1LQ0A

Crystal structure of human chitotriosidase at 2.2 angstrom resolution
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
365
structure length
365
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human chitotriosidase. Implications for specific inhibitor design and function of mammalian chitinase-like lectins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CHITOTRIOSIDASE
total genus 126
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1lq0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1lq0A01
1ODUA 1V3LA 4WKHA 3PZIA 4QCFA 5DT5A 5A3HA 2CBIA 2X8RA 1UD4A 1FOBA 6TAAA 4GI6A 1EIBA 1HKMA 3A3HA 2DH3A 5A6MA 2A3BA 1CECA 1Q6DA 3OIHA 3AIBA 2Y24A 2A3HA 2UY5A 4AZBA 3GXIA 1Q6CA 4Q22A 1LWJA 5D9NA 2WC7A 4HPHA 3WSUA 1OB0A 3FN9A 1PX4A 3TOPA 2CIPA 2XYLA 3VO0A 3IAPA 4LPCA 3QOMA 2FH6A 4CU8A 3K1DA 1PZ3A 1NP2A 4GQRA 1WDSA 3CZEA 3RM8A 4BQ2A 3ARSA 4KRUA 4WIWA 1MW1A 3O9NA 4AZCB 2A3AA 1HF6A 3FW6A 1W32A 3ZSTA 2JALA 2J47A 1ZBWA 1BHGA 2GJPA 2BY0A 1V0KA 1M04A 1JZ2A 2V3EA 4GZIA 1VIWA 1PX8A 4CCCA 2NT0A 2YBTA 4J3WA 5EB8A 3D5HA 1PBGA 3AXIA 3OLIA 1K9FA 3I3DA 3SUVA 2W92A 1BYCA 3AZTA 4FMVA 1OGBA 1GOIA 3AHTA 4AIEA 4OBRA 1C8XA 4OKDA 3VGHA 1E0VA 1VF8A 2YL6A 1R87A 2QLYA 2O92A 2IXUA 4J28A 3GYCA 4Z2JA 3AIEA 4NI3A 4WF7A 1KQZA 1JL8A 2DSWA 5HDRA 4D71A 2OSWA 4D6IA 4MADA 4PSPA 3UG4A 4QLLA 3VD7A 3SCVA 5I0DA 1QNOA 4FLQA 1JDDA 4S3JA 5I79A 3CGTA 3SEPA 3D3AA 2EPKX 1EHNA 1WZKA 1DWHM 3WF4A 1PPIA 2WHMA 3ZT6A 4D6DA 1QVBA 5KZ6A 2ZUNA 1TA3A 2OWWA 4AZIA 1TA3B 2YLAA 3AHXA 3BC9A 1QI3A 4W8AA 1XH0A 3I3BA 5A8QA 2QPSA 4LYQA 1E6RA 1DWAM 3VDAA 2BNJA 2VURA 5E0FA 4B3LA 4HTYA 2XIBA 3W0KA 2EO7A 4P8XA 2NSXA 3VIMA 4UFLA 1IV8A 2YJQA 2XPKA 1HN1A 1NOUA 3GBEA 3WN6A 1AQMA 5DF0A 4JCMA 3WIJA 1E55A 1V0LA 5LYRA 1BLIA 1JYWA 2VZUA 1JF5A 1TG7A 4ZE5A 3PZUA 4HA1A 4H04A 1VAHA 4TVCA 1MFUA 2J7BA 3T0AA 2FH8A 4DUVA 1M01A 1BAGA 1ESWA 2YLLA 4H7VA 3OB8A 3RPMA 1HNYA 2XSBA 1UD2A 3F4VA 3T0BA 2E9MA 3A4WA 4CUCA 3AS1A 3VVGA 1C93A 4XZWA 2WANA 3PHAA 4PTVA 2QPUA 1S46A 1SMDA 3TP4A 1HVXA 2F2HA 3TONA 4J3VA 4JFTA 3VILA 3WNKA 1ZB5A 3WL1A 2VX4A 5I23A 2BHUA 4Z2LA 3MSGA 2JIWA 1XSIA 1EDQA 1JG9A 5FL0A 4X0VA 3ARRA 3VNZA 3WELA 4MNMA 3WDIA 5GNXA 2G3MA 5I6SA 1XYFA 1KGWA 3PZTA 4WSKA 3W38A 1CDGA 4OOUA 3W27A 2DSZA 3CH9A 7TAAA 2E4TA 1UKTA 4UOZA 4H2CA 1E43A 1DHKA 2D0HA 2WHLA 3U57A 2F61A 1CXHA 3WUEA 4QCEA 5DMYA 4ZENA 4CD4A 2E8YA 3ARPA 4AD0A 1Q6EA 2X09A 3SUUA 4PCSA 4PMVA 1H4PA 1ZJBA 4AMCA 3VGDA 1UD5A 1Z32X 4AZ6A 1VRXA 3L2LA 2ZXAA 3RM4A 3MU7A 1W3HA 1CIUA 2XIIA 1PEZA 1VBRA 2J74A 3MV01 3KE0A 3BMVA 2OWXA 2C0HA 5M5DA 1B2YA 2BFGA 5FL1A 1WPCA 1XD0A 2OYKA 3AXXA 3UETA 2WLYA 5E70A 3POCA 1V3HA 2E0PA 1UWIA 4UOJA 3LPPA 1J0JA 1HJXA 1R8LA 1E9LA 1L8NA 3VMOA 3G6LA 4TX8A 1LL6A 1AQ0A 3VD9A 3WNMA 1NWUA 2W4XA 3K8KA 3UG3A 1G01A 1CTNA 1E4NA 1ZU8A 4HU8A 3SCNA 3K4AA 1EOKA 1QNSA 1UH3A 7CGTA 2ZOXA 1MQQA 1CXFA 3SCWA 3OG2A 3EYPA 2FGLA 1MWOA 3EMQA 1KXVA 1JIBA 4LGXA 2WXDM 1E72M 4W7VA 4N42A 3BMWA 3VMPA 3JUGA 2VR5A 3W37A 3A47A 1DEDA 1W9DM 2A3EA 4B3KA 5A6BD 2WM0A 3OGRA 4AD2A 3RO8A 4U2YA 5DFAA 3MANA 2WVVA 1TMQA 2J7DA 3BAJA 5TD4A 3S2CA 1EO7A 1JFXA 1UZ4A 2YA1A 3DYOA 3ARVA 1UQZA 1EHAA 3IAQA 4WLCA 1NWRA 5DEZA 3B9DA 5LA2A 3GXMA 3OZPA 3IJ8A 3WUBA 3VM5A 1KFWA 2C7FA 3M6DA 4BF7A 5FOOA 4Y7EA 5CQ1A 3LPGA 3KL3A 1GOOA 1E40A 2C8NA 4D6CA 2V3GA 3WKZA 4B15A 1WDRA 5ABFB 3T2PA 5E6ZA 2AAAA 4IPNB 4X0NA 1US2A 3WUGA 4P7OA 2Q8XA 1NH6A 2DQXA 2YL5A 1H3GA 3W28A 3BLPX 5I5RA 4IM4A 1UWRA 2PBOA 6A3HA 4J3XA 5EFDA 1HIZA 3ZT7A 5ABFA 3SCQA 1JYXA 1UHVA 4AZGA 2OSYA 3WH8A 5HPOA 4J27A 1Y7VA 2XHYA 4MDOA 1C92A 3MUIA 1V3KA 4Z2GA 1JD9A 1P6WA 1TUXA 1ZBVA 4Z2HA 1FP8A 1TCMA 1E1FA 2VJXA 1JNDA 3AS2A 1NQ6A 2EPOA 1E4MM 1ZL1A 5D4YA 4AISA 4JFUA 3L4UA 3VX0A 2CEQA 4ML4A 3GZAA 4DM1A 4AD4A 3VIHA 3VM7A 3WH6A 4AD5A 5CPSA 3QHOA 2VQUA 4UQEA 1HJUA 1UWQA 4NSBA 1O7AA 2J7FA 2A3CA 1QI4A 4FF5A 4DM2A 1WZLA 2WPGA 3CIVA 3PZ9A 4M81A 2PWGA 3SURA 5A6KA 1W9VA 1JZ3A 4DUWA 3CZ8A 1W3JA 1KGXA 3IANA 5AYBA 3FAXA 2CETA 2O9TA 3BH4A 4L4OA 3DHUA 3W24A 1RH9A 2DT1A 3VUPA 5C8BB 1KBBA 4PN2A 2UY4A 4C7GA 3CZGA 1WZMA 4ATDA 1ISVA 3FXYA 3PZVA 4QP0A 4AWEA 4CD6A 3BCFA 1XHGA 1WKYA 2WMHA 3CZKA 4URIA 2DSKA 1I1XA 3OGSA 1HXJA 3WF3A 1DP0A 2PWDA 4QDMA 4JKKA 1PX3A 1WZAA 1GW1A 1CLXA 4UQBA 3DHPA 1GHSA 1J0ZA 3CUFA 3NSNA 1BQCA 3F5JA 1H0IA 2XVPA 2ZX6A 4NRRA 1GONA 2X2YA 3KL5A 2VNCA 3W81A 2WMIA 1B3XA 2JEQA 3MUY1 4Z2IA 3N11A 1B9ZA 3UCQA 3ZSSA 2E40A 4W85A 3EDEA 2PF0A 3II1A 3ARXA 3W29A 2VZOA 3GH4A 3A6OA 3HN3A 1A47A 2EPLX 1JNEA 2ZUMA 4GINA 2WSPA 3W25A 3K46A 2WWCA 1CGUA 4DWSA 3SCSA 4JCLA 3RJXA 3N12A 4BQ4A 2G3JA 2XVLA 3AIVA 1V08A 3EDFA 4BQ5A 1B31A 2XM2A 3SIMA 3WENA 3ZT5A 4PMRA 5A8MA 3OLGA 1UD8A 4MPKA 3OBAA 3AS3A 3ZM8A 5C71A 1XV8A 4TVDA 4MAZA 4DWSC 2ZX5A 3B8SA 1UWSA 5ABEA 2CITA 4AEFA 1M7XA 4AY1A 5I24A 4QFUA 4TOQA 3WEZA 2Y8KA 1GOMA 4ATWA 1KBKA 5CLTA 2XWDA 1EA9C 5IDIA 1SYTA 3VKKA 4AIOA 3SCRA 1VFFA 4NZCA 1QPKA 1LF1A 2DDXA 4F79A 3ARYA 1MVYA 4HMCA 4JAWA 1WO2A 3U5YA 5I3DA 2WHJA 1JYVA 3TA9A 3K8LA 4M56A 1JZ7A 4W88A 1H41A 2D0GA 2EBNA 2YKKA 2CBUA 3AMDA 3PZMA 5JBDA 2WMGA 1E6XM 1K9DA 3AHVA 4ZE4A 1PAMA 2YA0A 2ZUUA 1CWYA 1E6PA 4GPNA 1CENA 1F4AA 2XTKA 1MQRA 5F7UA 2X05A 3VGFA 1HJSA 4J7RA 3PN8A 1E6NA 1UR8A 1DWIM 3QHNA 1K9EA 2W67A 2WBGA 4MB3A 3OGVA 3SUWA 2BVTA 4LXFA 1OGSA 2D24A 2J7HA 3K8MA 1E71M 4LYRA 4PMZA 3NSMA 3WFLA 1CGWA 3VNYA 3AHYA 1VFMA 1TVPA 4FLOA 5A1AA 3VINA 2YDSA 1QHOA 4BQ3A 3GDBA 4LYPA 1QHPA 1FH8A 1Q6GA 1UKOA 1D7FA 2Z1KA 1JXJA 1BGAA 2FHBA 2E9LA 1JZ4A 1OIFA 3DYPA 1ISZA 4XUYA 4X9YA 4HZ6A 3MMUA 3VIPA 1JD7A 2ZXDA 5BRPA 2XWEA 4EANA 4M1RA 2WVSA 3THCA 5HPCA 1EXPA 4BCEA 3PBGA 4D6EA 4AD1A 4XZBA 3B9AA 5D8WA 3O6AA 1PZ2A 3WNNA 1JFHA 2ZWZA 3L4WA 4TXEA 2V3DA 3G6MA 3TTYA 4IPLA 2XGBA 5CGTA 2XFRA 2NW0A 3HU7A 5AYIA 2XGIA 2GJRA 3GH5A 1BSIA 1LL4A 1WDPA 1KQYA 2FGZA 5E0CA 4UFJA 2GK1B 1QW8A 2V3FA 2VC9A 3MV11 3K4DA 2HISA 1HJWA 1UG6A 4UQDA 3FY1A 1FA2A 2VZVA 1XH1A 3B9EA 1E70M 6CGTA 2VTFA 4NRSA 5EFFA 1EO5A 2GFTA 3I3EA 4FLSA 4U33A 5M17A 4KWUA 1XYZA 4MDPA 2E3ZA 5HBFA 4UQCA 3QR3A 1GORA 4N0RA 1FH7A 2D3NA 3ZO9A 5GQBA 2YOCA 1UKQA 2BVYA 5JBEA 5BROA 1B3VA 1V6VA 4JIEA 5A6BA 3WDPP 2CCRA 4J3UA 3EDJA 1GQLA 4H41A 1DWFM 1A3HA 3GXFA 1PJ9A 4UFIA 3OLEA 2WHKA 4CGTA 5CSYA 4PTWA 5A6SA 3LPOA 4CN1A 1PIFA 2CNCA 3VIIA 2UY3A 2VMFA 3U5UA 2ZUVA 3ECQA 4W89A 5CPTA 4F8XA 3IJ9A 4PTMA 1W2VA 3AS0A 4UNIA 3T2OA 1G9HA 5CG0A 1VFUA 4D1JA 1W3KA 1SR0A 1R85A 2W62A 4QAWA 1OINA 2CKSA 3W53A 1B3YA 2VVNA 2J62A 1TVNA 3AYSA 1R7OA 1UWUA 1V6YA 3NIYA 3VOCA 1SMAA 5JBFA 4CCDA 5JIWA 1MW0A 3ZJ6A 1UD3A 1TFVA 3VD4A 4M24A 4MTVA 2IXVA 3QGVA 4B9ZA 3OA5A 3NJ3A 1X1NA 2EPMX 3UEQA 4XV0A 5DO8A 4JFWA 1UUQA 3VIKA 1JYNA 2YBUA 3UERA 3VD3A 5ABGA 4DUXA 3CPUA 3S6TA 2G41A 3FAWA 4ACZB 2PWHA 3PTKA 4JHZA 4TTUA 1KXTA 4PMQA 4UCFA 3CMGA 1VFOA 3DC0A 1E3XA 4TVUA 1GOQA 2F8QA 1OBAA 1GUVA 3PZNA 4PMDA 3WH5A 3SCPA 3WNLA 2G3NA 4F9JA 1H0GA 5IHSA 2DSUA 4M80A 3FHAA 1GQKA 2WBKA 2YA2A 1ZBCA 1BPLB 3J7HA 3AMGA 1CGVA 1CGTA 1V03A 2WW5A 5DT7A 9CGTA 2VX7A 4D6HA 1G5AA 5HXMA 2XUCA 1H11A 2MANA 1QNPA 4E8CA 3WQ5A 2VX5A 1C91A 3L2MA 4GKLA 4U5IA 1DWGM 2DIJA 2D2OA 4UQAA 3ZQ9A 2TAAA 3AOFA 2EJ1A 3VIGA 1AVAA 1ISXA 4FLRA 1KWKA 2J25A 3MUZ1 4JKLA 4PCTA 5IHRA 4HZ8A 2DGAA 2JF6A 4OZOA 5A2CA 3WD0A 5JUVA 2OYLA 1WDQA 3CHCA 1QOXA 1E15A 5IFTA 4H8HA 2QHAA 2WCSA 1JGIA 1W1PA 1BYDA 2X1IA 3MMWA 3WF0A 2PI6A 3MS8A 4GZJA 2V38A 2XSAA 1GOKA 3L4XA 4HOXA 2GVYA 2WVTA 5AY7A 3WDRA 1FHLA 1CEOA 3GNPA 4CN6A 3WH7A 3MMDA 1IZKA 3A4AA 1EGZA 2PBGA 1FFRA 3GNOA 2Y2WA 2PB1A 1E0WA 1M53A 1MXGA 1J18A 2GK1A 4QLKA 1XD1A 3CTTA 5BXTA 3AIRA 3WH9A 4HA4A 2GDUA 1HKJA 5I77A 1E56A 4JL1A 1W1VA 2BXZA 1XGZA 1OSEA 1J9YA 1HL9A 8A3HA 1OGGA 2IUZA 3WL0A 1J12A 3ZJ8A 2WZIA 2JF7A 4WK9A 3BAXA 1UH2A 1UA7A 1BG9A 3HMCA 1C7TA 3MUAA 1LG2A 3PTMA 1QBAA 3N18A 4AYSA 2WCAA 5ABHA 1HKKA 4WKAA 5M3WA 4U2ZA 3RJYA 2X0YA 1K6AA 1W2PA 4CD5A 2QMJA 2E8ZA 1KGUA 2G3IA 4P7NA 1V3IA 3VGEA 5A8PA 4NF7A 3BSHA 4IUGA 3IK2A 1UKSA 1B3WA 2ZIDA 2XVNA 1V3MA 1C8QA 2W5FA 4YN5A 4V2XA 1BG4A 5BRQA 3NYDA 3GBDA 1V6XA 4AZHA 5E09A 5LA1A 1V0MA 3W26A 1IT0A 1ITCA 1FH9A 4ATLA 3BLKA 1C7SA 2OLHA 4BA0A 1KXQA 4ZXOA 3AROA 3EMCA 4CD7A 1B3ZA 1QI5A 3N04A 2WC3A 4C7FA 3TTOA 1W1YA 2DT2A 3WF2A 1XRVA 2RGLA 1W9PA 1RD6A 2VQTA 2FDMA 3ARTA 1MXDA 4P7LA 4C7DA 4S3KA 1BGGA 3CHEA 1EH9A 4JKMA 1C90A 1TZ7A 1RPKA 2QF8A 3VIJA 3M7SA 1QW9A 2ZUTA 1G94A 1OT2A 1GNXA 4JZ5A 2FHFA 4OOZA 1GHRA 4W7WA 2XVGA 4CN4A 4KH2A 2FHCA 1C3FA 4IISA 2J4GA 1V02A 1M03A 4P7RA 3W6MA 1KR0A 1H09A 2BY3A 1AQHA 2VL4A 3DECA 1UD6A 1W91A 1FFQA 1JDCA 4PMOA 3VX1A 4OJYA 5IFPA 3EDDA 3WBAA 1HJVA 4D6JA 3CHFA 1HP4A 3NSXA 1I75A 3KZSA 3AICA 1CNVA 4KRTA 1HVQA 3BXWA 1LG1A 2AMGA 2VOTA 2VR4A 3VIFA 3AJ7A 1R7AA 1HX0A 1ISWA 4W93A 3AFBA 3L4YA 1GQJA 5CZKA 5CJ5A 1X6LA 3BSGA 4Q7NA 3WMCA 1WP6A 2VRKA 2XM1A 2D22A 3N17A 4K68A 1H2JA 4U31A 3THDA 5D9PA 3WQ6A 4PUDA 4W7UA 4UFKA 1E4IA 2HVMA 2V5DA 4MJ4A 2CHNA 3W4RA 3EDKA 1VEMA 4HMDA 4D6FA 1VB9A 4U3AA 2J75A 2RGMA 1BYAA 2CXGA 3POHA 4QLJA 1QI2A 3WDHA 3KWXA 1V02E 2QMKA 1D3CA 3DYMA 4H8UA 4EKJA 2WYSA 4AZ7A 2UY2A 1Q6FA 2WLZA 3RMEA 1NARA 4M29A 3E1F1 3AIQA 1EQPA 1KCLA 1QBBA 4TX6A 5A94A 2AOSA 2CBVA 3CLWA 2DEPA 1UR0A 2CHOA 3AIWA 4PMXA 2YDQA 3ZR6A 1OT1A 1BF2A 2VCCA 5E9AA 1MYRA 1US3A 2VCBA 3VDHA 2Y8VA 2GJXA 3FHQA 4XB3A 3WDJA 3L4ZA 1ITXA 1YHTA 2PWFA 5A6LA 5A95A 4ZFMA 5AC4A 1SFSA 4EAMA 3EBVA 1UR1A 1MW2A 4ZEPA 1CGYA 1VBUA 1TE1A 2ZX8A 5HNNA 2QV4A 4UZSA 2EPNA 3AIUA 1GZJA 1V3JA 1HKIA 3CZJA 1FP9A 1YQ2A 2D3LA 3UESA 4JFVA 2D20A 2J8GA 2WSKA 1I1WA 2X0HA 5FKYA 3GH7A 3AQUA 2DSVA 2J7EA 4E8DA 3UR8A 1V0NA 5HOSA 4J3SA 4DWSD 3N1AA 1CYGA 2VRJA 4U3CA 4OUEA 3EMZA 1U33A 2OWCA 2J78A 1VJSA 3NDYA 5A2BA 4UTFA 2Y4SA 4B16A 1W9BM 3VMNA 2NT1A 3WFZA 1JDAA 1MQPA 4UOQA 3W6LA 1U30A 2D1ZA 5JH8A 1CGXA 2ZXBA 3T09A 1E73M 1QNRA 2YIHA 1NOFA 4CCEA 3TTSA 3AYRA 1W9UA 2VI0A 2WMIB 4J3TA 4R5EA 5EBAA 2WAGA 3AZRA 1GCYA 4CKQA 4RE4A 1RP8A 1MW3A 3ZOAA 1EDTA 4UZUA 4H8VA 1KXHA 4PSRA 2Z1SA 1E3ZA 1IZJA 3VDBA 3IJ7A 4MJ2A 2WVVB 1NWTA 1F4HA 4GO8A 1E0XA 1CBGA 5EMYA 3RM9A 1OM0A 1TR1A 3ALFA 1JI2A 3ZIZA 3RCNA 2XG9A 1EQCA 4AZ5A 2BS9A 4PUEA 4HOWA 4CVUA 3KEHA 2CKRA 5A6AA 2VVSA 3BAKA 3VGGA 5BWFA 3OZOA 2CERA 3BAIA 4YHGA 5BCAA 1OWQA 3ARUA 1JZ8A 4KGLA 1UKPA 2WC4A 3CUGA 1QNQA 1B90A 2DIEA 1OCQA 1LJYA 1VEPA 5LA0A 1E6SM 2O9OA 4HOZA 2J7GA 1HP5A 3AZSA 2VT0A 4MNJA 5D9OA 2WKLA 5A6JA 1BYBA 2BXYA 4B9YA 1ISYA 1GVYA 1H49A 2XFFA 4KGJA 2WB5A 5BXSA 1W1TA 2BV9A 2VZSA 2VCAA 2PC8A 5BXPA 1UWTA 3AHZA 1WE5A 1JXKA 2CPUA 4WKFA 1OIMA 3CBWA 3T08A 4AC1X 4F9DA 1KWGA 4TTGA 5KEZA 1FHDA 2JE8A 2Y5EA 1HT6A 1RP9A 3L4TA 3U7BA 4D1IA 2CYGA 1VJZA 4P8VA 1CZ1A 1DTUA 3WMSA 2BVDA 4P7QA 1GQIA 2WZHA 3ZR5A 1E5NA 1CXEA 5GNZA 2XVKA 5JIPA 1GJUA 1LWHA 1XSKA 1JI1A 2W66A 5I2UA 5FIPA 1JF6A 1CPUA 1J0HA 3PZOA 2YL9A 5BXRA 3GM8A 1BFNA 2J7CA 1NOWA 2WWDA 1UZ1A 3PZQA 1JZ6A 3T0DA 4HP5A 2D23A 4MNKA 3NDZA 4A3YA 5CPQA 3QOKA 1KCKA 2ZX9A 1JAEA 1CXLA 1J0IA 2JEPA 3AI0A 2BY2A 3BAYA 1AMYA 3A4XA 4UQ9A 3SUSA 2ZXQA 2GJXB 5ECUA 3WD2A 2GSJA 3RDKA 2CBJA 5CGMA 3WNPA 3ZJ7A 1PIGA 2G4FA 1ODZA 4PBGA 3PZGA 2ZX7A 2EQDA 4M8UA 4GI8A 2W63A 5A8NA 1XCXA 2EXOA 4LQ1A 3BCDA 4EK7A 2J79A 4F66A 4ZXLA 2WNWA 4RL3A 8CGTA 2B31A 2CESA 3CZLA 4LX4A 4W84A 4GIAA 2W61A 5GNYA 3APGA 2WVUA 4W87A 1B30A 3WUFA 1EOMA 3WMBA 3NUKA 3ARWA 5BYWA 4MB1A 2V5CA 1KB3A 2JIEA 4E2OA 5AC5A 4EE9A 3HJEA 3WEMA 1QHZA 4PEEA 3ALGA 3AMKA 4MNLA 4PYSA 1BVNP 3AISA 1D2KA 3WD1A 2YL8A 1HL8A 4D72A 5D9MA 3FNDA 4E4PA 1E6QM 3M46A 3CUIA 3GTNA 3N9KA 1XC6A 1J01A 4GI9A 1WB0A 1W9XA 3CHDA 1H5VA 2OYMA 1ZJAA 2BHYA 2E9BA 3O2LA 4UR9A 4WSJA 1MFVA 3N13A 2J77A 4CD8A 3VTRA 1L0PA 2VO5A 3UG5A 3SCOA 3ARZA 2VUYA 3KL0A 1WNOA 3WD3A 1C8YA 3L4VA 3CO4A 4R27A 2VRQA 4HZ7A 3WQVA 4V28A 4PMYA 4AW7A 2ZUSA 2UWFA 4PTXA 4L4PA 1UA3A 1UQYA 2WKGA 3VIOA 1GPFA 2OSXA 2XJ7A 3GNRA 2WMFA 5CLWA 3WQ8A 4HA3A 5GPRA 4AZCA 5C70A 1H1NA 1Q4NX 4ACYA 4HMEA 3MSDA 5I78A 1JZ5A 1J0YA 1V6WA 4W5UA 3WQWA 4BS0A 2DH2A 1R86A 3UR7A 1W3LA 3CUHA 4JFSA 4OBSA 4YHEA 3NCOA 4GO9A 3GXDA 3LPFA 2W91A 1LL7A 3WF1A 1U2YA 4HU0A 3VU2A 1X6NA 1J10A 4AD3A 5A69A 1ZS2A 1UYQA 1UR2A 3AMLA 3QHMA 3ZMRA 4A4AA 2VX6A 2DT3A 5M03A 1DWJM 1WCGA 3WNOA 2YDRA 3BAWA 1E5JA 5E6YA 2ZICA 2ZE0A 3OLDA 4U5KA 1GVIA 1XSJA 4Z2KA 1CXIA 3CUJA 3WD4A 4MAVA 3N15A 4CU6A 1XH2A 1UR9A 1CXKA 2XFYA 4W86A 4PRWA 3VDCA 1VEOA 2JFEX 4P8WA 4DWSB 4D6GA 3PTQA 2ZUWA 3ARQA 3CMJA 1E4LA 4HPGA 4P8UA 1UR4A 1JAKA 1VENA 4MB4A 3WEOA 1K9TA 1OD0A 1N82A 3F5LA 1V6UA 4W8BA 4JHOA 3M07A 2GDVA 2WZEA 4BZYA 1GOWA 4V27A 3WDQA 4UFHA 1E1EA 1UH4A 4RE3A 1QI0A 3ZJKA 3LMYA 4JL2A 4TUFA 1XCWA 2ESCA 5CSUA 2D0FA 4GXPA 4CU7A 5FCZA 3VGBA 1OD8A 1ECEA 4A3HA 4W8LA 3WBEA 1NWSA 1KR1A 4OIFA 4CVWA 4AXNA 3F5KA 2DPEA 5CXPA 1J11A 1J0KA 2WMJA 3WY1A 5A8OA 3VPLA 4RE2A 1B0IA 4WJXA 2ZWYA 1NP0A 2G8ZA 2O9RA 2PWEA 3SUTA 2GUYA 1E6ZA 4PMUA 3WQ4A 4FK9A 3SCUA 1B1YA 2WK2A 3W82A 3RIKA 2BHZA 3U7VA 1BVZA 1CLVA 4GZEA 3TTQA 2J8FA 4W5ZA 1HJQA 4AEEA 1O6IA 1EDGA 2BY1A 4AIUA 5D8ZA 5A2AA 4KMQA 1WAWA 3MKKA 2WMKA 4PMNA 7A3HA 2VZTA 3AMCA 2EEXA 2WCGA 4YPJA 1UOKA 4XX6A 3RILA 2O9PA 1G1YA 1LQ0A 3SCTA 4M82A 4GQQA 3AXHA 1G0CA 5IXEA 4ACZA 3BGAA 1GJWA 2DT0A 1NM9A 1LLOA 5FD0A 4MB5A 3VD5A 1ZBKA 3MO4A 4UFMA 3T2QA 1BTCA
chains in the Genus database with same CATH superfamily
1V3LA 4EPDC 2CBIA 2H9AB 4G56A 1OFQA 4GI6A 3CYJA 3REQA 2ZQTA 1R2TA 2QAPA 4NIRA 5A6MA 3TMQA 1Q6DA 3OIHA 3AIBA 2Y24A 3ITYA 3BLEA 3SSZA 4WRHA 1Q6CA 2NV1A 2I9UA 5TQLA 3DGBA 4ML9A 5CCZA 1DJIA 3WBXA 3KFTA 3FS2A 1GG1A 1OB0A 5F4WA 4NX0A 1KD0A 2CIPA 4GE8A 1KCZA 3M44A 3IAPA 3QBUA 3QOMA 2FH6A 3TUUA 3K1DA 1PZ3A 2LPVA 2HV5A 4GQRA 5MHBA 4O8RA 2RDUA 1DJYA 3ARSA 4HPJA 1A5KC 1NIUA 4ASTA 4O54A 3ZYZA 3CEPA 4GH1A 2XINA 4DAIA 1YMYA 3DFSA 3LTYA 3REQB 2GJPA 1TV8A 1M04A 1V0KA 2V3EA 1H51A 1VIWA 1P7TB 3WQDA 2Y5JA 2UV8G 3T42A 2PRMA 3I3DA 1JCNA 3AZTA 4K39A 2I5IA 1U83A 2ZRXA 2CLFA 2HZGA 4OBRA 4OKDA 3FLUA 4C6BA 4J28A 2QLYA 5EU9A 5AC8A 5IBXC 3Q2DA 5LGZA 5C54A 1CLKA 4M6PA 2DSWA 4D71A 1UASA 1L6SA 1JUEA 2HNHA 5BOOA 5I0DA 2HPIA 1BEUA 5FEZA 1K8CA 4ZODA 1TPWA 3QXBA 3IIOA 4GHRA 3LV5A 4GI4A 3W72A 2WHMA 3O6YX 3TMLA 1V93A 3FSTA 1QVBA 1TA3A 1ZENA 3E02A 2OWWA 2YLAA 3E2SA 5AKQA 2CZVA 1QI3A 3M0XA 5RUBA 3TYAA 2YDAA 3FGCA 2BNJA 1C9DA 5E0FA 3VOIA 1OK4A 4B3LA 3UQIA 2VEIA 2XIBA 2EO7A 4ZSTA 2E6FA 3P7YA 4AQLA 1MMFA 3UWZA 3M0HA 1AQMA 4JCMA 4BWLC 1BLIA 2VZUA 3CB3A 4H04A 1RCQA 4TVCA 5LGXA 3T0AA 3S4TA 3QH2A 4WDUA 1RY8A 1XBXA 3UGVA 1NU5A 3ITTA 1QWKA 4H9VA 3F4VA 1TPVA 2FZBA 2Z26A 3SY8A 4CUCA 4BEQA 3W88A 5CZ0A 5HAOA 1O1ZA 3PHAA 4DBSA 1SMDA 3G3DA 3PM6A 5KSWA 3VKBA 1U5JA 2OZ3A 2VX4A 2BHUA 4RLIA 1SQ7A 1XSIA 2JIWA 3MSGA 1EDQA 1JG9A 1FX6A 3S5YA 3VNZA 1RLDA 1RLCL 4MNMA 3U2OA 5I6SA 5DY2A 1XYFA 3WQGA 4A22A 3LG3A 2M08A 3MP4A 1Y5WA 3PZTA 4WSKA 2FFIA 3W27A 1ZP4A 2X30A 4FNPA 4TX9A 3VCCA 2VGGA 7TAAA 7ENLA 1E43A 3H2CA 3NZGA 3PUOA 1W5PA 4LBSA 1O5XA 4DO6A 2O56A 4QE4A 4J35A 4QS5A 3R8RA 3NGFA 2INFA 1Q6EA 1SJCA 2X0SA 4PCSA 3O6CA 2IW0A 1E44A 6REQB 1Z32X 1PTDA 2EG7A 1EPVA 5BW6A 3W1TA 4OBTA 2PCEA 2L5HA 1CIUA 2PDBA 3UJEA 3BO9A 3B0XA 1EJ7L 2BFGA 4HHMA 1YDYA 1WPCA 3UETA 3POCA 4UUIA 3LPPA 2DVUA 1HJXA 5DLCA 3NNTA 1OZQA 4DI8A 1F7BA 4ERGA 2VFIA 3G1DA 3WNMA 3K8KA 1IEVA 4Z0SA 4HPNA 3SJ3A 4HU8A 3BSMA 3K4AA 3SCNA 2YW3A 1UH3A 2ZTJA 7CGTA 1W5MA 4JFKA 4O1EA 5CAHA 4AAJA 3GC4A 2ZOXA 1MQQA 3OG2A 1TIWA 3TU9A 2ZRZA 1KXVA 3ES8A 1P6CA 4DBEA 4IJRA 2QR6A 4AVFA 3PUGA 4EF9A 4W7VA 5JH2A 1IXOA 2Y61A 3BMWA 4L3NA 2VR2A 3AXMA 2O4MA 3BLOA 2DVTA 4GYJA 2J6XA 2WJFA 3VC5A 3MSRA 4WQ6A 4U2YA 1NAL1 3MANA 1UMLA 5A5WA 3GAKA 2WVVA 1TMQA 1VD6A 3S2CA 1XUUA 1IT8A 3IUHA 4TIMA 3IAQA 5DEZA 1N8FA 2I1OA 5LA2A 2QCDA 2GQ9A 2MPHA 3GXMA 4XZNX 3VM5A 3M6DA 3H70A 3I7RA 1TELA 1IYXA 4W9PA 2O0TA 5KZDA 1GOOA 1IEIA 4GIRA 4XAGA 3EWBX 3K30A 5SWUA 2F4EA 3KLKA 2ZC8A 1WDRA 3WX7A 2IF4A 4IPNB 1GVOA 4H83A 5FJPA 1US2A 4PB4A 1NH6A 3N4FA 3W28A 5ENLA 3L23A 4IM4A 4JTEA 4F0HA 3SCQA 4AZGA 5KZMA 4J27A 4E2VA 4QT3A 4NAEB 1C92A 1AUSL 4Z2GA 4XG1A 3UXAA 3CXOA 2Z0IA 1E1FA 2ZRYA 1JNDA 2CZEA 2EPOA 4HCDA 3M64A 3VX0A 2GWNA 5EL1A 5C9RA 2OKTA 1JGMA 1ZY9A 1Y5VA 3VM7A 3CNYA 5CPSA 3EA2A 3Q37A 4K37A 2GZXA 2VC7A 3IS4A 2MLZA 2QIIA 4DPPA 2JKAA 3QHOA 1HJUA 4GWEA 3BICA 1QDSA 2J7FA 3RR4A 1QU4A 4I90A 3O05A 2IPGA 4DEFA 1OG0A 2J6VA 3PZ9A 4M81A 3IGUA 5A6KA 4EWND 3CZ8A 3XISA 1W3JA 1KGXA 5GJPA 3KADA 4IL2A 3UU0A 3WLSA 3QKZA 1X96A 3W22A 2HNEA 3T0TA 4L4OA 4JY9A 3N4AA 1RH9A 4GQ0A 4Q4PA 1UW9A 4GVHA 1PZ0A 4L6DA 1WZMA 1ADDA 3FXYA 1EJRC 3NQVA 3BCFA 1XHGA 1WKYA 4DRIA 2OPJA 4GA8A 4WY0F 3I4KA 2VEKA 3TDBA 3WH0A 4WD0A 3HPXA 2R1LA 4LBUA 2JBMA 1GVSA 2P1FA 2B5UB 3AALA 4HNTA 3OYZA 1MRAA 5HJXA 2G50A 4QDMA 1GYMA 3TC3A 4HK7A 1EJVC 3ME3A 4HK5A 1TPDA 4GNJA 3W83A 1GHSA 4IGMA 4A29A 1L2UA 1QPLA 4FI4A 1Q2RA 1KBJA 3QEZA 2WQPA 1JVNA 2Z1BA 3KBNA 3KDNA 3KL5A 2X2YA 3E9AA 4IFOA 3W81A 3MUY1 4S3CA 3QR1A 4W85A 3T05A 4IP4A 1MNSA 2TMDA 3B4YA 3II1A 1P5BA 1VFSA 3WJYA 4F0LA 1XP3A 4JTFA 1A47A 1JNEA 4GINA 4ZFCA 3K46A 5D37A 1L6WA 1CGUA 2GPTA 4UTUA 3EPMA 4DWSA 1OYBA 2MF9A 3H7UA 1FVPA 3CH0A 2PWVA 3VE9A 3EDFA 2PRHA 5JXQA 5D05A 3NQDA 4MIMA 2DJXA 2VUNA 4LAUA 3OLGA 1UD8A 1AMKA 2AMXA 2H8ZA 4X63A 3AS3A 3KLLA 1RCOB 4JYEA 3GQYA 2CITA 5KMYA 1U5VA 3EIPA 3IPWA 1YRRA 4BF9A 2XN0A 1JCLA 3PAOA 2JK2A 1W8SA 5CH9A 3H9RB 1KBKA 5LNUA 3C6CA 2O55A 1OFAA 5CLTA 2GJNA 3VKKA 3TAOA 4N4QA 1VFFA 4NZCA 4KWSA 3TKFA 3TX9A 2DDXA 2YXXA 4WDTA 4F79A 3ARYA 5BU6A 5G1MA 2WV8A 3NPVA 3K8LA 4JYSA 1JZ7A 5LNWA 2YKKA 4J1OA 1PDZA 5F2GA 2ISVA 3AHVA 4GD0A 3TYBA 3T40A 1LLWA 2Y1HA 4W9TA 2QT3A 1E6PA 3OODA 1EX1A 3A5VA 1A5LC 4C02B 1KT1A 5I7GA 3O5IA 3DKLA 1E6NA 1DWIM 3UJRA 2FMOA 7ODCA 3BANA 1TQXA 1F74A 3TROA 3TCEA 4QS6A 5HWBA 3K8MA 1E71M 4S3EA 1KM1A 4KCWA 1IF2A 3VNYA 3AHYA 4XKMA 1BKSA 3TH6A 4FLOA 4XAZA 1QT1A 3VINA 1QHOA 3GC2A 4O14A 2PZNA 1KFKA 3BOFA 3LSCA 1EFZA 5K9XA 3KWSA 4OFCA 3DYPA 2QCCA 4X9YA 1SM9A 1FBAA 3P67A 3CK5A 1JD7A 5BRPA 3FVMA 1BXBA 3RNDA 4YLWA 4NZFA 4K38A 1PZ2A 1JFHA 4JS3A 4DJFD 1UUMA 4Q8NA 3DBNA 2V3DA 3OOQA 3RCYA 4B5SA 2NQHA 3TTYA 3MHUA 1KTBA 3ZVIA 5G5IA 5HA7A 5CJNA 4JHMA 1UROA 1PV8A 1LUCB 4HU4A 3OIXA 1PKLA 1KQYA 2FGZA 2RH9A 1Q7MA 4HYVA 4UFJA 2GK1B 2VC9A 1ICQA 3NZ1A 2EF9A 2HISA 1HJWA 3EKGA 4HNOA 2V30A 2VZVA 6CGTA 3NQ2A 1EO5A 3FV9A 4GCAA 3MDYB 4FLSA 5M17A 5TNVA 2HRWA 3OA3A 4KWUA 4MDPA 3QR3A 1FKSA 2YOCA 2BVYA 3ZLGA 5F4XA 2LJ4A 3DU0A 1Z41A 4ZO9A 4V15A 1B9BA 4PBFA 3S42A 1DWFM 1S5VA 4HMNA 3OLEA 5K7JA 2WHKA 1W26A 5A6SA 3LPOA 1P0BA 1PIFA 1XDJA 4KIRA 3VIIA 3U5UA 5FJIA 2QZRA 3ECQA 1YATA 4JFLA 1EEXA 4PTMA 3AS0A 4UNIA 3HQNA 3F4WA 1TTIA 1N1AA 1TZ9A 1P0EA 1XPYA 4B5XA 3LM7A 4B5TA 1VPYA 3LY0A 3W1XA 1V6YA 5ABTA 1DOSA 3MKCA 3RLVA 2X42A 4GFSA 4E8GA 3KS6A 3UJ2A 1OC7A 3ABOA 3OA5A 3NJ3A 4PBEA 3GUGA 5DO8A 2PLMA 2FPVA 1PCWA 4XVDA 2W3ZA 4XZIA 4KRZA 2NX1A 1EX5A 5G2WA 3PTKA 4GRSA 2RJGA 1VFOA 4HPXA 1NJJA 3HG3A 1GUVA 2I5QA 2OZ8A 3UZXA 3SCPA 5CC5A 1AH4A 1OADA 5FACA 4HVXA 1EZWA 5DRCA 3BK0A 4REQB 1GQKA 3J7HA 1BPLB 4GJJA 1V03A 3WLTA 5DT7A 4ZBCA 5HK4A 2FKEA 4HYRA 4JIRA 2MANA 1OC5A 3K5XA 4GYFA 1C91A 1TRDA 4YNGA 3L2MA 3I4EA 2HS8A 3ZQ9A 3VIGA 4FLRA 3AWNA 1KWKA 3MUZ1 4JEQA 5L6UA 3WQFA 2C91A 3WD0A 2IS7A 2OYLA 3GTHA 3D47A 3EXTA 3ZZ1A 5HANA 4H8HA 2QHAA 1JGIA 4EPKA 2X1IA 1Z8AA 3MMWA 5AOUA 3MS8A 1J5TA 2VCDA 4E5TA 3NEVA 2X16A 1GOKA 1TYGA 1ZHAA 4AY7A 3L0NA 2GVYA 4LUTA 3SI9A 2FVLA 2MUCA 4L7ZA 4BKNA 3RITA 3MVIA 4E4FA 3GKFA 1ZCOA 5HMDA 1FFRA 2AGKA 2Y2WA 1E0WA 4K36A 3MKVA 4EXBA 2CW6A 4KQZA 3SN1A 3CTTA 3AIRA 3WH9A 1EXBA 4HA4A 1HKJA 1E56A 5FI8A 3MI6A 5BWAA 3GSMA 1FKLA 4L1XA 1XGZA 1Q6QA 3ES7A 3A64A 3G1AA 4M5PA 1OGGA 1J12A 3JR2A 2WZIA 3LCHA 2Q5AA 4WK9A 4JTQA 2FAPA 1UA7A 1Q8JA 2CLHA 1KNWA 2PDLA 1FKHA 3PTMA 1QBAA 2ALDA 2C19A 3NQAA 4YYFA 3NA8A 3S83A 2ATMA 3UY8A 4U2ZA 3KABA 2ZVRA 2X0YA 1T11A 1K6AA 4L4MA 5HMSA 4FA3A 4GIEA 2OELA 1V3IA 3AU2A 5A8PA 2DZTA 2PBCA 3IK2A 4IICA 4OV4A 3V0UA 4C91A 2MNTA 2ZIDA 4ODOA 2XVNA 2OTDA 1C8QA 1GYLA 3E5BA 1WXZA 1LQ2A 3NZQA 2YBVA 2OT0A 3EAUA 3GU9A 5EMUA 1UIOA 2ZZ6A 3O5RA 3L9CA 3HPFA 3C2RA 4B5VA 3UJFA 3EKLA 1WUEA 2DORA 2OLHA 3QY6A 4DH0A 4K2SA 4ZXOA 4CD7A 1B3ZA 4TQTA 2KO7A 1J2WA 4IMEA 4XSMA 2WC3A 4C7FA 2IPFA 3TTOA 3LNMA 4FNTA 1OX4B 2PDNA 1OY0A 4BHYA 1LWIA 3WF2A 3WLRA 1T6MA 2Q01A 2JKPA 2QF7A 3P2VA 4JKMA 1C90A 1IQ8A 1TZ7A 1ICPA 4DZ5A 2ALRA 4DB7A 3M7SA 2ZUTA 4A8RA 1OT2A 4PRRA 4JZ5A 2FHFA 2Z28A 4RE0A 4M6UA 1C9HA 2FZ9A 2WO5A 2AGTA 1FKDA 1ONRA 3WQEA 1M03A 3W6MA 5J6EA 1JRCA 4N6FA 2OKOA 2OQYA 3M7WA 3DECA 2FVKA 3LBOA 5G2HA 3VX1A 5AYYA 4GH3A 3PWGA 1RJQA 4D6JA 2ADAA 1OX6A 5DO2A 1H7WA 2R1KA 4DZHA 2QUVA 3GHRA 1LG1A 2AMGA 1PSCA 1RQHA 4QNEA 5HUPA 4LEQA 1QRQA 1AJ2A 3QTPA 3XINA 2HEJA 3L4YA 1J6PA 1GKQA 4GMEA 3TEVA 3I6RA 3WMCA 1N55A 3KACA 1BKHA 4TO8A 1RK5A 1J4EA 1BTMA 1GKRA 4OU1A 1FQ0A 3IGHX 4YTRA 4EACA 1BQGA 3O7UA 4PUDA 4W7UA 1QNVA 2HVMA 1EJTC 1TX2A 3W4RA 3EDKA 4IMCA 3GDLA 2LGOA 2ZR4A 2CXGA 1V51A 2QMKA 3DENA 2IKHA 1LBMA 2PU1A 1D3CA 3DYMA 4J3ZA 3GXPA 3S5NA 3T7VA 2UY2A 4LAKA 3ZR4A 2WLZA 1G4EA 1LOSA 1TWDA 4J5NA 3HGOA 3M16A 1W6TA 3G1HA 1OABA 2HBXA 2CBVA 3CLWA 2DEPA 2CHOA 2Z1VA 3AIWA 3ZR6A 4MSPA 1Y0OA 4XAYA 3L67A 4XB3A 2A7NA 5LIKX 3SGGA 3PB0A 4I8YA 4ZVJA 4O53A 1K77A 1SJAA 1YIXA 3WLIA 4LS1A 4EAMA 2QCEA 1U5HA 1FWTA 3P74A 2CZ5A 1ENUA 4K6AA 2J13A 1KFCA 4QJ1A 5HNNA 1IHIA 4UZSA 3AYVA 3VAVA 3QV7A 2EPNA 3O0KA 3CZJA 1YADA 3EX1A 1Q7QA 3UESA 1PIIA 4JFVA 1TPUA 1A0EA 1CB2A 2J8GA 1TPC1 3NQMA 3P84A 1I2QA 4O15A 3QV9A 1I1WA 1O12A 4PFMA 4UTIA 1PTAA 4IMFA 2VENA 1V0NA 4PUJA 3F2CA 3MO7A 1TV4A 3HZ3A 2INZA 3UYIA 1CYGA 2E28A 3GW3A 1W8GA 3E96A 1Q45A 4AY8A 2Y4SA 4LTSA 1PO9A 1JDAA 4IQCA 1FWJC 3BG3A 2PC4A 3NI6A 1A5MC 1TMHA 4Y2WA 2D1ZA 1U22A 9XIAA 5D75A 3T09A 2HE5A 1E73M 1R3SA 3KM8A 3F03K 4CQ8A 2YIHA 1YNYA 4AX6A 3P62A 1JCJA 3GFYA 4A8IA 1ZQ5A 4GJIA 1JCXA 4L80A 3M47A 4Q4OA 4JTCA 4J3TA 3NQGA 1TCDA 1W1A1 2AL2B 4PL1A 1IEXA 2ISFA 4CKQA 3CQIA 2R8WA 2Z25A 4K7VA 2A21A 4NZ4A 1KA9F 3GVVA 3ZOAA 1EDTA 2NVDA 1JCHB 3IIPA 4QXIA 4PSRA 3VDBA 1D7KA 4MJ2A 4E6MA 2REQA 1F4HA 2FYMA 2IQTA 1GK8A 1SSGA 3GG0A 1JI2A 3RCNA 1M1BA 1EQCA 4AZ5A 4PUEA 2BP1A 2ZADA 4B5UA 2WQDA 2H6RA 5TAOA 2CKRA 2XIQA 5A6AA 2VVSA 3R6IA 2CERA 3BAIA 3WG6A 3INPA 5DCBA 3HBLA 1B90A 1DTNA 1RA0A 4Z1YA 4DY1A 1YBQB 4ROPA 3S9ZA 3GW0A 2O9OA 3DGRA 3QW4B 3MPGA 3ANUA 5D9OA 2QJHA 4B9YA 1RZMA 1GVYA 3CQJA 3WQOA 5D2YA 5BXSA 1VCVA 2XZ7A 5C7VA 2VZSA 1UWTA 3KAOA 3AHZA 4UBPC 3T08A 1KT0A 1KWGA 1FHUA 3L4TA 4D1IA 1QO5A 4NU7A 4A2RA 3WCZA 4IQDA 4P8VA 1TPH1 3H2AA 1DTUA 1POJA 3B8WA 4LYKA 1PBKA 2WZHA 3ZR5A 4DRHA 1E5NA 1JQXA 1XFCA 5CZSA 1LWHA 5JMUA 4KERA 4NKCA 1JF6A 1ITUA 4G6CA 5PTDA 3TZNA 4TNSA 2FTWA 3OVGA 1Q6IA 3GM8A 3KX6A 4FNUA 1U1JA 1KM5A 1NOWA 1S5NA 1UZ1A 3PZQA 4MJZA 4WXZA 1JZ6A 3T0DA 1TIMA 1ELSA 4A3YA 3DFTA 5CPQA 4JFJA 3MC5A 3B9OA 3V18A 2P3EA 5MF5A 1CXLA 4A21A 3PRAA 4KIEA 1TV5A 2BY2A 3SUSA 4PCNA 4XD4A 2GJXB 2QDEA 2R1NA 3OVPA 3WLPA 5C2GA 4MUPA 1KRMA 1D3GA 3PZGA 2GQ8A 3DBPA 4GI8A 1VLIA 3D3FA 4MSSA 1XCXA 2GUBA 4QIBA 2F6UA 4NVTA 3E0WA 3BLLA 3MDWA 4I3GA 3HG5A 4RW3A 2YYTA 8CGTA 4C6PA 4B90A 4FX8A 3TCZA 2W61A 3MY9A 2WJEA 4KCUA 1EOMA 4JN7A 3WMBA 2NWSA 1LP6A 5BYWA 3TW7A 2V5CA 3EGJA 3LI0A 4EE9A 2RDTA 5AHFA 3IUIA 1DXEA 2BGNE 4GUHA 4L64A 4QE5A 2GVLA 4PEEA 3D0CA 2YSWA 2RUDA 1EGMA 2QJJA 1TWIA 1SFLA 4NZ1A 1BVNP 3G1VA 3WD1A 1HL8A 3W86A 2BSLA 3CUIA 3S2JA 3H22A 4AYGA 1ZLPA 4HSNA 2OYMA 3R89A 3IRDA 4I7VA 4WSJA 2QULA 4NASA 2VO5A 2XISA 3NOEA 3Q65A 5ECVA 2P88A 3SCOA 2VUYA 1WNOA 3WD3A 3CO4A 4R27A 4ZQRA 3W1QA 1M6JA 3DI1A 2QUUA 3WQVA 4DJDD 3W7MA 4PMYA 2ZUSA 5HR6A 4Z1CA 4L4PA 1IGSA 1S2WA 1FY6A 1M7PA 4LUYA 3V35A 5FF0A 1W3NA 1XGEA 4O17A 3GNRA 2WMFA 3WQ8A 3VABA 1AA1B 1YXYA 5KITA 3LGDA 4EAYA 1F3TA 2QJIA 3ITCA 3MUCA 1J0YA 2Z24A 1W3LA 1ZPTA 3SN0A 4LEFA 1LT8A 4TW6A 1LL7A 4GXWA 2HPMA 3T07A 3VU2A 5AHMA 1YW5A 2X7WA 4Y9PA 5LNVA 1UR2A 3QHMA 1XBVA 3ZMRA 4A4AA 3PP7A 1OG6A 2OT1A 1GVRA 4DI9A 5E93A 1K7EA 1E5JA 3A9BA 3OLDA 1GVIA 3EPNA 4Z2KA 1REQA 5CZTA 3V5FA 3WLJA 3N15A 4CU6A 1UR9A 1IXNA 1PL9A 4OWGA 3VDCA 4GX9A 4P8WA 1J4RA 4US5D 2GGHA 2ONEA 3DERA 3V75A 1E4LA 3GFXA 4HPGA 3CT7A 1UR4A 4MB4A 1K9TA 4GYPA 3WK3A 4JHOA 4Q7BA 3QW3A 4YTUA 3QQ0A 4ZTYA 1PUDA 1XGDA 3FIGA 1AFSA 4NILA 2FJKA 1TMLA 5LHEA 4DYJA 1QI0A 3ZJKA 4JL2A 4ZPVR 3LCGA 4HHPA 5HW6A 3N2OA 5A6TC 4RDZA 1B3OA 1F2JA 4CVWA 4AXNA 5K3VA 3F5KA 3R0DA 3ISIX 3BVJA 2J9XA 6ALDA 1EP2A 2YCKX 3C2VA 1I2NA 4XIAA 4WJXA 2XP3A 3DFYA 2Y85A 2YB4A 2Z6IA 1E6ZA 3SQLA 4PMUA 3WQ4A 4FK9A 3SCUA 3EB4A 2WK2A 2QCFA 2OG9A 1BVZA 1CLVA 4GZEA 2CLIA 1QATA 3VA8A 4D8LA 4WJ8A 5FF2A 1XIDA 3O5MA 3DH7A 4N6EA 4UNLA 1QWGA 1FWEC 1UZDA 5JH1A 1FKTA 5A2AA 1FWHC 5HW7A 3IJIA 1WAWA 7A3HA 2WMKA 3E2QA 3W7EA 1J2BA 1UJQA 3KRUA 2WCGA 1X39A 5CC6A 1FWRA 1UOKA 4XX6A 4ORMA 5TF0A 1G1YA 3NM1A 4PUKA 5I07A 4C6NA 3BWWA 5AFDA 1OC6A 2ACUA 4IT4A 1ZBKA 3MO4A 3CT2A 5AHNA 4YVVA 4D6FA 3N14A 2EJAA 2AL1A 4HSHA 2AKMA 1T5AA 2W27A 1EIXA 2QJNA 4X2RA 4H9ZA 4JTKA 3L7RA 2UY5A 5DIUA 3UCCA 3GXIA 3FSUA 1FDJA 3IRSA 1YYAA 2ZZ3A 4B2DD 3KP1A 1P0DA 5D9NA 1NFPA 3RX4A 1M65A 2WC7A 3FN9A 3W7DA 1PX4A 5LXXA 1NF0A 5HR7A 1TREA 3VO0A 3RX3A 5I3KA 3IJ6A 3UI4A 4RNHA 4CU8A 1NP2A 3GDRA 1EJSC 4YTQA 1R3QA 4BQ2A 4KRUA 3O9NA 4IJBA 3SIZA 4H9TA 4WXYA 4IF2A 1HF6A 4MGVA 2OO6A 4XBJA 1AK5A 1HTIA 2JALA 1ZBWA 4DXKA 1LBFA 4L4LA 4ZPTR 1FHVA 2OB3A 3W01A 1BVWA 4B91A 4IIDA 1PBGA 3AXIA 2E6YA 1K9FA 4W9QA 1BYCA 3ABZA 2ZE3A 3N6QA 1OGBA 4XBKA 3UPBA 5CPNA 2QUMA 2Z00A 3C0QA 4PGLA 2VOMA 1PB0A 1K3UA 3PY2A 3H2EA 4Z2JA 4NI3A 4WF7A 3U48A 2PDQA 3NG3A 4RKAA 3ZWSA 4FLQA 4S3JA 5I79A 4L6HA 1L1PA 3BZJA 4MWAD 5KINA 3HIJA 1D7IA 2NV2A 4ODKA 1DWHM 2WSRA 4PMJA 4GIVA 3DC8A 1KM3A 3ZT6A 4O0ZA 1GWJA 4CQCA 2ZUNA 4JIIX 3G0SA 3FK4A 1FD9A 1TA3B 3GX9A 4L1GA 4W8AA 1XH0A 3I3BA 4AF0A 5A8QA 1PKYA 4RDVA 3RU8X 1DWAM 3ELFA 2PTWA 3VDAA 2GDQA 1CI1A 3MDUA 1EF3A 4HTYA 3V1PA 3LDVA 2NSXA 4HNVA 4UFLA 1IV8A 2HK1A 3CV7A 1P5QA 2V81A 4RZBA 3W1RA 2YJQA 5AC6A 3O8AA 3GBEA 3WN6A 5J5RA 3BGJA 4FZIA 4IT1A 1E55A 5LYRA 1JYWA 4HA1A 3O5EA 3LI1A 4J40A 3UA4A 2M2AA 2J7BA 3SZ8A 4DUVA 2CLPA 1AW2A 1BAGA 4FAPA 3VNLA 3RPMA 4M3PA 1UD2A 4S2BA 3T0BA 5FAGA 2E9MA 3A4WA 4N7QA 3AS1A 3MYPA 4OUIA 5E1QA 2BG5A 2WANA 3SB0A 3BMXA 2DW7A 1VCFA 4FOUA 1CT5A 1HVXA 3TP4A 3NQBA 5M1TA 3TSBA 5LNSA 2AKZA 1VZWA 4JFTA 3WNKA 4ADUA 4PL2A 1Q5MA 3HB9A 5L9FA 3CQKA 3M0VA 1T40A 2O7SA 2KX9A 4ERIA 2G3MA 2PAJA 2QVNA 4D2JA 3LENA 4ODNA 1CDGA 4OOUA 2V9DA 2E25A 1UKTA 2PSNA 3S6DA 1S39A 2B7NA 2KE0A 3LHUA 5FA5A 2WZMA 2WHLA 1AODA 2VDHA 3SGUA 1NMVA 3A9IA 4DYEA 1Q8AA 4MKSA 4I6KA 2RUSA 3WUEA 3NM3A 4QCEA 3UZJA 4ZENA 1A5CA 4GYKA 1O94A 3SUUA 4CNNA 5J8LA 1H4PA 3SAZA 3VGDA 4LNYA 4RJEA 3D6NA 5FF7A 3E0IA 2F23A 2HS6A 3HG4A 3WBWA 1LT7A 1M41A 3L2LA 4IP7A 1OZMA 5LKYA 2XIIA 1FCVA 4U86A 1VBRA 2J74A 2AQOA 4PODA 1DQXA 1S5MA 3WLKX 3LYEA 5I06A 3LBMA 2FKPA 5H8PA 3G5EA 3TIMA 3S5ZA 3AXXA 1EB3A 1UWIA 4UOJA 3DXIA 4Y8FA 1L8NA 1B5TA 1OEPA 1BWVA 3G1RA 1DL3A 2KI3A 4Q8QA 1XLGA 1A0CA 4TX8A 3W2KA 5LXEA 2DZAA 4WDWA 4QSFA 3UG3A 1E4NA 1ZU8A 3W7NA 2PDPA 3P3BA 2PWUA 4HJFA 1X8CA 3V7PA 2FPYA 2GQ3A 2WXDM 4GCXA 1AZ1A 1E72M 1QCWA 3LS9A 3GIQA 3KVJA 4FXRA 3RFAA 2I57A 2A3EA 3IJLA 3V5OA 2IPWA 1IIHA 3A21A 3M41A 5H6HA 5M2FX 2FVMA 1K8YA 2ACRA 3DAQA 2PTXA 3FJ4A 2J7DA 4GX8A 4DUOA 3VCNA 3E6EA 1H1ZA 1OFDA 1EO7A 3COTA 4S3GA 4IL0A 4I9TA 1HO1A 1NWRA 3DKJA 3NGJA 2QQ6A 4R85A 4C6LA 1KFWA 5FOOA 5DXYA 5C55A 3S5OA 1AD1A 2HK0A 1WAUA 3P5YA 2V3GA 2KZHA 3WKZA 4O12A 5E6ZA 2BXVA 1XLIA 4X0NA 3T81A 1HKVA 3WUGA 2P8BA 5I03A 4XO7A 1GTEA 1H3GA 4DO5A 6A3HA 2BOGX 5EFDA 4LF1A 1WBHA 5ABFA 1KRCC 1JYXA 1XLMA 3TSMA 1UHVA 3WH8A 5I02A 1Y7VA 4REQA 3BMBA 3MUIA 3M0MA 3SSJA 5JU6A 4RNJA 1P6WA 2Y0FA 1ZBVA 5EY5A 4Z2HA 1R6WA 1TCMA 3WBYA 3PBYA 5D30A 3GB6A 3BLDA 5D2WA 1JRBA 4ITZA 4YIWA 4Q4SA 3K13A 3GK0A 3PRBA 4JOMA 4H4IA 4K8HA 3CHVA 1G4SA 3WH6A 2FZ8A 3UYCA 1VP5A 1Z42A 1EBGA 3HV8A 4UQEA 4ZCWA 1UWQA 1Q6RA 4NSBA 1BXNA 5G2IA 4FF5A 4GNKB 4DM2A 3CIVA 5LNRA 3CMFA 2PWGA 1RAKA 3SURA 3DFOA 1EUAA 4LRSA 2ZQSA 3FYPA 3QV8A 1VBHA 4HBKA 5AYBA 3FAXA 3BTNA 2CETA 4HN8A 4WOQA 3BH4A 3PB2A 3W24A 3QLLA 3CAVA 3CYVA 3VUPA 3PWAA 3GXTA 2KAUC 2XH2A 2I9EA 1KLYA 4DZ3A 4FPSA 3MI2A 4S2CA 4ATDA 2NQZA 2V8ZA 3P0WA 1FKIA 4LH8A 3PZVA 4JGDA 1ME8A 2TYSA 3N25A 4AWEA 2P0IA 1TJPA 4E4UA 3DESA 3I6TA 4URIA 1M5WA 1B54A 1I1XA 3O0FA 4IH3A 1QMLA 4M6VA 1MZRA 1HXJA 4G1NA 3FFSA 1RJRA 2QUNA 3GTFA 3SQMA 3TK7A 3MZNA 4E38A 4ZOBA 2QV5A 2W0UA 3NSNA 4CNOA 2PTZA 1H0IA 3KBVA 4CQAA 4LAWA 4XAKA 4QJ4B 3TYDA 2D69A 2VNCA 4U85A 2WMIA 1B3XA 2JEQA 1W5QA 3ZSSA 3QR0A 4KKXA 4QDPA 3PSWA 4F0SA 2XIJA 1E1CA 3GH4A 1KC7A 2EPLX 4DROA 3NPUA 2WWCA 4IGSA 3HMJG 1MRQA 2I16A 4JCLA 1DIEA 3RJXA 3XIMA 6XIAA 2DP3A 4BQ4A 2G3JA 3AIVA 1DIDA 1V08A 5XIMA 3GD6A 2Y63A 1IGWA 9XIMA 2DIKA 3SIMA 3ZT5A 1W56A 5A8MA 4DAFA 4O18A 2PGWA 3CL8A 3AJXA 4HBEA 5G1TA 2A85A 4DIPA 1XDMA 3ZM8A 4GUGA 4TVDA 1BRLA 1MUCA 5ABEA 4HYWA 1M7XA 4AY1A 4FAMA 4A35A 3JZEA 3WEZA 4LANA 1GOMA 4QG8A 1AH0A 1GEQA 2QYGA 4JQAA 3BCJA 1EA9C 1SU5A 3SCRA 3QV6A 4RUBA 4HMCA 4JAWA 1WO2A 1Z3NA 4DX3A 2WHJA 1JYVA 2BGSA 2ZA3A 3TA9A 3RXZA 3URQA 4M56A 1H41A 4FO4A 1AD4A 4X3ZA 2J9ZA 3OVQA 3PZMA 1R3RA 4XTDA 1E6XM 4XAPA 5EYWA 5F4SA 1VPXA 2QPXA 3UI5A 1TJ0A 1PE1A 3NEHA 2PURA 1CENA 1F07A 3GR7A 1HJSA 4H2HA 4GGQA 3GS6A 2W67A 2WBGA 4MB3A 2ETNA 2VYOA 4ZQMA 2BVTA 4XWUA 3HOJA 5TBOA 4S3BA 3N34A 3NSMA 1CGWA 1K6WA 2A0NA 4V1YA 1VFMA 2HTMA 4BQ3A 3TDFA 4LYPA 3LCLA 3CM4A 1Q6GA 3GVGA 1DPMA 1D7FA 1UKOA 3V3WA 1ZSXA 1JXJA 1XKJA 2FHBA 1XIEA 3FXGA 1JZ4A 4IX2A 3VNIA 3IVTA 3U6WA 3H2MA 3LRMA 2A1YA 5D32A 3RLHA 2XWEA 2IQDA 1S5WA 3EWWA 1AL7A 3TR9A 2XIOA 3B9AA 3PR9A 5D8WA 3O6AA 4XK2A 5K9CA 2NVAA 2PP3A 3N9RA 1E9ZB 3FKKA 4Q8OA 1KM2A 4AUBA 6PTDA 4Z17A 1PXGA 4UTKA 2PDKA 3GH5A 1BSIA 3GU1A 1WDDA 3URAA 1QW8A 2V3FA 1CX9A 4RV3A 3FY1A 2NQJA 1XH1A 2F84A 2VTFA 3VCRA 4NRSA 4S3AA 2ZFAA 1IXQA 4F3HA 3APTA 3GHSA 1OCBA 4NZ3A 2E3ZA 4XQ6A 4UQCA 1GORA 4LAYA 1FH7A 2D3NA 4O52A 3GDMA 1Y0EA 3CU2A 4H6RA 4KW2A 3VNKA 3UWQA 1B3VA 1V6VA 4QIUA 2K8IA 2PLKA 5T9BG 4E2DA 5HATA 4J3UA 3GRIA 3KCOA 3GXFA 1A3HA 4QNWA 1PJ9A 1XICA 3EWZA 1VJIA 4CGTA 1D6OA 3ABXA 1R47A 2ZUVA 2RUCA 5CPTA 3MBFA 3IJ9A 3JRKA 5DBUA 5CG0A 1H62A 1UIPA 1VFUA 1JCMP 1SR0A 1R85A 4TW8A 1J4IA 1EKOA 1OINA 1VFHA 1B3YA 2IKIA 2J62A 1TVNA 4LSBA 1UWUA 1H7RA 4US5A 1SMAA 4FF7A 2V2CA 3C8FA 4CCDA 3M0ZA 3ZJ6A 4DRKA 2NQLA 2IXVA 4ODMA 3BARA 3UEQA 2EPMX 2VWTA 2X2GA 3T8LA 3KTSA 4JFWA 1RHCA 2PTYA 3E5PA 4GOAA 3KAFA 3VIKA 2YBUA 4C60A 1DE6A 1KFJA 3CPUA 3E3HA 3KAGA 4ACZB 1FKJA 4JHZA 4TTUA 1KXTA 1E3XA 1GOQA 1HQTA 3QYQA 3F7JA 1OBAA 3DIPA 3NAVA 2FGBA 3WNLA 3PNZA 4DRPA 2DVXA 1T0OA 4UXDA 3TYZA 2DSUA 4JN8A 1VS1A 3PG9A 4M80A 3FHAA 1TVLA 3KBJA 4QITA 3B03A 3WLLA 3AMGA 3UW6A 2P8CA 1QO2A 3EZ4A 9CGTA 1VQTA 5HXMA 2XUCA 3TQKA 5C5YA 3W23A 4KCTA 3G2GA 4GKLA 1FRBA 1SPQA 1DWGM 3KOWA 2DIJA 4H7ZA 3R8GA 1B4EA 1DJHA 1SZRA 2PN0A 3UPWA 5IHRA 2DGAA 5A2CA 1LQAA 1ADSA 4I5XA 1JCYA 3TNOA 1UB3A 3NO5A 1E15A 5DMNA 4N9DA 2PPNA 1TX0A 3WF0A 3G1XA 1FWGC 2XSAA 3HQOA 3NR0A 4ADTA 4HD5A 5AB3A 5I3IA 1TV2A 2R6OA 1EBHA 3M0YA 3WDRA 1Q63A 3PAJA 1CEOA 1KBLA 4GBDA 4LVDA 3RN6A 2WSYA 5T8GA 3A4AA 4PUWA 1EGZA 1D8CA 2PBGA 4FIQA 3W7RA 3C2YA 3GNOA 4RPPA 1OFPA 3WLNA 2YW4A 3FA4A 2PV2A 1VHCA 1XLFA 1M53A 1MXGA 2GK1A 5BXTA 4UB9A 3HO8A 1W1VA 2BXZA 1OSEA 3W07A 1VFLA 4MZYA 2IUZA 4PUNA 1BG9A 3HMCA 1QPOA 3NVDA 1F9CA 3LD5A 5I3GA 4AYSA 1LROA 2WCAA 5AN7A 3N73A 5FF3A 1IWBA 3L5MA 5M3WA 7TIMA 4L72B 3OW1A 3IVUA 3P60A 4CD5A 2QMJA 1RVGA 4HA0A 1Y5XA 2G3IA 4P7NA 4NF7A 3FX4A 3MP5A 3BSHA 3TNBA 4PTDA 1UKSA 3OJGA 2XU2A 1V3MA 3P93A 4IT6A 2FZDA 3LCFA 4O11A 4NP7A 3RYSA 4FOJA 4IQEA 5D2XA 3K2GA 3GBDA 4QQUA 2Y78A 3W1LA 3G1SA 2OZTA 3AO0A 2XFWA 1ITCA 3BLKA 3A22A 2A79A 2QXWA 2FLIA 3P61A 2FJUB 4AEOA 2PFHA 3EMCA 3W7KA 3GNNA 3SFWA 4FP1A 2QCDB 4OECA 4JBRA 4K7YA 5DQPA 1W1YA 1UC5A 4AU0A 1A49A 1W9PA 4HU3A 2VQTA 2FDMA 4UTHA 1MXDA 3ARTA 4KBXA 4C7DA 4ECLA 1M3UA 4S3KA 3DX5A 3ABRA 1E1CB 1EH9A 2QDDA 3VNDA 3O5KA 3DFQA 3O3RA 1RPKA 3QY8A 3VIJA 4F0RA 4ZO7A 4K8EA 1AL8A 4QG6A 1DJQA 3CWOX 5CPMA 2ZBTA 4W7WA 2F9RA 1EL3A 1UBSA 4LUTB 3BLFA 4P7RA 4BY3A 1H09A 5HNTA 2BY3A 3TJLA 3V1HA 1AQHA 1PHQA 4QT2A 2VL4A 1RR2A 4DYKA 3LN3A 4X61A 4JTJA 4LVBA 1XIHA 4NYUA 1E51A 3CHFA 4IMGA 5H1WA 3W7PA 1I75A 2Y5SA 2ZQ0A 3AICA 3CS2A 2XPBA 2XSXA 3EWUA 4KS0A 3QZEA 3VIFA 3AJ7A 1R7AA 1R0MA 3SRFA 1HX0A 3B8TA 1LLZA 4D9PA 2E1DA 3O5DA 5C9XA 4KEUA 2VRKA 5HQMA 3VOHA 2D22A 2PMQA 1KKRA 1YPXA 3KHDA 3GU2A 3UF8A 3THDA 1TQJA 3TJXA 3B0PA 1J93A 4NJHA 1VEMA 1SFTA 4WX2A 2ZVIA 4E0CA 1X7FA 3TV8A 1R3WA 2PF8A 2RGMA 2ON3A 3UWVA 5A8GA 3KWXA 4IP5A 2WYSA 4AZ7A 3RMEA 4M29A 3E1F1 4C5ZA 5AYZA 1EQPA 1KCLA 3THAA 1QBBA 4TX6A 3APYA 1YNPA 3W75A 5DRIA 4DZIA 4HNCA 1I60A 4ORIA 4DRMA 1MYRA 1VYSX 2EKGA 4GVIA 1ITXA 1EYWA 1YHTA 5A6LA 3ICJA 1PYMA 4A8LA 3WJSA 4UCGA 3B0VC 1MW2A 4W9OA 4GBUA 1TE1A 4JNYA 4Y96A 1YPIA 1N7KA 2ACSA 3W2NA 3SBFA 3V4BA 3NL2A 1XFBA 4YS1A 2D20A 1XLDA 4L61A 3I65A 1LCOA 2WSKA 1K70A 2DSVA 1Q3NA 5HOSA 4MLJA 2VWSA 3U4AA 4B2DA 4ZB2A 1MDLA 4U3CA 4OUEA 4UTWA 3C8NA 4JX6A 1BD0A 4B16A 4GABA 3LXCA 1MQPA 3TN6A 1F3EA 3VC6A 1RUSA 1T99A 1H63A 1QNRA 1I4NA 4TMBA 1UR3M 1RXOB 4UTTC 3UNDA 1XYMA 2HMCA 4I7WA 4XUGA 2WAGA 1NTHA 2XN2A 1Q6UA 1GCYA 4N4PA 3SGZA 2OX1A 4RE4A 3TCSA 3PBMA 1RP8A 2CLLA 3F4NA 4I6VA 4UZUA 4J2PA 2Z1SA 1IZJA 3IJ7A 3O6DA 2WVVB 1XYAA 3PBVA 1E0XA 1CBGA 5EMYA 1OM0A 4OHQA 2QDGA 4BI6A 1TB3A 3BG5A 2BVWA 1RALA 4LCSA 1VYPX 2IKJA 3KEHA 1FCQA 3BAKA 2YCLA 3UI6A 4OVXA 3SY5A 4Q8WA 1Q65A 3TJIA 3WLQA 1JZ8A 4C6MA 3T0CA 4ICCX 2YYUA 2DIEA 1WOBA 1OCQA 1C8VA 1VEPA 5B7ZA 1QASA 3U0HA 2NZLA 3E0LA 2P4VA 5LA0A 4PCFA 3E49A 2ANUA 1E6SM 8RUCA 2J7GA 2PRLA 2GQAA 2R91A 2VFEA 1VYRA 3EB2A 5DCDA 2BXYA 1NELA 1H49A 4KGJA 1MSSA 4H9XA 2Z6JA 1ZCNA 3C3NA 2VCAA 5T9CE 3W7QA 2CPUA 4J9JA 3CBWA 2NWRA 1W54A 4TTGA 1FKGA 2JE8A 4C6DA 5K2ZA 3JS3A 4PCPA 3S46A 1BKFA 5B80A 4X22A 5CSRA 5C6MA 2BVDA 3FDKA 1CXEA 5GPGA 2V0TA 4R33A 1QJWA 5JQ9A 1UWAA 4O0KA 4JTLA 5LIYX 1JDEA 3TSDA 2W66A 5I2UA 1CPUA 3IV8A 3PZOA 2UBPC 2DZSA 5BXRA 4G7FA 1BFNA 1TPEA 3OZMA 2GLKA 1IEWA 1UC4A 4O1CA 1L6GA 4GNVA 3UCDA 4C1LA 2M1IA 3W2MA 4D8AA 3QOKA 2RHGA 4ODPA 1OYAA 4TX0A 1J0IA 2PPPA 2JEPA 3AI0A 4Q4KA 1Z6KA 2PS2A 3BAYA 1PCKA 2GJLA 2I5GA 2ZXQA 4PC8A 3KDOA 2CWNA 5ECUA 3WD2A 3LA4A 2CBJA 3ZJ7A 4X2PA 4JNZA 3UFYA 1BSLA 3H12A 4HGXA 4PBGA 4UDMA 1OJXA 4F40A 2PODA 3H2NA 4Q7IA 4XSLA 4AF0B 4DF1A 3BOLA 3CWHA 3QMTA 2EXOA 4O19A 3BCDA 2J79A 2OZ0A 4F66A 1N2VA 4ZXLA 3N6HA 1V4YA 3BPWA 2CESA 4W84A 2A6NA 5D02A 4GIAA 1W31A 2ZZ4A 2QIWA 3APGA 1WKDA 1XYCA 4DRQA 3W7IA 1LRNA 3NUKA 1MNZA 3W2LA 1KB3A 4E2OA 3U4FA 2C16A 5AC5A 1S3TC 1L8PA 4JX4A 3ALGA 1XX1A 4LALA 1YNQA 3C2EA 2VDIA 1JJKA 1DORA 2YL8A 1YTDA 4D72A 5D9MA 4E4PA 3M46A 3KCLA 3PK7A 3GTNA 3KOYA 1XC6A 3W7LA 2GWGA 1J01A 4GI9A 1W9XA 3CHDA 2F6KA 2XGZA 2BHYA 1ZAIA 2E9BA 3QPZA 2BWGA 2J77A 3VE7A 3S9YA 3ARZA 3S3GA 4LY4A 3VOFA 3H2OA 3AC0A 3RGCA 3L4VA 3FVDA 4HZ7A 3GIPA 4DF2A 3LX9A 4GQBA 2VFGA 3LUTA 1UA3A 4JQ2A 1A3XA 3PFRA 2CLOA 5HNRA 2ZA2A 3T8QA 1GPFA 3IJDA 4I5UA 4TV5A 2DG4A 1S2UA 3QC3A 5CLWA 1TE6A 5GPRA 3QTGA 4ZO6A 4AZCA 1H1NA 3U3HA 4ACYA 1S3HA 3K4WA 1JZ5A 3CUXA 3WQWA 4BS0A 1JNSA 2GVEA 5AZ0A 3L66A 2ZZ1A 3GYEA 4JFSA 3BGGA 2IMRA 3R0UA 5CKSA 1R9HA 3LPFA 3WF1A 1HL2A 3GE7A 4AD3A 4UNKA 2BZNA 3A23A 5HQLA 2C1HA 4EPBC 2DT3A 5H8UA 5AC7A 2INEA 2WNQA 5J04A 1TV3A 4DELA 4L1WA 1DWJM 1J6OA 3C2FA 3EX2A 1WCGA 2YDRA 3MWCA 2BODX 1ZP3A 3KBMA 4FXFA 1XSJA 4AWSA 1DXFA 4LFYA 2PP0A 4CLMA 1LOLA 1RV8A 4LV9A 1K4GA 3AWOA 2XFYA 4W86A 4IQ2A 3N2CA 3C0JA 2OEJA 3FKRA 3W73A 1F6YA 4XIMA 2ZUWA 3ARQA 3BQ5A 1WKEA 3HG2A 1GRJA 1VENA 1OD0A 1V6UA 1GOWA 3M5VA 4V27A 4AH7A 3M0IA 4W4QA 3RRXA 1E1EA 1I45A 1RD5A 1UH4A 1I9CB 3LHVA 3OQ8A 2C3ZA 3GR8A 2ESCA 3LCXA 1YE4A 4GXPA 4NNRA 2VFHA 1MI3A 2NX9A 2QAFA 4CU7A 3VGBA 3LQGA 5FCZA 1ECEA 4Q4MA 4W8LA 3WBEA 1NWSA 3GVRA 4OIFA 3QPYA 5CXPA 1J11A 2GYIA 1J0KA 2WMJA 3WY1A 4RCXA 3CL6A 4DVOA 1NP0A 2GUYA 4YMZA 4Q6XA 3SR7A 3VFCA 2GOUA 4JTAA 3FAPA 2BHZA 3QFWA 1KV8A 5G1YA 4OT7A 2YZ5A 5BOFA 1XL9A 4ZQNA 2J8FA 2Q02A 1O1HA 4RW5A 1O6IA 3UWYA 1EDGA 2DZVA 1K8ZA 3ITXA 3ABSA 4PMNA 1X8FA 1IEQA 4J4KA 4TV6A 2ATSA 2VC5A 4R0XA 4DXXA 3O06A 2XH0A 5FEXA 1FKBA 5F2LA 1LM1A 3AXHA 4JXCA 4IIEA 1G0CA 5IXEA 2DT0A 5DIVA 1LLOA 5FD0A 2VXNA 3R10A 5MKGB 1R5YA 1N8IA 4DXVA 4UFMA 3T2QA 1Q1CA 3BUVA 4ODLA 2TRSA 1BTCA 4WKHA 3NQCA 3RR1A 3G1FA 2DY3A 1A53A 6TAAA 3F4CA 2HXUA 3G1YA 1CECA 5DY3A 2PV1A 4HHLA 4KPLA 2TSYA 4NYYA 5H8MA 3G8EA 5LIWX 1LWJA 3M0KA 1H7XA 3R7MA 4G7EB 4PA8A 2PLJA 4LPCA 1ITQA 3B8IA 4HSOA 3P8IA 1W1IE 1KFLA 4WHBA 2VEGA 5DANA 1WDSA 3CZEA 3HTWA 1IR2A 5CC7A 4DJDA 4WIWA 1DJWA 2B81A 4AZCB 1K7FA 2A3AA 1SW3A 1MEIA 1GYNA 3G0UA 1FWDC 5HUAA 4ZB0A 2PP1A 2J47A 2TPSA 1BHGA 1HKWA 1PINA 4GVGA 3CGNA 3SY1A 2BY0A 3MUXA 4LOCA 3S2LA 4GZIA 1PX8A 3GAYA 3QC0A 2NT0A 4CCCA 3NL5A 2YBTA 1O66A 1OK6A 3OLIA 3SUVA 4C6CA 2FZNA 2W92A 3AXKA 1QZ2A 4FMVA 4L6OA 2KFWA 3O63A 3S0CA 4XISA 3AHTA 2ZR6A 4AIEA 1C8XA 4C5YA 4PULA 3VGHA 2YL6A 1R87A 2IXUA 4HNUA 4EIVA 3GYCA 1VC4A 2HROA 2G4JA 1KTNA 5HINA 3VI2A 2JQXA 4MADA 5I3HA 3VD7A 3JYJA 2Y8UA 1QNOA 1JDDA 4GC3A 2I56A 3CGTA 1EC7A 3OU8A 1SR9A 3KTCA 3SEPA 3D3AA 2EPKX 1AZ2A 1YDOA 1EHNA 4EOUA 3WF4A 3LERA 1PPIA 1R9ZA 4LV4A 3VKJA 2W9MA 4D6DA 5KZ6A 2RJHA 1T7LA 4AZIA 4DBDA 1JPHA 2G96A 2QPSA 4PZVA 1F73A 3TA6A 4DZAA 3L0KA 3OHMB 4H9UA 2VURA 3UVIA 3L68A 1GKPA 3W00A 3ATYA 2QCLA 2OFNA 4P8XA 4AFYA 2XPKA 1HN1A 1FWNA 1NOUA 2OVLA 2R24A 4MY8A 4IWWA 3WIJA 1XIBA 4ZE5A 3S1GA 2XH7A 2UZ9A 1T8QA 1MFUA 1KM6A 1DQWA 4XZLX 2DQWA 1AH3A 2EULA 1ESWA 4XAFA 3TTEA 2XSBA 3TOYA 3HPAA 1K8XA 4IG2A 4RZ4A 3VVGA 1C93A 1TSIA 1VBGA 5KETA 3QGAC 4WGHA 3C0LA 2F2HA 5HNUA 4Z08A 3VILA 1EP3A 1ZAHA 5I23A 4Z2LA 2OFJA 5FL0A 4X0VA 2XP8A 3ARRA 3WELA 2YX0A 5GNXA 3EB3A 2WZTA 5D04C 1NVMA 1UZHA 1KGWA 4KEZA 3NDOA 4LCQA 5EGRA 2BTMA 3CH9A 1XBZA 4MMWA 2E4TA 3OBEA 4H2CA 1DHKA 1PS9A 3WJXA 4Z1DA 3ZFHA 1DE5A 1GJPA 4UMCA 4LVGA 4Y6GA 2J66A 3HPZA 5DMYA 1RSCA 4CD4A 3H53A 2E8YA 4AD0A 1XINA 3ODKA 4MKVA 4UTMA 4PMVA 4MF4A 4AMCA 3UF9A 2PD9A 2ZXAA 3RM4A 3I6CA 2GOKA 4Q33A 4JTHA 2Z2AA 3IIVA 2GGIA 3MV01 3KE0A 4Z0JA 3BMVA 2OWXA 1FKFA 5DELA 5M5DA 4LAMA 2RQSA 3GWQA 3WK0A 2WLYA 2E0PA 1P6BA 3KBSA 3UWWA 3NTYA 4S3DA 3MHFA 3WYZA 3VMOA 4C1NB 1JPMA 4DRJA 1VCGA 1LL6A 1EJUC 1AQ0A 4NUWA 1NWUA 5CPLA 5FJJA 5CJMA 3PTDA 3PRDA 2J24A 3IIZA 3H54A 4DJEA 1CXFA 3SCWA 4EF8A 3EYPA 2FGLA 3EMQA 1JIBA 4QZVB 4LGXA 4CQDA 1Q2SA 1AJZA 2DG3A 4FS9A 3CTLA 3H4WA 2VR5A 3W37A 2ACQA 3B97A 1W9DM 2PLCA 2R1PA 4QAIA 1X97A 1SZFA 5A6BD 2WM0A 3OGRA 4ZPWR 4AD2A 1M9HA 6TIMA 5DFAA 4S23A 1SJBA 1W3IA 2YA1A 3DYOA 3GC5A 2Z2UA 4NAFB 2EHHA 3S6OA 4WLCA 1S2CA 3W7OA 2I14A 3OZYA 2E7FA 5K9DA 3B9DA 3OZPA 3WUBA 2C7FA 4XD3A 1W17A 4Y7EA 3LPGA 2D73A 2H3DA 1JVWA 3LM3A 1E40A 1HW6A 2C8NA 1DXIA 1W1B1 4BF5A 4B15A 2VGIA 3T2PA 3H4GA 4NXKA 4JYDA 3LOTA 4WEVX 2Q8XA 2DQXA 1E0TA 2YL5A 3B40A 4JN6A 2VD8A 1A4LA 5I5RA 4IFRA 5EBUA 2ICSA 1UWRA 2PBOA 2WPBA 4GXMA 3TC5A 1HIZA 3ZT7A 4DF0A 3FJNA 2OSYA 3IGSA 5HPOA 5CSSA 2XHYA 4MDOA 2F6XA 1JD9A 3QKEA 4L9ZA 4Z42C 1D7JA 3LZ3A 2VJXA 1NQ6A 3AS2A 1E4MM 1ZL1A 4LWWA 5D4YA 2BX7A 2DUZA 3HPSA 4JFUA 3L4UA 5FEPA 2CEQA 3W9ZA 4ML4A 1QOPA 4AD4A 5T91A 5EKYA 4AD5A 3A3XA 3K1GA 5EMKA 3RMJA 1A5OC 3UT0A 1V77A 1IR1A 1QI4A 3N2TA 3TN4A 1TZZA 2ZQUA 3UZYA 2D2JA 4XBSA 1Q6OA 3GXNA 2H8XA 3PWIA 1W9VA 4MKNA 1JZ3A 2D2GA 3Q94A 2P50A 4JIHA 5BMWA 1GZ1A 3DHUA 3C86A 4UTTA 3KXQA 1XQLA 5C8BB 3STCA 1TR9A 4QM1A 3HFTA 1ZTVA 5HUOA 5C2CA 1ISVA 3RPDA 4JQ3A 4DLFA 4G2DA 4QP0A 1ME9A 3IHZA 3H7RA 1TCOC 4CD6A 5LSMA 1CW2A 1LTDA 1J5SA 2ZDRA 2MLXA 5T26A 3OGSA 4ILSA 5LZLA 4ZTXA 3WF3A 1XYBA 1PX3A 4JDBA 4F2BA 2E5BA 1CLXA 3DHPA 3JW7A 3CUFA 3M0JA 3WMLA 1BQCA 3F5JA 4KT2A 5E0KA 1OCNA 3GU0A 1HXVA 2NQ9A 4NRRA 4EVZA 2E5CA 3ANYA 4WSHA 4Z2IA 2XP9A 1B9ZA 1P0KA 3UCQA 4M0XA 4GUIA 4CNUA 3STEA 2Y70A 4HTBA 2PF0A 4XVEA 5CBIA 2ISSA 5EA9A 3HGSA 4B5NA 2VZOA 3HN3A 5D03A 1F3XA 3FJ6A 1EC9A 3WO8A 3N12A 4NG3A 2XVLA 3O15A 4LAXA 4B3ZA 4BQ5A 2POTA 3EEGA 5AHEA 1WOAA 4S3FA 1OX4A 2NLIA 2VFDA 2GL5A 3TQPA 4MPKA 3GHTA 3OBAA 1ZK6A 1US0A 4IFKB 1Z9AA 1XV8A 4MAZA 4OV9A 4DWSC 3B8SA 1UWSA 4NAEA 4AEFA 3UGRA 4NJKA 2PPGA 2OLAA 3GPKA 1ZJHA 1XC4A 1Q6HA 3PF3A 3USZA 4FXSA 2LLEA 1GOXA 5IDIA 1SYTA 3NZRA 1QPKA 1LF1A 4ES4A 2DW6A 3E2VA 4H19A 3W3OA 5I3DA 2A5HA 3KVLA 1BXCA 2A3LA 4ZMGA 4FIRA 3QQWA 4I7UA 4Y9AA 2EBNA 3TVAA 5JBDA 2WMGA 5D2VA 2TODA 4DRNA 1K9DA 1JPDX 1PAMA 1XIGA 3ZVHA 5C0QA 2YA0A 1BRLB 3M6YA 2ZUUA 1RJPA 4GPNA 3I68A 4KWVA 1R30A 3W02A 4J7RA 4AWTA 1UR8A 4OTKA 3QHNA 1R2RA 3ONCA 5I00A 1K9EA 4IHCA 1MUMA 4QJ3B 4QR6A 3TWAA 4LXFA 3WQCA 2J7HA 4EPEC 2O4QA 1WQ5A 4JTDA 3URBA 2PUZA 5D2TA 4O28A 3FEQA 2E1WA 1TVPA 3GUWA 3GR4A 1BGAA 3QPEA 3KTXA 2E9LA 3M43A 4XUYA 4AX7A 1L6FA 1DIKA 3VIPA 2ZXDA 4EANA 2WVSA 2FTYA 3THCA 1IX5A 3NFUA 1LUCA 4BCEA 4D6EA 4HCLA 4FALA 3KOZA 2YCIX 4XZBA 5E9XA 3HF3A 3F4DA 1XIMA 3L4WA 4TXEA 4R3UA 3G6MA 2VEPA 3T4CA 4NNBA 4IPLA 1XF0A 5CGTA 4ZS6A 2NW0A 3HU7A 3NQEA 2FIQA 2ZR5A 2XGIA 4R7JA 1LL4A 4WGXA 4H9MA 4Q6JA 5E0CA 1F61A 4ZOCA 1QW7A 1FA2A 2E5DA 3OYXA 1PYFA 3B9EA 1LZOA 5BMXA 2NXIA 3FDGA 1U1HA 1V8EA 2I7GA 2PCQA 4GLEA 3I3EA 5HBFA 2Z1XA 1TTJA 3IUDA 5F2MA