5I98A

Structure of apo fkbp12(p104g) from c. albicans
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
b'EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPGIIGPNETLVFEVELLGVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
molecule tags Isomerase
total genus 26
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5i98A00
4R0XA 2ZQTA 1M5YA 1D6OA 3CGMA 3KAIA 1W26A 1BKFA 1P5QA 1FKJA 3EY6A 2XPAA 2PPPA 2M08A 1FKHA 3NTPA 1T11A 3O5QA 3KCEA 2DG3A 4ODRA 3GPKA 1JNTA 1Q6IA 2RUQA 2FAPA 1J4RA 3UI6A 2RQSA 4DRQA 1D7JA 2XP9A 4G2PA 2F21A 1EYMA 2DG9A 2RUDA 3IK8A 2LGOA 3PRBA 4IQ2A 4TW6A 3MDYB 1BL4A 2AWGA 3OOBA 5I98A 1Y0OA 2K8IA 2F2DA 3RGCA 1FKFA 1FKIA 4U84A 3O5KA 5DIUA 1NMWA 3IKGA 3KAGA 3NRKA 4TX0A 4JYSA 2MLYA 4QIBA 3O5LA 4JFIA 2RSEA 1F40A 2JZVA 2Q5AA 3TCZA 3O5FA 1YW5A 2DG4A 4DRJA 4W9PA 5HW7A 4FAPA 4GIVA 1D7HA 5HUAA 4FN2A 4W9QA 1NMVA 3KADA 1FKGA 3UI4A 3KACA 5HKGA 5J6EA 4ODPA 5B8IC 4ODOA 4J4OA 3B7XA 2FKEA 3LUOA 3RFWA 3UQIA 5DITA 3UF8A 2ZQVA 1Q6HA 5BXJA 1FKBA 3WH0A 1C9HA 1PINA 2KO7A 3O5RA 3NI6A 4DIPA 1J4IA 2MLXA 1YATA 1FJDA 2KR7A 4J4NA 1U79A 2KI3A 2IF4A 3O5PA 1F8AB 1EQ3A 3O5MA 2ZR5A 2KGJA 4TYOA 3JXVA 1HXVA 4GGQA 1ZK6A 3O5OA 2MPHA 4DROA 2PPNA 3KABA 4TW8A 2ZQSA 4DT4A 1QPLA 1FKLA 4JFJA 4DRKA 1FKTA 3KAHA 4ITZA 4ODNA 4JFLA 1TCOC 4LAWA 2VCDA 2PV1A 2Y78A 3PA7A 5HW8A 1J4HA 3JYJA 2XP5A 2ITKA 3O5IA 5HWCA 3O5EA 3VAWA 1B6CA 1A7XA 2XP4A 4JFKA 1ROUA 1ZCNA 3IHZA 1J6YA 4NNRA 3H9RB 3TC5A 1R9HA 2VN1A 2XP6A 2MLZA 2ZR6A 1QZ2A 4IQCA 2KE0A 2M1IA 3PRDA 4G50A 3UI5A 1JNSA 2XP8A 1Q1CA 4DH0A 4DRNA 2KFWA 1N1AA 3O5DA 2UZ5A 4QT3A 3UQBA 5GPGA 3O5GA 4ODLA 1FD9A 3IKDA 1JVWA 4MGVA 5HTGA 3CGNA 1NSGA 4ODMA 2MNTA 2ZR4A 4QT2A 2PPOA 1D7IA 3ODKA 4TNSA 3KAFA 4DRIA 4U85A 4DRHA 4DZ3A 4MSPA 4LAXA 1L1PA 2LKNA 3JYMA 4IPXA 5D75A 2XPBA 2D9FA 2PV3A 2F4EA 4W9OA 2XP7A 2PBCA 1FAPA 2LJ4A 2L2SA 1KT0A 4DRPA 4C02B 5DIVA 4DZ2A 1KT1A 2OFNA 4U86A 2RURA 1PBKA 2N87A 4LAYA 4O2TA 4ODQA 4ODKA 1QPFA 4BF8A 1Q6UA 3TDBA 2RUCA 3UQAA 4DRMA 2MF9A 5HT1A 3O5JA 5HW6A 4N19A 1FKRA 1FKKA 3I6CA 2M2AA 1FKSA 2PV2A 2LPVA 4JFMA 3KZ7A 5HWBA 1FKDA 4TW7A 3FAPA 4LAVA 2XP3A 1ROTA 2ZQUA
chains in the Genus database with same CATH superfamily
3CGMA 3KAIA 1BKFA 2XPAA 1T11A 1ZU8A 1JNTA 2RUQA 3WD3A 4DRQA 4KR0B 2F21A 2RUDA 1EHNA 4TW6A 1BL4A 3ALFA 4U84A 2OLHA 3KAGA 3O5LA 2P4VA 3TCZA 1HKIA 1YW5A 4DRJA 1FFQA 2B31A 4GIVA 4FN2A 4W9QA 1NMVA 3KADA 1FKGA 5J6EA 4ODPA 4ODOA 1HKMA 3B7XA 3PR9A 4Q22A 1LG1A 5DITA 4WK9A 1E6PA 2O9OA 5BXJA 1FKBA 2G41A 3WH0A 1PINA 2KO7A 3O5RA 3CH9A 4IT6A 1FJDA 1U79A 3RM8A 3EIPA 4TYOA 4URIA 3ARTA 2PPNA 4DRKA 1LQ0A 4ITZA 1GUVA 2PV1A 1ITXA 3RMEA 2DSZA 2DT2A 3WL0A 4WJXA 5JH8A 1A7XA 1WAWA 4JFKA 3BXWA 4ML4A 3IHZA 3H9RB 1R9HA 1QZ2A 4IQCA 3PRDA 4G50A 2XP8A 1N1AA 1FD9A 3WL1A 4MGVA 1NWRA 1NSGA 4QT2A 3WD0A 3KAFA 3CHDA 4DRHA 1L1PA 3JYMA 5D75A 2PV3A 1E15A 2A3EA 2PBCA 4U86A 4LAYA 2N87A 4NSBA 1Q6UA 5GPRA 5HT1A 5HW6A 1FKRA 1UR9A 2PN0A 1JCHB 4P8WA 4R0XA 1NWTA 1D6OA 4LAVA 1W9UA 3EY6A 3NTPA 2PPPA 2M08A 2DT0A 2FDMA 2FAPA 1ZL1A 1D7JA 3WIJA 1EYMA 2DG9A 3IK8A 3PRBA 4IQ2A 3MDYB 2AWGA 3OOBA 2K8IA 3RGCA 3CHFA 3GTYX 5HWBA 3O5KA 3NRKA 4Z2IA 2MLYA 3FXYA 2RSEA 1LJYA 4W9PA 1WB0A 2DSWA 1IX5A 4WKHA 3KACA 1NH6A 1Q6HA 3WKZA 1W1VA 1W9VA 4HBOA 5GQBA 2KI3A 1UR8A 3ALGA 3O5PA 2DPEA 3CZ8A 1X6LA 2KGJA 1HXVA 1CTNA 3O5OA 3B9DA 2B5UB 1FKTA 3KAHA 2IUZA 4ODNA 4MNKA 5HW8A 2O92A 4IT4A 3O5EA 3ARXA 2A3BA 1ROUA 1ZCNA 4NNRA 4NZCA 1HKJA 2VN1A 2XP6A 2ZR6A 3AS1A 2KE0A 2M1IA 1Q1CA 4DH0A 2KFWA 4L3NA 3O5GA 1XRVA 3CGNA 4MNLA 2MNTA 2ZR4A 4HBEA 1W1PA 4DRIA 4Z2KA 1TFVA 2XPBA 2D9FA 1FAPA 2L2SA 1KT0A 4C02B 4DZ2A 4ZPTR 1X6NA 2OFNA 1HJVA 3CHEA 1HJWA 1PBKA 4BF8A 4DRMA 2MF9A 2A3CA 1ZBWA 1FKKA 1LL6A 4DWSD 1E6NA 2WM0A 1FKSA 1KFWA 4Z2GA 2LPVA 3ARQA 4HARA 4QZVB 4TW7A 3FAPA 3WQVA 2DSVA 1GPFA 2ZQTA 1M5YA 1HJXA 1P5QA 1FKJA 1ZBVA 3O5QA 1W1TA 3KCEA 3GPKA 1Q6IA 3UI6A 1J4RA 2RQSA 2XP9A 1E6RA 5DF0A 4Z2LA 2LGOA 1ZBKA 2DSUA 5I98A 3RM9A 1LL7A 1NWSA 4MAVA 1FKIA 1NMWA 3AS2A 4TX0A 4JYSA 3G6LA 3WQWA 1F40A 3O5FA 2DG4A 1H0GA 3B9AA 4P8VA 5HKGA 5B8IC 4J4OA 2A3AA 1EIBA 2FKEA 3LUOA 2QF8A 3UQIA 3UF8A 1OGBA 1J4IA 4XAKA 1YATA 4J4NA 4MNMA 2IF4A 1F8AB 1OWQA 3WD2A 2MPHA 3QOKA 3KABA 4P8XA 5DEZA 5DO2A 4DT4A 1QPLA 2PI6A 2Y78A 1J4HA 2DT1A 2ESCA 3ARVA 4ZS6A 2WLZA 5HWCA 4AY1A 3PRAA 1B6CA 2YBTA 1J6YA 4W5UA 1XHGA 3TC5A 3WD4A 2WLYA 3O5DA 2UZ5A 4Z2JA 3ARZA 3UQBA 4P8UA 2WK2A 1JVWA 5HTGA 4ZPVR 3AS3A 4TNSA 4WKAA 4LAXA 4IPXA 2YBUA 4WKFA 4DRPA 5DIVA 1KT1A 4O2TA 2DT3A 4ODQA 4ODKA 4DWSB 1QPFA 2RUCA 1ZBCA 3B8SA 3O5JA 4N19A 2M2AA 2EULA 4Q7NA 2PV2A 1NWUA 4WIWA 3ARYA 1JNEA 1E6ZA 3G6MA 3AROA 5HBFA 4MNJA 1VF8A 1W26A 2ETNA 1HKKA 1FKHA 4L72B 2DG3A 4ODRA 4MTVA 1H0IA 4DRNA 2F23A 4G2PA 3AS0A 1FFRA 4PTMA 1Y0OA 1RD6A 3W4RA 2F2DA 1LG2A 1FKFA 3GU0A 5DIUA 1EQ3A 3IKGA 2G8ZA 4QIBA 3BMBA 1EDQA 4JFIA 2JZVA 2Q5AA 1E44A 1O6IA 5HW7A 4FAPA 1D7HA 5HUAA 4Z2HA 3UI4A 3AQUA 3RFWA 3ARUA 2ZQVA 3B9EA 4MPKA 1C9HA 3NI6A 1ZB5A 1SR0A 1W1YA 3CHCA 2MLXA 4DIPA 2KR7A 1K9TA 3O5MA 2ZR5A 1OGGA 3JXVA 4GGQA 1ZK6A 4DWSC 4DROA 4TW8A 4DWSA 2ZQSA 1W9PA 1FKLA 4JFJA 4LGXA 4JFLA 1TCOC 4LAWA 2VCDA 1SYTA 4ZPWR 1E9LA 3PA7A 3JYJA 2XP5A 1WNOA 2ITKA 3O5IA 3ARSA 3VAWA 3ARRA 2XP4A 4S3KA 3ARWA 2MLZA 4UDMA 4KQZA 3UI5A 3RM4A 1JNSA 4QT3A 5GPGA 4ODLA 2AOSA 3IKDA 4ODMA 2PPOA 1D7IA 1JNDA 3ODKA 4U85A 4DZ3A 4MSPA 2LKNA 3OA5A 2F4EA 3ARPA 4W9OA 3WD1A 2XP7A 1GRJA 2LJ4A 2RURA 3TDBA 3UQAA 3I6CA 4S3JA 4R5EA 4JFMA 3FY1A 3KZ7A 1FKDA 1D2KA 2XP3A 1LL4A 1ROTA 2ZQUA 1GOIA
chains in the Genus database with same CATH topology
3CGMA 3KAIA 1BKFA 2XPAA 1T11A 1ZU8A 1JNTA 2RUQA 3WD3A 4DRQA 4KR0B 2F21A 2RUDA 1EHNA 4TW6A 1BL4A 3ALFA 4U84A 2OLHA 3KAGA 3O5LA 3TCZA 1HKIA 1YW5A 4DRJA 1FFQA 2B31A 4GIVA 4FN2A 4W9QA 1NMVA 3KADA 1FKGA 5J6EA 4ODPA 4ODOA 1HKMA 3B7XA 3PR9A 4Q22A 1LG1A 5DITA 4WK9A 1E6PA 2O9OA 5BXJA 1FKBA 2G41A 3WH0A 1PINA 2KO7A 3O5RA 3CH9A 4IT6A 1FJDA 1U79A 3RM8A 4TYOA 4URIA 3ARTA 2PPNA 4DRKA 1LQ0A 4ITZA 1GUVA 2PV1A 1ITXA 3RMEA 2DSZA 2DT2A 3WL0A 4WJXA 5JH8A 1A7XA 1WAWA 4JFKA 3BXWA 4ML4A 3IHZA 3H9RB 1R9HA 1QZ2A 4IQCA 3PRDA 4G50A 2XP8A 1N1AA 1FD9A 3WL1A 4MGVA 1NWRA 1NSGA 4QT2A 3WD0A 3KAFA 3CHDA 4DRHA 1L1PA 3JYMA 5D75A 2PV3A 1E15A 2A3EA 2PBCA 4U86A 4LAYA 2N87A 4NSBA 1Q6UA 5GPRA 5HT1A 5HW6A 1FKRA 1UR9A 4P8WA 4R0XA 1NWTA 1D6OA 4LAVA 1W9UA 3EY6A 3NTPA 2PPPA 2M08A 2DT0A 2FDMA 2FAPA 1ZL1A 1D7JA 3WIJA 1EYMA 2DG9A 3IK8A 3PRBA 4IQ2A 3MDYB 2AWGA 3OOBA 2K8IA 3RGCA 3CHFA 5HWBA 3O5KA 3NRKA 4Z2IA 2MLYA 3FXYA 2RSEA 1LJYA 4W9PA 1WB0A 2DSWA 1IX5A 4WKHA 3KACA 1NH6A 1Q6HA 3WKZA 1W1VA 1W9VA 4HBOA 5GQBA 2KI3A 1UR8A 3ALGA 3O5PA 2DPEA 3CZ8A 1X6LA 2KGJA 1HXVA 1CTNA 3O5OA 3B9DA 1FKTA 3KAHA 2IUZA 4ODNA 4MNKA 5HW8A 2O92A 4IT4A 3O5EA 3ARXA 2A3BA 1ROUA 1ZCNA 4NNRA 4NZCA 1HKJA 2VN1A 2XP6A 2ZR6A 3AS1A 2KE0A 2M1IA 1Q1CA 4DH0A 2KFWA 4L3NA 3O5GA 1XRVA 3CGNA 4MNLA 2MNTA 2ZR4A 4HBEA 1W1PA 4DRIA 4Z2KA 1TFVA 2XPBA 2D9FA 1FAPA 2L2SA 1KT0A 4C02B 4DZ2A 4ZPTR 1X6NA 2OFNA 1HJVA 3CHEA 1HJWA 1PBKA 4BF8A 4DRMA 2MF9A 2A3CA 1ZBWA 1FKKA 1LL6A 4DWSD 1E6NA 2WM0A 1FKSA 1KFWA 4Z2GA 2LPVA 3ARQA 4HARA 4QZVB 4TW7A 3FAPA 3WQVA 2DSVA 1GPFA 2ZQTA 1M5YA 1HJXA 1P5QA 1FKJA 1ZBVA 3O5QA 1W1TA 3KCEA 3GPKA 1Q6IA 3UI6A 1J4RA 2RQSA 2XP9A 1E6RA 5DF0A 4Z2LA 2LGOA 1ZBKA 2DSUA 5I98A 3RM9A 1LL7A 1NWSA 4MAVA 1FKIA 1NMWA 3AS2A 4TX0A 4JYSA 3G6LA 3WQWA 1F40A 3O5FA 2DG4A 1H0GA 3B9AA 4P8VA 5HKGA 5B8IC 4J4OA 2A3AA 1EIBA 2FKEA 3LUOA 2QF8A 3UQIA 3UF8A 1OGBA 1J4IA 4XAKA 1YATA 4J4NA 4MNMA 2IF4A 1F8AB 1OWQA 3WD2A 2MPHA 3QOKA 3KABA 4P8XA 5DEZA 5DO2A 4DT4A 1QPLA 2PI6A 2Y78A 1J4HA 2DT1A 2ESCA 3ARVA 4ZS6A 2WLZA 5HWCA 4AY1A 3PRAA 1B6CA 2YBTA 1J6YA 4W5UA 1XHGA 3TC5A 3WD4A 2WLYA 3O5DA 2UZ5A 4Z2JA 3ARZA 3UQBA 4P8UA 2WK2A 1JVWA 5HTGA 4ZPVR 3AS3A 4TNSA 4WKAA 4LAXA 4IPXA 2YBUA 4WKFA 4DRPA 5DIVA 1KT1A 4O2TA 2DT3A 4ODQA 4ODKA 4DWSB 1QPFA 2RUCA 1ZBCA 3B8SA 3O5JA 4N19A 2M2AA 4Q7NA 2PV2A 1NWUA 4WIWA 3ARYA 1JNEA 1E6ZA 3G6MA 3AROA 5HBFA 4MNJA 1VF8A 1W26A 1HKKA 1FKHA 4L72B 2DG3A 4ODRA 4MTVA 1H0IA 4DRNA 4G2PA 3AS0A 1FFRA 4PTMA 1Y0OA 1RD6A 3W4RA 2F2DA 1LG2A 1FKFA 5DIUA 1EQ3A 3IKGA 2G8ZA 4QIBA 1EDQA 4JFIA 2JZVA 2Q5AA 1O6IA 5HW7A 4FAPA 1D7HA 5HUAA 4Z2HA 3UI4A 3AQUA 3RFWA 3ARUA 2ZQVA 3B9EA 4MPKA 1C9HA 3NI6A 1ZB5A 1SR0A 1W1YA 3CHCA 2MLXA 4DIPA 2KR7A 1K9TA 3O5MA 2ZR5A 1OGGA 3JXVA 4GGQA 1ZK6A 4DWSC 4DROA 4TW8A 4DWSA 2ZQSA 1W9PA 1FKLA 4JFJA 4LGXA 4JFLA 1TCOC 4LAWA 2VCDA 1SYTA 4ZPWR 1E9LA 3PA7A 3JYJA 2XP5A 1WNOA 2ITKA 3O5IA 3ARSA 3VAWA 3ARRA 2XP4A 4S3KA 3ARWA 2MLZA 4KQZA 3UI5A 3RM4A 1JNSA 4QT3A 5GPGA 4ODLA 2AOSA 3IKDA 4ODMA 2PPOA 1D7IA 1JNDA 3ODKA 4U85A 4DZ3A 4MSPA 2LKNA 3OA5A 2F4EA 3ARPA 4W9OA 3WD1A 2XP7A 2LJ4A 2RURA 3TDBA 3UQAA 3I6CA 4S3JA 4R5EA 4JFMA 3FY1A 3KZ7A 1FKDA 1D2KA 2XP3A 1LL4A 1ROTA 2ZQUA 1GOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R0X A;  2ZQT A;  1M5Y A;  1D6O A;  3CGM A;  3KAI A;  1W26 A;  1BKF A;  1P5Q A;  1FKJ A;  3EY6 A;  2XPA A;  2PPP A;  2M08 A;  1FKH A;  3NTP A;  1T11 A;  3O5Q A;  3KCE A;  2DG3 A;  4ODR A;  3GPK A;  1JNT A;  1Q6I A;  2RUQ A;  2FAP A;  1J4R A;  3UI6 A;  2RQS A;  4DRQ A;  1D7J A;  2XP9 A;  4G2P A;  2F21 A;  1EYM A;  2DG9 A;  2RUD A;  3IK8 A;  2LGO A;  3PRB A;  4IQ2 A;  4TW6 A;  3MDY B;  1BL4 A;  2AWG A;  3OOB A;  5I98 A;  1Y0O A;  2K8I A;  2F2D A;  3RGC A;  1FKF A;  1FKI A;  4U84 A;  3O5K A;  5DIU A;  1NMW A;  3IKG A;  3KAG A;  3NRK A;  4TX0 A;  4JYS A;  2MLY A;  4QIB A;  3O5L A;  4JFI A;  2RSE A;  1F40 A;  2JZV A;  2Q5A A;  3TCZ A;  3O5F A;  1YW5 A;  2DG4 A;  4DRJ A;  4W9P A;  5HW7 A;  4FAP A;  4GIV A;  1D7H A;  5HUA A;  4FN2 A;  4W9Q A;  1NMV A;  3KAD A;  1FKG A;  3UI4 A;  3KAC A;  5HKG A;  5J6E A;  4ODP A;  5B8I C;  4ODO A;  4J4O A;  3B7X A;  2FKE A;  3LUO A;  3RFW A;  3UQI A;  5DIT A;  3UF8 A;  2ZQV A;  1Q6H A;  5BXJ A;  1FKB A;  3WH0 A;  1C9H A;  1PIN A;  2KO7 A;  3O5R A;  3NI6 A;  4DIP A;  1J4I A;  2MLX A;  1YAT A;  1FJD A;  2KR7 A;  4J4N A;  1U79 A;  2KI3 A;  2IF4 A;  3O5P A;  1F8A B;  1EQ3 A;  3O5M A;  2ZR5 A;  2KGJ A;  4TYO A;  3JXV A;  1HXV A;  4GGQ A;  1ZK6 A;  3O5O A;  2MPH A;  4DRO A;  2PPN A;  3KAB A;  4TW8 A;  2ZQS A;  4DT4 A;  1QPL A;  1FKL A;  4JFJ A;  4DRK A;  1FKT A;  3KAH A;  4ITZ A;  4ODN A;  4JFL A;  1TCO C;  4LAW A;  2VCD A;  2PV1 A;  2Y78 A;  3PA7 A;  5HW8 A;  1J4H A;  3JYJ A;  2XP5 A;  2ITK A;  3O5I A;  5HWC A;  3O5E A;  3VAW A;  1B6C A;  1A7X A;  2XP4 A;  4JFK A;  1ROU A;  1ZCN A;  3IHZ A;  1J6Y A;  4NNR A;  3H9R B;  3TC5 A;  1R9H A;  2VN1 A;  2XP6 A;  2MLZ A;  2ZR6 A;  1QZ2 A;  4IQC A;  2KE0 A;  2M1I A;  3PRD A;  4G50 A;  3UI5 A;  1JNS A;  2XP8 A;  1Q1C A;  4DH0 A;  4DRN A;  2KFW A;  1N1A A;  3O5D A;  2UZ5 A;  4QT3 A;  3UQB A;  5GPG A;  3O5G A;  4ODL A;  1FD9 A;  3IKD A;  1JVW A;  4MGV A;  5HTG A;  3CGN A;  1NSG A;  4ODM A;  2MNT A;  2ZR4 A;  4QT2 A;  2PPO A;  1D7I A;  3ODK A;  4TNS A;  3KAF A;  4DRI A;  4U85 A;  4DRH A;  4DZ3 A;  4MSP A;  4LAX A;  1L1P A;  2LKN A;  3JYM A;  4IPX A;  5D75 A;  2XPB A;  2D9F A;  2PV3 A;  2F4E A;  4W9O A;  2XP7 A;  2PBC A;  1FAP A;  2LJ4 A;  2L2S A;  1KT0 A;  4DRP A;  4C02 B;  5DIV A;  4DZ2 A;  1KT1 A;  2OFN A;  4U86 A;  2RUR A;  1PBK A;  2N87 A;  4LAY A;  4O2T A;  4ODQ A;  4ODK A;  1QPF A;  4BF8 A;  1Q6U A;  3TDB A;  2RUC A;  3UQA A;  4DRM A;  2MF9 A;  5HT1 A;  3O5J A;  5HW6 A;  4N19 A;  1FKR A;  1FKK A;  3I6C A;  2M2A A;  1FKS A;  2PV2 A;  2LPV A;  4JFM A;  3KZ7 A;  5HWB A;  1FKD A;  4TW7 A;  3FAP A;  4LAV A;  2XP3 A;  1ROT A;  2ZQU A; 
#chains in the Genus database with same CATH topology
 3CGM A;  3KAI A;  1BKF A;  2XPA A;  1T11 A;  1ZU8 A;  1JNT A;  2RUQ A;  3WD3 A;  4DRQ A;  4KR0 B;  2F21 A;  2RUD A;  1EHN A;  4TW6 A;  1BL4 A;  3ALF A;  4U84 A;  2OLH A;  3KAG A;  3O5L A;  2P4V A;  3TCZ A;  1HKI A;  1YW5 A;  4DRJ A;  1FFQ A;  2B31 A;  4GIV A;  4FN2 A;  4W9Q A;  1NMV A;  3KAD A;  1FKG A;  5J6E A;  4ODP A;  4ODO A;  1HKM A;  3B7X A;  3PR9 A;  4Q22 A;  1LG1 A;  5DIT A;  4WK9 A;  1E6P A;  2O9O A;  5BXJ A;  1FKB A;  2G41 A;  3WH0 A;  1PIN A;  2KO7 A;  3O5R A;  3CH9 A;  4IT6 A;  1FJD A;  1U79 A;  3RM8 A;  3EIP A;  4TYO A;  4URI A;  3ART A;  2PPN A;  4DRK A;  1LQ0 A;  4ITZ A;  1GUV A;  2PV1 A;  1ITX A;  3RME A;  2DSZ A;  2DT2 A;  3WL0 A;  4WJX A;  5JH8 A;  1A7X A;  1WAW A;  4JFK A;  3BXW A;  4ML4 A;  3IHZ A;  3H9R B;  1R9H A;  1QZ2 A;  4IQC A;  3PRD A;  4G50 A;  2XP8 A;  1N1A A;  1FD9 A;  3WL1 A;  4MGV A;  1NWR A;  1NSG A;  4QT2 A;  3WD0 A;  3KAF A;  3CHD A;  4DRH A;  1L1P A;  3JYM A;  5D75 A;  2PV3 A;  1E15 A;  2A3E A;  2PBC A;  4U86 A;  4LAY A;  2N87 A;  4NSB A;  1Q6U A;  5GPR A;  5HT1 A;  5HW6 A;  1FKR A;  1UR9 A;  2PN0 A;  1JCH B;  4P8W A;  4R0X A;  1NWT A;  1D6O A;  4LAV A;  1W9U A;  3EY6 A;  3NTP A;  2PPP A;  2M08 A;  2DT0 A;  2FDM A;  2FAP A;  1ZL1 A;  1D7J A;  3WIJ A;  1EYM A;  2DG9 A;  3IK8 A;  3PRB A;  4IQ2 A;  3MDY B;  2AWG A;  3OOB A;  2K8I A;  3RGC A;  3CHF A;  3GTY X;  5HWB A;  3O5K A;  3NRK A;  4Z2I A;  2MLY A;  3FXY A;  2RSE A;  1LJY A;  4W9P A;  1WB0 A;  2DSW A;  1IX5 A;  4WKH A;  3KAC A;  1NH6 A;  1Q6H A;  3WKZ A;  1W1V A;  1W9V A;  4HBO A;  5GQB A;  2KI3 A;  1UR8 A;  3ALG A;  3O5P A;  2DPE A;  3CZ8 A;  1X6L A;  2KGJ A;  1HXV A;  1CTN A;  3O5O A;  3B9D A;  2B5U B;  1FKT A;  3KAH A;  2IUZ A;  4ODN A;  4MNK A;  5HW8 A;  2O92 A;  4IT4 A;  3O5E A;  3ARX A;  2A3B A;  1ROU A;  1ZCN A;  4NNR A;  4NZC A;  1HKJ A;  2VN1 A;  2XP6 A;  2ZR6 A;  3AS1 A;  2KE0 A;  2M1I A;  1Q1C A;  4DH0 A;  2KFW A;  4L3N A;  3O5G A;  1XRV A;  3CGN A;  4MNL A;  2MNT A;  2ZR4 A;  4HBE A;  1W1P A;  4DRI A;  4Z2K A;  1TFV A;  2XPB A;  2D9F A;  1FAP A;  2L2S A;  1KT0 A;  4C02 B;  4DZ2 A;  4ZPT R;  1X6N A;  2OFN A;  1HJV A;  3CHE A;  1HJW A;  1PBK A;  4BF8 A;  4DRM A;  2MF9 A;  2A3C A;  1ZBW A;  1FKK A;  1LL6 A;  4DWS D;  1E6N A;  2WM0 A;  1FKS A;  1KFW A;  4Z2G A;  2LPV A;  3ARQ A;  4HAR A;  4QZV B;  4TW7 A;  3FAP A;  3WQV A;  2DSV A;  1GPF A;  2ZQT A;  1M5Y A;  1HJX A;  1P5Q A;  1FKJ A;  1ZBV A;  3O5Q A;  1W1T A;  3KCE A;  3GPK A;  1Q6I A;  3UI6 A;  1J4R A;  2RQS A;  2XP9 A;  1E6R A;  5DF0 A;  4Z2L A;  2LGO A;  1ZBK A;  2DSU A;  5I98 A;  3RM9 A;  1LL7 A;  1NWS A;  4MAV A;  1FKI A;  1NMW A;  3AS2 A;  4TX0 A;  4JYS A;  3G6L A;  3WQW A;  1F40 A;  3O5F A;  2DG4 A;  1H0G A;  3B9A A;  4P8V A;  5HKG A;  5B8I C;  4J4O A;  2A3A A;  1EIB A;  2FKE A;  3LUO A;  2QF8 A;  3UQI A;  3UF8 A;  1OGB A;  1J4I A;  4XAK A;  1YAT A;  4J4N A;  4MNM A;  2IF4 A;  1F8A B;  1OWQ A;  3WD2 A;  2MPH A;  3QOK A;  3KAB A;  4P8X A;  5DEZ A;  5DO2 A;  4DT4 A;  1QPL A;  2PI6 A;  2Y78 A;  1J4H A;  2DT1 A;  2ESC A;  3ARV A;  4ZS6 A;  2WLZ A;  5HWC A;  4AY1 A;  3PRA A;  1B6C A;  2YBT A;  1J6Y A;  4W5U A;  1XHG A;  3TC5 A;  3WD4 A;  2WLY A;  3O5D A;  2UZ5 A;  4Z2J A;  3ARZ A;  3UQB A;  4P8U A;  2WK2 A;  1JVW A;  5HTG A;  4ZPV R;  3AS3 A;  4TNS A;  4WKA A;  4LAX A;  4IPX A;  2YBU A;  4WKF A;  4DRP A;  5DIV A;  1KT1 A;  4O2T A;  2DT3 A;  4ODQ A;  4ODK A;  4DWS B;  1QPF A;  2RUC A;  1ZBC A;  3B8S A;  3O5J A;  4N19 A;  2M2A A;  2EUL A;  4Q7N A;  2PV2 A;  1NWU A;  4WIW A;  3ARY A;  1JNE A;  1E6Z A;  3G6M A;  3ARO A;  5HBF A;  4MNJ A;  1VF8 A;  1W26 A;  2ETN A;  1HKK A;  1FKH A;  4L72 B;  2DG3 A;  4ODR A;  4MTV A;  1H0I A;  4DRN A;  2F23 A;  4G2P A;  3AS0 A;  1FFR A;  4PTM A;  1Y0O A;  1RD6 A;  3W4R A;  2F2D A;  1LG2 A;  1FKF A;  3GU0 A;  5DIU A;  1EQ3 A;  3IKG A;  2G8Z A;  4QIB A;  3BMB A;  1EDQ A;  4JFI A;  2JZV A;  2Q5A A;  1E44 A;  1O6I A;  5HW7 A;  4FAP A;  1D7H A;  5HUA A;  4Z2H A;  3UI4 A;  3AQU A;  3RFW A;  3ARU A;  2ZQV A;  3B9E A;  4MPK A;  1C9H A;  3NI6 A;  1ZB5 A;  1SR0 A;  1W1Y A;  3CHC A;  2MLX A;  4DIP A;  2KR7 A;  1K9T A;  3O5M A;  2ZR5 A;  1OGG A;  3JXV A;  4GGQ A;  1ZK6 A;  4DWS C;  4DRO A;  4TW8 A;  4DWS A;  2ZQS A;  1W9P A;  1FKL A;  4JFJ A;  4LGX A;  4JFL A;  1TCO C;  4LAW A;  2VCD A;  1SYT A;  4ZPW R;  1E9L A;  3PA7 A;  3JYJ A;  2XP5 A;  1WNO A;  2ITK A;  3O5I A;  3ARS A;  3VAW A;  3ARR A;  2XP4 A;  4S3K A;  3ARW A;  2MLZ A;  4UDM A;  4KQZ A;  3UI5 A;  3RM4 A;  1JNS A;  4QT3 A;  5GPG A;  4ODL A;  2AOS A;  3IKD A;  4ODM A;  2PPO A;  1D7I A;  1JND A;  3ODK A;  4U85 A;  4DZ3 A;  4MSP A;  2LKN A;  3OA5 A;  2F4E A;  3ARP A;  4W9O A;  3WD1 A;  2XP7 A;  1GRJ A;  2LJ4 A;  2RUR A;  3TDB A;  3UQA A;  3I6C A;  4S3J A;  4R5E A;  4JFM A;  3FY1 A;  3KZ7 A;  1FKD A;  1D2K A;  2XP3 A;  1LL4 A;  1ROT A;  2ZQU A;  1GOI A; 
#chains in the Genus database with same CATH homology
 3CGM A;  3KAI A;  1BKF A;  2XPA A;  1T11 A;  1ZU8 A;  1JNT A;  2RUQ A;  3WD3 A;  4DRQ A;  4KR0 B;  2F21 A;  2RUD A;  1EHN A;  4TW6 A;  1BL4 A;  3ALF A;  4U84 A;  2OLH A;  3KAG A;  3O5L A;  3TCZ A;  1HKI A;  1YW5 A;  4DRJ A;  1FFQ A;  2B31 A;  4GIV A;  4FN2 A;  4W9Q A;  1NMV A;  3KAD A;  1FKG A;  5J6E A;  4ODP A;  4ODO A;  1HKM A;  3B7X A;  3PR9 A;  4Q22 A;  1LG1 A;  5DIT A;  4WK9 A;  1E6P A;  2O9O A;  5BXJ A;  1FKB A;  2G41 A;  3WH0 A;  1PIN A;  2KO7 A;  3O5R A;  3CH9 A;  4IT6 A;  1FJD A;  1U79 A;  3RM8 A;  4TYO A;  4URI A;  3ART A;  2PPN A;  4DRK A;  1LQ0 A;  4ITZ A;  1GUV A;  2PV1 A;  1ITX A;  3RME A;  2DSZ A;  2DT2 A;  3WL0 A;  4WJX A;  5JH8 A;  1A7X A;  1WAW A;  4JFK A;  3BXW A;  4ML4 A;  3IHZ A;  3H9R B;  1R9H A;  1QZ2 A;  4IQC A;  3PRD A;  4G50 A;  2XP8 A;  1N1A A;  1FD9 A;  3WL1 A;  4MGV A;  1NWR A;  1NSG A;  4QT2 A;  3WD0 A;  3KAF A;  3CHD A;  4DRH A;  1L1P A;  3JYM A;  5D75 A;  2PV3 A;  1E15 A;  2A3E A;  2PBC A;  4U86 A;  4LAY A;  2N87 A;  4NSB A;  1Q6U A;  5GPR A;  5HT1 A;  5HW6 A;  1FKR A;  1UR9 A;  4P8W A;  4R0X A;  1NWT A;  1D6O A;  4LAV A;  1W9U A;  3EY6 A;  3NTP A;  2PPP A;  2M08 A;  2DT0 A;  2FDM A;  2FAP A;  1ZL1 A;  1D7J A;  3WIJ A;  1EYM A;  2DG9 A;  3IK8 A;  3PRB A;  4IQ2 A;  3MDY B;  2AWG A;  3OOB A;  2K8I A;  3RGC A;  3CHF A;  5HWB A;  3O5K A;  3NRK A;  4Z2I A;  2MLY A;  3FXY A;  2RSE A;  1LJY A;  4W9P A;  1WB0 A;  2DSW A;  1IX5 A;  4WKH A;  3KAC A;  1NH6 A;  1Q6H A;  3WKZ A;  1W1V A;  1W9V A;  4HBO A;  5GQB A;  2KI3 A;  1UR8 A;  3ALG A;  3O5P A;  2DPE A;  3CZ8 A;  1X6L A;  2KGJ A;  1HXV A;  1CTN A;  3O5O A;  3B9D A;  1FKT A;  3KAH A;  2IUZ A;  4ODN A;  4MNK A;  5HW8 A;  2O92 A;  4IT4 A;  3O5E A;  3ARX A;  2A3B A;  1ROU A;  1ZCN A;  4NNR A;  4NZC A;  1HKJ A;  2VN1 A;  2XP6 A;  2ZR6 A;  3AS1 A;  2KE0 A;  2M1I A;  1Q1C A;  4DH0 A;  2KFW A;  4L3N A;  3O5G A;  1XRV A;  3CGN A;  4MNL A;  2MNT A;  2ZR4 A;  4HBE A;  1W1P A;  4DRI A;  4Z2K A;  1TFV A;  2XPB A;  2D9F A;  1FAP A;  2L2S A;  1KT0 A;  4C02 B;  4DZ2 A;  4ZPT R;  1X6N A;  2OFN A;  1HJV A;  3CHE A;  1HJW A;  1PBK A;  4BF8 A;  4DRM A;  2MF9 A;  2A3C A;  1ZBW A;  1FKK A;  1LL6 A;  4DWS D;  1E6N A;  2WM0 A;  1FKS A;  1KFW A;  4Z2G A;  2LPV A;  3ARQ A;  4HAR A;  4QZV B;  4TW7 A;  3FAP A;  3WQV A;  2DSV A;  1GPF A;  2ZQT A;  1M5Y A;  1HJX A;  1P5Q A;  1FKJ A;  1ZBV A;  3O5Q A;  1W1T A;  3KCE A;  3GPK A;  1Q6I A;  3UI6 A;  1J4R A;  2RQS A;  2XP9 A;  1E6R A;  5DF0 A;  4Z2L A;  2LGO A;  1ZBK A;  2DSU A;  5I98 A;  3RM9 A;  1LL7 A;  1NWS A;  4MAV A;  1FKI A;  1NMW A;  3AS2 A;  4TX0 A;  4JYS A;  3G6L A;  3WQW A;  1F40 A;  3O5F A;  2DG4 A;  1H0G A;  3B9A A;  4P8V A;  5HKG A;  5B8I C;  4J4O A;  2A3A A;  1EIB A;  2FKE A;  3LUO A;  2QF8 A;  3UQI A;  3UF8 A;  1OGB A;  1J4I A;  4XAK A;  1YAT A;  4J4N A;  4MNM A;  2IF4 A;  1F8A B;  1OWQ A;  3WD2 A;  2MPH A;  3QOK A;  3KAB A;  4P8X A;  5DEZ A;  5DO2 A;  4DT4 A;  1QPL A;  2PI6 A;  2Y78 A;  1J4H A;  2DT1 A;  2ESC A;  3ARV A;  4ZS6 A;  2WLZ A;  5HWC A;  4AY1 A;  3PRA A;  1B6C A;  2YBT A;  1J6Y A;  4W5U A;  1XHG A;  3TC5 A;  3WD4 A;  2WLY A;  3O5D A;  2UZ5 A;  4Z2J A;  3ARZ A;  3UQB A;  4P8U A;  2WK2 A;  1JVW A;  5HTG A;  4ZPV R;  3AS3 A;  4TNS A;  4WKA A;  4LAX A;  4IPX A;  2YBU A;  4WKF A;  4DRP A;  5DIV A;  1KT1 A;  4O2T A;  2DT3 A;  4ODQ A;  4ODK A;  4DWS B;  1QPF A;  2RUC A;  1ZBC A;  3B8S A;  3O5J A;  4N19 A;  2M2A A;  4Q7N A;  2PV2 A;  1NWU A;  4WIW A;  3ARY A;  1JNE A;  1E6Z A;  3G6M A;  3ARO A;  5HBF A;  4MNJ A;  1VF8 A;  1W26 A;  1HKK A;  1FKH A;  4L72 B;  2DG3 A;  4ODR A;  4MTV A;  1H0I A;  4DRN A;  4G2P A;  3AS0 A;  1FFR A;  4PTM A;  1Y0O A;  1RD6 A;  3W4R A;  2F2D A;  1LG2 A;  1FKF A;  5DIU A;  1EQ3 A;  3IKG A;  2G8Z A;  4QIB A;  1EDQ A;  4JFI A;  2JZV A;  2Q5A A;  1O6I A;  5HW7 A;  4FAP A;  1D7H A;  5HUA A;  4Z2H A;  3UI4 A;  3AQU A;  3RFW A;  3ARU A;  2ZQV A;  3B9E A;  4MPK A;  1C9H A;  3NI6 A;  1ZB5 A;  1SR0 A;  1W1Y A;  3CHC A;  2MLX A;  4DIP A;  2KR7 A;  1K9T A;  3O5M A;  2ZR5 A;  1OGG A;  3JXV A;  4GGQ A;  1ZK6 A;  4DWS C;  4DRO A;  4TW8 A;  4DWS A;  2ZQS A;  1W9P A;  1FKL A;  4JFJ A;  4LGX A;  4JFL A;  1TCO C;  4LAW A;  2VCD A;  1SYT A;  4ZPW R;  1E9L A;  3PA7 A;  3JYJ A;  2XP5 A;  1WNO A;  2ITK A;  3O5I A;  3ARS A;  3VAW A;  3ARR A;  2XP4 A;  4S3K A;  3ARW A;  2MLZ A;  4KQZ A;  3UI5 A;  3RM4 A;  1JNS A;  4QT3 A;  5GPG A;  4ODL A;  2AOS A;  3IKD A;  4ODM A;  2PPO A;  1D7I A;  1JND A;  3ODK A;  4U85 A;  4DZ3 A;  4MSP A;  2LKN A;  3OA5 A;  2F4E A;  3ARP A;  4W9O A;  3WD1 A;  2XP7 A;  2LJ4 A;  2RUR A;  3TDB A;  3UQA A;  3I6C A;  4S3J A;  4R5E A;  4JFM A;  3FY1 A;  3KZ7 A;  1FKD A;  1D2K A;  2XP3 A;  1LL4 A;  1ROT A;  2ZQU A;  1GOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...