1LQ0A

Crystal structure of human chitotriosidase at 2.2 angstrom resolution
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
365
structure length
365
Chain Sequence
b'AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITOTRIOSIDASE
publication title Structure of human chitotriosidase. Implications for specific inhibitor design and function of mammalian chitinase-like lectins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 126
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1lq0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1lq0A01
3II1A 1HN1A 1ZBKA 1WZKA 2BS9A 3WELA 4BQ2A 1CNVA 4UFHA 3W37A 3K4AA 3SUSA 2BNJA 3K46A 3AIRA 4P8XA 3WL0A 5A6SA 2J7FA 1AQHA 1EDGA 2FHFA 2XPKA 3RO8A 3ZIZA 5I2UA 1E56A 4NRRA 1W3LA 1BQCA 2A3CA 3KL3A 3PN8A 3GTNA 3ARSA 3MSDA 3HN3A 1HJWA 4M24A 3OB8A 3CUHA 2CCRA 2OYKA 2QMKA 3AI0A 1I1WA 4TOQA 3CUJA 4FK9A 2XJ7A 3PZVA 4KMQA 5A2AA 5CZKA 5ABHA 1B1YA 2DPEA 3WBEA 3NSNA 3G6LA 1EHNA 1B90A 4HU8A 4H2CA 5JIWA 2F2HA 2YOCA 4TX6A 5A6BD 3BAIA 3POHA 1B2YA 2OLHA 1DWHM 3WQ8A 1LG1A 3SCTA 2XVGA 3EMCA 1EDQA 1GHRA 3ZOAA 3UCQA 3DC0A 1W1TA 2XVNA 4AD2A 4KRTA 4XZBA 1G01A 2BFGA 2BV9A 5I0DA 1NWSA 5M17A 5CPQA 1PX4A 1W9XA 8A3HA 4CU7A 3GXMA 2QHAA 4EKJA 2WHJA 2CXGA 1B3XA 2A3BA 4QFUA 2RGMA 1WB0A 4K68A 3TTSA 1KFWA 4J3VA 4X0NA 5GNYA 4ATWA 1NH6A 1V0MA 4CVWA 4GPNA 1CLXA 2VR4A 2O92A 3SUTA 2VC9A 4XX6A 3VUPA 3WNKA 3SCPA 1EHAA 2VRKA 4FLQA 4UFJA 1GOOA 4UFIA 1OD8A 1QNRA 3ZSSA 1QNQA 2EPOA 7CGTA 1CECA 4CN6A 1GCYA 2J78A 4D6JA 2J7EA 4W7VA 1CENA 1B3VA 4HU0A 2WVTA 1DWFM 4IPLA 3VO0A 2X1IA 5I79A 4RE4A 5I6SA 1ZJBA 1UWTA 1G9HA 1M7XA 4DUXA 1GZJA 4GI9A 1C91A 2W4XA 1CEOA 4MPKA 5D9OA 3N9KA 3OLGA 3QR3A 5EBAA 2VMFA 1H49A 3BAYA 3CHCA 2VQUA 2VRJA 2ZE0A 4QAWA 1H2JA 5E6YA 1QHOA 2D3LA 1XH0A 2WK2A 4U3AA 1OT2A 2GK1B 2J4GA 4P7QA 2ZX7A 3BGAA 1DWJM 2YA0A 5BROA 1JZ7A 2V5DA 4PMQA 5FKYA 2YIHA 1UR2A 3BCDA 1WZLA 3KWXA 2PBGA 2OYMA 1Q6CA 1XGZA 2XM1A 1NQ6A 3BXWA 5EFFA 1QBBA 3L4TA 2UY3A 1PX8A 2PWDA 3CUFA 5KZ6A 4UQEA 3WFLA 4PYSA 1J01A 5IFTA 5AY7A 4J7RA 1E4MM 4LQ1A 5FOOA 3VDBA 2DSKA 1C3FA 2CYGA 4YN5A 5I23A 4JKMA 1EA9C 4ML4A 4YHEA 4J3XA 1C92A 2E3ZA 2J79A 2UY2A 2CBUA 3BAWA 3VD9A 3HJEA 5F7UA 4IUGA 1DWAM 4JFVA 2YDSA 1GQJA 3WN6A 4D6IA 4URIA 1JDCA 1WO2A 5D9PA 3UR7A 4DWSC 1EO5A 3WQVA 3PBGA 3CZKA 3UG3A 4GZIA 1HKKA 3WF0A 2Y8VA 5IHSA 2W5FA 3M07A 4B3KA 1UZ4A 4HZ7A 3EDKA 2ZWYA 2FH6A 4DM1A 4P8WA 6TAAA 2BVDA 2QMJA 5CQ1A 1VBUA 2D3NA 3L4XA 3VM5A 1V3KA 1ZL1A 2PWEA 2WKGA 1HKMA 1C8XA 2Z1SA 2GFTA 3ZMRA 2WBGA 4PTVA 1V3LA 1HXJA 1LLOA 1C8QA 1E72M 1V08A 2XM2A 3TONA 3AXIA 4W85A 4EANA 1JI2A 3VGEA 3W26A 3WNOA 2J47A 1UD2A 4W84A 4QLJA 1KR1A 3FXYA 5FCZA 1MW2A 1LWJA 4W89A 2WWCA 4W88A 4AD3A 1OGBA 2C0HA 3EMZA 4TXEA 4U2YA 4Q7NA 5CGMA 5M5DA 3ZM8A 4J3SA 1D7FA 5HNNA 3W25A 3OBAA 3PZQA 4D1IA 1EOKA 5JUVA 3AYRA 4QCFA 1UA3A 3NYDA 3AIQA 3ARQA 5A95A 3FW6A 1V3MA 3GM8A 2WVVA 2B31A 1KWGA 3AIBA 5BYWA 3ZJ8A 2AOSA 4W8LA 3ZJ7A 4U2ZA 5CLTA 5IDIA 3AMCA 2EEXA 1A47A 1JD7A 1HL9A 1EGZA 3MV01 2VNCA 1W2PA 4JZ5A 1XHGA 1J18A 3GXIA 4AZHA 2VUYA 1K9FA 5A6JA 3QOKA 3PZIA 2JFEX 2UY5A 4JFWA 3WY1A 4B9YA 1W1PA 3AS0A 2DSVA 4DWSB 1WPCA 4C7DA 1J0YA 3GH4A 1VRXA 2YL5A 1C90A 1H3GA 1WP6A 3MKKA 1A3HA 1N82A 1E70M 1SMDA 3UERA 4OBSA 1KGUA 4Y7EA 1RD6A 1JZ4A 2Z1KA 4DM2A 3ZSTA 1LL7A 3ALGA 1VFOA 1E5JA 3RILA 4QDMA 3TA9A 1JFHA 3PZNA 4CCCA 4PN2A 2ZXBA 4UQBA 4WLCA 1VBRA 2XUCA 3A4AA 4BZYA 1XV8A 3AHYA 5EB8A 3AOFA 4UQ9A 1CPUA 2DT2A 2DSWA 2DDXA 2WVVB 5CPSA 4AD1A 1E6SM 4BA0A 1B31A 2CKSA 2VX7A 3WDHA 1V02E 3M6DA 3MMWA 4AZCA 1MFUA 1PBGA 3KEHA 3WD4A 1C7TA 1UR4A 3WMBA 3OGVA 2Y4SA 3ZJKA 3ZT7A 1ITCA 2J7GA 2HVMA 3CBWA 4AYSA 4AIOA 2CETA 4AZGA 3CZJA 5FL1A 4HA1A 3SCOA 5A6MA 1GOQA 1FH7A 2WSKA 4FLOA 1JFXA 3POCA 1V0LA 3BAJA 1GPFA 3G6MA 1OCQA 4JCLA 4YHGA 2NT1A 5BRQA 4UCFA 3ZR6A 4D1JA 3QGVA 1OIMA 4BCEA 3ARVA 3T2OA 3VD4A 4NZCA 2VX5A 3THDA 3MANA 1TCMA 2OSXA 4V28A 2YA2A 4F79A 2DH3A 3VGHA 1DTUA 1WDQA 4ATDA 1UH4A 2WC4A 1UWUA 2XIBA 2OWCA 1JZ2A 1CXLA 5CPTA 1KWKA 1K9TA 3BSHA 2WMHA 1R85A 2EPLX 1S46A 4IPNB 3WDPP 1XRVA 1SMAA 1BGAA 5LA0A 5JH8A 1E6ZA 4CU8A 3WEOA 1ZB5A 2HISA 5E70A 2V3GA 5A8PA 2WCSA 3ZJ6A 1EOMA 1NARA 2E8YA 3CTTA 4N42A 2WLYA 2WVSA 3SCNA 3M46A 1CGYA 2O9RA 2D0GA 1NP2A 4W5ZA 1UD5A 5E09A 2W91A 3WEMA 3UR8A 1G5AA 3DYOA 1BYBA 1DP0A 2EO7A 3SIMA 5HXMA 1MW0A 1EDTA 1EIBA 1YHTA 2DH2A 3FAWA 4HTYA 3OLDA 2A3EA 4ACZA 1MW1A 1VIWA 3SCWA 2W66A 3NUKA 1D2KA 3F5JA 1E6RA 2XVLA 3J7HA 2F8QA 4MB5A 3GYCA 3ARUA 3BCFA 3CHDA 1Z32X 2YL8A 1QI4A 3GXFA 5HOSA 1Q4NX 3UESA 4UOJA 1Q6FA 1BHGA 3NDYA 1V6UA 4AIEA 2XYLA 1MW3A 4CGTA 2F61A 3MS8A 1JIBA 4KRUA 4UFKA 4WF7A 3S6TA 1JG9A 4OBRA 4ATLA 1GVIA 5JBEA 1FA2A 3IAQA 3VVGA 4KWUA 5BXRA 5A6KA 5CGTA 3T08A 1X6LA 2BY0A 5DEZA 3GH5A 3T0BA 1CXFA 5I78A 3EBVA 3A47A 1JDAA 4GXPA 4Q22A 2JIEA 1M04A 2RGLA 2GUYA 1J0JA 2EQDA 1OIFA 4ZXOA 4LYPA 1KGXA 2VX6A 4UNIA 3L4WA 1KQYA 3VIKA 4ACZB 4D6EA 1H11A 3ARYA 1SYTA 1IZKA 3VOCA 2VO5A 3AXHA 3CIVA 1EXPA 4M82A 2BY3A 1K9EA 4OUEA 3N17A 4XV0A 3PHAA 3D5HA 1HL8A 4GO8A 2JALA 4PTXA 3OA5A 5E6ZA 3SCVA 2UY4A 2D1ZA 3K8KA 1CGXA 3HMCA 2E40A 1MQRA 2CITA 1R87A 1UKTA 2BXZA 2NT0A 1W9VA 1PJ9A 1R8LA 2O9OA 3PZUA 2VURA 1E40A 4W7UA 1UWIA 2D20A 5A2BA 1ZBWA 4MAZA 1UG6A 2CKRA 5ABFA 3NJ3A 3W27A 4B15A 4W7WA 4PMUA 2WWDA 3U7BA 2D24A 5A3HA 1HP5A 1BVZA 3IANA 2PC8A 4JCMA 4C7GA 4MB4A 4UQAA 3ZT5A 1WDRA 1WAWA 4P7NA 1OT1A 4GZJA 1MQQA 2DIEA 4H7VA 5IFPA 4UFMA 2XSAA 4AXNA 3M7SA 3GDBA 2VCBA 3W29A 4AEEA 1E3ZA 3WD0A 5GQBA 1TVNA 3VIPA 2TAAA 1H5VA 3I3EA 2J25A 1M53A 1BGGA 5BRPA 4MAVA 1E71M 4UFLA 4OKDA 3T09A 1CGUA 4JKKA 2EPNA 1VEOA 2XGBA 1AMYA 2X09A 2VOTA 1CDGA 4Z2KA 3PTKA 4W8BA 4D6GA 5M03A 5A94A 1O6IA 3MUIA 4MJ4A 4AMCA 1XD0A 1Y7VA 3B9DA 1FHLA 3TTOA 4XUYA 3AJ7A 4H8VA 2WNWA 1EO7A 2V3FA 1LJYA 5I24A 3ZT6A 2GJRA 1KXQA 5HBFA 1QHZA 2C7FA 4W8AA 3THCA 1GHSA 4DWSD 3WKZA 1BTCA 3RPMA 4LYRA 1HKJA 5BWFA 3IJ9A 2YBUA 3SURA 5C71A 4E2OA 4M8UA 3VIIA 4ZENA 3WUGA 1DWGM 4CN4A 1E1FA 4M81A 2JE8A 3WQ4A 4HPHA 1OWQA 4JL1A 3CLWA 4MJ2A 5GNZA 1JZ5A 4MDOA 2QLYA 5A6BA 2W61A 1NOFA 4MB3A 3AMGA 3U5YA 2VR5A 3GXDA 3MV11 1V6VA 3W0KA 1ISYA 4M1RA 1TMQA 3VIGA 1VFMA 1ITXA 3CHEA 4YPJA 4BS0A 1JDDA 4PMDA 2J75A 1BPLB 1GJWA 3TTYA 1XH1A 3MU7A 8CGTA 5LA2A 2EPKX 4QCEA 2VZSA 5GPRA 2ZXAA 2VZOA 3VIMA 1OBAA 1PPIA 2YJQA 2WCAA 3ARXA 1UD6A 1US2A 3T0DA 4M29A 2G3NA 1V6YA 4AW7A 1QPKA 3CH9A 1JF5A 2XGIA 3GBEA 4PMVA 2X0YA 2CPUA 1H0IA 2VZUA 1KQZA 4FF5A 2O9PA 1C8YA 4E8DA 1LF1A 3K8MA 6CGTA 3AHVA 4UZSA 3N13A 3NDZA 4FLRA 4HOXA 1P6WA 4AZIA 4HA4A 1DHKA 5LA1A 1E1EA 3ARRA 1XSKA 3TP4A 4XZWA 3PZTA 1GONA 1BG9A 4OZOA 5BXPA 3WNMA 2WC7A 2GDVA 1CXKA 1TE1A 4HZ6A 1V6WA 5D8ZA 4ZE4A 4AD4A 3AIEA 1VFFA 4JAWA 2JF7A 5LYRA 1E6PA 1V3HA 2J62A 4D6FA 1NP0A 1JD9A 5DO8A 1QNSA 1EH9A 1OGSA 3WSUA 3ZR5A 3IJ8A 7A3HA 5A69A 4JHOA 3DECA 5A6LA 2D22A 3UEQA 1R7OA 1W1YA 1M03A 3WD1A 2WW5A 4H04A 1XSIA 1JXJA 3PTQA 4OIFA 1WE5A 4TTGA 4GI8A 2WSPA 1HJXA 2CNCA 1QI2A 1Q6EA 4MNLA 3QHOA 3WEZA 5ABEA 1WKYA 2WZHA 3L2MA 2J77A 3WF3A 3U7VA 2VCCA 4XB3A 1MXGA 1CWYA 3RMEA 5D9NA 5BXSA 1TUXA 2IUZA 2VI0A 2EJ1A 1JNDA 1UYQA 3FY1A 1CGTA 2J8GA 2XG9A 1Q6DA 2YKKA 1X6NA 4X0VA 2ZUTA 1EQPA 1V0NA 5CLWA 2VZVA 3OLEA 4P7RA 2ZICA 2V5CA 2ZUUA 3W28A 3FNDA 1I1XA 4RL3A 2OWWA 5AYIA 2WXDM 2XIIA 4WKHA 3VILA 1LL4A 4P7OA 4F66A 3T2PA 1HJQA 2DSUA 2FGLA 2YDQA 3DYPA 3VIJA 4U5IA 1J0HA 1V02A 2G8ZA 4PRWA 1B3WA 1QW8A 3VGGA 3VDAA 1OGGA 3CGTA 4LPCA 4UOQA 3IK2A 4LX4A 3AMLA 5JBDA 2CBJA 3RM4A 3VGFA 4E8CA 4UOZA 2E8ZA 3VDHA 3AQUA 1W32A 2DIJA 1E6NA 2X05A 3PZGA 3VGDA 4LGXA 1KGWA 2EBNA 3WQ5A 3VU2A 1UKSA 1FP8A 1QVBA 3S2CA 3W24A 1BSIA 2PB1A 1GVYA 1W9DM 2WHLA 3BAKA 5JIPA 1B0IA 2JEQA 2JEPA 1J0ZA 1HJSA 1W3JA 4HA3A 4PTWA 1UR8A 3W6MA 1E3XA 1OM0A 2MANA 3IAPA 3WUFA 3ARWA 4IM4A 3OIHA 1FH9A 2YLLA 1W2VA 1CTNA 3L2LA 1JI1A 1WCGA 1V03A 5EFDA 4GQQA 1JNEA 2DGAA 5BXTA 5I77A 4PMZA 3IJ7A 4P8VA 3VNZA 3ARZA 2CBVA 3WBAA 4F8XA 4WSJA 5D4YA 1QI5A 4UR9A 1UH3A 3NSXA 5JBFA 2FDMA 1F4HA 1TG7A 1KBBA 1UWSA 3W53A 1US3A 4QP0A 3DHUA 2NW0A 3VDCA 9CGTA 3CZGA 3LPPA 1KXHA 4JFSA 4DUWA 1H1NA 3MUAA 1LQ0A 3DHPA 4MB1A 4QLKA 4U31A 3NSMA 1UR1A 4Z2HA 1U30A 4GO9A 3WQ6A 1HNYA 4AZCB 4HMDA 3KL0A 2ZUMA 3EMQA 3WF4A 4CCDA 4HMEA 1JGIA 2CHNA 1AQMA 1MQPA 2VT0A 5IHRA 2CHOA 3UETA 3WFZA 3AS3A 1JYVA 3OG2A 5ECUA 4AZ7A 3AS1A 4S3KA 4EAMA 3AIWA 5DT7A 5AC4A 1E0WA 5AC5A 1ODUA 5FD0A 1D3CA 4Z2JA 4N0RA 4UQCA 1ZU8A 2XHYA 3LMYA 1E6QM 3U5UA 3ECQA 1MVYA 1QI3A 2WZEA 3N11A 4D6CA 1MXDA 2YL9A 5DT5A 4A3HA 4C7FA 1E43A 5HPCA 1HVQA 1UD4A 4GINA 1UWRA 1IV8A 4J3WA 3W4RA 2G4FA 3GH7A 3BAXA 1JXKA 2JIWA 3VX0A 3KZSA 4MNJA 3K1DA 3VPLA 3AICA 3PZMA 4KGLA 3MUZ1 4PBGA 2CESA 3BSGA 3PZ9A 4A4AA 3RM9A 2WM0A 4H8HA 3FN9A 1UKOA 2ZX8A 2W63A 2WC3A 4EE9A 2XFRA 2EPMX 5E0CA 5E0FA 1KB3A 1K9DA 2DEPA 4R27A 1ESWA 2D23A 5CXPA 4H8UA 2DT0A 2FGZA 1J10A 2DQXA 2AAAA 3CHFA 3VMOA 4BF7A 2VVNA 1HP4A 2A3HA 2IXUA 4RE3A 1E0XA 3AYSA 4GQRA 1V6XA 2G3IA 3BC9A 1VEPA 1J0KA 4JIEA 4D6HA 1ISVA 4IISA 4X9YA 4U5KA 4CD4A 3SUUA 3WF2A 4GIAA 3RIKA 1H4PA 2ZUSA 2VQTA 4A3YA 3WDQA 1I75A 4PCTA 2WMIA 1O7AA 2WKLA 2J74A 3KE0A 4B3LA 3FHAA 3QHNA 3WDRA 1CXIA 3VTRA 5IXEA 1VJSA 4MNKA 3CPUA 3I3DA 3K4DA 1G1YA 1PAMA 3A3HA 4L4OA 4JL2A 4F9JA 1AVAA 1C7SA 2Y2WA 3BMVA 3N18A 3O9NA 1HVXA 1CXEA 3WQWA 1JZ8A 3VM7A 4DUVA 4S3JA 1TR1A 3CZ8A 2CEQA 3WH7A 3LPOA 3VKKA 1E15A 3BMWA 2WANA 5A6AA 5AYBA 2WAGA 4OOUA 1JYWA 4QLLA 4AWEA 3T0AA 2XSBA 1AQ0A 4KH2A 4CD8A 2VRQA 4PUEA 3GNPA 3TTQA 1PEZA 2VX4A 4AD0A 2V3DA 1IZJA 4AZ6A 4OJYA 1RPKA 3B8SA 3F5KA 2WMIB 1UA7A 5E9AA 2AMGA 3NCOA 2D0HA 1FFRA 7TAAA 1JL8A 3RJYA 2ZX5A 4PSPA 3OGSA 4ZEPA 1HF6A 3ARTA 1GOMA 3CUIA 2PWHA 5DF0A 2GK1A 4PMNA 1VAHA 2GJPA 1BG4A 3AHZA 3A6OA 1QW9A 1LWHA 1FFQA 2Y24A 1KXVA 3OGRA 1WDPA 3T2QA 4H41A 1HT6A 3AS2A 2O9TA 2G41A 3WD2A 3VD3A 1FHDA 4HOWA 3E1F1 1F4AA 2XVPA 4PMYA 3EYPA 2BHYA 3WH5A 1V3JA 3CO4A 3SCRA 4CD6A 3LPFA 5ABFB 1LG2A 1B3ZA 1WZMA 1GUVA 1YQ2A 5C70A 5DFAA 2BHUA 4HPGA 2OSWA 1IT0A 1NWRA 1M01A 2WHMA 2G3JA 3ZQ9A 3GBDA 4HZ8A 2WB5A 3RM8A 1KXTA 2BXYA 3WDIA 5A1AA 1XSJA 2E9BA 3MMUA 5CSUA 3GZAA 5A8NA 3O2LA 1ISWA 1TA3A 3WUEA 4Z2IA 1ZBVA 4PSRA 2EXOA 3O6AA 4PTMA 3VD7A 3WD3A 1W9PA 4W87A 2BY2A 5A8MA 1GQLA 2IXVA 2OWXA 1ZJAA 4J28A 4HMCA 2Y5EA 4UQDA 2W62A 2ZUVA 3NIYA 2FHBA 2DT1A 1B3YA 1JYNA 4JHZA 4JFTA 4GI6A 4L4PA 2C8NA 4PUDA 1ISZA 3AIUA 4CVUA 1J9YA 3AIVA 1H0GA 3AISA 4TTUA 1OINA 3UG5A 3VINA 3N15A 4AZ5A 4CU6A 2XWDA 3FHQA 4BQ4A 2X0HA 1BF2A 4MADA 1V0KA 3AHTA 3GNOA 3WUBA 2GJXA 3VNYA 3VIHA 1UQZA 3AXXA 1GQKA 2ZWZA 1W91A 1LL6A 1XCWA 1RP8A 1NWUA 4GKLA 4FMVA 4WSKA 1RH9A 4CKQA 4PMRA 4J3TA 2E9MA 3MSGA 2BVYA 4P7LA 4CD5A 4PMOA 1OB0A 4GZEA 3GNRA 4NSBA 1TA3B 3ALFA 3N12A 5FL0A 4J27A 3I3BA 3MMDA 1GW1A 1G94A 2J7DA 4ZXLA 3TOPA 5CSYA 2V3EA 1CBGA 1UUQA 2YBTA 1E4NA 1PIGA 2E9LA 3HU7A 1E5NA 4PEEA 3WENA 3QOMA 3BLKA 1R7AA 5TD4A 1ZBCA 3K8LA 5CJ5A 4JFUA 2A3AA 3SCSA 1E73M 4PMXA 2DT3A 1UOKA 2WMKA 3WDJA 3WMSA 1CGWA 2D2OA 4BQ5A 1E9LA 1EQCA 6A3HA 1PZ2A 1J12A 4OOZA 1UR9A 2D0FA 4EK7A 3VMNA 1HKIA 2GJXB 2GDUA 3EDFA 4Z2GA 3AZSA 2WCGA 5A2CA 1GORA 1FOBA 2J7BA 3BH4A 2VVSA 5HDRA 1UHVA 4DWSA 4CD7A 1TVPA 1DEDA 1GQIA 1U2YA 2PI6A 4J3UA 2XFYA 2ESCA 1NWTA 1GOKA 1J0IA 5HPOA 5A8OA 1JF6A 2GSJA 2WHKA 2BVTA 3WF1A 2VL4A 3OZPA 4MNMA 1J11A 1W3HA 3WL1A 1OD0A 1G0CA 4M56A 1R86A 2X2YA 5I3DA 3F4VA 3SCQA 5D9MA 4AISA 1VENA 4WJXA 4TVDA 3A4XA 1PIFA 1B30A 4AEFA 1MWOA 2ZXDA 4WKFA 1BAGA 2QPUA 3W38A 4NF7A 1HJUA 1RP9A 4ACYA 3RDKA 4CCEA 1XYFA 4W93A 3VX1A 2OSYA 2V38A 1NOWA 1OSEA 1WNOA 1XYZA 4M80A 4JKLA 2GVYA 1GOWA 4ZE5A 1CXHA 1CGVA 1CLVA 2BY1A 3VIOA 3AZRA 4UZUA 3AFBA 1BYCA 4TX8A 2NSXA 3VMPA 2WMJA 3ARPA 3W6LA 3OLIA 1UR0A 2UWFA 3JUGA 1JZ6A 3KL5A 4B9ZA 1SFSA 2ZIDA 3CUGA 3RJXA 3AROA 1K6AA 2ZUWA 3ZO9A 1BLIA 2ZOXA 4WKAA 2CBIA 1E6XM 2J7CA 2PF0A 3CZEA 2E0PA 1E4IA 3WNNA 2E4TA 1UQYA 1E4LA 3QHMA 2WPGA 1HJVA 3SEPA 4E4PA 4LYQA 4CN1A 2W92A 4ZFMA 2YLAA 1ECEA 1W9BM 2VJXA 1UD8A 2X8RA 1BVNP 3FAXA 1B9ZA 1UZ1A 2ZUNA 4WIWA 1QOXA 1E0VA 4RE2A 3WNPA 4KGJA 1HX0A 4U3CA 1MYRA 1TZ7A 4BQ3A 1Q6GA 1GOIA 1WZAA 5EMYA 3VD5A 1JYXA 2QF8A 4B16A 4HOZA 3EDJA 5M3WA 1XD1A 4AD5A 2FHCA 4PCSA 1ODZA 2ZX6A 1E55A 1XCXA 1HIZA 3WH9A 4W5UA 1BYAA 3DYMA 4FLSA 2VCAA 1QNPA 4TVCA 3APGA 2WVUA 1X1NA 3PZOA 4AIUA 3EDDA 5GNXA 1PX3A 1GNXA 2BHZA 2G3MA 1UKPA 4MTVA 1UH2A 2XTKA 3AMKA 1VJZA 2WMFA 3A4WA 3L4UA 2WMGA 1XH2A 1JAKA 4AZBA 4NRSA 1WDSA 5I5RA 1KCLA 3UG4A 4R5EA 2ZX9A 5FIPA 2OYLA 1VEMA 4V27A 1QHPA 3VIFA 1UD3A 2YL6A 3L4YA 1QNOA 4HP5A 1BYDA 3OZOA 3AZTA 3W82A 3L4VA 3MO4A 1L8NA 1VF8A 1KCKA 2J8FA 4LXFA 3AHXA 3CMGA 1TFVA 2XFFA 4TVUA 2WBKA 1PZ3A 1H09A 3WMCA 2Q8XA 1FH8A 1KR0A 1CZ1A 3EDEA 2WYSA 3B9AA 1QI0A 3WH6A 3D3AA 1U33A 4CUCA 4NI3A 1GJUA 4D72A 2ZXQA 5C8BB 3MUY1 2CIPA 1KBKA 5ABGA 2DSZA 2QPSA 4W86A 3CMJA 2JF6A 1ZS2A 5D8WA 3VGBA 3BLPX 5DMYA 1DWIM 3AMDA 1C93A 1JZ3A 4P8UA 1W1VA 5BCAA 1BFNA 4D6DA 1NOUA 1CYGA 2J7HA 4U33A 1H41A 1JAEA 5KEZA 4V2XA 1FP9A 2QV4A 2WLZA 2PBOA 3F5LA 3SUVA 4UTFA 1MFVA 1L0PA 4AC1X 2XVKA 4Z2LA 3SCUA 4WK9A 2Y8KA 2XWEA 3N04A 2FH8A 1W9UA 2VZTA 1CIUA 1VFUA 2W67A 3B9EA 3PTMA 3WNLA 3RCNA 3L4ZA 4F9DA 3CZLA 4D71A 1QBAA 1SR0A 2CERA 1VB9A 4AY1A 2PWGA 4TUFA 3WIJA 1W3KA 2YDRA 2WZIA 1XC6A 3N1AA 1ISXA 3U57A 1UKQA 3LPGA 2PWFA 4MDPA 3SUWA 3WH8A 1NM9A 1UWQA 5A8QA 1V3IA 3W81A 2YA1A 2VTFA 5CG0A
chains in the Genus database with same CATH superfamily
1ZBKA 2BS9A 1VH7A 4I8YA 5EMKA 1EZWA 3U4AA 4QJ3B 2PGFA 4DRJA 3HIJA 3EB2A 1EDGA 2FHFA 2XPKA 3RO8A 2O4QA 3V3WA 2BGQA 3JZEA 1XIHA 3S3GA 3LMZA 3IACA 1XXXA 3WK2A 1PB0A 5LXXA 3GTNA 3CGNA 2IPJA 3GVRA 3W7HA 4PR4A 3CUHA 5DQPA 2QMKA 3AI0A 3FJNA 4TOQA 2XISA 5HWJA 3NTYA 1E0UA 1SZEA 3QGAC 6REQB 4NNAA 3P67A 1EHNA 1B90A 3KOWA 5D02A 2R14A 5FA5A 4TX6A 1PTAA 3POHA 4PL2A 3NZ1A 2QDHA 2OLHA 3CV7A 3TW6A 4K38A 1S3HA 2J6VA 3WQ8A 1LG1A 4IJBA 2KO7A 1EDQA 4DRPA 5DMLA 3CPGA 3W86A 4AD2A 3PBVA 4KRTA 1P6BA 3CGMA 4UTMA 4B2DD 2BV9A 1NWSA 1I0BA 4EKJA 2VFFA 3TW9A 4QFUA 2QJHA 1DXFA 3UWUA 2IQTA 4ATWA 1DIKA 1V0MA 2PURA 1KFCA 3LRKA 1CLXA 3O5KA 3S6OA 4DLFA 4QG8A 4H7ZA 3ABZA 3VUPA 4U86A 2J6XA 2RFGA 3W1MA 1QWGA 3NGFA 4UFIA 1JGMA 1TSIA 1TPDA 4FXJA 1QNQA 2QUNA 2BGSA 4Y2WA 2K8IA 3OJGA 3VKAA 4D6JA 4DO4A 1W5NA 3KOZA 5E93A 1B3VA 4XIAA 4B4HA 1KRMA 3DDMA 1TO3A 1NDWA 3FS2A 5I79A 4PH6A 4AX6A 2QCNA 3R0DA 4XIMA 1ZJBA 1UWTA 2ZVIA 3M0MA 4ROQA 1G9HA 1M7XA 1QWKA 4DUXA 2Y7FA 1IIGA 4DRKA 1WBJA 4AY7A 1FXQA 5D9OA 3PWAA 3N9KA 3TAOA 3MTWA 1XJBA 3BAYA 4KIRA 4KPLA 2VQUA 1QHOA 3GR7A 1JCJA 1Y0EA 2J4GA 3C5QA 3B8WA 2ZX7A 4P7QA 1DWJM 2C13A 3UZXA 2EKGA 4WGHA 3E2SA 4G1NA 3B05A 3FJLA 2BDQA 3WZ0E 3LD5A 4GOAA 4IOTA 3L4TA 1LTDA 1IIHA 2IKIA 1D8CA 2PWDA 3R13A 1FKBA 3WFLA 4Q4RA 1J01A 4IMGA 5IFTA 2GWGA 1TR9A 5FF4A 2PU0A 1KW1A 3FA5A 4DZ3A 2BTMA 5D05A 4R7JA 4JKMA 4ADUA 3M6YA 1FDJA 1Z41A 5C7VA 1C92A 5E0KA 2J79A 4DXKA 5F7UA 1DWAM 2YDSA 4URIA 1WO2A 5D9PA 3UR7A 4RPQA 4WDUA 3P60A 4J4NA 2QJIA 2AL1A 3WQVA 4ZB2A 3HPXA 3BW3A 1HKKA 2Y8VA 1IXQA 3M07A 3OYXA 4P5UA 1UZ4A 3OQ8A 1EJRC 1VCFA 4MM1A 3KVLA 4C6CA 2ZQTA 5EU9A 2OVLA 1AJZA 1VBUA 4IX0A 2D3NA 1V3KA 1ZL1A 2ALDA 4DEFA 2ZFAA 2OT0A 4AWSA 3ZMRA 3NM3A 1N1AA 4PUJA 1V08A 1U1HA 3AXIA 1QOPA 4P2VA 1JI2A 1TWDA 3W26A 1VC4A 5CPNA 2Z1BA 3HPAA 3KAGA 1XCFA 3QV8A 3LTPA 3KACA 3GVWA 5F4XA 3TUUA 2QCEA 1ZCNA 4W88A 4MPQA 4TXEA 3L66A 5CGMA 4R85A 5M5DA 1HW6A 4EPKA 4JXCA 1P0KA 4WDWA 3OBAA 1G4TA 4I5RA 1EOKA 3WLRA 1JPDX 2Z2AA 4HT3A 3NYDA 5I3HA 4JYFA 1V5XA 4Y96A 1F3WA 4QQUA 4W9TA 1POKA 2WVVA 3RCYA 1KWGA 3AIBA 2OX1A 1ME7A 2A7NA 1J8VA 1Z69A 1ROTA 2JZVA 1BWVA 1JD7A 5FEPA 4IL0A 2OMAA 1W2PA 3GHSA 1VLWA 4JZ5A 1PKMA 2CWXA 3SQLA 1K9FA 3S1VA 3PZIA 1LUCA 2DSVA 3IIOA 1WPCA 1Y5WA 1SJAA 4LY4A 1H3GA 5JQ9A 2EG8A 3UZ5A 3UERA 4Y7EA 2Z1KA 2X1SA 2A1YA 3TYCA 3W1UA 3K30A 5AC7A 3RLUA 3N6HA 5C5YA 3G24A 3GNXA 3CWHA 4PN2A 1D6OA 2QAFA 3IGSA 4ZB5A 2YYTA 1XV8A 5EB8A 4UQ9A 1CPUA 1FHUA 4L4MA 1KT1A 2QS8A 4C5YA 3TU9A 4MUZA 2RUQA 3D3FA 3FA4A 2VX7A 4N9EA 1PBGA 3KEHA 4C6EA 2I5IA 1R9XA 1QZ2A 3WD4A 5CZTA 1UR4A 1ZALA 3WMBA 3QV7A 1DJHA 3NZRA 3DBPA 2FTPA 1ITCA 4Q8WA 2KFWA 4C1NB 3B0YA 3CBWA 4AIOA 4GA8A 4GK8A 4I9MA 1S2TA 1P1XA 3SCOA 1KLZA 5A6MA 4BWLC 5LSMA 1GOQA 1QT1A 2I14A 3FSTA 1GPFA 1OCQA 1QXLA 3GE7A 2D69A 5EGRA 4YS1A 4D1JA 1OIMA 3TEVA 4HPXA 3T2OA 4HNNA 4DRNA 1JCXA 3THDA 1REQB 4GACA 3B8IA 2YCLB 3GU2A 1LQAA 5G4WA 5AFDA 4ODNA 1RLCL 4K3ZA 4ZFCA 2C14A 4HN4A 2IW0A 3DENA 2OZTA 3TYBA 5D2WA 3P0WA 1KWKA 3SADA 4K7VA 3PFMA 4IXXA 2WMHA 3DBNA 2ADAA 3G3MA 3I4KA 4IPNB 3N2XA 4GZ7A 5JH8A 3WEOA 2HISA 3M9YA 5AYZA 5D32A 4PB3A 1EOMA 3OBEA 1NARA 1UUOA 2WVSA 1AMKA 3M46A 2O9RA 4DZHA 3RR1A 1NFGA 5IDZA 3PJTA 4ZOEA 3E2VA 1VKFA 3UWVA 3KVMA 3KVJA 1BYBA 4O52A 3DKLA 1F6PA 4R0XA 4UXDA 1EDTA 3TNOA 1SSDA 1MNSA 4ACZA 3NL3A 4IMAA 1E6RA 3J7HA 5FF2A 3ARUA 1EEPA 3APYA 4FOKA 3VXGA 4J35A 5XIMA 3R0UA 4ORMA 1XYBA 1Q4NX 1IXOA 4UOJA 1Q6FA 2QGYA 2GGJA 3NDYA 3DG7A 3P84A 3AO0A 4KCVA 1OCNA 3GFZA 3S6TA 2LLEA 3BLOA 2R94A 3KW3A 1GVIA 3D46A 3A21A 3SM0A 5K9DA 3LGGA 1FWIC 3UWEA 5FESA 1X6LA 2BY0A 5DEZA 2Z2BA 3R11A 4O17A 1CXFA 1U5VA 3BQ6A 3HM7A 1Y8BA 3EBVA 3ITCA 1KC7A 2NXIA 3P5ZA 1JUBA 2GUYA 2RGLA 5G4EA 1J0JA 1F9CA 4GBUA 1OIFA 4WSHA 4LYPA 4DHGA 3RYSA 3B8DA 3DXIA 4B92A 3NQ8A 3UWWA 2YXGA 3L4WA 1KQYA 4UNIA 4CQAA 3I65A 3O6YX 4AY8A 3P81A 1H11A 3KAOA 3VOCA 2LKNA 5F4WA 4QRNA 3F4CA 3NYZA 4M82A 1ZZMA 2A2IA 3D5HA 2OODA 2JALA 3PBWA 2FKEA 1A80A 4XO6A 5E6ZA 1P6CA 3UJRA 1LROA 1TMHA 2E40A 1R87A 3GDLA 4YIWA 3SFKA 1W9VA 2O9OA 3WQDA 1TWZA 3OG3A 1H1ZA 4YLWA 5A2BA 1BEUA 2QAPA 4WR3A 5JU6A 4IG2A 3EXTA 5FSDC 2CKRA 3I68A 1CLKA 4UBPC 3NJ3A 1L2UA 3ONBA 3SFWA 5LNWA 3R7MA 1HP5A 1BVZA 3IANA 4XZNX 4BEQA 2BASA 3KTXA 1JJKA 1WAWA 1WDRA 2B0MA 1OT1A 4GZJA 5DY2A 2DIEA 4KR0B 1J79A 3JRKA 2DZBA 1IR2A 3ZXWA 3TDFA 1A53A 3T9PA 2VGIA 4IMFA 3C8NA 3CJPA 1NIUA 3C52A 3QTGA 3KP0A 3VIPA 3S9IA 3TYAA 3W7LA 2V69A 5BRPA 4PGLA 4C6IA 5I3IA 1E71M 4UFLA 1TJ1A 4XD3A 4K8HA 1GEQA 4S3FA 4HSHA 1VEOA 4AEOA 3BJFA 5PTDA 2FZDA 2Q01A 3GIQA 1F8IA 3LM7A 3TLLA 3WLTA 2RJHA 3DI0A 3PJXA 4UNKA 1W1B1 1EO7A 1RBLA 2V3FA 3G8EA 4B5NA 4OT7A 3A3WA 4O13A 2GJRA 4CCZA 1SO6A 4K8EA 3M44A 1GHSA 3KTCA 4LYRA 5BWFA 3GO2A 3W1NA 4X61A 1LT8A 5U4NA 1EL3A 4E2OA 4M8UA 4GISA 3M0VA 1E1FA 2FJUB 1PWLA 5DBUA 4M81A 1Y5VA 4H3DA 3SRKA 4A2SA 2WZTA 2JE8A 3WQ4A 4UC5A 3G1HA 4MJ2A 3ES8A 4QE5A 4H9TA 2QUMA 4UMCA 4MIMA 5K7JA 3LERA 1RZMA 3U5YA 3V0TA 3MV11 1V6VA 2O0TA 4M1RA 5DITA 1OFBA 1S5MA 3I7RA 1ITXA 2PD5A 3CMFA 4ZOCA 1XQKA 4E8GA 4J3ZA 2J75A 1GJWA 2Z27A 2B5UB 4FOJA 7ENLA 2EPKX 3GPKA 1EJSC 7REQB 5KZDA 5F2IA 1DOSA 3CYJA 4NZ5A 3MP4A 2HJPA 3UA3A 1X97A 3EWYA 2J8TA 1XC4A 3N73A 4LCSA 4QGCA 3OVRA 4O10A 1GJPA 5T9CE 4QBXA 1RBAA 1PKYA 2J24A 3UY7A 2VZUA 3SSZA 4FB7A 3K8MA 5AHNA 3KVKA 3AHVA 4H00A 2TSYA 4JY8A 2XIJA 4HA4A 4GGBA 3ARRA 4ODLA 4WCJA 4GUFA 2VDGA 1YXYA 2ETNA 4Q4QA 3WNMA 1OX4A 4Z42C 3R5EA 3AIEA 2I5QA 4JAWA 2XPAA 3SGUA 1KNWA 3PUGA 2JF7A 5LYRA 2WJEA 3P6LA 1V3HA 1XG4A 2J62A 1NP0A 3IRSA 3C2EA 2OB3A 3WSUA 3ZR5A 2G5WA 2Y1HA 4JHOA 1JRCA 1TWWA 1BQGA 4UTJA 3BL3A 3OBKA 4QIBA 1HKVA 1AH3A 5LXEA 1XSIA 1JXJA 2AGTA 3PTQA 4ZO7A 3QC3A 4JTDA 2CNCA 1TTIA 3W85A 2Y8UA 1XRTA 3RCMA 3TAKA 4RE0A 2A7RA 2A3LA 3UWZA 2VCCA 1MXGA 2HRWA 1ZSXA 5D9NA 5BXSA 4LC6A 3S9ZA 2VI0A 4A8RA 3FY1A 3UG8A 1E51A 1NFBA 2G4JA 1WUEA 3WFAA 1O94A 3IPWA 4I8DA 1EJTC 3GHTA 5CLWA 3GY1A 3OLEA 1XM3A 3REQB 4P7RA 3KWSA 2PF8A 4E2VA 1I1XA 4RL3A 4JFJA 1LL4A 1E1CB 2C16A 3M0KA 2R1NA 4F66A 1TELA 1HJQA 3DYPA 2YDQA 1Q2SA 3VIJA 1XL9A 3UCDA 3W9ZA 3E9AA 3Q37A 1LOQA 1OGGA 2Z6JA 3IK2A 3ICJA 4JQ2A 3VDHA 2DG4A 4IQCA 5I98A 3AJXA 2DIJA 1GQNA 1E6NA 4LB4A 1LWIA 2E7FA 4LV4A 2EBNA 3G0UA 3VU2A 1UKSA 3P62A 1BSIA 5ABTA 2PB1A 1KCXA 1OCBA 2JEQA 4UMAA 1O5KA 3N2CA 4RKAA 4LY8A 1ONRA 6PTDA 2F84A 3W6MA 3TFXA 3EXRA 1O68A 4N6EA 4LS2A 3WUFA 5C0QA 1Q7ZA 3ARWA 4IM4A 3RRAA 1UIPA 3QM3A 3L2LA 5C2GA 1R3SA 5EFDA 3KCOA 3ABSA 3GIPA 3W2JA 3UXLA 3NQGA 1JVNA 3W7DA 2BB0A 3VNZA 1BRLB 4WSJA 3T1GA 5D4YA 1QI5A 2E1DA 1S2WA 5JBFA 2PDXA 1F4HA 1K03A 2OT1A 4GY0A 1VFTA 1A3XA 2QNEA 1US3A 1NSGA 1F6KA 3GRIA 1OF6A 4A29A 3CZGA 1KXHA 4HHHA 1EYMA 1H1NA 4I5XA 4YTQA 3THUA 3GG8A 1LQ0A 3F7JA 4Q8VA 4YWIA 3NSMA 2Z00A 3BCJA 5IM51 5CSSA 3UJFA 3C0QA 1UR1A 3G2GA 3WJZA 1VHCA 4MKSA 2Y70A 3IV3A 3GW0A 4HMDA 1YYAA 1DQXA 1YX1A 3EB3A 2ZUMA 3QY6A 3EMQA 5C55A 2QCDA 4AUBA 2QJMA 1KM3A 1JGIA 4HNLA 1SO5A 2VT0A 4KCTA 2CHOA 3PB0A 3P5YA 5BWAA 4KFNA 3AS3A 1UMLA 3GB6A 4N9DA 4BK9A 3PG9A 3OG2A 4AZ7A 3G1FA 3AS1A 4KW2A 5AC4A 2CZDA 4IGMA 4R9OA 3FVMA 3W6YA 4IQLA 4Z2JA 1D3CA 4JIRA 3N9SA 4QT3A 3TC3A 1YDYA 3LMYA 3PUOA 1MVYA 1MUWA 3W07A 4A3HA 3PNZA 2QXWA 4C7FA 1WX0A 1UD4A 1UWRA 4J3WA 1IV8A 2MUCA 4QAIA 4W9QA 1C9HA 1EYWA 3I7SA 4OGZA 4MNJA 2FFCA 2CESA 3BSGA 3PZ9A 5I7GA 2D2HA 1UKOA 2NQJA 2XFRA 4ITZA 3RN6A 2PPOA 5LNRA 5E0FA 3F2CA 1K7FA 1VZWA 2IPWA 1XLKA 4I6VA 1L8PA 2W27A 5XINA 4ZO9A 4I9JA 5T9BG 1I2PA 2YZ5A 2FGZA 5CZJA 3FKKA 2AAAA 4I9AA 1ALDA 4BF7A 3RITA 5D2TA 2FQIA 4JTCA 5AYXA 2XN0A 4QJ5B 4H6QA 3QMSA 4AMAA 3W83A 3KDNA 4BI5A 4PB5A 4JIEA 1ISVA 4S3EA 1IXNA 3TR2A 1Q6QA 4CD4A 1EPVA 2VM8A 3TFCA 4LAXA 2I17A 4UTKA 3EEGA 1PIIA 4A3YA 1I75A 2C71A 2A21A 5HATA 7TIMA 4B3LA 3O5RA 3FHAA 3WDRA 2J9YA 1CXIA 3VTRA 5IXEA 1VJSA 4MNKA 5IBXC 3I3DA 2B81A 3GU0A 3GG1A 3W2UA 4REQA 2PGEA 2PZNA 1AD4A 3VZZA 4QEEA 1CXEA 3G18A 1ZY9A 4K39A 3CIWA 1K8XA 1TR1A 3CZ8A 1PUDA 3N29A 4GX9A 3LPOA 4IP5A 5A6AA 2E25A 3W88A 3SRFA 2VUNA 2WAGA 4JX4A 5I3KA 4AWEA 1RLDA 3T0AA 4IFKB 3TTQA 2VX4A 2V3DA 3C4UA 4KFOA 4QITA 6ALDA 2NX9A 1X8FA 1RPKA 2DG3A 2WMIB 2OJPA 2FDSA 1EXBA 2CLLA 4WZHA 1FFRA 1JL8A 3RJYA 1QATA 3O1NA 3OGSA 4D2JA 2FVMA 3MYPA 3N25A 1LRTA 3DFSA 4BF9A 3QKEA 5DF0A 5CBIA 1BG4A 2R1LA 3AHZA 1WA3A 3EPMA 4DX3A 1FFQA 1KXVA 4M3PA 2FYMA 4RZ4A 2TYSA 3VD3A 4CLMA 3E1F1 3EYPA 4JTFA 5D30A 3SCRA 1P1MA 3NQEA 3LPFA 1WZMA 2BX7A 4C6BA 5F4SA 2DW6A 2OOGA 4HPGA 3C2YA 4O1FA 3DHFA 2PTWA 1NWRA 2WHMA 2G3JA 3ZQ9A 2C1HA 4G9PA 3WLHA 2G95A 5G2IA 3RM8A 3W00A 2BXYA 4PUMA 5AHLA 3C2FA 3LI0A 3MMUA 1KM5A 1G67A 3W74A 3GZAA 4JIPA 1FWRA 4JICA 1TA3A 1OHLA 1CT5A 1ZBVA 2EXOA 3QFEA 3PJWA 4X60A 1N8FA 2BY2A 1OQFA 2AGKA 1S2VA 2W62A 3OYZA 2ZUVA 1VYRA 2FHBA 3T78A 1JYNA 1W3NA 1D7HA 4HVXA 5B80A 3AXKA 4QTGA 2C8NA 1KTCA 4CVUA 3ZVHA 5GVJA 4LUTB 1J9YA 1H0GA 4F0RA 4TTUA 4JN6A 2Y88A 4NUWA 2AL2A 5K4XA 2XWDA 3FHQA 1EIXA 1VS1A 4MADA 1F3EA 3M43A 3W76A 3GNOA 4RXFA 4O8RA 4GVHA 1ZAIA 3PR9A 1P7TA 1W91A 5DN1A 3KCLA 4PZVA 3T05A 4CKQA 3SB0A 2VXNA 2DQWA 1J2BA 3UD6A 4PMOA 4J4KA 5BNKA 5BZAA 3ALFA 4DBDA 1FXPA 4JDBA 3I3BA 4YVPA 3LDVA 3MMDA 5AC6A 1GW1A 3VOGA 2GOUA 3N2MA 1UUQA 1E4NA 5HMSA 1Z6KA 5I00A 4H9XA 2HK1A 3TQVA 3MI6A 4E4UA 4JFUA 1GGOA 4JIQA 3NWRA 2CWNA 1RHCA 4PMXA 1NF7A 2DT3A 1UOKA 1D9EA 4DIAA 3H21A 1EQCA 4PODA 2J66A 3LX9A 3Q45A 3KZ7A 3H7VA 1J5SA 4G8TA 5EYWA 1HKIA 3BW2A 1SFJA 3A5VA 3H8AA 2WCGA 1FOBA 4IPIA 2VVSA 5LIYX 3UGVA 3LLFA 3ZFHA 4DWSA 1BF6A 5HNUA 1DXEA 1M41A 1GQIA 2TPSA 4IJCA 5JH1A 4XTIA 2VC5A 4XSLA 5HULA 1GOKA 3H2AA 4HN8A 5A8OA 2GSJA 2M1IA 1XX1A 2BVTA 5C6MA 4DQWA 4TU1A 7ODCA 3UWQA 3UQIA 1W3HA 4WXZA 3KBMA 3NPWA 3MZNA 4ZQNA 1L6GA 5I3DA 2PEVA 4LT9A 3BOFA 3GG7A 2OQLA 4WJXA 2QKFA 2PDMA 4ZO8A 1PZ1A 3Q94A 1B30A 3RXZA 4AEFA 2OFJA 4I9TA 2ZQ0A 3WQGA 2PPGA 1Z42A 4ACYA 1E9ZB 2DZAA 1OY0A 1XLDA 1XUUA 2ZQVA 4M80A 1ME9A 2CW6A 4DI8A 2DIKA 4QSHA 2BY1A 3VIOA 3C0SA 4IH3A 1N8IA 1YBQB 4UZUA 2AKMA 4O4VA 1BYCA 1R0MA 1X8CA 2PBCA 3W6LA 3OLIA 3LGEA 4QR6A 3KL5A 3CPRA 3NNTA 4B9ZA 1SFSA 1IT8A 3RJXA 4EACA 1YADA 1N2VA 4L1GA 1FX6A 1FKKA 3OTRA 1S5VA 4Q6JA 5LHFA 3CZEA 4JQ1A 5KINA 4AVFA 4ES4A 1SW7A 3RMJA 4CQBA 3W1XA 3SEPA 4DAIA 4E4PA 5H6HA 1ZJIA 3MPGA 4H2HA 3NQAA 3BG3A 4C1KA 3V1HA 4LF1A 1UD8A 3FAXA 1H5YA 2VD8A 1FY6A 3H2NA 4WIWA 4F0HA 4LANA 3RUBL 2B7OA 4KGJA 1HX0A 8TIMA 3KRBA 3E2QA 2BZNA 2QF8A 4V15A 1TCDA 1RQEA 5CGQA 3EDJA 4QROA 4ZZ9A 1LRQA 2Q6ZA 3MA8A 1ODZA 3CU2A 3E74A 1XCXA 3M64A 3GDTA 3JW7A 3WH9A 1BYAA 4FLSA 2VCAA 2GPTA 2Z7KA 2WQDA 1X1NA 3PZOA 2HV5A 1T8QA 5GNXA 2IKHA 2X7VA 3R79A 4LNCA 1GTEA 3WQEA 3O5IA 3ID7A 4DBEA 3AMKA 3STCA 3O3RA 4NI8A 1JAKA 3AXMA 4L3NA 1W37A 1WDSA 4V27A 1JEZA 2VENA 2BSLA 7XIMA 1QUMA 2YL6A 1KTNA 5DRCA 4JQAA 1QNOA 3OZOA 2QCCA 3TDBA 1TJ2A 1L8NA 3SBFA 5REQA 4MYXA 3AHXA 1TFVA 1VFLA 3HQPA 2V2CA 2AQVA 1R3TA 2Y5SA 1H09A 3EDEA 3RNDA 2A0NA 2WYSA 4YVXA 1QI0A 1U33A 2XP4A 2R9RA 3IIVA 2QCMA 1KBKA 1ZHAA 3FYPA 3LCFA 4M6UA 4PCNA 2Z1WA 3IK4A 1SZRA 3HGOA 1R3YA 3BJTA 1TWIA 1ZPTA 4O28A 5BCAA 3QKZA 2D9FA 2D2JA 1XBYA 1NOUA 2FPVA 3F1QA 1DJGA 3DH7A 1H41A 2GGIA 1JAEA 4V2XA 3F5LA 1RA5A 1MFVA 5DBTA 1RXOB 4Z2LA 3SCUA 2Y8KA 5D33A 4C6PA 3CAKA 2XWEA 1XIIA 1W9UA 2IQDA 4GX8A 3DESA 4F9DA 2ZZ4A 3WNLA 2DUXA 3M0HA 1SR0A 4TUFA 1OX6A 3GQYA 4XK2A 1XC6A 1B5TA 1EP3A 3ATZA 1NM9A 1UWQA 1ZNNA 2GVEA 2NV9A 1QAPA 1A5BA 1DJIA 1HN1A 3QW3A 2W6RA 3QGKC 3FGCA 4UFHA 3SUSA 3TA6A 2OEMA 1PO9A 5TF0A 1I45A 2J7FA 1RQBA 3GUWA 3ZIZA 3U2OA 3RF9A 1EP1A 5CZSA 3NZPA 3H2CA 4NJJA 1XLMA 4KFPA 1W3LA 1BQCA 2A3CA 4KEMA 2PDUA 4ZSUA 3ARSA 1VHNA 4XISA 5EPDA 1HJWA 3T40A 1F2JA 2CCRA 2I7GA 1W6TA 1OFRA 3QBUA 3CUJA 4L4LA 3PZVA 1F07A 5A2AA 1B1YA 3NSNA 3G6LA 3FXGA 1I6NA 3PULA 1HO4A 2KAUC 4HU8A 5EMUA 5JIWA 2YOCA 3VZYA 1B2YA 1A5MC 1H51A 2FVLA 3NPXA 4NJGA 3LXBA 3JXVA 4LV9A 1DWHM 3W02A 5L6UA 3SCTA 2XVGA 4D8LA 1VBHA 1U79A 3EMCA 4AU0A 3ZOAA 6XIAA 3URQA 5I3GA 3DC0A 2XVNA 5LKYA 2PDFA 3S5YA 1TV5A 1W9XA 4CU7A 1OABA 5SWUA 1YKWA 2WHJA 2A3BA 2RGMA 1WB0A 4A22A 4UTHA 4D9PA 1NH6A 1RY0A 3TV8A 1GYMA 1W26A 4GCAA 3AC0A 2G96A 3R43A 3WNKA 3S47A 2VRKA 3FA3A 2AAMA 3VCRA 4UFJA 1GOOA 1WAUA 1LOSA 1OD8A 2GGEA 3ZSSA 1FWGC 4QXIA 2EPOA 7CGTA 2CFFA 1H7NA 2HNHA 3BGJA 1CENA 4D8ZA 4AB4A 4CQDA 1YMYA 1OFEA 3VNDA 2X1IA 4H19A 3U0HA 2VEIA 1Q6OA 4X3ZA 4E2BA 4UB9A 3TOYA 3BANA 1GZJA 4TQTA 1JVWA 4GI9A 1C91A 2F6KA 5DCBA 5FJRA 5F2MA 3UA4A 4H6EA 3OLGA 4QJ1A 3QMTA 5EBAA 2VMFA 1PWMA 3CHCA 2VFHA 2VRJA 2ZE0A 3JS3A 1H2JA 5C2CA 3OU8A 3W22A 2D3LA 2WK2A 1FKIA 2GK1B 4JFKA 2VEGA 3LCWA 4GUIA 1F6YA 1TV3A 1KBIA 2YA0A 2INFA 5JVLA 1XDMA 4FSAA 1UCWA 4PMQA 3B06A 4JTEA 3KS6A 1XBXA 1UR2A 3BCDA 1KCZA 4I7VA 3KWXA 2PBGA 1Q6CA 3L65A 4XSMA 5A6TC 3HPZA 2UY3A 1PX8A 4LAVA 2BOFX 4S3AA 3CUFA 1A5NC 1AFSA 4NQ1A 4OUIA 4PYSA 4NASA 2PTDA 4MFDA 3EPOA 1IWAA 1UBPC 3VDBA 3OO2A 1F05A 2Y7GA 1C3FA 4MSPA 2CYGA 5I23A 1R38A 3O5OA 1IXPA 1EJUC 1EA9C 1OFQA 1GZGA 4ML4A 4YHEA 2OGYA 4EWJA 3NDOA 2E3ZA 2UY2A 3HJEA 3TN5A 3R8HA 4JFVA 4D6IA 1FWFC 3O0KA 2QUUA 2MLZA 4GZIA 3WF0A 3L23A 4MWAC 3NOYA 3LS9A 4Q8QA 2FH6A 4P8WA 3A24A 4OE7A 4WDXA 1JULA 4MYAA 3HQNA 3U4FA 2XP9A 1I9CB 2QJGA 2WBGA 3LRLA 4BI6A 4HSNA 2VDIA 1LBLA 4GYPA 3BOLA 4W85A 1ROUA 1XLHA 4XQ6A 2YFOA 1OF8A 2NLIA 2GUUA 1XYLA 3WNOA 2GQAA 5B7ZA 2H3BA 4Q8MA 4W84A 3TYZA 1JDEA 1KR1A 5FCZA 3VCNA 3WMLA 4RJEA 1RCOB 4GE8A 4AD3A 3IKDA 3M0YA 5F1UA 1XKJA 4J3SA 3P61A 1D7FA 1DIDA 1LBFA 3W25A 4IT1A 4ONVA 1G4PA 5I06A 2ZZ5A 3PZQA 4D1IA 5EMJA 1HO1A 2HZGA 1VYSX 4DO7A 3UXIA 4TV5A 4ZR8A 3NURA 1OG6A 3FW6A 1V3MA 1KFJA 3ZJ8A 1MO0A 2ZR5A 2FTWA 4W8LA 3ZJ7A 3GXTA 1OFPA 4U2ZA 5CSRA 4IICA 4INFA 1OC6A 3AMCA 4TX9A 1A47A 1XR2A 1HL9A 2VNCA 1D7KA 1J18A 2CLIA 5LIXX 2VUYA 3U3HA 4C1NA 1IEQA 2JFEX 2UY5A 4JFWA 4B9YA 4MWAE 4LCQA 1FCVA 3H2EA 5LNUA 2PPPA 4C7DA 1VRXA 1XLEA 3PVFA 4O1BA 2PDHA 2YL5A 3BOXA 4GWEA 1C90A 4IIEA 1WP6A 3MKKA 1SMDA 1E70M 3OHIA 3P80A 4OBSA 3UXKA 3WH0A 5FAGA 4L56A 3RRXA 1J2WA 4ICNA 3LTSA 1H7PA 3KBSA 1E5JA 4XBJA 4HU4A 2JBMA 3RILA 1LDCA 2YCLA 1JFHA 4C6QA 4CCCA 3G8RA 1TMLA 2ZXBA 3W7GA 1VBRA 3A4AA 3BLFA 3AHYA 3GC2A 2DT2A 2DDXA 5CG7A 5CPSA 2ALRA 4E5TA 3KOYA 4BA0A 2CKSA 4P61A 2GYIA 2YB1A 3M6DA 1MFUA 4LBRA 1O5RA 2F6UA 1EF3A 5DRIA 4Y90A 4C6NA 2Y4SA 3ZT7A 4DJEC 1AODA 3VAWA 4GJJA 4JTSA 1ICPA 3G1VA 2RJGA 5HW8A 4AZGA 2ZZ6A 4IUOA 2QUTA 2F9RA 5CJMA 3B0UX 4FNRA 1KO0A 5CPOA 2WSKA 3LY0A 3O5FA 1BSLA 4FLOA 1JFXA 3PJUA 3POCA 3GVVA 3QF0A 4DH0A 1SO4A 5BRQA 3ZR6A 3QGVA 3ARVA 3VD4A 1O66A 1EX5A 2VX5A 2ZZ3A 4IIGA 1TCMA 4DYJA 1PS9A 4GKTA 5AYYA 2YA2A 4F79A 2DH3A 1WDQA 2ISSA 3CAWA 1UH4A 2WC4A 1A5LC 2GOKA 5CC5A 1ZAJA 4DJEA 5MKGB 1CXLA 1NMWA 1IR1A 3P74A 2EPLX 1IZCA 3O5LA 1S46A 2Y5JA 3F2DA 3WDPP 3KRUA 1PTGA 1XRVA 1SFTA 4GY1A 1AQFA 1E6ZA 4CU8A 1ZB5A 1GVQA 3W7MA 1XGEA 2EPHA 2WLYA 1CGYA 3EWXA 2Y85A 4XKYB 1UD5A 2PRLA 1EJ7L 2HS6A 2WQPA 5E09A 2W91A 3UWYA 3WEMA 2H90A 2XSXA 1EA0A 3LRMA 1DP0A 1A5AA 3KCJA 3PPHA 3FAWA 4Q8UA 2PPNA 3SCWA 4WY0A 2ASHA 1RJRA 2XVLA 3PM6A 1HG3A 4MB5A 3GYCA 1YNYA 3LBMA 1Z32X 5HTGA 4O50A 2DZWA 3NQVA 3TR9A 5HUPA 2GVLA 2DZXA 2BBFA 3F4DA 3RX4A 4JTRA 5DCDA 1V6UA 3QV6A 2XYLA 2PDIA 1B54A 2FZ9A 1KFLA 3NQBA 4Q3MA 2F61A 1BWLA 2C1GA 3MS8A 1JIBA 3VFCA 4WF7A 1JG9A 4ATLA 5JBEA 1RALA 1FA2A 3FK4A 3VVGA 3BTNA 5BXRA 5CGTA 2ZRZA 3T08A 2QDDA 3TN4A 4QZVB 3BICA 3TC5A 5EA9A 4GVFA 1M04A 2YB4A 2GDQA 2EQDA 3BMBA 2ZRWA 2ZRYA 1BTMA 1KGXA 3GTFA 1PTDA 5HNRA 4I6KA 1VGAA 1PDYA 4F2BA 3NL5A 4NZFA 3THAA 1P5QA 1SYTA 1IZKA 1XRFA 2VO5A 3OA3A 2BY3A 4JYDA 3BLEA 4UTUA 1GRJA 4PTXA 3F2BA 3SCVA 4C6MA 2OPJA 1KRBC 2C18A 1PJ9A 1R8LA 5TQLA 4W7UA 1SVDA 1UWIA 2D20A 3TJ4A 1ZBWA 1G7UA 4BY3A 1V79A 2MNTA 4FNQA 2QJJA 3W27A 2WJDA 4NAFB 3T81A 4JHMA 4B15A 2ONEA 5BU9A 4C6JA 2PC8A 3T6CA 1X7IA 4UQAA 3ZT5A 4P7NA 1XIFA 4HNCA 3GDMA 3MZ2A 4GNKB 4GVGA 4H7VA 4UFMA 5CJNA 4AXNA 3HF3A 3PS7A 3WLOA 5F2LA 2VCBA 2PWUA 3G77A 2VN1A 3WD0A 2VC7A 1N55A 1XYCA 1O95A 3BJSA 4Z0SA 5AZ1A 2TAAA 1CI1A 1K7XA 4LUIA 1M53A 1TPWA 1BGGA 4EF8A 5HMFA 2QF7A 4OKDA 3T09A 3W2NA 5GJNA 4TX0A 1XBVA 3COTA 2EPNA 2E5CA 2X09A 3NQCA 2VOTA 1CDGA 3VABA 3TTEA 2QCFA 2GJNA 1GVFA 1TUFA 5AVHA 3MUIA 4MJ4A 1YW5A 1XD0A 1Y7VA 5FEXA 3V5FA 3LQGA 3UZYA 3TTOA 3AJ7A 4ERGA 4ZA0A 4Z1BA 3LV5A 3RPDA 5C2XA 7REQA 5IRPA 5I24A 3ZT6A 3C0JA 4PBEA 3SGZA 3WX7A 2Y7EA 4M6PA 3H53A 2VYOA 1BTCA 1EFZA 1H61A 3IJ9A 1KT0A 8XIAA 2D73A 3IEBA 2YBUA 3SURA 4IQEA 4MWAD 3MWAA 3VIIA 1TTQA 2PLJA 4YCOA 5C9ZA 1UW9A 3HURA 2NX1A 4MSSA 1OWQA 1OG0A 2RUDA 3E0LA 5GNZA 1JZ5A 3LK6A 4ERIA 1IT7A 3E3HA 3AMGA 1ISYA 4ORIA 1K7EA 3R10A 2ISFA 4ZQMA 2VEFA 4ZQRA 4YTUA 3W7OA 3MW7A 1JDDA 4X9SA 4G5DA 2PD9A 3TTYA 1XH1A 8CGTA 3UBPC 3QMRA 2YW3A 5GPRA 4B2DA 3QR1A 2YXOA 4H83A 3ARXA 1UD6A 3T8LA 4QS5A 3T0DA 2B7PA 2FZMA 2G3NA 1V6YA 4AW7A 1EJVC 4H9YA 4PMVA 2V5JA 2PGRA 2X0YA 3H2FA 3EGJA 2WKJA 4PTNA 4KCWA 1XLGA 3E49A 4TMBA 6CGTA 1AA1B 2PODA 3N13A 1HL2A 4M51A 3NG3A 3NDZA 4FLRA 3ANUA 4AZIA 1BXNA 3A4JA 4LVBA 4O57A 4DJDD 4HK6A 4FNPA 4NIRA 1WOBA 4IXHA 4S2CA 3LUTA 1CXKA 1S2AA 1CB7B 4HZ6A 3DFHA 4ZE4A 5H1WA 4AD4A 4JFIA 3REQA 2I9UA 4JEJA 3TVAA 3USZA 3R12A 1NELA 4OBTA 2B7QA 1E6PA 3KBWA 1ADSA 5DO8A 3KHDA 5I03A 3RK8A 1ZAHA 5K3VA 2GVJA 4LAWA 3EZ4A 1DYSA 1QOQA 5A6LA 2D22A 2ABAA 1W1YA 2NUXA 3WD1A 4W4QA 1T7LA 4CNOA 2HROA 1BL4A 5CEWA 2WSPA 4IMEA 4KRZA 1QI2A 2CLMA 4DNHA 3EA3A 3GZ3A 2R6OA 3PANA 4G1KA 4DYEA 2J77A 4ERAA 3WF3A 4UDMA 1RCQA 1W1A1 1BD0A 4RK8A 1XIDA 3ZVIA 3BURA 4DNMA 1TUXA 1Q1CA 1VP5A 1V6TA 1UYQA 4O16A 2BGNE 1CGTA 5DMNA 2H9AA 2J8GA 3VDGA 1A4MA 2VDHA 3IVSA 4XO7A 4X0VA 1EQPA 5D2XA 1PZ0A 1J4HA 4ODKA 4NNCA 3ONCA 4J5NA 2ZUUA 5AYIA 3PPCA 2RDUA 2XIIA 4ZOAA 4WKHA 5DXXA 4L7ZA 5FJOA 4S38A 4DXXA 2DSUA 3MT1A 1TREA 1V02A 1BRLA 3E96A 4GC3A 4Q4PA 4DBSA 3PAJA 4UTTC 3VGGA 4FF7A 3VDAA 2ZE3A 4AG0A 3IRDA 4LX4A 3AMLA 5JBDA 2CBJA 3RM4A 3VGFA 4UOZA 3UR2A 3AQUA 1W32A 3A9BA 1EGMA 3W2LA 2X05A 3PZGA 1V4YA 3UQBA 1KGWA 1TCOC 3UI4A 1KTBA 3V36A 3MJYA 1IEIA 1QVBA 2ZKMX 4NNRA 5ENLA 2WHLA 4Q4MA 3BAKA 5LIKX 2ZVRA 3QN3A 1HQTA 3NL2A 1J0ZA 1HJSA 2JEPA 3CS2A 4HA3A 4PTWA 3RFWA 1UR8A 1TPC1 1Z3NA 2PP0A 1E3XA 2MANA 1ML1A 3C86A 3D47A 1AJ0A 1F73A 1XLJA 4K37A 2R24A 1PINA 4B5XA 2G3FA 4QM1A 2OZ8A 3JYMA 3C3NA 3UPWA 1PE1A 1W2VA 4UTTA 3RR4A 4HKPA 1LUCB 1MMFA 3H55A 4ZSTA 5J5DA 1JNEA 3L0GA 1DTNA 5I77A 4PMZA 3IJ7A 4P8VA 3AAMA 3MJMA 2HWGA 4HNVA 2CBVA 2W0UA 5JXQA 4U4MA 1TG7A 3GKFA 1K02A 4R3UA 3T42A 1UWSA 3RX2A 4HB7A 3UT0A 4KWWA 3DHUA 4AVOA 1XW8A 3LPPA 4JFSA 3KS5A 4DUWA 1QPRA 3E0IA 2V0TA 1AUSL 1WQ5A 2INEA 2GSEA 3IJ6A 4Z2HA 1U30A 1DE6A 4NAEA 1HNYA 3LCHA 4X2RA 2N87A 3IUDA 4GJ1A 3KAIA 5LHEA 4FXSA 2VEPA 3E0FA 2NXHA 4MZ1A 1Y5XA 5AOUA 3WF4A 1VQTA 4HMEA 5IHRA 1AQMA 3IIZA 5HJXA 3WFZA 3NVTA 1KRCC 1RR2A 5L9FA 4YL2A 5G1YA 1AW1A 3KM8A 3W1PA 1ODUA 5D09A 4N0RA 2QVNA 1ZU8A 1XLCA 3DGRA 2VELA 8XIMA 1TQJA 2Z6IA 3OW1A 3DG6A 3WYZA 4FALA 3BUVA 5HR7A 3QYSA 3WO8A 4HBEA 1JXKA 3P7YA 1WYIA 1EC7A 3K1DA 1FCBA 3AICA 3MUZ1 2WM0A 4H8HA 2X2GA 3FN9A 4RZBA 2ZX8A 2W63A 2WC3A 1AW5A 1CCWB 2EPMX 4IGSA 2FB2A 4JDYA 3HFTA 2RH9A 4O1AA 3SI9A 4DWDA 1TWSA 1W1IE 2CC0A 5HQLA 4G56A 3W7RA 1GKQA 1ESWA 5CXPA 2DT0A 1J10A 1W5QA 1H7WA 3NXFA 2DVTA 4DJFD 3OVGA 1FJDA 1HP4A 2V6AA 3CH0A 5HNTA 2IXUA 1E0XA 4GQRA 1V6XA 3EOUA 2G3IA 3BC9A 1VEPA 1J0KA 4RV3A 4E2DA 3WF2A 4GIAA 4FIQA 4GBDA 1H4PA 3WQFA 2ZUSA 2VQTA 1K8ZA 2OEJA 3WDQA 1R3VA 2WMIA 1O7AA 2WKLA 5D03A 4K1GA 3SY5A 2HVNA 3NI6A 3W7PA 3HQ1A 4S2BA 5MHBA 2PDGA 2VHLA 4GH1A 4IF2A 1EUNA 4Y8FA 4L4OA 3CNYA 5EY5A 1C7SA 4ILSA 4ZQOA 3O9NA 3A22A 3SR7A 3VM7A 4HHPA 3VK5A 1NQKA 4NZJA 3VKKA 4WQ6A 2RKXA 1VPXA 2XH4A 1I2QA 3BW4A 4UWMA 1QPLA 4LRTA 4L5ZA 3CLMA 2XH7A 2XFWA 4QG9A 1AK5A 2XSBA 1A0EA 4KH2A 1NDVA 2OO0A 4PUEA 4NYUA 3H26A 4ZB0A 4B91A 1IZJA 4X22A 3B8VA 1EEXA 2ACSA 4OJYA 1EBGA 3F5KA 1UA7A 1RY8A 3NCOA 2CHRA 4UCGA 1ICSA 3ABOA 5EMMA 3R1ZA 2I1OA 3QLLA 2WSYA 4XZ9A 1Q8AA 3GUGA 4PMNA 1VAHA 2GJPA 4NYYA 1VFHA 1QW9A 2ACRA 4LUTA 1GZ1A 3T2QA 1HT6A 3UXDA 4AF0B 2QQ6A 3N6QA 2NUYA 2AQOA 3WD2A 5K2ZA 5KZEA 3FKRA 1F4AA 4IG2B 3WH5A 3CO4A 4CD6A 5A5WA 3CAQA 1ADDA 1GUVA 1H7RA 2IKJA 4ZBCA 2BHUA 1BWKA 4B5SA 1IT0A 1M01A 2Z26A 4AWUA 1KXTA 2E9BA 2P50A 3VAVA 3PNUA 3BZGA 1OC7A 1SO3A 4Z2IA 5H8PA 1DQWA 3WD3A 3KOFA 2PAJA 5J8LA 4H7CA 2ZTKA 5AKQA 1MDRA 4HMCA 4NX5A 4UQDA 4GNVA 2FLIA 2YXXA 4RZ5A 2DT1A 3G22A 1NDZA 4BHYA 4JFTA 5CC3A 4RDVA 2XN2A 4WX2A 4PUDA 3AIUA 3N6JA 3AISA 2EG6A 3TN6A 4Q8NA 3G3DA 2E6AA 3MHFA 1ZUAX 4BQ4A 2X0HA 3ZLFA 3WUBA 1KM1A 4F4RA 3AXXA 4XVEA 2ZWZA 4IL2A 5FJTA 3KBVA 1XCWA 3KHJA 1NWUA 1HUVA 3E0VA 3RLGA 5DELA 2CXEA 3YPIA 3SZ8A 4PMRA 3W1AA 1KM2A 1JDFA 4Q33A 3NQ7A 1OB0A 4GZEA 3NQFA 1WXJA 3GWQA 4AC7C 5CAKA 2P76A 3IGHX 3N12A 4J27A 4MY8A 4HQVA 5DIUA 2J7DA 3V16A 5C7HA 4O4WA 3TC7A 3PRBA 4PEEA 3WENA 3UQAA 2XP8A 2VC6A 3L9CA 3V0SA 1EJWC 1WXYA 2G0WA 4GC4A 1JQXA 2A3AA 4IJRA 3SCSA 1VBGA 3CEPA 1E73M 4IX2A 1OVDA 3B4UA 2WMKA 1S39A 3JYJA 1E9LA 1QU4A 3UW6A 1PZ2A 2O7SA 2ZQSA 5RUBA 3WQPA 2D0FA 4EK7A 3VMNA 1J6PA 3DZ1A 4CQ8A 2ZDRA 4H4IA 4TR9A 2PDLA 4M6QA 1MSSA 5A2CA 2X0SA 3IJLA 1YBQA 4DZ5A 5HDRA 4ZCWA 5B7YA 3QQWA 1UHVA 3LA4A 3V18A 2GSHA 3C0LA 3QPYA 4CD7A 1T5AA 1DEDA 4J9JA 2BXVA 2QULA 3OHMB 3CQIA 4GUGA 1YXCA 1M3UA 4DPPA 1NWTA 2VFDA 3LV6A 3FJ4A 1J0IA 2O4MA 1W31A 4NZ3A 4JTJA 3OZPA 1EWEA 2V9DA 4PBFA 4V1XA 3TQPA 3WL1A 3UY8A 3G1XA 4JY9A 4YCPA 3BARA 3B0PA 2GQ3A 3QH2A 3ABQA 4AISA 1OX4B 4Y6GA 4C6LA 1OJXA 2NWRA 2ZXDA 1FWTA 4WKFA 1BAGA 2QPUA 3W38A 2H3DA 4CCEA 2G50A 2QIIA 4W93A 2V38A 4GIVA 4L72B 1OSEA 3H23A 1WNOA 6XIMA 4OVXA 4ML9A 1P4CA 2OR2A 2GVYA 4ZE5A 4O11A 5C9UA 4WRHA 3AFBA 4TX8A 3VMPA 3WJYA 5AZ0A 4GIRA 2L2SA 1Z44A 3TSMA 4LAMA 4ADSA 4GGQA 1OYBA 4GQBA 2Z1XA 1K6AA 3ZO9A 4MWAB 5HQEA 2ZOXA 3B9OA 4H8NA 3NEVA 2CBIA 1E6XM 1P48A 5HWNA 2EJAA 1E4IA 3SGGA 2MLXA 1R3WA 2DJXA 2PLMA 4BR1A 3QHMA 2POZA 3FSUA 3N4FA 4XUGA 3R89A 2YLAA 1W9BM 4F2TA 4JTAA 4Z0JA 3TZFA 1U1UA 4KCUA 1BVNP 2AMXA 1UZ1A 3SQMA 3PUEA 3F03K 4U3CA 2DP3A 2YBVA 1OYAA 3PPGA 3R2GA 1SPQA 3VD5A 1FCUA 4Y8EA 3TLQA 4I7UA 3UJEA 4HOZA 1YTEA 2P53A 3MQTA 3T0CA 3FLUA 4PCSA 1E55A 3N2BA 1S3TC 4H9MA 3DYMA 2WVUA 4AIUA 3O5GA 2WJZA 5JMUA 4KQZA 2RURA 2BHZA 4HHMA 1FD9A 2YR1A 4O53A 5BOFA 2XTKA 3OQEA 2CZ5A 2HXTA 1FWSA 4A3RA 3B9NA 3L4UA 5ECVA 4AZBA 4NRSA 5I5RA 1KCLA 4EOUA 5FIPA 4NZ1A 1QHPA 3VIFA 1F5ZA 2CLOA 3O7UA 5D37A 1BYDA 2WJFA 4IZGA 3W82A 3KBJA 1RD5A 3L4VA 1FAPA 1KCKA 4BWLA 1S5TA 3QFWA 4YU1A 5HWBA 1W5MA 2Q8XA 3UYCA 1CZ1A 3S46A 1PCKA 4NT0A 4CUCA 1CB2A 4Q4OA 1QO5A 3L21A 3MUY1 3PK7A 3LCLA 2FAPA 3L5LA 3A3XA 2AWGA 3O5QA 3D6NA 2QPSA 1R30A 3VGBA 4DROA 2HQAA 3ZLHA 2BG5A 3AMDA 4C6DA 4IIDA 1JZ3A 4Y9AA 5F2GA 1QO2A 3L7RA 4D6DA 5J5RA 1CYGA 4A05A 4XBSA 5HMEA 3K13A 3SIZA 5KEZA 2VGBA 4XAZA 1A5CA 2GGGA 1POJA 5TIMA 4N2YA 3Q4DA 3INPA 2QCDB 4WK9A 3N04A 4IFOA 4O0QA 3CXOA 1CIUA 1T40A 3ITTA 3PUDA 2W67A 3PTMA 4XAGA 3L4ZA 3CZLA 5FF3A 2CERA 2ZTJA 3FIGA 5LGZA 1VB9A 4AY1A 1KV8A 2PWGA 3WIJA 1W3KA 2B7NA 4JTIA 5EL1A 3N1AA 4Q6XA 3GTYX 5DLCA 2PC4A 3ITOA 3LPGA 3NM1A 2PWFA 4MDPA 5HUOA 3LHTA 3N9RA 3RLVA 1DKWA 1V3IA 3JZUA 2YA1A 3C61A 3LNPA 3KDOA 4DELA 4MF4A 3H24A 1YLVA 3WELA 4BQ2A 1CNVA 1OK4A 3MSRA 1K3UA 3F4NA 4P8XA 3WL0A 4MZ8A 5A6SA 1AQHA 1PHQA 3S2LA 2IF4A 3LI1A 3OODA 3W87A 4ENLA 3EKGA 4F3HA 5HKGA 2VWSA 2M2AA 3PN8A 2JGQA 2VWTA 3MSDA 3HN3A 4QS6A 5D04C 4N02A 2C19A 2OYKA 3ENLA 4JGDA 1DJWA 2P8BA 3EX2A 2NUWA 1M9HA 5CZKA 2DPEA 1S5NA 4TMCA 4C6KA 2F2HA 1W3TA 5A6BD 3O0FA 4QNEA 4RDWA 1L6WA 3C2VA 3QY7A 1RCXB 3HOJA 1IGWA 4JR5A 4JFMA 3ZZ1A 2R82A 1FWJC 3GC5A 3UCQA 2KE0A 1W1TA 3BGGA 4Q4KA 2DY3A 3M0IA 3AYTA 4XZBA 4LBUA 1TPVA 2Y6ZA 1FKRA 2P8CA 2KR7A 8A3HA 3GXMA 2QHAA 4QG6A 2CXGA 3PAOA 4K68A 4XAPA 3TTSA 1KFWA 1MRQA 4X0NA 1THFD 4UR8A 5GNYA 4HPNA 3LN3A 4DBUA 2O92A 3B0XA 5CKSA 3SRDA 2OELA 4YTTA 1XIBA 4XX6A 1A4LA 2Y89A 3W3OA 5BMXA 4YYFA 1EHAA 2V5LA 3K4WA 3A5FA 3SN1A 2E77A 3G1AA 3CQKA 1ONXA 1QNRA 4J4OA 4CN6A 1GCYA 3TZNA 3R94A 1YXDA 1GW9A 4HSOA 4UTIA 3VO0A 3T44A 1T8XA 3D0CA 5I6SA 1FBAA 4LYKA 3PFRA 4YNGA 1DJZA 1TZZA 3RU8X 4DB7A 3H9RB 1GVRA 1R6WA 2VCDA 1CEOA 4MPKA 2W4XA 3IIXA 2ZC8A 4TO8A 3GAYA 4IT4A 4XAKA 5E6YA 1XP3A 1XH0A 4FHAA 4GYKA 5AECA 3OOBA 1PDZA 1PBKA 2F4EA 4FOUA 1TX2A 4EPBC 1WDDA 4KERA 4FPSA 4WOQA 4NX0A 3WJWA 5EFFA 3H4WA 3KP1A 1X96A 1DJNA 1DIOA 5BOOA 5KZ6A 4LEQA 4UQEA 3LNMA 5FF7A 5AY7A 1V51A 4J7RA 3HPSA 2PV2A 4LQ1A 4C91A 5CC6A 2PWVA 2DSKA 2BWGA 4O8AA 4IHCA 3EKZA 3KCEA 2A6NA 2FTYA 2X7WA 4J3XA 1J6YA 3BAWA 2CBUA 2ZA1A 4IUGA 3QY8A 1GQJA 1JDCA 4S3GA 1EO5A 3IS4A 2C15A 3URAA 1JPHA 4CQ9A 3PBGA 3CZKA 3UG3A 2OFNA 2PP3A 4M6VA 3O15A 4N9BA 1JCYA 3CL6A 1LBMA 1JPKA 4HZ7A 3LQLA 3ZVHB 3CV6A 1TPH1 4ODOA 1UROA 3KABA 3Q2DA 3SJNA 6TAAA 3PTDA 3O16A 4DO5A 3IARA 5CQ1A 2AL2B 1LYXA 4JS3A 1TPEA 3FAPA 4UTWC 4WHBA 2Z1SA 1QTWA 2GFTA 3NFUA 1HXVA 4PTVA 1TPB1 2FPYA 4YMZA 1V3LA 1LLOA 1P7TB 3WLLA 1C8QA 3PY2A 2XM2A 4LS1A 3UJSA 1ONEA 4DXVA 1T41A 4PL1A 3RLHA 2J47A 5B8IC 1KD0A 1PKNA 3RGCA 4QLJA 3FXYA 2Z25A 1MW2A 3H12A 1Q7MA 2WWCA 2C0HA 1T0OA 3EMZA 1LT7A 5HNNA 4GUHA 3ZYZA 4PRTA 4O1CA 2IQ0A 5JUVA 4DRQA 4E3TA 1DPMA 2A5HA 3AIQA 3MCMA 5A95A 3MBFA 4NP7A 3O5JA 1VLIA 5BYWA 3KOXA 4OU1A 1LP6A 5G4HC 1QR7A 2GQ8A 4GMEA 2OQHA 3ZR4A 2EEXA 1FKSA 1PCWA 3GXIA 4RX0A 4AZHA 2QEZA 1A5UA 3DG3A 1FWBC 3QOKA 3GU1A 1Q6IA 3ZWSA 4AIBA 3ISIX 4L6DA 3L67A 3P8JA 3AS0A 3MB9A 4DWSB 4U84A 2ATSA 3GH4A 3HFYA 3W7QA 5LIWX 1R9YA 2VOMA 3RU6A 2QYGA 1FKLA 1FWEC 1KGUA 3U2ZA 1RD6A 4NJHA 2OO6A 2XP3A 1LL7A 1VFOA 1YTKA 4QDMA 3PZNA 4DF0A 2XH2A 2E1WA 2V2HA 4WLCA 3CM4A 2L5HA 1FKXA 4AD1A 4PULA 1E6SM 4POCA 5MKGA 4PUNA 3P0XA 1B31A 1H7XA 1V02E 1IGSA 3VKBA 4AZCA 3XISA 3OGVA 3V75A 2FIQA 3KZPA 4EAYA 1EQ3A 2J7GA 3R25A 3O6DA 2CETA 1WOAA 3WLQA 3CZJA 5FL1A 4WOZA 4XKYA 1V0LA 2YSWA 2PZ0A 3O5MA 4N19A 1FDZA 1DE5A 3ITGA 4BCEA 4NZCA 4LAZA 3KAHA 4E4FA 2OLAA 4V28A 1IWBA 3GXPA 3H4XA 1DTUA 4HJWA 1KFKA 4ATDA 4MG4A 4Q8TA 1UWUA 3CUZA 4Z1AA 1JZ2A 3L12A 1GK8A 2V81A 3KTSA 3ME3A 4YWSA 3B7XA 1K4GA 1KM4A 2C6QA 5CPTA 1K9TA 1W1ZA 3BSHA 3TXZA 1R85A 2YX0A 4ZTYA 3R6IA 2R1MA 1SMAA 1EWDA 1BGAA 4M7TA 2P3EA 2HE8A 5BRBA 1ECQA 3SY1A 1C8VA 2HCVA 4GI4A 3ZJ6A 3SSJA 3CTTA 3NO3A 4DRSA 2D0GA 3FX4A 4S39A 3CASA 3AYVA 3M41A 5CAHA 3TC6A 1UZDA 3BV7A 1G5AA 4E3VA 2YCKX 3DYOA 2EO7A 3SIMA 2PDJA 1MW0A 2GWNA 1YHTA 2DH2A 1M7PA 4ZQCA 4HTYA 3OLDA 1FWWA 1TKKA 1MW1A 1VIWA 3NUKA 1SJDA 1DIEA 3F5JA 3WK3A 4AX7A 3TJLA 2F8QA 4FS9A 3BCFA 2P1FA 4A35A 1RVKA 4J2MA 3GFYA 3HG5A 3B8TA 3PRDA 3NO1A 3UESA 1N8WA 1U83A 2PRMA 3M1ZA 4DI9A 1XIJA 3CB3A 5REQB 4AIEA 1PVNA 1RA0A 3U6WA 4CGTA 3TXVA 1F76A 3VNLA 3QC0A 1FWCC 3UCCA 1TIMA 1EBHA 1HGWA 4NAFA 5LGXA 3S8HA 3GH5A 2GGHA 4KKXA 4PUUA 3EX6A 2PSNA 3FEQA 1A0CA 3A47A 4GXPA 3V4BA 3PPFA 4MMWA 3TYUA 4ZXOA 4HARA 4ODRA 1XLLA 5CPMA 1UB3A 2VX6A 4H9VA 5A8GA 3Q67A 3E0WA 2VKZG 4D6EA 3PP7A 4B5WA 3HG4A 2X1UA 3WLNA 4DO6A 2VGFA 4IP4A 3V35A 2HSAA 2NVCA 1M6JA 4MKVA 4LUSB 1W56A 3OEXA 3AXHA 5KSWA 1EXPA 3W73A 1K9EA 4OUEA 4XV0A 3PHAA 1RSCA 3OA5A 4D8AA 1YPFA 2UY4A 4O1EA 3LBCA 2D1ZA 3K8KA 3EY6A 1CGXA 1MQRA 4FNSA 3LCXA 4MJMA 2NT0A 4IIFA 1E40A 4LAKA 1Q6RA 3TCSA 3CL7A 1UG6A 4MAZA 3ITVA 3PC0A 1F61A 5G1TA 3T55A 5ABFA 3W01A 1AH0A 4PMUA 3S5ZA 5A3HA 3FGCB 4JCMA 3MKCA 4MB4A 4O19A 4JNYA 1SZNA 1MQQA 2RHGA 3UZZA 1Q6LA 4DIPA 5IFPA 1XLIA 4KBXA 5IBXA 4Y9MA 1HTIA 3DHDA 3M7SA 3GDBA 2O56A 3BE7A 1E3ZA 4LFYA 5HWCA 3S2JA 1QJWA 1TVNA 3PF3A 1M7JA 1H5VA 3KX6A 2J25A 1P0BA 4ODPA 4U10A 4GUJA 5HK4A 2Z7GA 1GKRA 1J96A 4BEUA 4MAVA 1M7OA 4PB4A 4ZGYA 1I2RA 1RUSA 2NV1A 4NG3A 7PTDA 4ODQA 2XGBA 1AMYA 4PCFA 4U28A 3IJDA 1GPWA 4IIBA 3DFPA 3R4IA 4C5ZA 5BU6A 3B9DA 3L0KA 2TRSA 2DZUA 2JKPA 4XUYA 4M0XA 3HGSA 2VFIA 4H8VA 3AALA 2WNWA 1KKOA 3UFYA 1LZOA 3G1RA 3QVQA 3QV9A 1LJYA 3IUIA 3S2MA 4RPPA 2C7FA 1QHZA 4RDYA 1B6CA 4W8AA 2NVDA 3WKZA 5CZ0A 1C9DA 2VEKA 4C60A 1HKJA 2J9XA 3HV9A 2QDGA 1QPFA 2XINA 3ELFA 5C71A 1R9ZA 2O55A 1US0A 3WUGA 1M1BA 4CN4A 2ZA2A 2XIQA 3H54A 4HPHA 4HBOA 2QLYA 2W61A 3EA2A 1NOFA 1I4NA 1UJQA 2VR5A 2PDNA