1LQ0A

Crystal structure of human chitotriosidase at 2.2 angstrom resolution
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
365
structure length
365
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human chitotriosidase. Implications for specific inhibitor design and function of mammalian chitinase-like lectins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CHITOTRIOSIDASE
total genus 126
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1lq0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1lq0A01
3RCNA 2UY3A 1LQ0A 1MW2A 4URIA 4FF5A 3AIQA 3CUHA 3WDIA 1QOXA 1W9UA 4MB3A 1BYDA 3LPFA 4GZJA 3WDRA 1UWTA 2WCGA 2GJRA 2J7HA 4ML4A 3WH6A 4H7VA 3VD7A 1CLVA 2DQXA 4D1IA 1UKQA 1V02E 2D24A 3ARSA 2WHLA 3UEQA 2OSXA 1V03A 3LMYA 4HP5A 3W29A 1HJSA 4AZBA 3K8MA 1ZBKA 3MV01 5LA0A 1QHPA 3BGAA 3THCA 1QNQA 1CPUA 4AEFA 1QHZA 5FD0A 1TA3B 1V08A 4M24A 5IHRA 1CZ1A 1P6WA 2GDVA 2QMJA 3OGRA 2X05A 2XSAA 2ZX5A 3VINA 2FH6A 2JF6A 1J0YA 2PF0A 1IV8A 2WVVB 3NJ3A 3L4VA 1H41A 1VBUA 3BXWA 3CHCA 2ZX7A 2EPOA 2O92A 7A3HA 1GPFA 4PMNA 3ZMRA 4HTYA 4AD5A 3WUBA 4TXEA 1UH3A 2VTFA 1E4MM 3WIJA 4JFTA 4V28A 2Y8VA 1JAEA 4UQBA 1EHAA 2PWHA 2QV4A 2CCRA 2VR5A 2XHYA 3FXYA 4PMVA 2NSXA 4ZXOA 2VCCA 4GPNA 1OWQA 2WXDM 3VDBA 1CXLA 4BQ5A 3AMKA 1LLOA 4TVCA 4PTMA 2XFFA 4AZ6A 2J79A 1E55A 3T2OA 2FHBA 4HPGA 5AC4A 3AIVA 1CXFA 2G41A 4X9YA 2BVTA 1KBBA 1VAHA 2ZX8A 1C91A 5I6SA 3ALFA 1MW3A 2XFYA 2YLLA 2ZX6A 1E3XA 2CYGA 1JG9A 4BQ3A 3PZIA 4LPCA 3ZSTA 3TA9A 3GNRA 4KRUA 1RPKA 3FAWA 1CNVA 3OLGA 2WCAA 1WDRA 1D2KA 1YQ2A 4AZCB 4DWSA 2ESCA 4JCLA 1XGZA 3WQ5A 4AW7A 4AIOA 7CGTA 4WIWA 1AVAA 1A47A 1EDTA 3AICA 4D6GA 1CGWA 4X0NA 3M7SA 1XH1A 1C8XA 2J4GA 5BRQA 3WQWA 6CGTA 2JFEX 2PBOA 1HP5A 3K46A 3AXXA 1UR0A 1CBGA 1JDCA 1E6PA 2VUYA 2E9MA 3A47A 1QI4A 1CTNA 5EFDA 1OB0A 1D7FA 2VVSA 3KE0A 4C7FA 4MNLA 3ZJ6A 1WO2A 1NP2A 3AIEA 2BHUA 2E4TA 5A6SA 2VX7A 1BLIA 3GDBA 4W84A 4QAWA 2MANA 3VILA 3CHEA 1JDAA 5ABEA 4J3WA 1ISZA 1GQIA 2J7EA 5A1AA 2VRQA 5CSYA 3VGGA 3IANA 4GIAA 1BSIA 3PTQA 4AD3A 2XWEA 3WEMA 1B0IA 1ISYA 2FH8A 4CU7A 1E1EA 2D22A 3GH7A 1NH6A 3SCWA 1UH2A 4RE2A 4PMQA 1JZ4A 1W91A 4D6DA 1CGYA 4HU0A 2XYLA 3I3BA 4U31A 3SUWA 2PI6A 4NRRA 4AYSA 3VIKA 1KXTA 4MTVA 5CJ5A 3BMWA 4B9YA 4FLSA 2IXUA 1ECEA 4YPJA 1JZ3A 3GTNA 1Q4NX 4XZWA 2PWGA 3WFZA 1J0HA 1TVNA 3PZMA 4D6FA 3B9EA 2V5DA 5CPTA 2OYLA 3WD3A 1CYGA 3A3HA 5AC5A 2WC4A 1W32A 1UR1A 2W5FA 4PCTA 1UUQA 2OWCA 4UFLA 3PZTA 4W7UA 3ZR5A 2EPKX 4GQQA 2JIEA 5HXMA 3A6OA 3ARRA 4CCDA 3OZOA 4HA1A 4ATLA 4Q22A 5A94A 3MO4A 4CVUA 3NYDA 4UQ9A 5A8NA 3BAYA 1JL8A 1E56A 2EPNA 3KWXA 3MUAA 2ZUTA 4D6CA 3IJ8A 3U5YA 2WSPA 4KMQA 1PZ3A 4RE4A 2OWXA 1JI2A 2BV9A 5KEZA 4MADA 1Q6FA 1EIBA 1DWHM 3CGTA 3VPLA 3W81A 2WMIB 2J74A 2VX6A 1J0JA 3W37A 3ALGA 1OGSA 1BAGA 3OB8A 1M04A 1J18A 5BROA 3QR3A 3UG5A 1HX0A 2DSZA 3HN3A 3OG2A 3KL5A 1UD6A 5BCAA 3ZIZA 1NWSA 4CKQA 3WSUA 1H3GA 4F66A 8CGTA 1U33A 3BSHA 3EYPA 3TTSA 1OD0A 2F8QA 3WD4A 2DH2A 4XV0A 4BA0A 3I3DA 3T08A 2CBVA 2FDMA 4GXPA 1UA3A 4H8HA 2WVTA 1CXKA 2X0HA 5A69A 3EMCA 4J3TA 1UA7A 1CGTA 2Y8KA 2J75A 2DPEA 1TUXA 3QHMA 8A3HA 1NWRA 3GH5A 1ISVA 2BHZA 2VQUA 3WDPP 5EFFA 1ZBCA 5CG0A 4H2CA 3ARPA 3PZOA 5DFAA 3VNYA 2CIPA 4KH2A 3K8LA 2VNCA 1PEZA 1BF2A 1V0NA 3LPGA 1JAKA 1R87A 1W3JA 1FHDA 5HPOA 5F7UA 2RGMA 3AZRA 1U2YA 1GOOA 3N1AA 2WBGA 3DECA 1E4LA 3OGVA 3VD4A 3RM9A 2XTKA 2XVKA 3BLKA 1GJUA 2WVUA 3MUIA 4TOQA 3UETA 1W9PA 3RDKA 3VGBA 2JEPA 3OBAA 3RMEA 1IT0A 3POHA 3WBAA 3VO0A 3DHPA 3UESA 5I79A 1XC6A 3FNDA 3WFLA 2VQTA 1B3YA 1NOWA 2W67A 3VIFA 1H11A 1QI2A 1G9HA 3PN8A 1JF5A 4HA4A 3VIHA 4GI8A 4PN2A 2XM1A 1HJWA 5BWFA 4PMRA 5E09A 2EJ1A 1DHKA 5FCZA 3L4XA 4QCFA 4UQEA 1OT1A 3FW6A 1ITXA 4OJYA 2DT1A 5D9PA 3CZ8A 1I1WA 1E6QM 3IK2A 3VMOA 4HOZA 3GM8A 1W1TA 1HNYA 3WQ8A 1E9LA 3NDYA 4HMDA 2YA2A 1H0IA 2J77A 1E15A 1TMQA 3PZGA 4W8LA 5CQ1A 1UQYA 3NCOA 5HNNA 3SUTA 3O2LA 1CIUA 5C71A 3IAPA 3F5LA 5D9OA 1ZL1A 3SIMA 1UHVA 3WNNA 1FH8A 5JUVA 1E43A 3DYOA 2BXYA 3WENA 4QP0A 1PPIA 4E2OA 1WZMA 2DH3A 2YL5A 1W1PA 1QPKA 2WBKA 3SUUA 3VIIA 4AD0A 3T0DA 3FHQA 4F9DA 4MB4A 3CTTA 5GQBA 1WNOA 1B2YA 1JZ8A 2W4XA 3W6LA 1DEDA 4AZCA 2E0PA 1LWJA 3ARUA 4PTXA 1ITCA 3SCUA 2ZWYA 1EGZA 3SCOA 1E3ZA 4BZYA 1QW8A 4AISA 1JDDA 2YL6A 4MPKA 1H1NA 4AWEA 1VEMA 3VU2A 3PZUA 5BXRA 1AQHA 5D9MA 5EB8A 3VIMA 2CHNA 2FHCA 2VI0A 2WLZA 3N17A 1PZ2A 4UR9A 5D9NA 4GI6A 3TTOA 1QW9A 2YOCA 2YBTA 4MNMA 3VMPA 5M5DA 5M17A 1M03A 2ZXQA 3MMDA 4P7QA 4IPLA 3RILA 2YJQA 1MFUA 4CD5A 3VOCA 1B31A 1XD0A 5I0DA 4HZ8A 5CPSA 3EDEA 1J9YA 2ZUUA 4ZE4A 5CLTA 2A3CA 4R5EA 3GYCA 4ZXLA 1V6UA 1V3LA 3WMBA 2A3AA 1LL6A 5D4YA 2W91A 4GZEA 4CN4A 2E9LA 2WVVA 3UERA 1X6NA 3AMCA 1KQZA 1XYZA 5CXPA 3MANA 3DC0A 3BAKA 5A2AA 4U5IA 3T2PA 1E5NA 3RJXA 2UY2A 4OOUA 1F4AA 4OIFA 1EDGA 5A6LA 4ACZB 1QI3A 2J7GA 1UD8A 3ZJ8A 1ZJBA 5ABFA 3FAXA 1OCQA 4MB5A 3UR8A 3VM7A 2GK1A 4UQAA 4HOXA 3SCSA 5IXEA 1H4PA 1UD2A 1W9BM 2WSKA 3WUFA 2PWEA 2CKSA 4D6HA 3NDZA 4NSBA 1GONA 3WDHA 4Z2GA 5IFTA 2G4FA 1JYWA 2CITA 4D1JA 4MJ2A 3VNZA 3AS2A 1I75A 2C8NA 1HF6A 3K4DA 1E4NA 3KZSA 4TTUA 1E6XM 1UZ4A 2WWCA 3E1F1 1OGGA 4GI9A 3WF0A 3DHUA 2DSKA 2O9TA 4WK9A 4KWUA 3WEZA 2WAGA 4WKHA 1J12A 1EO7A 2DSVA 4PUEA 2AOSA 1C3FA 2JE8A 3ZJ7A 4AY1A 5I77A 1CXIA 1CWYA 2XSBA 2J62A 2J78A 4DWSD 4W5ZA 3G6MA 1CGXA 1EOMA 4FLRA 2ZUWA 3BCFA 4LX4A 2QPSA 1C8YA 2VO5A 3GBDA 1HL8A 1E6RA 2VZTA 1RP8A 5FIPA 1GNXA 1VJZA 4UQDA 1HKIA 4CVWA 4UFMA 1QNPA 3WDQA 1DWFM 3NUKA 1G94A 4D72A 1K9DA 1ZBWA 1LF1A 1G5AA 4JL2A 2FHFA 2VZVA 2D2OA 1KWGA 2GJPA 4WF7A 4D6EA 4XB3A 1KQYA 4BF7A 1KBKA 3GH4A 1KGXA 2NT1A 3F5KA 3T2QA 2BY1A 5GPRA 2WANA 3W27A 3G6LA 2FGLA 4Z2HA 3WQVA 3AS0A 5I2UA 4JHOA 2E8YA 3CMJA 2D20A 4TUFA 2XVLA 4PMDA 1V3IA 2WMHA 3VX0A 2AAAA 4Z2KA 4S3JA 1R85A 4PYSA 2YA0A 4U2ZA 2A3BA 1Q6EA 1LWHA 3L2LA 5KZ6A 1UR9A 4UCFA 3CPUA 3J7HA 4N0RA 4C7GA 1GHSA 4FMVA 2X1IA 1AMYA 4H41A 1E40A 2V3GA 5E6YA 1NOUA 4AD4A 1R7OA 3K1DA 2WK2A 1C7SA 1UZ1A 4U3AA 3TTQA 2E9BA 1FHLA 2J8FA 1HJQA 1HIZA 3W38A 2PWFA 2E3ZA 1EQCA 2UY5A 3AIRA 1UQZA 3EMZA 4AZ5A 1E71M 4WJXA 3RM4A 4KGJA 4B3LA 2ZUNA 2OYMA 2VVNA 2GVYA 1WP6A 2D23A 5IHSA 3ZO9A 1G0CA 4CU6A 4M80A 1US2A 3VGEA 3VKKA 4ATDA 3S2CA 1NM9A 2V5CA 1LG2A 5DO8A 2WMGA 4W93A 5BXPA 1TVPA 4QLKA 3PZNA 2F61A 2VRKA 3ARQA 2YA1A 4J3SA 3UCQA 1PJ9A 5JIWA 3VUPA 2YDSA 2E40A 1C93A 1CGUA 1ODUA 2CERA 5AY7A 2V38A 1ISXA 4W8BA 5M3WA 4JKKA 1NQ6A 1KGUA 1JIBA 2CBJA 5JH8A 3DYPA 1GUVA 4PCSA 1KWKA 1JD9A 5C8BB 1EXPA 1B90A 3BMVA 4W88A 3SCVA 5JIPA 2VL4A 5GNXA 4UZUA 2A3EA 3WNLA 1K9FA 4F9JA 4H8UA 3JUGA 1NOFA 2WB5A 2XPKA 1GORA 4MAZA 1XHGA 4PUDA 5A95A 4OOZA 3CUFA 2VR4A 4E8DA 5GNZA 2XG9A 3M46A 3FY1A 4DWSC 1TG7A 5JBFA 1HN1A 2G3JA 4JZ5A 1V3KA 3VIGA 3BAJA 1W9VA 4XUYA 4F79A 1CXHA 3ZT6A 3OLIA 3PBGA 2WNWA 4GO8A 4NI3A 1UKPA 5DT5A 1VFFA 4JKMA 2ZUVA 1UR2A 3WQ6A 4FK9A 1E73M 4AIEA 4OBRA 2CNCA 4UFIA 3CLWA 4HPHA 5HOSA 5D8ZA 4HZ7A 2ZXBA 3CUGA 1X6LA 2O9RA 4CGTA 5A2BA 3N12A 3VIOA 1JNEA 1K9EA 3BC9A 2CKRA 2BY0A 4GO9A 3TP4A 1JZ6A 1KFWA 3W0KA 1GOIA 3B9DA 2V3DA 2FGZA 1Y7VA 2O9OA 3ZSSA 3OA5A 4LXFA 2J47A 3VVGA 4JKLA 2DT3A 2WWDA 4NF7A 3WUEA 2VX5A 1GCYA 2NT0A 2VURA 4M82A 1CLXA 2BVYA 1DWAM 1W1YA 1E0VA 2BHYA 2OLHA 4PBGA 1JZ2A 1MQPA 4JAWA 1V0KA 1JFHA 1I1XA 1BVNP 3WH9A 1XSKA 5CGTA 3SUVA 2DDXA 1W9DM 5AYIA 3VDAA 3SEPA 1DWIM 1SMDA 2EPMX 1QI0A 5I23A 1ZBVA 1O6IA 1JYVA 3U57A 3GZAA 1DP0A 4JFVA 3HMCA 4HMEA 2EXOA 3KL3A 4ACZA 1Q6DA 4MB1A 3TOPA 4Z2LA 2D0HA 1WDSA 2OYKA 4LYQA 5DMYA 3T0BA 3EDJA 2WM0A 4AZIA 3ZT5A 2EEXA 2RGLA 1W3LA 2Y2WA 1UKOA 1UWQA 1C8QA 4EE9A 3WF3A 3L4UA 1E6NA 2IXVA 2QLYA 1CEOA 3K8KA 5A8QA 4CD8A 4B16A 1V0LA 5DF0A 3N9KA 2WW5A 3VDCA 1OT2A 1EDQA 3BAIA 2D1ZA 5HBFA 3UR7A 4GZIA 4W86A 1BYBA 4BQ4A 5IDIA 2BXZA 1TCMA 4J3UA 1GHRA 1FP8A 3POCA 2IUZA 1KR1A 1V6YA 3D5HA 4HA3A 1GVYA 4PTVA 1BGGA 3FHAA 1UWIA 2YLAA 2Y24A 3ZM8A 3M07A 1XCWA 2CBIA 4M8UA 3APGA 4MDOA 1GZJA 5A6MA 4YHGA 4KGLA 1JZ7A 1BG4A 3DYMA 3L4YA 3A4WA 3W6MA 2W61A 4TTGA 3LPPA 1L0PA 1NARA 1BVZA 1QHOA 1DWGM 4Q7NA 1DTUA 5EMYA 4OZOA 1PBGA 1HVXA 1VB9A 5DT7A 4CN6A 1CECA 1U30A 1OIMA 4B3KA 1V6WA 4AEEA 4QLJA 4PMZA 2CBUA 5E6ZA 1PX4A 3CHFA 1BYCA 4ATWA 2YIHA 3SCTA 1HVQA 4EANA 4L4PA 4MNJA 3SCQA 2J8GA 1MQRA 3AISA 1B9ZA 4DWSB 3ECQA 2B31A 5ABGA 2DT0A 2WHMA 3L4WA 2WMIA 2ZICA 1QBAA 4CUCA 3U7BA 1E6ZA 2VT0A 4U33A 3PZVA 4QLLA 3AFBA 2WKLA 5EBAA 4PMXA 1E1FA 1AQ0A 4DUXA 4J3XA 5BXTA 2CESA 3W26A 4JL1A 2ZOXA 3EDDA 3CHDA 2V3EA 3CIVA 2OSYA 3NSNA 3TONA 1PIFA 1E6SM 2Q8XA 3AIBA 1OGBA 3AHVA 3PZQA 3W4RA 1ISWA 4J7RA 1HXJA 3WDJA 5CPQA 2PBGA 5FL0A 1GW1A 2ZXAA 5A6BA 3MMUA 2C0HA 4E8CA 1VBRA 6TAAA 3B8SA 1E72M 1FA2A 3CO4A 1EHNA 3AHZA 5LA1A 2JF7A 1XYFA 4YN5A 4NRSA 2ZE0A 1B3XA 3AHYA 3SCPA 2PWDA 3WBEA 5A8PA 2XM2A 4AIUA 1Q6CA 3CZGA 5IFPA 1EOKA 1NP0A 2DEPA 2WC3A 5A8MA 3MS8A 5BYWA 4J28A 1FFQA 3ZOAA 3GNPA 4WSKA 2DT2A 4MAVA 2J7DA 3CZJA 3OZPA 2D3LA 3ZJKA 2ZUSA 2PB1A 1LL7A 4JHZA 1C92A 4LGXA 1R7AA 1X1NA 2WLYA 4ZE5A 1ODZA 2UWFA 4C7DA 4J27A 4WSJA 1BTCA 3WF4A 4FLQA 1C90A 1KGWA 1V0MA 4P8UA 3RIKA 4P7LA 1MW0A 3GBEA 1US3A 1GOMA 2W66A 3PTMA 2DSWA 3NSXA 1WCGA 3AMGA 1H0GA 4P8WA 1HKKA 3F4VA 4S3KA 1UKSA 1UWRA 1MFVA 2XVPA 2D0FA 4TX8A 1DWJM 1ESWA 1W9XA 1ZS2A 1KCKA 5HPCA 1WB0A 2XGIA 4D71A 1YHTA 1W2PA 2VX4A 5CZKA 1HP4A 3VIPA 5A3HA 2AMGA 1JYXA 3ZR6A 4CD4A 1F4HA 1BG9A 1VEOA 3ARZA 1OSEA 3BSGA 1ZJAA 1VFOA 3OGSA 5E0CA 2VRJA 1XD1A 3CH9A 4W7WA 4NZCA 1WE5A 3GXDA 3N04A 1G1YA 4AC1X 3VGDA 3MMWA 1KXHA 1FFRA 4F8XA 2WMJA 1WPCA 4JFWA 4WKFA 4IISA 3WMSA 3CMGA 1HJUA 2XWDA 5BXSA 4OUEA 1FP9A 3GXMA 4W7VA 1R8LA 2D0GA 2XVGA 2TAAA 4OKDA 1C7TA 1PAMA 3AMLA 4UFJA 2JIWA 2G3NA 4E4PA 4UQCA 1J10A 4GQRA 3W24A 2XIBA 2GUYA 3NIYA 5I78A 1S46A 3VTRA 1XCXA 2WZEA 3WQ4A 2XFRA 2ZIDA 2QPUA 2A3HA 4PMUA 1WDPA 3CZLA 3ARTA 4CCEA 1FH9A 3MSDA 3LPOA 1W3KA 3WH8A 2YBUA 1CGVA 2GK1B 1KXQA 4PSRA 3VM5A 1ZU8A 3ARWA 3WD0A 4B9ZA 3PTKA 5ECUA 4RL3A 1M01A 4UNIA 1MXGA 3AS1A 2CXGA 4AZGA 3SCRA 2C7FA 1MXDA 3WH5A 3WY1A 4UZSA 2YKKA 3UG3A 3O6AA 4JFUA 5BRPA 1ZB5A 3D3AA 4U3CA 4UOZA 3ZT7A 5E70A 4DM2A 4W8AA 2GJXB 4W85A 1SYTA 5A8OA 1WZKA 2YL9A 4KRTA 5A2CA 1UWUA 1QBBA 2J7CA 1J01A 3AIWA 4AD2A 2QMKA 1XH2A 4EKJA 1NWTA 1H5VA 2GSJA 1E0WA 4H8VA 3W28A 3QOMA 1UWSA 3N15A 1V6XA 3NSMA 4A3YA 1WKYA 1OM0A 4Z2JA 4M29A 1RP9A 4TX6A 3AIUA 1VFMA 2X09A 1TA3A 3BAXA 4R27A 2GJXA 3KL0A 3GNOA 1VENA 1W1VA 2CHOA 2OSWA 3RJYA 4AMCA 4EK7A 3MV11 4ZEPA 5A6AA 1VF8A 3WD2A 2CEQA 4GKLA 1BHGA 3RPMA 4Z2IA 3KEHA 1JI1A 2EBNA 5LYRA 1UD4A 4UTFA 2XIIA 3WELA 1WDQA 1M7XA 1LJYA 1VIWA 1B3VA 3II1A 2YL8A 1J0KA 5JBEA 2J7BA 4PSPA 2F2HA 4ZENA 1WAWA 1MWOA 2DIEA 3WNKA 2WVSA 3S6TA 1MQQA 3IJ9A 4PTWA 3AHXA 4DM1A 2X0YA 1L8NA 1UOKA 3OIHA 4AZ7A 1UD3A 4V27A 1E4IA 4X0VA 3WNMA 5CLWA 3ARVA 1MW1A 1SFSA 1W3HA 1XSIA 2WC7A 2ZX9A 2Y4SA 1SMAA 3MSGA 1UKTA 1HL9A 3HU7A 4M81A 1HJXA 3AHTA 4YHEA 1KB3A 1KXVA 1WZLA 4PEEA 4JIEA 1IZKA 2J25A 5FL1A 5LA2A 1VRXA 4P7RA 1BFNA 4ZFMA 5A6JA 3U7VA 4D6IA 1HJVA 1UR4A 3WL1A 5FOOA 3K4AA 2CETA 3WF1A 1H09A 3BAWA 4PRWA 4UOJA 1PX3A 1E0XA 4GINA 1JXKA 1AQMA 1QI5A 2Z1KA 3AOFA 3OLDA 2G8ZA 2NW0A 3WMCA 2HVMA 4QDMA 2WZIA 3VIJA 1KR0A 4DUWA 4K68A 2BY2A 1HT6A 4U2YA 2V3FA 2XUCA 4P7NA 3IAQA 5HDRA 1H2JA 4XX6A 4HMCA 1KCLA 1Z32X 5A6KA 4RE3A 1GOWA 3CUJA 5ABHA 3AXHA 1GQLA 3T09A 2WHJA 1LL4A 1V6VA 4P7OA 2X2YA 1JYNA 1QVBA 2W62A 3L4TA 3VGHA 3MUY1 1V3MA 3PZ9A 3UG4A 1SR0A 1TR1A 2JALA 5CGMA 2VZUA 4DUVA 1GJWA 1UH4A 3CZEA 2WMFA 3BLPX 1JXJA 5CSUA 1B3ZA 3WKZA 1PIGA 1H49A 3VD5A 3AJ7A 1WZAA 4BCEA 4TVUA 1D3CA 1M53A 3AYSA 3WH7A 1EA9C 3EBVA 3ZQ9A 5I3DA 3U5UA 4L4OA 3FN9A 3M6DA 1OBAA 2G3IA 3BCDA 4FLOA 3WN6A 3F5JA 4BS0A 1XV8A 1XRVA 3EDFA 1N82A 1J0IA 2UY4A 3OLEA 4MDPA 1PX8A 3CUIA 2WZHA 4QFUA 1UG6A 2XVNA 1HKJA 3QHNA 2CPUA 4V2XA 1VFUA 1GVIA 5JBDA 2YDQA 5E9AA 2WKGA 4WKAA 3PHAA 5TD4A 5DEZA 2BVDA 3WNOA 3RM8A 4J3VA 1BQCA 2BS9A 3THDA 2XGBA 2ZWZA 3AZSA 3WD1A 4Y7EA 1QNSA 3TTYA 1OD8A 3O9NA 2QHAA 1GOKA 4A4AA 4W87A 3AROA 5FKYA 6A3HA 1K9TA 4PMYA 2O9PA 5I24A 3B9AA 4UFKA 2HISA 3CZKA 3MUZ1 4D6JA 2E8ZA 5A6BD 5AYBA 1CDGA 4N42A 3MKKA 4BQ2A 3W25A 2WMKA 4CD6A 1JF6A 2GFTA 4ACYA 1UD5A 1B3WA 3VD3A 4UFHA 3ARXA 3WL0A 4W89A 1J0ZA 2EO7A 2VMFA 3AMDA 2VZOA 3WF2A 1MVYA 2GDUA 1K6AA 1B1YA 3L4ZA 1UR8A 1FOBA 3VMNA 2WYSA 4CD7A 1E5JA 1JGIA 4W5UA 2VC9A 1EQPA 1O7AA 4WLCA 1B30A 1CXEA 3AXIA 5E0FA 4U5KA 4XZBA 1GQJA 3AS3A 1UYQA 2XJ7A 1JZ5A 1EO5A 2G3MA 3N18A 4HZ6A 3L2MA 1V3HA 1GQKA 3ARYA 4EAMA 2WHKA 3VGFA 1VJSA 3W82A 5M03A 3N11A 5ABFB 4IUGA 1TE1A 4AZHA 4CU8A 1JD7A 1W2VA 4AXNA 1V3JA 4MNKA 3QGVA 4TVDA 1VEPA 1FH7A 1E70M 4M56A 3AYRA 4LQ1A 1BPLB 2DGAA 5GNYA 3QOKA 2W92A 3WNPA 2VCBA 2ZUMA 3IJ7A 2BNJA 4LYPA 4IM4A 4JFSA 3SCNA 3I3EA 1MYRA 4AD1A 4P8XA 2EQDA 4OBSA 4HU8A 1JNDA 2VZSA 2D3NA 3SURA 3A4AA 1TFVA 1BYAA 2ZXDA 2QF8A 1XH0A 2Z1SA 4A3HA 3CBWA 2DIJA 1Q6GA 2YDRA 3GXFA 4QCEA 3N13A 2Y5EA 1HKMA 2VCAA 4P8VA 1EH9A 4LYRA 4HOWA 2X8RA 3AI0A 1R86A 4IPNB 3VDHA 2OWWA 1NWUA 3WEOA 1GOQA 2J7FA 3W53A 1RH9A 3AQUA 2BFGA 2JEQA 7TAAA 5I5RA 1BGAA 1G01A 3HJEA 1J11A 2VJXA 4M1RA 1V02A 3RO8A 1QNRA 1LG1A 4CCCA 1IZJA 1OIFA 3VX1A 3A4XA 1RD6A 2BY3A 5C70A 1QNOA 3QHOA 4B15A 3GXIA 3VD9A 2DSUA 2WCSA 2EPLX 4MJ4A 2PC8A 9CGTA 4UOQA 1XSJA 2VOTA 3SUSA 1A3HA 3T0AA 1OINA 2W63A 2WPGA 1TZ7A 3EDKA 3WUGA 3BH4A 4H04A 3EMQA 4JCMA 4PMOA 5D8WA 4CN1A 1JFXA 3MU7A 1CENA 3AZTA
chains in the Genus database with same CATH superfamily
1RY0A 4IMAA 1SSDA 1TX0A 3WDIA 2ZTKA 4ODQA 3B06A 4ODKA 4O0QA 3O3RA 4LUYA 4CQAA 2GJRA 4UIOA 1WKEA 2NUXA 2RDXA 3KAHA 2H9AA 1V02E 4EXBA 4UTKA 4DROA 2WHLA 3UEQA 3LK6A 1F6KA 1KT0A 3N2CA 3DFOA 1FKSA 1L9WA 5LGZA 3W88A 4AHOA 1BQGA 1GVEA 4UCGA 4NAFB 2GDVA 5KTLA 3RRAA 2ZX5A 2GGIA 2DG9A 2JF6A 4I8YA 1J0YA 2PF0A 3NQVA 1IV8A 3ITCA 1XDLA 4DXXA 3BXWA 3R79A 3S1WA 3FEMA 3TQ0A 4D8ZA 3L0KA 3QLDA 3DHDA 2W9MA 3A64A 2RURA 4JFTA 4V28A 2BODX 2Y8VA 4UQBA 2PWHA 2QV4A 3KOXA 3G2GA 2CCRA 2XHYA 4MUZA 4PMVA 1FKWA 1QZ2A 4ZXOA 4PB3A 1OWQA 1HZYA 1XRSA 1L6YA 2V69A 3URAA 1TTJA 3SR7A 2XFFA 2J79A 4IXHA 3F2BA 4HPGA 4JIPA 4JTFA 3LNPA 1CXFA 3UZXA 1CT5A 2OGJA 3GB6A 3N9SA 3BOLA 5FJOA 1I0BA 2BVTA 1F9CA 3CC1A 4L9YA 2Y63A 2XFYA 1XCFA 4G1KA 1DXIA 3PZIA 4I7UA 3C8NA 4GYPC 3NTPA 3E0VA 4LAUA 4ZMGA 2I16A 3FAWA 1US0A 3CTLA 1WDRA 4AZCB 3OIXA 2ESCA 2F7FA 3DI1A 4AW7A 3PNUA 3A13A 3QMSA 4Z0JA 4D6GA 1A47A 1FDJA 4X2PA 4JTIA 2FZDA 4R33A 2BGSA 2XN0A 4EOUA 2QVNA 3NO1A 1BEUA 3IWPA 1KTBA 1DE5A 3ZS4A 2VFDA 3GW3A 3WQWA 3S46A 4C65A 4IGSA 3AXXA 2E67A 1QI4A 3ABOA 3PA7A 2OOFA 5EFDA 2NQJA 3SQLA 4HMNA 3T78A 3ZJ6A 1S2AA 2BHUA 5A6SA 2VEIA 2VX7A 1KM0A 1K4GA 2OFNA 1TPWA 4QAWA 3CHEA 1Y5XA 3XINA 3HPFA 5ABEA 4J3WA 1X1ZA 1ISZA 5A1AA 4JTKA 1PZ0A 3VGGA 4IJBA 5IBXA 5K3VA 1T0OA 1B0IA 4PEKA 2FJUB 2YCLB 2FH8A 4GVIA 3GH7A 2Q71A 4Q8PA 3QM3A 3SCWA 1RVKA 4K2SA 2XPAA 1W1A1 1OFAA 4PMQA 1XF0A 1JZ4A 1W91A 3RR1A 3WK0A 1D7IA 2OEKA 4PA8A 2PI6A 4NRRA 2HSAA 4KIEA 5KZMA 1EC9A 4HBKA 3GIYA 3I10A 3ZVHA 1CB2A 3K5XA 4MLJA 1OC6A 4B9YA 1W17A 2IXUA 1ECEA 3U2ZA 3CU2A 1BF6A 2PTDA 4WEVX 5CBBA 1J0HA 1M9HA 1YDVA 3PZMA 5REQA 3CIWA 3KBMA 1TZZA 2B7OA 2WC4A 4L56A 3LHZA 3W7OA 4PCTA 4N4QA 1OYBA 4YTQA 2ZDSA 3M0IA 2O7QA 4Z1BA 3ZR5A 3NI6A 3LXAA 1TPEA 3MVIA 4HGXA 4B92A 4JQAA 4HA1A 3W2LA 4MYXA 4UQ9A 2NQLA 2ZQSA 5HMDA 3BAYA 1JL8A 1JNTA 2BLEA 2R91A 1S5NA 4HK6A 2TPSA 4KMQA 3RNDA 3CT2A 2BV9A 2WSYA 1IQ8A 1DWHM 1M68A 4M51A 3NL2A 3VPLA 3W81A 2WMIB 4AIBA 3TU9A 3W87A 1OGSA 1ZHAA 1M7OA 4LEQA 4AF0A 5K4XA 3HN3A 3KL5A 1YPIA 1KM2A 1UD6A 3NR0A 1H3GA 5DBUA 4IMFA 4NVTA 3BSHA 2YYUA 3WD4A 3OHIA 1P0BA 4KS0A 3VUSA 3H23A 4N9EA 2DP3A 1GYMA 2FDMA 4GXPA 4H8HA 2WVTA 1UW9A 4GY1A 3IUIA 1TPVA 1UA7A 4RW3A 2ON3A 2DPEA 1NWRA 3G1HA 3TLLA 3W86A 3VNYA 4KH2A 2VNCA 4ZO9A 2RJHA 1R87A 3VCCA 2RGMA 1KRCC 3AZRA 3MDWA 5H6HA 3N1AA 3BUVA 1E4LA 3PRAA 5I3KA 4MVAA 3RM9A 1Q2SA 5EA9A 2Y8UA 2C16A 4ZSUA 3VGBA 4H9UA 4ICNA 1U1UA 2VEFA 3VO0A 5I79A 1WQ5A 4E0CA 3FNDA 4GX8A 1ZP3A 3CIXA 4GVFA 1NOWA 4LC6A 2W67A 2GDQA 1XLJA 3NM3A 1SO3A 3VIFA 2D73A 1MUCA 1ADOA 1XUUA 1TJ2A 1JF5A 3PN8A 2PD9A 1P6CA 1VPXA 1A5BA 1SJDA 3BVJA 1Y65A 1GK8A 4DJEC 3GUGA 5HTGA 1BD0A 1Q45A 3UWUA 5KMYA 3TN4A 4XBSA 1FQ0A 2DT1A 4GIRA 3E96A 3CZ8A 4IGHA 1FWSA 4H01A 3O06A 3ZWTA 3VMOA 5GVJA 4HOZA 1W1TA 1Q85A 3NDYA 4HMDA 3LV5A 3M44A 4FSAA 3UW6A 5LIYX 4FX8A 1TMQA 4YCOA 2PDHA 3E0LA 3CWHA 3R10A 2Z24A 3CJPA 4PULA 5CQ1A 5IM51 3BG3A 4YL2A 3NCOA 3KZPA 3CQ0A 2QGYA 4MHBA 3H2CA 1T6MA 4V1YA 1KV5A 4QIUA 3O2LA 5H2ZA 1CIUA 1TREA 1O12A 1SSGA 3P3BA 4I5XA 3R25A 3PULA 5C2CA 1HGYA 3SIMA 4HHMA 3E2VA 2QKFA 1K7XA 4HN8A 3GU2A 3E74A 1KFBA 1PPIA 1WZMA 2DH3A 2WBKA 3VIIA 1DIKA 4IIHA 1NQKA 4MB4A 2ACSA 1LWJA 2J9YA 4WY0B 4PTXA 3S2MA 1MSSA 1R3YA 2DZTA 3Q45A 2ZWYA 3SCOA 3JZEA 1QW8A 4DRHA 4PB5A 5D33A 3KS6A 3BOXA 4HSHA 4KCTA 3R4IA 5EB8A 3OEXA 2V5BA 5HUPA 3VIMA 2RUDA 3SRHA 3BW3A 2VI0A 4GIVA 5DIUA 1GKQA 4JTCA 5CSSA 5D9NA 3VMPA 3KRSA 5EPDA 2Z7KA 3VOIA 4FNTA 3XISA 2ZXQA 3VYLA 3MMDA 4IPLA 1W1IE 4BEQA 4MSPA 2VWTA 4CD5A 3VOCA 1CCWB 3MKVA 4HZ8A 4PUUA 3QFEA 5JH1A 4S3AA 2KR7A 1REQA 3RFWA 3EOOA 4O0ZA 4MKNA 2ZUUA 4DRPA 4ZOBA 2X42A 4R5EA 1VS1A 3BANA 2INZA 1YDOA 2MLYA 4XIMA 4LCSA 4AU0A 3SY8A 4NZ5A 4XSLA 2ZC1A 1U79A 5KZEA 1RALA 1XBVA 2VELA 2BOFX 3NQ6A 3QV7A 1J4IA 5B7ZA 3GXNA 3KOZA 2PTYA 3LCGA 1J6PA 2NVAA 4K36A 1GRJA 4REQB 1EEXA 4AAJA 1I6NA 4A8LA 1E5NA 1F4AA 4S3GA 2OQHA 4OIFA 5F4XA 3AYVA 4ACZB 5DXXA 3FA3A 4B2DD 2NX9A 5I00A 1V4YA 1OCQA 4N19A 5H8UA 2YXGA 2GK1A 3MA8A 3T8LA 1P48A 2CFFA 3UI4A 4L6DA 7XIMA 1Z44A 3UZ5A 3NQEA 1PTGA 2QEZA 3IHZA 4Y90A 4D6HA 4XUGA 3VCRA 4IICA 3SADA 1CI1A 1GONA 5I06A 3F1QA 3F2CA 3PBWA 3WDHA 3F4NA 5G4HC 2QPXA 3EB4A 1FWAC 3DXIA 1S3HA 3EXTA 3AS2A 1HF6A 3GRIA 3H9RB 1E6XM 5F4SA 1KM3A 2TSYA 4YNGA 3GO2A 3O0FA 3MMTA 3WF0A 3DHUA 3L5LA 3Q94A 2ZVIA 1LOSA 4KWUA 3TWBA 3UYCA 2XIQA 2WAGA 4RZBA 4LV9A 3EY6A 4HCHA 4Q8VA 1XW8A 3PWGA 2GJLA 3R0DA 4IMCA 3ZJ7A 3BLIA 2FDSA 5I77A 1CWYA 2XSBA 2J78A 1EOMA 4AVNA 1D3GA 2ZUWA 4PFMA 4LX4A 1A0EA 1S5WA 1LYXA 3SRFA 3EEZA 4CVWA 1DWFM 2RH9A 1EJXC 4LUJA 5ENLA 2H3BA 4JL2A 3KOFA 5DY3A 5B80A 1H7WA 2ZRUA 2VZVA 2VC5A 2Q8ZA 4D6EA 4XB3A 3SFKA 1EL3A 3GH4A 2BY1A 4XISA 2QCLA 1FWFC 4JQ2A 3SSZA 3FYOA 4LF1A 2J27A 3NZGA 3F4DA 3CWNA 4JD4A 1Q6IA 1R9YA 1UASA 3LLXA 3C2YA 2XVLA 4QTGA 4R3UA 1DVJA 2AAAA 4Z2KA 2EF9A 1R85A 3GK0A 4PYSA 1Q7ZA 3LRMA 5CBIA 4LUTB 4LJ3A 2A3BA 1KRMA 4U10A 4IOTA 3M64A 2PURA 3L2LA 2QZRA 4UCFA 3DN5A 1FWJC 4N0RA 4DWDA 5GPGA 1J8VA 1D7JA 1AMYA 4H41A 1E40A 2QDEA 1XRTA 2WK2A 3LTYA 4I9JA 5C5YA 5K9DA 3H70A 4RV8A 3UWYA 2Q3OA 1FHLA 3PJXA 3W38A 4UNLA 3AIRA 3WBXA 1VYSX 3EMZA 4AZ5A 1GVRA 3REQA 3ZVIA 2ZUNA 2VGFA 2VVNA 3A3XA 2GVYA 4V33A 3ZO9A 1G0CA 1T40A 1US2A 4C6CA 3W74A 3R0UA 1QW7A 3U2OA 4A3RA 4Z08A 1J5TA 2V5CA 4UXDA 3E2RA 2I5QA 1N8WA 4DIPA 1KFEA 1MUWA 2VRKA 4XAGA 4J3SA 3UCQA 1PJ9A 3XIMA 2YDSA 2E40A 3W7JA 1C93A 3SZ8A 6ALDA 2CERA 4NJIA 2KX9A 2V38A 1ISXA 4KFPA 1GG1A 5M3WA 1NQ6A 2FB2A 2ZRYA 2CBJA 5JH8A 3DYPA 3H53A 1Q8JA 1KWKA 3QN3A 3UZJA 4GFIA 2HK0A 5AC8A 3B03A 4JTGA 2C19A 3IVTA 1SUXA 4W88A 3Q37A 3G3MA 3KOWA 5JIPA 3WLKX 5HUOA 2A3EA 3QQWA 1K9FA 3WNLA 4LCRA 1BWKA 4UTTC 3JUGA 3CQKA 4DXVA 3C0JA 4OOZA 5CZTA 3CUFA 3DH7A 3VKCA 4R7JA 4JZ5A 3R8RA 3BAJA 2A7RA 4NI3A 1QAPA 5FEXA 3AXMA 3HJZA 1TQJA 3AUOA 1E73M 1RJQA 3TC3A 1UZDA 1UPPA 1PE1A 2C13A 4CGTA 5G1TA 4XZHA 3S9IA 1K9EA 2IPJA 3OOQA 1ELSA 3TP4A 5BRBA 7ENLA 4UMAA 3B9DA 4J4OA 2O9OA 3ZSSA 5LXXA 1A3XA 4ODRA 3VVGA 4JKLA 4PB4A 2VURA 3N2XA 2HEJA 3WYZA 2BVYA 3TLQA 3T44A 1HG3A 4I6VA 2Y7DA 1E9ZB 1Z6KA 4DI8A 2DDXA 4IQDA 2PBCA 5DRCA 4E3VA 2PDKA 5KSWA 2EPMX 3V0UA 2VOMA 5HNRA 3GZAA 1JYVA 1DP0A 3O63A 3TSBA 3UZYA 1Z9AA 3UCCA 2ZQ0A 2B0MA 4NG3A 3AXKA 3EB2A 1Q6DA 1EBGA 2OYKA 4LYQA 3KS5A 1GGOA 1Q7QA 2WM0A 2EEXA 1W3LA 4RKAA 1ONWA 1UWQA 4XK2A 2XDFA 1C8QA 3DFQA 3WF3A 3CL6A 4L80A 3BWWA 1E6NA 4H9MA 5LHFA 4WZHA 5A8QA 2AL2A 2H8ZA 1QU4A 4B16A 1PYMA 5DF0A 3N9KA 2WW5A 5KZDA 4WDXA 1OT2A 3GE7A 3C3NA 2D1ZA 3UR7A 3UA3A 4W86A 2VDHA 1JPDX 4KETA 4XD3A 5HK4A 4TR9A 2W0UA 1TQXA 1Q63A 4DN1A 1TCMA 1J96A 4J3UA 1GHRA 3POCA 3S5OA 2V2CA 2IUZA 4AX7A 3P82A 3P14A 4PTVA 3FHAA 4L9ZA 1LROA 4ZOCA 4D8LA 3GD6A 4DB7A 4ZPTR 1XLHA 4I8DA 1XCWA 2CLEA 4MDOA 5D32A 3S6DA 5HWMA 4PGLA 5C54A 3JW7A 1JZ7A 3DKJA 4ERGA 1BVZA 1QHOA 1DTUA 1RLDA 4OZOA 5DT7A 1JUEA 1FKLA 1H7PA 1V6WA 2HS6A 2ZA1A 4AEEA 4HNTA 1VZWA 3MHFA 3RX2A 3CHFA 5D09A 1IXOA 3SCTA 3SCQA 2Q6ZA 1MQRA 4LVBA 3HGRA 2WHMA 3L4WA 2WMIA 1EBHA 1EB3A 1F8IA 3K4WA 3O0KA 1S2WA 4ML9A 4HQVA 1E6ZA 3IGXA 4U33A 4PRTA 5HW8A 4QLLA 3AFBA 2WKLA 3UGRA 2ZZ4A 3CL8A 5I03A 2WNNA 1MEWA 3W26A 4JL1A 5HMSA 4L9XA 4C6QA 2QJGA 2V3EA 2OSYA 2P0OA 1Q6LA 2Q8XA 3AHVA 3PZQA 1ISWA 4J7RA 3UR2A 2NX3A 1HXJA 3WDJA 1W31A 2ZXAA 2C0HA 4E8CA 3R6IA 1E72M 1EHNA 1EWEA 1XYFA 3ABZA 3GFZA 1SGJA 1YDYA 3SCPA 4MPQA 4UC5A 1ZAJA 4AIUA 4ILSA 3OJGA 5IFPA 1EOKA 3SY1A 1NP0A 4ADTA 4TW8A 5A8MA 3KBWA 4H7CA 5XINA 4MAVA 3EWUA 3GTFA 3OZPA 2ZUSA 1IIGA 2HXTA 2Z7GA 1KV8A 2A6NA 4JHZA 2WM1A 2WLYA 1ME8A 4J9JA 4C7DA 1AD4A 4DJDD 1EYEA 3G3DA 1YBQA 4A22A 1KFLA 1KGWA 4MY1A 4HU3A 4P7LA 4ZTYA 1US3A 2VP8A 1GOMA 2W66A 4LT9A 3NAVA 1TWZA 2PN0A 1WCGA 1DKWA 2VDGA 3NEHA 1GZ1A 2ZR4A 3DOPA 4DJFA 1F7BA 3SRKA 4S3KA 5CZJA 5DCDA 2XVPA 1I9CB 1DWJM 3V7PA 4JIIX 4GH3A 4K39A 4YVXA 1WB0A 4XAYA 3IEBA 4D71A 5I3JA 3WLHA 1WA3A 1W2PA 2VX4A 5CZKA 4WHBA 2PDUA 1HP4A 3VIPA 4ZB2A 3TNOA 4HKPA 3G1XA 3WCZA 2Y62A 3BSGA 4HARA 4ZS6A 4QROA 5E0CA 5F1UA 2EKGA 1Q6OA 4FNSA 4NZCA 1WE5A 3GXDA 3N6HA 3VGDA 3MMWA 1FFRA 2DORA 2WMJA 4JFWA 4N02A 2XPBA 3T07A 4JFMA 3CV1A 4IISA 2P50A 3CAVA 1HJUA 3KX6A 3AYTA 3VABA 3GXMA 1BKHA 1R8LA 2D0GA 4I9AA 3S0CA 2TAAA 1PAMA 3C2OA 2G4JA 2G3NA 1WXYA 1C29A 2XIBA 3EWWA 4NZ3A 5I78A 1S46A 3VTRA 2WZEA 4GA8A 3NFUA 3NQAA 2ZIDA 2CWNA 2R1KA 1JVWA 3SB0A 3SW6A 4FS9A 4JXCA 2WSRA 2JGYA 1WDPA 4LFYA 2ZZ3A 4XZIA 3TCSA 3UZWA 3GHUA 4KQNA 1W3KA 3K2GA 3GNXA 3WH8A 1CGVA 2GK1B 3H4WA 3ARWA 3PTKA 3W9ZA 1P0DA 4XD6A 3DG3A 4QM1A 4RL3A 3LSCA 4HNCA 3C86A 2CXGA 5H8MA 2C7FA 1MXDA 2MUCA 4E38A 4GCAA 3WH5A 9XIAA 3MUCA 2YKKA 2PDFA 4JFUA 5BRPA 4U3CA 4UOZA 3BMBA 2W3ZA 4UTLA 3OVQA 4QNEA 2R14A 4NNBA 1ZNNA 4W85A 3NO5A 1S5VA 1PWLA 5HANA 1DJHA 5E1QA 5A2CA 1TPFA 1X7IA 2J7CA 1J01A 3UXLA 1XR2A 2QMKA 1TTIA 4LBSA 1XH2A 5CGQA 4H8VA 3RPTA 1O94A 1UWSA 3N15A 4DLMA 1WKYA 3C52A 2FTPA 4GWEA 4Z2JA 4TX6A 3S1GA 1YPFA 4K8EA 1TA3A 2ZZ7A 3TXVA 3IV8A 3GNOA 2CHOA 4GE8A 3IV3A 5EGRA 4ZCWA 3ITOA 3V5CA 2CEQA 4TMBA 2FPTA 4Z2IA 3RPMA 3VOGA 1EYWA 1AJ2A 2EBNA 4EXQA 1M3UA 3LHWA 1KM1A 2XIIA 1W5MA 3VAVA 3II1A 2YL8A 4AMAA 4W4QA 3QXBA 2F2HA 3SM0A 2PZNA 1WAWA 3PRDA 3VC6A 2WVSA 3S6TA 1MQQA 4DM1A 5I07A 2CZEA 5DRIA 4QZVB 1PVNA 3L67A 1DJIA 5EL1A 4CNSA 3NQDA 3WLJA 4Q4RA 1E4IA 4X0VA 3WNMA 5CLWA 2GVEA 3ODKA 2Y7EA 2V0TA 4GZ7A 1XSIA 2HE8A 8TIMA 3NL6A 4H6RA 3O6YX 1RSCA 1YLVA 4M81A 4WR3A 4YHEA 1KB3A 3H7UA 1IE7C 3RU6A 1VRXA 3OPSA 3BL3A 5A6JA 7TIMA 1UR4A 1W8SA 1H09A 4GKTA 4PRWA 4UOJA 1TWDA 1E0XA 4KCUA 2A4AA 1ROTA 4O1FA 2NQ5A 2PGRA 2HVOA 4RW5A 1JXKA 1AQMA 4DZIA 3AOFA 2M2AA 1DJWA 1A4MA 4Z1YA 3THQA 3KAGA 2HVMA 3VIJA 4WDWA 1SZRA 4WQ6A 4K68A 1PIIA 2RUQA 1OFBA 2V3FA 4P7NA 1TX2A 3VOFA 2DFAA 1NTHA 4PL2A 3M5YA 2ZADA 4L72B 2FPYA 2P76A 5ABTA 4J40A 2X2YA 1RXOB 1JYNA 4HPXA 1JCXA 1QVBA 4AY8A 3C2EA 3VGHA 3GLCA 1Q65A 3PZ9A 1TR1A 2JALA 4L6OA 5CGMA 3CPRA 4XWUA 2VZUA 3CZEA 3PPGA 2WMFA 3BLPX 2ZA3A 4KFNA 5TQLA 5CSUA 4K8HA 2HPIA 4MLRA 3CH0A 5IOBA 3MB9A 2ZZ2A 1WZAA 3FGCA 3QC0A 1D3CA 4FNRA 1MNSA 2HPMA 2FJKA 3NO3A 3LGGA 5I3DA 3EWYA 4DYEA 4RJEA 3W2JA 2YZRA 2I14A 3BQ5A 1KT1A 1OBAA 1OF8A 2G3IA 2QYGA 1XDJA 3WN6A 4D9PA 5DN1A 1XRVA 3EDFA 3N73A 3GQYA 1UJPA 4WY0F 3OLEA 3WLNA 2CPUA 3GDLA 2HJPA 3VNDA 1OCNA 4W9PA 5E9AA 4WKAA 2ANUA 1K8CA 3HG3A 3IPWA 1OHLA 3B8TA 2H8XA 1XQKA 3MDYB 1VRDA 1FWEC 2BS9A 3LHYA 4HU4A 2ZWZA 3AZSA 1QNSA 3TTYA 1OD8A 3O9NA 2WJEA 4GYPA 1IGSA 2OELA 4M5PA 5HA7A 1YIXA 1OC7A 3CZKA 3MUZ1 4LS0A 1DIOA 4H19A 4LYKA 1GKRA 4KEUA 2KI3A 4N42A 5AYBA 3FVMA 3W25A 4M1BA 4QJ3B 3RG6A 4OBTA 3WG6A 4UFHA 1MRAA 3R8GA 3PTDA 2BGQA 3P67A 2DW7A 3W7QA 1SPQA 1MVYA 3UQAA 1K6AA 1B1YA 2FTWA 4DO6A 3M0XA 4DQWA 1UR8A 4B5WA 1UB3A 2R1NA 4PL1A 1QDSA 1E5JA 4CD7A 4W5UA 1W37A 2VC9A 4WLCA 2QF7A 2L2SA 3AXIA 4JBRA 4NJGA 2V2DA 1CX9A 1Q6HA 1UYQA 3N18A 2OX4A 3GY1A 4QGCA 1V3HA 1QPRA 3ARYA 1SZFA 5F2IA 5TBOA 4C1NB 1U83A 1YW1A 1LLZA 2P3EA 4WUIA 3WLOA 1M65A 2C3ZA 4CU8A 1JD7A 3GPKA 1BTMA 1EJWC 4WDTA 3JU2A 2BSLA 1E70M 4LW7A 4LQ1A 2VN1A 3TW6A 2CXEA 4FXRA 1F61A 3I3EA 3H4XA 2QJMA 1GVOA 2WPBA 1NAL1 4HU8A 1LUCB 4IJCA 1UIOA 1JNDA 2M1IA 4I3GA 1DJGA 1T99A 2ZXDA 4K8GA 3KXQA 2Z1SA 3CBWA 1KBJA 4AWSA 1S5TA 3N2TA 4DF1A 3N13A 3I6RA 2FTYA 2YPIA 4WXZA 2VCAA 1O66A 4LYRA 2A7NA 2ZZ1A 4HOWA 2X8RA 3AI0A 4FR1A 3VDHA 3UQBA 3ITTA 1F6YA 4NYYA 3ICJA 3KM8A 1E51A 3DI0A 1FKKA 3ERPA 3W53A 4B4FA 3TE9A 1OJXA 3FFSA 5I5RA 2ZZ6A 1R2RA 4F0MA 2OT1A 3MC5A 4O1BA 2XIMA 3VX1A 1TRIA 5E9XA 1FWRA 3TN5A 3STCA 5G1YA 2I1OA 4H8NA 5DCBA 3EWBX 2MLXA 3TUUA 3TC5A 3TAOA 4UOQA 2GPTA 2VOTA 5T26A 3OA3A 1JPHA 3K30A 2WPGA 1MUMA 4B5UA 4GVHA 2Y7GA 4DRQA 3RU8X 3E2SA 3BH4A 4LOCA 4LBRA 1QPNA 4M7SA 2B5UB 4H9ZA 4JCMA 5D8WA 2PWVA 1RHCA 2QCMA 4BEUA 2OFJA 2E6YA 3MU7A 1CENA 4C6DA 5AVHA 5IDZA 1UUMA 1LRTA 1IF2A 3RCNA 1LQ0A 1MW2A 4QE5A 4URIA 3UJ2A 1XIJA 4TV6A 2JKPA 3BG9A 3LPFA 4INFA 1AH3A 1QJWA 2P8BA 1ADDA 1UWTA 1XM3A 4JFLA 2J7HA 4H7VA 4OQVA 3C61A 2DQXA 4NT0A 2PGEA 3ARSA 4AX6A 2QCHA 2OSXA 3W29A 1HJSA 3FSUA 3K8MA 4RDYA 1P1MA 2RSEA 3MV01 5LA0A 2CWXA 4PBFA 3W7DA 3KLLA 4JX6A 5EYWA 3SQMA 4NASA 4IPIA 4AEFA 1QHZA 2VDIA 1JULA 3JS3A 1IEXA 3HGSA 5D2VA 2AQWA 3OGRA 2QJIA 4KKXA 2FH6A 3PP7A 1GOXA 1Z41A 3CHCA 3MYOA 3EKLA 2O92A 4PMNA 1XIHA 3NPUA 1VP5A 3E02A 1TPUA 4HTYA 3L23A 1UH3A 1E4MM 2QCCA 3WIJA 1JAEA 1Y5VA 3K13A 3G8RA 4NUWA 1Q3NA 5A6TC 4H9XA 2L5HA 4FPSA 1POJA 3LY0A 1FKRA 4I9MA 2RDUA 3IIZA 4FIQA 4BQ5A 3W7CA 1LLOA 5AC6A 1A4LA 4QX4A 1SO6A 2WKJA 3SBFA 3O5RA 3DG6A 1ZPTA 4Q4MA 4IP7A 4F0KA 1KBBA 3O5FA 2ZX8A 1C91A 5I6SA 3ALFA 4WVXA 2J8TA 1E3XA 3UWZA 3GNDA 4BQ3A 2HNEA 3CYJA 1F3WA 2I57A 2QVHA 4WY0A 4DPQA 5T8GA 1P5BA 3WQ5A 3GAKA 1PO9A 3TFCA 1IWAA 7CGTA 4WIWA 1AVAA 1VFTA 4KEMA 1MEIA 2QR6A 1CGWA 1KRBC 1RA5A 3M7SA 3NQCA 1H63A 2J4GA 1THFD 3H2AA 6REQB 5EKYA 3EB3A 3WK2A 4S23A 4R7OA 1BSLA 3QKEA 5CC5A 2JFEX 2D2JA 1UR0A 2VUYA 1A5OC 3HB9A 2J9ZA 1XBYA 4AEOA 1CTNA 3HQNA 1OB0A 2FB3A 2QDGA 2VVSA 1TV4A 3KE0A 2Q8LA 4BJHA 5F2GA 1YXDA 3AIEA 1MMFA 1K8YA 4B91A 4I7VA 1Q4WA 4TW6A 4DBSA 3V16A 2J7EA 4LAYA 1SR9A 2VRQA 3SI9A 1DQWA 1VLWA 2CHRA 5HQEA 4GIAA 1LZOA 3PTQA 4AD3A 4DH0A 2XWEA 4Q8UA 1ISYA 3PUGA 1YTDA 2VR2A 1QATA 1TJRA 4OGZA 4N9CA 3TYCA 3G0SA 4IMDA 2OO0A 3CGNA 1OX6A 1ZJIA 3FGCB 2QUVA 3TW9A 2QDDA 1XRFA 3P2VA 1TSIA 4U31A 3NL3A 4AYSA 3M0HA 3WQPA 3BW2A 3VIKA 3OU8A 4MTVA 1W5OA 2HVNA 3ATYA 4DJDC 3CQJA 2PP1A 5DITA 3GTNA 1TV2A 5LIKX 3OYZA 3WFZA 4B5TA 5XIMA 1TVNA 4D6FA 3B9EA 3KCEA 5DMLA 1CYGA 1ML1A 4A3QA 2XFWA 1SW3A 4YVVA 2X16A 1UUQA 1KLYA 3OBKA 4UFLA 3PZTA 4W7UA 2M08A 3LDVA 4K7YA 4ODMA 2F6KA 1F40A 5HXMA 3A6OA 4CCDA 3OZOA 4ATLA 1OFPA 1PXGA 4JICA 5A94A 4CVUA 3EOSA 4Q7IA 3MSYA 1VBGA 4KRZA 1ZCNA 3LRLA 3VDGA 5A8NA 3P0WA 2EPNA 3MUAA 3JR2A 4DJEA 1OX4A 1PUDA 3MY9A 3IJ8A 1M6JA 1PZ3A 4PZVA 2OWXA 1Q6FA 1EIBA 1FKFA 1HO4A 2VX6A 1J0JA 1XPYA 4J2MA 4NAEA 1SJCA 1GW9A 1TUFA 1HX0A 3QR3A 5HQLA 3OG2A 4GXWA 5BCAA 4ZPVR 1NWSA 4CKQA 3WSUA 4RK8A 4F66A 2V5LA 1Q13A 3EYPA 1OD0A 1F3EA 3A5FA 3BGGA 4AF0B 4ROPA 1SQ7A 1U5HA 3O6DA 2XH4A 1EC7A 2X2GA 3TZNA 5A69A 2KO7A 1PKNA 2BXVA 3A9BA 5AYYA 1CGTA 2Y8KA 2J75A 2E09A 1TUXA 1J4HA 3DBNA 3QHMA 3CL7A 3NQ7A 3QLLA 3MJMA 4OV4A 4F0SA 1ISVA 2J6XA 2BHZA 3V5OA 5CG0A 3W7HA 2FGBA 4H2CA 3ARPA 3PZOA 3CV7A 2CIPA 4IJRA 1BF2A 3DENA 1W3JA 5F7UA 3SDOA 1P0KA 4QXIA 1YADA 2WBGA 3DECA 3AO0A 3QY6A 3LI1A 2XTKA 3BLKA 2R24A 2QUTA 2BB0A 4TOQA 3UETA 1W9PA 3RDKA 3M0KA 4ZR8A 1M1BA 3RMEA 1IT0A 1FWHC 4B5VA 3WBAA 3SGGA 2OQYA 3UESA 1G4SA 1XX1A 4ODOA 4QT2A 1WKFA 3GIQA 2VC7A 1WBJA 3MHUA 1RA0A 2VEMA 4A8IA 4LUTA 3AUJA 4PN2A 2PCEA 1NF0A 3VK5A 4JY8A 1TWWA 2EJ1A 5FCZA 4G7FA 4MY9A 5FF3A 2QCFA 4FOKA 1F76A 5BMWA 2XP9A 4UQEA 3S6OA 3FW6A 3T81A 3DZ1A 1D8CA 2BOGX 5AHMA 5D9PA 1I1WA 4FX7A 1TR9A 1O5RA 3W7EA 1OF6A 1P5QA 3TQVA 3E0FA 3WQ8A 1HNYA 4O4WA 1MZHA 4Y9PA 2ZA2A 2YA2A 1H0IA 3QJAA 3DESA 2X30A 4IGMA 3A4JA 4KCWA 1W1ZA 5K7JA 4O4VA 5DQPA 3FX4A 3H2OA 3W01A 1EIXA 5C71A 2OZTA 3MBFA 1EKOA 1RK5A 1ZL1A 1UHVA 3WNNA 2NLIA 2SFPA 4KWOA 3TSMA 5HR7A 4IIGA 3WENA 4QP0A 1QWGA 1QPKA 4AD0A 4FB7A 2REQB 1WNOA 4IQEA 5TNVA 3W6LA 1DEDA 4AZCA 2E0PA 2O56A 3WQDA 3ARUA 5AHIA 2BOEX 4HPJA 3UXIA 2CZVA 2WNZA 3SCUA 3ZR4A 1ZZMA 1E3ZA 4AISA 1HKVA 1JDDA 1ZENA 2YL6A 3PPHA 4MPKA 1PKMA 3EKGA 1K77A 1OK6A 6PTDA 3RAOA 3P81A 2CHNA 3O5IA 4CQBA 4UR9A 1PZ2A 4RX0A 2NWRA 1F5ZA 1ITQA 4GI6A 4Y8EA 2YBTA 4MNMA 1G4PA 4J3ZA 5AHNA 5M5DA 3GTIA 3IRSA 4V15A 2DUXA 4N6EA 4WGXA 5I0DA 4Q4QA 2OU4A 2PEVA 3EDEA 2E5BA 3BICA 2A3CA 3V4BA 3GYCA 4JFKA 3ZWSA 2PDMA 3IACA 1V3LA 2JKEA 3STFA 3L12A 3MKCA 4FXJA 4GZEA 2HE5A 2I9UA 4CN4A 4U4MA 2V5KA 1GYNA 4LWWA 3QY8A 4KPLA 2INFA 3KHJA 2VC6A 1F8AB 1FKJA 1KQZA 5CXPA 3MANA 5A2AA 3T7VA 2PFHA 4GABA 6ENLA 4IGNA 2A3LA 2F2DA 4MG4A 1EDGA 1KTNA 2ZQTA 5A6LA 4MWAC 1QI3A 4LCQA 1NY1A 1ZJBA 2QUMA 4BFAA 3KBNA 1PTDA 4JNMA 2OO6A 1TZ9A 4WRHA 5J5DA 4UQAA 3SCSA 5IXEA 3GVWA 1H4PA 5JU6A 2NVCA 4RNJA 1R38A 5A8GA 1K70A 4MWAD 3B4YA 4JNYA 1RK6A 5KINA 3W7NA 1JYWA 4D1JA 1QPLA 4MJ2A 3QSRA 2C8NA 3K4DA 3M47A 4TTUA 4R85A 3DHFA 4Y2WA 3E1F1 1OGGA 4WK9A 3E38A 1REQB 1J12A 1EO7A 1Q1CA 1K1DA 1WUFA 1L1PA 2JE8A 3ES7A 4AY1A 1NDWA 1JRBA 2J62A 4DWSD 3E9AA 3QV9A 3LGDA 3HG5A 1AUSL 2QPSA 5E93A 4G7EA 3S5SA 3GBDA 3LCFA 3MW7A 1RP8A 3RN6A 1V7AA 1R9XA 3PM6A 1Q5MA 4ZOEA 3T55A 2G5WA 2YSWA 3G0XA 4WJEA 4LAXA 3GTXA 2D2OA 2GJPA 4WF7A 3CGMA 1FWCC 2PV3A 3A21A 3TFXA 1XFCA 4BF7A 1KBKA 1B4KA 3L7RA 2YCEA 3O5PA 1O1HA 3T2QA 2WANA 3W27A 4JX5A 3EIPA 4GRSA 4BY3A 4US5A 2OVLA 3G6LA 2FGLA 5FJTA 3PAOA 3UJRA 3LQLA 2FVMA 3WQVA 2A6LA 2GUUA 4H6EA 4JHOA 3JVAA 4TUFA 3DUGA 5FACA 3P93A 3VX0A 1XYMA 4R0XA 2DVTA 1QK0A 2QULA 2YA0A 2OEMA 4U2ZA 1R46A 5HNUA 3VA8A 3GX9A 3H4GA 1ITUA 4YWIA 1OX4B 3GHTA 1MDRA 1O1ZA 1W0MA 3LUTA 4F0LA 4FMVA 1NSJA 3AJXA 2UZ9A 2V3GA 1XGEA 4AD4A 4TMCA 1R7OA 4AVOA 4QE4A 1C7SA 4O1DA 3U3HA 2WOQA 4U3AA 4UTWA 4ZZ9A 4ZODA 2O55A 5B8IC 2Z2AA 1HJQA 1HIZA 2OODA 2PWFA 2E6DA 1EPVA 5BOOA 1ZQ5A 2UY5A 5CPMA 4DIAA 1PHWA 3ABQA 2ODOA 3BJFA 1JCLA 2OYMA 1WP6A 4HYRA 5IHSA 2ZRVA 3C2VA 3TYDA 4L1XA 1OFOA 4G5DA 3TH6A 1RVGA 3S2CA 4UTTA 3HFTA 3V1HA 2GL5A 4W93A 1MRQA 3PZNA 4KWVA 2F61A 3ARQA 2YA1A 3QPYA 3VUPA 5BOEA 1W3NA 5AY7A 1OVDA 4Q8WA 4JKKA 4ZFCA 1O68A 2MLZA 4C6IA 3QW4B 3BQ6A 4GUJA 4WOZA 1YNQA 2ETNA 4GYKA 5GNXA 1XKYA 4NZJA 4H8UA 1AA1B 2OKTA 3CEUA 2X41A 1V79A 3EA1A 2WB5A 2VENA 4XAPA 2XPKA 4E3TA 5A95A 3QBUA 2VR4A 3B8IA 4DJED 2XG9A 4GBUA 3WBYA 3M46A 3FY1A 1TG7A 3ISIX 3LCWA 4ECLA 2G3JA 5JBFA 2BVWA 4RR4A 1V3KA 3VIGA 1W9VA 4XUYA 1TO3A 2RDTA 4NNAA 4G7EB 1HXVA 5DT5A 4UMCA 4IQJA 2GJNA 4FK9A 3BTNA 3LTSA 4GQBA 4RPPA 4OFCA 4XKMA 1UBPC 3WQGA 4G9PA 4LUSA 4HPHA 4X2RA 5D8ZA 3GDKA 1XP3A 2PTXA 1FKDA 3N12A 3E12A 3VIOA 1JNEA 2MNRA 2PU0A 1Q6UA 3BC9A 3H2FA 4GCXA 3EKZA 4NJHA 1YATA 2PGWA 2ABBA 1HO1A 1JZ6A 5L6UA 3O5EA 3UCDA 3W0KA 1GOIA 2V3DA 2FGZA 1IZCA 1DBTA 1VQTA 4HTBA 3NQMA 2CLPA 2J47A 1FHUA 2WWDA 4NF7A 3WUEA 2VX5A 4S3CA 4H00A 2NT0A 4M82A 4NXKA 1C8VA 4HZMA 3TW7A 1DWAM 1W1YA 4QBXA 4PBGA 1I1XA 3SAZA 3PY2A 3WH9A 3W1AA 1XSKA 3SUVA 3NM1A 4Q4SA 5AYIA 2Y7FA 1DWIM 1QI0A 1ZBVA 1O6IA 1EGMA 4JFVA 2NWSA 1AJ0A 4HMEA 3KL3A 5LIWX 5REQB 4IQ2A 4MB1A 3TOPA 4Z2LA 2D0HA 1H1ZA 5D75A 5DMYA 3RITA 3HQOA 3T0BA 4AZIA 3ZT5A 2RGLA 1ENUA 1UKOA 4FAPA 3R58A 2ACRA 1O5QA 2PRMA 2PGFA 3VKDA 2IXVA 4AVFA 3TYUA 1PDZA 3K8KA 4CD8A 4XKYB 4ZPWR 4E6MA 4NKCA 1TE6A 1XKJA 4UDMA 1SW7A 5JMUA 1GJPA 4RZ4A 1EDQA 3BAIA 4ODLA 2AQVA 4GZIA 4XAFA 5HMEA 4BQ4A 5IDIA 1A49A 3W02A 3H7RA 3MZ2A 1LTDA 1HGWA 1KR1A 1QMLA 1V6YA 3FKRA 3D5HA 1X38A 3QV8A 4NNCA 1BGGA 1LRNA 4NY2A 4Y9NA 2YLAA 2Y24A 1SJAA 3NG3A 1XI3A 4M8UA 1ONXA 4LAWA 1GZJA 4ICCX 1DJNA 5FF7A 4YHGA 3HF3A 3DYMA 1HL2A 3WLSA 3LPPA 1EEPA 1IIHA 1DWGM 3G1AA 5EMYA 3V0SA 1GVQA 3JYJA 1OIMA 3KZ7A 3W2KA 2ONEA 2CBUA 5E6ZA 1PX4A 2PDBA 3ITGA 4RDZA 4PTDA 3IKDA 3G0UA 1I0DA 3PANA 2HXUA 3ECQA 3THUA 5ABGA 3RF9A 3UWEA 4MFEA 2ZICA 4ORMA 5GJPA 3U4FA 3GVRA 4JYFA 1EJVC 3U7BA 1R2SA 2HZGA 1YDNA 1AQ0A 4JTAA 1KFCA 2FFCA 2CESA 3M1ZA 3ES8A 2ZOXA 5I09A 3AAMA 1WUEA 4NJJA 2V8ZA 9RUBA 3I7RA 3COTA 4OU1A 1PIFA 1OGBA 3W4RA 3IGHX 3TJLA 5DLCA 3IGSA 2PBGA 2YCIX 4MGVA 5A6BA 3MMUA 4C6KA 6TAAA 4U86A 4NX5A 4N9DA 3CO4A 3H8AA 5LA1A 3KTCA 2P5NA 4YN5A 1OABA 4NRSA 2ACQA 1Y0EA 1ZFJA 1B3XA 3AHYA 2PWDA 2GWGA 5FSDC 2WQDA 2P4VA 1LBMA 2J6VA 3CZGA 2DEPA 4H9TA 5BYWA 1LUCA 1YW5A 1FFQA 3GNPA 1G6CA 5K2ZA 4S38A 2CLLA 2J7DA 1TKKA 2D3LA 3ZJKA 2K8IA 4JIRA 1C92A 3O5MA 1DPMA 1X1NA 1GQNA 3M9YA 1L2QA 3N25A 3MP4A 3QKZA 4FHAA 4FALA 1GTEA 2D9FA 4EPKA 1PYFA 3URBA 4IT6A 1MW0A 4F48A 3AMGA 1H0GA 4MJMA 4UTHA 3TQPA 2ZE3A 1JGMA 1HKKA 1ZTVA 2BP1A 2ZC8A 3HIJA 2J88A 1IXQA 4CNNA 1UWRA 5C55A 1MFVA 4ZA0A 3I7SA 1HKWA 1W9XA 4IH3A 4G56A 5HPCA 1B57A 2XGIA 1YHTA 1RUSA 4KW2A 2FFIA 1EUNA 4PCNA 3B0YA 4O28A 2AMGA 4ZQPA 1WDDA 3ZR6A 4CD4A 1JYXA 4WDUA 1BG9A 3H55A 1VEOA 4DPPA 4LAKA 4R7WA 3UVIA 1VFOA 3H22A 2VRJA 3CH9A 2V6AA 3N04A 4YYCA 4AC1X 3BLFA 3W76A 3O16A 1KXHA 4F8XA 1XLLA 4TQTA 5F1VA 3AU6A 4NXSA 3WQFA 4Z1DA 4LNCA 1R3QA 3CMGA 3W1MA 1TWIA 2XWDA 4G50A 1EJRC 2VEPA 1R3TA 1JCJA 1JJKA 1HQTA 3LUOA 3RXZA 1C7TA 3AMLA 4E4PA 2PLJA 4KESA 3UA4A 3W24A 4YYFA 4S2BA 2GUYA 3NIYA 2OX1A 1PL9A 3QV6A 1ADSA 2IMRA 3WQ4A 2XFRA 4LB4A 5HW7A 3RYSA 1QUMA 4U84A 4O50A 4PR4A 3MSDA 1FKXA 1DQXA 3NVDA 3U48A 3UZZA 1XIDA 5HNTA 1AG1O 4JFIA 4I90A 1ZU8A 3WD0A 4B9ZA 5ECUA 1N7KA 1P43A 3HZ3A 4UNIA 4O13A 1MXGA 3W1TA 3AS1A 4AZGA 3WY1A 4UZSA 1W26A 3UG3A 3O6AA 4PCFA 4E8GA 2Z1XA 4HJFA 3ZT7A 5E70A 4W8AA 2JK2A 1EJSC 2YL9A 4KRTA 4QQ3A 1R3WA 1UWUA 4AXKA 3AIWA 3PWIA 2OPJA 3RK8A 4EKJA 3UGVA 4L1WA 2J13A 4TX0A 2GSJA 1E0WA 7ODCA 4K38A 2J66A 3W28A 4AWTA 4JOMA 3QOMA 3NSMA 3TN6A 2WQPA 3H6OA 3B0XA 4M29A 1RP9A 4O11A 3N14A 2Y88A 3UNDA 3G5EA 3E5BA 4CQ8A 4XZ9A 3BZJA 4QDPA 4AC7C 2CLIA 1I2RA 4AMCA 2Z27A 4US5D 4GVGA 5A6AA 3WD2A 1FWTA 4O12A 3A22A 3WFAA 3KEHA 3GWQA 5LYRA 5C9RA 1UD4A 5G4WA 1WKDA 4L1GA 3WELA 1WDQA 1TWSA 1B3VA 5JBEA 3MJYA 1RBLA 1VCGA 1MWOA 3U9IA 2JQXA 3IJ9A 4PTWA 3W7GA 3UXKA 1JCMP 3OIHA 3FJ4A 4MWAA 3ITXA 4V27A 2DZUA 2F6XA 3SECA 3GVGA 3ARVA 1MW1A 1SFSA 1W3HA 2JZVA 1QASA 2WC7A 3QRHA 3LBCA 5AECA 2W6RA 1HL9A 1OZQA 4NILA 1WZLA 4R9OA 3D3FA 4PEEA 1IZKA 2J25A 1MEHA 1K02A 4BF8A 3BG5A 3P60A 3KDOA 2NV1A 4IIFA 2QDHA 4US6A 4QG9A 2CETA 2DJLA 4GH1A 3BAWA 3L65A 1PX3A 2BDQA 1NF7A 3OLDA 4Y8FA 4JIHA 1X8CA 4EPBC 1S1PA 2Y5JA 4QDMA 3TV8A 3GDRA 2WZIA 2EKCA 4LSBA 1KR0A 2F23A 2BY2A 4GXMA 4KQZA 3PBYA 3SY5A 1G4EA 4X60A 4DRKA 4EXAA 3S47A 3IAQA 2WV8A 4XVDA 1L6FA 3RX3A 3NQGA 1B6CA 2QS8A 5BMXA 4XX6A 3REQB 3RCYA 3TDBA 1TIWA 1VH7A 4BR1A 1GOWA 3CUJA 5ABHA 3AXHA 1GQLA 1XJBA 3KWSA 1Z42A 4DAIA 4P7OA 2YZ5A 4DRMA 1R6WA 2AKZA 2W62A 3MUY1 4R34A 4C6EA 1UH4A 5EBUA 4ERIA 1B3ZA 1ZRQA 3WKZA 2MF9A 4PC8A 3S5NA 4PUJA 1Z8AA 2QIIA 3AJ7A 4BCEA 3EX1A 2PPNA 3WH7A 1EA9C 4IP5A 3U5UA 1T11A 5C2GA 2X1RA 3H24A 4L4OA 2ZRWA 4F0RA 2QCEA 3N29A 4UTMA 2VM8A 3BCDA 4FLOA 4BS0A 1XV8A 3BV7A 1TPB1 3RO6A 3W23A 3WZ0E 4JEQA 1R9HA 1K7EA 2UY4A 1EUAA 1KNWA 3QQ1A 1VR6A 2WZHA 1S2TA 1UG6A 1HKJA 1PSCA 2XH0A 3QHNA 3CQHA 4L5ZA 1GVIA 5JBDA 3R11A 1DXEA 3UPWA 3SSJA 1KKOA 3QVQA 4QJ1A 4O19A 3IIVA 5I02A 2BVDA 3WNOA 2GZXA 1XG3A 3QH2A 4J3VA 4PUKA 1UCWA 3LLFA 4Y7EA 2PS2A 3GC2A 4JNZA 4A4AA 3AROA 3DGBA 5FKYA 3JZUA 6A3HA 2GQ9A 5L9FA 2O9PA 5I24A 3UVAA 4FO4A 3IS4A 2HISA 1ZSXA 3N4AA 3QTPA 4DELA 3TC6A 3BARA 4DI9A 4JN8A 3R13A 4W9OA 1TIMA 5DO2A 1JF6A 4ACYA 4HNLA 1UD5A 5E5CA 1GPWA 3ARXA 3ANYA 3WL0A 1J93A 4W89A 1R3SA 3IJQA 2ZVRA 2I5IA 1QR7A 3L4ZA 1FOBA 3VMNA 2YCKX 4DO5A 3M0JA 4P5UA 1SZGA 2WYSA 3CB3A 4RNFA 3FCPA 3PS7A 4BI6A 5E0FA 3RLGA 3AS3A 2XJ7A 3PNZA 3LSBA 1RLCL 2PMQA 3GTHA 2V5JA 1OFDA 2QIWA 3N4EA 1U5VA 1GVSA 4BF5A 4D2JA 3N11A 4DNHA 3FAPA 5GJNA 3GG7A 1XIBA 2FZNA 4AZHA 1OYCA 3U0HA 1H50A 4TVDA 5AYXA 3ITLA 3M7WA 4M56A 4EPDC 1BPLB 3HFYA 3NZRA 1LBLA 3S8HA 2ZUMA 3IJ7A 3O07A 4LYPA 3K1GA 3MP5A 4IM4A 3GG0A 2Q09A 4JFSA 2R8WA 3C6CA 1FBAA 1MYRA 4AD1A 2AGKA 4XZMX 1TMLA 1W54A 2Z28A 3YPIA 2D3NA 4O18A 2OQLA 4N7QA 1XH0A 1RD5A 3EOUA 1OYAA 2UV8G 2DIJA 4YTTA 1XIIA 2YDRA 3GXFA 2PUZA 2Y5EA 1DTNA 4DZ3A 1EH9A 4QHRA 1R86A 4IPNB 5CZSA 3P0XA 1RPXA 1YTKA 4A29A 1KFKA 4I6KA 3AQUA 3G18A 3MPGA 1PKLA 2YDAA 2E28A 4DJFC 7TAAA 4GJIA 1BGAA 4J2PA 4PMJA 1G01A 2VJXA 1A7XA 1V02A 2WNQA 1EWDA 3WMLA 3IKGA 1RD6A 2C15A 5C70A 4B15A 4A2RA 2DSUA 2WCSA 4LU0A 2VEKA 9CGTA 2PDQA 3B05A 4IMGA 4LUIA 2GYIA 3UJSA 3SUSA 1EJTC 2RKXA 3T9PA 4J1OA 3EOEA 4H04A 1U5JA 2JBMA 3RX4A 2XU2A 4Q3MA 4XKYA 1JFXA 1A5MC 1D7HA 3F4WA 4GNKB 2E1DA 3B9NA 3EXSA 2J9XA 2WO5A 5H91A 1B5TA 4MGGA 3U2EA 2EULA 3QPZA 2WJDA 3ID7A 1W9UA 4H6KA 4MB3A 4GZJA 4LF2A 3WDRA 1B3OA 2WCGA 4GJ1A 3UPMA 4ML4A 3NA8A 1DJYA 3VD7A 3H2EA 1S39A 2PPGA 1A5UA 4JTDA 2XN1A 3LMYA 3WK3A 1IEQA 1ZBKA 1O4UA 4ZB0A 3W1LA 3VKJA 3BGAA 4DO4A 1F6PA 4H9YA 2YW3A 1V7YA 3LV6A 2C71A 5AZ0A 6XIAA 1SFLA 1XLGA 4M24A 4ZVJA 5IHRA 2XH7A 1CZ1A 1P6WA 4B5NA 1F3XA 1KM5A 2X05A 2XSAA 4OHQA 4LANA 2NXHA 2WVVB 3NJ3A 3TWAA 3UXAA 2DW6A 1VBUA 1PS9A 3QZAA 2WJFA 3S5YA 2PP0A 1GT8A 2Z29A 4RCXA 4AD5A 3OW1A 3WUBA 2VTFA 3GU9A 1LOQA 4BI7A 1EHAA 4H4IA 4EF8A 2VR5A 3FXYA 2POZA 4ZQOA 2VCCA 4MKSA 3TMLA 3FVDA 4MY8A 1CXLA 2E25A 3AMKA 1XYCA 4DZ2A 4AHQA 3AC0A 4PTMA 3CT7A 1E55A 3T2OA 1KD0A 5AC4A 3M6YA 3DIPA 3O05A 4AWUA 1W3TA 2NX1A 3AIVA 4X9YA 3DERA 5BXJA 2OOGA 1VAHA 1MW3A 3VE9A 4GJJA 3W1PA 2CYGA 3KRBA 2I9EA 3ZSTA 1VKFA 3W1NA 4KRUA 4CNPA 1RPKA 2OZ0A 1DXFA 3HM7A 1CNVA 2Q5AA 2E1WA 3N9RA 3OLGA 2WCAA 1YQ2A 3KW3A 4JTJA 1QPOA 2NQHA 4S2CA 1M7PA 4XZLX 4AIOA 4Z0SA 3LXCA 3KVJA 3O5OA 2GSEA 2C1HA 4QNWA 4X0NA 4LC8A 4JQ1A 1XH1A 5BRQA 1K4HA 4HSNA 3TSDA 3LGEA 4IT1A 6CGTA 3B7XA 1HP5A 3K46A 5AHFA 1CBGA 1E6PA 1NSGA 1IWBA 1MNZA 4O54A 3OG3A 4MYAA 3DX5A 2DZBA 4CCZA 3S2LA 1D7FA 5CBJA 3ZLGA 4MNLA 1WO2A 2F6UA 9XIMA 3T1GA 1BLIA 4DXKA 5FJPA 1NDYA 1JDAA 1EPXA 5G2WA 4DRSA 2NLYA 3IANA 5HJYA 3B0PA 2DG3A 2IKHA 5B7YA 1XLKA 4C5ZA 1FCBA 1XLCA 1ZALA 4FXSA 1UMLA 1DIEA 2Z1VA 1UH2A 3A12A 3FYPA 4WXYA 5CEWA 3WH0A 1A0DA 5AN7A 1FHVA 4YS1A 1CGYA 4JN6A 2XYLA 3I3BA 4M6VA 3SUWA 3TQKA 4L61A 2TYSA 3HBLA 5JXQA 5CJ5A 4O8RA 4KIRA 3BMWA 4FLSA 5D37A 3L5AA 3E3HA 4YPJA 4U85A 4DY1A 4GY0A 4XZWA 2ISWA 2V5DA 5AC5A 2HMCA 1UR1A 2W5FA 3BLEA 2NXGA 4FNUA 2OWCA 4JS3A 1XYAA 5F4WA 1ZLPA 4IL0A 2EPKX 4GQQA 2PDLA 2X0SA 1RJPA 5I3IA 3W7IA 3EPNA 1W5QA 3MO4A 1A5SA 3O7UA 1TJ0A 3UU0A 3NYDA 4AH7A 3LMZA 3I68A 2RUCA 3VKBA 4RUBA 3DU0A 4D6CA 1C9WA 3U5YA 2WSPA 2I5GA 3AWNA 1JI2A 4MADA 3QEZA 3T42A 3R43A 1JEZA 2J74A 3NGJA 4L64A 3OYXA 3DFNA 1OEPA 4FR6A 3CS2A 3W37A 1XINA 1M04A 4GC4A 1J18A 5BROA 3WJZA 3QTGA 3H2NA 5AVNA 1TV8A 4OT7A 3O5JA 8CGTA 3P8JA 4HT3A 4Q33A 2F8QA 4XV0A 4DF2A 3PG8A 1ALDA 4BA0A 3I3DA 4JYEA 1F73A 1TPC1 3T08A 2CBVA 1ROUA 2RAGA 4Z1AA 1YXCA 4IQCA 5HMFA 4DRNA 1V6TA 1ME9A 8A3HA 3BDKA 2VFGA 2VQUA 2Z00A 3BCJA 5EMJA 3WDPP 5EFFA 3MCOA 3MUXA 3TX9A 5D02A 4QSFA 4XO6A 1H7NA 3K8LA 3R89A 1PEZA 4EPEC 1V0NA 3V1PA 1TMHA 3LPGA 1JAKA 2EG7A 1FHDA 5HPOA 1U2YA 3W84A 1GOOA 3STGA 2OCZA 5J04A 3UT0A 4LVFA 3CV2A 1LM1A 5XIAA 3MUIA 1HFBA 3OQEA 1RBAA 1D3HA 2MPHA 1AW5A 3OVPA 4GISA 4LRSA 2XZ7A 3POHA 3DHPA 3KBJA 1H62A 1XC6A 4IXXA 1ICQA 2VQTA 1B3YA 3W7KA 3WO8A 4GGHA 1T96A 3KLKA 3MVTA 1G9HA 4TIMA 4S39A 4NJKA 3GR7A 3NOEA 3RPDA 1KA9F 3MO7A 3WQOA 4GI8A 3IJ6A 4UUIA 3OHMB 1KKRA 2XM1A 3W73A 3BK0A 5BWFA 4IX2A 5E09A 1DHKA 4GBDA 4DZHA 1JCHB 2C1GA 4Y9AA 2P3ZA 1L6SA 4FP1A 4XIAA 5C7VA 4OJYA 1UJQA 3MI2A 4HHLA 1S2VA 4ZBCA 1E6QM 3IK2A 4O16A 3KOYA 2GOKA 3UJEA 4IFKA 2ZZ5A 3KFTA 2QCGA 3PRBA 3GM8A 1BWLA 2PU1A 1UZHA 3NURA 3C0SA 4WD0A 2J77A 1FKBA 1E15A 1DV7A 1ECQA 4GACA 4C60A 1EJ7L 2RQSA 2XP7A 3SUTA 5DCEA 2PSNA 3CAKA 4CNTA 3GTYX 3AWOA 3OODA 1XLBA 2D2HA 2KAUC 4GHRA 3M5XA 1LOLA 2PRHA 2V63A 4NIRA 2LGOA 1FH8A 2REQA 5JUVA 3EPOA 1E43A 3DYOA 2BXYA 1IEVA 5T91A 2B7QA 1W1PA 3SUUA 4F9DA 5GQBA 3V36A 8RUCA 2YGYA 1VC4A 2W4XA 2QJHA 3KRZA 3BMXA 3EX3A 2YR1A 1ITCA 1QTWA 1DHPA 2YFOA 3O5QA 4BZYA 2PLKA 3VI2A 1H1NA 4AWEA 1VEMA 1XLDA 5MHBA 1AQHA 4M6UA 5D9MA 1AW2A 1UROA 2NUWA 2G3FA 2WLZA 2CZDA 1IXPA 3TTOA 1EP3A 6XIMA 5HUAA 1XBXA 5M17A 1M03A 1NFGA 5EMLA 3C0LA 4K6AA 2P88A 3IIOA 2YJQA 4OWGA 3MT1A 3E0WA 1XPGA 1B31A 2KFWA 1XD0A 4HNNA 1FKHA 1VD6A 4WCJA 2ZTJA 4DHGA 1J9YA 4ZE4A 1NIUA 3TOYA 8XIAA 1FXQA 3FXGA 4ZXLA 4MUPA 4JDBA 3THAA 2LKNA 3WMBA 2A3AA 1LL6A 2WJZA 1YE4A 1T8QA 4R53A 2AL2B 2E9LA 3MWAA 3F7JA 3UERA 4O2TA 4YTSA 1X6NA 3MYPA 5K9XA 3AMCA 3UQIA 3N2BA 1TTPA 3APTA 4U5IA 3T2PA 3RJXA 3TJXA 4OOUA 2HS8A 3TC7A 4JFJA 4ALDA 3GHRA 3PWAA 3O5KA 2J7GA 1UD8A 1W3IA 3ZJ8A 3OOBA 3FAXA 1KCXA 3UR8A 3HG4A 1HUVA 3VM7A 5HATA 1FKIA 4J4NA 5HWBA 4ZO7A 4IPPA 2XP3A 5HW6A 4XQ6A 1XIMA 4POCA 1NDVA 1UD2A 1W9BM 1DL3A 2PZ0A 2PWEA 2CKSA 2LLEA 3NDZA 3QYQA 5LIXX 2YYTA 3LN3A 3DFYA 5HINA 1XUZA 4OVXA 4Z2GA 5IFTA 2G4FA 5FESA 5BU9A 3VNZA 4NU7A 1I75A 3UF8A 1Z7AA 3KZSA 3A23A 3LCIA 4HD5A 2V81A 4GI9A 1HTIA 2BWGA 1JCYA 1BXNA 5LNVA 4KEVA 2F9RA 4YMZA 2FAPA 1AZ1A 3WEZA 1NMVA 4WKHA 1I8JA 2DSVA 4PUEA 1KLZA 3IJLA 2RHGA 1G7VA 1RBOB 1CXIA 3TN3A