5I98A

Structure of apo fkbp12(p104g) from c. albicans
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPGIIGPNETLVFEVELLGVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
molecule tags Isomerase
total genus 26
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5i98A00
3EY6A 2D9FA 2LJ4A 2XPAA 4ODLA 2JZVA 2XP7A 3IKDA 3O5LA 2PPOA 2AWGA 4ODQA 4DT4A 2KO7A 4TYOA 3O5KA 4MGVA 2MPHA 3I6CA 4DH0A 5J6EA 1J6YA 4DRHA 3O5PA 3B7XA 4BF8A 4U85A 4ODNA 3O5FA 1EQ3A 1YATA 2ZR5A 3KAIA 4FN2A 4TW6A 1N1AA 1D7IA 4FAPA 2RSEA 4ODOA 2LPVA 5HKGA 5HUAA 1YW5A 1ROTA 3TCZA 1C9HA 2FAPA 2PPNA 1FKGA 3H9RB 4N19A 2N87A 3IKGA 1EYMA 2RQSA 3WH0A 4GGQA 3NI6A 2MNTA 4G2PA 1KT1A 1FKFA 3GPKA 5GPGA 2M08A 2MLZA 3UI5A 3O5MA 1FKLA 2RUCA 3MDYB 3ODKA 2PV3A 1T11A 1FJDA 2ZQVA 3KABA 2DG3A 1FKSA 4DROA 3O5GA 1FKHA 4LAYA 4QT2A 1BKFA 2UZ5A 2XP6A 1JNTA 5D75A 2XP3A 4JFLA 5HW6A 5HWCA 4IQ2A 1TCOC 4LAWA 4ODKA 5BXJA 1D6OA 1F40A 3IK8A 2DG9A 1Q6UA 1W26A 2Q5AA 2PV2A 3KAGA 3RFWA 4DZ3A 2ITKA 2PPPA 4DRQA 2M1IA 4ITZA 4ODPA 1M5YA 2LGOA 1QZ2A 3PRDA 1D7JA 1FD9A 4ODMA 3JYJA 4U84A 2PV1A 3FAPA 5DITA 4MSPA 2XP4A 4LAXA 1JVWA 2L2SA 4JFMA 1FKJA 4DIPA 1FKKA 2F21A 1PINA 3O5OA 2VN1A 4TX0A 4LAVA 2MLYA 4IPXA 1NSGA 2K8IA 3NRKA 3O5EA 1FKBA 1Y0OA 2XP8A 4DRNA 2KFWA 1HXVA 3JXVA 4U86A 2RURA 4TNSA 3RGCA 1ZK6A 1A7XA 1J4IA 3UF8A 2KR7A 3UQIA 2XP9A 4TW7A 3NTPA 4O2TA 3UQBA 1QPLA 4JYSA 4DRMA 2IF4A 1Q6IA 4W9OA 4JFJA 5HTGA 2XPBA 3KZ7A 1FKTA 2ZR4A 2M2AA 2MLXA 1Q6HA 3VAWA 4JFIA 2DG4A 2F2DA 1FKDA 2MF9A 2ZR6A 3CGMA 4DZ2A 5DIUA 3OOBA 5HW7A 2ZQUA 3O5QA 2FKEA 1D7HA 2OFNA 3TDBA 4W9QA 2XP5A 1ROUA 1NMWA 1P5QA 4J4NA 5DIVA 1Q1CA 1J4HA 1R9HA 2ZQSA 1U79A 4DRJA 1L1PA 1KT0A 2RUQA 4C02B 4QIBA 1FKRA 3O5IA 4R0XA 5HWBA 1PBKA 2KGJA 4DRPA 2VCDA 1FAPA 5HT1A 2F4EA 1NMVA 1ZCNA 1JNSA 1B6CA 3O5JA 4JFKA 1BL4A 4QT3A 3KAHA 5HW8A 1QPFA 3IHZA 4J4OA 4ODRA 4DRKA 2Y78A 3UQAA 3JYMA 3TC5A 2RUDA 2KE0A 3KACA 3O5RA 5I98A 2ZQTA 4IQCA 1FKIA 3LUOA 3KADA 3PRBA 4TW8A 1J4RA 3KCEA 3UI6A 2KI3A 3KAFA 3PA7A 3UI4A 4GIVA 4NNRA 5B8IC 2PBCA 2LKNA 4W9PA 4DRIA 4G50A 1F8AB 3O5DA 3CGNA
chains in the Genus database with same CATH superfamily
3ARYA 2D9FA 1LG1A 4ZS6A 2XP7A 4P8XA 3O5LA 3O5KA 1GOIA 4MGVA 1X6NA 3KAIA 1HJXA 3ARPA 1WNOA 1N1AA 2QF8A 4ODOA 1ROTA 2PI6A 3ARSA 3IKGA 2RQSA 3WL1A 4GGQA 4G2PA 1W9PA 2M08A 1FKLA 1HJWA 2PV3A 4R5EA 4P8WA 4DROA 2O92A 4LGXA 1FKHA 1WAWA 4Z2GA 5JH8A 1ZBVA 5HW6A 1TCOC 3AROA 1D6OA 1F40A 3IK8A 1Q6UA 1W26A 2Q5AA 4DRQA 1M5YA 1QZ2A 4U84A 4MSPA 4LAXA 1NWTA 1FKJA 4TX0A 4LAVA 4IPXA 1HKIA 1NSGA 3O5EA 1FKBA 1Y0OA 2XP8A 1H0GA 3JXVA 2RURA 4XAKA 3RGCA 1ZK6A 1A7XA 2WK2A 2KR7A 4ML4A 3UQIA 3ALFA 3ARUA 3B9DA 1HKJA 4DWSD 1Q6IA 4W9OA 4QZVB 5HTGA 2ZR4A 1X6LA 2DG4A 2F2DA 1W1YA 3CGMA 3RM8A 3WD3A 3OOBA 5DF0A 3TDBA 2OFNA 1E6NA 2XP5A 4J4NA 4P8VA 1J4HA 1R9HA 2B31A 1L1PA 2RUQA 4C02B 4QIBA 4DRPA 4WJXA 4JFKA 4L3NA 4Z2LA 4DRKA 3JYMA 1FFQA 5I98A 2ZQTA 3LUOA 4NZCA 3PRBA 1J4RA 3KCEA 3KAFA 1OWQA 4Q22A 1F8AB 3O5DA 3ARXA 2P4VA 2XPAA 2JZVA 2PPOA 2AWGA 4ODQA 4DT4A 2KO7A 4TYOA 2MPHA 3I6CA 1J6YA 1SR0A 4BF8A 4U85A 1EQ3A 1O6IA 1JNDA 1D7IA 4KR0B 4Z2HA 2DSZA 1K9TA 1EHNA 1FFRA 1GPFA 1YW5A 1JCHB 1E6RA 3ARTA 4N19A 2N87A 1UR9A 1NH6A 3ARVA 3NI6A 2MNTA 2DT0A 1LG2A 3ALGA 3GPKA 2A3CA 3UI5A 3WQVA 1HJVA 4S3JA 1SYTA 3MDYB 4PTMA 1ZU8A 1T11A 2DG3A 3RM9A 3ARWA 5D75A 4JFLA 2YBTA 4IQ2A 4ODKA 1GRJA 2PV2A 3KAGA 3RFWA 3WQWA 2PPPA 5DO2A 4ITZA 4ODPA 2LGOA 2FDMA 1FD9A 3FAPA 5DITA 2XP4A 2L2SA 4DIPA 1IX5A 1ZBWA 3RM4A 2MLYA 3NRKA 2KFWA 4U86A 3AS3A 1HXVA 3UF8A 3QOKA 4TW7A 3RMEA 2B5UB 1E6PA 1W9VA 4JFJA 5DEZA 2XPBA 2DT1A 1FKTA 3KZ7A 4UDMA 2M2AA 2MLXA 1Q6HA 3VAWA 3CHFA 5GPRA 3OA5A 2ZQUA 5HBFA 1D7HA 4W9QA 2IUZA 3ARRA 3B9EA 1P5QA 4NSBA 2ZQSA 4DRJA 1LL6A 1FKRA 1PBKA 1VF8A 3AS2A 3WD4A 1NMVA 2PN0A 4HARA 1B6CA 4IT4A 3BMBA 4WKHA 3O5JA 4J4OA 1ZBKA 1XRVA 2RUDA 3FY1A 1ITXA 3KACA 4DZ2A 3KADA 4Q7NA 3UI6A 2KI3A 1LQ0A 4GIVA 2LKNA 4G50A 3PRAA 5DIUA 3EY6A 2G8ZA 2DSUA 4ODLA 1NWUA 1HKKA 1E15A 1ZL1A 1LL4A 4DH0A 4DRHA 3WL0A 1E6ZA 3O5FA 1YATA 3ARZA 4FN2A 4TW6A 4FAPA 2RSEA 3G6MA 2LPVA 4WKFA 2WLZA 3H9RB 3WH0A 1H0IA 1EYMA 1FKFA 5GPGA 3O5MA 2RUCA 3ODKA 1FJDA 2ZQVA 3KABA 2DSWA 2ESCA 4ZPTR 4LAYA 1JNTA 4S3KA 2XP3A 1RD6A 3ARQA 3W4RA 5HWCA 5BXJA 2DG9A 4DZ3A 2ITKA 3G6LA 1D7JA 3CHEA 3JYJA 2PV1A 1W1VA 1JVWA 4MAVA 3O5OA 2VN1A 1UR8A 2A3BA 1NWSA 1E9LA 5GQBA 1J4IA 4O2TA 1TFVA 3UQBA 3GTYX 1QPLA 4JYSA 4DRMA 2IF4A 4DWSA 1CTNA 4JFIA 2ZR6A 1FKDA 2MF9A 2OLHA 4HBEA 4MNMA 4MNJA 4DWSC 2DT3A 5HW7A 4WIWA 2AOSA 4IT6A 4HBOA 1EIBA 1ROUA 1NMWA 1ZB5A 5DIVA 1OGGA 4MNKA 3AS1A 1KT0A 4WK9A 3BXWA 3O5IA 5HWBA 2G41A 1FAPA 2WM0A 3EIPA 1W1PA 2F4EA 1ZCNA 2F23A 1BL4A 4QT3A 3CHDA 3IHZA 2Y78A 2DPEA 3UQAA 1KFWA 2A3EA 2KE0A 3O5RA 2O9OA 4TW8A 4IQCA 1FKIA 3UI4A 4DWSB 3PA7A 2PBCA 4W9PA 4DRIA 1LJYA 2A3AA 3CGNA 4P8UA 2LJ4A 1EDQA 3AS0A 3IKDA 1LL7A 4URIA 5J6EA 1WB0A 3O5PA 3B7XA 4ODNA 4WKAA 2ZR5A 4KQZA 4L72B 5HKGA 5HUAA 3WD1A 3TCZA 1C9HA 2FAPA 2PPNA 1FKGA 4Z2IA 1KT1A 2DT2A 2MLZA 1OGBA 3PR9A 1FKSA 3O5GA 4QT2A 1BKFA 2UZ5A 2XP6A 4LAWA 4MTVA 4MPKA 2EULA 2M1IA 3PRDA 1D2KA 4ODMA 1E44A 3AQUA 3CZ8A 4JFMA 1FKKA 1PINA 2F21A 3WKZA 4ZPWR 3CH9A 2K8IA 4DRNA 2WLYA 4ZPVR 4TNSA 2XP9A 3FXYA 3NTPA 4Z2JA 1NWRA 2ETNA 3B8SA 1GUVA 1W9UA 1ZBCA 3O5QA 2FKEA 4W5UA 3B9AA 1Q1CA 1U79A 4R0XA 2KGJA 3WD0A 3WIJA 2VCDA 5HT1A 1JNSA 1XHGA 4MNLA 3KAHA 5HW8A 1QPFA 4ODRA 1JNEA 3TC5A 2YBUA 2DSVA 4Z2KA 3GU0A 4AY1A 1W1TA 3WD2A 4NNRA 5B8IC 3CHCA 1HKMA
chains in the Genus database with same CATH topology
3ARYA 2D9FA 1LG1A 4ZS6A 2XP7A 4P8XA 3O5LA 3O5KA 1GOIA 4MGVA 1X6NA 3KAIA 1HJXA 3ARPA 1WNOA 1N1AA 2QF8A 4ODOA 1ROTA 2PI6A 3ARSA 3IKGA 2RQSA 3WL1A 4GGQA 4G2PA 1W9PA 2M08A 1FKLA 1HJWA 2PV3A 4R5EA 4P8WA 4DROA 2O92A 4LGXA 1FKHA 1WAWA 4Z2GA 5JH8A 1ZBVA 5HW6A 1TCOC 3AROA 1D6OA 1F40A 3IK8A 1Q6UA 1W26A 2Q5AA 4DRQA 1M5YA 1QZ2A 4U84A 4MSPA 4LAXA 1NWTA 1FKJA 4TX0A 4LAVA 4IPXA 1HKIA 1NSGA 3O5EA 1FKBA 1Y0OA 2XP8A 1H0GA 3JXVA 2RURA 4XAKA 3RGCA 1ZK6A 1A7XA 2WK2A 2KR7A 4ML4A 3UQIA 3ALFA 3ARUA 3B9DA 1HKJA 4DWSD 1Q6IA 4W9OA 4QZVB 5HTGA 2ZR4A 1X6LA 2DG4A 2F2DA 1W1YA 3CGMA 3RM8A 3WD3A 3OOBA 5DF0A 3TDBA 2OFNA 1E6NA 2XP5A 4J4NA 4P8VA 1J4HA 1R9HA 2B31A 1L1PA 2RUQA 4C02B 4QIBA 4DRPA 4WJXA 4JFKA 4L3NA 4Z2LA 4DRKA 3JYMA 1FFQA 5I98A 2ZQTA 3LUOA 4NZCA 3PRBA 1J4RA 3KCEA 3KAFA 1OWQA 4Q22A 1F8AB 3O5DA 3ARXA 2XPAA 2JZVA 2PPOA 2AWGA 4ODQA 4DT4A 2KO7A 4TYOA 2MPHA 3I6CA 1J6YA 1SR0A 4BF8A 4U85A 1EQ3A 1O6IA 1JNDA 1D7IA 4KR0B 4Z2HA 2DSZA 1K9TA 1EHNA 1FFRA 1GPFA 1YW5A 1E6RA 3ARTA 4N19A 2N87A 1UR9A 1NH6A 3ARVA 3NI6A 2MNTA 2DT0A 1LG2A 3ALGA 3GPKA 2A3CA 3UI5A 3WQVA 1HJVA 4S3JA 1SYTA 3MDYB 4PTMA 1ZU8A 1T11A 2DG3A 3RM9A 3ARWA 5D75A 4JFLA 2YBTA 4IQ2A 4ODKA 2PV2A 3KAGA 3RFWA 3WQWA 2PPPA 5DO2A 4ITZA 4ODPA 2LGOA 2FDMA 1FD9A 3FAPA 5DITA 2XP4A 2L2SA 4DIPA 1IX5A 1ZBWA 3RM4A 2MLYA 3NRKA 2KFWA 4U86A 3AS3A 1HXVA 3UF8A 3QOKA 4TW7A 3RMEA 1E6PA 1W9VA 4JFJA 5DEZA 2XPBA 2DT1A 1FKTA 3KZ7A 2M2AA 2MLXA 1Q6HA 3VAWA 3CHFA 5GPRA 3OA5A 2ZQUA 5HBFA 1D7HA 4W9QA 2IUZA 3ARRA 3B9EA 1P5QA 4NSBA 2ZQSA 4DRJA 1LL6A 1FKRA 1PBKA 1VF8A 3AS2A 3WD4A 1NMVA 4HARA 1B6CA 4IT4A 4WKHA 3O5JA 4J4OA 1ZBKA 1XRVA 2RUDA 3FY1A 1ITXA 3KACA 4DZ2A 3KADA 4Q7NA 3UI6A 2KI3A 1LQ0A 4GIVA 2LKNA 4G50A 3PRAA 5DIUA 3EY6A 2G8ZA 2DSUA 4ODLA 1NWUA 1HKKA 1E15A 1ZL1A 1LL4A 4DH0A 4DRHA 3WL0A 1E6ZA 3O5FA 1YATA 3ARZA 4FN2A 4TW6A 4FAPA 2RSEA 3G6MA 2LPVA 4WKFA 2WLZA 3H9RB 3WH0A 1H0IA 1EYMA 1FKFA 5GPGA 3O5MA 2RUCA 3ODKA 1FJDA 2ZQVA 3KABA 2DSWA 2ESCA 4ZPTR 4LAYA 1JNTA 4S3KA 2XP3A 1RD6A 3ARQA 3W4RA 5HWCA 5BXJA 2DG9A 4DZ3A 2ITKA 3G6LA 1D7JA 3CHEA 3JYJA 2PV1A 1W1VA 1JVWA 4MAVA 3O5OA 2VN1A 1UR8A 2A3BA 1NWSA 1E9LA 5GQBA 1J4IA 4O2TA 1TFVA 3UQBA 1QPLA 4JYSA 4DRMA 2IF4A 4DWSA 1CTNA 4JFIA 2ZR6A 1FKDA 2MF9A 2OLHA 4HBEA 4MNMA 4MNJA 4DWSC 2DT3A 5HW7A 4WIWA 2AOSA 4IT6A 4HBOA 1EIBA 1ROUA 1NMWA 1ZB5A 5DIVA 1OGGA 4MNKA 3AS1A 1KT0A 4WK9A 3BXWA 3O5IA 5HWBA 2G41A 1FAPA 2WM0A 1W1PA 2F4EA 1ZCNA 1BL4A 4QT3A 3CHDA 3IHZA 2Y78A 2DPEA 3UQAA 1KFWA 2A3EA 3O5RA 2KE0A 2O9OA 4TW8A 4IQCA 1FKIA 3UI4A 4DWSB 3PA7A 2PBCA 4W9PA 4DRIA 1LJYA 2A3AA 3CGNA 4P8UA 2LJ4A 1EDQA 3AS0A 3IKDA 1LL7A 4URIA 5J6EA 1WB0A 3O5PA 3B7XA 4ODNA 4WKAA 2ZR5A 4KQZA 4L72B 5HKGA 5HUAA 3WD1A 3TCZA 1C9HA 2FAPA 2PPNA 1FKGA 4Z2IA 1KT1A 2DT2A 2MLZA 1OGBA 3PR9A 1FKSA 3O5GA 4QT2A 1BKFA 2UZ5A 2XP6A 4LAWA 4MTVA 4MPKA 2M1IA 3PRDA 1D2KA 4ODMA 3AQUA 3CZ8A 4JFMA 1FKKA 1PINA 2F21A 3WKZA 4ZPWR 3CH9A 2K8IA 4DRNA 2WLYA 4ZPVR 4TNSA 2XP9A 3FXYA 3NTPA 4Z2JA 1NWRA 3B8SA 1GUVA 1W9UA 1ZBCA 3O5QA 2FKEA 4W5UA 3B9AA 1Q1CA 1U79A 4R0XA 2KGJA 3WD0A 3WIJA 2VCDA 5HT1A 1JNSA 1XHGA 4MNLA 3KAHA 5HW8A 1QPFA 4ODRA 1JNEA 3TC5A 2YBUA 2DSVA 4Z2KA 4AY1A 1W1TA 3WD2A 4NNRA 5B8IC 3CHCA 1HKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EY6 A;  2D9F A;  2LJ4 A;  2XPA A;  4ODL A;  2JZV A;  2XP7 A;  3IKD A;  3O5L A;  2PPO A;  2AWG A;  4ODQ A;  4DT4 A;  2KO7 A;  4TYO A;  3O5K A;  4MGV A;  2MPH A;  3I6C A;  4DH0 A;  5J6E A;  1J6Y A;  4DRH A;  3O5P A;  3B7X A;  4BF8 A;  4U85 A;  4ODN A;  3O5F A;  1EQ3 A;  1YAT A;  2ZR5 A;  3KAI A;  4FN2 A;  4TW6 A;  1N1A A;  1D7I A;  4FAP A;  2RSE A;  4ODO A;  2LPV A;  5HKG A;  5HUA A;  1YW5 A;  1ROT A;  3TCZ A;  1C9H A;  2FAP A;  2PPN A;  1FKG A;  3H9R B;  4N19 A;  2N87 A;  3IKG A;  1EYM A;  2RQS A;  3WH0 A;  4GGQ A;  3NI6 A;  2MNT A;  4G2P A;  1KT1 A;  1FKF A;  3GPK A;  5GPG A;  2M08 A;  2MLZ A;  3UI5 A;  3O5M A;  1FKL A;  2RUC A;  3MDY B;  3ODK A;  2PV3 A;  1T11 A;  1FJD A;  2ZQV A;  3KAB A;  2DG3 A;  1FKS A;  4DRO A;  3O5G A;  1FKH A;  4LAY A;  4QT2 A;  1BKF A;  2UZ5 A;  2XP6 A;  1JNT A;  5D75 A;  2XP3 A;  4JFL A;  5HW6 A;  5HWC A;  4IQ2 A;  1TCO C;  4LAW A;  4ODK A;  5BXJ A;  1D6O A;  1F40 A;  3IK8 A;  2DG9 A;  1Q6U A;  1W26 A;  2Q5A A;  2PV2 A;  3KAG A;  3RFW A;  4DZ3 A;  2ITK A;  2PPP A;  4DRQ A;  2M1I A;  4ITZ A;  4ODP A;  1M5Y A;  2LGO A;  1QZ2 A;  3PRD A;  1D7J A;  1FD9 A;  4ODM A;  3JYJ A;  4U84 A;  2PV1 A;  3FAP A;  5DIT A;  4MSP A;  2XP4 A;  4LAX A;  1JVW A;  2L2S A;  4JFM A;  1FKJ A;  4DIP A;  1FKK A;  2F21 A;  1PIN A;  3O5O A;  2VN1 A;  4TX0 A;  4LAV A;  2MLY A;  4IPX A;  1NSG A;  2K8I A;  3NRK A;  3O5E A;  1FKB A;  1Y0O A;  2XP8 A;  4DRN A;  2KFW A;  1HXV A;  3JXV A;  4U86 A;  2RUR A;  4TNS A;  3RGC A;  1ZK6 A;  1A7X A;  1J4I A;  3UF8 A;  2KR7 A;  3UQI A;  2XP9 A;  4TW7 A;  3NTP A;  4O2T A;  3UQB A;  1QPL A;  4JYS A;  4DRM A;  2IF4 A;  1Q6I A;  4W9O A;  4JFJ A;  5HTG A;  2XPB A;  3KZ7 A;  1FKT A;  2ZR4 A;  2M2A A;  2MLX A;  1Q6H A;  3VAW A;  4JFI A;  2DG4 A;  2F2D A;  1FKD A;  2MF9 A;  2ZR6 A;  3CGM A;  4DZ2 A;  5DIU A;  3OOB A;  5HW7 A;  2ZQU A;  3O5Q A;  2FKE A;  1D7H A;  2OFN A;  3TDB A;  4W9Q A;  2XP5 A;  1ROU A;  1NMW A;  1P5Q A;  4J4N A;  5DIV A;  1Q1C A;  1J4H A;  1R9H A;  2ZQS A;  1U79 A;  4DRJ A;  1L1P A;  1KT0 A;  2RUQ A;  4C02 B;  4QIB A;  1FKR A;  3O5I A;  4R0X A;  5HWB A;  1PBK A;  2KGJ A;  4DRP A;  2VCD A;  1FAP A;  5HT1 A;  2F4E A;  1NMV A;  1ZCN A;  1JNS A;  1B6C A;  3O5J A;  4JFK A;  1BL4 A;  4QT3 A;  3KAH A;  5HW8 A;  1QPF A;  3IHZ A;  4J4O A;  4ODR A;  4DRK A;  2Y78 A;  3UQA A;  3JYM A;  3TC5 A;  2RUD A;  2KE0 A;  3KAC A;  3O5R A;  5I98 A;  2ZQT A;  4IQC A;  1FKI A;  3LUO A;  3KAD A;  3PRB A;  4TW8 A;  1J4R A;  3KCE A;  3UI6 A;  2KI3 A;  3KAF A;  3PA7 A;  3UI4 A;  4GIV A;  4NNR A;  5B8I C;  2PBC A;  2LKN A;  4W9P A;  4DRI A;  4G50 A;  1F8A B;  3O5D A;  3CGN A; 
#chains in the Genus database with same CATH topology
 3ARY A;  2D9F A;  1LG1 A;  4ZS6 A;  2XP7 A;  4P8X A;  3O5L A;  3O5K A;  1GOI A;  4MGV A;  1X6N A;  3KAI A;  1HJX A;  3ARP A;  1WNO A;  1N1A A;  2QF8 A;  4ODO A;  1ROT A;  2PI6 A;  3ARS A;  3IKG A;  2RQS A;  3WL1 A;  4GGQ A;  4G2P A;  1W9P A;  2M08 A;  1FKL A;  1HJW A;  2PV3 A;  4R5E A;  4P8W A;  4DRO A;  2O92 A;  4LGX A;  1FKH A;  1WAW A;  4Z2G A;  5JH8 A;  1ZBV A;  5HW6 A;  1TCO C;  3ARO A;  1D6O A;  1F40 A;  3IK8 A;  1Q6U A;  1W26 A;  2Q5A A;  4DRQ A;  1M5Y A;  1QZ2 A;  4U84 A;  4MSP A;  4LAX A;  1NWT A;  1FKJ A;  4TX0 A;  4LAV A;  4IPX A;  1HKI A;  1NSG A;  3O5E A;  1FKB A;  1Y0O A;  2XP8 A;  1H0G A;  3JXV A;  2RUR A;  4XAK A;  3RGC A;  1ZK6 A;  1A7X A;  2WK2 A;  2KR7 A;  4ML4 A;  3UQI A;  3ALF A;  3ARU A;  3B9D A;  1HKJ A;  4DWS D;  1Q6I A;  4W9O A;  4QZV B;  5HTG A;  2ZR4 A;  1X6L A;  2DG4 A;  2F2D A;  1W1Y A;  3CGM A;  3RM8 A;  3WD3 A;  3OOB A;  5DF0 A;  3TDB A;  2OFN A;  1E6N A;  2XP5 A;  4J4N A;  4P8V A;  1J4H A;  1R9H A;  2B31 A;  1L1P A;  2RUQ A;  4C02 B;  4QIB A;  4DRP A;  4WJX A;  4JFK A;  4L3N A;  4Z2L A;  4DRK A;  3JYM A;  1FFQ A;  5I98 A;  2ZQT A;  3LUO A;  4NZC A;  3PRB A;  1J4R A;  3KCE A;  3KAF A;  1OWQ A;  4Q22 A;  1F8A B;  3O5D A;  3ARX A;  2P4V A;  2XPA A;  2JZV A;  2PPO A;  2AWG A;  4ODQ A;  4DT4 A;  2KO7 A;  4TYO A;  2MPH A;  3I6C A;  1J6Y A;  1SR0 A;  4BF8 A;  4U85 A;  1EQ3 A;  1O6I A;  1JND A;  1D7I A;  4KR0 B;  4Z2H A;  2DSZ A;  1K9T A;  1EHN A;  1FFR A;  1GPF A;  1YW5 A;  1JCH B;  1E6R A;  3ART A;  4N19 A;  2N87 A;  1UR9 A;  1NH6 A;  3ARV A;  3NI6 A;  2MNT A;  2DT0 A;  1LG2 A;  3ALG A;  3GPK A;  2A3C A;  3UI5 A;  3WQV A;  1HJV A;  4S3J A;  1SYT A;  3MDY B;  4PTM A;  1ZU8 A;  1T11 A;  2DG3 A;  3RM9 A;  3ARW A;  5D75 A;  4JFL A;  2YBT A;  4IQ2 A;  4ODK A;  1GRJ A;  2PV2 A;  3KAG A;  3RFW A;  3WQW A;  2PPP A;  5DO2 A;  4ITZ A;  4ODP A;  2LGO A;  2FDM A;  1FD9 A;  3FAP A;  5DIT A;  2XP4 A;  2L2S A;  4DIP A;  1IX5 A;  1ZBW A;  3RM4 A;  2MLY A;  3NRK A;  2KFW A;  4U86 A;  3AS3 A;  1HXV A;  3UF8 A;  3QOK A;  4TW7 A;  3RME A;  2B5U B;  1E6P A;  1W9V A;  4JFJ A;  5DEZ A;  2XPB A;  2DT1 A;  1FKT A;  3KZ7 A;  4UDM A;  2M2A A;  2MLX A;  1Q6H A;  3VAW A;  3CHF A;  5GPR A;  3OA5 A;  2ZQU A;  5HBF A;  1D7H A;  4W9Q A;  2IUZ A;  3ARR A;  3B9E A;  1P5Q A;  4NSB A;  2ZQS A;  4DRJ A;  1LL6 A;  1FKR A;  1PBK A;  1VF8 A;  3AS2 A;  3WD4 A;  1NMV A;  2PN0 A;  4HAR A;  1B6C A;  4IT4 A;  3BMB A;  4WKH A;  3O5J A;  4J4O A;  1ZBK A;  1XRV A;  2RUD A;  3FY1 A;  1ITX A;  3KAC A;  4DZ2 A;  3KAD A;  4Q7N A;  3UI6 A;  2KI3 A;  1LQ0 A;  4GIV A;  2LKN A;  4G50 A;  3PRA A;  5DIU A;  3EY6 A;  2G8Z A;  2DSU A;  4ODL A;  1NWU A;  1HKK A;  1E15 A;  1ZL1 A;  1LL4 A;  4DH0 A;  4DRH A;  3WL0 A;  1E6Z A;  3O5F A;  1YAT A;  3ARZ A;  4FN2 A;  4TW6 A;  4FAP A;  2RSE A;  3G6M A;  2LPV A;  4WKF A;  2WLZ A;  3H9R B;  3WH0 A;  1H0I A;  1EYM A;  1FKF A;  5GPG A;  3O5M A;  2RUC A;  3ODK A;  1FJD A;  2ZQV A;  3KAB A;  2DSW A;  2ESC A;  4ZPT R;  4LAY A;  1JNT A;  4S3K A;  2XP3 A;  1RD6 A;  3ARQ A;  3W4R A;  5HWC A;  5BXJ A;  2DG9 A;  4DZ3 A;  2ITK A;  3G6L A;  1D7J A;  3CHE A;  3JYJ A;  2PV1 A;  1W1V A;  1JVW A;  4MAV A;  3O5O A;  2VN1 A;  1UR8 A;  2A3B A;  1NWS A;  1E9L A;  5GQB A;  1J4I A;  4O2T A;  1TFV A;  3UQB A;  3GTY X;  1QPL A;  4JYS A;  4DRM A;  2IF4 A;  4DWS A;  1CTN A;  4JFI A;  2ZR6 A;  1FKD A;  2MF9 A;  2OLH A;  4HBE A;  4MNM A;  4MNJ A;  4DWS C;  2DT3 A;  5HW7 A;  4WIW A;  2AOS A;  4IT6 A;  4HBO A;  1EIB A;  1ROU A;  1NMW A;  1ZB5 A;  5DIV A;  1OGG A;  4MNK A;  3AS1 A;  1KT0 A;  4WK9 A;  3BXW A;  3O5I A;  5HWB A;  2G41 A;  1FAP A;  2WM0 A;  3EIP A;  1W1P A;  2F4E A;  1ZCN A;  2F23 A;  1BL4 A;  4QT3 A;  3CHD A;  3IHZ A;  2Y78 A;  2DPE A;  3UQA A;  1KFW A;  2A3E A;  2KE0 A;  3O5R A;  2O9O A;  4TW8 A;  4IQC A;  1FKI A;  3UI4 A;  4DWS B;  3PA7 A;  2PBC A;  4W9P A;  4DRI A;  1LJY A;  2A3A A;  3CGN A;  4P8U A;  2LJ4 A;  1EDQ A;  3AS0 A;  3IKD A;  1LL7 A;  4URI A;  5J6E A;  1WB0 A;  3O5P A;  3B7X A;  4ODN A;  4WKA A;  2ZR5 A;  4KQZ A;  4L72 B;  5HKG A;  5HUA A;  3WD1 A;  3TCZ A;  1C9H A;  2FAP A;  2PPN A;  1FKG A;  4Z2I A;  1KT1 A;  2DT2 A;  2MLZ A;  1OGB A;  3PR9 A;  1FKS A;  3O5G A;  4QT2 A;  1BKF A;  2UZ5 A;  2XP6 A;  4LAW A;  4MTV A;  4MPK A;  2EUL A;  2M1I A;  3PRD A;  1D2K A;  4ODM A;  1E44 A;  3AQU A;  3CZ8 A;  4JFM A;  1FKK A;  1PIN A;  2F21 A;  3WKZ A;  4ZPW R;  3CH9 A;  2K8I A;  4DRN A;  2WLY A;  4ZPV R;  4TNS A;  2XP9 A;  3FXY A;  3NTP A;  4Z2J A;  1NWR A;  2ETN A;  3B8S A;  1GUV A;  1W9U A;  1ZBC A;  3O5Q A;  2FKE A;  4W5U A;  3B9A A;  1Q1C A;  1U79 A;  4R0X A;  2KGJ A;  3WD0 A;  3WIJ A;  2VCD A;  5HT1 A;  1JNS A;  1XHG A;  4MNL A;  3KAH A;  5HW8 A;  1QPF A;  4ODR A;  1JNE A;  3TC5 A;  2YBU A;  2DSV A;  4Z2K A;  3GU0 A;  4AY1 A;  1W1T A;  3WD2 A;  4NNR A;  5B8I C;  3CHC A;  1HKM A; 
#chains in the Genus database with same CATH homology
 3ARY A;  2D9F A;  1LG1 A;  4ZS6 A;  2XP7 A;  4P8X A;  3O5L A;  3O5K A;  1GOI A;  4MGV A;  1X6N A;  3KAI A;  1HJX A;  3ARP A;  1WNO A;  1N1A A;  2QF8 A;  4ODO A;  1ROT A;  2PI6 A;  3ARS A;  3IKG A;  2RQS A;  3WL1 A;  4GGQ A;  4G2P A;  1W9P A;  2M08 A;  1FKL A;  1HJW A;  2PV3 A;  4R5E A;  4P8W A;  4DRO A;  2O92 A;  4LGX A;  1FKH A;  1WAW A;  4Z2G A;  5JH8 A;  1ZBV A;  5HW6 A;  1TCO C;  3ARO A;  1D6O A;  1F40 A;  3IK8 A;  1Q6U A;  1W26 A;  2Q5A A;  4DRQ A;  1M5Y A;  1QZ2 A;  4U84 A;  4MSP A;  4LAX A;  1NWT A;  1FKJ A;  4TX0 A;  4LAV A;  4IPX A;  1HKI A;  1NSG A;  3O5E A;  1FKB A;  1Y0O A;  2XP8 A;  1H0G A;  3JXV A;  2RUR A;  4XAK A;  3RGC A;  1ZK6 A;  1A7X A;  2WK2 A;  2KR7 A;  4ML4 A;  3UQI A;  3ALF A;  3ARU A;  3B9D A;  1HKJ A;  4DWS D;  1Q6I A;  4W9O A;  4QZV B;  5HTG A;  2ZR4 A;  1X6L A;  2DG4 A;  2F2D A;  1W1Y A;  3CGM A;  3RM8 A;  3WD3 A;  3OOB A;  5DF0 A;  3TDB A;  2OFN A;  1E6N A;  2XP5 A;  4J4N A;  4P8V A;  1J4H A;  1R9H A;  2B31 A;  1L1P A;  2RUQ A;  4C02 B;  4QIB A;  4DRP A;  4WJX A;  4JFK A;  4L3N A;  4Z2L A;  4DRK A;  3JYM A;  1FFQ A;  5I98 A;  2ZQT A;  3LUO A;  4NZC A;  3PRB A;  1J4R A;  3KCE A;  3KAF A;  1OWQ A;  4Q22 A;  1F8A B;  3O5D A;  3ARX A;  2XPA A;  2JZV A;  2PPO A;  2AWG A;  4ODQ A;  4DT4 A;  2KO7 A;  4TYO A;  2MPH A;  3I6C A;  1J6Y A;  1SR0 A;  4BF8 A;  4U85 A;  1EQ3 A;  1O6I A;  1JND A;  1D7I A;  4KR0 B;  4Z2H A;  2DSZ A;  1K9T A;  1EHN A;  1FFR A;  1GPF A;  1YW5 A;  1E6R A;  3ART A;  4N19 A;  2N87 A;  1UR9 A;  1NH6 A;  3ARV A;  3NI6 A;  2MNT A;  2DT0 A;  1LG2 A;  3ALG A;  3GPK A;  2A3C A;  3UI5 A;  3WQV A;  1HJV A;  4S3J A;  1SYT A;  3MDY B;  4PTM A;  1ZU8 A;  1T11 A;  2DG3 A;  3RM9 A;  3ARW A;  5D75 A;  4JFL A;  2YBT A;  4IQ2 A;  4ODK A;  2PV2 A;  3KAG A;  3RFW A;  3WQW A;  2PPP A;  5DO2 A;  4ITZ A;  4ODP A;  2LGO A;  2FDM A;  1FD9 A;  3FAP A;  5DIT A;  2XP4 A;  2L2S A;  4DIP A;  1IX5 A;  1ZBW A;  3RM4 A;  2MLY A;  3NRK A;  2KFW A;  4U86 A;  3AS3 A;  1HXV A;  3UF8 A;  3QOK A;  4TW7 A;  3RME A;  1E6P A;  1W9V A;  4JFJ A;  5DEZ A;  2XPB A;  2DT1 A;  1FKT A;  3KZ7 A;  2M2A A;  2MLX A;  1Q6H A;  3VAW A;  3CHF A;  5GPR A;  3OA5 A;  2ZQU A;  5HBF A;  1D7H A;  4W9Q A;  2IUZ A;  3ARR A;  3B9E A;  1P5Q A;  4NSB A;  2ZQS A;  4DRJ A;  1LL6 A;  1FKR A;  1PBK A;  1VF8 A;  3AS2 A;  3WD4 A;  1NMV A;  4HAR A;  1B6C A;  4IT4 A;  4WKH A;  3O5J A;  4J4O A;  1ZBK A;  1XRV A;  2RUD A;  3FY1 A;  1ITX A;  3KAC A;  4DZ2 A;  3KAD A;  4Q7N A;  3UI6 A;  2KI3 A;  1LQ0 A;  4GIV A;  2LKN A;  4G50 A;  3PRA A;  5DIU A;  3EY6 A;  2G8Z A;  2DSU A;  4ODL A;  1NWU A;  1HKK A;  1E15 A;  1ZL1 A;  1LL4 A;  4DH0 A;  4DRH A;  3WL0 A;  1E6Z A;  3O5F A;  1YAT A;  3ARZ A;  4FN2 A;  4TW6 A;  4FAP A;  2RSE A;  3G6M A;  2LPV A;  4WKF A;  2WLZ A;  3H9R B;  3WH0 A;  1H0I A;  1EYM A;  1FKF A;  5GPG A;  3O5M A;  2RUC A;  3ODK A;  1FJD A;  2ZQV A;  3KAB A;  2DSW A;  2ESC A;  4ZPT R;  4LAY A;  1JNT A;  4S3K A;  2XP3 A;  1RD6 A;  3ARQ A;  3W4R A;  5HWC A;  5BXJ A;  2DG9 A;  4DZ3 A;  2ITK A;  3G6L A;  1D7J A;  3CHE A;  3JYJ A;  2PV1 A;  1W1V A;  1JVW A;  4MAV A;  3O5O A;  2VN1 A;  1UR8 A;  2A3B A;  1NWS A;  1E9L A;  5GQB A;  1J4I A;  4O2T A;  1TFV A;  3UQB A;  1QPL A;  4JYS A;  4DRM A;  2IF4 A;  4DWS A;  1CTN A;  4JFI A;  2ZR6 A;  1FKD A;  2MF9 A;  2OLH A;  4HBE A;  4MNM A;  4MNJ A;  4DWS C;  2DT3 A;  5HW7 A;  4WIW A;  2AOS A;  4IT6 A;  4HBO A;  1EIB A;  1ROU A;  1NMW A;  1ZB5 A;  5DIV A;  1OGG A;  4MNK A;  3AS1 A;  1KT0 A;  4WK9 A;  3BXW A;  3O5I A;  5HWB A;  2G41 A;  1FAP A;  2WM0 A;  1W1P A;  2F4E A;  1ZCN A;  1BL4 A;  4QT3 A;  3CHD A;  3IHZ A;  2Y78 A;  2DPE A;  3UQA A;  1KFW A;  2A3E A;  3O5R A;  2KE0 A;  2O9O A;  4TW8 A;  4IQC A;  1FKI A;  3UI4 A;  4DWS B;  3PA7 A;  2PBC A;  4W9P A;  4DRI A;  1LJY A;  2A3A A;  3CGN A;  4P8U A;  2LJ4 A;  1EDQ A;  3AS0 A;  3IKD A;  1LL7 A;  4URI A;  5J6E A;  1WB0 A;  3O5P A;  3B7X A;  4ODN A;  4WKA A;  2ZR5 A;  4KQZ A;  4L72 B;  5HKG A;  5HUA A;  3WD1 A;  3TCZ A;  1C9H A;  2FAP A;  2PPN A;  1FKG A;  4Z2I A;  1KT1 A;  2DT2 A;  2MLZ A;  1OGB A;  3PR9 A;  1FKS A;  3O5G A;  4QT2 A;  1BKF A;  2UZ5 A;  2XP6 A;  4LAW A;  4MTV A;  4MPK A;  2M1I A;  3PRD A;  1D2K A;  4ODM A;  3AQU A;  3CZ8 A;  4JFM A;  1FKK A;  1PIN A;  2F21 A;  3WKZ A;  4ZPW R;  3CH9 A;  2K8I A;  4DRN A;  2WLY A;  4ZPV R;  4TNS A;  2XP9 A;  3FXY A;  3NTP A;  4Z2J A;  1NWR A;  3B8S A;  1GUV A;  1W9U A;  1ZBC A;  3O5Q A;  2FKE A;  4W5U A;  3B9A A;  1Q1C A;  1U79 A;  4R0X A;  2KGJ A;  3WD0 A;  3WIJ A;  2VCD A;  5HT1 A;  1JNS A;  1XHG A;  4MNL A;  3KAH A;  5HW8 A;  1QPF A;  4ODR A;  1JNE A;  3TC5 A;  2YBU A;  2DSV A;  4Z2K A;  4AY1 A;  1W1T A;  3WD2 A;  4NNR A;  5B8I C;  3CHC A;  1HKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...