1E44A

Ribonuclease domain of colicin e3 in complex with its immunity protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
84
structure length
84
Chain Sequence
GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribonuclease
molecule keywords IMMUNITY PROTEIN
publication title Inhibition of a Ribosome Inactivating Ribonuclease: The Crystal Structure of the Cytotoxic Domain of Colicin E3 in Complex with its Immunity Protein
pubmed doi rcsb
source organism Escherichia coli
total genus 20
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2000-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03513 Cloacin_immun Cloacin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.20 Alpha Beta Roll Chitinase A; domain 3 Cloacin immunity protein 1e44A00
2B5UB 4UDMA 1E44A 3EIPA 1JCHB
chains in the Genus database with same CATH superfamily
1NWTA 3UQBA 1FD9A 4TW8A 3O5FA 4ODNA 1O6IA 3BMBA 3WQWA 3WD4A 3CGMA 3KADA 4NSBA 2YBUA 2DSUA 2UZ5A 4GGQA 1FAPA 4ODRA 3B9DA 3RM8A 4J4OA 4NZCA 1PBKA 5DIUA 4ML4A 2PV1A 1EYMA 2DPEA 1ZBCA 3KCEA 3G6LA 4MTVA 3GU0A 1EDQA 2PPPA 1NMWA 4ZPTR 3WL1A 3EY6A 4UDMA 5HUAA 4DRPA 1LG1A 3JXVA 2B5UB 2KE0A 2DT3A 3O5PA 4R0XA 1FFQA 4WKHA 2DT0A 1HJWA 2A3EA 4JFJA 3ODKA 1NWSA 2WM0A 3TDBA 2YBTA 2MNTA 3O5GA 1P5QA 2M08A 1GPFA 5DEZA 4DRQA 4U85A 2MLXA 5HWCA 1WNOA 4LAWA 1HKMA 1NWUA 4IPXA 3IK8A 3O5RA 2LJ4A 3AS0A 4DWSD 1UR9A 1OWQA 2XP5A 3VAWA 5HBFA 3ARXA 3AQUA 4ODKA 1NMVA 4MPKA 4QZVB 4TW6A 4W9QA 5HT1A 2F2DA 4P8XA 3RM9A 1J4HA 5GPGA 1JNTA 2PPNA 3ARWA 4FN2A 4DRMA 4PTMA 4JFLA 4FAPA 1NH6A 2ZR6A 3CGNA 2XP8A 5BXJA 1BL4A 2D9FA 4Z2KA 4N19A 2MF9A 4IT4A 3IKGA 4P8WA 1OGGA 3ARRA 2M2AA 4GIVA 4ITZA 5I98A 1Q6UA 2KGJA 3RFWA 2PBCA 2ZR5A 3CH9A 4P8VA 1M5YA 4AY1A 2XP7A 3O5JA 1W26A 3NTPA 3ARQA 3ARPA 3KZ7A 4MNMA 4TYOA 4JFMA 2O9OA 4KR0B 1LL7A 4Z2LA 1TFVA 1OGBA 4G2PA 1D7JA 2RUDA 2K8IA 4LAXA 1PINA 2DG9A 4IQ2A 2ZR4A 4W9PA 4JYSA 3WD2A 2OLHA 4ODMA 4DWSA 1HJXA 3GPKA 3KACA 2XP9A 2DT1A 5D75A 4IQCA 4KQZA 2LKNA 4DWSC 4Q22A 2PI6A 2FAPA 1FJDA 3O5KA 1B6CA 3WIJA 3I6CA 3KAFA 1Q6IA 1H0GA 1ROUA 4HARA 3PA7A 3NI6A 2RURA 1QZ2A 3O5IA 4ZPVR 1GUVA 1FKKA 3ARYA 4MGVA 2G41A 4P8UA 3LUOA 1W1YA 1YW5A 1U79A 1ZBWA 4BF8A 4IT6A 3WL0A 4G50A 1HKKA 3TC5A 4XAKA 3WD0A 3H9RB 2A3CA 1HJVA 5DITA 3CHEA 5HW7A 4DWSB 1VF8A 2DG3A 1QPFA 4TW7A 4U86A 3UF8A 4DRIA 3W4RA 1ZK6A 1XHGA 4ODOA 4L3NA 1ZBKA 2IUZA 1E6PA 4W9OA 4LGXA 5HW6A 1ZB5A 1R9HA 4WIWA 4Z2IA 3AS2A 1FKTA 1LL4A 3O5EA 1FKLA 2RUCA 2QF8A 3WD3A 3KAIA 1TCOC 3O5OA 1ZL1A 3ARUA 1FFRA 4JFKA 3RMEA 1N1AA 1K9TA 2WLYA 1ITXA 2F21A 3ALFA 3AROA 4QIBA 2DG4A 1E6RA 1WB0A 3JYMA 2FDMA 1RD6A 2DSWA 2VN1A 2ZQTA 1X6NA 4DRHA 4Z2GA 1J6YA 1LG2A 1XRVA 1HKIA 3KAHA 1Q1CA 2MPHA 3PR9A 2XP4A 3O5QA 1A7XA 3KABA 1JVWA 1IX5A 4TX0A 3CHCA 4ODQA 1JNDA 4DRNA 1KT0A 4R5EA 3CZ8A 1FKJA 2XPAA 3CHFA 1L1PA 2M1IA 3EIPA 4ZS6A 2Q5AA 2KR7A 3B8SA 3B7XA 2DSVA 1W9VA 3RM4A 4DRJA 3UI4A 1Q6HA 4L72B 3ALGA 4W5UA 1GRJA 1D2KA 1J4RA 3IKDA 2O92A 4NNRA 2KO7A 1E44A 5B8IC 1EQ3A 1T11A 2PV2A 2JZVA 3JYJA 3ARTA 2RQSA 4MNKA 1J4IA 1UR8A 1HXVA 2DT2A 3PRDA 1W1TA 4MAVA 1Y0OA 1EHNA 5JH8A 2ITKA 2MLYA 1NWRA 4ODLA 2ZQSA 5DIVA 2ZQUA 1E6NA 3BXWA 1FKBA 1D7IA 1GOIA 2A3AA 3UI5A 2DSZA 1W9UA 1D7HA 1LQ0A 4Z2HA 3UQAA 3O5MA 1E6ZA 2AWGA 3WD1A 1KT1A 2A3BA 2B31A 2WLZA 2LPVA 1SR0A 2P4VA 1F40A 4WKFA 3AS3A 2WK2A 4WKAA 2AOSA 2ETNA 3OA5A 1FKDA 4ODPA 1W1VA 1E9LA 4HBOA 4C02B 1WAWA 2OFNA 3UQIA 3B9AA 1W9PA 4DRKA 4Z2JA 4TNSA 3FY1A 2VCDA 1FKGA 3QOKA 1E15A 3PRAA 3CHDA 1LJYA 2F4EA 3ARSA 4LAVA 5DF0A 3TCZA 1D6OA 5GPRA 4DT4A 4U84A 3UI6A 3WH0A 2PPOA 1JNSA 4WK9A 3MDYB 4Q7NA 1C9HA 1JNEA 1HKJA 3FXYA 2EULA 2KFWA 4MNLA 1ZU8A 4S3JA 1FKRA 3G6MA 3KAGA 3ARZA 5GQBA 1JCHB 2Y78A 2ESCA 3O5DA 5HKGA 1FKIA 5HW8A 2G8ZA 5HWBA 1ROTA 4DROA 3FAPA 4WJXA 3GTYX 4URIA 2PN0A 2XP3A 2RSEA 4J4NA 1EIBA 4QT3A 1FKHA 2XPBA 4MSPA 3PRBA 1FKFA 1YATA 2F23A 2KI3A 4O2TA 2FKEA 1ZCNA 3AS1A 3WKZA 1NSGA 4JFIA 2MLZA 5DO2A 2LGOA 5HTGA 2XP6A 4MNJA 3NRKA 3RGCA 5J6EA 2IF4A 2N87A 2L2SA 4DZ3A 1BKFA 2RUQA 1FKSA 4ZPWR 4S3KA 4DZ2A 1W1PA 3OOBA 1F8AB 3B9EA 1H0IA 4DIPA 3ARVA 2PV3A 1KFWA 3O5LA 1SYTA 3WQVA 1X6LA 1ZBVA 1QPLA 4QT2A 1CTNA 3IHZA 2ZQVA 1LL6A 4LAYA 4DH0A 4HBEA
chains in the Genus database with same CATH topology
2B5UB 4UDMA 1E44A 3EIPA 1JCHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5U B;  4UDM A;  1E44 A;  3EIP A;  1JCH B; 
#chains in the Genus database with same CATH topology
 1NWT A;  3UQB A;  1FD9 A;  4TW8 A;  3O5F A;  4ODN A;  1O6I A;  3BMB A;  3WQW A;  3WD4 A;  3CGM A;  3KAD A;  4NSB A;  2YBU A;  2DSU A;  2UZ5 A;  4GGQ A;  1FAP A;  4ODR A;  3B9D A;  3RM8 A;  4J4O A;  4NZC A;  1PBK A;  5DIU A;  4ML4 A;  2PV1 A;  1EYM A;  2DPE A;  1ZBC A;  3KCE A;  3G6L A;  4MTV A;  3GU0 A;  1EDQ A;  2PPP A;  1NMW A;  4ZPT R;  3WL1 A;  3EY6 A;  4UDM A;  5HUA A;  4DRP A;  1LG1 A;  3JXV A;  2B5U B;  2KE0 A;  2DT3 A;  3O5P A;  4R0X A;  1FFQ A;  4WKH A;  2DT0 A;  1HJW A;  2A3E A;  4JFJ A;  3ODK A;  1NWS A;  2WM0 A;  3TDB A;  2YBT A;  2MNT A;  3O5G A;  1P5Q A;  2M08 A;  1GPF A;  5DEZ A;  4DRQ A;  4U85 A;  2MLX A;  5HWC A;  1WNO A;  4LAW A;  1HKM A;  1NWU A;  4IPX A;  3IK8 A;  3O5R A;  2LJ4 A;  3AS0 A;  4DWS D;  1UR9 A;  1OWQ A;  2XP5 A;  3VAW A;  5HBF A;  3ARX A;  3AQU A;  4ODK A;  1NMV A;  4MPK A;  4QZV B;  4TW6 A;  4W9Q A;  5HT1 A;  2F2D A;  4P8X A;  3RM9 A;  1J4H A;  5GPG A;  1JNT A;  2PPN A;  3ARW A;  4FN2 A;  4DRM A;  4PTM A;  4JFL A;  4FAP A;  1NH6 A;  2ZR6 A;  3CGN A;  2XP8 A;  5BXJ A;  1BL4 A;  2D9F A;  4Z2K A;  4N19 A;  2MF9 A;  4IT4 A;  3IKG A;  4P8W A;  1OGG A;  3ARR A;  2M2A A;  4GIV A;  4ITZ A;  5I98 A;  1Q6U A;  2KGJ A;  3RFW A;  2PBC A;  2ZR5 A;  3CH9 A;  4P8V A;  1M5Y A;  4AY1 A;  2XP7 A;  3O5J A;  1W26 A;  3NTP A;  3ARQ A;  3ARP A;  3KZ7 A;  4MNM A;  4TYO A;  4JFM A;  2O9O A;  4KR0 B;  1LL7 A;  4Z2L A;  1TFV A;  1OGB A;  4G2P A;  1D7J A;  2RUD A;  2K8I A;  4LAX A;  1PIN A;  2DG9 A;  4IQ2 A;  2ZR4 A;  4W9P A;  4JYS A;  3WD2 A;  2OLH A;  4ODM A;  4DWS A;  1HJX A;  3GPK A;  3KAC A;  2XP9 A;  2DT1 A;  5D75 A;  4IQC A;  4KQZ A;  2LKN A;  4DWS C;  4Q22 A;  2PI6 A;  2FAP A;  1FJD A;  3O5K A;  1B6C A;  3WIJ A;  3I6C A;  3KAF A;  1Q6I A;  1H0G A;  1ROU A;  4HAR A;  3PA7 A;  3NI6 A;  2RUR A;  1QZ2 A;  3O5I A;  4ZPV R;  1GUV A;  1FKK A;  3ARY A;  4MGV A;  2G41 A;  4P8U A;  3LUO A;  1W1Y A;  1YW5 A;  1U79 A;  1ZBW A;  4BF8 A;  4IT6 A;  3WL0 A;  4G50 A;  1HKK A;  3TC5 A;  4XAK A;  3WD0 A;  3H9R B;  2A3C A;  1HJV A;  5DIT A;  3CHE A;  5HW7 A;  4DWS B;  1VF8 A;  2DG3 A;  1QPF A;  4TW7 A;  4U86 A;  3UF8 A;  4DRI A;  3W4R A;  1ZK6 A;  1XHG A;  4ODO A;  4L3N A;  1ZBK A;  2IUZ A;  1E6P A;  4W9O A;  4LGX A;  5HW6 A;  1ZB5 A;  1R9H A;  4WIW A;  4Z2I A;  3AS2 A;  1FKT A;  1LL4 A;  3O5E A;  1FKL A;  2RUC A;  2QF8 A;  3WD3 A;  3KAI A;  1TCO C;  3O5O A;  1ZL1 A;  3ARU A;  1FFR A;  4JFK A;  3RME A;  1N1A A;  1K9T A;  2WLY A;  1ITX A;  2F21 A;  3ALF A;  3ARO A;  4QIB A;  2DG4 A;  1E6R A;  1WB0 A;  3JYM A;  2FDM A;  1RD6 A;  2DSW A;  2VN1 A;  2ZQT A;  1X6N A;  4DRH A;  4Z2G A;  1J6Y A;  1LG2 A;  1XRV A;  1HKI A;  3KAH A;  1Q1C A;  2MPH A;  3PR9 A;  2XP4 A;  3O5Q A;  1A7X A;  3KAB A;  1JVW A;  1IX5 A;  4TX0 A;  3CHC A;  4ODQ A;  1JND A;  4DRN A;  1KT0 A;  4R5E A;  3CZ8 A;  1FKJ A;  2XPA A;  3CHF A;  1L1P A;  2M1I A;  3EIP A;  4ZS6 A;  2Q5A A;  2KR7 A;  3B8S A;  3B7X A;  2DSV A;  1W9V A;  3RM4 A;  4DRJ A;  3UI4 A;  1Q6H A;  4L72 B;  3ALG A;  4W5U A;  1GRJ A;  1D2K A;  1J4R A;  3IKD A;  2O92 A;  4NNR A;  2KO7 A;  1E44 A;  5B8I C;  1EQ3 A;  1T11 A;  2PV2 A;  2JZV A;  3JYJ A;  3ART A;  2RQS A;  4MNK A;  1J4I A;  1UR8 A;  1HXV A;  2DT2 A;  3PRD A;  1W1T A;  4MAV A;  1Y0O A;  1EHN A;  5JH8 A;  2ITK A;  2MLY A;  1NWR A;  4ODL A;  2ZQS A;  5DIV A;  2ZQU A;  1E6N A;  3BXW A;  1FKB A;  1D7I A;  1GOI A;  2A3A A;  3UI5 A;  2DSZ A;  1W9U A;  1D7H A;  1LQ0 A;  4Z2H A;  3UQA A;  3O5M A;  1E6Z A;  2AWG A;  3WD1 A;  1KT1 A;  2A3B A;  2B31 A;  2WLZ A;  2LPV A;  1SR0 A;  2P4V A;  1F40 A;  4WKF A;  3AS3 A;  2WK2 A;  4WKA A;  2AOS A;  2ETN A;  3OA5 A;  1FKD A;  4ODP A;  1W1V A;  1E9L A;  4HBO A;  4C02 B;  1WAW A;  2OFN A;  3UQI A;  3B9A A;  1W9P A;  4DRK A;  4Z2J A;  4TNS A;  3FY1 A;  2VCD A;  1FKG A;  3QOK A;  1E15 A;  3PRA A;  3CHD A;  1LJY A;  2F4E A;  3ARS A;  4LAV A;  5DF0 A;  3TCZ A;  1D6O A;  5GPR A;  4DT4 A;  4U84 A;  3UI6 A;  3WH0 A;  2PPO A;  1JNS A;  4WK9 A;  3MDY B;  4Q7N A;  1C9H A;  1JNE A;  1HKJ A;  3FXY A;  2EUL A;  2KFW A;  4MNL A;  1ZU8 A;  4S3J A;  1FKR A;  3G6M A;  3KAG A;  3ARZ A;  5GQB A;  1JCH B;  2Y78 A;  2ESC A;  3O5D A;  5HKG A;  1FKI A;  5HW8 A;  2G8Z A;  5HWB A;  1ROT A;  4DRO A;  3FAP A;  4WJX A;  3GTY X;  4URI A;  2PN0 A;  2XP3 A;  2RSE A;  4J4N A;  1EIB A;  4QT3 A;  1FKH A;  2XPB A;  4MSP A;  3PRB A;  1FKF A;  1YAT A;  2F23 A;  2KI3 A;  4O2T A;  2FKE A;  1ZCN A;  3AS1 A;  3WKZ A;  1NSG A;  4JFI A;  2MLZ A;  5DO2 A;  2LGO A;  5HTG A;  2XP6 A;  4MNJ A;  3NRK A;  3RGC A;  5J6E A;  2IF4 A;  2N87 A;  2L2S A;  4DZ3 A;  1BKF A;  2RUQ A;  1FKS A;  4ZPW R;  4S3K A;  4DZ2 A;  1W1P A;  3OOB A;  1F8A B;  3B9E A;  1H0I A;  4DIP A;  3ARV A;  2PV3 A;  1KFW A;  3O5L A;  1SYT A;  3WQV A;  1X6L A;  1ZBV A;  1QPL A;  4QT2 A;  1CTN A;  3IHZ A;  2ZQV A;  1LL6 A;  4LAY A;  4DH0 A;  4HBE A; 
#chains in the Genus database with same CATH homology
 2B5U B;  4UDM A;  1E44 A;  3EIP A;  1JCH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...