5I98A

Structure of apo fkbp12(p104g) from c. albicans
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPGIIGPNETLVFEVELLGVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
molecule tags Isomerase
molecule keywords FK506-binding protein 1
total genus 26
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5i98A00
3CGNA 2ZR4A 3KABA 4J4OA 4DZ3A 1D7JA 4TYOA 4ODOA 1PBKA 3JXVA 4QT3A 4O2TA 2LJ4A 2LPVA 5DIVA 4J4NA 2ZQUA 3UF8A 4GIVA 3VAWA 3O5RA 4G2PA 3UI4A 3IKGA 3TCZA 4MGVA 1FKKA 4IPXA 4TW6A 4JFIA 1FKFA 3WH0A 4N19A 3RFWA 1FKGA 3O5OA 2PBCA 4IQCA 4ITZA 4JFKA 1A7XA 1FKTA 1JNTA 3UI6A 1Y0OA 4U86A 4DRKA 1Q6UA 4DRQA 1FKJA 2KO7A 4TX0A 3JYMA 2XPBA 3O5LA 1W26A 3O5MA 2IF4A 2ZQSA 4ODRA 5HWBA 5I98A 2DG4A 4JFJA 2OFNA 4LAVA 4ODMA 5D75A 4DT4A 2XP9A 4DRJA 4GGQA 1F8AB 1EQ3A 2FAPA 3GPKA 3IKDA 4TW8A 3FAPA 3IHZA 4DRMA 1L1PA 1D7HA 3I6CA 2PV1A 2RSEA 5HUAA 4LAXA 1B6CA 1ZK6A 2M2AA 2RUCA 2ZR5A 4ODKA 3TC5A 2VCDA 1QZ2A 3EY6A 4DRPA 2UZ5A 2D9FA 5BXJA 3RGCA 4DRNA 1YW5A 1FKIA 2XP5A 2KGJA 3O5KA 3O5JA 2KE0A 3KAHA 3NRKA 3O5PA 3B7XA 1J6YA 2L2SA 4DRIA 4DRHA 1NMWA 2MLYA 5HTGA 1P5QA 2F21A 4TNSA 1ZCNA 1C9HA 1NSGA 2Q5AA 3KAIA 2ITKA 3UQIA 1QPLA 4DZ2A 2KI3A 1Q6IA 1J4IA 2RUDA 3IK8A 4DIPA 4W9PA 4DH0A 1BKFA 1FKHA 3KAFA 1KT0A 2ZQVA 1M5YA 5HWCA 5HT1A 2ZR6A 3O5IA 3O5DA 4BF8A 5HKGA 1FKLA 4NNRA 2DG9A 1BL4A 2M1IA 2XP8A 1FJDA 2ZQTA 2F4EA 1J4RA 1PINA 3TDBA 2PV2A 3JYJA 1NMVA 3KACA 1ROUA 4IQ2A 3UI5A 4G50A 1TCOC 2LKNA 3ODKA 3UQAA 1KT1A 2AWGA 5HW7A 1D6OA 2M08A 2RURA 3MDYB 3NI6A 4MSPA 4JYSA 3H9RB 4U84A 1D7IA 1U79A 4R0XA 1F40A 2PV3A 2MPHA 1Q6HA 2JZVA 4JFMA 5J6EA 1FKRA 2XPAA 4QIBA 1FKBA 2F2DA 2MF9A 4LAWA 1YATA 2KFWA 3PRBA 4W9QA 4W9OA 2VN1A 2XP6A 4FN2A 3OOBA 3KAGA 1JNSA 4ODLA 5HW6A 3NTPA 3O5EA 3O5GA 4DROA 3LUOA 5GPGA 3KCEA 1Q1CA 2RQSA 3KADA 4C02B 1FD9A 1N1AA 2DG3A 4FAPA 2Y78A 3PA7A 3O5FA 1FKSA 4U85A 2LGOA 4ODQA 2KR7A 5B8IC 4JFLA 2PPOA 2MNTA 3UQBA 5DIUA 3CGMA 4ODPA 2XP7A 2MLZA 3KZ7A 4LAYA 3O5QA 2XP3A 4TW7A 5DITA 2PPPA 4QT2A 2MLXA 1EYMA 1ROTA 1FAPA 3PRDA 1JVWA 5HW8A 2PPNA 1R9HA 2K8IA 1HXVA 1T11A 2FKEA 2XP4A 2N87A 1J4HA 4ODNA 2RUQA 1QPFA 1FKDA
chains in the Genus database with same CATH superfamily
3KABA 1WNOA 1NWUA 5DIVA 4J4NA 1KFWA 1ZBVA 3ARXA 3ARPA 3RM8A 4Z2IA 4JFKA 1GUVA 3UI6A 1Y0OA 4U86A 1FKJA 2XPBA 1W26A 3O5MA 2ZQSA 5I98A 5D75A 1F8AB 1EQ3A 1EIBA 1HKIA 2RSEA 5HUAA 4Q22A 1ZB5A 4DRPA 2UZ5A 3RGCA 2KGJA 3WD3A 3EIPA 3B7XA 2MLYA 1P5QA 2F21A 2ITKA 1QPLA 2G41A 2KI3A 4DIPA 1SR0A 2DSZA 2YBTA 2ZR6A 1NWRA 3O5IA 4WJXA 3AS2A 1JNDA 4ZPTR 2ZQTA 2F4EA 1J4RA 1ZU8A 4MNMA 3KACA 3JYJA 2F23A 1ROUA 3B9DA 3CH9A 1TCOC 2DT1A 3ODKA 1KT1A 2AWGA 1E15A 1E6RA 3H9RB 1NWTA 4R0XA 4Z2LA 1WAWA 4HBEA 2JZVA 2XPAA 4WKAA 4FN2A 1JNSA 1E6NA 4P8UA 3G6LA 3O5GA 3O5EA 2RQSA 1FD9A 4WKFA 1FFQA 2IUZA 2Y78A 3O5FA 3PA7A 4ZPWR 2PPOA 3UQBA 3ARUA 3CGMA 4ODPA 2XP7A 2MLZA 3O5QA 5DITA 3CHCA 4LGXA 4QT2A 3PRDA 1VF8A 1HJVA 1JVWA 2K8IA 1HXVA 1T11A 2XP4A 1J4HA 3ARZA 1FKDA 3CGNA 2ZR4A 1O6IA 1LG1A 4J4OA 1D7JA 4TYOA 4QT3A 4O2TA 1D2KA 4WKHA 5JH8A 3ALFA 2A3AA 3O5RA 1E6ZA 3BXWA 3IKGA 3TCZA 1FKKA 4TW6A 3WQVA 4JFIA 1NWSA 1H0IA 4DWSC 2PBCA 1E9LA 1A7XA 3WD4A 3PRAA 2KO7A 4TX0A 2IF4A 1W9PA 2OFNA 3ALGA 4ODMA 4DT4A 4DRJA 4Z2GA 2FAPA 3FAPA 1FFRA 4L72B 4Z2JA 1D7HA 3FY1A 2PV1A 5GPRA 4MTVA 3TC5A 2OLHA 2ZR5A 1CTNA 4S3JA 5BXJA 1YW5A 1FKIA 1W1PA 3O5KA 3ARTA 3O5PA 4W5UA 3WIJA 4DRIA 4DWSA 1W1TA 4ZS6A 1ZCNA 1NSGA 2P4VA 1J4IA 1HKMA 1BKFA 1HJWA 3KAFA 4XAKA 2ZQVA 3AS1A 5HKGA 1FKLA 2XP8A 3CZ8A 4G50A 1K9TA 3GU0A 1D6OA 1UR8A 3MDYB 5HW7A 4IT4A 4MSPA 3ARYA 1F40A 1GPFA 3WL0A 2PV3A 2MPHA 5J6EA 1FKRA 4ML4A 4QIBA 1FKBA 1YATA 1JNEA 2VN1A 4Z2KA 1GRJA 3FXYA 4UDMA 2XP6A 4DROA 5GPGA 3KCEA 4MNLA 4C02B 4FAPA 1LL4A 1WB0A 3WD0A 4MNJA 1UR9A 3B9EA 5B8IC 5HW8A 2WLYA 2N87A 1SYTA 3ARSA 3CHDA 1XHGA 3W4RA 2RUQA 4DZ3A 4ODOA 1PBKA 1HKKA 2DSWA 2LJ4A 3VAWA 3PR9A 1FKFA 4DWSB 3WH0A 2DSUA 3RFWA 1FKGA 3O5OA 1OWQA 4IQCA 4ITZA 1FKTA 4DRKA 4R5EA 3ARRA 3JYMA 3O5LA 4ODRA 4L3NA 4WIWA 4JFJA 4ZPVR 2XP9A 3GPKA 3IHZA 4S3KA 3CHFA 1HJXA 3I6CA 4WK9A 1B6CA 2M2AA 2VCDA 1QZ2A 3EY6A 2WLZA 1X6NA 4DWSD 2ESCA 1ITXA 2L2SA 5HTGA 4TNSA 1C9HA 2Q5AA 3KAIA 2DT2A 1Q6IA 4NZCA 3IK8A 2RUDA 4DZ2A 4DH0A 1FKHA 1KT0A 1M5YA 5HWCA 5HT1A 4BF8A 4NNRA 2DG9A 1BL4A 4NSBA 1ZL1A 3ARQA 2PV2A 1NMVA 2FDMA 1XRVA 2A3EA 3QOKA 3UQAA 5GQBA 4Z2HA 1X6LA 2RURA 3NI6A 4U84A 4JYSA 1D7IA 4IT6A 4P8VA 1H0GA 2O92A 2WM0A 4LAWA 2MF9A 4URIA 4W9QA 4HBOA 2WK2A 3OOBA 3KAGA 4ODLA 2G8ZA 3LUOA 3OA5A 1Q1CA 3KADA 2O9OA 2DG3A 1ZBWA 4ODQA 1OGBA 1W1YA 4JFLA 2MNTA 1RD6A 3GTYX 4LAYA 4TW7A 5DF0A 1JCHB 2MLXA 1EYMA 2FKEA 1OGGA 2XP5A 2DT3A 2PN0A 3ARVA 3JXVA 1LJYA 2DSVA 3AS0A 2LPVA 3AQUA 2ZQUA 3UF8A 4GIVA 3UI4A 4G2PA 4MNKA 4MGVA 4IPXA 2PI6A 4N19A 3ARWA 4PTMA 1E44A 1JNTA 3BMBA 4MPKA 5HBFA 1Q6UA 4DRQA 1EHNA 4QZVB 1NH6A 4KQZA 5HWBA 2A3BA 4AY1A 4P8WA 2DG4A 4LAVA 4GGQA 4DRMA 3IKDA 1L1PA 4TW8A 2EULA 3WD2A 1W9UA 4LAXA 1ZK6A 2RUCA 4ODKA 2D9FA 2B5UB 4DRNA 3O5JA 2KE0A 3KAHA 3NRKA 1J6YA 4DRHA 1LL6A 1NMWA 1LG2A 1LQ0A 3UQIA 1W9VA 2A3CA 2DPEA 1E6PA 1HKJA 3B8SA 5DO2A 4W9PA 2B31A 1EDQA 3CHEA 4KR0B 3WD1A 3O5DA 3B9AA 2M1IA 2AOSA 1LL7A 1TFVA 1FJDA 3WKZA 1PINA 2YBUA 3TDBA 4IQ2A 3RMEA 3UI5A 4HARA 3RM4A 2LKNA 2M08A 1U79A 3AROA 3RM9A 1Q6HA 1GOIA 4JFMA 3AS3A 2F2DA 2KFWA 4W9OA 3PRBA 3WL1A 1IX5A 5HW6A 3NTPA 1ZBKA 2ETNA 1N1AA 4P8XA 1FKSA 4U85A 2QF8A 2LGOA 2KR7A 1ZBCA 5DIUA 5DEZA 3KZ7A 1W1VA 3WQWA 2XP3A 2PPPA 1ROTA 1FAPA 2PPNA 1R9HA 4Q7NA 2DT0A 3G6MA 4ODNA 4MAVA 1QPFA
chains in the Genus database with same CATH topology
3KABA 1WNOA 1NWUA 5DIVA 4J4NA 1KFWA 1ZBVA 3ARXA 3ARPA 3RM8A 4Z2IA 4JFKA 1GUVA 3UI6A 1Y0OA 4U86A 1FKJA 2XPBA 1W26A 3O5MA 2ZQSA 5I98A 5D75A 1F8AB 1EQ3A 1EIBA 1HKIA 2RSEA 5HUAA 4Q22A 1ZB5A 4DRPA 2UZ5A 3RGCA 2KGJA 3WD3A 3B7XA 2MLYA 1P5QA 2F21A 2ITKA 1QPLA 2G41A 2KI3A 4DIPA 1SR0A 2DSZA 2YBTA 2ZR6A 1NWRA 3O5IA 4WJXA 3AS2A 1JNDA 4ZPTR 2ZQTA 2F4EA 1J4RA 1ZU8A 4MNMA 3JYJA 3KACA 3B9DA 1ROUA 3CH9A 1TCOC 2DT1A 3ODKA 1KT1A 2AWGA 1E15A 1E6RA 3H9RB 1NWTA 4R0XA 4Z2LA 1WAWA 4HBEA 2JZVA 2XPAA 4WKAA 4FN2A 1JNSA 1E6NA 4P8UA 3G6LA 3O5GA 3O5EA 2RQSA 1FD9A 4WKFA 1FFQA 2IUZA 2Y78A 3O5FA 3PA7A 4ZPWR 2PPOA 3UQBA 3ARUA 3CGMA 4ODPA 2XP7A 2MLZA 3O5QA 5DITA 3CHCA 4LGXA 4QT2A 3PRDA 1VF8A 1HJVA 1JVWA 2K8IA 1HXVA 1T11A 2XP4A 1J4HA 3ARZA 1FKDA 3CGNA 2ZR4A 1O6IA 1LG1A 4J4OA 1D7JA 4TYOA 4QT3A 4O2TA 1D2KA 4WKHA 5JH8A 3ALFA 2A3AA 3O5RA 1E6ZA 3BXWA 3IKGA 3TCZA 1FKKA 4TW6A 3WQVA 4JFIA 1NWSA 1H0IA 4DWSC 2PBCA 1E9LA 1A7XA 3WD4A 3PRAA 2KO7A 4TX0A 2IF4A 1W9PA 2OFNA 3ALGA 4ODMA 4DT4A 4DRJA 4Z2GA 2FAPA 3FAPA 1FFRA 4L72B 4Z2JA 1D7HA 3FY1A 2PV1A 5GPRA 4MTVA 3TC5A 2OLHA 2ZR5A 1CTNA 4S3JA 5BXJA 1YW5A 1FKIA 1W1PA 3O5KA 3ARTA 3O5PA 4W5UA 3WIJA 4DRIA 4DWSA 1W1TA 4ZS6A 1ZCNA 1NSGA 1J4IA 1HKMA 1BKFA 1HJWA 3KAFA 4XAKA 2ZQVA 3AS1A 5HKGA 1FKLA 2XP8A 3CZ8A 4G50A 1K9TA 5HW7A 1D6OA 1UR8A 3MDYB 4IT4A 4MSPA 3ARYA 1F40A 1GPFA 3WL0A 2PV3A 2MPHA 5J6EA 1FKRA 4ML4A 4QIBA 1FKBA 1YATA 1JNEA 2VN1A 4Z2KA 3FXYA 2XP6A 4DROA 5GPGA 3KCEA 4MNLA 4C02B 4FAPA 1LL4A 1WB0A 3WD0A 4MNJA 1UR9A 3B9EA 5B8IC 5HW8A 2WLYA 2N87A 1SYTA 3ARSA 3CHDA 1XHGA 3W4RA 2RUQA 4DZ3A 4ODOA 1PBKA 1HKKA 2DSWA 2LJ4A 3VAWA 3PR9A 1FKFA 4DWSB 3WH0A 2DSUA 3RFWA 1FKGA 3O5OA 1OWQA 4IQCA 4ITZA 1FKTA 4DRKA 4R5EA 3ARRA 3JYMA 3O5LA 4ODRA 4L3NA 4WIWA 4JFJA 4ZPVR 2XP9A 3GPKA 3IHZA 4S3KA 3CHFA 1HJXA 3I6CA 4WK9A 1B6CA 2M2AA 2VCDA 1QZ2A 3EY6A 2WLZA 1X6NA 4DWSD 2ESCA 1ITXA 2L2SA 5HTGA 4TNSA 1C9HA 2Q5AA 3KAIA 2DT2A 1Q6IA 4NZCA 3IK8A 2RUDA 4DZ2A 4DH0A 1FKHA 1KT0A 1M5YA 5HWCA 5HT1A 4BF8A 4NNRA 2DG9A 1BL4A 4NSBA 1ZL1A 3ARQA 2PV2A 1NMVA 2FDMA 1XRVA 2A3EA 3QOKA 3UQAA 5GQBA 4Z2HA 1X6LA 2RURA 3NI6A 4U84A 4JYSA 1D7IA 4IT6A 4P8VA 1H0GA 2O92A 2WM0A 4LAWA 2MF9A 4URIA 4W9QA 4HBOA 2WK2A 3OOBA 3KAGA 4ODLA 2G8ZA 3LUOA 3OA5A 1Q1CA 3KADA 2O9OA 2DG3A 1ZBWA 4ODQA 1OGBA 1W1YA 4JFLA 2MNTA 1RD6A 4LAYA 4TW7A 5DF0A 2MLXA 1EYMA 2FKEA 1OGGA 2XP5A 2DT3A 3ARVA 3JXVA 1LJYA 2DSVA 3AS0A 2LPVA 3AQUA 2ZQUA 3UF8A 4GIVA 3UI4A 4G2PA 4MNKA 4MGVA 4IPXA 2PI6A 4N19A 3ARWA 4PTMA 1JNTA 4MPKA 5HBFA 1Q6UA 4DRQA 1EHNA 4QZVB 1NH6A 4KQZA 5HWBA 2A3BA 4AY1A 4P8WA 2DG4A 4LAVA 4GGQA 4DRMA 3IKDA 1L1PA 4TW8A 3WD2A 1W9UA 4LAXA 1ZK6A 2RUCA 4ODKA 2D9FA 4DRNA 3O5JA 2KE0A 3KAHA 3NRKA 1J6YA 4DRHA 1LL6A 1NMWA 1LG2A 1LQ0A 3UQIA 1W9VA 2A3CA 2DPEA 1E6PA 1HKJA 3B8SA 5DO2A 4W9PA 2B31A 1EDQA 3CHEA 4KR0B 3WD1A 3O5DA 3B9AA 2M1IA 2AOSA 1LL7A 1TFVA 1FJDA 3WKZA 1PINA 2YBUA 3TDBA 4IQ2A 3RMEA 3UI5A 4HARA 3RM4A 2LKNA 2M08A 1U79A 3AROA 3RM9A 1Q6HA 1GOIA 4JFMA 3AS3A 2F2DA 2KFWA 4W9OA 3PRBA 3WL1A 1IX5A 5HW6A 3NTPA 1ZBKA 1N1AA 4P8XA 1FKSA 4U85A 2QF8A 2LGOA 2KR7A 1ZBCA 5DIUA 5DEZA 3KZ7A 1W1VA 3WQWA 2XP3A 2PPPA 1ROTA 1FAPA 2PPNA 1R9HA 4Q7NA 2DT0A 3G6MA 4ODNA 4MAVA 1QPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CGN A;  2ZR4 A;  3KAB A;  4J4O A;  4DZ3 A;  1D7J A;  4TYO A;  4ODO A;  1PBK A;  3JXV A;  4QT3 A;  4O2T A;  2LJ4 A;  2LPV A;  5DIV A;  4J4N A;  2ZQU A;  3UF8 A;  4GIV A;  3VAW A;  3O5R A;  4G2P A;  3UI4 A;  3IKG A;  3TCZ A;  4MGV A;  1FKK A;  4IPX A;  4TW6 A;  4JFI A;  1FKF A;  3WH0 A;  4N19 A;  3RFW A;  1FKG A;  3O5O A;  2PBC A;  4IQC A;  4ITZ A;  4JFK A;  1A7X A;  1FKT A;  1JNT A;  3UI6 A;  1Y0O A;  4U86 A;  4DRK A;  1Q6U A;  4DRQ A;  1FKJ A;  2KO7 A;  4TX0 A;  3JYM A;  2XPB A;  3O5L A;  1W26 A;  3O5M A;  2IF4 A;  2ZQS A;  4ODR A;  5HWB A;  5I98 A;  2DG4 A;  4JFJ A;  2OFN A;  4LAV A;  4ODM A;  5D75 A;  4DT4 A;  2XP9 A;  4DRJ A;  4GGQ A;  1F8A B;  1EQ3 A;  2FAP A;  3GPK A;  3IKD A;  4TW8 A;  3FAP A;  3IHZ A;  4DRM A;  1L1P A;  1D7H A;  3I6C A;  2PV1 A;  2RSE A;  5HUA A;  4LAX A;  1B6C A;  1ZK6 A;  2M2A A;  2RUC A;  2ZR5 A;  4ODK A;  3TC5 A;  2VCD A;  1QZ2 A;  3EY6 A;  4DRP A;  2UZ5 A;  2D9F A;  5BXJ A;  3RGC A;  4DRN A;  1YW5 A;  1FKI A;  2XP5 A;  2KGJ A;  3O5K A;  3O5J A;  2KE0 A;  3KAH A;  3NRK A;  3O5P A;  3B7X A;  1J6Y A;  2L2S A;  4DRI A;  4DRH A;  1NMW A;  2MLY A;  5HTG A;  1P5Q A;  2F21 A;  4TNS A;  1ZCN A;  1C9H A;  1NSG A;  2Q5A A;  3KAI A;  2ITK A;  3UQI A;  1QPL A;  4DZ2 A;  2KI3 A;  1Q6I A;  1J4I A;  2RUD A;  3IK8 A;  4DIP A;  4W9P A;  4DH0 A;  1BKF A;  1FKH A;  3KAF A;  1KT0 A;  2ZQV A;  1M5Y A;  5HWC A;  5HT1 A;  2ZR6 A;  3O5I A;  3O5D A;  4BF8 A;  5HKG A;  1FKL A;  4NNR A;  2DG9 A;  1BL4 A;  2M1I A;  2XP8 A;  1FJD A;  2ZQT A;  2F4E A;  1J4R A;  1PIN A;  3TDB A;  2PV2 A;  3JYJ A;  1NMV A;  3KAC A;  1ROU A;  4IQ2 A;  3UI5 A;  4G50 A;  1TCO C;  2LKN A;  3ODK A;  3UQA A;  1KT1 A;  2AWG A;  5HW7 A;  1D6O A;  2M08 A;  2RUR A;  3MDY B;  3NI6 A;  4MSP A;  4JYS A;  3H9R B;  4U84 A;  1D7I A;  1U79 A;  4R0X A;  1F40 A;  2PV3 A;  2MPH A;  1Q6H A;  2JZV A;  4JFM A;  5J6E A;  1FKR A;  2XPA A;  4QIB A;  1FKB A;  2F2D A;  2MF9 A;  4LAW A;  1YAT A;  2KFW A;  3PRB A;  4W9Q A;  4W9O A;  2VN1 A;  2XP6 A;  4FN2 A;  3OOB A;  3KAG A;  1JNS A;  4ODL A;  5HW6 A;  3NTP A;  3O5E A;  3O5G A;  4DRO A;  3LUO A;  5GPG A;  3KCE A;  1Q1C A;  2RQS A;  3KAD A;  4C02 B;  1FD9 A;  1N1A A;  2DG3 A;  4FAP A;  2Y78 A;  3PA7 A;  3O5F A;  1FKS A;  4U85 A;  2LGO A;  4ODQ A;  2KR7 A;  5B8I C;  4JFL A;  2PPO A;  2MNT A;  3UQB A;  5DIU A;  3CGM A;  4ODP A;  2XP7 A;  2MLZ A;  3KZ7 A;  4LAY A;  3O5Q A;  2XP3 A;  4TW7 A;  5DIT A;  2PPP A;  4QT2 A;  2MLX A;  1EYM A;  1ROT A;  1FAP A;  3PRD A;  1JVW A;  5HW8 A;  2PPN A;  1R9H A;  2K8I A;  1HXV A;  1T11 A;  2FKE A;  2XP4 A;  2N87 A;  1J4H A;  4ODN A;  2RUQ A;  1QPF A;  1FKD A; 
#chains in the Genus database with same CATH topology
 3KAB A;  1WNO A;  1NWU A;  5DIV A;  4J4N A;  1KFW A;  1ZBV A;  3ARX A;  3ARP A;  3RM8 A;  4Z2I A;  4JFK A;  1GUV A;  3UI6 A;  1Y0O A;  4U86 A;  1FKJ A;  2XPB A;  1W26 A;  3O5M A;  2ZQS A;  5I98 A;  5D75 A;  1F8A B;  1EQ3 A;  1EIB A;  1HKI A;  2RSE A;  5HUA A;  4Q22 A;  1ZB5 A;  4DRP A;  2UZ5 A;  3RGC A;  2KGJ A;  3WD3 A;  3EIP A;  3B7X A;  2MLY A;  1P5Q A;  2F21 A;  2ITK A;  1QPL A;  2G41 A;  2KI3 A;  4DIP A;  1SR0 A;  2DSZ A;  2YBT A;  2ZR6 A;  1NWR A;  3O5I A;  4WJX A;  3AS2 A;  1JND A;  4ZPT R;  2ZQT A;  2F4E A;  1J4R A;  1ZU8 A;  4MNM A;  3KAC A;  3JYJ A;  2F23 A;  1ROU A;  3B9D A;  3CH9 A;  1TCO C;  2DT1 A;  3ODK A;  1KT1 A;  2AWG A;  1E15 A;  1E6R A;  3H9R B;  1NWT A;  4R0X A;  4Z2L A;  1WAW A;  4HBE A;  2JZV A;  2XPA A;  4WKA A;  4FN2 A;  1JNS A;  1E6N A;  4P8U A;  3G6L A;  3O5G A;  3O5E A;  2RQS A;  1FD9 A;  4WKF A;  1FFQ A;  2IUZ A;  2Y78 A;  3O5F A;  3PA7 A;  4ZPW R;  2PPO A;  3UQB A;  3ARU A;  3CGM A;  4ODP A;  2XP7 A;  2MLZ A;  3O5Q A;  5DIT A;  3CHC A;  4LGX A;  4QT2 A;  3PRD A;  1VF8 A;  1HJV A;  1JVW A;  2K8I A;  1HXV A;  1T11 A;  2XP4 A;  1J4H A;  3ARZ A;  1FKD A;  3CGN A;  2ZR4 A;  1O6I A;  1LG1 A;  4J4O A;  1D7J A;  4TYO A;  4QT3 A;  4O2T A;  1D2K A;  4WKH A;  5JH8 A;  3ALF A;  2A3A A;  3O5R A;  1E6Z A;  3BXW A;  3IKG A;  3TCZ A;  1FKK A;  4TW6 A;  3WQV A;  4JFI A;  1NWS A;  1H0I A;  4DWS C;  2PBC A;  1E9L A;  1A7X A;  3WD4 A;  3PRA A;  2KO7 A;  4TX0 A;  2IF4 A;  1W9P A;  2OFN A;  3ALG A;  4ODM A;  4DT4 A;  4DRJ A;  4Z2G A;  2FAP A;  3FAP A;  1FFR A;  4L72 B;  4Z2J A;  1D7H A;  3FY1 A;  2PV1 A;  5GPR A;  4MTV A;  3TC5 A;  2OLH A;  2ZR5 A;  1CTN A;  4S3J A;  5BXJ A;  1YW5 A;  1FKI A;  1W1P A;  3O5K A;  3ART A;  3O5P A;  4W5U A;  3WIJ A;  4DRI A;  4DWS A;  1W1T A;  4ZS6 A;  1ZCN A;  1NSG A;  2P4V A;  1J4I A;  1HKM A;  1BKF A;  1HJW A;  3KAF A;  4XAK A;  2ZQV A;  3AS1 A;  5HKG A;  1FKL A;  2XP8 A;  3CZ8 A;  4G50 A;  1K9T A;  3GU0 A;  1D6O A;  1UR8 A;  3MDY B;  5HW7 A;  4IT4 A;  4MSP A;  3ARY A;  1F40 A;  1GPF A;  3WL0 A;  2PV3 A;  2MPH A;  5J6E A;  1FKR A;  4ML4 A;  4QIB A;  1FKB A;  1YAT A;  1JNE A;  2VN1 A;  4Z2K A;  1GRJ A;  3FXY A;  4UDM A;  2XP6 A;  4DRO A;  5GPG A;  3KCE A;  4MNL A;  4C02 B;  4FAP A;  1LL4 A;  1WB0 A;  3WD0 A;  4MNJ A;  1UR9 A;  3B9E A;  5B8I C;  5HW8 A;  2WLY A;  2N87 A;  1SYT A;  3ARS A;  3CHD A;  1XHG A;  3W4R A;  2RUQ A;  4DZ3 A;  4ODO A;  1PBK A;  1HKK A;  2DSW A;  2LJ4 A;  3VAW A;  3PR9 A;  1FKF A;  4DWS B;  3WH0 A;  2DSU A;  3RFW A;  1FKG A;  3O5O A;  1OWQ A;  4IQC A;  4ITZ A;  1FKT A;  4DRK A;  4R5E A;  3ARR A;  3JYM A;  3O5L A;  4ODR A;  4L3N A;  4WIW A;  4JFJ A;  4ZPV R;  2XP9 A;  3GPK A;  3IHZ A;  4S3K A;  3CHF A;  1HJX A;  3I6C A;  4WK9 A;  1B6C A;  2M2A A;  2VCD A;  1QZ2 A;  3EY6 A;  2WLZ A;  1X6N A;  4DWS D;  2ESC A;  1ITX A;  2L2S A;  5HTG A;  4TNS A;  1C9H A;  2Q5A A;  3KAI A;  2DT2 A;  1Q6I A;  4NZC A;  3IK8 A;  2RUD A;  4DZ2 A;  4DH0 A;  1FKH A;  1KT0 A;  1M5Y A;  5HWC A;  5HT1 A;  4BF8 A;  4NNR A;  2DG9 A;  1BL4 A;  4NSB A;  1ZL1 A;  3ARQ A;  2PV2 A;  1NMV A;  2FDM A;  1XRV A;  2A3E A;  3QOK A;  3UQA A;  5GQB A;  4Z2H A;  1X6L A;  2RUR A;  3NI6 A;  4U84 A;  4JYS A;  1D7I A;  4IT6 A;  4P8V A;  1H0G A;  2O92 A;  2WM0 A;  4LAW A;  2MF9 A;  4URI A;  4W9Q A;  4HBO A;  2WK2 A;  3OOB A;  3KAG A;  4ODL A;  2G8Z A;  3LUO A;  3OA5 A;  1Q1C A;  3KAD A;  2O9O A;  2DG3 A;  1ZBW A;  4ODQ A;  1OGB A;  1W1Y A;  4JFL A;  2MNT A;  1RD6 A;  3GTY X;  4LAY A;  4TW7 A;  5DF0 A;  1JCH B;  2MLX A;  1EYM A;  2FKE A;  1OGG A;  2XP5 A;  2DT3 A;  2PN0 A;  3ARV A;  3JXV A;  1LJY A;  2DSV A;  3AS0 A;  2LPV A;  3AQU A;  2ZQU A;  3UF8 A;  4GIV A;  3UI4 A;  4G2P A;  4MNK A;  4MGV A;  4IPX A;  2PI6 A;  4N19 A;  3ARW A;  4PTM A;  1E44 A;  1JNT A;  3BMB A;  4MPK A;  5HBF A;  1Q6U A;  4DRQ A;  1EHN A;  4QZV B;  1NH6 A;  4KQZ A;  5HWB A;  2A3B A;  4AY1 A;  4P8W A;  2DG4 A;  4LAV A;  4GGQ A;  4DRM A;  3IKD A;  1L1P A;  4TW8 A;  2EUL A;  3WD2 A;  1W9U A;  4LAX A;  1ZK6 A;  2RUC A;  4ODK A;  2D9F A;  2B5U B;  4DRN A;  3O5J A;  2KE0 A;  3KAH A;  3NRK A;  1J6Y A;  4DRH A;  1LL6 A;  1NMW A;  1LG2 A;  1LQ0 A;  3UQI A;  1W9V A;  2A3C A;  2DPE A;  1E6P A;  1HKJ A;  3B8S A;  5DO2 A;  4W9P A;  2B31 A;  1EDQ A;  3CHE A;  4KR0 B;  3WD1 A;  3O5D A;  3B9A A;  2M1I A;  2AOS A;  1LL7 A;  1TFV A;  1FJD A;  3WKZ A;  1PIN A;  2YBU A;  3TDB A;  4IQ2 A;  3RME A;  3UI5 A;  4HAR A;  3RM4 A;  2LKN A;  2M08 A;  1U79 A;  3ARO A;  3RM9 A;  1Q6H A;  1GOI A;  4JFM A;  3AS3 A;  2F2D A;  2KFW A;  4W9O A;  3PRB A;  3WL1 A;  1IX5 A;  5HW6 A;  3NTP A;  1ZBK A;  2ETN A;  1N1A A;  4P8X A;  1FKS A;  4U85 A;  2QF8 A;  2LGO A;  2KR7 A;  1ZBC A;  5DIU A;  5DEZ A;  3KZ7 A;  1W1V A;  3WQW A;  2XP3 A;  2PPP A;  1ROT A;  1FAP A;  2PPN A;  1R9H A;  4Q7N A;  2DT0 A;  3G6M A;  4ODN A;  4MAV A;  1QPF A; 
#chains in the Genus database with same CATH homology
 3KAB A;  1WNO A;  1NWU A;  5DIV A;  4J4N A;  1KFW A;  1ZBV A;  3ARX A;  3ARP A;  3RM8 A;  4Z2I A;  4JFK A;  1GUV A;  3UI6 A;  1Y0O A;  4U86 A;  1FKJ A;  2XPB A;  1W26 A;  3O5M A;  2ZQS A;  5I98 A;  5D75 A;  1F8A B;  1EQ3 A;  1EIB A;  1HKI A;  2RSE A;  5HUA A;  4Q22 A;  1ZB5 A;  4DRP A;  2UZ5 A;  3RGC A;  2KGJ A;  3WD3 A;  3B7X A;  2MLY A;  1P5Q A;  2F21 A;  2ITK A;  1QPL A;  2G41 A;  2KI3 A;  4DIP A;  1SR0 A;  2DSZ A;  2YBT A;  2ZR6 A;  1NWR A;  3O5I A;  4WJX A;  3AS2 A;  1JND A;  4ZPT R;  2ZQT A;  2F4E A;  1J4R A;  1ZU8 A;  4MNM A;  3JYJ A;  3KAC A;  3B9D A;  1ROU A;  3CH9 A;  1TCO C;  2DT1 A;  3ODK A;  1KT1 A;  2AWG A;  1E15 A;  1E6R A;  3H9R B;  1NWT A;  4R0X A;  4Z2L A;  1WAW A;  4HBE A;  2JZV A;  2XPA A;  4WKA A;  4FN2 A;  1JNS A;  1E6N A;  4P8U A;  3G6L A;  3O5G A;  3O5E A;  2RQS A;  1FD9 A;  4WKF A;  1FFQ A;  2IUZ A;  2Y78 A;  3O5F A;  3PA7 A;  4ZPW R;  2PPO A;  3UQB A;  3ARU A;  3CGM A;  4ODP A;  2XP7 A;  2MLZ A;  3O5Q A;  5DIT A;  3CHC A;  4LGX A;  4QT2 A;  3PRD A;  1VF8 A;  1HJV A;  1JVW A;  2K8I A;  1HXV A;  1T11 A;  2XP4 A;  1J4H A;  3ARZ A;  1FKD A;  3CGN A;  2ZR4 A;  1O6I A;  1LG1 A;  4J4O A;  1D7J A;  4TYO A;  4QT3 A;  4O2T A;  1D2K A;  4WKH A;  5JH8 A;  3ALF A;  2A3A A;  3O5R A;  1E6Z A;  3BXW A;  3IKG A;  3TCZ A;  1FKK A;  4TW6 A;  3WQV A;  4JFI A;  1NWS A;  1H0I A;  4DWS C;  2PBC A;  1E9L A;  1A7X A;  3WD4 A;  3PRA A;  2KO7 A;  4TX0 A;  2IF4 A;  1W9P A;  2OFN A;  3ALG A;  4ODM A;  4DT4 A;  4DRJ A;  4Z2G A;  2FAP A;  3FAP A;  1FFR A;  4L72 B;  4Z2J A;  1D7H A;  3FY1 A;  2PV1 A;  5GPR A;  4MTV A;  3TC5 A;  2OLH A;  2ZR5 A;  1CTN A;  4S3J A;  5BXJ A;  1YW5 A;  1FKI A;  1W1P A;  3O5K A;  3ART A;  3O5P A;  4W5U A;  3WIJ A;  4DRI A;  4DWS A;  1W1T A;  4ZS6 A;  1ZCN A;  1NSG A;  1J4I A;  1HKM A;  1BKF A;  1HJW A;  3KAF A;  4XAK A;  2ZQV A;  3AS1 A;  5HKG A;  1FKL A;  2XP8 A;  3CZ8 A;  4G50 A;  1K9T A;  5HW7 A;  1D6O A;  1UR8 A;  3MDY B;  4IT4 A;  4MSP A;  3ARY A;  1F40 A;  1GPF A;  3WL0 A;  2PV3 A;  2MPH A;  5J6E A;  1FKR A;  4ML4 A;  4QIB A;  1FKB A;  1YAT A;  1JNE A;  2VN1 A;  4Z2K A;  3FXY A;  2XP6 A;  4DRO A;  5GPG A;  3KCE A;  4MNL A;  4C02 B;  4FAP A;  1LL4 A;  1WB0 A;  3WD0 A;  4MNJ A;  1UR9 A;  3B9E A;  5B8I C;  5HW8 A;  2WLY A;  2N87 A;  1SYT A;  3ARS A;  3CHD A;  1XHG A;  3W4R A;  2RUQ A;  4DZ3 A;  4ODO A;  1PBK A;  1HKK A;  2DSW A;  2LJ4 A;  3VAW A;  3PR9 A;  1FKF A;  4DWS B;  3WH0 A;  2DSU A;  3RFW A;  1FKG A;  3O5O A;  1OWQ A;  4IQC A;  4ITZ A;  1FKT A;  4DRK A;  4R5E A;  3ARR A;  3JYM A;  3O5L A;  4ODR A;  4L3N A;  4WIW A;  4JFJ A;  4ZPV R;  2XP9 A;  3GPK A;  3IHZ A;  4S3K A;  3CHF A;  1HJX A;  3I6C A;  4WK9 A;  1B6C A;  2M2A A;  2VCD A;  1QZ2 A;  3EY6 A;  2WLZ A;  1X6N A;  4DWS D;  2ESC A;  1ITX A;  2L2S A;  5HTG A;  4TNS A;  1C9H A;  2Q5A A;  3KAI A;  2DT2 A;  1Q6I A;  4NZC A;  3IK8 A;  2RUD A;  4DZ2 A;  4DH0 A;  1FKH A;  1KT0 A;  1M5Y A;  5HWC A;  5HT1 A;  4BF8 A;  4NNR A;  2DG9 A;  1BL4 A;  4NSB A;  1ZL1 A;  3ARQ A;  2PV2 A;  1NMV A;  2FDM A;  1XRV A;  2A3E A;  3QOK A;  3UQA A;  5GQB A;  4Z2H A;  1X6L A;  2RUR A;  3NI6 A;  4U84 A;  4JYS A;  1D7I A;  4IT6 A;  4P8V A;  1H0G A;  2O92 A;  2WM0 A;  4LAW A;  2MF9 A;  4URI A;  4W9Q A;  4HBO A;  2WK2 A;  3OOB A;  3KAG A;  4ODL A;  2G8Z A;  3LUO A;  3OA5 A;  1Q1C A;  3KAD A;  2O9O A;  2DG3 A;  1ZBW A;  4ODQ A;  1OGB A;  1W1Y A;  4JFL A;  2MNT A;  1RD6 A;  4LAY A;  4TW7 A;  5DF0 A;  2MLX A;  1EYM A;  2FKE A;  1OGG A;  2XP5 A;  2DT3 A;  3ARV A;  3JXV A;  1LJY A;  2DSV A;  3AS0 A;  2LPV A;  3AQU A;  2ZQU A;  3UF8 A;  4GIV A;  3UI4 A;  4G2P A;  4MNK A;  4MGV A;  4IPX A;  2PI6 A;  4N19 A;  3ARW A;  4PTM A;  1JNT A;  4MPK A;  5HBF A;  1Q6U A;  4DRQ A;  1EHN A;  4QZV B;  1NH6 A;  4KQZ A;  5HWB A;  2A3B A;  4AY1 A;  4P8W A;  2DG4 A;  4LAV A;  4GGQ A;  4DRM A;  3IKD A;  1L1P A;  4TW8 A;  3WD2 A;  1W9U A;  4LAX A;  1ZK6 A;  2RUC A;  4ODK A;  2D9F A;  4DRN A;  3O5J A;  2KE0 A;  3KAH A;  3NRK A;  1J6Y A;  4DRH A;  1LL6 A;  1NMW A;  1LG2 A;  1LQ0 A;  3UQI A;  1W9V A;  2A3C A;  2DPE A;  1E6P A;  1HKJ A;  3B8S A;  5DO2 A;  4W9P A;  2B31 A;  1EDQ A;  3CHE A;  4KR0 B;  3WD1 A;  3O5D A;  3B9A A;  2M1I A;  2AOS A;  1LL7 A;  1TFV A;  1FJD A;  3WKZ A;  1PIN A;  2YBU A;  3TDB A;  4IQ2 A;  3RME A;  3UI5 A;  4HAR A;  3RM4 A;  2LKN A;  2M08 A;  1U79 A;  3ARO A;  3RM9 A;  1Q6H A;  1GOI A;  4JFM A;  3AS3 A;  2F2D A;  2KFW A;  4W9O A;  3PRB A;  3WL1 A;  1IX5 A;  5HW6 A;  3NTP A;  1ZBK A;  1N1A A;  4P8X A;  1FKS A;  4U85 A;  2QF8 A;  2LGO A;  2KR7 A;  1ZBC A;  5DIU A;  5DEZ A;  3KZ7 A;  1W1V A;  3WQW A;  2XP3 A;  2PPP A;  1ROT A;  1FAP A;  2PPN A;  1R9H A;  4Q7N A;  2DT0 A;  3G6M A;  4ODN A;  4MAV A;  1QPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...