1FKBA

Atomic structure of the rapamycin human immunophilin fkbp-12 complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Structure of the Rapamycin Human Immunophilin Fkbp-12 Complex
pubmed rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506 BINDING PROTEIN
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkbA00
2XP5A 4ODNA 1F40A 2FAPA 2F2DA 2KO7A 4IPXA 4W9OA 4JYSA 2ITKA 5I98A 1Y0OA 4BF8A 2RUCA 1FJDA 4DRKA 2KE0A 1FKFA 3UF8A 2KI3A 2XP8A 4G2PA 1P5QA 4MSPA 4U85A 3PRBA 1B6CA 3LUOA 2D9FA 2UZ5A 2N87A 2XPAA 4TX0A 1Q6IA 5HW8A 4TW7A 1M5YA 4JFMA 4ODOA 1R9HA 3FAPA 4DRMA 2MPHA 2LKNA 2L2SA 2M08A 3O5KA 1FKIA 3O5DA 4W9QA 2M2AA 3NTPA 5HKGA 3I6CA 1D7IA 4G50A 5BXJA 2MLXA 2VCDA 2JZVA 3O5EA 1NMVA 1FKSA 4QT3A 4QT2A 1KT0A 4U84A 1FKGA 2LJ4A 3MDYB 1BKFA 5DIVA 1N1AA 3KAIA 3UQAA 4JFJA 2KFWA 2F4EA 5HW7A 1L1PA 1FD9A 3KACA 3JYJA 4C02B 3UQIA 2M1IA 2PPNA 2PV1A 4TYOA 2ZQSA 3O5MA 2IF4A 3IKDA 1KT1A 3UI5A 1FAPA 1D6OA 3NI6A 1QPFA 3KCEA 1D7JA 4TW6A 5DITA 5J6EA 3IKGA 3O5JA 3O5GA 2K8IA 1PBKA 1TCOC 1T11A 1FKLA 2DG4A 3O5FA 1QPLA 3KAFA 2DG9A 4FN2A 4DRPA 1EQ3A 1NSGA 3EY6A 1J4RA 4TW8A 3PRDA 3NRKA 3KAHA 4DZ2A 3H9RB 5HWCA 1JVWA 1W26A 2PV3A 4JFKA 2RUDA 2OFNA 1ZK6A 4MGVA 1EYMA 1ROTA 3RFWA 3WH0A 5DIUA 3VAWA 4R0XA 4JFIA 2PV2A 2PBCA 3B7XA 4ODQA 1ZCNA 2PPOA 3KADA 1YW5A 2ZR4A 5HUAA 2KGJA 3TDBA 4DRQA 5D75A 1FKBA 5HW6A 3CGMA 4LAVA 4IQCA 1FKTA 1U79A 4ODRA 1J4IA 3KAGA 3OOBA 3IHZA 1FKDA 3O5RA 5HTGA 4DROA 4U86A 1ROUA 2XP6A 3O5LA 4J4NA 4TNSA 5HWBA 3O5IA 1JNSA 2ZR5A 3TCZA 1FKHA 2XPBA 1JNTA 1F8AB 2AWGA 2Y78A 2ZQVA 4IQ2A 4ODPA 4DH0A 1J6YA 4ODLA 3UI4A 2LPVA 4LAXA 2MLYA 3KABA 2FKEA 3UQBA 3IK8A 3CGNA 4DIPA 4NNRA 3ODKA 3KZ7A 3JYMA 5HT1A 4J4OA 2LGOA 2XP4A 3O5PA 4QIBA 2MNTA 1Q6UA 1A7XA 4DRHA 2Q5AA 4DRIA 3TC5A 3UI6A 4DRJA 3O5QA 2MF9A 2RQSA 1C9HA 2ZQUA 1FKJA 4DRNA 4O2TA 3GPKA 4GGQA 4DT4A 2MLZA 1J4HA 4ITZA 4LAWA 2PPPA 4ODMA 3JXVA 4LAYA 1BL4A 4W9PA 2RSEA 1YATA 1FKRA 2XP3A 2ZR6A 2XP7A 2ZQTA 1QZ2A 2DG3A 1Q1CA 4GIVA 3PA7A 5GPGA 4N19A 1PINA 4DZ3A 2VN1A 4ODKA 1HXVA 1Q6HA 3RGCA 1NMWA 1FKKA 1D7HA 2KR7A 4JFLA 5B8IC 3O5OA 2XP9A 4FAPA 2RUQA 2F21A 2RURA
chains in the Genus database with same CATH superfamily
2F2DA 3WL1A 4BF8A 1FJDA 1TFVA 1NWSA 2KI3A 1K9TA 4MSPA 2UZ5A 1E6ZA 2N87A 4UDMA 1OWQA 1R9HA 4DRMA 1W1VA 2L2SA 2LKNA 2M08A 3FY1A 2OLHA 2WM0A 1D7IA 4G50A 5BXJA 3ARSA 2DSVA 1H0IA 4Z2GA 1FKSA 4QT2A 4U84A 1FKGA 5DIVA 1GPFA 1UR8A 2F4EA 3GU0A 3JYJA 1LG1A 1NWRA 1ZL1A 3WD4A 1KFWA 1KT1A 1FAPA 5J6EA 1QPFA 3KCEA 3O5GA 2K8IA 1NWUA 1EDQA 1QPLA 1ZBVA 2A3AA 3B8SA 3AROA 3H9RB 5HWCA 1W26A 4JFKA 1HKKA 4WKFA 3B9AA 4MGVA 1ROTA 4P8VA 2F23A 4S3KA 4ODQA 5HUAA 1NWTA 4WKHA 1HKIA 3ARXA 3CHFA 5D75A 1FKBA 4ODRA 3ALGA 2YBTA 1SYTA 1ROUA 3RMEA 3O5IA 3CHEA 3TCZA 2XPBA 1JNTA 2ZQVA 2QF8A 4NZCA 1HKJA 3CGNA 4WKAA 4NNRA 3ODKA 4L3NA 1FFQA 3WD0A 4DRHA 1Q6UA 2Q5AA 3O5QA 2MF9A 2RQSA 4WIWA 1E44A 4DRNA 1HJWA 2MLZA 1J4HA 2YBUA 4LAWA 3JXVA 4LAYA 1FKRA 2ZR6A 3ARWA 3BMBA 3WD1A 2DG3A 1OGGA 4N19A 2VN1A 4ODKA 4PTMA 1Q6HA 1FKKA 2WLYA 5B8IC 3O5OA 4DWSA 2RURA 4ODNA 2FAPA 1JNEA 4JYSA 1WNOA 5JH8A 3QOKA 1P5QA 3ARTA 2O9OA 5HW8A 4TW7A 5GQBA 4ODOA 1W1YA 3FAPA 3O5KA 4IT4A 4WJXA 3ARPA 1FKIA 4ZPVR 2MLXA 2VCDA 3WIJA 2WK2A 3O5EA 4QT3A 3CH9A 1UR9A 2LJ4A 1GUVA 5HW7A 2G8ZA 1ZBWA 4C02B 3PR9A 2PV1A 1XHGA 2ZQSA 3IKDA 4HBOA 3AS2A 3IKGA 3RM8A 1FKLA 2DG4A 3KAFA 4DRPA 3EY6A 1W1PA 2B31A 1GRJA 2PV3A 1ZBCA 1W9UA 2B5UB 2RUDA 4W5UA 1ZK6A 3RFWA 3VAWA 1SR0A 2PV2A 3B7XA 5DF0A 1ZCNA 2PPOA 2KGJA 4ZPWR 4MNKA 4DRQA 1U79A 5HTGA 1FKDA 3O5RA 4DROA 4U86A 2XP6A 4TNSA 1JNSA 1D2KA 2DT2A 2Y78A 4DH0A 1F8AB 3AS0A 4LAXA 1WB0A 1X6NA 2FKEA 5GPRA 2A3BA 4ZS6A 3JYMA 5HT1A 2XP4A 4R5EA 1A7XA 4MTVA 4DRJA 1C9HA 1HJXA 3GPKA 4ODMA 2DSZA 4IT6A 2ESCA 1QZ2A 1Q1CA 1PINA 4DWSD 4MAVA 3RGCA 3EIPA 1NMWA 1ZU8A 1LL6A 2DSWA 4JFMA 3O5LA 2F21A 4J4NA 4Z2LA 2XP5A 1LJYA 1O6IA 1W9PA 3ARRA 4KR0B 4IPXA 2DT1A 1Y0OA 4DWSC 1FKFA 3UF8A 1CTNA 4U85A 3PRBA 1B6CA 3LUOA 2D9FA 4QZVB 4TX0A 2PN0A 4AY1A 2MPHA 1OGBA 1GOIA 3CZ8A 3I6CA 4MNLA 3AS1A 3CHDA 1NMVA 1KT0A 3MDYB 1BKFA 1N1AA 4JFJA 2KFWA 1L1PA 1RD6A 1FD9A 3KACA 4ZPTR 3WD3A 3UQIA 4TYOA 3O5MA 2DSUA 2IF4A 4Q22A 3UI5A 3NI6A 1E6NA 1D6OA 4Z2JA 4MNMA 1D7JA 4MPKA 4TW6A 5DO2A 1IX5A 1WAWA 4KQZA 1HKMA 1TCOC 2DG9A 4FN2A 1EQ3A 1NSGA 3PRDA 3GTYX 3NRKA 2AOSA 4DZ2A 4Z2HA 2IUZA 2DT3A 2OFNA 4JFIA 2PBCA 1YW5A 2ZR4A 4HBEA 4MNJA 1LL4A 4LAVA 1FKTA 3KAGA 3OOBA 1LL7A 3ARYA 4IQ2A 1LQ0A 2AWGA 4ODPA 4ODLA 3G6LA 2MLYA 1X6LA 4HARA 3UQBA 2EULA 4DIPA 3KZ7A 4J4OA 2LGOA 4Z2IA 4QIBA 3UI6A 3B9EA 2ZQUA 1E6PA 2FDMA 1E6RA 4O2TA 4GGQA 4ITZA 4W9PA 3ARUA 3W4RA 2ZQTA 4NSBA 4GIVA 3PA7A 3OA5A 4ML4A 3AQUA 1D7HA 4JFLA 3O5PA 2RUQA 1JNDA 3RM9A 1F40A 2KO7A 4W9OA 2ITKA 5I98A 1NH6A 2RUCA 4DWSB 4DRKA 2KE0A 2XP8A 4G2PA 2XPAA 2P4VA 1Q6IA 3FXYA 1M5YA 1ZB5A 1LG2A 3O5DA 4W9QA 2M2AA 1E9LA 3NTPA 5HKGA 1HJVA 1ITXA 3ARZA 2JZVA 1JCHB 2ETNA 3UQAA 3KAIA 3WL0A 3G6MA 2M1IA 2PPNA 2DPEA 3WKZA 5DITA 3ALFA 4Z2KA 3O5JA 4LGXA 4XAKA 3BXWA 1PBKA 1T11A 2O92A 3O5FA 1J4RA 4TW8A 1VF8A 3WQVA 3KAHA 1E15A 1JVWA 1W9VA 3PRAA 3WH0A 2A3EA 1EYMA 1W1TA 5DIUA 4R0XA 3KADA 3TDBA 5HW6A 3CGMA 2WLZA 4IQCA 1J4IA 3IHZA 4URIA 1FFRA 5HWBA 2ZR5A 3AS3A 1FKHA 1J6YA 3UI4A 2LPVA 4S3JA 5DEZA 3KABA 3IK8A 4Q7NA 2MNTA 3CHCA 3WQWA 4DRIA 3TC5A 3WD2A 1H0GA 1FKJA 4DT4A 3ARQA 4P8WA 2PPPA 3B9DA 1BL4A 2RSEA 4P8UA 1YATA 2XP3A 2XP7A 1XRVA 4P8XA 2G41A 4DZ3A 5GPGA 5HBFA 1HXVA 2PI6A 2DT0A 2KR7A 4L72B 4WK9A 1EIBA 1EHNA 2XP9A 4FAPA 2A3CA 3ARVA 3RM4A 1ZBKA
chains in the Genus database with same CATH topology
2F2DA 3WL1A 4BF8A 1FJDA 1TFVA 1NWSA 2KI3A 1K9TA 4MSPA 2UZ5A 1E6ZA 2N87A 1OWQA 1R9HA 4DRMA 1W1VA 2L2SA 2LKNA 2M08A 3FY1A 2OLHA 2WM0A 1D7IA 4G50A 5BXJA 3ARSA 2DSVA 1H0IA 4Z2GA 1FKSA 4QT2A 4U84A 1FKGA 5DIVA 1GPFA 1UR8A 2F4EA 3JYJA 1LG1A 1NWRA 1ZL1A 3WD4A 1KFWA 1KT1A 1FAPA 5J6EA 1QPFA 3KCEA 3O5GA 2K8IA 1NWUA 1EDQA 1QPLA 1ZBVA 2A3AA 3B8SA 3AROA 3H9RB 5HWCA 1W26A 4JFKA 1HKKA 4WKFA 3B9AA 4MGVA 1ROTA 4P8VA 4S3KA 4ODQA 5HUAA 1NWTA 4WKHA 1HKIA 3ARXA 3CHFA 5D75A 1FKBA 4ODRA 3ALGA 2YBTA 1SYTA 1ROUA 3RMEA 3O5IA 3CHEA 3TCZA 2XPBA 1JNTA 2ZQVA 2QF8A 4NZCA 1HKJA 3CGNA 4WKAA 4NNRA 3ODKA 4L3NA 1FFQA 3WD0A 4DRHA 1Q6UA 2Q5AA 3O5QA 2MF9A 2RQSA 4WIWA 4DRNA 1HJWA 2MLZA 1J4HA 2YBUA 4LAWA 3JXVA 4LAYA 1FKRA 2ZR6A 3ARWA 3WD1A 2DG3A 1OGGA 4N19A 2VN1A 4ODKA 4PTMA 1Q6HA 1FKKA 2WLYA 5B8IC 3O5OA 4DWSA 2RURA 4ODNA 2FAPA 1JNEA 4JYSA 1WNOA 5JH8A 3QOKA 1P5QA 3ARTA 2O9OA 5HW8A 4TW7A 5GQBA 4ODOA 1W1YA 3FAPA 3O5KA 4IT4A 4WJXA 3ARPA 1FKIA 4ZPVR 2MLXA 2VCDA 3WIJA 2WK2A 3O5EA 4QT3A 3CH9A 1UR9A 2LJ4A 1GUVA 5HW7A 2G8ZA 1ZBWA 4C02B 3PR9A 2PV1A 1XHGA 2ZQSA 3IKDA 4HBOA 3AS2A 3IKGA 3RM8A 1FKLA 2DG4A 3KAFA 4DRPA 3EY6A 1W1PA 2B31A 2PV3A 1ZBCA 1W9UA 2RUDA 4W5UA 1ZK6A 3RFWA 3VAWA 1SR0A 2PV2A 3B7XA 5DF0A 1ZCNA 2PPOA 2KGJA 4ZPWR 4MNKA 4DRQA 1U79A 5HTGA 1FKDA 3O5RA 4DROA 4U86A 2XP6A 4TNSA 1JNSA 1D2KA 2DT2A 2Y78A 4DH0A 1F8AB 3AS0A 4LAXA 1WB0A 1X6NA 2FKEA 5GPRA 2A3BA 4ZS6A 3JYMA 5HT1A 2XP4A 4R5EA 1A7XA 4MTVA 4DRJA 1C9HA 1HJXA 3GPKA 4ODMA 2DSZA 4IT6A 2ESCA 1QZ2A 1Q1CA 1PINA 4DWSD 4MAVA 3RGCA 1NMWA 1ZU8A 1LL6A 2DSWA 4JFMA 3O5LA 4J4NA 2F21A 4Z2LA 2XP5A 1LJYA 1O6IA 1W9PA 3ARRA 4KR0B 4IPXA 2DT1A 1Y0OA 4DWSC 1FKFA 3UF8A 1CTNA 4U85A 3PRBA 1B6CA 3LUOA 2D9FA 4QZVB 4TX0A 4AY1A 2MPHA 1OGBA 1GOIA 3CZ8A 3I6CA 4MNLA 3AS1A 3CHDA 1NMVA 1KT0A 3MDYB 1BKFA 1N1AA 4JFJA 2KFWA 1L1PA 1RD6A 1FD9A 3KACA 4ZPTR 3WD3A 3UQIA 4TYOA 3O5MA 2DSUA 2IF4A 4Q22A 3UI5A 3NI6A 1E6NA 1D6OA 4Z2JA 4MNMA 1D7JA 4MPKA 4TW6A 5DO2A 1IX5A 1WAWA 4KQZA 1HKMA 1TCOC 2DG9A 4FN2A 1EQ3A 1NSGA 3PRDA 3NRKA 2AOSA 4DZ2A 4Z2HA 2IUZA 2DT3A 2OFNA 4JFIA 2PBCA 1YW5A 2ZR4A 4HBEA 4MNJA 1LL4A 4LAVA 1FKTA 3KAGA 3OOBA 1LL7A 3ARYA 4IQ2A 1LQ0A 2AWGA 4ODPA 4ODLA 3G6LA 2MLYA 1X6LA 4HARA 3UQBA 4DIPA 3KZ7A 4J4OA 2LGOA 4Z2IA 4QIBA 3UI6A 3B9EA 2ZQUA 1E6PA 2FDMA 1E6RA 4O2TA 4GGQA 4ITZA 4W9PA 3ARUA 3W4RA 2ZQTA 4NSBA 4GIVA 3PA7A 3OA5A 4ML4A 3AQUA 1D7HA 4JFLA 3O5PA 2RUQA 1JNDA 3RM9A 1F40A 2KO7A 4W9OA 2ITKA 5I98A 1NH6A 2RUCA 4DWSB 4DRKA 2KE0A 2XP8A 4G2PA 2XPAA 1Q6IA 3FXYA 1M5YA 1ZB5A 1LG2A 3O5DA 4W9QA 2M2AA 1E9LA 3NTPA 5HKGA 1HJVA 1ITXA 3ARZA 2JZVA 3UQAA 3KAIA 3WL0A 3G6MA 2M1IA 2PPNA 2DPEA 3WKZA 5DITA 3ALFA 4Z2KA 3O5JA 4LGXA 4XAKA 3BXWA 1PBKA 1T11A 2O92A 3O5FA 1J4RA 4TW8A 1VF8A 3WQVA 3KAHA 1E15A 1JVWA 1W9VA 3PRAA 3WH0A 2A3EA 1EYMA 1W1TA 5DIUA 4R0XA 3KADA 3TDBA 5HW6A 3CGMA 4IQCA 2WLZA 1J4IA 3IHZA 4URIA 1FFRA 5HWBA 2ZR5A 3AS3A 1FKHA 1J6YA 3UI4A 2LPVA 4S3JA 5DEZA 3KABA 3IK8A 4Q7NA 2MNTA 3CHCA 3WQWA 4DRIA 3TC5A 3WD2A 1H0GA 1FKJA 4DT4A 3ARQA 4P8WA 2PPPA 3B9DA 1BL4A 2RSEA 4P8UA 1YATA 2XP3A 2XP7A 1XRVA 4P8XA 2G41A 4DZ3A 5GPGA 5HBFA 1HXVA 2PI6A 2DT0A 2KR7A 4L72B 4WK9A 1EIBA 1EHNA 2XP9A 4FAPA 2A3CA 3ARVA 3RM4A 1ZBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP5 A;  4ODN A;  1F40 A;  2FAP A;  2F2D A;  2KO7 A;  4IPX A;  4W9O A;  4JYS A;  2ITK A;  5I98 A;  1Y0O A;  4BF8 A;  2RUC A;  1FJD A;  4DRK A;  2KE0 A;  1FKF A;  3UF8 A;  2KI3 A;  2XP8 A;  4G2P A;  1P5Q A;  4MSP A;  4U85 A;  3PRB A;  1B6C A;  3LUO A;  2D9F A;  2UZ5 A;  2N87 A;  2XPA A;  4TX0 A;  1Q6I A;  5HW8 A;  4TW7 A;  1M5Y A;  4JFM A;  4ODO A;  1R9H A;  3FAP A;  4DRM A;  2MPH A;  2LKN A;  2L2S A;  2M08 A;  3O5K A;  1FKI A;  3O5D A;  4W9Q A;  2M2A A;  3NTP A;  5HKG A;  3I6C A;  1D7I A;  4G50 A;  5BXJ A;  2MLX A;  2VCD A;  2JZV A;  3O5E A;  1NMV A;  1FKS A;  4QT3 A;  4QT2 A;  1KT0 A;  4U84 A;  1FKG A;  2LJ4 A;  3MDY B;  1BKF A;  5DIV A;  1N1A A;  3KAI A;  3UQA A;  4JFJ A;  2KFW A;  2F4E A;  5HW7 A;  1L1P A;  1FD9 A;  3KAC A;  3JYJ A;  4C02 B;  3UQI A;  2M1I A;  2PPN A;  2PV1 A;  4TYO A;  2ZQS A;  3O5M A;  2IF4 A;  3IKD A;  1KT1 A;  3UI5 A;  1FAP A;  1D6O A;  3NI6 A;  1QPF A;  3KCE A;  1D7J A;  4TW6 A;  5DIT A;  5J6E A;  3IKG A;  3O5J A;  3O5G A;  2K8I A;  1PBK A;  1TCO C;  1T11 A;  1FKL A;  2DG4 A;  3O5F A;  1QPL A;  3KAF A;  2DG9 A;  4FN2 A;  4DRP A;  1EQ3 A;  1NSG A;  3EY6 A;  1J4R A;  4TW8 A;  3PRD A;  3NRK A;  3KAH A;  4DZ2 A;  3H9R B;  5HWC A;  1JVW A;  1W26 A;  2PV3 A;  4JFK A;  2RUD A;  2OFN A;  1ZK6 A;  4MGV A;  1EYM A;  1ROT A;  3RFW A;  3WH0 A;  5DIU A;  3VAW A;  4R0X A;  4JFI A;  2PV2 A;  2PBC A;  3B7X A;  4ODQ A;  1ZCN A;  2PPO A;  3KAD A;  1YW5 A;  2ZR4 A;  5HUA A;  2KGJ A;  3TDB A;  4DRQ A;  5D75 A;  1FKB A;  5HW6 A;  3CGM A;  4LAV A;  4IQC A;  1FKT A;  1U79 A;  4ODR A;  1J4I A;  3KAG A;  3OOB A;  3IHZ A;  1FKD A;  3O5R A;  5HTG A;  4DRO A;  4U86 A;  1ROU A;  2XP6 A;  3O5L A;  4J4N A;  4TNS A;  5HWB A;  3O5I A;  1JNS A;  2ZR5 A;  3TCZ A;  1FKH A;  2XPB A;  1JNT A;  1F8A B;  2AWG A;  2Y78 A;  2ZQV A;  4IQ2 A;  4ODP A;  4DH0 A;  1J6Y A;  4ODL A;  3UI4 A;  2LPV A;  4LAX A;  2MLY A;  3KAB A;  2FKE A;  3UQB A;  3IK8 A;  3CGN A;  4DIP A;  4NNR A;  3ODK A;  3KZ7 A;  3JYM A;  5HT1 A;  4J4O A;  2LGO A;  2XP4 A;  3O5P A;  4QIB A;  2MNT A;  1Q6U A;  1A7X A;  4DRH A;  2Q5A A;  4DRI A;  3TC5 A;  3UI6 A;  4DRJ A;  3O5Q A;  2MF9 A;  2RQS A;  1C9H A;  2ZQU A;  1FKJ A;  4DRN A;  4O2T A;  3GPK A;  4GGQ A;  4DT4 A;  2MLZ A;  1J4H A;  4ITZ A;  4LAW A;  2PPP A;  4ODM A;  3JXV A;  4LAY A;  1BL4 A;  4W9P A;  2RSE A;  1YAT A;  1FKR A;  2XP3 A;  2ZR6 A;  2XP7 A;  2ZQT A;  1QZ2 A;  2DG3 A;  1Q1C A;  4GIV A;  3PA7 A;  5GPG A;  4N19 A;  1PIN A;  4DZ3 A;  2VN1 A;  4ODK A;  1HXV A;  1Q6H A;  3RGC A;  1NMW A;  1FKK A;  1D7H A;  2KR7 A;  4JFL A;  5B8I C;  3O5O A;  2XP9 A;  4FAP A;  2RUQ A;  2F21 A;  2RUR A; 
#chains in the Genus database with same CATH topology
 2F2D A;  3WL1 A;  4BF8 A;  1FJD A;  1TFV A;  1NWS A;  2KI3 A;  1K9T A;  4MSP A;  2UZ5 A;  1E6Z A;  2N87 A;  4UDM A;  1OWQ A;  1R9H A;  4DRM A;  1W1V A;  2L2S A;  2LKN A;  2M08 A;  3FY1 A;  2OLH A;  2WM0 A;  1D7I A;  4G50 A;  5BXJ A;  3ARS A;  2DSV A;  1H0I A;  4Z2G A;  1FKS A;  4QT2 A;  4U84 A;  1FKG A;  5DIV A;  1GPF A;  1UR8 A;  2F4E A;  3GU0 A;  3JYJ A;  1LG1 A;  1NWR A;  1ZL1 A;  3WD4 A;  1KFW A;  1KT1 A;  1FAP A;  5J6E A;  1QPF A;  3KCE A;  3O5G A;  2K8I A;  1NWU A;  1EDQ A;  1QPL A;  1ZBV A;  2A3A A;  3B8S A;  3ARO A;  3H9R B;  5HWC A;  1W26 A;  4JFK A;  1HKK A;  4WKF A;  3B9A A;  4MGV A;  1ROT A;  4P8V A;  2F23 A;  4S3K A;  4ODQ A;  5HUA A;  1NWT A;  4WKH A;  1HKI A;  3ARX A;  3CHF A;  5D75 A;  1FKB A;  4ODR A;  3ALG A;  2YBT A;  1SYT A;  1ROU A;  3RME A;  3O5I A;  3CHE A;  3TCZ A;  2XPB A;  1JNT A;  2ZQV A;  2QF8 A;  4NZC A;  1HKJ A;  3CGN A;  4WKA A;  4NNR A;  3ODK A;  4L3N A;  1FFQ A;  3WD0 A;  4DRH A;  1Q6U A;  2Q5A A;  3O5Q A;  2MF9 A;  2RQS A;  4WIW A;  1E44 A;  4DRN A;  1HJW A;  2MLZ A;  1J4H A;  2YBU A;  4LAW A;  3JXV A;  4LAY A;  1FKR A;  2ZR6 A;  3ARW A;  3BMB A;  3WD1 A;  2DG3 A;  1OGG A;  4N19 A;  2VN1 A;  4ODK A;  4PTM A;  1Q6H A;  1FKK A;  2WLY A;  5B8I C;  3O5O A;  4DWS A;  2RUR A;  4ODN A;  2FAP A;  1JNE A;  4JYS A;  1WNO A;  5JH8 A;  3QOK A;  1P5Q A;  3ART A;  2O9O A;  5HW8 A;  4TW7 A;  5GQB A;  4ODO A;  1W1Y A;  3FAP A;  3O5K A;  4IT4 A;  4WJX A;  3ARP A;  1FKI A;  4ZPV R;  2MLX A;  2VCD A;  3WIJ A;  2WK2 A;  3O5E A;  4QT3 A;  3CH9 A;  1UR9 A;  2LJ4 A;  1GUV A;  5HW7 A;  2G8Z A;  1ZBW A;  4C02 B;  3PR9 A;  2PV1 A;  1XHG A;  2ZQS A;  3IKD A;  4HBO A;  3AS2 A;  3IKG A;  3RM8 A;  1FKL A;  2DG4 A;  3KAF A;  4DRP A;  3EY6 A;  1W1P A;  2B31 A;  1GRJ A;  2PV3 A;  1ZBC A;  1W9U A;  2B5U B;  2RUD A;  4W5U A;  1ZK6 A;  3RFW A;  3VAW A;  1SR0 A;  2PV2 A;  3B7X A;  5DF0 A;  1ZCN A;  2PPO A;  2KGJ A;  4ZPW R;  4MNK A;  4DRQ A;  1U79 A;  5HTG A;  1FKD A;  3O5R A;  4DRO A;  4U86 A;  2XP6 A;  4TNS A;  1JNS A;  1D2K A;  2DT2 A;  2Y78 A;  4DH0 A;  1F8A B;  3AS0 A;  4LAX A;  1WB0 A;  1X6N A;  2FKE A;  5GPR A;  2A3B A;  4ZS6 A;  3JYM A;  5HT1 A;  2XP4 A;  4R5E A;  1A7X A;  4MTV A;  4DRJ A;  1C9H A;  1HJX A;  3GPK A;  4ODM A;  2DSZ A;  4IT6 A;  2ESC A;  1QZ2 A;  1Q1C A;  1PIN A;  4DWS D;  4MAV A;  3RGC A;  3EIP A;  1NMW A;  1ZU8 A;  1LL6 A;  2DSW A;  4JFM A;  3O5L A;  2F21 A;  4J4N A;  4Z2L A;  2XP5 A;  1LJY A;  1O6I A;  1W9P A;  3ARR A;  4KR0 B;  4IPX A;  2DT1 A;  1Y0O A;  4DWS C;  1FKF A;  3UF8 A;  1CTN A;  4U85 A;  3PRB A;  1B6C A;  3LUO A;  2D9F A;  4QZV B;  4TX0 A;  2PN0 A;  4AY1 A;  2MPH A;  1OGB A;  1GOI A;  3CZ8 A;  3I6C A;  4MNL A;  3AS1 A;  3CHD A;  1NMV A;  1KT0 A;  3MDY B;  1BKF A;  1N1A A;  4JFJ A;  2KFW A;  1L1P A;  1RD6 A;  1FD9 A;  3KAC A;  4ZPT R;  3WD3 A;  3UQI A;  4TYO A;  3O5M A;  2DSU A;  2IF4 A;  4Q22 A;  3UI5 A;  3NI6 A;  1E6N A;  1D6O A;  4Z2J A;  4MNM A;  1D7J A;  4MPK A;  4TW6 A;  5DO2 A;  1IX5 A;  1WAW A;  4KQZ A;  1HKM A;  1TCO C;  2DG9 A;  4FN2 A;  1EQ3 A;  1NSG A;  3PRD A;  3GTY X;  3NRK A;  2AOS A;  4DZ2 A;  4Z2H A;  2IUZ A;  2DT3 A;  2OFN A;  4JFI A;  2PBC A;  1YW5 A;  2ZR4 A;  4HBE A;  4MNJ A;  1LL4 A;  4LAV A;  1FKT A;  3KAG A;  3OOB A;  1LL7 A;  3ARY A;  4IQ2 A;  1LQ0 A;  2AWG A;  4ODP A;  4ODL A;  3G6L A;  2MLY A;  1X6L A;  4HAR A;  3UQB A;  2EUL A;  4DIP A;  3KZ7 A;  4J4O A;  2LGO A;  4Z2I A;  4QIB A;  3UI6 A;  3B9E A;  2ZQU A;  1E6P A;  2FDM A;  1E6R A;  4O2T A;  4GGQ A;  4ITZ A;  4W9P A;  3ARU A;  3W4R A;  2ZQT A;  4NSB A;  4GIV A;  3PA7 A;  3OA5 A;  4ML4 A;  3AQU A;  1D7H A;  4JFL A;  3O5P A;  2RUQ A;  1JND A;  3RM9 A;  1F40 A;  2KO7 A;  4W9O A;  2ITK A;  5I98 A;  1NH6 A;  2RUC A;  4DWS B;  4DRK A;  2KE0 A;  2XP8 A;  4G2P A;  2XPA A;  2P4V A;  1Q6I A;  3FXY A;  1M5Y A;  1ZB5 A;  1LG2 A;  3O5D A;  4W9Q A;  2M2A A;  1E9L A;  3NTP A;  5HKG A;  1HJV A;  1ITX A;  3ARZ A;  2JZV A;  1JCH B;  2ETN A;  3UQA A;  3KAI A;  3WL0 A;  3G6M A;  2M1I A;  2PPN A;  2DPE A;  3WKZ A;  5DIT A;  3ALF A;  4Z2K A;  3O5J A;  4LGX A;  4XAK A;  3BXW A;  1PBK A;  1T11 A;  2O92 A;  3O5F A;  1J4R A;  4TW8 A;  1VF8 A;  3WQV A;  3KAH A;  1E15 A;  1JVW A;  1W9V A;  3PRA A;  3WH0 A;  2A3E A;  1EYM A;  1W1T A;  5DIU A;  4R0X A;  3KAD A;  3TDB A;  5HW6 A;  3CGM A;  2WLZ A;  4IQC A;  1J4I A;  3IHZ A;  4URI A;  1FFR A;  5HWB A;  2ZR5 A;  3AS3 A;  1FKH A;  1J6Y A;  3UI4 A;  2LPV A;  4S3J A;  5DEZ A;  3KAB A;  3IK8 A;  4Q7N A;  2MNT A;  3CHC A;  3WQW A;  4DRI A;  3TC5 A;  3WD2 A;  1H0G A;  1FKJ A;  4DT4 A;  3ARQ A;  4P8W A;  2PPP A;  3B9D A;  1BL4 A;  2RSE A;  4P8U A;  1YAT A;  2XP3 A;  2XP7 A;  1XRV A;  4P8X A;  2G41 A;  4DZ3 A;  5GPG A;  5HBF A;  1HXV A;  2PI6 A;  2DT0 A;  2KR7 A;  4L72 B;  4WK9 A;  1EIB A;  1EHN A;  2XP9 A;  4FAP A;  2A3C A;  3ARV A;  3RM4 A;  1ZBK A; 
#chains in the Genus database with same CATH homology
 2F2D A;  3WL1 A;  4BF8 A;  1FJD A;  1TFV A;  1NWS A;  2KI3 A;  1K9T A;  4MSP A;  2UZ5 A;  1E6Z A;  2N87 A;  1OWQ A;  1R9H A;  4DRM A;  1W1V A;  2L2S A;  2LKN A;  2M08 A;  3FY1 A;  2OLH A;  2WM0 A;  1D7I A;  4G50 A;  5BXJ A;  3ARS A;  2DSV A;  1H0I A;  4Z2G A;  1FKS A;  4QT2 A;  4U84 A;  1FKG A;  5DIV A;  1GPF A;  1UR8 A;  2F4E A;  3JYJ A;  1LG1 A;  1NWR A;  1ZL1 A;  3WD4 A;  1KFW A;  1KT1 A;  1FAP A;  5J6E A;  1QPF A;  3KCE A;  3O5G A;  2K8I A;  1NWU A;  1EDQ A;  1QPL A;  1ZBV A;  2A3A A;  3B8S A;  3ARO A;  3H9R B;  5HWC A;  1W26 A;  4JFK A;  1HKK A;  4WKF A;  3B9A A;  4MGV A;  1ROT A;  4P8V A;  4S3K A;  4ODQ A;  5HUA A;  1NWT A;  4WKH A;  1HKI A;  3ARX A;  3CHF A;  5D75 A;  1FKB A;  4ODR A;  3ALG A;  2YBT A;  1SYT A;  1ROU A;  3RME A;  3O5I A;  3CHE A;  3TCZ A;  2XPB A;  1JNT A;  2ZQV A;  2QF8 A;  4NZC A;  1HKJ A;  3CGN A;  4WKA A;  4NNR A;  3ODK A;  4L3N A;  1FFQ A;  3WD0 A;  4DRH A;  1Q6U A;  2Q5A A;  3O5Q A;  2MF9 A;  2RQS A;  4WIW A;  4DRN A;  1HJW A;  2MLZ A;  1J4H A;  2YBU A;  4LAW A;  3JXV A;  4LAY A;  1FKR A;  2ZR6 A;  3ARW A;  3WD1 A;  2DG3 A;  1OGG A;  4N19 A;  2VN1 A;  4ODK A;  4PTM A;  1Q6H A;  1FKK A;  2WLY A;  5B8I C;  3O5O A;  4DWS A;  2RUR A;  4ODN A;  2FAP A;  1JNE A;  4JYS A;  1WNO A;  5JH8 A;  3QOK A;  1P5Q A;  3ART A;  2O9O A;  5HW8 A;  4TW7 A;  5GQB A;  4ODO A;  1W1Y A;  3FAP A;  3O5K A;  4IT4 A;  4WJX A;  3ARP A;  1FKI A;  4ZPV R;  2MLX A;  2VCD A;  3WIJ A;  2WK2 A;  3O5E A;  4QT3 A;  3CH9 A;  1UR9 A;  2LJ4 A;  1GUV A;  5HW7 A;  2G8Z A;  1ZBW A;  4C02 B;  3PR9 A;  2PV1 A;  1XHG A;  2ZQS A;  3IKD A;  4HBO A;  3AS2 A;  3IKG A;  3RM8 A;  1FKL A;  2DG4 A;  3KAF A;  4DRP A;  3EY6 A;  1W1P A;  2B31 A;  2PV3 A;  1ZBC A;  1W9U A;  2RUD A;  4W5U A;  1ZK6 A;  3RFW A;  3VAW A;  1SR0 A;  2PV2 A;  3B7X A;  5DF0 A;  1ZCN A;  2PPO A;  2KGJ A;  4ZPW R;  4MNK A;  4DRQ A;  1U79 A;  5HTG A;  1FKD A;  3O5R A;  4DRO A;  4U86 A;  2XP6 A;  4TNS A;  1JNS A;  1D2K A;  2DT2 A;  2Y78 A;  4DH0 A;  1F8A B;  3AS0 A;  4LAX A;  1WB0 A;  1X6N A;  2FKE A;  5GPR A;  2A3B A;  4ZS6 A;  3JYM A;  5HT1 A;  2XP4 A;  4R5E A;  1A7X A;  4MTV A;  4DRJ A;  1C9H A;  1HJX A;  3GPK A;  4ODM A;  2DSZ A;  4IT6 A;  2ESC A;  1QZ2 A;  1Q1C A;  1PIN A;  4DWS D;  4MAV A;  3RGC A;  1NMW A;  1ZU8 A;  1LL6 A;  2DSW A;  4JFM A;  3O5L A;  4J4N A;  2F21 A;  4Z2L A;  2XP5 A;  1LJY A;  1O6I A;  1W9P A;  3ARR A;  4KR0 B;  4IPX A;  2DT1 A;  1Y0O A;  4DWS C;  1FKF A;  3UF8 A;  1CTN A;  4U85 A;  3PRB A;  1B6C A;  3LUO A;  2D9F A;  4QZV B;  4TX0 A;  4AY1 A;  2MPH A;  1OGB A;  1GOI A;  3CZ8 A;  3I6C A;  4MNL A;  3AS1 A;  3CHD A;  1NMV A;  1KT0 A;  3MDY B;  1BKF A;  1N1A A;  4JFJ A;  2KFW A;  1L1P A;  1RD6 A;  1FD9 A;  3KAC A;  4ZPT R;  3WD3 A;  3UQI A;  4TYO A;  3O5M A;  2DSU A;  2IF4 A;  4Q22 A;  3UI5 A;  3NI6 A;  1E6N A;  1D6O A;  4Z2J A;  4MNM A;  1D7J A;  4MPK A;  4TW6 A;  5DO2 A;  1IX5 A;  1WAW A;  4KQZ A;  1HKM A;  1TCO C;  2DG9 A;  4FN2 A;  1EQ3 A;  1NSG A;  3PRD A;  3NRK A;  2AOS A;  4DZ2 A;  4Z2H A;  2IUZ A;  2DT3 A;  2OFN A;  4JFI A;  2PBC A;  1YW5 A;  2ZR4 A;  4HBE A;  4MNJ A;  1LL4 A;  4LAV A;  1FKT A;  3KAG A;  3OOB A;  1LL7 A;  3ARY A;  4IQ2 A;  1LQ0 A;  2AWG A;  4ODP A;  4ODL A;  3G6L A;  2MLY A;  1X6L A;  4HAR A;  3UQB A;  4DIP A;  3KZ7 A;  4J4O A;  2LGO A;  4Z2I A;  4QIB A;  3UI6 A;  3B9E A;  2ZQU A;  1E6P A;  2FDM A;  1E6R A;  4O2T A;  4GGQ A;  4ITZ A;  4W9P A;  3ARU A;  3W4R A;  2ZQT A;  4NSB A;  4GIV A;  3PA7 A;  3OA5 A;  4ML4 A;  3AQU A;  1D7H A;  4JFL A;  3O5P A;  2RUQ A;  1JND A;  3RM9 A;  1F40 A;  2KO7 A;  4W9O A;  2ITK A;  5I98 A;  1NH6 A;  2RUC A;  4DWS B;  4DRK A;  2KE0 A;  2XP8 A;  4G2P A;  2XPA A;  1Q6I A;  3FXY A;  1M5Y A;  1ZB5 A;  1LG2 A;  3O5D A;  4W9Q A;  2M2A A;  1E9L A;  3NTP A;  5HKG A;  1HJV A;  1ITX A;  3ARZ A;  2JZV A;  3UQA A;  3KAI A;  3WL0 A;  3G6M A;  2M1I A;  2PPN A;  2DPE A;  3WKZ A;  5DIT A;  3ALF A;  4Z2K A;  3O5J A;  4LGX A;  4XAK A;  3BXW A;  1PBK A;  1T11 A;  2O92 A;  3O5F A;  1J4R A;  4TW8 A;  1VF8 A;  3WQV A;  3KAH A;  1E15 A;  1JVW A;  1W9V A;  3PRA A;  3WH0 A;  2A3E A;  1EYM A;  1W1T A;  5DIU A;  4R0X A;  3KAD A;  3TDB A;  5HW6 A;  3CGM A;  4IQC A;  2WLZ A;  1J4I A;  3IHZ A;  4URI A;  1FFR A;  5HWB A;  2ZR5 A;  3AS3 A;  1FKH A;  1J6Y A;  3UI4 A;  2LPV A;  4S3J A;  5DEZ A;  3KAB A;  3IK8 A;  4Q7N A;  2MNT A;  3CHC A;  3WQW A;  4DRI A;  3TC5 A;  3WD2 A;  1H0G A;  1FKJ A;  4DT4 A;  3ARQ A;  4P8W A;  2PPP A;  3B9D A;  1BL4 A;  2RSE A;  4P8U A;  1YAT A;  2XP3 A;  2XP7 A;  1XRV A;  4P8X A;  2G41 A;  4DZ3 A;  5GPG A;  5HBF A;  1HXV A;  2PI6 A;  2DT0 A;  2KR7 A;  4L72 B;  4WK9 A;  1EIB A;  1EHN A;  2XP9 A;  4FAP A;  2A3C A;  3ARV A;  3RM4 A;  1ZBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...