1E44A

Ribonuclease domain of colicin e3 in complex with its immunity protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
84
structure length
84
Chain Sequence
GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of a Ribosome Inactivating Ribonuclease: The Crystal Structure of the Cytotoxic Domain of Colicin E3 in Complex with its Immunity Protein
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribonuclease
molecule keywords IMMUNITY PROTEIN
total genus 20
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2000-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03513 Cloacin_immun Cloacin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.20 Alpha Beta Roll Chitinase A; domain 3 Cloacin immunity protein 1e44A00
1E44A 3EIPA 4UDMA 2B5UB 1JCHB
chains in the Genus database with same CATH superfamily
3LUOA 1Q6UA 1SYTA 2M1IA 1OGBA 1HKIA 4KR0B 4UDMA 2MLYA 3NI6A 5DIUA 1Q6HA 3WIJA 2DSVA 3GPKA 3KAGA 2ZQVA 2WM0A 4IQCA 2PPNA 1ZB5A 3KCEA 4DH0A 3TC5A 1ZBWA 2B5UB 1FJDA 3WH0A 2DPEA 5HTGA 1ZU8A 3UQBA 1FD9A 2PV3A 1O6IA 2M2AA 1C9HA 3B9AA 1ZCNA 1OWQA 2ZR6A 2MLZA 1RD6A 2B31A 3G6MA 2D9FA 1NWSA 1EIBA 4DRJA 4TW7A 1ROTA 1WB0A 2PPOA 4W9OA 2A3EA 3NTPA 3KAFA 3PA7A 3UI6A 3ARSA 1GUVA 3CHCA 1W1VA 4DWSD 1F40A 1FAPA 1X6LA 2OLHA 4DT4A 3UF8A 4R0XA 2KGJA 2RQSA 3OOBA 2OFNA 4DWSC 3RMEA 4W5UA 2ZQSA 1QZ2A 4U85A 2XP3A 4Z2JA 4QT3A 1E6RA 3O5JA 2DG4A 4P8XA 1TFVA 3OA5A 4ODOA 2ZR4A 1E6PA 3ARRA 4NNRA 4J4NA 3ALGA 4Z2IA 1GPFA 2QF8A 5D75A 2XP8A 1KT0A 1EHNA 4MPKA 5GPGA 3CHDA 2RURA 3O5EA 3B9EA 4QIBA 5DEZA 1FKFA 3UQAA 2Q5AA 3AROA 2IF4A 1HKKA 1ROUA 1HKMA 1ZBVA 4DRQA 1LL4A 3AS2A 1NWUA 2WLZA 2K8IA 1E9LA 1UR8A 2RUQA 4Z2KA 3H9RB 3WKZA 4MNMA 2RSEA 5HWCA 1R9HA 1GOIA 2L2SA 2F2DA 3WL0A 4S3JA 3GU0A 2O9OA 4MTVA 4ML4A 4R5EA 3O5RA 4FAPA 4NSBA 3JYJA 2MF9A 3KABA 1ITXA 1K9TA 4NZCA 1FKGA 2FDMA 4LAYA 2PPPA 3EIPA 3ARTA 4JFMA 5HW8A 3ARVA 3O5DA 4JFLA 3WL1A 3FXYA 1FKRA 2IUZA 2A3CA 1ZK6A 1BL4A 2G41A 4DZ3A 4ODKA 5DIVA 3VAWA 1L1PA 2DT0A 1J4IA 5HUAA 1D2KA 4WKAA 1ZBCA 2KI3A 4Q7NA 2LPVA 4MAVA 4WKFA 1PBKA 4U84A 3IKGA 3NRKA 4MNLA 3IHZA 4IT4A 4JFKA 2DSWA 4P8VA 1KFWA 3WQWA 4DZ2A 1NH6A 2ZR5A 4GIVA 4ODPA 3B9DA 1F8AB 3GTYX 1H0IA 3JXVA 4XAKA 3KZ7A 1E6NA 1H0GA 3CZ8A 4ZPVR 4W9PA 3UQIA 1EYMA 4JYSA 1FKKA 2ETNA 2PV2A 4HBOA 1JCHB 2P4VA 5DF0A 4MNJA 1W1PA 4O2TA 2EULA 3UI4A 3O5LA 1FKIA 2LKNA 4TX0A 3KAIA 4JFIA 1E15A 1YW5A 2WK2A 4MSPA 1JNSA 4DIPA 3PR9A 2XP6A 1FKHA 3RM4A 4KQZA 4P8UA 1FKDA 1TCOC 2DT3A 2VN1A 1W1TA 2N87A 4WJXA 5JH8A 4U86A 1N1AA 1YATA 3UI5A 1A7XA 3O5IA 2F23A 1NMWA 2MPHA 4LGXA 3O5PA 1W9VA 3O5FA 4Z2HA 1HJWA 1IX5A 2ITKA 3JYMA 4LAWA 4ZPTR 3WQVA 3FAPA 2AWGA 1LG1A 3CH9A 5HW7A 1LL6A 2F4EA 3KAHA 1FKLA 3RM9A 5B8IC 1NMVA 3CGNA 1E6ZA 2ZQTA 5HT1A 1J4HA 4G2PA 4URIA 3I6CA 4IQ2A 3PRDA 1NSGA 1XRVA 3EY6A 4WKHA 2PN0A 4DWSA 4ODLA 3WD3A 1JNEA 1W1YA 1FFRA 4DRMA 1QPLA 4N19A 1JNTA 2DT1A 2XP7A 1FKSA 1Q6IA 1X6NA 4J4OA 2DSZA 2FAPA 3WD2A 4FN2A 1FKBA 3ARWA 3WD0A 2UZ5A 3ODKA 2VCDA 5BXJA 3MDYB 4WK9A 4S3KA 1B6CA 4DRIA 1OGGA 3KACA 5J6EA 4LAVA 5HBFA 3O5KA 3WD1A 4L3NA 4ODQA 2ESCA 2MNTA 2XPAA 4IT6A 4ODMA 1HXVA 1U79A 3WD4A 2A3AA 4P8WA 1M5YA 2M08A 2Y78A 3TDBA 3KADA 1NWTA 4L72B 1BKFA 3G6LA 2ZQUA 1SR0A 3IKDA 3PRBA 4TYOA 2O92A 4ODRA 1T11A 3CHFA 3QOKA 4QT2A 1W26A 4ZS6A 4HBEA 3W4RA 4LAXA 4PTMA 2AOSA 2F21A 4DROA 1GRJA 1D7JA 1D7IA 1E44A 3O5GA 2PV1A 3AQUA 3BXWA 4C02B 2JZVA 3RGCA 3B7XA 3O5MA 3PRAA 4GGQA 5DO2A 2KFWA 3TCZA 3CHEA 1ZL1A 4Z2LA 3AS3A 5GQBA 4G50A 2LJ4A 4QZVB 2YBTA 3IK8A 1W9UA 2MLXA 1J4RA 2XP9A 2YBUA 2WLYA 1WAWA 1XHGA 4ZPWR 1P5QA 1LQ0A 2KE0A 2LGOA 3BMBA 2A3BA 3B8SA 3AS0A 4ODNA 4TW8A 1QPFA 5HWBA 3RM8A 4JFJA 4DRNA 1HJXA 4HARA 1Y0OA 5HW6A 1FFQA 1Q1CA 2KO7A 1VF8A 4TW6A 3RFWA 1FKJA 3CGMA 4DWSB 1HJVA 1KT1A 5HKGA 2KR7A 4TNSA 5GPRA 2XPBA 4DRPA 1D6OA 5I98A 1UR9A 1PINA 3AS1A 4IPXA 4AY1A 1W9PA 2FKEA 3ARZA 4ITZA 2PBCA 3ARUA 1JNDA 1J6YA 1FKTA 3ARQA 4DRHA 3ALFA 4DRKA 2DSUA 3ARPA 2DT2A 4W9QA 4MNKA 2XP4A 4WIWA 3FY1A 1JVWA 4Z2GA 1LL7A 2DG9A 1HKJA 2XP5A 1LJYA 2RUDA 5DITA 3O5QA 4BF8A 1EDQA 3O5OA 2RUCA 1CTNA 1LG2A 1D7HA 1NWRA 3ARXA 1WNOA 2G8ZA 1EQ3A 4Q22A 3ARYA 4MGVA 2DG3A 2PI6A 1ZBKA
chains in the Genus database with same CATH topology
1E44A 3EIPA 4UDMA 2B5UB 1JCHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E44 A;  3EIP A;  4UDM A;  2B5U B;  1JCH B; 
#chains in the Genus database with same CATH topology
 3LUO A;  1Q6U A;  1SYT A;  2M1I A;  1OGB A;  1HKI A;  4KR0 B;  4UDM A;  2MLY A;  3NI6 A;  5DIU A;  1Q6H A;  3WIJ A;  2DSV A;  3GPK A;  3KAG A;  2ZQV A;  2WM0 A;  4IQC A;  2PPN A;  1ZB5 A;  3KCE A;  4DH0 A;  3TC5 A;  1ZBW A;  2B5U B;  1FJD A;  3WH0 A;  2DPE A;  5HTG A;  1ZU8 A;  3UQB A;  1FD9 A;  2PV3 A;  1O6I A;  2M2A A;  1C9H A;  3B9A A;  1ZCN A;  1OWQ A;  2ZR6 A;  2MLZ A;  1RD6 A;  2B31 A;  3G6M A;  2D9F A;  1NWS A;  1EIB A;  4DRJ A;  4TW7 A;  1ROT A;  1WB0 A;  2PPO A;  4W9O A;  2A3E A;  3NTP A;  3KAF A;  3PA7 A;  3UI6 A;  3ARS A;  1GUV A;  3CHC A;  1W1V A;  4DWS D;  1F40 A;  1FAP A;  1X6L A;  2OLH A;  4DT4 A;  3UF8 A;  4R0X A;  2KGJ A;  2RQS A;  3OOB A;  2OFN A;  4DWS C;  3RME A;  4W5U A;  2ZQS A;  1QZ2 A;  4U85 A;  2XP3 A;  4Z2J A;  4QT3 A;  1E6R A;  3O5J A;  2DG4 A;  4P8X A;  1TFV A;  3OA5 A;  4ODO A;  2ZR4 A;  1E6P A;  3ARR A;  4NNR A;  4J4N A;  3ALG A;  4Z2I A;  1GPF A;  2QF8 A;  5D75 A;  2XP8 A;  1KT0 A;  1EHN A;  4MPK A;  5GPG A;  3CHD A;  2RUR A;  3O5E A;  3B9E A;  4QIB A;  5DEZ A;  1FKF A;  3UQA A;  2Q5A A;  3ARO A;  2IF4 A;  1HKK A;  1ROU A;  1HKM A;  1ZBV A;  4DRQ A;  1LL4 A;  3AS2 A;  1NWU A;  2WLZ A;  2K8I A;  1E9L A;  1UR8 A;  2RUQ A;  4Z2K A;  3H9R B;  3WKZ A;  4MNM A;  2RSE A;  5HWC A;  1R9H A;  1GOI A;  2L2S A;  2F2D A;  3WL0 A;  4S3J A;  3GU0 A;  2O9O A;  4MTV A;  4ML4 A;  4R5E A;  3O5R A;  4FAP A;  4NSB A;  3JYJ A;  2MF9 A;  3KAB A;  1ITX A;  1K9T A;  4NZC A;  1FKG A;  2FDM A;  4LAY A;  2PPP A;  3EIP A;  3ART A;  4JFM A;  5HW8 A;  3ARV A;  3O5D A;  4JFL A;  3WL1 A;  3FXY A;  1FKR A;  2IUZ A;  2A3C A;  1ZK6 A;  1BL4 A;  2G41 A;  4DZ3 A;  4ODK A;  5DIV A;  3VAW A;  1L1P A;  2DT0 A;  1J4I A;  5HUA A;  1D2K A;  4WKA A;  1ZBC A;  2KI3 A;  4Q7N A;  2LPV A;  4MAV A;  4WKF A;  1PBK A;  4U84 A;  3IKG A;  3NRK A;  4MNL A;  3IHZ A;  4IT4 A;  4JFK A;  2DSW A;  4P8V A;  1KFW A;  3WQW A;  4DZ2 A;  1NH6 A;  2ZR5 A;  4GIV A;  4ODP A;  3B9D A;  1F8A B;  3GTY X;  1H0I A;  3JXV A;  4XAK A;  3KZ7 A;  1E6N A;  1H0G A;  3CZ8 A;  4ZPV R;  4W9P A;  3UQI A;  1EYM A;  4JYS A;  1FKK A;  2ETN A;  2PV2 A;  4HBO A;  1JCH B;  2P4V A;  5DF0 A;  4MNJ A;  1W1P A;  4O2T A;  2EUL A;  3UI4 A;  3O5L A;  1FKI A;  2LKN A;  4TX0 A;  3KAI A;  4JFI A;  1E15 A;  1YW5 A;  2WK2 A;  4MSP A;  1JNS A;  4DIP A;  3PR9 A;  2XP6 A;  1FKH A;  3RM4 A;  4KQZ A;  4P8U A;  1FKD A;  1TCO C;  2DT3 A;  2VN1 A;  1W1T A;  2N87 A;  4WJX A;  5JH8 A;  4U86 A;  1N1A A;  1YAT A;  3UI5 A;  1A7X A;  3O5I A;  2F23 A;  1NMW A;  2MPH A;  4LGX A;  3O5P A;  1W9V A;  3O5F A;  4Z2H A;  1HJW A;  1IX5 A;  2ITK A;  3JYM A;  4LAW A;  4ZPT R;  3WQV A;  3FAP A;  2AWG A;  1LG1 A;  3CH9 A;  5HW7 A;  1LL6 A;  2F4E A;  3KAH A;  1FKL A;  3RM9 A;  5B8I C;  1NMV A;  3CGN A;  1E6Z A;  2ZQT A;  5HT1 A;  1J4H A;  4G2P A;  4URI A;  3I6C A;  4IQ2 A;  3PRD A;  1NSG A;  1XRV A;  3EY6 A;  4WKH A;  2PN0 A;  4DWS A;  4ODL A;  3WD3 A;  1JNE A;  1W1Y A;  1FFR A;  4DRM A;  1QPL A;  4N19 A;  1JNT A;  2DT1 A;  2XP7 A;  1FKS A;  1Q6I A;  1X6N A;  4J4O A;  2DSZ A;  2FAP A;  3WD2 A;  4FN2 A;  1FKB A;  3ARW A;  3WD0 A;  2UZ5 A;  3ODK A;  2VCD A;  5BXJ A;  3MDY B;  4WK9 A;  4S3K A;  1B6C A;  4DRI A;  1OGG A;  3KAC A;  5J6E A;  4LAV A;  5HBF A;  3O5K A;  3WD1 A;  4L3N A;  4ODQ A;  2ESC A;  2MNT A;  2XPA A;  4IT6 A;  4ODM A;  1HXV A;  1U79 A;  3WD4 A;  2A3A A;  4P8W A;  1M5Y A;  2M08 A;  2Y78 A;  3TDB A;  3KAD A;  1NWT A;  4L72 B;  1BKF A;  3G6L A;  2ZQU A;  1SR0 A;  3IKD A;  3PRB A;  4TYO A;  2O92 A;  4ODR A;  1T11 A;  3CHF A;  3QOK A;  4QT2 A;  1W26 A;  4ZS6 A;  4HBE A;  3W4R A;  4LAX A;  4PTM A;  2AOS A;  2F21 A;  4DRO A;  1GRJ A;  1D7J A;  1D7I A;  1E44 A;  3O5G A;  2PV1 A;  3AQU A;  3BXW A;  4C02 B;  2JZV A;  3RGC A;  3B7X A;  3O5M A;  3PRA A;  4GGQ A;  5DO2 A;  2KFW A;  3TCZ A;  3CHE A;  1ZL1 A;  4Z2L A;  3AS3 A;  5GQB A;  4G50 A;  2LJ4 A;  4QZV B;  2YBT A;  3IK8 A;  1W9U A;  2MLX A;  1J4R A;  2XP9 A;  2YBU A;  2WLY A;  1WAW A;  1XHG A;  4ZPW R;  1P5Q A;  1LQ0 A;  2KE0 A;  2LGO A;  3BMB A;  2A3B A;  3B8S A;  3AS0 A;  4ODN A;  4TW8 A;  1QPF A;  5HWB A;  3RM8 A;  4JFJ A;  4DRN A;  1HJX A;  4HAR A;  1Y0O A;  5HW6 A;  1FFQ A;  1Q1C A;  2KO7 A;  1VF8 A;  4TW6 A;  3RFW A;  1FKJ A;  3CGM A;  4DWS B;  1HJV A;  1KT1 A;  5HKG A;  2KR7 A;  4TNS A;  5GPR A;  2XPB A;  4DRP A;  1D6O A;  5I98 A;  1UR9 A;  1PIN A;  3AS1 A;  4IPX A;  4AY1 A;  1W9P A;  2FKE A;  3ARZ A;  4ITZ A;  2PBC A;  3ARU A;  1JND A;  1J6Y A;  1FKT A;  3ARQ A;  4DRH A;  3ALF A;  4DRK A;  2DSU A;  3ARP A;  2DT2 A;  4W9Q A;  4MNK A;  2XP4 A;  4WIW A;  3FY1 A;  1JVW A;  4Z2G A;  1LL7 A;  2DG9 A;  1HKJ A;  2XP5 A;  1LJY A;  2RUD A;  5DIT A;  3O5Q A;  4BF8 A;  1EDQ A;  3O5O A;  2RUC A;  1CTN A;  1LG2 A;  1D7H A;  1NWR A;  3ARX A;  1WNO A;  2G8Z A;  1EQ3 A;  4Q22 A;  3ARY A;  4MGV A;  2DG3 A;  2PI6 A;  1ZBK A; 
#chains in the Genus database with same CATH homology
 1E44 A;  3EIP A;  4UDM A;  2B5U B;  1JCH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...