;  1FJD A;  2LPV A;  3IHZ A;  4ODR A;  2M1I A;  1TCO C;  2ITK A;  1U79 A;  4NNR A;  2ZQV A;  3LUO A;  3O5P A;  4W9P A;  1N1A A;  1FKG A;  1R9H A;  2KE0 A;  2Q5A A;  1M5Y A;  3KAB A;  4MGV A;  3PRB A;  3JYM A;  1KT0 A;  4TYO A;  4W9O A;  2XP6 A;  4U84 A;  3RFW A;  3O5R A;  4DZ3 A;  5HWC A;  1FD9 A;  1ROU A;  4J4N A;  1BKF A;  5HW8 A;  1JNT A;  3O5L A;  5HWB A;  4DH0 A;  2RUR A;  1B6C A;  2ZR6 A;  2MLY A;  4ODO A;  1PIN A; 
#chains in the Genus database with same CATH topology
 1W9U A;  1E9L A;  3IKG A;  5HW7 A;  4U86 A;  4MNM A;  4Q22 A;  2PN0 A;  4HAR A;  2ZR5 A;  1T11 A;  3CGM A;  3AS0 A;  4FAP A;  4GGQ A;  4DIP A;  1J4I A;  1NMW A;  3IKD A;  3AQU A;  1LQ0 A;  3ARS A;  4ML4 A;  1FKJ A;  2LJ4 A;  2XPA A;  2M2A A;  1GRJ A;  4QIB A;  2WK2 A;  4ZPT R;  4P8U A;  4JFK A;  3NI6 A;  2N87 A;  1FKH A;  3PRD A;  4URI A;  5GPR A;  2XP9 A;  2K8I A;  2DSU A;  1HJV A;  2WLZ A;  3CHE A;  1E15 A;  3AS3 A;  1HXV A;  4ODP A;  4DRJ A;  3ARW A;  2PV1 A;  1P5Q A;  3ARR A;  3TC5 A;  4JFI A;  4S3K A;  2P4V A;  4LAV A;  4W5U A;  2KGJ A;  1YW5 A;  4DWS B;  3NTP A;  4P8W A;  3ODK A;  3UF8 A;  1NWT A;  1JVW A;  4KQZ A;  5I98 A;  4Q7N A;  2MF9 A;  1LJY A;  2XPB A;  1LL7 A;  1CTN A;  2VCD A;  3CHD A;  3UQI A;  1JCH B;  3CH9 A;  1W1V A;  1Q1C A;  3O5D A;  1QPF A;  4W9Q A;  2A3E A;  1D7I A;  2XP5 A;  1HKJ A;  3JXV A;  3O5Q A;  3UQA A;  1HKM A;  3H9R B;  3PR9 A;  4WK9 A;  3B9E A;  1NSG A;  4TW8 A;  2DT2 A;  4DWS C;  2M1I A;  1TCO C;  1NH6 A;  2B31 A;  3O5P A;  4R5E A;  1FKG A;  3WQW A;  3KAB A;  1SR0 A;  1M5Y A;  5HWB A;  3RFW A;  1KT0 A;  5HWC A;  2XP6 A;  4U84 A;  1FD9 A;  1ROU A;  1BKF A;  2G41 A;  4MAV A;  4DH0 A;  1B6C A;  3IHZ A;  1PIN A;  4JFJ A;  2FAP A;  3WD1 A;  3W4R A;  4ODN A;  3OOB A;  1JNS A;  3ALG A;  3KZ7 A;  2RUC A;  4R0X A;  4DRP A;  1FKT A;  3O5E A;  3B8S A;  1X6L A;  4MPK A;  4ODQ A;  1E6Z A;  2RSE A;  1LG1 A;  1EYM A;  1HKK A;  1LL6 A;  4Z2G A;  2O92 A;  1E6N A;  2XP3 A;  3B9D A;  4G2P A;  3UI5 A;  3ARX A;  3TCZ A;  2ZR4 A;  4ODM A;  4DRK A;  1EIB A;  2RUD A;  1VF8 A;  4TW6 A;  4TX0 A;  2XP8 A;  3FY1 A;  4IT4 A;  5GQB A;  1PBK A;  3FAP A;  2A3B A;  1XRV A;  3WD2 A;  3UQB A;  3CGN A;  3GPK A;  3BXW A;  4C02 B;  1ZB5 A;  2ESC A;  2DSW A;  1E6R A;  4GIV A;  1ZBC A;  1EHN A;  1ZBV A;  2PV2 A;  3CHC A;  3WL0 A;  2AWG A;  1E44 A;  4WKF A;  2DSZ A;  3WL1 A;  3AS2 A;  4KR0 B;  4ODL A;  3IK8 A;  2LGO A;  4WIW A;  3B7X A;  1D2K A;  5BXJ A;  2LKN A;  3WD3 A;  4DZ2 A;  1HJW A;  4MNL A;  3OA5 A;  1TFV A;  1J6Y A;  2PBC A;  1F40 A;  3RM8 A;  4LAY A;  4S3J A;  3NRK A;  1FFQ A;  1WAW A;  1ZBK A;  4N19 A;  1BL4 A;  2PV3 A;  1GUV A;  3ALF A;  4DRH A;  1FJD A;  2LPV A;  3WQV A;  3QOK A;  1NWR A;  2Q5A A;  4W9O A;  2QF8 A;  3JYM A;  4Z2J A;  4DZ3 A;  4O2T A;  2ZR6 A;  4Z2L A;  2DSV A;  2B5U B;  3G6M A;  4DRN A;  1Q6U A;  3WH0 A;  1FKF A;  3ART A;  5HBF A;  3RM4 A;  1FKI A;  4U85 A;  1Q6H A;  1SYT A;  1KFW A;  3EIP A;  3ARQ A;  1EQ3 A;  2VN1 A;  3ARV A;  4IPX A;  4Z2I A;  5J6E A;  1D7J A;  4HBE A;  2MLX A;  1KT1 A;  4MNJ A;  2ZQS A;  2IUZ A;  3WKZ A;  1OGG A;  2MNT A;  1GOI A;  3KAC A;  2KR7 A;  1JND A;  3ARO A;  4L72 B;  4QZV B;  4DRI A;  2PI6 A;  3UI4 A;  4QT3 A;  2D9F A;  3PA7 A;  3WD0 A;  1W26 A;  1FKK A;  4ITZ A;  4G50 A;  5GPG A;  2AOS A;  1FKD A;  1W9V A;  4MNK A;  2PPO A;  2XP4 A;  2F23 A;  3KAD A;  4ZPW R;  4JFM A;  3PRA A;  1A7X A;  3O5K A;  3GU0 A;  1OGB A;  3RM9 A;  4NSB A;  3WD4 A;  3VAW A;  3O5J A;  1UR8 A;  4WKA A;  2XP7 A;  2DT1 A;  1IX5 A;  1UR9 A;  2OLH A;  5HKG A;  4P8V A;  1QPL A;  4NZC A;  1Q6I A;  4IQ2 A;  2KI3 A;  4DRM A;  3KAI A;  1RD6 A;  5DIU A;  4DRO A;  1J4R A;  3O5M A;  5B8I C;  4TW7 A;  3TDB A;  2F21 A;  3KCE A;  3O5G A;  2PPN A;  2DPE A;  1ZCN A;  1H0G A;  3I6C A;  2RQS A;  2EUL A;  4DT4 A;  1LG2 A;  1EDQ A;  4TNS A;  3KAH A;  2MPH A;  2WM0 A;  1H0I A;  4PTM A;  4IQC A;  4MSP A;  1QZ2 A;  2DG9 A;  2F2D A;  2DG3 A;  5JH8 A;  2ITK A;  1U79 A;  2ZQV A;  4W9P A;  1N1A A;  2KE0 A;  4L3N A;  3CZ8 A;  4MGV A;  1WNO A;  4TYO A;  4AY1 A;  1FFR A;  3O5R A;  5HW8 A;  3O5L A;  1GPF A;  4ODO A;  3ARZ A;  5D75 A;  2DT0 A;  2KO7 A;  1W9P A;  4LAX A;  1ZU8 A;  3G6L A;  3GTY X;  3ARU A;  3KAF A;  5HT1 A;  1E6P A;  3ARP A;  4J4O A;  1XHG A;  3AS1 A;  5HTG A;  5DEZ A;  3BMB A;  3MDY B;  4DWS A;  3UI6 A;  3WIJ A;  2OFN A;  2M08 A;  1FKR A;  1ROT A;  1W1Y A;  5HUA A;  4MTV A;  4WKH A;  1WB0 A;  2A3C A;  3O5O A;  1OWQ A;  1JNE A;  2RUQ A;  1D7H A;  3EY6 A;  4XAK A;  5HW6 A;  2PPP A;  4LGX A;  1HJX A;  2JZV A;  1K9T A;  1ZL1 A;  2WLY A;  5DF0 A;  3RME A;  4WJX A;  3O5F A;  2F4E A;  2IF4 A;  4P8X A;  5DO2 A;  1L1P A;  1FAP A;  4HBO A;  2ZQT A;  1C9H A;  1F8A B;  1Y0O A;  2DG4 A;  2FDM A;  4Z2K A;  4DWS D;  3B9A A;  4Z2H A;  5DIT A;  1ZK6 A;  2DT3 A;  2O9O A;  3CHF A;  1NMV A;  1X6N A;  4JFL A;  2KFW A;  1D6O A;  1FKS A;  2Y78 A;  1J4H A;  1FKB A;  3KAG A;  5DIV A;  3O5I A;  4ZPV R;  1W1T A;  2A3A A;  1NWU A;  4ODK A;  2MLZ A;  1O6I A;  4QT2 A;  1YAT A;  2G8Z A;  4JYS A;  2UZ5 A;  4DRQ A;  4LAW A;  1FKL A;  2ZQU A;  3JYJ A;  1ITX A;  3RGC A;  4FN2 A;  2L2S A;  2FKE A;  1W1P A;  4ODR A;  1LL4 A;  4NNR A;  3ARY A;  3LUO A;  1R9H A;  1HKI A;  2YBU A;  4IT6 A;  4UDM A;  3FXY A;  3PRB A;  2YBT A;  1NWS A;  2ETN A;  1ZBW A;  4J4N A;  1JNT A;  2RUR A;  4BF8 A;  2MLY A;  4ZS6 A; 
#chains in the Genus database with same CATH homology
 1W9U A;  1E9L A;  3IKG A;  5HW7 A;  4U86 A;  4MNM A;  4Q22 A;  4HAR A;  2ZR5 A;  1T11 A;  3CGM A;  3AS0 A;  4FAP A;  4GGQ A;  4DIP A;  1J4I A;  1NMW A;  3IKD A;  3AQU A;  1LQ0 A;  3ARS A;  4ML4 A;  1FKJ A;  2LJ4 A;  2XPA A;  2M2A A;  4QIB A;  2WK2 A;  4ZPT R;  4P8U A;  4JFK A;  3NI6 A;  2N87 A;  1FKH A;  3PRD A;  4URI A;  5GPR A;  2XP9 A;  2K8I A;  2DSU A;  1HJV A;  2WLZ A;  3CHE A;  1E15 A;  3AS3 A;  1HXV A;  4ODP A;  4DRJ A;  3ARW A;  2PV1 A;  1P5Q A;  3ARR A;  3TC5 A;  4JFI A;  4S3K A;  4LAV A;  4W5U A;  2KGJ A;  1YW5 A;  4DWS B;  3NTP A;  4P8W A;  3ODK A;  3UF8 A;  1NWT A;  1JVW A;  4KQZ A;  5I98 A;  4Q7N A;  2MF9 A;  1LJY A;  2XPB A;  1LL7 A;  1CTN A;  2VCD A;  3CHD A;  3UQI A;  3CH9 A;  1W1V A;  1Q1C A;  3O5D A;  1QPF A;  4W9Q A;  2A3E A;  1D7I A;  2XP5 A;  1HKJ A;  3JXV A;  3O5Q A;  3UQA A;  1HKM A;  3H9R B;  3PR9 A;  4WK9 A;  3B9E A;  1NSG A;  4TW8 A;  2DT2 A;  4DWS C;  2M1I A;  1TCO C;  1NH6 A;  2B31 A;  3O5P A;  4R5E A;  1FKG A;  3WQW A;  3KAB A;  1SR0 A;  1M5Y A;  5HWB A;  3RFW A;  1KT0 A;  5HWC A;  2XP6 A;  4U84 A;  1FD9 A;  1ROU A;  1BKF A;  2G41 A;  4MAV A;  4DH0 A;  1B6C A;  3IHZ A;  1PIN A;  4JFJ A;  2FAP A;  3WD1 A;  3W4R A;  4ODN A;  3OOB A;  1JNS A;  3ALG A;  3KZ7 A;  2RUC A;  4R0X A;  4DRP A;  1FKT A;  3O5E A;  3B8S A;  1X6L A;  4MPK A;  4ODQ A;  1E6Z A;  2RSE A;  1LG1 A;  1EYM A;  1HKK A;  1LL6 A;  4Z2G A;  2O92 A;  1E6N A;  2XP3 A;  3B9D A;  4G2P A;  3UI5 A;  3ARX A;  3TCZ A;  2ZR4 A;  4ODM A;  4DRK A;  1EIB A;  2RUD A;  1VF8 A;  4TW6 A;  4TX0 A;  2XP8 A;  3FY1 A;  4IT4 A;  5GQB A;  1PBK A;  3FAP A;  2A3B A;  1XRV A;  3WD2 A;  3UQB A;  3CGN A;  3GPK A;  3BXW A;  4C02 B;  1ZB5 A;  2ESC A;  2DSW A;  1E6R A;  4GIV A;  1ZBC A;  1EHN A;  1ZBV A;  2PV2 A;  3CHC A;  3WL0 A;  2AWG A;  4WKF A;  2DSZ A;  3WL1 A;  3AS2 A;  4KR0 B;  4ODL A;  3IK8 A;  2LGO A;  4WIW A;  3B7X A;  1D2K A;  5BXJ A;  2LKN A;  3WD3 A;  4DZ2 A;  1HJW A;  4MNL A;  3OA5 A;  1TFV A;  1J6Y A;  2PBC A;  1F40 A;  3RM8 A;  4LAY A;  4S3J A;  3NRK A;  1FFQ A;  1WAW A;  1ZBK A;  4N19 A;  1BL4 A;  2PV3 A;  1GUV A;  3ALF A;  4DRH A;  1FJD A;  2LPV A;  3WQV A;  3QOK A;  1NWR A;  2Q5A A;  4W9O A;  2QF8 A;  3JYM A;  4Z2J A;  4DZ3 A;  4O2T A;  2ZR6 A;  4Z2L A;  2DSV A;  3G6M A;  4DRN A;  1Q6U A;  3WH0 A;  1FKF A;  3ART A;  5HBF A;  3RM4 A;  1FKI A;  4U85 A;  1Q6H A;  1SYT A;  1KFW A;  3ARQ A;  1EQ3 A;  2VN1 A;  3ARV A;  4IPX A;  4Z2I A;  5J6E A;  1D7J A;  4HBE A;  2MLX A;  1KT1 A;  4MNJ A;  2ZQS A;  2IUZ A;  3WKZ A;  1OGG A;  2MNT A;  1GOI A;  3KAC A;  2KR7 A;  1JND A;  3ARO A;  4L72 B;  4QZV B;  4DRI A;  2PI6 A;  3UI4 A;  4QT3 A;  2D9F A;  3PA7 A;  3WD0 A;  1W26 A;  1FKK A;  4ITZ A;  4G50 A;  5GPG A;  2AOS A;  1FKD A;  1W9V A;  4MNK A;  2PPO A;  2XP4 A;  3KAD A;  4ZPW R;  4JFM A;  3PRA A;  1A7X A;  3O5K A;  1OGB A;  3RM9 A;  4NSB A;  3WD4 A;  3VAW A;  3O5J A;  1UR8 A;  4WKA A;  2XP7 A;  2DT1 A;  1IX5 A;  1UR9 A;  2OLH A;  5HKG A;  4P8V A;  1QPL A;  4NZC A;  1Q6I A;  4IQ2 A;  2KI3 A;  4DRM A;  3KAI A;  1RD6 A;  5DIU A;  4DRO A;  1J4R A;  3O5M A;  5B8I C;  4TW7 A;  3TDB A;  2F21 A;  3KCE A;  3O5G A;  2PPN A;  2DPE A;  1ZCN A;  1H0G A;  3I6C A;  2RQS A;  4DT4 A;  1LG2 A;  1EDQ A;  4TNS A;  3KAH A;  2MPH A;  2WM0 A;  1H0I A;  4PTM A;  4IQC A;  4MSP A;  1QZ2 A;  2DG9 A;  2F2D A;  2DG3 A;  5JH8 A;  2ITK A;  1U79 A;  2ZQV A;  4W9P A;  1N1A A;  2KE0 A;  4L3N A;  3CZ8 A;  4MGV A;  1WNO A;  4TYO A;  4AY1 A;  1FFR A;  3O5R A;  5HW8 A;  3O5L A;  1GPF A;  4ODO A;  3ARZ A;  5D75 A;  2DT0 A;  2KO7 A;  1W9P A;  4LAX A;  1ZU8 A;  3G6L A;  3ARU A;  3KAF A;  5HT1 A;  1E6P A;  3ARP A;  4J4O A;  1XHG A;  3AS1 A;  5HTG A;  5DEZ A;  3MDY B;  4DWS A;  3UI6 A;  3WIJ A;  2OFN A;  2M08 A;  1FKR A;  1ROT A;  1W1Y A;  5HUA A;  4MTV A;  4WKH A;  1WB0 A;  2A3C A;  3O5O A;  1OWQ A;  1JNE A;  2RUQ A;  1D7H A;  3EY6 A;  4XAK A;  5HW6 A;  2PPP A;  4LGX A;  1HJX A;  2JZV A;  1K9T A;  1ZL1 A;  2WLY A;  5DF0 A;  3RME A;  4WJX A;  3O5F A;  2F4E A;  2IF4 A;  4P8X A;  5DO2 A;  1L1P A;  1FAP A;  4HBO A;  2ZQT A;  1C9H A;  1F8A B;  1Y0O A;  2DG4 A;  2FDM A;  4Z2K A;  4DWS D;  3B9A A;  4Z2H A;  5DIT A;  1ZK6 A;  2DT3 A;  2O9O A;  3CHF A;  1NMV A;  1X6N A;  4JFL A;  2KFW A;  1D6O A;  1FKS A;  2Y78 A;  1J4H A;  1FKB A;  3KAG A;  5DIV A;  3O5I A;  4ZPV R;  1W1T A;  2A3A A;  1NWU A;  4ODK A;  2MLZ A;  1O6I A;  4QT2 A;  1YAT A;  2G8Z A;  4JYS A;  2UZ5 A;  4DRQ A;  4LAW A;  1FKL A;  2ZQU A;  3JYJ A;  1ITX A;  3RGC A;  4FN2 A;  2L2S A;  2FKE A;  1W1P A;  4ODR A;  1LL4 A;  4NNR A;  3ARY A;  3LUO A;  1R9H A;  1HKI A;  2YBU A;  4IT6 A;  3FXY A;  3PRB A;  2YBT A;  1NWS A;  1ZBW A;  4J4N A;  1JNT A;  2RUR A;  4BF8 A;  2MLY A;  4ZS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...