1FKBA

Atomic structure of the rapamycin human immunophilin fkbp-12 complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506 BINDING PROTEIN
publication title Atomic Structure of the Rapamycin Human Immunophilin Fkbp-12 Complex
pubmed rcsb
source organism Homo sapiens
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkbA00
5HW8A 2Y78A 3EY6A 3B7XA 2LKNA 2ZR4A 4TNSA 1F40A 2ITKA 3KCEA 3O5PA 3UI6A 2ZQTA 3H9RB 5BXJA 1JNSA 2IF4A 1ZCNA 2XP6A 2RSEA 5DIVA 1M5YA 2F4EA 2PV2A 4LAYA 2L2SA 2PV3A 4JFJA 4DIPA 1F8AB 1R9HA 1D7JA 2UZ5A 4ODOA 5GPGA 3KABA 4FAPA 3O5LA 2ZR6A 3KAHA 4IQCA 4MGVA 3WH0A 4ODPA 1W26A 3FAPA 1ROTA 3IK8A 4TYOA 1FD9A 4DT4A 2PPOA 5B8IC 2DG4A 2N87A 4MSPA 2M2AA 3JYJA 1N1AA 4W9OA 4J4OA 2KI3A 5DIUA 5HTGA 3TC5A 4DRHA 3UQBA 1EQ3A 2MLZA 2MPHA 1EYMA 1TCOC 2DG9A 4IPXA 3O5IA 3O5OA 1C9HA 4DRMA 3KZ7A 1Q6HA 1PBKA 2LJ4A 2Q5AA 1FKDA 3NRKA 1NMVA 2PBCA 4ODQA 2M08A 2DG3A 2KE0A 2MF9A 2XP5A 3KAIA 4TW7A 1JVWA 2RURA 5D75A 4DRPA 4TW6A 5HW7A 5HT1A 1J6YA 2LPVA 3CGNA 4ODNA 4DRQA 4GIVA 3KADA 3JXVA 2XP9A 1BKFA 1J4RA 2KGJA 2M1IA 4FN2A 1YATA 4QT3A 2K8IA 1FKHA 1Q6IA 2D9FA 1P5QA 2KO7A 2F21A 3OOBA 1A7XA 1Y0OA 3KACA 3UQIA 1FKBA 2XP3A 3O5GA 1BL4A 1ZK6A 2F2DA 2MLXA 2OFNA 2RQSA 3MDYB 4JYSA 1D7HA 4NNRA 4R0XA 3TDBA 4DRNA 5I98A 1Q1CA 3NI6A 1KT0A 3VAWA 2XP4A 1U79A 3IHZA 3IKGA 3IKDA 3KAFA 4LAXA 4TX0A 5HWCA 4DZ3A 4JFLA 3UI4A 4JFKA 1KT1A 4DZ2A 2PV1A 2JZVA 3O5DA 2AWGA 4G2PA 4IQ2A 2RUQA 2ZR5A 3UF8A 2ZQUA 4O2TA 4ODKA 2LGOA 4ODMA 1FKRA 4JFIA 1FKTA 2MLYA 4DRKA 5HWBA 4LAVA 2ZQSA 3KAGA 2XPBA 3PA7A 4DRJA 3JYMA 1FKGA 4ODLA 1J4IA 4G50A 4J4NA 4DROA 4ODRA 1FKSA 5DITA 3O5RA 3RFWA 1NSGA 2ZQVA 5HUAA 4ITZA 4W9QA 3LUOA 3O5MA 1L1PA 5HW6A 3O5JA 3PRDA 3UI5A 4U84A 3TCZA 4GGQA 2KR7A 3O5QA 3GPKA 1FKJA 3CGMA 2FAPA 1FKLA 1B6CA 3PRBA 4TW8A 3O5EA 1FKIA 3UQAA 3RGCA 1HXVA 1J4HA 1FAPA 4U86A 2VN1A 4W9PA 4N19A 1FKFA 2XPAA 4JFMA 1FJDA 3O5FA 2MNTA 2PPPA 2RUDA 4LAWA 4BF8A 1JNTA 4DRIA 3NTPA 2FKEA 2KFWA 1D6OA 4U85A 4QT2A 2PPNA 1PINA 1QZ2A 1D7IA 1ROUA 3ODKA 4C02B 1QPFA 1Q6UA 5HKGA 4QIBA 2XP7A 5J6EA 1QPLA 3I6CA 3O5KA 1T11A 4DH0A 1YW5A 2XP8A 2VCDA 1NMWA 1FKKA 2RUCA
chains in the Genus database with same CATH superfamily
1HJXA 2EULA 3O5PA 4WK9A 2IF4A 5HBFA 4Z2KA 2PI6A 2B5UB 3ARZA 2F23A 2PV2A 3CHDA 4JFJA 2YBUA 3G6LA 2A3BA 1WNOA 1WB0A 2ZR6A 1W9UA 4ODPA 3ARTA 1ROTA 3WD0A 1E6NA 1H0IA 3IK8A 4MSPA 1N1AA 2KI3A 5DIUA 3WD4A 4DRHA 3UQBA 3FXYA 4AY1A 4DWSD 1E9LA 3KZ7A 1ZU8A 2LJ4A 1EIBA 2IUZA 2PBCA 1K9TA 2DG3A 1JVWA 4DRPA 5HW7A 4P8UA 3KADA 2DT1A 1VF8A 3JXVA 4MTVA 5GQBA 4Z2GA 2D9FA 1P5QA 3AS3A 2ETNA 4MNLA 1W9PA 3KACA 4Z2IA 4ZS6A 3UQIA 3O5GA 4R0XA 1Q1CA 3VAWA 4P8VA 1ZBWA 4JFKA 2JZVA 4G2PA 4IQ2A 1JCHB 1GRJA 2ESCA 1W9VA 2ZQUA 1FKRA 4ZPWR 1FKTA 4IT6A 5HWBA 3ARRA 2XPBA 1WAWA 4DRJA 1J4IA 3RM8A 2YBTA 2OLHA 5HUAA 3RMEA 3LUOA 1L1PA 3O5JA 3PRDA 1SYTA 2FAPA 1W1YA 1B6CA 3PRBA 3ALGA 5GPRA 3O5EA 1JNEA 4W9PA 3QOKA 1W1TA 3WQVA 2DSVA 1FFQA 3O5FA 4ZPVR 2RUDA 4BF8A 3NTPA 2FKEA 2KFWA 1H0GA 2PPNA 1O6IA 1PINA 4IT4A 1Q6UA 5HKGA 4QIBA 1QPLA 1GUVA 2XP8A 4DRNA 2AOSA 2Y78A 5HW8A 1OGGA 3B7XA 1F40A 3UI6A 2ZQTA 3H9RB 1X6NA 1ZCNA 2XP6A 1LL4A 2WK2A 4DIPA 3GU0A 1F8AB 1GPFA 2UZ5A 4FAPA 3O5LA 3KAHA 1KFWA 1UR8A 2PN0A 2DPEA 1W1PA 3FAPA 2M2AA 3JYJA 3B9EA 4J4OA 3TC5A 4KR0B 4WKHA 4Q7NA 2MPHA 1EYMA 3O5IA 2Q5AA 4TW7A 4URIA 3B9DA 4DWSC 3ARXA 2RURA 5HT1A 1J6YA 2LPVA 3CGNA 2DT3A 1J4RA 2KGJA 2M1IA 1YATA 1ZBKA 1Q6IA 4HBEA 4W5UA 3BXWA 3PRAA 2A3AA 3BMBA 2MLXA 5I98A 4DWSA 3NI6A 1KT0A 1LL7A 2XP4A 3KAFA 3CH9A 3ARPA 1HJVA 4DZ3A 3UI4A 1KT1A 1OWQA 3ARUA 3UF8A 3WKZA 5DF0A 2DT2A 1NWTA 3AS2A 3CZ8A 2ZQSA 3KAGA 4Q22A 3JYMA 4WJXA 1ZB5A 4ODRA 5DITA 3O5RA 2ZQVA 4P8XA 4ITZA 4W9QA 4WKAA 3UI5A 4U84A 2KR7A 3O5QA 3GPKA 1FKJA 4PTMA 1EDQA 1FKIA 1TFVA 1HKMA 1HXVA 1J4HA 1FAPA 4U86A 4N19A 2XPAA 3AS1A 4JFMA 1FJDA 1JNTA 4WKFA 4DRIA 1D6OA 3W4RA 4LGXA 1QPFA 5J6EA 1LL6A 1T11A 1YW5A 1XRVA 2VCDA 1FKKA 1LQ0A 2RUCA 2DSWA 1D2KA 2LKNA 3B9AA 1LG2A 3KCEA 5BXJA 1JNSA 5DIVA 4Z2LA 4LAYA 4KQZA 2PV3A 1NH6A 1E15A 1D7JA 5GPGA 4MAVA 2O92A 1LG1A 3PR9A 4MGVA 2A3EA 3AROA 1W26A 1LJYA 1FD9A 4MNMA 2PPOA 2N87A 1ZBVA 3WD2A 3FY1A 2DT0A 2DG9A 4MPKA 3RM9A 3NRKA 1NMVA 2M08A 5D75A 2XP5A 1RD6A 4DRQA 3G6MA 1NWUA 2XP9A 1OGBA 1E6PA 1ZBCA 1FKHA 3ARSA 2KO7A 3ARQA 3OOBA 1Y0OA 1FKBA 2XP3A 4JYSA 3MDYB 2RQSA 4NNRA 3TDBA 4WIWA 3IKDA 3IHZA 4TX0A 3CHCA 5HWCA 4DZ2A 2PV1A 3OA5A 4DWSB 3B8SA 4ODKA 4ODMA 2LGOA 4MNKA 4P8WA 4LAVA 2WM0A 1HKKA 2B31A 4Z2HA 4DROA 1CTNA 2QF8A 4G50A 1FKSA 1E44A 1JNDA 3RFWA 3WQWA 2DSZA 3AQUA 5HW6A 4HBOA 3TCZA 3CGMA 2FDMA 3CHEA 1FKLA 3UQAA 1W1VA 3WL0A 2VN1A 4MNJA 5DO2A 2PPPA 3ARVA 3WIJA 4ZPTR 4U85A 4QT2A 1QZ2A 1X6LA 1ROUA 3I6CA 3O5KA 4R5EA 4LAXA 3EY6A 2ZR4A 4TNSA 2ITKA 1HKIA 1UR9A 2G8ZA 1FFRA 1E6ZA 2RSEA 1M5YA 2F4EA 4S3KA 2L2SA 1R9HA 4ODOA 3GTYX 3KABA 4IQCA 3WH0A 1NWSA 4TYOA 4DT4A 5B8IC 2DG4A 4W9OA 5HTGA 4UDMA 3CHFA 1EQ3A 1ZL1A 2MLZA 1TCOC 4IPXA 3O5OA 1C9HA 4DRMA 1Q6HA 1PBKA 1FKDA 4ODQA 3KAIA 2KE0A 2MF9A 3AS0A 3WD1A 4TW6A 1ITXA 4L72B 4ODNA 4GIVA 4NZCA 4NSBA 1BKFA 4FN2A 4L3NA 4QT3A 2K8IA 3ARWA 2F21A 1NWRA 4Z2JA 1A7XA 3WD3A 1BL4A 1ZK6A 2F2DA 2OFNA 3EIPA 3RGCA 1D7HA 1GOIA 5JH8A 3IKGA 1U79A 2A3CA 2O9OA 4JFLA 1SR0A 3ARYA 1HJWA 3O5DA 2AWGA 4S3JA 2RUQA 2ZR5A 4O2TA 4JFIA 2MLYA 4DRKA 2DSUA 2G41A 3PA7A 1FKGA 4ODLA 4J4NA 1NSGA 2WLZA 3WL1A 4ML4A 3O5MA 3ALFA 4XAKA 4HARA 4GGQA 4QZVB 4TW8A 5DEZA 1E6RA 1FKFA 2MNTA 2P4VA 4LAWA 1IX5A 1XHGA 4C02B 1D7IA 3ODKA 2XP7A 3RM4A 1EHNA 4DH0A 1HKJA 2WLYA 1NMWA
chains in the Genus database with same CATH topology
1HJXA 3O5PA 4WK9A 2IF4A 5HBFA 4Z2KA 2PI6A 3ARZA 2PV2A 3CHDA 4JFJA 2YBUA 3G6LA 2A3BA 1WNOA 1WB0A 2ZR6A 1W9UA 4ODPA 3ARTA 1ROTA 3WD0A 1E6NA 1H0IA 3IK8A 4MSPA 1N1AA 2KI3A 5DIUA 3WD4A 4DRHA 3UQBA 3FXYA 4AY1A 4DWSD 1E9LA 3KZ7A 1ZU8A 2LJ4A 1EIBA 2IUZA 2PBCA 1K9TA 2DG3A 1JVWA 4DRPA 5HW7A 4P8UA 3KADA 2DT1A 1VF8A 3JXVA 4MTVA 5GQBA 4Z2GA 2D9FA 1P5QA 3AS3A 4MNLA 1W9PA 3KACA 4Z2IA 4ZS6A 3UQIA 3O5GA 4R0XA 1Q1CA 3VAWA 4P8VA 1ZBWA 4JFKA 2JZVA 4G2PA 4IQ2A 2ESCA 1W9VA 2ZQUA 1FKRA 4ZPWR 1FKTA 4IT6A 5HWBA 3ARRA 2XPBA 1WAWA 4DRJA 1J4IA 3RM8A 2YBTA 2OLHA 5HUAA 3RMEA 3LUOA 1L1PA 3O5JA 3PRDA 1SYTA 2FAPA 1W1YA 1B6CA 3PRBA 3ALGA 5GPRA 3O5EA 1JNEA 4W9PA 3QOKA 1W1TA 3WQVA 2DSVA 1FFQA 3O5FA 4ZPVR 2RUDA 4BF8A 3NTPA 2FKEA 2KFWA 1H0GA 2PPNA 1O6IA 1PINA 4IT4A 1Q6UA 5HKGA 4QIBA 1QPLA 1GUVA 2XP8A 4DRNA 2AOSA 2Y78A 5HW8A 1OGGA 3B7XA 1F40A 3UI6A 2ZQTA 3H9RB 1X6NA 1ZCNA 2XP6A 1LL4A 2WK2A 4DIPA 1F8AB 1GPFA 2UZ5A 4FAPA 3O5LA 3KAHA 1KFWA 1UR8A 2DPEA 1W1PA 3FAPA 2M2AA 3JYJA 3B9EA 4J4OA 3TC5A 4KR0B 4WKHA 4Q7NA 2MPHA 1EYMA 3O5IA 2Q5AA 4TW7A 4URIA 3B9DA 4DWSC 3ARXA 2RURA 5HT1A 1J6YA 2LPVA 3CGNA 2DT3A 1J4RA 2KGJA 2M1IA 1YATA 1ZBKA 1Q6IA 4HBEA 4W5UA 3BXWA 3PRAA 2A3AA 2MLXA 5I98A 4DWSA 3NI6A 1KT0A 1LL7A 2XP4A 3KAFA 3CH9A 3ARPA 1HJVA 4DZ3A 3UI4A 1KT1A 1OWQA 3ARUA 3UF8A 3WKZA 5DF0A 2DT2A 1NWTA 3AS2A 3CZ8A 2ZQSA 3KAGA 4Q22A 3JYMA 4WJXA 1ZB5A 4ODRA 5DITA 3O5RA 2ZQVA 4P8XA 4ITZA 4W9QA 4WKAA 3UI5A 4U84A 2KR7A 3O5QA 3GPKA 1FKJA 4PTMA 1EDQA 1FKIA 1TFVA 1HKMA 1HXVA 1J4HA 1FAPA 4U86A 4N19A 2XPAA 3AS1A 4JFMA 1FJDA 1JNTA 4WKFA 4DRIA 1D6OA 3W4RA 4LGXA 1QPFA 5J6EA 1LL6A 1T11A 1YW5A 1XRVA 2VCDA 1FKKA 1LQ0A 2RUCA 2DSWA 1D2KA 2LKNA 3B9AA 1LG2A 3KCEA 5BXJA 1JNSA 5DIVA 4Z2LA 4LAYA 4KQZA 2PV3A 1NH6A 1E15A 1D7JA 5GPGA 4MAVA 2O92A 1LG1A 3PR9A 4MGVA 2A3EA 3AROA 1W26A 1LJYA 1FD9A 4MNMA 2PPOA 2N87A 1ZBVA 3WD2A 3FY1A 2DT0A 2DG9A 4MPKA 3RM9A 3NRKA 1NMVA 2M08A 5D75A 2XP5A 1RD6A 4DRQA 3G6MA 1NWUA 2XP9A 1OGBA 1E6PA 1ZBCA 1FKHA 3ARSA 2KO7A 3ARQA 3OOBA 1Y0OA 1FKBA 2XP3A 4JYSA 3MDYB 2RQSA 4NNRA 3TDBA 4WIWA 3IKDA 3IHZA 4TX0A 3CHCA 5HWCA 4DZ2A 2PV1A 3OA5A 4DWSB 3B8SA 4ODKA 4ODMA 2LGOA 4MNKA 4P8WA 4LAVA 2WM0A 1HKKA 2B31A 4Z2HA 4DROA 1CTNA 2QF8A 4G50A 1FKSA 1JNDA 3RFWA 3WQWA 2DSZA 3AQUA 5HW6A 4HBOA 3TCZA 3CGMA 2FDMA 3CHEA 1FKLA 3UQAA 1W1VA 3WL0A 2VN1A 4MNJA 5DO2A 2PPPA 3ARVA 3WIJA 4ZPTR 4U85A 4QT2A 1QZ2A 1X6LA 1ROUA 3I6CA 3O5KA 4R5EA 4LAXA 3EY6A 2ZR4A 4TNSA 2ITKA 1HKIA 1UR9A 2G8ZA 1FFRA 1E6ZA 2RSEA 1M5YA 2F4EA 4S3KA 2L2SA 1R9HA 4ODOA 3KABA 4IQCA 3WH0A 1NWSA 4TYOA 4DT4A 5B8IC 2DG4A 4W9OA 5HTGA 3CHFA 1EQ3A 1ZL1A 2MLZA 1TCOC 4IPXA 3O5OA 1C9HA 4DRMA 1Q6HA 1PBKA 1FKDA 4ODQA 3KAIA 2KE0A 2MF9A 3AS0A 3WD1A 4TW6A 1ITXA 4L72B 4ODNA 4GIVA 4NZCA 4NSBA 1BKFA 4FN2A 4L3NA 4QT3A 2K8IA 3ARWA 2F21A 1NWRA 4Z2JA 1A7XA 3WD3A 1BL4A 1ZK6A 2F2DA 2OFNA 3RGCA 1D7HA 1GOIA 5JH8A 3IKGA 1U79A 2A3CA 2O9OA 4JFLA 1SR0A 3ARYA 1HJWA 3O5DA 2AWGA 4S3JA 2RUQA 2ZR5A 4O2TA 4JFIA 2MLYA 4DRKA 2DSUA 2G41A 3PA7A 1FKGA 4ODLA 4J4NA 1NSGA 2WLZA 3WL1A 4ML4A 3O5MA 3ALFA 4XAKA 4HARA 4GGQA 4QZVB 4TW8A 5DEZA 1E6RA 1FKFA 2MNTA 4LAWA 1IX5A 1XHGA 4C02B 1D7IA 3ODKA 2XP7A 3RM4A 1EHNA 4DH0A 1HKJA 2WLYA 1NMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HW8 A;  2Y78 A;  3EY6 A;  3B7X A;  2LKN A;  2ZR4 A;  4TNS A;  1F40 A;  2ITK A;  3KCE A;  3O5P A;  3UI6 A;  2ZQT A;  3H9R B;  5BXJ A;  1JNS A;  2IF4 A;  1ZCN A;  2XP6 A;  2RSE A;  5DIV A;  1M5Y A;  2F4E A;  2PV2 A;  4LAY A;  2L2S A;  2PV3 A;  4JFJ A;  4DIP A;  1F8A B;  1R9H A;  1D7J A;  2UZ5 A;  4ODO A;  5GPG A;  3KAB A;  4FAP A;  3O5L A;  2ZR6 A;  3KAH A;  4IQC A;  4MGV A;  3WH0 A;  4ODP A;  1W26 A;  3FAP A;  1ROT A;  3IK8 A;  4TYO A;  1FD9 A;  4DT4 A;  2PPO A;  5B8I C;  2DG4 A;  2N87 A;  4MSP A;  2M2A A;  3JYJ A;  1N1A A;  4W9O A;  4J4O A;  2KI3 A;  5DIU A;  5HTG A;  3TC5 A;  4DRH A;  3UQB A;  1EQ3 A;  2MLZ A;  2MPH A;  1EYM A;  1TCO C;  2DG9 A;  4IPX A;  3O5I A;  3O5O A;  1C9H A;  4DRM A;  3KZ7 A;  1Q6H A;  1PBK A;  2LJ4 A;  2Q5A A;  1FKD A;  3NRK A;  1NMV A;  2PBC A;  4ODQ A;  2M08 A;  2DG3 A;  2KE0 A;  2MF9 A;  2XP5 A;  3KAI A;  4TW7 A;  1JVW A;  2RUR A;  5D75 A;  4DRP A;  4TW6 A;  5HW7 A;  5HT1 A;  1J6Y A;  2LPV A;  3CGN A;  4ODN A;  4DRQ A;  4GIV A;  3KAD A;  3JXV A;  2XP9 A;  1BKF A;  1J4R A;  2KGJ A;  2M1I A;  4FN2 A;  1YAT A;  4QT3 A;  2K8I A;  1FKH A;  1Q6I A;  2D9F A;  1P5Q A;  2KO7 A;  2F21 A;  3OOB A;  1A7X A;  1Y0O A;  3KAC A;  3UQI A;  1FKB A;  2XP3 A;  3O5G A;  1BL4 A;  1ZK6 A;  2F2D A;  2MLX A;  2OFN A;  2RQS A;  3MDY B;  4JYS A;  1D7H A;  4NNR A;  4R0X A;  3TDB A;  4DRN A;  5I98 A;  1Q1C A;  3NI6 A;  1KT0 A;  3VAW A;  2XP4 A;  1U79 A;  3IHZ A;  3IKG A;  3IKD A;  3KAF A;  4LAX A;  4TX0 A;  5HWC A;  4DZ3 A;  4JFL A;  3UI4 A;  4JFK A;  1KT1 A;  4DZ2 A;  2PV1 A;  2JZV A;  3O5D A;  2AWG A;  4G2P A;  4IQ2 A;  2RUQ A;  2ZR5 A;  3UF8 A;  2ZQU A;  4O2T A;  4ODK A;  2LGO A;  4ODM A;  1FKR A;  4JFI A;  1FKT A;  2MLY A;  4DRK A;  5HWB A;  4LAV A;  2ZQS A;  3KAG A;  2XPB A;  3PA7 A;  4DRJ A;  3JYM A;  1FKG A;  4ODL A;  1J4I A;  4G50 A;  4J4N A;  4DRO A;  4ODR A;  1FKS A;  5DIT A;  3O5R A;  3RFW A;  1NSG A;  2ZQV A;  5HUA A;  4ITZ A;  4W9Q A;  3LUO A;  3O5M A;  1L1P A;  5HW6 A;  3O5J A;  3PRD A;  3UI5 A;  4U84 A;  3TCZ A;  4GGQ A;  2KR7 A;  3O5Q A;  3GPK A;  1FKJ A;  3CGM A;  2FAP A;  1FKL A;  1B6C A;  3PRB A;  4TW8 A;  3O5E A;  1FKI A;  3UQA A;  3RGC A;  1HXV A;  1J4H A;  1FAP A;  4U86 A;  2VN1 A;  4W9P A;  4N19 A;  1FKF A;  2XPA A;  4JFM A;  1FJD A;  3O5F A;  2MNT A;  2PPP A;  2RUD A;  4LAW A;  4BF8 A;  1JNT A;  4DRI A;  3NTP A;  2FKE A;  2KFW A;  1D6O A;  4U85 A;  4QT2 A;  2PPN A;  1PIN A;  1QZ2 A;  1D7I A;  1ROU A;  3ODK A;  4C02 B;  1QPF A;  1Q6U A;  5HKG A;  4QIB A;  2XP7 A;  5J6E A;  1QPL A;  3I6C A;  3O5K A;  1T11 A;  4DH0 A;  1YW5 A;  2XP8 A;  2VCD A;  1NMW A;  1FKK A;  2RUC A; 
#chains in the Genus database with same CATH topology
 1HJX A;  2EUL A;  3O5P A;  4WK9 A;  2IF4 A;  5HBF A;  4Z2K A;  2PI6 A;  2B5U B;  3ARZ A;  2F23 A;  2PV2 A;  3CHD A;  4JFJ A;  2YBU A;  3G6L A;  2A3B A;  1WNO A;  1WB0 A;  2ZR6 A;  1W9U A;  4ODP A;  3ART A;  1ROT A;  3WD0 A;  1E6N A;  1H0I A;  3IK8 A;  4MSP A;  1N1A A;  2KI3 A;  5DIU A;  3WD4 A;  4DRH A;  3UQB A;  3FXY A;  4AY1 A;  4DWS D;  1E9L A;  3KZ7 A;  1ZU8 A;  2LJ4 A;  1EIB A;  2IUZ A;  2PBC A;  1K9T A;  2DG3 A;  1JVW A;  4DRP A;  5HW7 A;  4P8U A;  3KAD A;  2DT1 A;  1VF8 A;  3JXV A;  4MTV A;  5GQB A;  4Z2G A;  2D9F A;  1P5Q A;  3AS3 A;  2ETN A;  4MNL A;  1W9P A;  3KAC A;  4Z2I A;  4ZS6 A;  3UQI A;  3O5G A;  4R0X A;  1Q1C A;  3VAW A;  4P8V A;  1ZBW A;  4JFK A;  2JZV A;  4G2P A;  4IQ2 A;  1JCH B;  1GRJ A;  2ESC A;  1W9V A;  2ZQU A;  1FKR A;  4ZPW R;  1FKT A;  4IT6 A;  5HWB A;  3ARR A;  2XPB A;  1WAW A;  4DRJ A;  1J4I A;  3RM8 A;  2YBT A;  2OLH A;  5HUA A;  3RME A;  3LUO A;  1L1P A;  3O5J A;  3PRD A;  1SYT A;  2FAP A;  1W1Y A;  1B6C A;  3PRB A;  3ALG A;  5GPR A;  3O5E A;  1JNE A;  4W9P A;  3QOK A;  1W1T A;  3WQV A;  2DSV A;  1FFQ A;  3O5F A;  4ZPV R;  2RUD A;  4BF8 A;  3NTP A;  2FKE A;  2KFW A;  1H0G A;  2PPN A;  1O6I A;  1PIN A;  4IT4 A;  1Q6U A;  5HKG A;  4QIB A;  1QPL A;  1GUV A;  2XP8 A;  4DRN A;  2AOS A;  2Y78 A;  5HW8 A;  1OGG A;  3B7X A;  1F40 A;  3UI6 A;  2ZQT A;  3H9R B;  1X6N A;  1ZCN A;  2XP6 A;  1LL4 A;  2WK2 A;  4DIP A;  3GU0 A;  1F8A B;  1GPF A;  2UZ5 A;  4FAP A;  3O5L A;  3KAH A;  1KFW A;  1UR8 A;  2PN0 A;  2DPE A;  1W1P A;  3FAP A;  2M2A A;  3JYJ A;  3B9E A;  4J4O A;  3TC5 A;  4KR0 B;  4WKH A;  4Q7N A;  2MPH A;  1EYM A;  3O5I A;  2Q5A A;  4TW7 A;  4URI A;  3B9D A;  4DWS C;  3ARX A;  2RUR A;  5HT1 A;  1J6Y A;  2LPV A;  3CGN A;  2DT3 A;  1J4R A;  2KGJ A;  2M1I A;  1YAT A;  1ZBK A;  1Q6I A;  4HBE A;  4W5U A;  3BXW A;  3PRA A;  2A3A A;  3BMB A;  2MLX A;  5I98 A;  4DWS A;  3NI6 A;  1KT0 A;  1LL7 A;  2XP4 A;  3KAF A;  3CH9 A;  3ARP A;  1HJV A;  4DZ3 A;  3UI4 A;  1KT1 A;  1OWQ A;  3ARU A;  3UF8 A;  3WKZ A;  5DF0 A;  2DT2 A;  1NWT A;  3AS2 A;  3CZ8 A;  2ZQS A;  3KAG A;  4Q22 A;  3JYM A;  4WJX A;  1ZB5 A;  4ODR A;  5DIT A;  3O5R A;  2ZQV A;  4P8X A;  4ITZ A;  4W9Q A;  4WKA A;  3UI5 A;  4U84 A;  2KR7 A;  3O5Q A;  3GPK A;  1FKJ A;  4PTM A;  1EDQ A;  1FKI A;  1TFV A;  1HKM A;  1HXV A;  1J4H A;  1FAP A;  4U86 A;  4N19 A;  2XPA A;  3AS1 A;  4JFM A;  1FJD A;  1JNT A;  4WKF A;  4DRI A;  1D6O A;  3W4R A;  4LGX A;  1QPF A;  5J6E A;  1LL6 A;  1T11 A;  1YW5 A;  1XRV A;  2VCD A;  1FKK A;  1LQ0 A;  2RUC A;  2DSW A;  1D2K A;  2LKN A;  3B9A A;  1LG2 A;  3KCE A;  5BXJ A;  1JNS A;  5DIV A;  4Z2L A;  4LAY A;  4KQZ A;  2PV3 A;  1NH6 A;  1E15 A;  1D7J A;  5GPG A;  4MAV A;  2O92 A;  1LG1 A;  3PR9 A;  4MGV A;  2A3E A;  3ARO A;  1W26 A;  1LJY A;  1FD9 A;  4MNM A;  2PPO A;  2N87 A;  1ZBV A;  3WD2 A;  3FY1 A;  2DT0 A;  2DG9 A;  4MPK A;  3RM9 A;  3NRK A;  1NMV A;  2M08 A;  5D75 A;  2XP5 A;  1RD6 A;  4DRQ A;  3G6M A;  1NWU A;  2XP9 A;  1OGB A;  1E6P A;  1ZBC A;  1FKH A;  3ARS A;  2KO7 A;  3ARQ A;  3OOB A;  1Y0O A;  1FKB A;  2XP3 A;  4JYS A;  3MDY B;  2RQS A;  4NNR A;  3TDB A;  4WIW A;  3IKD A;  3IHZ A;  4TX0 A;  3CHC A;  5HWC A;  4DZ2 A;  2PV1 A;  3OA5 A;  4DWS B;  3B8S A;  4ODK A;  4ODM A;  2LGO A;  4MNK A;  4P8W A;  4LAV A;  2WM0 A;  1HKK A;  2B31 A;  4Z2H A;  4DRO A;  1CTN A;  2QF8 A;  4G50 A;  1FKS A;  1E44 A;  1JND A;  3RFW A;  3WQW A;  2DSZ A;  3AQU A;  5HW6 A;  4HBO A;  3TCZ A;  3CGM A;  2FDM A;  3CHE A;  1FKL A;  3UQA A;  1W1V A;  3WL0 A;  2VN1 A;  4MNJ A;  5DO2 A;  2PPP A;  3ARV A;  3WIJ A;  4ZPT R;  4U85 A;  4QT2 A;  1QZ2 A;  1X6L A;  1ROU A;  3I6C A;  3O5K A;  4R5E A;  4LAX A;  3EY6 A;  2ZR4 A;  4TNS A;  2ITK A;  1HKI A;  1UR9 A;  2G8Z A;  1FFR A;  1E6Z A;  2RSE A;  1M5Y A;  2F4E A;  4S3K A;  2L2S A;  1R9H A;  4ODO A;  3GTY X;  3KAB A;  4IQC A;  3WH0 A;  1NWS A;  4TYO A;  4DT4 A;  5B8I C;  2DG4 A;  4W9O A;  5HTG A;  4UDM A;  3CHF A;  1EQ3 A;  1ZL1 A;  2MLZ A;  1TCO C;  4IPX A;  3O5O A;  1C9H A;  4DRM A;  1Q6H A;  1PBK A;  1FKD A;  4ODQ A;  3KAI A;  2KE0 A;  2MF9 A;  3AS0 A;  3WD1 A;  4TW6 A;  1ITX A;  4L72 B;  4ODN A;  4GIV A;  4NZC A;  4NSB A;  1BKF A;  4FN2 A;  4L3N A;  4QT3 A;  2K8I A;  3ARW A;  2F21 A;  1NWR A;  4Z2J A;  1A7X A;  3WD3 A;  1BL4 A;  1ZK6 A;  2F2D A;  2OFN A;  3EIP A;  3RGC A;  1D7H A;  1GOI A;  5JH8 A;  3IKG A;  1U79 A;  2A3C A;  2O9O A;  4JFL A;  1SR0 A;  3ARY A;  1HJW A;  3O5D A;  2AWG A;  4S3J A;  2RUQ A;  2ZR5 A;  4O2T A;  4JFI A;  2MLY A;  4DRK A;  2DSU A;  2G41 A;  3PA7 A;  1FKG A;  4ODL A;  4J4N A;  1NSG A;  2WLZ A;  3WL1 A;  4ML4 A;  3O5M A;  3ALF A;  4XAK A;  4HAR A;  4GGQ A;  4QZV B;  4TW8 A;  5DEZ A;  1E6R A;  1FKF A;  2MNT A;  2P4V A;  4LAW A;  1IX5 A;  1XHG A;  4C02 B;  1D7I A;  3ODK A;  2XP7 A;  3RM4 A;  1EHN A;  4DH0 A;  1HKJ A;  2WLY A;  1NMW A; 
#chains in the Genus database with same CATH homology
 1HJX A;  3O5P A;  4WK9 A;  2IF4 A;  5HBF A;  4Z2K A;  2PI6 A;  3ARZ A;  2PV2 A;  3CHD A;  4JFJ A;  2YBU A;  3G6L A;  2A3B A;  1WNO A;  1WB0 A;  2ZR6 A;  1W9U A;  4ODP A;  3ART A;  1ROT A;  3WD0 A;  1E6N A;  1H0I A;  3IK8 A;  4MSP A;  1N1A A;  2KI3 A;  5DIU A;  3WD4 A;  4DRH A;  3UQB A;  3FXY A;  4AY1 A;  4DWS D;  1E9L A;  3KZ7 A;  1ZU8 A;  2LJ4 A;  1EIB A;  2IUZ A;  2PBC A;  1K9T A;  2DG3 A;  1JVW A;  4DRP A;  5HW7 A;  4P8U A;  3KAD A;  2DT1 A;  1VF8 A;  3JXV A;  4MTV A;  5GQB A;  4Z2G A;  2D9F A;  1P5Q A;  3AS3 A;  4MNL A;  1W9P A;  3KAC A;  4Z2I A;  4ZS6 A;  3UQI A;  3O5G A;  4R0X A;  1Q1C A;  3VAW A;  4P8V A;  1ZBW A;  4JFK A;  2JZV A;  4G2P A;  4IQ2 A;  2ESC A;  1W9V A;  2ZQU A;  1FKR A;  4ZPW R;  1FKT A;  4IT6 A;  5HWB A;  3ARR A;  2XPB A;  1WAW A;  4DRJ A;  1J4I A;  3RM8 A;  2YBT A;  2OLH A;  5HUA A;  3RME A;  3LUO A;  1L1P A;  3O5J A;  3PRD A;  1SYT A;  2FAP A;  1W1Y A;  1B6C A;  3PRB A;  3ALG A;  5GPR A;  3O5E A;  1JNE A;  4W9P A;  3QOK A;  1W1T A;  3WQV A;  2DSV A;  1FFQ A;  3O5F A;  4ZPV R;  2RUD A;  4BF8 A;  3NTP A;  2FKE A;  2KFW A;  1H0G A;  2PPN A;  1O6I A;  1PIN A;  4IT4 A;  1Q6U A;  5HKG A;  4QIB A;  1QPL A;  1GUV A;  2XP8 A;  4DRN A;  2AOS A;  2Y78 A;  5HW8 A;  1OGG A;  3B7X A;  1F40 A;  3UI6 A;  2ZQT A;  3H9R B;  1X6N A;  1ZCN A;  2XP6 A;  1LL4 A;  2WK2 A;  4DIP A;  1F8A B;  1GPF A;  2UZ5 A;  4FAP A;  3O5L A;  3KAH A;  1KFW A;  1UR8 A;  2DPE A;  1W1P A;  3FAP A;  2M2A A;  3JYJ A;  3B9E A;  4J4O A;  3TC5 A;  4KR0 B;  4WKH A;  4Q7N A;  2MPH A;  1EYM A;  3O5I A;  2Q5A A;  4TW7 A;  4URI A;  3B9D A;  4DWS C;  3ARX A;  2RUR A;  5HT1 A;  1J6Y A;  2LPV A;  3CGN A;  2DT3 A;  1J4R A;  2KGJ A;  2M1I A;  1YAT A;  1ZBK A;  1Q6I A;  4HBE A;  4W5U A;  3BXW A;  3PRA A;  2A3A A;  2MLX A;  5I98 A;  4DWS A;  3NI6 A;  1KT0 A;  1LL7 A;  2XP4 A;  3KAF A;  3CH9 A;  3ARP A;  1HJV A;  4DZ3 A;  3UI4 A;  1KT1 A;  1OWQ A;  3ARU A;  3UF8 A;  3WKZ A;  5DF0 A;  2DT2 A;  1NWT A;  3AS2 A;  3CZ8 A;  2ZQS A;  3KAG A;  4Q22 A;  3JYM A;  4WJX A;  1ZB5 A;  4ODR A;  5DIT A;  3O5R A;  2ZQV A;  4P8X A;  4ITZ A;  4W9Q A;  4WKA A;  3UI5 A;  4U84 A;  2KR7 A;  3O5Q A;  3GPK A;  1FKJ A;  4PTM A;  1EDQ A;  1FKI A;  1TFV A;  1HKM A;  1HXV A;  1J4H A;  1FAP A;  4U86 A;  4N19 A;  2XPA A;  3AS1 A;  4JFM A;  1FJD A;  1JNT A;  4WKF A;  4DRI A;  1D6O A;  3W4R A;  4LGX A;  1QPF A;  5J6E A;  1LL6 A;  1T11 A;  1YW5 A;  1XRV A;  2VCD A;  1FKK A;  1LQ0 A;  2RUC A;  2DSW A;  1D2K A;  2LKN A;  3B9A A;  1LG2 A;  3KCE A;  5BXJ A;  1JNS A;  5DIV A;  4Z2L A;  4LAY A;  4KQZ A;  2PV3 A;  1NH6 A;  1E15 A;  1D7J A;  5GPG A;  4MAV A;  2O92 A;  1LG1 A;  3PR9 A;  4MGV A;  2A3E A;  3ARO A;  1W26 A;  1LJY A;  1FD9 A;  4MNM A;  2PPO A;  2N87 A;  1ZBV A;  3WD2 A;  3FY1 A;  2DT0 A;  2DG9 A;  4MPK A;  3RM9 A;  3NRK A;  1NMV A;  2M08 A;  5D75 A;  2XP5 A;  1RD6 A;  4DRQ A;  3G6M A;  1NWU A;  2XP9 A;  1OGB A;  1E6P A;  1ZBC A;  1FKH A;  3ARS A;  2KO7 A;  3ARQ A;  3OOB A;  1Y0O A;  1FKB A;  2XP3 A;  4JYS A;  3MDY B;  2RQS A;  4NNR A;  3TDB A;  4WIW A;  3IKD A;  3IHZ A;  4TX0 A;  3CHC A;  5HWC A;  4DZ2 A;  2PV1 A;  3OA5 A;  4DWS B;  3B8S A;  4ODK A;  4ODM A;  2LGO A;  4MNK A;  4P8W A;  4LAV A;  2WM0 A;  1HKK A;  2B31 A;  4Z2H A;  4DRO A;  1CTN A;  2QF8 A;  4G50 A;  1FKS A;  1JND A;  3RFW A;  3WQW A;  2DSZ A;  3AQU A;  5HW6 A;  4HBO A;  3TCZ A;  3CGM A;  2FDM A;  3CHE A;  1FKL A;  3UQA A;  1W1V A;  3WL0 A;  2VN1 A;  4MNJ A;  5DO2 A;  2PPP A;  3ARV A;  3WIJ A;  4ZPT R;  4U85 A;  4QT2 A;  1QZ2 A;  1X6L A;  1ROU A;  3I6C A;  3O5K A;  4R5E A;  4LAX A;  3EY6 A;  2ZR4 A;  4TNS A;  2ITK A;  1HKI A;  1UR9 A;  2G8Z A;  1FFR A;  1E6Z A;  2RSE A;  1M5Y A;  2F4E A;  4S3K A;  2L2S A;  1R9H A;  4ODO A;  3KAB A;  4IQC A;  3WH0 A;  1NWS A;  4TYO A;  4DT4 A;  5B8I C;  2DG4 A;  4W9O A;  5HTG A;  3CHF A;  1EQ3 A;  1ZL1 A;  2MLZ A;  1TCO C;  4IPX A;  3O5O A;  1C9H A;  4DRM A;  1Q6H A;  1PBK A;  1FKD A;  4ODQ A;  3KAI A;  2KE0 A;  2MF9 A;  3AS0 A;  3WD1 A;  4TW6 A;  1ITX A;  4L72 B;  4ODN A;  4GIV A;  4NZC A;  4NSB A;  1BKF A;  4FN2 A;  4L3N A;  4QT3 A;  2K8I A;  3ARW A;  2F21 A;  1NWR A;  4Z2J A;  1A7X A;  3WD3 A;  1BL4 A;  1ZK6 A;  2F2D A;  2OFN A;  3RGC A;  1D7H A;  1GOI A;  5JH8 A;  3IKG A;  1U79 A;  2A3C A;  2O9O A;  4JFL A;  1SR0 A;  3ARY A;  1HJW A;  3O5D A;  2AWG A;  4S3J A;  2RUQ A;  2ZR5 A;  4O2T A;  4JFI A;  2MLY A;  4DRK A;  2DSU A;  2G41 A;  3PA7 A;  1FKG A;  4ODL A;  4J4N A;  1NSG A;  2WLZ A;  3WL1 A;  4ML4 A;  3O5M A;  3ALF A;  4XAK A;  4HAR A;  4GGQ A;  4QZV B;  4TW8 A;  5DEZ A;  1E6R A;  1FKF A;  2MNT A;  4LAW A;  1IX5 A;  1XHG A;  4C02 B;  1D7I A;  3ODK A;  2XP7 A;  3RM4 A;  1EHN A;  4DH0 A;  1HKJ A;  2WLY A;  1NMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...