1E44A

Ribonuclease domain of colicin e3 in complex with its immunity protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
84
structure length
84
Chain Sequence
GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNITY PROTEIN
publication title Inhibition of a Ribosome Inactivating Ribonuclease: The Crystal Structure of the Cytotoxic Domain of Colicin E3 in Complex with its Immunity Protein
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribonuclease
total genus 20
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2000-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03513 Cloacin_immun Cloacin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.20 Alpha Beta Roll Chitinase A; domain 3 Cloacin immunity protein 1e44A00
1JCHB 1E44A 4UDMA 2B5UB 3EIPA
chains in the Genus database with same CATH superfamily
1F40A 1ROUA 1W1TA 2M1IA 1M5YA 4TYOA 5HT1A 2MLZA 2DT1A 2ZQSA 4ODOA 3UI4A 3WD2A 4LAXA 1Y0OA 2F4EA 2LPVA 2AWGA 4IT6A 2KGJA 1FKLA 4U85A 2VN1A 2AOSA 5DO2A 4DWSC 1WAWA 2XPAA 4Z2IA 3BXWA 3MDYB 3WIJA 1FKBA 4JFIA 3KAIA 4W5UA 1J4RA 4DRIA 1LL4A 4WIWA 4HBEA 3RFWA 4LAWA 1BL4A 1N1AA 4R5EA 1WNOA 2FDMA 3ARTA 5JH8A 2VCDA 3G6LA 4DRMA 4Z2LA 3WL1A 2D9FA 4P8WA 2RSEA 3RGCA 1FKHA 1GPFA 1TCOC 1JNSA 1JCHB 4MNLA 4N19A 2UZ5A 3BMBA 5HW7A 1ZL1A 4LAVA 4QZVB 3PRAA 2F2DA 4R0XA 4NNRA 4MGVA 3TCZA 1W9PA 2MLYA 2DSWA 3IKGA 1ROTA 1L1PA 3PR9A 1QZ2A 5DIVA 1X6NA 4FAPA 3AS3A 5HW6A 2PPOA 3WD3A 4FN2A 2DG3A 2A3AA 2O92A 2QF8A 5HW8A 3KABA 1FKDA 1OGGA 3GU0A 2PI6A 5D75A 1HKJA 3KAHA 1HJVA 4DWSD 1YATA 2DT0A 3ARZA 1NMVA 3EIPA 1NWUA 4G2PA 1D7HA 4S3KA 1F8AB 1QPLA 2ZR4A 3OOBA 4URIA 5I98A 3KCEA 1H0IA 1EIBA 4KR0B 2A3EA 4MAVA 1C9HA 4W9QA 1HXVA 1ZBVA 4P8UA 2N87A 3PA7A 2JZVA 2A3BA 1H0GA 3G6MA 2XP5A 1GOIA 4DZ3A 1WB0A 2YBUA 2KO7A 4ODLA 3CH9A 3O5FA 3UI5A 2PPNA 4DRHA 4Q22A 1E6ZA 3B9AA 3B9EA 3JYJA 4JYSA 1Q6UA 1HJXA 4ZPVR 3AS0A 4P8VA 2PN0A 4NSBA 1LQ0A 4NZCA 2DT2A 3B8SA 3CHFA 1D7JA 1EYMA 2P4VA 1E6RA 1B6CA 1W9UA 3WD1A 1RD6A 4MNMA 3O5MA 1FKSA 3GTYX 3ALGA 4HBOA 3UQIA 1HKMA 2DG9A 4U86A 4WKHA 3B7XA 2OLHA 3O5PA 5DITA 4DIPA 4TNSA 4GGQA 4U84A 2XP7A 4S3JA 4TX0A 3UQAA 1J6YA 3O5QA 2WK2A 1E44A 1KT0A 5GPRA 4TW8A 2LJ4A 1D7IA 3O5DA 1A7XA 3KAFA 4WK9A 4QT2A 1FKIA 2B5UB 4DWSB 1W9VA 3CZ8A 1HJWA 3PRBA 3ARSA 5HUAA 4P8XA 3CHEA 3AS1A 2XPBA 1KT1A 3QOKA 3NI6A 1P5QA 1W1VA 1SR0A 3W4RA 2DSUA 3TC5A 2MLXA 3O5LA 3O5RA 2KR7A 2ITKA 2L2SA 2FKEA 3ARPA 2MF9A 3B9DA 2F21A 1FKTA 2XP6A 3UI6A 5HWCA 5HTGA 1FJDA 1LG2A 1PINA 1YW5A 2EULA 1FD9A 1SYTA 2K8IA 4Z2HA 2B31A 4IQCA 2RUQA 2RQSA 3KADA 2ZQVA 3NRKA 5GQBA 1E6PA 1XRVA 3KZ7A 2F23A 3ARQA 5DEZA 4ODRA 3O5EA 3CGMA 3O5OA 4DH0A 3WQWA 3FXYA 1NWSA 2ZQTA 3CHCA 4HARA 2IUZA 4ODPA 5HWBA 3ARYA 4XAKA 4ZPTR 1JVWA 1EHNA 2PV3A 2G41A 1UR8A 3AS2A 3I6CA 1ZB5A 1NMWA 1E9LA 3KAGA 1LL6A 5HKGA 3PRDA 3OA5A 1NWRA 5DF0A 3ARRA 4MNKA 3FY1A 1JNTA 1D2KA 1NSGA 2FAPA 3JXVA 4W9PA 4Q7NA 3RM4A 2LGOA 1UR9A 3WQVA 1Q1CA 2M2AA 1EQ3A 1OWQA 3UF8A 2Y78A 1D6OA 2XP8A 2ZQUA 1W1PA 2IF4A 3O5IA 3AROA 3ARUA 1E15A 4DRPA 3CGNA 1KFWA 4Z2GA 4IT4A 1ZBWA 4ODQA 2LKNA 4ODNA 4IQ2A 3KACA 3RM8A 3EY6A 1E6NA 2PV1A 3JYMA 2ZR6A 1GRJA 4ZPWR 1R9HA 1T11A 3VAWA 2PPPA 2DSZA 2RUDA 2M08A 4C02B 2XP9A 3RMEA 4DRJA 4DZ2A 4Z2KA 4J4NA 4DT4A 2A3CA 2KI3A 3O5JA 4L3NA 5J6EA 3WKZA 1ZK6A 3ARWA 4ODKA 3ARXA 1FKJA 4L72B 1CTNA 4BF8A 2PBCA 1W1YA 4WJXA 1QPFA 2OFNA 3ODKA 4UDMA 1FKGA 3AQUA 2ZR5A 4Z2JA 1ZBCA 3GPKA 4IPXA 4DRQA 1FFRA 4JFKA 2XP3A 4QIBA 4LAYA 4DWSA 1O6IA 3UQBA 1FAPA 2DPEA 5GPGA 2ESCA 4QT3A 1X6LA 3O5GA 1FKKA 1W26A 1JNDA 1Q6HA 1HKIA 2DG4A 4DRKA 3LUOA 4WKAA 1NH6A 4AY1A 1J4IA 4KQZA 4TW6A 4ODMA 5DIUA 2RUCA 4JFMA 4DROA 1ZU8A 2XP4A 4ITZA 2MNTA 1PBKA 5BXJA 4O2TA 1GUVA 3H9RB 2PV2A 2KE0A 1FKFA 2MPHA 1ZCNA 3ARVA 4MNJA 3ALFA 2DSVA 1EDQA 4J4OA 1IX5A 3RM9A 4GIVA 1LJYA 2G8ZA 3IK8A 3FAPA 5B8IC 1VF8A 1U79A 4G50A 1ITXA 4MPKA 3WD4A 2DT3A 3NTPA 2WLYA 1XHGA 2ETNA 4ML4A 3WD0A 2WLZA 4MTVA 1TFVA 1ZBKA 2Q5AA 1BKFA 1HKKA 4TW7A 3WH0A 3IHZA 4LGXA 2YBTA 3CHDA 4ZS6A 1J4HA 1JNEA 3TDBA 1LL7A 4MSPA 3WL0A 1FFQA 2KFWA 2RURA 1Q6IA 3O5KA 4JFJA 1LG1A 4PTMA 4DRNA 5HBFA 1FKRA 4JFLA 2O9OA 2WM0A 3IKDA 4WKFA 1K9TA 4W9OA 1OGBA 1NWTA
chains in the Genus database with same CATH topology
1JCHB 1E44A 4UDMA 2B5UB 3EIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JCH B;  1E44 A;  4UDM A;  2B5U B;  3EIP A; 
#chains in the Genus database with same CATH topology
 1F40 A;  1ROU A;  1W1T A;  2M1I A;  1M5Y A;  4TYO A;  5HT1 A;  2MLZ A;  2DT1 A;  2ZQS A;  4ODO A;  3UI4 A;  3WD2 A;  4LAX A;  1Y0O A;  2F4E A;  2LPV A;  2AWG A;  4IT6 A;  2KGJ A;  1FKL A;  4U85 A;  2VN1 A;  2AOS A;  5DO2 A;  4DWS C;  1WAW A;  2XPA A;  4Z2I A;  3BXW A;  3MDY B;  3WIJ A;  1FKB A;  4JFI A;  3KAI A;  4W5U A;  1J4R A;  4DRI A;  1LL4 A;  4WIW A;  4HBE A;  3RFW A;  4LAW A;  1BL4 A;  1N1A A;  4R5E A;  1WNO A;  2FDM A;  3ART A;  5JH8 A;  2VCD A;  3G6L A;  4DRM A;  4Z2L A;  3WL1 A;  2D9F A;  4P8W A;  2RSE A;  3RGC A;  1FKH A;  1GPF A;  1TCO C;  1JNS A;  1JCH B;  4MNL A;  4N19 A;  2UZ5 A;  3BMB A;  5HW7 A;  1ZL1 A;  4LAV A;  4QZV B;  3PRA A;  2F2D A;  4R0X A;  4NNR A;  4MGV A;  3TCZ A;  1W9P A;  2MLY A;  2DSW A;  3IKG A;  1ROT A;  1L1P A;  3PR9 A;  1QZ2 A;  5DIV A;  1X6N A;  4FAP A;  3AS3 A;  5HW6 A;  2PPO A;  3WD3 A;  4FN2 A;  2DG3 A;  2A3A A;  2O92 A;  2QF8 A;  5HW8 A;  3KAB A;  1FKD A;  1OGG A;  3GU0 A;  2PI6 A;  5D75 A;  1HKJ A;  3KAH A;  1HJV A;  4DWS D;  1YAT A;  2DT0 A;  3ARZ A;  1NMV A;  3EIP A;  1NWU A;  4G2P A;  1D7H A;  4S3K A;  1F8A B;  1QPL A;  2ZR4 A;  3OOB A;  4URI A;  5I98 A;  3KCE A;  1H0I A;  1EIB A;  4KR0 B;  2A3E A;  4MAV A;  1C9H A;  4W9Q A;  1HXV A;  1ZBV A;  4P8U A;  2N87 A;  3PA7 A;  2JZV A;  2A3B A;  1H0G A;  3G6M A;  2XP5 A;  1GOI A;  4DZ3 A;  1WB0 A;  2YBU A;  2KO7 A;  4ODL A;  3CH9 A;  3O5F A;  3UI5 A;  2PPN A;  4DRH A;  4Q22 A;  1E6Z A;  3B9A A;  3B9E A;  3JYJ A;  4JYS A;  1Q6U A;  1HJX A;  4ZPV R;  3AS0 A;  4P8V A;  2PN0 A;  4NSB A;  1LQ0 A;  4NZC A;  2DT2 A;  3B8S A;  3CHF A;  1D7J A;  1EYM A;  2P4V A;  1E6R A;  1B6C A;  1W9U A;  3WD1 A;  1RD6 A;  4MNM A;  3O5M A;  1FKS A;  3GTY X;  3ALG A;  4HBO A;  3UQI A;  1HKM A;  2DG9 A;  4U86 A;  4WKH A;  3B7X A;  2OLH A;  3O5P A;  5DIT A;  4DIP A;  4TNS A;  4GGQ A;  4U84 A;  2XP7 A;  4S3J A;  4TX0 A;  3UQA A;  1J6Y A;  3O5Q A;  2WK2 A;  1E44 A;  1KT0 A;  5GPR A;  4TW8 A;  2LJ4 A;  1D7I A;  3O5D A;  1A7X A;  3KAF A;  4WK9 A;  4QT2 A;  1FKI A;  2B5U B;  4DWS B;  1W9V A;  3CZ8 A;  1HJW A;  3PRB A;  3ARS A;  5HUA A;  4P8X A;  3CHE A;  3AS1 A;  2XPB A;  1KT1 A;  3QOK A;  3NI6 A;  1P5Q A;  1W1V A;  1SR0 A;  3W4R A;  2DSU A;  3TC5 A;  2MLX A;  3O5L A;  3O5R A;  2KR7 A;  2ITK A;  2L2S A;  2FKE A;  3ARP A;  2MF9 A;  3B9D A;  2F21 A;  1FKT A;  2XP6 A;  3UI6 A;  5HWC A;  5HTG A;  1FJD A;  1LG2 A;  1PIN A;  1YW5 A;  2EUL A;  1FD9 A;  1SYT A;  2K8I A;  4Z2H A;  2B31 A;  4IQC A;  2RUQ A;  2RQS A;  3KAD A;  2ZQV A;  3NRK A;  5GQB A;  1E6P A;  1XRV A;  3KZ7 A;  2F23 A;  3ARQ A;  5DEZ A;  4ODR A;  3O5E A;  3CGM A;  3O5O A;  4DH0 A;  3WQW A;  3FXY A;  1NWS A;  2ZQT A;  3CHC A;  4HAR A;  2IUZ A;  4ODP A;  5HWB A;  3ARY A;  4XAK A;  4ZPT R;  1JVW A;  1EHN A;  2PV3 A;  2G41 A;  1UR8 A;  3AS2 A;  3I6C A;  1ZB5 A;  1NMW A;  1E9L A;  3KAG A;  1LL6 A;  5HKG A;  3PRD A;  3OA5 A;  1NWR A;  5DF0 A;  3ARR A;  4MNK A;  3FY1 A;  1JNT A;  1D2K A;  1NSG A;  2FAP A;  3JXV A;  4W9P A;  4Q7N A;  3RM4 A;  2LGO A;  1UR9 A;  3WQV A;  1Q1C A;  2M2A A;  1EQ3 A;  1OWQ A;  3UF8 A;  2Y78 A;  1D6O A;  2XP8 A;  2ZQU A;  1W1P A;  2IF4 A;  3O5I A;  3ARO A;  3ARU A;  1E15 A;  4DRP A;  3CGN A;  1KFW A;  4Z2G A;  4IT4 A;  1ZBW A;  4ODQ A;  2LKN A;  4ODN A;  4IQ2 A;  3KAC A;  3RM8 A;  3EY6 A;  1E6N A;  2PV1 A;  3JYM A;  2ZR6 A;  1GRJ A;  4ZPW R;  1R9H A;  1T11 A;  3VAW A;  2PPP A;  2DSZ A;  2RUD A;  2M08 A;  4C02 B;  2XP9 A;  3RME A;  4DRJ A;  4DZ2 A;  4Z2K A;  4J4N A;  4DT4 A;  2A3C A;  2KI3 A;  3O5J A;  4L3N A;  5J6E A;  3WKZ A;  1ZK6 A;  3ARW A;  4ODK A;  3ARX A;  1FKJ A;  4L72 B;  1CTN A;  4BF8 A;  2PBC A;  1W1Y A;  4WJX A;  1QPF A;  2OFN A;  3ODK A;  4UDM A;  1FKG A;  3AQU A;  2ZR5 A;  4Z2J A;  1ZBC A;  3GPK A;  4IPX A;  4DRQ A;  1FFR A;  4JFK A;  2XP3 A;  4QIB A;  4LAY A;  4DWS A;  1O6I A;  3UQB A;  1FAP A;  2DPE A;  5GPG A;  2ESC A;  4QT3 A;  1X6L A;  3O5G A;  1FKK A;  1W26 A;  1JND A;  1Q6H A;  1HKI A;  2DG4 A;  4DRK A;  3LUO A;  4WKA A;  1NH6 A;  4AY1 A;  1J4I A;  4KQZ A;  4TW6 A;  4ODM A;  5DIU A;  2RUC A;  4JFM A;  4DRO A;  1ZU8 A;  2XP4 A;  4ITZ A;  2MNT A;  1PBK A;  5BXJ A;  4O2T A;  1GUV A;  3H9R B;  2PV2 A;  2KE0 A;  1FKF A;  2MPH A;  1ZCN A;  3ARV A;  4MNJ A;  3ALF A;  2DSV A;  1EDQ A;  4J4O A;  1IX5 A;  3RM9 A;  4GIV A;  1LJY A;  2G8Z A;  3IK8 A;  3FAP A;  5B8I C;  1VF8 A;  1U79 A;  4G50 A;  1ITX A;  4MPK A;  3WD4 A;  2DT3 A;  3NTP A;  2WLY A;  1XHG A;  2ETN A;  4ML4 A;  3WD0 A;  2WLZ A;  4MTV A;  1TFV A;  1ZBK A;  2Q5A A;  1BKF A;  1HKK A;  4TW7 A;  3WH0 A;  3IHZ A;  4LGX A;  2YBT A;  3CHD A;  4ZS6 A;  1J4H A;  1JNE A;  3TDB A;  1LL7 A;  4MSP A;  3WL0 A;  1FFQ A;  2KFW A;  2RUR A;  1Q6I A;  3O5K A;  4JFJ A;  1LG1 A;  4PTM A;  4DRN A;  5HBF A;  1FKR A;  4JFL A;  2O9O A;  2WM0 A;  3IKD A;  4WKF A;  1K9T A;  4W9O A;  1OGB A;  1NWT A; 
#chains in the Genus database with same CATH homology
 1JCH B;  1E44 A;  4UDM A;  2B5U B;  3EIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...