5I98A

Structure of apo fkbp12(p104g) from c. albicans
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPGIIGPNETLVFEVELLGVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
total genus 26
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5i98A00
1FAPA 4IPXA 3KAHA 2ZR6A 4IQCA 1FKSA 4FN2A 4QIBA 1J6YA 2VN1A 2ZQSA 1TCOC 3O5PA 2PBCA 4ODQA 3PRDA 4J4NA 1FKGA 4TYOA 3O5JA 4W9OA 1FKBA 5HUAA 1Q6HA 2D9FA 1M5YA 2MF9A 3NTPA 4LAXA 4R0XA 5GPGA 2XP7A 1FKTA 4TX0A 4ITZA 5HWBA 2XP9A 5J6EA 1D7JA 4IQ2A 4ODNA 2FAPA 4ODLA 3I6CA 4ODPA 2XPAA 3UQBA 3O5GA 1JVWA 2L2SA 3IHZA 2PV1A 4DH0A 1ROTA 4LAWA 2M1IA 5DITA 2PPOA 4LAVA 3UI4A 3O5KA 1W26A 4TW8A 3TCZA 2LGOA 4ODRA 1D7IA 2XPBA 3O5DA 1A7XA 3NI6A 1FKHA 4U86A 2MLYA 4DZ3A 3UQIA 4FAPA 2ZQVA 3IK8A 1C9HA 3NRKA 2LJ4A 5B8IC 1ZK6A 1R9HA 5HT1A 1B6CA 1FKLA 1D7HA 2KI3A 2KO7A 3CGNA 3KADA 3RGCA 4JFIA 1F40A 1NMWA 4JFKA 1NSGA 3RFWA 1FKIA 5HTGA 4J4OA 1FKDA 4ODMA 4DRHA 2MLXA 5I98A 1JNSA 3KACA 1L1PA 2KE0A 3O5OA 2MLZA 4TW6A 1QZ2A 4U84A 3O5RA 5DIVA 3KAGA 2MNTA 4O2TA 2KFWA 2LKNA 3KZ7A 2DG4A 2XP3A 1FJDA 1EQ3A 1F8AB 1JNTA 3UI6A 5HW6A 1FKKA 2ZR4A 3O5FA 4U85A 3TDBA 3WH0A 4C02B 2XP8A 4TW7A 2RUDA 4DT4A 4ODOA 2PV2A 3O5QA 1KT1A 2RUQA 4JFJA 2FKEA 3O5IA 2UZ5A 3JXVA 4JFLA 2PPNA 2XP5A 1EYMA 1ROUA 4JFMA 3UI5A 3JYMA 3UQAA 4DRIA 1N1AA 2MPHA 3UF8A 1FKFA 4DIPA 1NMVA 5HW7A 4MGVA 1QPLA 2N87A 2ZQTA 4W9PA 4GIVA 2F2DA 2KGJA 4LAYA 4DRNA 1BL4A 1D6OA 4BF8A 5HKGA 5BXJA 2PV3A 5D75A 3TC5A 2RQSA 1Y0OA 1Q6IA 4DRQA 2M2AA 3JYJA 4DROA 4NNRA 1YW5A 2RUCA 3CGMA 2ITKA 3GPKA 3O5MA 4GGQA 3O5LA 3B7XA 2VCDA 4JYSA 1FD9A 2LPVA 3VAWA 2K8IA 1J4HA 4G50A 1J4IA 2DG9A 2XP6A 2F21A 2OFNA 2PPPA 3KAFA 3ODKA 1J4RA 4N19A 1KT0A 2XP4A 3PRBA 2RURA 2M08A 4ODKA 1BKFA 1U79A 3EY6A 4W9QA 2Q5AA 3MDYB 1T11A 1PBKA 2RSEA 1QPFA 3PA7A 3FAPA 3IKGA 3KCEA 4QT3A 2DG3A 3H9RB 4QT2A 4TNSA 3KABA 2F4EA 2ZR5A 2IF4A 4DZ2A 2ZQUA 2KR7A 3O5EA 3OOBA 1FKJA 5HW8A 2Y78A 1HXVA 3LUOA 5DIUA 2AWGA 1PINA 4DRPA 3IKDA 5HWCA 1Q1CA 4MSPA 4DRMA 4DRJA 4DRKA 1ZCNA 1YATA 3KAIA 1FKRA 2JZVA 4G2PA 1Q6UA 1P5QA
chains in the Genus database with same CATH superfamily
1FAPA 3B8SA 4Z2KA 4QIBA 2VN1A 5GPRA 4S3KA 1GRJA 3O5PA 2PBCA 4TYOA 2MF9A 3NTPA 5GPGA 4LAXA 2XP7A 4TX0A 3RMEA 2DT0A 5J6EA 4IQ2A 3ARUA 4ODNA 4ZPWR 3I6CA 3UQBA 1JVWA 3UI4A 3O5KA 1ITXA 4Z2IA 3O5DA 1FKHA 4U86A 1C9HA 3WQWA 2LJ4A 5B8IC 1ZK6A 5HT1A 1NWSA 3RM9A 3KADA 1LQ0A 3BMBA 2ETNA 1NMWA 3RFWA 1FKIA 5HTGA 2MLXA 1E6RA 3W4RA 3O5OA 2PI6A 5DIVA 3KZ7A 2EULA 2XP3A 1JNTA 1FKKA 1HJXA 1L1PA 2FDMA 4TW7A 4ODOA 4W5UA 2FKEA 3JXVA 2PPNA 3B9AA 4DRIA 2MPHA 1FKFA 5HW7A 4W9PA 2ZQTA 4DRNA 1D6OA 1JNEA 2RQSA 3AS0A 2M2AA 3AS3A 2ITKA 4ZPTR 2VCDA 3VAWA 2K8IA 4R5EA 1KFWA 3ODKA 4MNLA 2XP4A 2M08A 1BKFA 1U79A 2Q5AA 5HBFA 2RSEA 3ARPA 1E6ZA 2F23A 4WK9A 4DWSD 2DG3A 3H9RB 2F4EA 2B5UB 3O5EA 2G8ZA 3ARSA 5DIUA 2B31A 4DRPA 3CH9A 3CHCA 1Q1CA 4MSPA 3G6MA 2ZR6A 1FKSA 1LL4A 1WNOA 5HUAA 1FKGA 3O5JA 1Q6HA 1XRVA 4HBEA 1FKTA 4ZPVR 4MNKA 2FAPA 1W9UA 2XPAA 3IHZA 1UR9A 5DITA 1ZBVA 4TW8A 1NH6A 3AS2A 1A7XA 2ZQVA 3ARZA 3NRKA 3ARRA 4WKAA 2KI3A 2KO7A 3RGCA 4WIWA 4J4OA 4WKFA 4DRHA 4Z2HA 1JNSA 2DT1A 1QZ2A 1W1YA 3KAGA 2MNTA 1FFQA 2KFWA 2LKNA 4IT4A 1FJDA 5HW6A 4C02B 3O5FA 2PV2A 1KT1A 4P8WA 4WJXA 2UZ5A 5DEZA 1IX5A 1EYMA 1ROUA 1N1AA 3WD4A 1D2KA 4HBOA 4LAYA 2P4VA 3TC5A 1Y0OA 4DWSB 4DRQA 4NNRA 1O6IA 2RUCA 3CGMA 1HJWA 2ESCA 2YBTA 3GPKA 1E6NA 3WQVA 4QZVB 4JYSA 4MNJA 4G50A 4NSBA 1J4IA 2XP6A 2OFNA 4N19A 2PPPA 3ARTA 4KQZA 2RURA 1W9VA 3EY6A 1TFVA 4W9QA 1RD6A 3MDYB 1ZBWA 1OGGA 3WD0A 2DSUA 2WLZA 4TNSA 4DWSA 4KR0B 2IF4A 4MPKA 4MTVA 1EHNA 2ZQUA 3OOBA 4HARA 1FKJA 3ALGA 3CHFA 1UR8A 3CZ8A 1GOIA 4NZCA 3KAIA 1LG2A 4G2PA 1Q6UA 4IPXA 3AS1A 1HJVA 1XHGA 4IQCA 4FN2A 4PTMA 3ARVA 1JNDA 1TCOC 3PRAA 4ODQA 3PRDA 4J4NA 1FKBA 2D9FA 1M5YA 3ALFA 4ITZA 2QF8A 1SR0A 1D7JA 3WL1A 4ODLA 4ODPA 2L2SA 3AQUA 4DH0A 1ROTA 1EDQA 4LAVA 1W26A 2LGOA 4ODRA 4Q22A 3EIPA 1H0GA 3ARQA 3NI6A 2A3BA 2MLYA 3CGNA 3G6LA 3WIJA 4JFIA 4JFKA 4XAKA 4ODMA 5I98A 2OLHA 1VF8A 4U84A 3BXWA 3WD2A 1EQ3A 1F8AB 4MAVA 3UI6A 3WH0A 2ZR4A 2IUZA 1W1TA 2RUDA 2DSZA 3O5IA 3FXYA 2XP5A 4JFMA 3UI5A 3UF8A 1NMVA 4MGVA 3WD1A 4ML4A 3ARWA 4GIVA 2F2DA 3CHEA 5HKGA 4P8VA 1LG1A 1HKKA 2PV3A 5D75A 3RM4A 4AY1A 1LL7A 1YW5A 2A3AA 4MNMA 4L72B 3O5LA 4DWSC 1WB0A 1W1VA 2DG9A 2F21A 1J4RA 2A3EA 1KT0A 3PRBA 4ODKA 1W9PA 4ZS6A 1T11A 4P8XA 3WD3A 3WL0A 3KCEA 2WM0A 1X6NA 3KABA 2ZR5A 3RM8A 4DZ2A 2KR7A 1ZU8A 5HW8A 2Y78A 2AWGA 1PINA 1E15A 2A3CA 2YBUA 4DRJA 4DRKA 1ZCNA 1YATA 3GU0A 2JZVA 4JFLA 5DO2A 3OA5A 1P5QA 3GTYX 3KAHA 1E9LA 1J6YA 2ZQSA 3FY1A 4WKHA 1CTNA 4W9OA 4L3NA 1HKIA 4R0XA 5HWBA 2XP9A 1HKJA 2DSWA 4S3JA 1NWUA 3AROA 5GQBA 3O5GA 4Z2GA 4IT6A 2PV1A 4Q7NA 1FFRA 1NWTA 1H0IA 2M1IA 4LAWA 2PPOA 3TCZA 1JCHB 3QOKA 3PR9A 1D7IA 2XPBA 3ARYA 1ZL1A 4DZ3A 3UQIA 4FAPA 3IK8A 2DT3A 4Z2LA 1LL6A 4UDMA 1R9HA 1E6PA 1B6CA 1FKLA 1D7HA 1F40A 1W1PA 1NSGA 1FKDA 1ZB5A 1NWRA 3KACA 2KE0A 3WKZA 1SYTA 2O9OA 2MLZA 4TW6A 3O5RA 1GUVA 4O2TA 2WLYA 1ZBKA 2DG4A 3ARXA 4U85A 3TDBA 1X6LA 2XP8A 4DT4A 3O5QA 4JFJA 2RUQA 1LJYA 2DT2A 2PN0A 3UQAA 3JYMA 3B9EA 4DIPA 1EIBA 1QPLA 2N87A 5DF0A 1HKMA 1OWQA 2WK2A 4Z2JA 2KGJA 1BL4A 4BF8A 5BXJA 1Q6IA 4URIA 2DSVA 3JYJA 4DROA 2G41A 1K9TA 3O5MA 4GGQA 3B7XA 1OGBA 2O92A 1FD9A 4LGXA 2LPVA 1J4HA 3KAFA 1ZBCA 1WAWA 3CHDA 5JH8A 1PBKA 2AOSA 1QPFA 3PA7A 3FAPA 3IKGA 4QT3A 4QT2A 2DPEA 4P8UA 1HXVA 3LUOA 1GPFA 3IKDA 5HWCA 1E44A 4DRMA 1FKRA 3B9DA
chains in the Genus database with same CATH topology
1FAPA 3B8SA 4Z2KA 4QIBA 2VN1A 5GPRA 4S3KA 3O5PA 2PBCA 4TYOA 2MF9A 3NTPA 5GPGA 4LAXA 2XP7A 4TX0A 3RMEA 2DT0A 5J6EA 4IQ2A 3ARUA 4ODNA 4ZPWR 3I6CA 3UQBA 1JVWA 3UI4A 3O5KA 1ITXA 4Z2IA 3O5DA 1FKHA 4U86A 1C9HA 3WQWA 2LJ4A 5B8IC 1ZK6A 5HT1A 1NWSA 3RM9A 3KADA 1LQ0A 1NMWA 3RFWA 1FKIA 5HTGA 2MLXA 1E6RA 3W4RA 3O5OA 2PI6A 5DIVA 3KZ7A 2XP3A 1JNTA 1FKKA 1HJXA 1L1PA 2FDMA 4TW7A 4ODOA 4W5UA 2FKEA 3JXVA 2PPNA 3B9AA 4DRIA 2MPHA 1FKFA 5HW7A 4W9PA 2ZQTA 4DRNA 1D6OA 1JNEA 2RQSA 3AS0A 2M2AA 3AS3A 2ITKA 4ZPTR 2VCDA 3VAWA 2K8IA 4R5EA 1KFWA 3ODKA 4MNLA 2XP4A 2M08A 1BKFA 1U79A 2Q5AA 5HBFA 2RSEA 3ARPA 1E6ZA 4WK9A 4DWSD 2DG3A 3H9RB 2F4EA 3O5EA 2G8ZA 3ARSA 5DIUA 2B31A 4DRPA 3CH9A 3CHCA 1Q1CA 4MSPA 3G6MA 2ZR6A 1FKSA 1LL4A 1WNOA 5HUAA 1FKGA 3O5JA 1Q6HA 1XRVA 4HBEA 1FKTA 4ZPVR 4MNKA 2FAPA 1W9UA 2XPAA 3IHZA 1UR9A 5DITA 1ZBVA 4TW8A 1NH6A 3AS2A 1A7XA 2ZQVA 3ARZA 3NRKA 3ARRA 4WKAA 2KI3A 2KO7A 3RGCA 4WIWA 4J4OA 4WKFA 4DRHA 4Z2HA 1JNSA 2DT1A 1QZ2A 1W1YA 3KAGA 2MNTA 1FFQA 2KFWA 2LKNA 4IT4A 1FJDA 5HW6A 4C02B 3O5FA 2PV2A 1KT1A 4P8WA 4WJXA 2UZ5A 5DEZA 1IX5A 1EYMA 1ROUA 1N1AA 3WD4A 1D2KA 4HBOA 4LAYA 3TC5A 1Y0OA 4DWSB 4DRQA 4NNRA 1O6IA 2RUCA 3CGMA 1HJWA 2ESCA 2YBTA 3GPKA 1E6NA 3WQVA 4QZVB 4JYSA 4MNJA 4G50A 4NSBA 1J4IA 2XP6A 2OFNA 4N19A 2PPPA 3ARTA 4KQZA 2RURA 1W9VA 3EY6A 1TFVA 4W9QA 1RD6A 3MDYB 1ZBWA 1OGGA 3WD0A 2DSUA 2WLZA 4TNSA 4DWSA 4KR0B 2IF4A 4MPKA 4MTVA 1EHNA 2ZQUA 3OOBA 4HARA 1FKJA 3ALGA 3CHFA 1UR8A 3CZ8A 1GOIA 4NZCA 3KAIA 1LG2A 4G2PA 1Q6UA 4IPXA 3AS1A 1HJVA 1XHGA 4IQCA 4FN2A 4PTMA 3ARVA 1JNDA 1TCOC 3PRAA 4ODQA 3PRDA 4J4NA 1FKBA 2D9FA 1M5YA 3ALFA 4ITZA 2QF8A 1SR0A 1D7JA 3WL1A 4ODLA 4ODPA 2L2SA 3AQUA 4DH0A 1ROTA 1EDQA 4LAVA 1W26A 2LGOA 4ODRA 4Q22A 1H0GA 3ARQA 3NI6A 2A3BA 2MLYA 3CGNA 3G6LA 3WIJA 4JFIA 4JFKA 4XAKA 4ODMA 5I98A 2OLHA 1VF8A 4U84A 3BXWA 3WD2A 1EQ3A 1F8AB 4MAVA 3UI6A 3WH0A 2ZR4A 2IUZA 1W1TA 2RUDA 2DSZA 3O5IA 3FXYA 2XP5A 4JFMA 3UI5A 3UF8A 1NMVA 4MGVA 3WD1A 4ML4A 3ARWA 4GIVA 2F2DA 3CHEA 5HKGA 4P8VA 1LG1A 1HKKA 2PV3A 5D75A 3RM4A 4AY1A 1LL7A 1YW5A 2A3AA 4MNMA 4L72B 3O5LA 4DWSC 1WB0A 1W1VA 2DG9A 2F21A 1J4RA 2A3EA 1KT0A 3PRBA 4ODKA 1W9PA 4ZS6A 1T11A 4P8XA 3WD3A 3WL0A 3KCEA 2WM0A 1X6NA 3KABA 2ZR5A 3RM8A 4DZ2A 2KR7A 1ZU8A 5HW8A 2Y78A 2AWGA 1PINA 1E15A 2A3CA 2YBUA 4DRJA 4DRKA 1ZCNA 1YATA 2JZVA 4JFLA 5DO2A 3OA5A 1P5QA 3KAHA 1E9LA 1J6YA 2ZQSA 3FY1A 4WKHA 1CTNA 4W9OA 4L3NA 1HKIA 4R0XA 5HWBA 2XP9A 1HKJA 2DSWA 4S3JA 1NWUA 3AROA 5GQBA 3O5GA 4Z2GA 4IT6A 2PV1A 4Q7NA 1FFRA 1NWTA 1H0IA 2M1IA 4LAWA 2PPOA 3TCZA 3QOKA 3PR9A 1D7IA 2XPBA 3ARYA 1ZL1A 4DZ3A 3UQIA 4FAPA 3IK8A 2DT3A 4Z2LA 1LL6A 1R9HA 1E6PA 1B6CA 1FKLA 1D7HA 1F40A 1W1PA 1NSGA 1FKDA 1ZB5A 1NWRA 3KACA 2KE0A 3WKZA 1SYTA 2O9OA 2MLZA 4TW6A 3O5RA 1GUVA 4O2TA 2WLYA 1ZBKA 2DG4A 3ARXA 4U85A 3TDBA 1X6LA 2XP8A 4DT4A 3O5QA 4JFJA 2RUQA 1LJYA 2DT2A 3UQAA 3JYMA 3B9EA 4DIPA 1EIBA 1QPLA 2N87A 5DF0A 1HKMA 1OWQA 2WK2A 4Z2JA 2KGJA 1BL4A 4BF8A 5BXJA 1Q6IA 4URIA 2DSVA 3JYJA 4DROA 2G41A 1K9TA 3O5MA 4GGQA 3B7XA 1OGBA 2O92A 1FD9A 4LGXA 2LPVA 1J4HA 3KAFA 1ZBCA 1WAWA 3CHDA 5JH8A 1PBKA 2AOSA 1QPFA 3PA7A 3FAPA 3IKGA 4QT3A 4QT2A 2DPEA 4P8UA 1HXVA 3LUOA 1GPFA 3IKDA 5HWCA 4DRMA 1FKRA 3B9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FAP A;  4IPX A;  3KAH A;  2ZR6 A;  4IQC A;  1FKS A;  4FN2 A;  4QIB A;  1J6Y A;  2VN1 A;  2ZQS A;  1TCO C;  3O5P A;  2PBC A;  4ODQ A;  3PRD A;  4J4N A;  1FKG A;  4TYO A;  3O5J A;  4W9O A;  1FKB A;  5HUA A;  1Q6H A;  2D9F A;  1M5Y A;  2MF9 A;  3NTP A;  4LAX A;  4R0X A;  5GPG A;  2XP7 A;  1FKT A;  4TX0 A;  4ITZ A;  5HWB A;  2XP9 A;  5J6E A;  1D7J A;  4IQ2 A;  4ODN A;  2FAP A;  4ODL A;  3I6C A;  4ODP A;  2XPA A;  3UQB A;  3O5G A;  1JVW A;  2L2S A;  3IHZ A;  2PV1 A;  4DH0 A;  1ROT A;  4LAW A;  2M1I A;  5DIT A;  2PPO A;  4LAV A;  3UI4 A;  3O5K A;  1W26 A;  4TW8 A;  3TCZ A;  2LGO A;  4ODR A;  1D7I A;  2XPB A;  3O5D A;  1A7X A;  3NI6 A;  1FKH A;  4U86 A;  2MLY A;  4DZ3 A;  3UQI A;  4FAP A;  2ZQV A;  3IK8 A;  1C9H A;  3NRK A;  2LJ4 A;  5B8I C;  1ZK6 A;  1R9H A;  5HT1 A;  1B6C A;  1FKL A;  1D7H A;  2KI3 A;  2KO7 A;  3CGN A;  3KAD A;  3RGC A;  4JFI A;  1F40 A;  1NMW A;  4JFK A;  1NSG A;  3RFW A;  1FKI A;  5HTG A;  4J4O A;  1FKD A;  4ODM A;  4DRH A;  2MLX A;  5I98 A;  1JNS A;  3KAC A;  1L1P A;  2KE0 A;  3O5O A;  2MLZ A;  4TW6 A;  1QZ2 A;  4U84 A;  3O5R A;  5DIV A;  3KAG A;  2MNT A;  4O2T A;  2KFW A;  2LKN A;  3KZ7 A;  2DG4 A;  2XP3 A;  1FJD A;  1EQ3 A;  1F8A B;  1JNT A;  3UI6 A;  5HW6 A;  1FKK A;  2ZR4 A;  3O5F A;  4U85 A;  3TDB A;  3WH0 A;  4C02 B;  2XP8 A;  4TW7 A;  2RUD A;  4DT4 A;  4ODO A;  2PV2 A;  3O5Q A;  1KT1 A;  2RUQ A;  4JFJ A;  2FKE A;  3O5I A;  2UZ5 A;  3JXV A;  4JFL A;  2PPN A;  2XP5 A;  1EYM A;  1ROU A;  4JFM A;  3UI5 A;  3JYM A;  3UQA A;  4DRI A;  1N1A A;  2MPH A;  3UF8 A;  1FKF A;  4DIP A;  1NMV A;  5HW7 A;  4MGV A;  1QPL A;  2N87 A;  2ZQT A;  4W9P A;  4GIV A;  2F2D A;  2KGJ A;  4LAY A;  4DRN A;  1BL4 A;  1D6O A;  4BF8 A;  5HKG A;  5BXJ A;  2PV3 A;  5D75 A;  3TC5 A;  2RQS A;  1Y0O A;  1Q6I A;  4DRQ A;  2M2A A;  3JYJ A;  4DRO A;  4NNR A;  1YW5 A;  2RUC A;  3CGM A;  2ITK A;  3GPK A;  3O5M A;  4GGQ A;  3O5L A;  3B7X A;  2VCD A;  4JYS A;  1FD9 A;  2LPV A;  3VAW A;  2K8I A;  1J4H A;  4G50 A;  1J4I A;  2DG9 A;  2XP6 A;  2F21 A;  2OFN A;  2PPP A;  3KAF A;  3ODK A;  1J4R A;  4N19 A;  1KT0 A;  2XP4 A;  3PRB A;  2RUR A;  2M08 A;  4ODK A;  1BKF A;  1U79 A;  3EY6 A;  4W9Q A;  2Q5A A;  3MDY B;  1T11 A;  1PBK A;  2RSE A;  1QPF A;  3PA7 A;  3FAP A;  3IKG A;  3KCE A;  4QT3 A;  2DG3 A;  3H9R B;  4QT2 A;  4TNS A;  3KAB A;  2F4E A;  2ZR5 A;  2IF4 A;  4DZ2 A;  2ZQU A;  2KR7 A;  3O5E A;  3OOB A;  1FKJ A;  5HW8 A;  2Y78 A;  1HXV A;  3LUO A;  5DIU A;  2AWG A;  1PIN A;  4DRP A;  3IKD A;  5HWC A;  1Q1C A;  4MSP A;  4DRM A;  4DRJ A;  4DRK A;  1ZCN A;  1YAT A;  3KAI A;  1FKR A;  2JZV A;  4G2P A;  1Q6U A;  1P5Q A; 
#chains in the Genus database with same CATH topology
 1FAP A;  3B8S A;  4Z2K A;  4QIB A;  2VN1 A;  5GPR A;  4S3K A;  1GRJ A;  3O5P A;  2PBC A;  4TYO A;  2MF9 A;  3NTP A;  5GPG A;  4LAX A;  2XP7 A;  4TX0 A;  3RME A;  2DT0 A;  5J6E A;  4IQ2 A;  3ARU A;  4ODN A;  4ZPW R;  3I6C A;  3UQB A;  1JVW A;  3UI4 A;  3O5K A;  1ITX A;  4Z2I A;  3O5D A;  1FKH A;  4U86 A;  1C9H A;  3WQW A;  2LJ4 A;  5B8I C;  1ZK6 A;  5HT1 A;  1NWS A;  3RM9 A;  3KAD A;  1LQ0 A;  3BMB A;  2ETN A;  1NMW A;  3RFW A;  1FKI A;  5HTG A;  2MLX A;  1E6R A;  3W4R A;  3O5O A;  2PI6 A;  5DIV A;  3KZ7 A;  2EUL A;  2XP3 A;  1JNT A;  1FKK A;  1HJX A;  1L1P A;  2FDM A;  4TW7 A;  4ODO A;  4W5U A;  2FKE A;  3JXV A;  2PPN A;  3B9A A;  4DRI A;  2MPH A;  1FKF A;  5HW7 A;  4W9P A;  2ZQT A;  4DRN A;  1D6O A;  1JNE A;  2RQS A;  3AS0 A;  2M2A A;  3AS3 A;  2ITK A;  4ZPT R;  2VCD A;  3VAW A;  2K8I A;  4R5E A;  1KFW A;  3ODK A;  4MNL A;  2XP4 A;  2M08 A;  1BKF A;  1U79 A;  2Q5A A;  5HBF A;  2RSE A;  3ARP A;  1E6Z A;  2F23 A;  4WK9 A;  4DWS D;  2DG3 A;  3H9R B;  2F4E A;  2B5U B;  3O5E A;  2G8Z A;  3ARS A;  5DIU A;  2B31 A;  4DRP A;  3CH9 A;  3CHC A;  1Q1C A;  4MSP A;  3G6M A;  2ZR6 A;  1FKS A;  1LL4 A;  1WNO A;  5HUA A;  1FKG A;  3O5J A;  1Q6H A;  1XRV A;  4HBE A;  1FKT A;  4ZPV R;  4MNK A;  2FAP A;  1W9U A;  2XPA A;  3IHZ A;  1UR9 A;  5DIT A;  1ZBV A;  4TW8 A;  1NH6 A;  3AS2 A;  1A7X A;  2ZQV A;  3ARZ A;  3NRK A;  3ARR A;  4WKA A;  2KI3 A;  2KO7 A;  3RGC A;  4WIW A;  4J4O A;  4WKF A;  4DRH A;  4Z2H A;  1JNS A;  2DT1 A;  1QZ2 A;  1W1Y A;  3KAG A;  2MNT A;  1FFQ A;  2KFW A;  2LKN A;  4IT4 A;  1FJD A;  5HW6 A;  4C02 B;  3O5F A;  2PV2 A;  1KT1 A;  4P8W A;  4WJX A;  2UZ5 A;  5DEZ A;  1IX5 A;  1EYM A;  1ROU A;  1N1A A;  3WD4 A;  1D2K A;  4HBO A;  4LAY A;  2P4V A;  3TC5 A;  1Y0O A;  4DWS B;  4DRQ A;  4NNR A;  1O6I A;  2RUC A;  3CGM A;  1HJW A;  2ESC A;  2YBT A;  3GPK A;  1E6N A;  3WQV A;  4QZV B;  4JYS A;  4MNJ A;  4G50 A;  4NSB A;  1J4I A;  2XP6 A;  2OFN A;  4N19 A;  2PPP A;  3ART A;  4KQZ A;  2RUR A;  1W9V A;  3EY6 A;  1TFV A;  4W9Q A;  1RD6 A;  3MDY B;  1ZBW A;  1OGG A;  3WD0 A;  2DSU A;  2WLZ A;  4TNS A;  4DWS A;  4KR0 B;  2IF4 A;  4MPK A;  4MTV A;  1EHN A;  2ZQU A;  3OOB A;  4HAR A;  1FKJ A;  3ALG A;  3CHF A;  1UR8 A;  3CZ8 A;  1GOI A;  4NZC A;  3KAI A;  1LG2 A;  4G2P A;  1Q6U A;  4IPX A;  3AS1 A;  1HJV A;  1XHG A;  4IQC A;  4FN2 A;  4PTM A;  3ARV A;  1JND A;  1TCO C;  3PRA A;  4ODQ A;  3PRD A;  4J4N A;  1FKB A;  2D9F A;  1M5Y A;  3ALF A;  4ITZ A;  2QF8 A;  1SR0 A;  1D7J A;  3WL1 A;  4ODL A;  4ODP A;  2L2S A;  3AQU A;  4DH0 A;  1ROT A;  1EDQ A;  4LAV A;  1W26 A;  2LGO A;  4ODR A;  4Q22 A;  3EIP A;  1H0G A;  3ARQ A;  3NI6 A;  2A3B A;  2MLY A;  3CGN A;  3G6L A;  3WIJ A;  4JFI A;  4JFK A;  4XAK A;  4ODM A;  5I98 A;  2OLH A;  1VF8 A;  4U84 A;  3BXW A;  3WD2 A;  1EQ3 A;  1F8A B;  4MAV A;  3UI6 A;  3WH0 A;  2ZR4 A;  2IUZ A;  1W1T A;  2RUD A;  2DSZ A;  3O5I A;  3FXY A;  2XP5 A;  4JFM A;  3UI5 A;  3UF8 A;  1NMV A;  4MGV A;  3WD1 A;  4ML4 A;  3ARW A;  4GIV A;  2F2D A;  3CHE A;  5HKG A;  4P8V A;  1LG1 A;  1HKK A;  2PV3 A;  5D75 A;  3RM4 A;  4AY1 A;  1LL7 A;  1YW5 A;  2A3A A;  4MNM A;  4L72 B;  3O5L A;  4DWS C;  1WB0 A;  1W1V A;  2DG9 A;  2F21 A;  1J4R A;  2A3E A;  1KT0 A;  3PRB A;  4ODK A;  1W9P A;  4ZS6 A;  1T11 A;  4P8X A;  3WD3 A;  3WL0 A;  3KCE A;  2WM0 A;  1X6N A;  3KAB A;  2ZR5 A;  3RM8 A;  4DZ2 A;  2KR7 A;  1ZU8 A;  5HW8 A;  2Y78 A;  2AWG A;  1PIN A;  1E15 A;  2A3C A;  2YBU A;  4DRJ A;  4DRK A;  1ZCN A;  1YAT A;  3GU0 A;  2JZV A;  4JFL A;  5DO2 A;  3OA5 A;  1P5Q A;  3GTY X;  3KAH A;  1E9L A;  1J6Y A;  2ZQS A;  3FY1 A;  4WKH A;  1CTN A;  4W9O A;  4L3N A;  1HKI A;  4R0X A;  5HWB A;  2XP9 A;  1HKJ A;  2DSW A;  4S3J A;  1NWU A;  3ARO A;  5GQB A;  3O5G A;  4Z2G A;  4IT6 A;  2PV1 A;  4Q7N A;  1FFR A;  1NWT A;  1H0I A;  2M1I A;  4LAW A;  2PPO A;  3TCZ A;  1JCH B;  3QOK A;  3PR9 A;  1D7I A;  2XPB A;  3ARY A;  1ZL1 A;  4DZ3 A;  3UQI A;  4FAP A;  3IK8 A;  2DT3 A;  4Z2L A;  1LL6 A;  4UDM A;  1R9H A;  1E6P A;  1B6C A;  1FKL A;  1D7H A;  1F40 A;  1W1P A;  1NSG A;  1FKD A;  1ZB5 A;  1NWR A;  3KAC A;  2KE0 A;  3WKZ A;  1SYT A;  2O9O A;  2MLZ A;  4TW6 A;  3O5R A;  1GUV A;  4O2T A;  2WLY A;  1ZBK A;  2DG4 A;  3ARX A;  4U85 A;  3TDB A;  1X6L A;  2XP8 A;  4DT4 A;  3O5Q A;  4JFJ A;  2RUQ A;  1LJY A;  2DT2 A;  2PN0 A;  3UQA A;  3JYM A;  3B9E A;  4DIP A;  1EIB A;  1QPL A;  2N87 A;  5DF0 A;  1HKM A;  1OWQ A;  2WK2 A;  4Z2J A;  2KGJ A;  1BL4 A;  4BF8 A;  5BXJ A;  1Q6I A;  4URI A;  2DSV A;  3JYJ A;  4DRO A;  2G41 A;  1K9T A;  3O5M A;  4GGQ A;  3B7X A;  1OGB A;  2O92 A;  1FD9 A;  4LGX A;  2LPV A;  1J4H A;  3KAF A;  1ZBC A;  1WAW A;  3CHD A;  5JH8 A;  1PBK A;  2AOS A;  1QPF A;  3PA7 A;  3FAP A;  3IKG A;  4QT3 A;  4QT2 A;  2DPE A;  4P8U A;  1HXV A;  3LUO A;  1GPF A;  3IKD A;  5HWC A;  1E44 A;  4DRM A;  1FKR A;  3B9D A; 
#chains in the Genus database with same CATH homology
 1FAP A;  3B8S A;  4Z2K A;  4QIB A;  2VN1 A;  5GPR A;  4S3K A;  3O5P A;  2PBC A;  4TYO A;  2MF9 A;  3NTP A;  5GPG A;  4LAX A;  2XP7 A;  4TX0 A;  3RME A;  2DT0 A;  5J6E A;  4IQ2 A;  3ARU A;  4ODN A;  4ZPW R;  3I6C A;  3UQB A;  1JVW A;  3UI4 A;  3O5K A;  1ITX A;  4Z2I A;  3O5D A;  1FKH A;  4U86 A;  1C9H A;  3WQW A;  2LJ4 A;  5B8I C;  1ZK6 A;  5HT1 A;  1NWS A;  3RM9 A;  3KAD A;  1LQ0 A;  1NMW A;  3RFW A;  1FKI A;  5HTG A;  2MLX A;  1E6R A;  3W4R A;  3O5O A;  2PI6 A;  5DIV A;  3KZ7 A;  2XP3 A;  1JNT A;  1FKK A;  1HJX A;  1L1P A;  2FDM A;  4TW7 A;  4ODO A;  4W5U A;  2FKE A;  3JXV A;  2PPN A;  3B9A A;  4DRI A;  2MPH A;  1FKF A;  5HW7 A;  4W9P A;  2ZQT A;  4DRN A;  1D6O A;  1JNE A;  2RQS A;  3AS0 A;  2M2A A;  3AS3 A;  2ITK A;  4ZPT R;  2VCD A;  3VAW A;  2K8I A;  4R5E A;  1KFW A;  3ODK A;  4MNL A;  2XP4 A;  2M08 A;  1BKF A;  1U79 A;  2Q5A A;  5HBF A;  2RSE A;  3ARP A;  1E6Z A;  4WK9 A;  4DWS D;  2DG3 A;  3H9R B;  2F4E A;  3O5E A;  2G8Z A;  3ARS A;  5DIU A;  2B31 A;  4DRP A;  3CH9 A;  3CHC A;  1Q1C A;  4MSP A;  3G6M A;  2ZR6 A;  1FKS A;  1LL4 A;  1WNO A;  5HUA A;  1FKG A;  3O5J A;  1Q6H A;  1XRV A;  4HBE A;  1FKT A;  4ZPV R;  4MNK A;  2FAP A;  1W9U A;  2XPA A;  3IHZ A;  1UR9 A;  5DIT A;  1ZBV A;  4TW8 A;  1NH6 A;  3AS2 A;  1A7X A;  2ZQV A;  3ARZ A;  3NRK A;  3ARR A;  4WKA A;  2KI3 A;  2KO7 A;  3RGC A;  4WIW A;  4J4O A;  4WKF A;  4DRH A;  4Z2H A;  1JNS A;  2DT1 A;  1QZ2 A;  1W1Y A;  3KAG A;  2MNT A;  1FFQ A;  2KFW A;  2LKN A;  4IT4 A;  1FJD A;  5HW6 A;  4C02 B;  3O5F A;  2PV2 A;  1KT1 A;  4P8W A;  4WJX A;  2UZ5 A;  5DEZ A;  1IX5 A;  1EYM A;  1ROU A;  1N1A A;  3WD4 A;  1D2K A;  4HBO A;  4LAY A;  3TC5 A;  1Y0O A;  4DWS B;  4DRQ A;  4NNR A;  1O6I A;  2RUC A;  3CGM A;  1HJW A;  2ESC A;  2YBT A;  3GPK A;  1E6N A;  3WQV A;  4QZV B;  4JYS A;  4MNJ A;  4G50 A;  4NSB A;  1J4I A;  2XP6 A;  2OFN A;  4N19 A;  2PPP A;  3ART A;  4KQZ A;  2RUR A;  1W9V A;  3EY6 A;  1TFV A;  4W9Q A;  1RD6 A;  3MDY B;  1ZBW A;  1OGG A;  3WD0 A;  2DSU A;  2WLZ A;  4TNS A;  4DWS A;  4KR0 B;  2IF4 A;  4MPK A;  4MTV A;  1EHN A;  2ZQU A;  3OOB A;  4HAR A;  1FKJ A;  3ALG A;  3CHF A;  1UR8 A;  3CZ8 A;  1GOI A;  4NZC A;  3KAI A;  1LG2 A;  4G2P A;  1Q6U A;  4IPX A;  3AS1 A;  1HJV A;  1XHG A;  4IQC A;  4FN2 A;  4PTM A;  3ARV A;  1JND A;  1TCO C;  3PRA A;  4ODQ A;  3PRD A;  4J4N A;  1FKB A;  2D9F A;  1M5Y A;  3ALF A;  4ITZ A;  2QF8 A;  1SR0 A;  1D7J A;  3WL1 A;  4ODL A;  4ODP A;  2L2S A;  3AQU A;  4DH0 A;  1ROT A;  1EDQ A;  4LAV A;  1W26 A;  2LGO A;  4ODR A;  4Q22 A;  1H0G A;  3ARQ A;  3NI6 A;  2A3B A;  2MLY A;  3CGN A;  3G6L A;  3WIJ A;  4JFI A;  4JFK A;  4XAK A;  4ODM A;  5I98 A;  2OLH A;  1VF8 A;  4U84 A;  3BXW A;  3WD2 A;  1EQ3 A;  1F8A B;  4MAV A;  3UI6 A;  3WH0 A;  2ZR4 A;  2IUZ A;  1W1T A;  2RUD A;  2DSZ A;  3O5I A;  3FXY A;  2XP5 A;  4JFM A;  3UI5 A;  3UF8 A;  1NMV A;  4MGV A;  3WD1 A;  4ML4 A;  3ARW A;  4GIV A;  2F2D A;  3CHE A;  5HKG A;  4P8V A;  1LG1 A;  1HKK A;  2PV3 A;  5D75 A;  3RM4 A;  4AY1 A;  1LL7 A;  1YW5 A;  2A3A A;  4MNM A;  4L72 B;  3O5L A;  4DWS C;  1WB0 A;  1W1V A;  2DG9 A;  2F21 A;  1J4R A;  2A3E A;  1KT0 A;  3PRB A;  4ODK A;  1W9P A;  4ZS6 A;  1T11 A;  4P8X A;  3WD3 A;  3WL0 A;  3KCE A;  2WM0 A;  1X6N A;  3KAB A;  2ZR5 A;  3RM8 A;  4DZ2 A;  2KR7 A;  1ZU8 A;  5HW8 A;  2Y78 A;  2AWG A;  1PIN A;  1E15 A;  2A3C A;  2YBU A;  4DRJ A;  4DRK A;  1ZCN A;  1YAT A;  2JZV A;  4JFL A;  5DO2 A;  3OA5 A;  1P5Q A;  3KAH A;  1E9L A;  1J6Y A;  2ZQS A;  3FY1 A;  4WKH A;  1CTN A;  4W9O A;  4L3N A;  1HKI A;  4R0X A;  5HWB A;  2XP9 A;  1HKJ A;  2DSW A;  4S3J A;  1NWU A;  3ARO A;  5GQB A;  3O5G A;  4Z2G A;  4IT6 A;  2PV1 A;  4Q7N A;  1FFR A;  1NWT A;  1H0I A;  2M1I A;  4LAW A;  2PPO A;  3TCZ A;  3QOK A;  3PR9 A;  1D7I A;  2XPB A;  3ARY A;  1ZL1 A;  4DZ3 A;  3UQI A;  4FAP A;  3IK8 A;  2DT3 A;  4Z2L A;  1LL6 A;  1R9H A;  1E6P A;  1B6C A;  1FKL A;  1D7H A;  1F40 A;  1W1P A;  1NSG A;  1FKD A;  1ZB5 A;  1NWR A;  3KAC A;  2KE0 A;  3WKZ A;  1SYT A;  2O9O A;  2MLZ A;  4TW6 A;  3O5R A;  1GUV A;  4O2T A;  2WLY A;  1ZBK A;  2DG4 A;  3ARX A;  4U85 A;  3TDB A;  1X6L A;  2XP8 A;  4DT4 A;  3O5Q A;  4JFJ A;  2RUQ A;  1LJY A;  2DT2 A;  3UQA A;  3JYM A;  3B9E A;  4DIP A;  1EIB A;  1QPL A;  2N87 A;  5DF0 A;  1HKM A;  1OWQ A;  2WK2 A;  4Z2J A;  2KGJ A;  1BL4 A;  4BF8 A;  5BXJ A;  1Q6I A;  4URI A;  2DSV A;  3JYJ A;  4DRO A;  2G41 A;  1K9T A;  3O5M A;  4GGQ A;  3B7X A;  1OGB A;  2O92 A;  1FD9 A;  4LGX A;  2LPV A;  1J4H A;  3KAF A;  1ZBC A;  1WAW A;  3CHD A;  5JH8 A;  1PBK A;  2AOS A;  1QPF A;  3PA7 A;  3FAP A;  3IKG A;  4QT3 A;  4QT2 A;  2DPE A;  4P8U A;  1HXV A;  3LUO A;  1GPF A;  3IKD A;  5HWC A;  4DRM A;  1FKR A;  3B9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...