1FKBA

Atomic structure of the rapamycin human immunophilin fkbp-12 complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title Atomic Structure of the Rapamycin Human Immunophilin Fkbp-12 Complex
pubmed rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkbA00
2MLXA 3H9RB 3NTPA 2KE0A 1J4IA 4LAWA 4ITZA 4IQCA 5DITA 4LAXA 2RSEA 1J4RA 3CGMA 3O5JA 1FD9A 3LUOA 1FKSA 4DT4A 3JYJA 3UQAA 1ZK6A 3KAFA 4R0XA 2PPNA 3NI6A 3TC5A 4DRMA 2XP9A 2IF4A 3ODKA 4DRIA 2KFWA 2KI3A 1YATA 1NSGA 2UZ5A 2FKEA 2F21A 1KT0A 2PV2A 3IK8A 1U79A 1F8AB 3O5FA 2M2AA 2MLZA 5J6EA 2F2DA 2ZR5A 3KABA 1FKJA 2DG3A 3O5KA 4W9OA 2RUQA 3O5OA 4DZ3A 2VN1A 3JYMA 2ZQSA 1C9HA 1KT1A 4MSPA 4TW7A 3UQIA 4TYOA 4JFLA 4IQ2A 1QZ2A 1Q1CA 2PV1A 3GPKA 3OOBA 1FKDA 3IKDA 2XP7A 4N19A 4W9PA 3KADA 4QT2A 3UF8A 4GGQA 1D6OA 1QPFA 5DIUA 1JVWA 1ROTA 1ROUA 2RURA 4ODNA 5HWBA 4DRQA 4G2PA 3UQBA 2VCDA 2KO7A 1ZCNA 1N1AA 1Q6HA 1FKTA 1FJDA 4DRJA 1R9HA 4ODLA 4JFIA 3I6CA 2XP6A 1T11A 1PBKA 2PV3A 2L2SA 2XPBA 3KAHA 4J4NA 1P5QA 2LKNA 1J4HA 2Q5AA 4DZ2A 4U86A 1PINA 5HT1A 1FKHA 2XPAA 4ODKA 4FAPA 4QIBA 4JFMA 4ODPA 2DG9A 1NMVA 1FKGA 2M1IA 4TNSA 2XP4A 4DROA 5HWCA 5I98A 4ODOA 2PBCA 3IHZA 2LGOA 3KCEA 1D7IA 3NRKA 3PRBA 3CGNA 4TX0A 4DRKA 4JFJA 4GIVA 4LAYA 1BKFA 3UI5A 5BXJA 1L1PA 3PRDA 1FKRA 4LAVA 1FKBA 2KGJA 2XP8A 2ZR4A 1D7JA 3JXVA 5GPGA 4NNRA 2F4EA 4DIPA 5HKGA 2FAPA 3IKGA 1HXVA 3PA7A 2AWGA 1FKLA 3O5IA 4ODRA 2XP5A 2RUCA 3UI6A 2ITKA 3RFWA 4MGVA 4JYSA 1W26A 4U85A 2N87A 2XP3A 3TDBA 1D7HA 1JNSA 3KAIA 1NMWA 4FN2A 1FAPA 2ZQUA 1TCOC 1YW5A 3O5EA 3O5RA 2MNTA 3KAGA 4G50A 3WH0A 5HTGA 2D9FA 5HW6A 3TCZA 3O5LA 1A7XA 2PPOA 1FKFA 1BL4A 4W9QA 1M5YA 2ZQTA 4TW8A 1EQ3A 3O5DA 2RUDA 4DRPA 1FKKA 2KR7A 3O5GA 2DG4A 2LPVA 2M08A 2Y78A 4U84A 5D75A 4ODMA 3O5MA 2ZR6A 3B7XA 3UI4A 4DRHA 5HUAA 1Q6UA 2K8IA 1QPLA 4DH0A 1Q6IA 2JZVA 2MF9A 2ZQVA 4ODQA 2MPHA 4TW6A 3VAWA 4C02B 2MLYA 1J6YA 4JFKA 3O5QA 5HW7A 2RQSA 3RGCA 4O2TA 3FAPA 4DRNA 3O5PA 3EY6A 4IPXA 4QT3A 4J4OA 5HW8A 1JNTA 2LJ4A 3KZ7A 1EYMA 5B8IC 1Y0OA 2OFNA 3KACA 3MDYB 4BF8A 1FKIA 1B6CA 1F40A 5DIVA 2PPPA
chains in the Genus database with same CATH superfamily
1K9TA 3H9RB 1OGBA 1GPFA 3UQAA 1GUVA 1LQ0A 2PPNA 4S3KA 1NH6A 3IK8A 1E44A 5JH8A 2DT0A 1EDQA 2M2AA 4DWSD 4MNMA 2ZR5A 2DG3A 2G41A 3JYMA 2ZQSA 3UQIA 4IT6A 3WQWA 4TYOA 4JFLA 1Q1CA 2PV1A 2O9OA 4XAKA 1E6PA 3OOBA 4MNLA 4LGXA 3ARZA 5DIUA 2RURA 1LL7A 1ROTA 1ROUA 4ODNA 5HWBA 4DZ3A 4S3JA 2XP6A 1T11A 3KAHA 1FKHA 2WLZA 5HWCA 4URIA 4HBEA 1NWTA 5I98A 1D7IA 4DRKA 1BKFA 3W4RA 1FKRA 1FKBA 2KGJA 2A3AA 1HXVA 2AWGA 1FKLA 4ODRA 1OGGA 4JYSA 1W26A 3WQVA 1E9LA 1FAPA 3QOKA 4Q22A 2DT2A 2OLHA 2D9FA 3O5LA 4QZVB 4Z2IA 3ARWA 4WIWA 1HJWA 3O5DA 4MAVA 2KR7A 2DG4A 2Y78A 2B5UB 2ZR6A 4MPKA 1Q6UA 2PI6A 2JZVA 2MF9A 2ZQVA 3AROA 2EULA 4C02B 4P8WA 1RD6A 3WIJA 1H0IA 3CHFA 4O2TA 4Z2JA 3FAPA 4J4OA 3ALGA 5HW8A 1W9VA 5B8IC 1Y0OA 4DWSC 5DIVA 2PPPA 2KE0A 2WLYA 4LAWA 4ITZA 3FXYA 4IQCA 3CGMA 1FD9A 2A3BA 2PN0A 3WD2A 3ALFA 3RM9A 4DRMA 2DSUA 2KFWA 1NSGA 4ZPVR 3PRAA 2PV2A 2ESCA 1U79A 1LL4A 2MLZA 1FKJA 3O5KA 4W9OA 4MSPA 4P8VA 3GPKA 3GU0A 1FKDA 2DSWA 1D6OA 2O92A 1QPFA 3WL1A 4Z2KA 1UR9A 3ARTA 2KO7A 4DWSB 1Q6HA 4WKAA 3BXWA 1FJDA 1R9HA 2L2SA 4L3NA 4ODKA 4WJXA 4P8UA 1NWUA 4DROA 2FDMA 3IHZA 3NRKA 4TX0A 3KCEA 3PRBA 3WKZA 1W1PA 5HBFA 4GIVA 4PTMA 1VF8A 1L1PA 3EIPA 2IUZA 5HKGA 5GPGA 4NNRA 1ZL1A 3PA7A 4Z2LA 3O5IA 1E6RA 4P8XA 3TDBA 1ZBWA 4FN2A 2ZQUA 2QF8A 4ZPWR 2MNTA 3G6MA 2PPOA 4MTVA 1FKFA 1BL4A 2ZQTA 4WKFA 2RUDA 4MNJA 2LPVA 5DF0A 3UI4A 5HUAA 1HKJA 2K8IA 1FFQA 4ODQA 4TW6A 1LG2A 3CHCA 4NZCA 4Q7NA 1J6YA 5HW7A 1E15A 1UR8A 1ZU8A 3EY6A 3B9AA 3ARPA 4UDMA 3KACA 1FKGA 2DPEA 2MLXA 1J4IA 1LG1A 4LAXA 1SR0A 4Z2HA 3LUOA 3KAFA 4R0XA 4HBOA 3NI6A 3WD4A 4DRIA 2KI3A 2F23A 2FKEA 2F21A 1JNEA 1F8AB 4L72B 2RUQA 3O5OA 5DEZA 2VN1A 1C9HA 1KT1A 3ARVA 4TW7A 1ITXA 3ARQA 4IQ2A 3OA5A 2WM0A 4IT4A 3IKDA 4N19A 4R5EA 2AOSA 3UF8A 4GGQA 3FY1A 1CTNA 5GQBA 4DRQA 4G2PA 2VCDA 4Z2GA 3ARUA 1ZBCA 4DRJA 4ODLA 3AS3A 4JFIA 3I6CA 5HT1A 2XPBA 5BXJA 1ZB5A 1P5QA 1J4HA 4U86A 1PINA 4W5UA 1WNOA 4JFMA 4TNSA 2DG9A 2M1IA 4KR0B 1JNDA 3CGNA 4JFJA 3UI5A 1W1TA 3PRDA 4WKHA 3JXVA 2ZR4A 4DIPA 1LJYA 3ARSA 2F4EA 3IKGA 2DT1A 2A3CA 2RUCA 3RMEA 1OWQA 4U85A 1NWRA 2N87A 2XP3A 3AQUA 1NMWA 1TFVA 1EHNA 1TCOC 3WH0A 1LL6A 3TCZA 1EQ3A 4TW8A 3AS1A 3B9EA 1FKKA 2M08A 5D75A 1XHGA 3O5MA 3B7XA 1QPLA 1KFWA 2MLYA 1EIBA 4JFKA 3CHEA 4ZS6A 1XRVA 4MNKA 4WK9A 3RGCA 4DWSA 4DRNA 4IPXA 1W1VA 1JNTA 1D2KA 1IX5A 2OFNA 1F40A 1FKIA 1B6CA 4W9QA 4HARA 3NTPA 5DITA 1NWSA 2RSEA 1JCHB 1J4RA 3GTYX 3O5JA 4DT4A 1FKSA 3JYJA 3CZ8A 1ZK6A 3TC5A 2XP9A 2IF4A 3ODKA 1YATA 2UZ5A 1WAWA 1KT0A 2ETNA 3O5FA 5J6EA 2F2DA 3KABA 1W1YA 1W9PA 1QZ2A 5GPRA 1X6LA 1HJXA 3PR9A 2XP7A 4W9PA 3KADA 4QT2A 3B8SA 3G6LA 1JVWA 2G8ZA 3UQBA 1X6NA 1O6IA 1ZCNA 2YBTA 1N1AA 1FKTA 1SYTA 3RM8A 2DSVA 1PBKA 2PV3A 4J4NA 2LKNA 2DT3A 2DSZA 2Q5AA 4DZ2A 1H0GA 3ARRA 4ML4A 2XPAA 3WD0A 4FAPA 1E6NA 3WD1A 4QIBA 4ODPA 1NMVA 2XP4A 2WK2A 3CH9A 4NSBA 4ODOA 2PBCA 2LGOA 2A3EA 4LAYA 1HKKA 4KQZA 2B31A 4LAVA 2XP8A 1HKIA 1D7JA 4ZPTR 2FAPA 3ARYA 2XP5A 1HJVA 3UI6A 3BMBA 2ITKA 3RFWA 4MGVA 2P4VA 3WD3A 1JNSA 1D7HA 3KAIA 1ZBVA 1YW5A 3O5RA 3O5EA 4G50A 3KAGA 5HTGA 5HW6A 1A7XA 3B9DA 1M5YA 1ZBKA 2YBUA 4DRPA 3O5GA 4U84A 4DRHA 4ODMA 1GRJA 1GOIA 3CHDA 4DH0A 1WB0A 1Q6IA 2MPHA 3VAWA 3WL0A 3AS2A 3O5QA 3AS0A 2RQSA 1W9UA 3O5PA 4QT3A 1HKMA 3KZ7A 2LJ4A 3ARXA 1EYMA 1E6ZA 3RM4A 1FFRA 4AY1A 3MDYB 4BF8A 5DO2A
chains in the Genus database with same CATH topology
1K9TA 3H9RB 1OGBA 1GPFA 3UQAA 1GUVA 1LQ0A 2PPNA 4S3KA 1NH6A 3IK8A 5JH8A 2DT0A 1EDQA 2M2AA 4DWSD 4MNMA 2ZR5A 2DG3A 2G41A 3JYMA 2ZQSA 3UQIA 4IT6A 3WQWA 4TYOA 4JFLA 1Q1CA 2PV1A 2O9OA 4XAKA 1E6PA 3OOBA 4MNLA 4LGXA 3ARZA 5DIUA 2RURA 1LL7A 1ROTA 1ROUA 4ODNA 5HWBA 4DZ3A 4S3JA 2XP6A 1T11A 3KAHA 1FKHA 2WLZA 5HWCA 4URIA 4HBEA 1NWTA 5I98A 1D7IA 4DRKA 1BKFA 3W4RA 1FKRA 1FKBA 2KGJA 2A3AA 1HXVA 2AWGA 1FKLA 4ODRA 1OGGA 4JYSA 1W26A 3WQVA 1E9LA 1FAPA 3QOKA 4Q22A 2DT2A 2OLHA 2D9FA 3O5LA 4QZVB 4Z2IA 3ARWA 4WIWA 1HJWA 3O5DA 4MAVA 2KR7A 2DG4A 2Y78A 2ZR6A 4MPKA 1Q6UA 2PI6A 2JZVA 2MF9A 2ZQVA 3AROA 4C02B 4P8WA 1RD6A 3WIJA 1H0IA 3CHFA 4O2TA 4Z2JA 3FAPA 4J4OA 3ALGA 5HW8A 1W9VA 5B8IC 1Y0OA 4DWSC 5DIVA 2PPPA 2KE0A 2WLYA 4LAWA 4ITZA 3FXYA 4IQCA 3CGMA 1FD9A 2A3BA 3WD2A 3ALFA 3RM9A 4DRMA 2DSUA 2KFWA 1NSGA 4ZPVR 3PRAA 2PV2A 2ESCA 1U79A 1LL4A 2MLZA 1FKJA 3O5KA 4W9OA 4MSPA 4P8VA 3GPKA 1FKDA 2DSWA 1D6OA 2O92A 1QPFA 3WL1A 4Z2KA 1UR9A 3ARTA 2KO7A 4DWSB 1Q6HA 4WKAA 3BXWA 1FJDA 1R9HA 2L2SA 4L3NA 4ODKA 4WJXA 4P8UA 1NWUA 4DROA 2FDMA 3IHZA 3NRKA 4TX0A 3KCEA 3PRBA 3WKZA 1W1PA 5HBFA 4GIVA 4PTMA 1VF8A 1L1PA 2IUZA 5HKGA 5GPGA 4NNRA 1ZL1A 3PA7A 4Z2LA 3O5IA 1E6RA 4P8XA 3TDBA 1ZBWA 4FN2A 2ZQUA 2QF8A 4ZPWR 2MNTA 3G6MA 2PPOA 4MTVA 1FKFA 1BL4A 2ZQTA 4WKFA 2RUDA 4MNJA 2LPVA 5DF0A 3UI4A 5HUAA 1HKJA 2K8IA 1FFQA 4ODQA 4TW6A 1LG2A 3CHCA 4NZCA 4Q7NA 1J6YA 5HW7A 1E15A 1UR8A 1ZU8A 3EY6A 3B9AA 3ARPA 3KACA 1FKGA 2DPEA 2MLXA 1J4IA 1LG1A 4LAXA 1SR0A 4Z2HA 3LUOA 3KAFA 4R0XA 4HBOA 3NI6A 3WD4A 4DRIA 2KI3A 2FKEA 2F21A 1JNEA 1F8AB 4L72B 2RUQA 3O5OA 5DEZA 2VN1A 1C9HA 1KT1A 3ARVA 4TW7A 1ITXA 3ARQA 4IQ2A 3OA5A 2WM0A 4IT4A 3IKDA 4N19A 4R5EA 2AOSA 3UF8A 4GGQA 3FY1A 1CTNA 5GQBA 4DRQA 4G2PA 2VCDA 4Z2GA 3ARUA 1ZBCA 4DRJA 4ODLA 3AS3A 4JFIA 3I6CA 5HT1A 2XPBA 5BXJA 1ZB5A 1P5QA 1J4HA 4U86A 1PINA 4W5UA 1WNOA 4JFMA 4TNSA 2DG9A 2M1IA 4KR0B 1JNDA 3CGNA 4JFJA 3UI5A 1W1TA 3PRDA 4WKHA 3JXVA 2ZR4A 4DIPA 1LJYA 3ARSA 2F4EA 3IKGA 2DT1A 2A3CA 2RUCA 3RMEA 1OWQA 4U85A 1NWRA 2N87A 2XP3A 3AQUA 1NMWA 1TFVA 1EHNA 1TCOC 3WH0A 1LL6A 3TCZA 1EQ3A 4TW8A 3AS1A 3B9EA 1FKKA 2M08A 5D75A 1XHGA 3O5MA 3B7XA 1QPLA 1KFWA 2MLYA 1EIBA 4JFKA 3CHEA 4ZS6A 1XRVA 4MNKA 4WK9A 3RGCA 4DWSA 4DRNA 4IPXA 1W1VA 1JNTA 1D2KA 1IX5A 2OFNA 1F40A 1FKIA 1B6CA 4W9QA 4HARA 3NTPA 5DITA 1NWSA 2RSEA 1J4RA 3O5JA 4DT4A 1FKSA 3JYJA 3CZ8A 1ZK6A 3TC5A 2XP9A 2IF4A 3ODKA 1YATA 2UZ5A 1WAWA 1KT0A 3O5FA 5J6EA 2F2DA 3KABA 1W1YA 1W9PA 1QZ2A 5GPRA 1X6LA 1HJXA 3PR9A 2XP7A 4W9PA 3KADA 4QT2A 3B8SA 3G6LA 1JVWA 2G8ZA 3UQBA 1X6NA 1O6IA 1ZCNA 2YBTA 1N1AA 1FKTA 1SYTA 3RM8A 2DSVA 1PBKA 2PV3A 4J4NA 2LKNA 2DT3A 2DSZA 2Q5AA 4DZ2A 1H0GA 3ARRA 4ML4A 2XPAA 3WD0A 4FAPA 1E6NA 3WD1A 4QIBA 4ODPA 1NMVA 2XP4A 2WK2A 3CH9A 4NSBA 4ODOA 2PBCA 2LGOA 2A3EA 4LAYA 1HKKA 4KQZA 2B31A 4LAVA 2XP8A 1HKIA 1D7JA 4ZPTR 2FAPA 3ARYA 2XP5A 1HJVA 3UI6A 2ITKA 3RFWA 4MGVA 3WD3A 1JNSA 1D7HA 3KAIA 1ZBVA 3O5RA 1YW5A 3O5EA 4G50A 3KAGA 5HTGA 5HW6A 1A7XA 3B9DA 1M5YA 1ZBKA 2YBUA 4DRPA 3O5GA 4U84A 4DRHA 4ODMA 1GOIA 3CHDA 4DH0A 1WB0A 1Q6IA 2MPHA 3VAWA 3WL0A 3AS2A 3O5QA 3AS0A 2RQSA 1W9UA 3O5PA 4QT3A 1HKMA 3KZ7A 2LJ4A 3ARXA 1EYMA 1E6ZA 3RM4A 1FFRA 4AY1A 3MDYB 4BF8A 5DO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLX A;  3H9R B;  3NTP A;  2KE0 A;  1J4I A;  4LAW A;  4ITZ A;  4IQC A;  5DIT A;  4LAX A;  2RSE A;  1J4R A;  3CGM A;  3O5J A;  1FD9 A;  3LUO A;  1FKS A;  4DT4 A;  3JYJ A;  3UQA A;  1ZK6 A;  3KAF A;  4R0X A;  2PPN A;  3NI6 A;  3TC5 A;  4DRM A;  2XP9 A;  2IF4 A;  3ODK A;  4DRI A;  2KFW A;  2KI3 A;  1YAT A;  1NSG A;  2UZ5 A;  2FKE A;  2F21 A;  1KT0 A;  2PV2 A;  3IK8 A;  1U79 A;  1F8A B;  3O5F A;  2M2A A;  2MLZ A;  5J6E A;  2F2D A;  2ZR5 A;  3KAB A;  1FKJ A;  2DG3 A;  3O5K A;  4W9O A;  2RUQ A;  3O5O A;  4DZ3 A;  2VN1 A;  3JYM A;  2ZQS A;  1C9H A;  1KT1 A;  4MSP A;  4TW7 A;  3UQI A;  4TYO A;  4JFL A;  4IQ2 A;  1QZ2 A;  1Q1C A;  2PV1 A;  3GPK A;  3OOB A;  1FKD A;  3IKD A;  2XP7 A;  4N19 A;  4W9P A;  3KAD A;  4QT2 A;  3UF8 A;  4GGQ A;  1D6O A;  1QPF A;  5DIU A;  1JVW A;  1ROT A;  1ROU A;  2RUR A;  4ODN A;  5HWB A;  4DRQ A;  4G2P A;  3UQB A;  2VCD A;  2KO7 A;  1ZCN A;  1N1A A;  1Q6H A;  1FKT A;  1FJD A;  4DRJ A;  1R9H A;  4ODL A;  4JFI A;  3I6C A;  2XP6 A;  1T11 A;  1PBK A;  2PV3 A;  2L2S A;  2XPB A;  3KAH A;  4J4N A;  1P5Q A;  2LKN A;  1J4H A;  2Q5A A;  4DZ2 A;  4U86 A;  1PIN A;  5HT1 A;  1FKH A;  2XPA A;  4ODK A;  4FAP A;  4QIB A;  4JFM A;  4ODP A;  2DG9 A;  1NMV A;  1FKG A;  2M1I A;  4TNS A;  2XP4 A;  4DRO A;  5HWC A;  5I98 A;  4ODO A;  2PBC A;  3IHZ A;  2LGO A;  3KCE A;  1D7I A;  3NRK A;  3PRB A;  3CGN A;  4TX0 A;  4DRK A;  4JFJ A;  4GIV A;  4LAY A;  1BKF A;  3UI5 A;  5BXJ A;  1L1P A;  3PRD A;  1FKR A;  4LAV A;  1FKB A;  2KGJ A;  2XP8 A;  2ZR4 A;  1D7J A;  3JXV A;  5GPG A;  4NNR A;  2F4E A;  4DIP A;  5HKG A;  2FAP A;  3IKG A;  1HXV A;  3PA7 A;  2AWG A;  1FKL A;  3O5I A;  4ODR A;  2XP5 A;  2RUC A;  3UI6 A;  2ITK A;  3RFW A;  4MGV A;  4JYS A;  1W26 A;  4U85 A;  2N87 A;  2XP3 A;  3TDB A;  1D7H A;  1JNS A;  3KAI A;  1NMW A;  4FN2 A;  1FAP A;  2ZQU A;  1TCO C;  1YW5 A;  3O5E A;  3O5R A;  2MNT A;  3KAG A;  4G50 A;  3WH0 A;  5HTG A;  2D9F A;  5HW6 A;  3TCZ A;  3O5L A;  1A7X A;  2PPO A;  1FKF A;  1BL4 A;  4W9Q A;  1M5Y A;  2ZQT A;  4TW8 A;  1EQ3 A;  3O5D A;  2RUD A;  4DRP A;  1FKK A;  2KR7 A;  3O5G A;  2DG4 A;  2LPV A;  2M08 A;  2Y78 A;  4U84 A;  5D75 A;  4ODM A;  3O5M A;  2ZR6 A;  3B7X A;  3UI4 A;  4DRH A;  5HUA A;  1Q6U A;  2K8I A;  1QPL A;  4DH0 A;  1Q6I A;  2JZV A;  2MF9 A;  2ZQV A;  4ODQ A;  2MPH A;  4TW6 A;  3VAW A;  4C02 B;  2MLY A;  1J6Y A;  4JFK A;  3O5Q A;  5HW7 A;  2RQS A;  3RGC A;  4O2T A;  3FAP A;  4DRN A;  3O5P A;  3EY6 A;  4IPX A;  4QT3 A;  4J4O A;  5HW8 A;  1JNT A;  2LJ4 A;  3KZ7 A;  1EYM A;  5B8I C;  1Y0O A;  2OFN A;  3KAC A;  3MDY B;  4BF8 A;  1FKI A;  1B6C A;  1F40 A;  5DIV A;  2PPP A; 
#chains in the Genus database with same CATH topology
 1K9T A;  3H9R B;  1OGB A;  1GPF A;  3UQA A;  1GUV A;  1LQ0 A;  2PPN A;  4S3K A;  1NH6 A;  3IK8 A;  1E44 A;  5JH8 A;  2DT0 A;  1EDQ A;  2M2A A;  4DWS D;  4MNM A;  2ZR5 A;  2DG3 A;  2G41 A;  3JYM A;  2ZQS A;  3UQI A;  4IT6 A;  3WQW A;  4TYO A;  4JFL A;  1Q1C A;  2PV1 A;  2O9O A;  4XAK A;  1E6P A;  3OOB A;  4MNL A;  4LGX A;  3ARZ A;  5DIU A;  2RUR A;  1LL7 A;  1ROT A;  1ROU A;  4ODN A;  5HWB A;  4DZ3 A;  4S3J A;  2XP6 A;  1T11 A;  3KAH A;  1FKH A;  2WLZ A;  5HWC A;  4URI A;  4HBE A;  1NWT A;  5I98 A;  1D7I A;  4DRK A;  1BKF A;  3W4R A;  1FKR A;  1FKB A;  2KGJ A;  2A3A A;  1HXV A;  2AWG A;  1FKL A;  4ODR A;  1OGG A;  4JYS A;  1W26 A;  3WQV A;  1E9L A;  1FAP A;  3QOK A;  4Q22 A;  2DT2 A;  2OLH A;  2D9F A;  3O5L A;  4QZV B;  4Z2I A;  3ARW A;  4WIW A;  1HJW A;  3O5D A;  4MAV A;  2KR7 A;  2DG4 A;  2Y78 A;  2B5U B;  2ZR6 A;  4MPK A;  1Q6U A;  2PI6 A;  2JZV A;  2MF9 A;  2ZQV A;  3ARO A;  2EUL A;  4C02 B;  4P8W A;  1RD6 A;  3WIJ A;  1H0I A;  3CHF A;  4O2T A;  4Z2J A;  3FAP A;  4J4O A;  3ALG A;  5HW8 A;  1W9V A;  5B8I C;  1Y0O A;  4DWS C;  5DIV A;  2PPP A;  2KE0 A;  2WLY A;  4LAW A;  4ITZ A;  3FXY A;  4IQC A;  3CGM A;  1FD9 A;  2A3B A;  2PN0 A;  3WD2 A;  3ALF A;  3RM9 A;  4DRM A;  2DSU A;  2KFW A;  1NSG A;  4ZPV R;  3PRA A;  2PV2 A;  2ESC A;  1U79 A;  1LL4 A;  2MLZ A;  1FKJ A;  3O5K A;  4W9O A;  4MSP A;  4P8V A;  3GPK A;  3GU0 A;  1FKD A;  2DSW A;  1D6O A;  2O92 A;  1QPF A;  3WL1 A;  4Z2K A;  1UR9 A;  3ART A;  2KO7 A;  4DWS B;  1Q6H A;  4WKA A;  3BXW A;  1FJD A;  1R9H A;  2L2S A;  4L3N A;  4ODK A;  4WJX A;  4P8U A;  1NWU A;  4DRO A;  2FDM A;  3IHZ A;  3NRK A;  4TX0 A;  3KCE A;  3PRB A;  3WKZ A;  1W1P A;  5HBF A;  4GIV A;  4PTM A;  1VF8 A;  1L1P A;  3EIP A;  2IUZ A;  5HKG A;  5GPG A;  4NNR A;  1ZL1 A;  3PA7 A;  4Z2L A;  3O5I A;  1E6R A;  4P8X A;  3TDB A;  1ZBW A;  4FN2 A;  2ZQU A;  2QF8 A;  4ZPW R;  2MNT A;  3G6M A;  2PPO A;  4MTV A;  1FKF A;  1BL4 A;  2ZQT A;  4WKF A;  2RUD A;  4MNJ A;  2LPV A;  5DF0 A;  3UI4 A;  5HUA A;  1HKJ A;  2K8I A;  1FFQ A;  4ODQ A;  4TW6 A;  1LG2 A;  3CHC A;  4NZC A;  4Q7N A;  1J6Y A;  5HW7 A;  1E15 A;  1UR8 A;  1ZU8 A;  3EY6 A;  3B9A A;  3ARP A;  4UDM A;  3KAC A;  1FKG A;  2DPE A;  2MLX A;  1J4I A;  1LG1 A;  4LAX A;  1SR0 A;  4Z2H A;  3LUO A;  3KAF A;  4R0X A;  4HBO A;  3NI6 A;  3WD4 A;  4DRI A;  2KI3 A;  2F23 A;  2FKE A;  2F21 A;  1JNE A;  1F8A B;  4L72 B;  2RUQ A;  3O5O A;  5DEZ A;  2VN1 A;  1C9H A;  1KT1 A;  3ARV A;  4TW7 A;  1ITX A;  3ARQ A;  4IQ2 A;  3OA5 A;  2WM0 A;  4IT4 A;  3IKD A;  4N19 A;  4R5E A;  2AOS A;  3UF8 A;  4GGQ A;  3FY1 A;  1CTN A;  5GQB A;  4DRQ A;  4G2P A;  2VCD A;  4Z2G A;  3ARU A;  1ZBC A;  4DRJ A;  4ODL A;  3AS3 A;  4JFI A;  3I6C A;  5HT1 A;  2XPB A;  5BXJ A;  1ZB5 A;  1P5Q A;  1J4H A;  4U86 A;  1PIN A;  4W5U A;  1WNO A;  4JFM A;  4TNS A;  2DG9 A;  2M1I A;  4KR0 B;  1JND A;  3CGN A;  4JFJ A;  3UI5 A;  1W1T A;  3PRD A;  4WKH A;  3JXV A;  2ZR4 A;  4DIP A;  1LJY A;  3ARS A;  2F4E A;  3IKG A;  2DT1 A;  2A3C A;  2RUC A;  3RME A;  1OWQ A;  4U85 A;  1NWR A;  2N87 A;  2XP3 A;  3AQU A;  1NMW A;  1TFV A;  1EHN A;  1TCO C;  3WH0 A;  1LL6 A;  3TCZ A;  1EQ3 A;  4TW8 A;  3AS1 A;  3B9E A;  1FKK A;  2M08 A;  5D75 A;  1XHG A;  3O5M A;  3B7X A;  1QPL A;  1KFW A;  2MLY A;  1EIB A;  4JFK A;  3CHE A;  4ZS6 A;  1XRV A;  4MNK A;  4WK9 A;  3RGC A;  4DWS A;  4DRN A;  4IPX A;  1W1V A;  1JNT A;  1D2K A;  1IX5 A;  2OFN A;  1F40 A;  1FKI A;  1B6C A;  4W9Q A;  4HAR A;  3NTP A;  5DIT A;  1NWS A;  2RSE A;  1JCH B;  1J4R A;  3GTY X;  3O5J A;  4DT4 A;  1FKS A;  3JYJ A;  3CZ8 A;  1ZK6 A;  3TC5 A;  2XP9 A;  2IF4 A;  3ODK A;  1YAT A;  2UZ5 A;  1WAW A;  1KT0 A;  2ETN A;  3O5F A;  5J6E A;  2F2D A;  3KAB A;  1W1Y A;  1W9P A;  1QZ2 A;  5GPR A;  1X6L A;  1HJX A;  3PR9 A;  2XP7 A;  4W9P A;  3KAD A;  4QT2 A;  3B8S A;  3G6L A;  1JVW A;  2G8Z A;  3UQB A;  1X6N A;  1O6I A;  1ZCN A;  2YBT A;  1N1A A;  1FKT A;  1SYT A;  3RM8 A;  2DSV A;  1PBK A;  2PV3 A;  4J4N A;  2LKN A;  2DT3 A;  2DSZ A;  2Q5A A;  4DZ2 A;  1H0G A;  3ARR A;  4ML4 A;  2XPA A;  3WD0 A;  4FAP A;  1E6N A;  3WD1 A;  4QIB A;  4ODP A;  1NMV A;  2XP4 A;  2WK2 A;  3CH9 A;  4NSB A;  4ODO A;  2PBC A;  2LGO A;  2A3E A;  4LAY A;  1HKK A;  4KQZ A;  2B31 A;  4LAV A;  2XP8 A;  1HKI A;  1D7J A;  4ZPT R;  2FAP A;  3ARY A;  2XP5 A;  1HJV A;  3UI6 A;  3BMB A;  2ITK A;  3RFW A;  4MGV A;  2P4V A;  3WD3 A;  1JNS A;  1D7H A;  3KAI A;  1ZBV A;  1YW5 A;  3O5R A;  3O5E A;  4G50 A;  3KAG A;  5HTG A;  5HW6 A;  1A7X A;  3B9D A;  1M5Y A;  1ZBK A;  2YBU A;  4DRP A;  3O5G A;  4U84 A;  4DRH A;  4ODM A;  1GRJ A;  1GOI A;  3CHD A;  4DH0 A;  1WB0 A;  1Q6I A;  2MPH A;  3VAW A;  3WL0 A;  3AS2 A;  3O5Q A;  3AS0 A;  2RQS A;  1W9U A;  3O5P A;  4QT3 A;  1HKM A;  3KZ7 A;  2LJ4 A;  3ARX A;  1EYM A;  1E6Z A;  3RM4 A;  1FFR A;  4AY1 A;  3MDY B;  4BF8 A;  5DO2 A; 
#chains in the Genus database with same CATH homology
 1K9T A;  3H9R B;  1OGB A;  1GPF A;  3UQA A;  1GUV A;  1LQ0 A;  2PPN A;  4S3K A;  1NH6 A;  3IK8 A;  5JH8 A;  2DT0 A;  1EDQ A;  2M2A A;  4DWS D;  4MNM A;  2ZR5 A;  2DG3 A;  2G41 A;  3JYM A;  2ZQS A;  3UQI A;  4IT6 A;  3WQW A;  4TYO A;  4JFL A;  1Q1C A;  2PV1 A;  2O9O A;  4XAK A;  1E6P A;  3OOB A;  4MNL A;  4LGX A;  3ARZ A;  5DIU A;  2RUR A;  1LL7 A;  1ROT A;  1ROU A;  4ODN A;  5HWB A;  4DZ3 A;  4S3J A;  2XP6 A;  1T11 A;  3KAH A;  1FKH A;  2WLZ A;  5HWC A;  4URI A;  4HBE A;  1NWT A;  5I98 A;  1D7I A;  4DRK A;  1BKF A;  3W4R A;  1FKR A;  1FKB A;  2KGJ A;  2A3A A;  1HXV A;  2AWG A;  1FKL A;  4ODR A;  1OGG A;  4JYS A;  1W26 A;  3WQV A;  1E9L A;  1FAP A;  3QOK A;  4Q22 A;  2DT2 A;  2OLH A;  2D9F A;  3O5L A;  4QZV B;  4Z2I A;  3ARW A;  4WIW A;  1HJW A;  3O5D A;  4MAV A;  2KR7 A;  2DG4 A;  2Y78 A;  2ZR6 A;  4MPK A;  1Q6U A;  2PI6 A;  2JZV A;  2MF9 A;  2ZQV A;  3ARO A;  4C02 B;  4P8W A;  1RD6 A;  3WIJ A;  1H0I A;  3CHF A;  4O2T A;  4Z2J A;  3FAP A;  4J4O A;  3ALG A;  5HW8 A;  1W9V A;  5B8I C;  1Y0O A;  4DWS C;  5DIV A;  2PPP A;  2KE0 A;  2WLY A;  4LAW A;  4ITZ A;  3FXY A;  4IQC A;  3CGM A;  1FD9 A;  2A3B A;  3WD2 A;  3ALF A;  3RM9 A;  4DRM A;  2DSU A;  2KFW A;  1NSG A;  4ZPV R;  3PRA A;  2PV2 A;  2ESC A;  1U79 A;  1LL4 A;  2MLZ A;  1FKJ A;  3O5K A;  4W9O A;  4MSP A;  4P8V A;  3GPK A;  1FKD A;  2DSW A;  1D6O A;  2O92 A;  1QPF A;  3WL1 A;  4Z2K A;  1UR9 A;  3ART A;  2KO7 A;  4DWS B;  1Q6H A;  4WKA A;  3BXW A;  1FJD A;  1R9H A;  2L2S A;  4L3N A;  4ODK A;  4WJX A;  4P8U A;  1NWU A;  4DRO A;  2FDM A;  3IHZ A;  3NRK A;  4TX0 A;  3KCE A;  3PRB A;  3WKZ A;  1W1P A;  5HBF A;  4GIV A;  4PTM A;  1VF8 A;  1L1P A;  2IUZ A;  5HKG A;  5GPG A;  4NNR A;  1ZL1 A;  3PA7 A;  4Z2L A;  3O5I A;  1E6R A;  4P8X A;  3TDB A;  1ZBW A;  4FN2 A;  2ZQU A;  2QF8 A;  4ZPW R;  2MNT A;  3G6M A;  2PPO A;  4MTV A;  1FKF A;  1BL4 A;  2ZQT A;  4WKF A;  2RUD A;  4MNJ A;  2LPV A;  5DF0 A;  3UI4 A;  5HUA A;  1HKJ A;  2K8I A;  1FFQ A;  4ODQ A;  4TW6 A;  1LG2 A;  3CHC A;  4NZC A;  4Q7N A;  1J6Y A;  5HW7 A;  1E15 A;  1UR8 A;  1ZU8 A;  3EY6 A;  3B9A A;  3ARP A;  3KAC A;  1FKG A;  2DPE A;  2MLX A;  1J4I A;  1LG1 A;  4LAX A;  1SR0 A;  4Z2H A;  3LUO A;  3KAF A;  4R0X A;  4HBO A;  3NI6 A;  3WD4 A;  4DRI A;  2KI3 A;  2FKE A;  2F21 A;  1JNE A;  1F8A B;  4L72 B;  2RUQ A;  3O5O A;  5DEZ A;  2VN1 A;  1C9H A;  1KT1 A;  3ARV A;  4TW7 A;  1ITX A;  3ARQ A;  4IQ2 A;  3OA5 A;  2WM0 A;  4IT4 A;  3IKD A;  4N19 A;  4R5E A;  2AOS A;  3UF8 A;  4GGQ A;  3FY1 A;  1CTN A;  5GQB A;  4DRQ A;  4G2P A;  2VCD A;  4Z2G A;  3ARU A;  1ZBC A;  4DRJ A;  4ODL A;  3AS3 A;  4JFI A;  3I6C A;  5HT1 A;  2XPB A;  5BXJ A;  1ZB5 A;  1P5Q A;  1J4H A;  4U86 A;  1PIN A;  4W5U A;  1WNO A;  4JFM A;  4TNS A;  2DG9 A;  2M1I A;  4KR0 B;  1JND A;  3CGN A;  4JFJ A;  3UI5 A;  1W1T A;  3PRD A;  4WKH A;  3JXV A;  2ZR4 A;  4DIP A;  1LJY A;  3ARS A;  2F4E A;  3IKG A;  2DT1 A;  2A3C A;  2RUC A;  3RME A;  1OWQ A;  4U85 A;  1NWR A;  2N87 A;  2XP3 A;  3AQU A;  1NMW A;  1TFV A;  1EHN A;  1TCO C;  3WH0 A;  1LL6 A;  3TCZ A;  1EQ3 A;  4TW8 A;  3AS1 A;  3B9E A;  1FKK A;  2M08 A;  5D75 A;  1XHG A;  3O5M A;  3B7X A;  1QPL A;  1KFW A;  2MLY A;  1EIB A;  4JFK A;  3CHE A;  4ZS6 A;  1XRV A;  4MNK A;  4WK9 A;  3RGC A;  4DWS A;  4DRN A;  4IPX A;  1W1V A;  1JNT A;  1D2K A;  1IX5 A;  2OFN A;  1F40 A;  1FKI A;  1B6C A;  4W9Q A;  4HAR A;  3NTP A;  5DIT A;  1NWS A;  2RSE A;  1J4R A;  3O5J A;  4DT4 A;  1FKS A;  3JYJ A;  3CZ8 A;  1ZK6 A;  3TC5 A;  2XP9 A;  2IF4 A;  3ODK A;  1YAT A;  2UZ5 A;  1WAW A;  1KT0 A;  3O5F A;  5J6E A;  2F2D A;  3KAB A;  1W1Y A;  1W9P A;  1QZ2 A;  5GPR A;  1X6L A;  1HJX A;  3PR9 A;  2XP7 A;  4W9P A;  3KAD A;  4QT2 A;  3B8S A;  3G6L A;  1JVW A;  2G8Z A;  3UQB A;  1X6N A;  1O6I A;  1ZCN A;  2YBT A;  1N1A A;  1FKT A;  1SYT A;  3RM8 A;  2DSV A;  1PBK A;  2PV3 A;  4J4N A;  2LKN A;  2DT3 A;  2DSZ A;  2Q5A A;  4DZ2 A;  1H0G A;  3ARR A;  4ML4 A;  2XPA A;  3WD0 A;  4FAP A;  1E6N A;  3WD1 A;  4QIB A;  4ODP A;  1NMV A;  2XP4 A;  2WK2 A;  3CH9 A;  4NSB A;  4ODO A;  2PBC A;  2LGO A;  2A3E A;  4LAY A;  1HKK A;  4KQZ A;  2B31 A;  4LAV A;  2XP8 A;  1HKI A;  1D7J A;  4ZPT R;  2FAP A;  3ARY A;  2XP5 A;  1HJV A;  3UI6 A;  2ITK A;  3RFW A;  4MGV A;  3WD3 A;  1JNS A;  1D7H A;  3KAI A;  1ZBV A;  3O5R A;  1YW5 A;  3O5E A;  4G50 A;  3KAG A;  5HTG A;  5HW6 A;  1A7X A;  3B9D A;  1M5Y A;  1ZBK A;  2YBU A;  4DRP A;  3O5G A;  4U84 A;  4DRH A;  4ODM A;  1GOI A;  3CHD A;  4DH0 A;  1WB0 A;  1Q6I A;  2MPH A;  3VAW A;  3WL0 A;  3AS2 A;  3O5Q A;  3AS0 A;  2RQS A;  1W9U A;  3O5P A;  4QT3 A;  1HKM A;  3KZ7 A;  2LJ4 A;  3ARX A;  1EYM A;  1E6Z A;  3RM4 A;  1FFR A;  4AY1 A;  3MDY B;  4BF8 A;  5DO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...