1LQ0A

Crystal structure of human chitotriosidase at 2.2 angstrom resolution
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
365
structure length
365
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CHITOTRIOSIDASE
publication title Structure of human chitotriosidase. Implications for specific inhibitor design and function of mammalian chitinase-like lectins
pubmed doi rcsb
source organism Homo sapiens
total genus 126
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1lq0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1lq0A01
1GPFA 9CGTA 3TP4A 2DSUA 3WDRA 3RO8A 1EGZA 2XVKA 3PZQA 4BQ5A 4GZEA 3SCTA 2WKLA 2JIEA 1KFWA 3WUFA 1BF2A 3OIHA 1DWIM 1J0KA 1KGUA 1OD8A 4ACYA 2XGIA 5ECUA 2V3GA 1E56A 2NSXA 5CSUA 4XZWA 1C3FA 1W2PA 4GZJA 3RCNA 1CENA 2V5DA 4K68A 4AIOA 2VC9A 4WKAA 3UR7A 2XG9A 1J12A 3LMYA 4E8CA 2Y2WA 2VCAA 1WDPA 5IFPA 3DHUA 1QOXA 1BYAA 1V0KA 2OSYA 1PX8A 3ZT5A 5M3WA 2XVPA 3VIKA 1W3LA 2VURA 5A6MA 3WNKA 1GZJA 1TG7A 3VNZA 1AVAA 4NRSA 1TFVA 3EDDA 1C92A 1OCQA 2WC3A 5IDIA 3QOKA 4KWUA 2D23A 1E6QM 4PSRA 1HJVA 1JD9A 4A3YA 2EPOA 1EQPA 4MADA 4W84A 2OWWA 1CEOA 2WMFA 3IANA 3WUGA 2WMIB 4AWEA 2D22A 3N18A 1CGWA 2UY4A 3OA5A 1TMQA 3PZOA 3FN9A 3WQ8A 4DWSA 4Z2GA 1S46A 3T0BA 1OIMA 2WWCA 3ARRA 1UZ1A 1B31A 5LYRA 1QBAA 3WH5A 2ZX6A 2X8RA 1O7AA 3II1A 1R85A 5A6KA 1G0CA 3B9EA 2PI6A 1E6ZA 4CD4A 1UWIA 1JYVA 1BAGA 2WHJA 1E5NA 2CKSA 4W7VA 4DM2A 2WANA 2WAGA 3SUUA 3FXYA 1W91A 5CPQA 4CD6A 2QMKA 1C8XA 2UY3A 4MJ4A 1GOQA 1UKQA 1R87A 4E8DA 1F4HA 3S6TA 1B1YA 2NW0A 1E55A 1HJWA 1ZBWA 3FW6A 4F66A 1UHVA 4CN4A 4DUVA 1EDQA 3O2LA 4WKFA 3RDKA 3MUAA 1NWRA 3BCDA 1EH9A 1B3ZA 3EDEA 1V3KA 1E9LA 1SR0A 3VMOA 3MMUA 1VEOA 5HXMA 5I3DA 5BRPA 4R5EA 4OJYA 3MUY1 2J47A 3RMEA 3AXHA 4JFUA 1JL8A 3WEOA 3UEQA 4N0RA 4FF5A 5D8ZA 1HN1A 3ZOAA 1EO5A 3CHCA 3W28A 2OLHA 3AS0A 1J11A 2A3BA 1J9YA 3M07A 5HPOA 3JUGA 2EPNA 1XD0A 1ITXA 1TA3B 1NP2A 4AEEA 2WZEA 4CD8A 3L4YA 5C71A 3WFZA 4AD5A 2WVSA 2AOSA 2DT0A 4RE2A 4NF7A 1G1YA 4HU8A 4JZ5A 1XV8A 2JEPA 5FL1A 4UOZA 1K9FA 1UH3A 3O6AA 5A8QA 5A94A 2Y4SA 1DHKA 1XCXA 1OBAA 1BQCA 2O92A 3T0DA 4BCEA 3SCVA 1FP9A 1KXTA 4P7RA 1VENA 3BAJA 1WDRA 4A3HA 5IHRA 2AAAA 2ZUNA 3GBEA 3MU7A 5LA1A 1RPKA 2JALA 3BSHA 4B3LA 4J7RA 1H0GA 3WNOA 1ISXA 2OYMA 2ZIDA 2CBIA 5DO8A 5DMYA 3TOPA 4AZ6A 4MDPA 1CGUA 1CXIA 3AYSA 5HPCA 3B8SA 2E9BA 3CUGA 4AD4A 4V28A 3POHA 3WQ6A 3VU2A 3WD2A 5BXRA 2CESA 1NH6A 4QCFA 2WMKA 4LQ1A 1I75A 1E6RA 3L4UA 3BLPX 4MNMA 5AYBA 4CN6A 3BAXA 4QLJA 2WZHA 5CGMA 3UERA 1ISZA 2D2OA 2WVUA 3W38A 4XX6A 1E15A 1FFRA 1HP5A 3K8MA 1CYGA 4BZYA 1H09A 2OYLA 3LPFA 1MFUA 1JAKA 2FHCA 4P8WA 4AD2A 2ESCA 4AZCA 4FLSA 4WLCA 4AMCA 3WH8A 1Q6DA 4P7NA 1O6IA 4D1JA 1ITCA 1UA3A 1UA7A 3GH7A 3N15A 4W8AA 3CZJA 1XYFA 4X0NA 3MSGA 5A8OA 1E6NA 1J18A 4E4PA 4PEEA 3SCNA 1DWJM 4H2CA 3PHAA 1Q6FA 3OGVA 5CPTA 1HX0A 1X1NA 1UR1A 1QNOA 3LPGA 1V3JA 1E4LA 4JKLA 1V0NA 2DPEA 4MB3A 4MB5A 3K4DA 5C70A 4GZIA 2GDVA 2A3HA 4W86A 1V02E 4MNKA 4RE4A 4PMUA 1K9TA 4D6EA 4JIEA 4JKMA 1OD0A 2BVYA 2NT1A 3SCOA 5D4YA 3CBWA 1C7TA 3WKZA 5A6LA 3GXIA 3A4AA 2G4FA 4QFUA 1D2KA 3L4TA 2VJXA 5TD4A 1GOOA 1ODZA 1UG6A 2WCGA 4HMCA 4AZ5A 3CZ8A 1R86A 5BXPA 4DWSB 1C90A 4UZSA 2D0GA 3RM8A 3FHQA 3WQWA 4X0VA 4BQ4A 3A47A 1E3XA 1FFQA 4AIEA 2IXUA 2CETA 2E8ZA 2BVTA 1GQIA 3ARSA 3ZJ7A 1E5JA 3OG2A 2EPKX 2O9RA 1HNYA 1GCYA 3PZNA 5I77A 2FH8A 3D3AA 4LPCA 3AHYA 2WKGA 1EXPA 3OB8A 4BQ3A 1KXVA 1XH0A 3W81A 1W32A 3MO4A 2DQXA 2X05A 2E8YA 3ECQA 2QPSA 3ZJKA 3SCUA 3AIBA 4CU8A 4Z2HA 4ZFMA 3GNPA 2QPUA 1BG4A 2XWDA 2J74A 4XV0A 4M82A 3A3HA 1US3A 1U30A 4PN2A 2ZX8A 1QNRA 3QGVA 4QLLA 3L2MA 3AOFA 4TX8A 3CGTA 5ABEA 1IV8A 1W3HA 4ZXLA 1L8NA 3EMQA 3WNNA 2WVTA 3VD5A 3EDJA 1NWUA 2GDUA 4GKLA 2XYLA 1EDGA 2GK1B 1V08A 2W4XA 4JCMA 3F5JA 3SEPA 1BYDA 1Q6GA 7CGTA 3VGEA 2JEQA 3ZSTA 5A6BD 1UH2A 2YOCA 2GJRA 1KWKA 2DT2A 1TE1A 2ZXDA 1R8LA 3U7BA 1CGTA 1GJUA 4D1IA 4TVUA 3BAIA 4UTFA 4P8UA 3UG3A 2CPUA 3ARYA 2G41A 3AISA 2VQTA 1UKSA 3WF4A 4W88A 1JXKA 3VGBA 1E6XM 2BS9A 5IHSA 3FAXA 1W1VA 1P6WA 5GPRA 3ARPA 3SCWA 1WDSA 2CITA 3VMPA 3WFLA 4QLKA 2OWXA 2DIEA 1CBGA 1R7AA 4MTVA 4H8VA 2UY5A 4HA3A 3PZMA 5FIPA 3APGA 3W29A 3PTMA 3TTOA 2XSBA 1CNVA 4HMEA 1Q6EA 3VIJA 1JZ8A 1UD8A 3AIQA 1VBRA 2CXGA 1H1NA 2UWFA 2ZWYA 2WC4A 4H41A 5E6YA 2VT0A 4ACZA 5CJ5A 4TOQA 2VVNA 4QAWA 1LJYA 3VINA 2FHBA 1QBBA 2YLAA 3SIMA 1A47A 2EO7A 3KL3A 3EDKA 5A8NA 3WUEA 2WSKA 3CZLA 2PWFA 3PTKA 2ZWZA 4JFTA 2QHAA 1HL8A 2BXZA 2DH2A 1QW8A 3VMNA 4FLOA 1MFVA 4HOZA 2J75A 3L4XA 4KGJA 2W61A 4PSPA 5A6SA 2J62A 1J0ZA 3WQ5A 1JNEA 2DSZA 2J7HA 2GFTA 1HVQA 1IT0A 3VM5A 4B15A 5DEZA 4TXEA 5A2BA 5CGTA 2MANA 2ZXBA 4HZ6A 3W6LA 5DT7A 2BY2A 2PB1A 3ZR6A 1OGBA 5CLWA 1K9EA 3T0AA 1ZBKA 3CLWA 5LA2A 2CEQA 3AMCA 2YDRA 3GH5A 1PZ3A 3AMKA 4OUEA 2EQDA 2Y24A 2O9OA 3VX0A 4W8BA 5D9NA 1K6AA 4AIUA 1GOIA 4D71A 1JZ7A 3AMGA 1WZLA 4LXFA 1XC6A 1W9BM 1XSIA 2V38A 4MB4A 2VZOA 1WKYA 1FH8A 1C93A 1LWHA 3CIVA 3MANA 4GQRA 4TVDA 1DTUA 4UQ9A 2ZUTA 2EPLX 3WDPP 2YBUA 1BLIA 1JYNA 2CKRA 1HKKA 4C7GA 4E2OA 2VMFA 2ZUUA 4CUCA 3AHTA 1B0IA 1XH1A 2X1IA 2X0HA 1OB0A 3AZRA 1U33A 3PTQA 3KL5A 1W9UA 1FHDA 4ZENA 2PWDA 2Y8KA 4W7WA 1JFXA 2F2HA 1HT6A 3GDBA 1B2YA 3QOMA 4DUXA 2EEXA 2O9PA 2YL6A 3ARZA 4ZE4A 4J28A 2GVYA 4PMZA 4HU0A 1MQPA 4L4OA 4B9ZA 2WMJA 5AY7A 1BPLB 2DDXA 3SURA 3VIGA 1NARA 3IK2A 1BSIA 4PMXA 4D6JA 4AZGA 2J8GA 3IAPA 1SMAA 4PMYA 4WJXA 1Q4NX 2WVVA 4JFSA 2V3FA 3QHNA 2XFRA 4OZOA 1HKIA 3GTNA 4BA0A 4DWSD 5E0FA 4HOXA 3AQUA 1M01A 1V0MA 3B9DA 3CHFA 1M03A 4MNLA 3N11A 5A2AA 4Q22A 2PF0A 3SCRA 4LYQA 1AQ0A 3WDQA 3AJ7A 1KR0A 1JNDA 4HPGA 3W82A 3BXWA 3WEMA 1OGGA 3OZOA 4F9DA 4PTVA 2B31A 2WZIA 4P7LA 1E72M 3PZGA 3CZEA 2VRKA 6CGTA 2VZSA 1GOWA 2YIHA 1ZB5A 1QHOA 1TR1A 5FKYA 3VIPA 1JG9A 3CMJA 4XB3A 3FHAA 5A2CA 5HBFA 1VFOA 1JYWA 3W0KA 1GNXA 1KCLA 3WF1A 1ZL1A 2YDQA 1Z32X 2D20A 3VO0A 3BH4A 3EYPA 1HJUA 4M8UA 4CU6A 5IFTA 1RH9A 4PCTA 4WF7A 4Q7NA 1BHGA 1JFHA 4AD0A 1M04A 3CHDA 4AXNA 1XSKA 3J7HA 2A3AA 5EBAA 2WSPA 5D8WA 4LYRA 4DUWA 1DWHM 2WYSA 5JIWA 2WBKA 4U5KA 3PZUA 4EAMA 1LL7A 1MWOA 2XTKA 4M29A 2JIWA 2D1ZA 1C7SA 1PIGA 5ABHA 4CVWA 4UFKA 3EMCA 5BCAA 5AYIA 2WHKA 4ZE5A 4JCLA 5LA0A 2CERA 1GHSA 1LLOA 1LQ0A 5FCZA 3WD0A 3ZQ9A 1UD6A 3PBGA 4JKKA 5FOOA 3BGAA 3K8LA 2J7DA 3WUBA 3N13A 2DIJA 4AD1A 1W3KA 1WPCA 5CQ1A 3NUKA 4HZ8A 1ISYA 3VGFA 3U5YA 1GQLA 4HA1A 4XZBA 2WXDM 1HJSA 1WCGA 2VCBA 4J3TA 1TVNA 1PZ2A 3IJ7A 4ACZB 3NJ3A 2X2YA 1DWFM 3ZSSA 4H7VA 1QI3A 3AIVA 1PBGA 4EKJA 4MNJA 5M17A 2J7BA 3WEZA 3WH6A 2RGLA 1CECA 4PTXA 2J8FA 1CXKA 1UD2A 1SFSA 2CCRA 2VO5A 1QHPA 5JH8A 1TZ7A 2J7CA 2E4TA 2W62A 5GQBA 2WNWA 3MUIA 3F5LA 3OZPA 1FP8A 3AMLA 4PMNA 3W26A 2BY0A 2EBNA 3D5HA 4GINA 1B90A 1B3VA 1KGWA 2TAAA 1CIUA 1CXFA 2ZX7A 3QR3A 2RGMA 1V6YA 4NZCA 1WE5A 3ARVA 1OWQA 2AMGA 1JI2A 3BMWA 2Y5EA 3KEHA 2E0PA 1JZ5A 5CPSA 5AC4A 5JBFA 1GQJA 4U2YA 3WDHA 3THCA 1HP4A 2W66A 1XGZA 1UD4A 2BY1A 4IUGA 8A3HA 3WL0A 1D7FA 2DGAA 4JHOA 2YBTA 1PJ9A 2XPKA 5DT5A 1F4AA 2WMGA 4YPJA 3CHEA 1ESWA 2A3CA 3WF3A 3NSNA 1E4MM 1UR8A 4CCCA 4YN5A 2G8ZA 3ZR5A 5CG0A 1BYBA 4U3CA 4W8LA 2VVSA 2CHNA 4GI8A 4EANA 4GXPA 2XUCA 3T2OA 5F7UA 1E0WA 5I0DA 1MQRA 5A3HA 2QV4A 1QNSA 1GHRA 4CN1A 4RE3A 3VIMA 4P8XA 1DWGM 1W3JA 1ZBCA 4TX6A 3BAWA 3M7SA 1XSJA 4U31A 2VR5A 1GQKA 1BFNA 3ARXA 1E0VA 5IXEA 2WMHA 1JZ6A 2W92A 3SUWA 4AW7A 1LG2A 3A6OA 3K46A 2HISA 4GQQA 4PMRA 2DSVA 3VIOA 4UFJA 3WQVA 1M7XA 4P8VA 2BHZA 3DC0A 5CSYA 2YA1A 2IUZA 2ZUSA 4MAVA 4CCDA 2XSAA 3W4RA 3UETA 3FAWA 1JAEA 4UQEA 5CLTA 3WY1A 4WSKA 2XIIA 1W9PA 3L2LA 1UQYA 4M24A 1GW1A 2WPGA 3A4XA 3GNRA 3K8KA 4UR9A 1QNPA 4OBSA 5I5RA 1CGYA 1V3HA 1V6UA 1ODUA 2BVDA 2WMIA 3VVGA 2VI0A 3N12A 3VDAA 1W9VA 3F4VA 1WP6A 4TVCA 1HKMA 1W9DM 2PWHA 1WB0A 3S2CA 1WDQA 4GPNA 3SCSA 4D6HA 1A3HA 4PMVA 2DEPA 4N42A 2CNCA 5I2UA 2VX5A 3TONA 1DEDA 4AZBA 2VTFA 1XH2A 4M56A 1MW2A 2O9TA 4CCEA 4D6IA 2V3EA 1KXHA 4ZXOA 4H8HA 3AYRA 1MW0A 4KGLA 2JE8A 2CBVA 1ZJBA 2D0HA 1UWUA 1EHNA 2VOTA 1B3WA 1MW1A 5E70A 3W53A 2WC7A 1RP8A 4WKHA 2ZXQA 4B16A 1US2A 4D6DA 3BC9A 1ZJAA 2G3MA 3KWXA 1E3ZA 4Y7EA 3VUPA 4HTYA 4YHEA 3CUIA 1C8QA 2J7FA 3LPPA 5ABFA 3VDBA 3KE0A 5A6BA 3VD4A 4FLQA 2ZE0A 2YJQA 2PWEA 4P7QA 3WNLA 5DF0A 1Q6CA 1Y7VA 4UFLA 3U5UA 1UWTA 2XWEA 2BY3A 3OLDA 4EE9A 3BMVA 5GNYA 2BHUA 4FK9A 7A3HA 2CHOA 4XUYA 4QP0A 3VD9A 4U33A 2WBGA 1V6XA 1MXGA 1EIBA 4J3SA 2D3NA 1E71M 1EDTA 2J78A 2XHYA 1KWGA 4KRUA 5A95A 4YHGA 2X0YA 3M46A 1C91A 1CXLA 4AZHA 4UOQA 2Z1KA 2XFFA 5I6SA 3QHMA 1KR1A 2GJXA 1JZ2A 1JGIA 3RJXA 2ZOXA 3FY1A 1UKPA 1EOKA 4JFVA 1CLVA 2D0FA 1ZU8A 4R27A 1V3MA 1OIFA 2E3ZA 1LG1A 1DP0A 1H2JA 6A3HA 1KQZA 2DSWA 1NOUA 2W5FA 2YL9A 3VIIA 3WBAA 2F8QA 2VRJA 1PEZA 4D72A 1TUXA 4OOUA 3WD4A 1EA9C 5EFFA 1XHGA 1QPKA 3SUVA 1VEMA 4F8XA 3ZM8A 2DH3A 3RJYA 3EDFA 1JIBA 2VZVA 1UZ4A 5HNNA 1UR0A 2C0HA 2A3EA 3ALGA 1VBUA 4H04A 1V02A 3UCQA 2ZUVA 1ZBVA 1LF1A 4DWSC 1JZ4A 1B3XA 4AZCB 1VFMA 2XGBA 3VDHA 1AMYA 3UG5A 5FL0A 4PUEA 4OOZA 1X6NA 3GYCA 4Z2IA 4NSBA 1BVNP 2XJ7A 3W25A 2VX6A 3N04A 4OBRA 4ATWA 3CUFA 2C8NA 1G01A 1KGXA 3O9NA 3ZMRA 3ARQA 3BAYA 4PTMA 2J4GA 3NIYA 4OIFA 3WDJA 3PZTA 3WQ4A 1GOKA 4CGTA 1H5VA 4AC1X 1QVBA 3PZIA 4PMOA 4PTWA 3BLKA 1R7OA 4CU7A 2W67A 3ARUA 3RPMA 2BNJA 2Z1SA 2BV9A 1GONA 3UESA 4M1RA 2CBUA 2J25A 5D9OA 1VB9A 3GXMA 4LYPA 3RM4A 4BS0A 3GXDA 1MQQA 5DFAA 2GUYA 3IJ8A 3WNMA 1BTCA 1BGGA 3MV01 2DT3A 2V3DA 3MUZ1 3VIFA 2VNCA 2QF8A 3BAKA 1UQZA 1HXJA 1XRVA 1M53A 3CMGA 2VR4A 3UR8A 2NT0A 3DYPA 5BRQA 1H49A 3F5KA 3VGGA 3ZIZA 4W5UA 1YHTA 4HOWA 1FH9A 2E9MA 2XIBA 3N17A 3ZT7A 1JDDA 4FLRA 2WLYA 2BFGA 1UKOA 1EQCA 2DT1A 1UWSA 2ZUWA 1H0IA 3WN6A 3SUTA 1B30A 3WENA 2VL4A 3G6MA 4ZEPA 3VNYA 1E70M 1JDCA 4IISA 1CWYA 4KH2A 1OM0A 1QHZA 2WCSA 1HF6A 3MMWA 1BYCA 5M03A 3VM7A 3WELA 3G6LA 1H41A 3PN8A 3CO4A 1V6VA 8CGTA 4UQBA 1H11A 3LPOA 4GI9A 4F9JA 3OGSA 2BHYA 1JI1A 4S3JA 1E1FA 4HZ7A 4ATLA 2G3NA 1EOMA 5JUVA 2XVLA 4HP5A 2WLZA 3OBAA 2DSKA 1IZJA 3AIEA 1E73M 3AZTA 2XVGA 1WZKA 3AICA 2WB5A 3E1F1 4C7FA 4J27A 1QI0A 3VDCA 4JL1A 3W27A 1AQMA 3AIRA 4MPKA 3K4AA 3VD7A 1HIZA 3WDIA 1UR2A 5KEZA 4HPHA 4ML4A 2OSWA 1CGVA 4PCSA 2YA2A 1J0IA 3VTRA 1WO2A 4MB1A 1WAWA 1E6SM 5ABFB 3EBVA 1OINA 4NI3A 3EMZA 3ZT6A 4P7OA 1J0YA 1NM9A 4URIA 3AZSA 4BF7A 4IM4A 1KCKA 3N1AA 1H4PA 3OLIA 1KBKA 3VGHA 2WM0A 1V03A 4U5IA 3PZVA 2YDSA 3AHXA 4J3XA 2W91A 5I24A 1UH4A 4UFMA 4WSJA 4UQCA 2WWDA 5I78A 4U3AA 1FOBA 1NQ6A 3L4ZA 1CZ1A 1QW9A 2FGLA 2GK1A 1WZMA 5EB8A 4UFHA 4GI6A 1UD5A 1FA2A 4WK9A 1OT1A 2F61A 1VIWA 2YLLA 3A4WA 2J7GA 4C7DA 1UR9A 2C7FA 2GJXB 2PBOA 2Y8VA 1V6WA 1VAHA 5HDRA 1MW3A 3MV11 3T09A 3GBDA 6TAAA 1PAMA 2Q8XA 1PX4A 3DHPA 1JDAA 5CZKA 1ISWA 1JD7A 3VOCA 3FNDA 4PYSA 1MVYA 5E09A 1J01A 4J3VA 1B3YA 3I3EA 7TAAA 1SYTA 4CVUA 1HKJA 3BCFA 1KXQA 4J3UA 5M5DA 3ARTA 2OYKA 1UD3A 2EXOA 4UFIA 5D9MA 4KRTA 4RL3A 4D6FA 2G3JA 4V27A 3T2QA 5HOSA 1N82A 1OGSA 4OKDA 4UQAA 2EJ1A 5A8MA 1W1YA 1GOMA 1W2VA 1E43A 3RILA 1VJSA 4EK7A 4B9YA 1CXEA 1NOWA 3AXXA 1NWSA 1KBBA 3WF0A 3U7VA 2XFYA 3W37A 1LWJA 3VKKA 2PBGA 4DM1A 3T2PA 2V5CA 1WZAA 3THDA 1BVZA 4J3WA 1PPIA 4TTGA 1RP9A 3NDYA 1JXJA 3M6DA 3GM8A 3ARWA 1W1TA 1I1WA 4V2XA 1XCWA 5E9AA 3T08A 3WIJA 1J0JA 4AYSA 3AS3A 5BROA 2QMJA 3SCQA 3WNPA 3OLGA 3AIUA 3ZO9A 2FH6A 1E6PA 1QI5A 2FHFA 4PRWA 1V3LA 4GO8A 3K1DA 3I3BA 3WMCA 3NSMA 2W63A 3L4WA 2ZXAA 2GJPA 3ZJ6A 4D6CA 5JBEA 1IZKA 3AXIA 2VZTA 5JBDA 2VCCA 3OLEA 3NSXA 1LL6A 2WW5A 2OWCA 3VGDA 1VJZA 3TTSA 1E0XA 1QI4A 4Z2JA 3HU7A 2JF7A 4PUDA 1KQYA 3WMSA 1TVPA 1E1EA 3WL1A 2VUYA 3VX1A 4CD5A 4M81A 2EPMX 5GNZA 1MXDA 2CIPA 4FMVA 1WNOA 2WHLA 2XM1A 1L0PA 3DYOA 1NWTA 3PZ9A 5I23A 3AMDA 1VF8A 3GXFA 2JFEX 4WIWA 3DECA 3AS2A 5A1AA 2VZUA 1MYRA 2YL8A 3CTTA 5ABGA 4UOJA 1YQ2A 3MMDA 3WD1A 3I3DA 1GJWA 3VD3A 1RD6A 3IJ9A 4LX4A 1G5AA 5A6JA 1W1PA 3CH9A 1K9DA 1VFFA 1UOKA 4D6GA 4H8UA 5D9PA 5BWFA 4QDMA 5EFDA 3AROA 1CGXA 4CKQA 2CBJA 2WVVB 3AHVA 4JAWA 2J79A 4JL2A 1VEPA 1OSEA 4S3KA 2XM2A 2D24A 1TCMA 3UG4A 3GH4A 3WF2A 4X9YA 4AISA 2ZX5A 2VX4A 2X09A 3OGRA 4JFWA 3AIWA 3HN3A 1PX3A 2OSXA 4W85A 1CDGA 2VRQA 5I79A 1UR4A 1QI2A 4AZ7A 4HA4A 2ZUMA 2J77A 1D3CA 4GO9A 1UKTA 4IPLA 4TUFA 1BG9A 4JHZA 4W5ZA 1GVYA 3AFBA 4IPNB 1BGAA 5BYWA 4F79A 3CUHA 1FH7A 5E0CA 5BXSA 2BXYA 4U2ZA 2QLYA 4LGXA 3ZJ8A 1HL9A 1B9ZA 1VFUA 3CUJA 4L4PA 3B9AA 4B3KA 1SMDA 4PMQA 1JF6A 2YL5A 2PWGA 2J7EA 4UQDA 1UYQA 3WSUA 3AS1A 4MAZA 3CZKA 2YKKA 1CTNA 2HVMA 1V0LA 2PC8A 4A4AA 4GIAA 1CPUA 4AY1A 1JZ3A 3NDZA 1GVIA 1GORA 1UWRA 2YA0A 2XVNA 2WK2A 1H3GA 1V3IA 2FGZA 1E4IA 1OT2A 3VPLA 3N9KA 1NP0A 3MKKA 3SCPA 2WCAA 3KZSA 1KB3A 1W9XA 3TA9A 5CXPA 4MJ2A 4AD3A 3KL0A 1ECEA 1TA3A 1G9HA 3POCA 4UNIA 3NCOA 4AEFA 4MDOA 2WHMA 4KMQA 4PMDA 3MS8A 1AQHA 3HMCA 3WD3A 3TTQA 3IAQA 3W24A 1C8YA 2E40A 3HJEA 3RIKA 1ISVA 1FHLA 1J10A 4W7UA 2ZICA 3TTYA 3DYMA 1HVXA 4PBGA 3ALFA 1G94A 1CXHA 1XD1A 5KZ6A 1E40A 4NRRA 3AI0A 2VQUA 3CPUA 2G3IA 1EHAA 5A8PA 3WBEA 2GSJA 3SUSA 1CLXA 1XYZA 1X6LA 2IXVA 1DWAM 1EO7A 3VIHA 2CYGA 1E4NA 1HJXA 4M80A 3NYDA 1J0HA 1GUVA 4CD7A 5FD0A 4TTUA 3U57A 2VX7A 2JF6A 3WH7A 3CZGA 3BSGA 3AHZA 4HMDA 5JIPA 1I1XA 1QNQA 2E9LA 4UCFA 4AZIA 3RM9A 1VRXA 5E6ZA 3WMBA 5A69A 1UUQA 5A6AA 3L4VA 2ZX9A 5BXTA 3W6MA 1JF5A 4W89A 1U2YA 2UY2A 3MSDA 1PIFA 3QHOA 5AC5A 4W87A 1LL4A 1JYXA 4UZUA 1UWQA 1ZS2A 2D3LA 3GZAA 1NOFA 4BQ2A 3VILA 3GNOA 4ATDA 5C8BB 4Z2LA 5EMYA 4W93A 1HJQA 2FDMA 5GNXA 4Z2KA 3WH9A 4QCEA
chains in the Genus database with same CATH superfamily
3VAVA 3PJXA 4QHRA 3EB4A 2XVKA 3PZQA 1C9HA 2JIEA 4FNTA 1I2PA 1TIMA 1QPRA 4RXFA 5CZSA 3T42A 1KGUA 1OD8A 2YXGA 2TRSA 2V3GA 1E56A 5CSUA 2CHRA 1E51A 1C3FA 3LX9A 1IX5A 3RCNA 2V5DA 2FZBA 1LLZA 2XG9A 4E8CA 2Y2WA 3I68A 2B5UB 4UCGA 1WDPA 3MJYA 1GYNA 3LXCA 2QEZA 2PURA 1Q7QA 3L7RA 4UTWC 2Z6IA 3KVKA 4MY9A 2J13A 1S5TA 5M3WA 1L6YA 2VURA 3FCPA 3FVDA 5HQLA 3WNKA 1GZJA 4NJGA 1PHQA 2PN0A 2PBCA 3L67A 1XYAA 1FQ0A 1OCQA 4OECA 4KWUA 4Q32A 2A7NA 3OA3A 2D23A 4LAMA 4PSRA 1JD9A 4IG2A 4H6EA 3OJGA 1W8GA 3THAA 3KM8A 4W84A 2OWWA 3IANA 4XVEA 1PBKA 4IOTA 3UPBA 1CGWA 3OA5A 3PZOA 4M7TA 5BW6A 4DWSA 3CB3A 3PUGA 3T0BA 2ZDRA 1UZ1A 3R8HA 1H60A 1YDNA 4G6CA 2OT1A 3IVTA 2X8RA 5FF0A 3G1YA 4XO7A 3WYZA 2PC4A 1R85A 5A6KA 2FMOA 2E1WA 1RD5A 1UWIA 1P5BA 2OG9A 1JYVA 5D38A 3GY1A 2WHJA 1E5NA 4W7VA 5I02A 4G56A 2RQSA 2VCDA 4GY1A 4JQ2A 1QDSA 1B1YA 2NW0A 3LHVA 1E55A 3GIQA 1ZBWA 3FW6A 4F66A 4CN4A 1EDQA 1P5QA 2FYMA 2WQPA 3RDKA 3S1GA 3W3OA 3DI0A 3IIZA 1Y65A 3N4AA 3S1VA 4GC4A 4PA8A 1V3KA 5D2WA 1E9LA 3QZEA 3VMOA 5HXMA 3PB2A 5I3KA 5I3DA 3DFOA 5BRPA 2AL2B 4R5EA 3ITCA 4QE1A 4OJYA 4KEZA 3RMEA 3IPWA 4GE8A 4Y8FA 3W28A 4KQZA 4YJ5A 3M07A 1ITXA 3MJMA 4DELA 2XH7A 3W7MA 5T9CE 4AD5A 3LY0A 3UYCA 3DFSA 5CBJA 1PKYA 4K8EA 1OK6A 4JZ5A 1XV8A 4XKYB 5FL1A 3CUXA 2QUTA 2FZ9A 2Z2AA 2Y4SA 3A12A 1KA9F 3KRBA 1BQCA 3TYZA 3SCVA 1DXIA 4LNCA 1OFOA 4HJWA 3EX6A 2QUMA 3U0HA 4JTSA 1L8PA 5FEXA 3NQMA 3T40A 3R58A 2JALA 3E02A 5EPDA 3DFTA 7TIMA 4B3LA 5B8IC 2BX7A 1LOSA 1PKLA 5CC5A 1DJYA 2ZIDA 1IWPA 3CLMA 4MDPA 4FHAA 3B8WA 4FNPA 2QVNA 3Q58A 4I6VA 1WUFA 5BXRA 1JGMA 2WMKA 4ERIA 3BLPX 4EAYA 3C52A 1R3TA 3KW3A 3F7JA 3MYPA 1S3TC 5CGMA 4QJ5B 3UERA 1VFSA 4DRHA 2D2OA 2WVUA 3UJFA 1E15A 1VBJA 4A2RA 1CYGA 3RU6A 1H09A 2OYLA 3LPFA 1MFUA 3W2KA 4WLCA 4AMCA 4NJJA 4EXAA 1Q6DA 1O6IA 2Q8ZA 1UA3A 3QR1A 5LNUA 3V0SA 3NQAA 2ZZ4A 3W7OA 6ALDA 4B5VA 1M1BA 1R2SA 3C86A 3V36A 4GUIA 3CZJA 3LQLA 1V7YA 4X0NA 5HR7A 1H63A 2B81A 4EWND 1Y8BA 1DWJM 4IMGA 4UTMA 3PHAA 4EF9A 3NRKA 3WBXA 3N2XA 4DRMA 5CPTA 1WYIA 1TE6A 1X1NA 3Q2DA 4DROA 3LPGA 4RNHA 3HTWA 1P1XA 1E4LA 4HD5A 1V0NA 4GZIA 3MA8A 3UBPC 4MNKA 1FY6A 3IUHA 4RE4A 3WLNA 2V8ZA 1P7TA 2NT1A 1K8XA 2J6XA 3CBWA 2ON3A 3TXZA 3G0UA 4J4KA 3BMBA 4ZPWR 4IG2B 3EWXA 2G4FA 3MCMA 4FSAA 3VNDA 4QFUA 4OVXA 1PB0A 2CLKA 3L4TA 3PUOA 1LDCA 5I3GA 4LCSA 1ODZA 1UG6A 1ZJHA 4DWSB 3PSWA 1ZK6A 3LBOA 3B9OA 1C90A 4UZSA 1H51A 1PWLA 2HJPA 3LHUA 1LWIA 3A47A 1E3XA 3WLOA 4PBFA 2C1HA 2E8ZA 4H7ZA 1G69A 4GNJA 5C6MA 3DEQA 1E5JA 3BANA 4QISA 5G1YA 4KCWA 1WBJA 1VHCA 3UVIA 2ZZ2A 3A23A 1PYFA 5I77A 2WKGA 4ES4A 4BQ3A 1KXVA 2X05A 1OABA 4LCQA 4LF1A 3SCUA 2GLKA 3CT7A 2XPAA 1TWSA 4GX9A 3GNPA 3AUOA 2XH0A 3O5EA 4LCRA 4N2YA 1R3VA 2J74A 2F38A 1QNRA 2ZBTA 5FF2A 3CGTA 3RF9A 2GJLA 4ZXLA 1L8NA 3VD5A 1CB2A 3NDOA 1GPWA 1NDZA 3G1RA 2XYLA 1EDGA 3RU8X 4A05A 4ZOEA 1BYDA 4C90A 3VGEA 2Z27A 3L9CA 2QUNA 4ZQMA 3W1RA 2GJRA 1KWKA 1FKJA 1NEYA 1MZHA 2CZFA 4D1IA 3DG6A 3FDGA 4IL2A 4MVAA 2DG9A 3W7RA 4LB3A 1QNVA 2HNHA 3WQGA 1OZQA 3HBLA 3M0ZA 1UKSA 2GUBA 4W88A 1A5OC 1M7OA 3FAXA 2C91A 1W1VA 3SGZA 4KPLA 1QCWA 1WDSA 3TYUA 3WFLA 2VEFA 1ZUAX 4QLKA 5CG7A 1R7AA 2XH2A 1EPXA 4HA3A 4O53A 3EX2A 4DO7A 2WSQA 3CAKA 1DJXA 3A4JA 1H7NA 2DW6A 4JTGA 3AIQA 3BOXA 2CXGA 1BKFA 4H41A 3L0KA 5E6YA 4RDWA 3TAKA 3M47A 4DO4A 4L65A 1DE6A 4QAWA 2PRLA 1QO2A 1K7EA 4REQB 2YLAA 4DJDA 5A8NA 3WUEA 2PE4A 4AVNA 1UP0A 2PWFA 3PTKA 2ZWZA 3UZ5A 3CL7A 1HL8A 3GNDA 2BXZA 2QJNA 4XD3A 2G50A 4MM1A 5C9RA 3L21A 3L4XA 4PSPA 5DO2A 4ZB5A 3N6QA 5A6SA 1UWAA 2J62A 5I06A 4U84A 1J0ZA 3WQ5A 2R1PA 4I8YA 4Q8MA 1XGEA 1HVQA 1LQAA 4B15A 3O5RA 5DEZA 1Q63A 4Q6JA 3C5QA 2I1OA 3P5YA 2MANA 2ZXBA 5DT7A 2Y61A 4LB4A 2QJGA 2ZZ5A 1OGBA 1YXCA 1K9EA 3DXIA 1W1ZA 4IQCA 3CLWA 3CH0A 1PZ3A 4OUEA 2F6KA 3O15A 1TRDA 2O9OA 2YR1A 4W8BA 5D9NA 4D71A 1GOIA 3B03A 3H22A 3QFWA 3RMJA 1WZLA 3OOBA 1W9BM 2V38A 4QDPA 1EYMA 1FH8A 1C93A 1EJRC 3WQDA 1NF7A 1UJPA 3LS9A 1TWZA 5FJIA 1YTDA 4GMEA 4DJED 3KAOA 3FLUA 3NVTA 3BQ6A 1ZFJA 2JKEA 2E6DA 4ERGA 1CT5A 4GGQA 3M0HA 3W76A 1OC5A 2FJUB 1VR6A 1OB0A 3MDYB 3AZRA 4ZENA 2PWDA 3M4HA 4C1LA 3XIMA 1RVGA 1HT6A 1B2YA 1KM6A 4ZPTR 4IPPA 3A3WA 2F2DA 3CV2A 4R7OA 4FI4A 4J28A 4PB5A 4DO5A 2V82A 4PMZA 4FNSA 4FO4A 4L1XA 2WMJA 2E5BA 2VFEA 1GYMA 2YDAA 4FXJA 1BSIA 3CEPA 4WJXA 4O1DA 2WVVA 2AQWA 4DRQA 3N9RA 2XFRA 1VFLA 1HKIA 4DWSD 4UR7A 1P6CA 1Q65A 3OVQA 4MNLA 4Q22A 1SJBA 1AD1A 3SCRA 2O55A 5G4WA 1AQ0A 4U10A 3CAWA 3SAZA 3APTA 3BDKA 3W82A 3P5ZA 1BWLA 5DQPA 3I7RA 1DV7A 1J5SA 3PULA 3OZOA 2X7VA 4S3CA 1XLEA 2R94A 4F9DA 1OC6A 2B31A 4P7LA 3G22A 3TC5A 4PUWA 5GJMA 2OR2A 3UWWA 2WJZA 1V51A 4WGXA 3OODA 4JYFA 4L5ZA 4O4WA 3VIPA 1JG9A 3TROA 4XB3A 2OT0A 4BJHA 4G2DA 1A5CA 3O7UA 1GNXA 2YDQA 4E2DA 1F07A 3KUMA 4AVOA 2Z1BA 4NAFA 4MFEA 1SUXA 3GSMA 1HJUA 2ZQUA 4H4IA 4CU6A 4Y9NA 3PUDA 4PCTA 3HQ1A 4AWTA 1UBPC 2PFHA 4V33A 3TMLA 4AXNA 3J7HA 4GLEA 1TCOC 2WSPA 1RLDA 3STFA 4EXQA 5JIWA 2WBKA 1EF3A 4U5KA 4AX6A 3UA4A 1LL7A 4JFIA 3TOYA 1C7SA 5DMLA 1EC8A 3T07A 5BCAA 4DLMA 4N9DA 1PIIA 4RE0A 5D02A 1JUEA 3KLKA 5LNRA 3GVRA 3G8RA 2FKEA 3KVMA 5BU6A 4DAFA 1A4LA 1EF2A 2J7DA 3WUBA 4BHYA 3NXLA 1IQ8A 3CT2A 1FWBC 3B8UA 3NUKA 3K4WA 4HZ8A 3SB0A 3TYDA 3I7SA 1BEUA 4W9QA 4LNYA 5D2TA 4ZODA 2X40A 3DDMA 4J3TA 3T0CA 4JR5A 1J6YA 2RKXA 3ZSSA 3V5CA 3AIVA 1YATA 3GWQA 3N6JA 5M17A 4C6DA 1TELA 3WEZA 2RURA 1J4EA 2C15A 3EOSA 1VYSX 2VO5A 1TPH1 8RUCA 3S0CA 4D8LA 1EYEA 2NWRA 4JX5A 3WH0A 2WNWA 3GTHA 2KO7A 3MUIA 4YMZA 4XBKA 3W26A 2EBNA 1B4EA 1Q13A 3D5HA 5FJUA 1B90A 4IT1A 1KGWA 1D7KA 4U85A 3H2OA 1V6YA 5I3JA 1Y5XA 2B7QA 3PS7A 2V81A 4J40A 4ZZ9A 4FX7A 2QS8A 4L6HA 4YCOA 3QR0A 2Y5EA 2E0PA 3B06A 1Q6HA 3ITVA 3THCA 4GIEA 1HP4A 1KM5A 8A3HA 4ML9A 3WL0A 1XFCA 4H6RA 3BOLA 1WA3A 3ZFHA 5HWNA 1XIEA 3CHEA 3WF3A 1E4MM 4R7WA 1GVSA 4YVPA 4I9JA 5EL1A 1XWYA 4YN5A 3A22A 1F5ZA 1TWIA 5CG0A 5FSDC 2VVSA 3FK4A 3S9ZA 4ODKA 2XUCA 5DANA 4AY8A 2DVUA 2HVOA 1HW6A 1E0WA 4KBXA 2W6RA 1MQRA 4UTUA 1QPNA 4H1ZA 1QNSA 4CN1A 1XKJA 1ZBCA 4TX6A 4U31A 2VR5A 3PB0A 3L2IA 4DYJA 3UY7A 3PR9A 4EVZA 5IXEA 2WMHA 1FUYA 3UPWA 1LG2A 2RH9A 4PMRA 6ENLA 1A3XA 2KR7A 1YADA 4Z1CA 3KAHA 2DZXA 3GC5A 3A13A 1QT1A 1R9ZA 2YA1A 3M43A 4GJJA 4TW8A 4B90A 3CV6A 3JZEA 4CCDA 2XSAA 4MJZA 3UETA 5DCDA 1R9YA 1TWWA 3FAWA 3T7VA 2MNRA 3HPZA 4GVGA 4XO6A 4WSKA 2XIIA 3N6HA 1UQYA 1DQUA 4KCUA 3K8KA 4GUGA 1PTAA 1ZAHA 5I5RA 1FKFA 3UXKA 2X16A 1V6UA 4HKPA 1ODUA 2BVDA 4C6LA 4JHMA 1E9IA 2EG8A 2BVWA 4DF2A 2PWHA 1LUCA 2GGEA 3S2CA 3ERPA 4L80A 4B4HA 2ABAA 4GPNA 4LAWA 3W7CA 3HO8A 1A5BA 2DEPA 4Q8PA 3IGHX 2CNCA 2DV0A 3MTWA 3UR5A 1FKXA 2VTFA 4TV6A 1F76A 1XRFA 1UUOA 1KT1A 1WXZA 2P50A 4D6IA 4ZXOA 4H8HA 3AYRA 3SGGA 4KGLA 5D37A 1OG0A 2CBVA 1ZJBA 1UWUA 4L3NA 4NAFB 2PA6A 4E6MA 1B3WA 3W53A 2WC7A 3VNLA 1Q6OA 4FNRA 3KWSA 1ZJAA 3KWXA 1E3ZA 4Y7EA 2J7FA 3LCGA 1F74A 3KE0A 3WLKX 4LAYA 4FLQA 7REQA 4KWOA 1DORA 1KM1A 1MNZA 5LGZA 5JU6A 3WNLA 4L61A 4UFLA 3U5UA 2BY3A 3BV7A 3GDLA 3S5NA 1YBQA 2BHUA 4FK9A 4HJFA 7A3HA 2A85A 3DGBA 3HZ3A 1XINA 2CHOA 2MUCA 4NU7A 1XS2A 2B0MA 3LSBA 2WBGA 1V6XA 1KTNA 1EIBA 3IK8A 2D3NA 2C18A 2XHYA 1TJ1A 4YHGA 1FXPA 3UNTA 2X0YA 1CXLA 4JQAA 2XFFA 4O1AA 3GUGA 3CK5A 3V0TA 1RJQA 4QG9A 3DN5A 3RRAA 4U86A 3MKCA 1IEIA 1B3OA 1EOKA 2D0FA 2C1GA 4WJEA 1OIFA 1LG1A 1DP0A 2DSWA 2YL9A 4K3ZA 4LUSA 2VRJA 1PEZA 4D72A 1XBZA 3H70A 3QMTA 4LEFA 3S5YA 1QPKA 3SUVA 1K1DA 3NQDA 4DPPA 4WR3A 2INZA 1L6FA 2YX0A 1J6PA 1JIBA 1ML1A 1J4HA 1UZ4A 4GI4A 4UTHA 5HNNA 1JCNA 4S3EA 2CLLA 3TC6A 1ZBVA 2H6RA 1B3XA 4AZCB 1YMYA 1IEWA 4O0ZA 5DLCA 3P61A 3VDHA 2ZRXA 4TQTA 2Q3OA 3W1TA 4PUEA 2D73A 3T6CA 1NVMA 4NSBA 1PZ0A 3PPGA 3SQMA 3TCEA 3DIPA 2OEJA 4HNUA 4OBTA 3TW6A 1V4YA 3ARQA 3F03K 1AUSL 4QGCA 2VDGA 2LPVA 4JIHA 3WDJA 3WQ4A 3MHFA 1GOKA 1H5VA 4AC1X 1QVBA 3G1FA 3PZIA 3URNA 1FWWA 4XAZA 3BLKA 4LS0A 3M0JA 4B3ZA 3RPMA 4DJFD 2Z1SA 3UESA 4KQNA 2J25A 2PV2A 1VB9A 3GXMA 4YIWA 3IVSA 1QAPA 2HXUA 1BTCA 2DT3A 5FJPA 3BAKA 1VQTA 2ALDA 1M53A 3UR8A 3EY6A 3DYPA 3DERA 3GFZA 5BRQA 4IQ2A 4F3HA 1VRDA 1KT0A 1OY0A 5LIKX 3VGGA 2BP1A 4FXRA 2XIBA 3OYXA 4RKAA 1TV8A 5HA7A 4FNQA 4FLRA 2WLYA 2BFGA 4MLRA 1EQCA 2DT1A 4DZIA 1UWSA 1S2AA 1H0IA 4Z42C 2ZKMX 4E8GA 3VZXA 1NY1A 1SSGA 1AJ2A 5EMMA 1PINA 1OM0A 3G3MA 3MMWA 2Y7FA 2PGFA 3VM7A 4Y9AA 4JIPA 3LZ3A 5KZEA 4F0MA 1SU5A 5EMUA 3P2VA 3NZQA 2QDEA 3QEZA 1JI1A 1Z8AA 1FKWA 1ZP3A 3SQSA 4ATLA 3PNZA 5KITA 1IT8A 1EOMA 2P76A 4S3AA 5EY5A 4O19A 1XPYA 2WNNA 1U1UA 1IZJA 3AIEA 1E73M 3DI1A 4UDMA 4NG3A 3VKBA 4XAGA 4H6KA 2WB5A 4I3GA 4C7FA 4J27A 3O5JA 1QI0A 3VDCA 3O0KA 3W27A 3K4AA 1A0CA 3AIRA 1NDVA 3WDIA 1RUSA 1TPDA 1CGVA 1ZCCA 2Z6JA 1RJRA 2YA2A 1WO2A 2AWGA 2H8ZA 4MMWA 1WAWA 4ZOAA 4ZR8A 4R0XA 4BI6A 3M5YA 4NI3A 3WQPA 3EMZA 4EOUA 2OFNA 1YDOA 7REQB 3M7WA 4BF7A 4IM4A 5BNKA 3UW6A 3TYEA 4O10A 3KFTA 3VGHA 4DEFA 1AH3A 3PZVA 3W22A 2W91A 5I24A 5D09A 4GH1A 1UH4A 1YBQB 4WSJA 4UQCA 4Q4QA 1RJPA 3OYZA 1PO9A 1AQFA 1XP3A 2FGLA 4KW2A 1XLKA 5EB8A 3O16A 1IR2A 3RO6A 4UFHA 1WV2A 2XIOA 1Z3NA 2HCVA 2JGQA 3A4WA 2NUWA 3NNTA 2GQAA 3K13A 4A8IA 1OZMA 3LRMA 3APYA 6TAAA 2PS2A 4RUBA 2XH4A 3GG8A 1JD7A 4HIBA 1MVYA 5E09A 3S42A 5CZTA 4WSHA 4LUSB 1B3YA 1XICA 1M5YA 2PUZA 5M5DA 3IKDA 3ARTA 3LM3A 4DVOA 3CTLA 4UFIA 2F6UA 2OGJA 1RK5A 2G3JA 4IWWA 3T2QA 2PWUA 2GJNA 1KBLA 3RILA 4LW7A 4EK7A 5HULA 4B2DA 1I9CB 5HW6A 3TUUA 1JR1A 5L6UA 2RDWA 3VKKA 4DHGA 2XN2A 4DM1A 1UUMA 3N2MA 3G24A 1XLHA 4ADTA 3WX7A 5D03A 3GVVA 3TFXA 4PC8A 3W7KA 4C1KA 3M6DA 1W1TA 1W17A 1KLZA 4V2XA 5XINA 1EJ7L 4OGZA 3AS3A 3ITGA 2CU0A 3SCQA 3WNPA 3OLGA 3O5DA 2HPIA 1QI5A 2ZADA 3CUZA 5G5IA 3HF3A 4F0HA 4GUHA 1AW1A 3L4WA 2GJPA 3FKKA 5IDZA 2QXWA 4B5XA 1HG3A 1JEZA 1IZKA 1DXFA 2VCCA 3NG3A 1FXQA 3OLEA 3MVTA 3OPSA 1QI4A 5TBOA 1KQYA 4R9OA 5GVJA 4DRIA 2HMCA 4L72B 3W7JA 4CD5A 3K2GA 1X1OA 1MXDA 2CIPA 2VM8A 4ICMA 4S1FA 1L0PA 3DYOA 1NWTA 2IKHA 4NJHA 4S38A 4CQAA 2XP4A 3BTNA 3FXGA 2VZUA 1MYRA 3PBYA 4FR6A 3CTTA 4E38A 1TV4A 3OQEA 4Q8QA 3WK1A 2V2HA 3M0MA 4UOJA 1YQ2A 4AQLA 4NI8A 1GJWA 4LX4A 2NXHA 1OX5A 1UP2A 3R43A 1Z41A 3CH9A 1K9DA 1ZPTA 2GGGA 1US0A 5D9PA 1P6BA 5BWFA 4QDMA 4I5XA 1RCOB 3MQTA 1CGXA 2J79A 1J4RA 2A7PA 2WSYA 1OSEA 3N19B 2D24A 2E68A 3KS5A 3U2EA 2NUYA 1SO6A 3UVAA 3V5OA 2QCHA 4QJ4B 3VA8A 3WF2A 4ZO7A 3IWPA 1AG1O 5C2GA 3SN4A 5J8LA 1QI2A 4QDWA 3VC5A 3S1UA 3C2OA 4HA4A 4QT2A 4HNNA 4O8RA 2GGHA 4JHZA 2FTPA 2HZGA 1G6CA 3AFBA 2DZUA 3HGJA 3F2DA 4R33A 5BMXA 5E0CA 3OBEA 3QRHA 2QLYA 5DXYA 4LGXA 4G1NA 1MI3A 4UBPC 2OQLA 1DIEA 1N55A 3HPFA 3B9AA 1KFEA 2BOEX 2C6QA 4BK9A 4LAUA 4RCXA 1SMDA 5TF0A 5EU9A 3BWWA 2YL5A 4OHQA 3GIPA 3AS1A 3TN6A 4MAZA 5FF3A 1PHWA 3N34A 1RY0A 3CIWA 3STGA 2PC8A 4GIAA 4CNNA 4PTNA 4EACA 1J93A 2DZVA 2XSXA 4DI9A 1GVIA 2YA0A 4DRNA 3GPKA 3FA3A 4HBEA 1E4IA 2E1DA 5C9ZA 3DKJA 3MKKA 2WCAA 3KZSA 1KB3A 3IK4A 2RSEA 4QNEA 1J6OA 3NO3A 4AD3A 2HEJA 3GDMA 3QH2A 1XIIA 2FJKA 3KL0A 1OFAA 4EP8C 4DQWA 3NCOA 4MDOA 2WHMA 4KMQA 1AQHA 3RNDA 1ZJIA 4AHQA 2ACRA 5B7ZA 1FX6A 1XLAA 2PV3A 2J88A 2VENA 4FF7A 2E40A 3HJEA 3RIKA 4H9VA 4W7UA 3DYMA 4PBGA 1LQ2A 4JTDA 2R9RA 1BKSA 2E67A 1EHAA 5A8PA 1CLXA 3W7DA 1NAL1 4WCJA 1X6LA 1QASA 2IXVA 3PG8A 1DWAM 3PWAA 4C1NA 3TSMA 2Z1XA 2JF6A 3STCA 3WH7A 3CZGA 3BSGA 3AHZA 3CQ0A 2RUSA 2KAUC 2R91A 2VXNA 3WMBA 5LHFA 1UUQA 4RZ5A 4WUIA 1JCHB 1Q8AA 3MSDA 1QPOA 3QHOA 5K9XA 3EB2A 1TPFA 1LOLA 3DUGA 1K02A 4O13A 4JTKA 5PTDA 3R1ZA 3O5PA 4MG4A 4BQ2A 2I5QA 3KVJA 4WY0B 4NAEA 3P60A 3PBVA 4W93A 2REQA 3TAOA 1ZLPA 4QITA 2FDMA 3A21A 4QCEA 9CGTA 2IMRA 3TP4A 2OLAA 1MUCA 3RO8A 1I0BA 1EGZA 2PODA 3NZ1A 2PDLA 1O66A 3I65A 3NYZA 1OFPA 3BUVA 1KFWA 4GVHA 3WUFA 2O0TA 1BF2A 3UPMA 3LB0A 2ZRVA 2XGIA 3OTRA 3BLEA 4ONVA 4XZWA 3MYOA 1W2PA 4K68A 1ZCOA 4AIOA 4WKAA 1YX1A 2Q3RA 3IIOA 3ATZA 1J12A 4R88A 2CWXA 1H7WA 5B80A 1V0KA 1PX8A 1P48A 4RNJA 5LZLA 2XVPA 3JRKA 3VIKA 3HMJG 2I56A 3VNZA 3E0LA 4ZMGA 2WC3A 4LY4A 3MI3A 5FEZA 5BZAA 1HJVA 4A22A 3TCSA 3W7LA 7XIMA 2V67A 2WMIB 1G4EA 1XLIA 3C0SA 4AWEA 3WJZA 4ODLA 1TMQA 1GKQA 2R8WA 3GU9A 3WQ8A 1S46A 4Z2GA 2WWCA 4PCFA 2LLEA 3SI9A 2FVKA 4QQUA 2X1TA 1F6PA 4S3FA 2HPMA 1G0CA 2PWVA 2KZHA 3GKFA 4FX6M 3WJWA 2I7GA 3WJSA 1DTNA 4B5NA 2WAGA 4HCLA 3OOQA 4OTKA 3KABA 5H8UA 2QMKA 2UY3A 1GOQA 2YCIX 3NZGA 1R87A 4E8DA 1KC7A 5B7YA 1EEXA 1OG6A 2A6LA 3AXMA 1TIWA 4IGMA 3TWAA 4K36A 4DUVA 1ADDA 3O2LA 1EJXC 1I2RA 9RUBA 1NWRA 1EH9A 1OF8A 1T96A 1B3ZA 3W73A 4WXZA 3EDEA 3NO5A 4BI7A 1WDWA 1PTDA 5AB3A 4HZMA 4FOJA 2J47A 4JFUA 3WEOA 4ECLA 4FF5A 2HK0A 3S5SA 1KM3A 4RXGA 1EO5A 4AIBA 2A3BA 1XD0A 1CW2A 1FKBA 1I8JA 1NP2A 2DZPA 9XIMA 2NZLA 3N2BA 1DL3A 1QK0A 4CNUA 1O4UA 2F7FA 3L4YA 5C71A 1B57A 3GR4A 2Q09A 5L9FA 1R6WA 4PB4A 2WVSA 5HUAA 2J27A 3H4GA 3F1QA 4UIOA 1G1YA 3TC7A 4J35A 1LBLA 3B04A 2G4JA 3BZGA 3BOFA 5HMDA 1UH3A 5A94A 1HGYA 1M68A 1DHKA 1OBAA 1AW2A 1YE6A 3HPXA 1FP9A 3ABZA 1KXTA 3CNYA 4P7RA 4AWSA 3MP5A 5BMWA 3DZ1A 2AAAA 1LLWA 5MHBA 5LA1A 1RPKA 3V1HA 4HQVA 1GYLA 1UASA 4C1NB 5AKQA 1H0GA 2QGYA 1QWKA 2OO6A 1A80A 3WNOA 2OYMA 3A3XA 5M1TA 5ECVA 1NIUA 3BLFA 4AZ6A 1CXIA 3AYSA 5HPCA 4AD4A 5TQLA 1UPMB 1JPKA 5REQB 3SQLA 4O12A 3L4UA 2QCNA 3QY7A 4S39A 3KRSA 3NQCA 3EXSA 4CN6A 1Z42A 1EKOA 2EKCA 3N14A 4HK5A 3OVPA 2JBMA 1FFRA 2XP8A 4BZYA 2PDQA 1VH7A 4KWVA 3R8GA 4DUOA 2E28A 5H2ZA 4D1JA 4ZTXA 1UA7A 3N15A 2E5CA 4YNGA 3T8QA 5TAOA 3NEHA 4NZJA 4YTUA 1UMYA 4LBSA 3EIPA 4HSHA 3KOWA 2BDQA 3L23A 1E0UA 1TJ0A 4E4PA 2YYTA 1EZWA 2E5DA 4PEEA 3HFYA 4AAJA 4PZVA 4EIVA 1V3JA 3WLPA 1BD0A 4MUZA 4JKLA 2DPEA 4MB5A 5C70A 4Y9PA 3GG1A 2D69A 1X8FA 2A3HA 4W86A 2P0OA 3TQVA 3PUEA 3QV9A 3QGAC 5LKYA 4WRHA 4LRSA 3PJWA 2VD8A 5H1WA 4JKMA 2BVYA 5D4YA 4C60A 3GXIA 4A21A 4QIUA 2Z29A 2LGOA 3HPSA 1D2KA 4CCZA 2VJXA 1M9HA 1M41A 2I5IA 1FWJC 2D0GA 4LUTA 4X0VA 4PL2A 1FFQA 3SECA 2CETA 3ME3A 1FCVA 3DFYA 3T78A 1OFQA 3LHZA 1IT7A 2VELA 3EB3A 2XISA 2ZTJA 1QW7A 4AX7A 1W32A 2IW0A 3G1HA 1S5MA 3ECQA 4PEKA 3AIBA 1XIGA 3MCOA 4Z2HA 4LSBA 4PUKA 2QPUA 1BG4A 2OQYA 1QPFA 3VNIA 1US3A 1U30A 1FBAA 1FWGC 3L2MA 3SRHA 3WLHA 4GNVA 4TX8A 3N2TA 4FALA 4O16A 5LIUX 3WNNA 4I5RA 4KESA 3RR1A 4I8DA 1EGMA 2OZ8A 2OQHA 1IGWA 3VFCA 1W1IE 4BR1A 3VZZA 2GVLA 2GVEA 4GKLA 4KFNA 1H5YA 2WJFA 1V08A 2W4XA 2GL5A 1R30A 4A8RA 3SEPA 1BL4A 1QOPA 3W7EA 1TRIA 5MF5A 1K4HA 4IH3A 1T7LA 1FWNA 2KX9A 5DX7A 5LIYX 2DT2A 5AHEA 3UY8A 1POJA 3GB6A 1IEQA 4TVUA 4H83A 1FWAC 4UTFA 4P8UA 3NTYA 2MLYA 3KBMA 3UG3A 2PGRA 4NZ4A 1A3WA 1TB3A 4GYKA 2VQTA 1JXKA 3VGBA 4O28A 3VK5A 3LXBA 1FAPA 4G50A 4M51A 4ALDA 4HPJA 4DX3A 3FYOA 1HO4A 4S2CA 3C2YA 3WLJA 3ARPA 3F2BA 1HFBA 3MZNA 3LD5A 3JZUA 3M9YA 3JR2A 4JICA 4DF0A 4I7UA 3WG6A 3D47A 4ZL1A 1QXLA 3MI2A 1CBGA 4ODRA 4CQDA 1KNWA 3KTSA 3B97A 2UY5A 3PZMA 1TSIA 3APGA 3W29A 3TTOA 1FVPA 3UQNA 4HMEA 1DBTA 5LHEA 2Y70A 1Q6EA 1JZ8A 1XBVA 1OX6A 3SIZA 6REQA 1MEIA 2OCZA 1VBRA 1H1NA 4JN6A 1E9YB 3G18A 3R4IA 3RPDA 1CCWB 2QPXA 1YNQA 4ZB0A 4S23A 5CJ5A 3MW7A 5E93A 3MP3A 1NQKA 4O14A 4YTTA 4MSSA 1QBBA 1UW9A 4EWJA 3EDKA 5CPMA 4H9XA 2FPYA 2QJHA 4UTIA 1AL7A 3UXIA 2QUVA 4H01A 2SFPA 3VMNA 1ITUA 1MFVA 2WOQA 1JCYA 1JNEA 3RX4A 3QQWA 1ZRQA 1BXNA 2J7HA 1IT0A 5FAGA 3LI0A 1SQ7A 5CGTA 2FQIA 3USBA 3EX4A 5HNRA 5CLWA 3MC5A 3UZWA 5CC7A 1YIXA 4LUJA 5LA2A 3AMCA 3O0FA 4MY8A 1OK4A 1RPXA 4AIUA 5K3VA 1K6AA 3IUDA 4KFPA 1JZ7A 1TTIA 3EA1A 2IPWA 3PAOA 4JFLA 2BWGA 2Y5SA 4PR4A 2PDUA 3H4WA 3O3RA 1K6WA 3B9NA 5TIMA 1LWHA 2VFDA 4L6OA 3KBJA 2FPVA 3W75A 3OQ8A 3B8DA 2G3FA 4GQRA 1DTUA 4UQ9A 2NV1A 2EPLX 3W1LA 1JQVA 2OOGA 4JQ3A 1FCUA 2NV9A 4C7GA 4E2OA 4K8HA 3QV6A 1XH1A 5DELA 1U33A 4Z17A 3UXDA 1FHDA 1F8IA 2V63A 5C54A 4W7WA 2A1YA 4V15A 3GDBA 3QZAA 1BSLA 1KM2A 3VOFA 4L4OA 4B9ZA 4J4OA 3NR0A 4YWSA 3S2NA 4DRSA 1EZ2A 3L66A 5XIAA 1NARA 5HWCA 4FOUA 3F4NA 2GSEA 3GR7A 3UZZA 3LG3A 1Q4NX 1TPB1 4ODQA 4TNSA 1DQWA 4HYVA 2H3DA 3AQUA 1V0MA 3P3BA 2J9ZA 3B9DA 1AD4A 2PF0A 3UA3A 4H7CA 4LJ3A 4A8NA 4O1CA 2C16A 1JNDA 2Y7GA 1OGGA 1ZZMA 4GUFA 1RSCA 2Z25A 5I00A 2WZIA 4ENLA 3KCEA 1AMKA 5AYZA 3PZGA 2OO0A 2YIHA 1GOWA 1ZB5A 1ZQ5A 5FKYA 1NDYA 5HBFA 1G4TA 1ZAJA 3ANUA 2X1RA 1Z32X 3ATYA 2D20A 4MKSA 4RDVA 3PK7A 1QZ2A 5AYYA 5T26A 4R53A 2ICSA 3W83A 1BHGA 3GAYA 5F2GA 2QAFA 4DRPA 3RXZA 2A3AA 5EBAA 4DUWA 4LYRA 3NL6A 2WYSA 5AHFA 4EAMA 2PP3A 2NQJA 1MWOA 3I6CA 4M29A 5ABHA 3EWBX 2ZRZA 4UFKA 4LAXA 2V2CA 3WLIA 4DT4A 3UG8A 1VD6A 2CXEA 3QKEA 4AG0A 1LLOA 3ZQ9A 3BLIA 2E25A 4JKKA 3S2JA 2D9FA 3K8LA 4JTAA 3EWYA 1KV5A 4IICA 1MUMA 1WUEA 3E2SA 5CQ1A 4P5UA 1ISYA 4F0KA 3VGFA 3W87A 1GQLA 1HJSA 4Z1AA 2P88A 3DU0A 4L64A 2X2YA 1DWFM 5H8PA 4H7VA 3KOFA 1S5WA 4CEXC 2J7BA 3GIYA 4B5TA 2RGLA 4PTXA 1VPQA 1SFSA 1IYXA 1QHPA 3TCZA 1DIDA 2YSWA 2E4TA 3V5FA 4LUYA 1D3HA 1FP8A 2BY0A 1O12A 3AU2A 3T05A 2GSHA 4CQBA 1AJZA 4DRKA 4NP7A 3MWCA 2TAAA 2ZX7A 1EBHA 4ZFCA 3VNJA 5AHIA 5CAKA 2WSRA 4JX4A 1JCTA 3L12A 3KLLA 1K77A 1UC4A 3SJ3A 1JZ5A 4YVXA 1OYBA 2GOUA 4MGGA 2ZR4A 1KRMA 5AC4A 1F3XA 3WDHA 4NXSA 1F9CA 3MWAA 1KCXA 1F4AA 2WMGA 3TNBA 2FB2A 1ESWA 5CPLA 3NSNA 1UR8A 4I9MA 1MMFA 1Q7ZA 4CCCA 3ZR5A 5CZ0A 5DN1A 4FR1A 3IIPA 4NKCA 1XUZA 4U3CA 2ZZ3A 4GI8A 4EANA 4GXPA 2B4GA 3KOXA 3ABOA 4XSMA 3STEA 4DN1A 4LF2A 5I0DA 3MPGA 4XIMA 2QV4A 4P8XA 1DWGM 4M7SA 1W1A1 3BAWA 3GDKA 4ADUA 4UTTC 4H9TA 4IL0A 4AWUA 1V6TA 1JZ6A 2O56A 2OOFA 4GQQA 2HISA 3I7QA 2DSVA 3SM0A 1TJPA 1SM9A 1VC4A 4P8VA 4ORMA 2EHHA 5CSYA 4XAFA 2ZUSA 4UB9A 4MAVA 3H23A 5BWAA 3SR7A 1EC7A 2Z7GA 1XYBA 4IGSA 1W9PA 3NQBA 4JFKA 1QNPA 4AF0B 4DBEA 3NA8A 4XAPA 4IXHA 1U83A 1CGYA 3M5ZA 3TJ4A 3UCDA 3C8NA 1V3HA 3N12A 3VDAA 1ONXA 3NL3A 1WP6A 4MWAC 4TVCA 4HNOA 1WB0A 3Q4DA 1K4GA 3FSTA 2FGBA 3MSYA 2OTDA 3Q37A 3SCSA 5A6TC 4QM1A 4ZOBA 1A3HA 4PGLA 1OCNA 4PMVA 2OKOA 4OU1A 1AH4A 3FA4A 5I2UA 2VX5A 3WJYA 1DEDA 2ATMA 4AZBA 4M56A 1TZ9A 1MW2A 2O9TA 3IVUA 4GNKB 2V3EA 1KXHA 2GYIA 1MW0A 4S3BA 3R25A 4TO8A 2XP9A 4ODOA 3P8IA 1MW1A 5E70A 4X3ZA 4D6DA 3BC9A 2G3MA 1BWVA 5F2MA 3CUIA 1C8QA 5JMUA 3UD6A 4B4FA 5ABFA 3HG5A 3BG5A 4FAMA 3BJSA 4AFYA 3FDKA 5DMMA 1H61A 3QPEA 2WKJA 2XWEA 4XIAA 3OLDA 3EOEA 4DIAA 3VDGA 2FMNA 3RLHA 2AL2A 4EX4A 4Y90A 4Y96A 2JQXA 1VCGA 3OVGA 5DITA 1R38A 4U33A 2IKGA 4J3SA 1E71M 1EDTA 5AHLA 4KRUA 5A95A 1GVRA 3FYPA 4DIPA 3IJ6A 2FZNA 4Z1BA 5A5WA 1C91A 2ONEA 2HROA 3LV6A 3QSTA 3TZNA 1F3WA 4WVXA 5I6SA 3DCPA 3QHMA 1JZ2A 1T5AA 3RJXA 3K30A 1XIHA 1WOAA 3B05A 2YXOA 3B4UA 3GHUA 4L9ZA 1J79A 5CGQA 4JFVA 2R82A 5IBXA 3FSUA 4ZA0A 1V3MA 2ZDSA 1H2JA 2W5FA 3VIIA 4F40A 2F8QA 4RW3A 3PBWA 3O5QA 1TUXA 1O5KA 3FS2A 3WD4A 1EA9C 2JKAA 1XHGA 3TW7A 4IZGA 1L6WA 2DH3A 3RJYA 2NVDA 3O5IA 2VZVA 1TWDA 1F3EA 5DMNA 3TYCA 2A3EA 2DUAA 3WQOA 2HK1A 2NXGA 2PTWA 4H04A 1V02A 1I45A 1K8YA 3UCQA 4DWSC 1SO3A 1O94A 2BB0A 1X97A 2XGBA 3KS6A 1F40A 5FJRA 4OOZA 1E1CB 2I57A 3C2VA 1U5HA 3W25A 2VX6A 3N04A 2RHGA 3UF8A 1O1ZA 3N4EA 1G01A 3ZMRA 4KERA 4GVIA 1V79A 3BAYA 3VOGA 2MNTA 3NIYA 3PZTA 3TKFA 4Q4KA 5AN7A 1SFLA 1FD9A 4GGHA 3MDUA 2TYSA 4CU7A 2BNJA 2BV9A 1GONA 2QCLA 3S46A 4M1RA 4RX0A 5D9OA 1MQQA 2OXNA 2A4AA 2GUYA 3IJ8A 4WOQA 4LT9A 4IFKA 4QSFA 1OX4A 4S3GA 3PRBA 2V3DA 5FA5A 4HHPA 4O15A 1R2RA 2PDCA 3UXAA 2QF8A 4NZ5A 4DJEA 2R1NA 4NHVA 1HXJA 1XIBA 1AL8A 1AH0A 2YB1A 2BOGX 5J5RA 2NV2A 3IARA 3MVIA 2V0TA 3WLLA 4RZBA 4UR8A 4DH0A 3O6DA 3TMQA 4C91A 2P3EA 2OGYA 1DIOA 3ZT7A 2YW4A 1TV3A 2XPBA 2PSNA 1UKOA 4IP5A 3CEUA 4QT3A 1VKFA 5JH2A 4F2UA 2RDUA 1MRQA 2VL4A 3MCNA 1Z48A 3OVRA 3QM3A 1ONEA 1GQNA 2VDIA 1QHZA 4OFCA 1MEWA 1HF6A 4YLWA 4I5UA 3G6LA 1SW3A 1H41A 3Q65A 3E6EA 3LUOA 1V6VA 4UQBA 1HTIA 4F9JA 2PGEA 3OGSA 5DRCA 1W8SA 3G8EA 4Q7IA 2AGKA 1VJIA 3PG9A 3HG3A 7ODCA 4HP5A 2NLYA 4GVFA 1GJPA 2P8CA 1T8XA 4GBDA 3VABA 3TN4A 1QFEA 2WLZA 3OBAA 1XLMA 4O54A 3VNKA 2IKJA 2VEMA 2W79A 5FEWA 2XVGA 3AICA 3E1F1 1KFLA 2F84A 4QR6A 4QEEA 4JL1A 1AQMA 4MPKA 2POZA 3KCOA 3W1MA 4E3VA 1UR2A 3GZ3A 1MEHA 1W5OA 2CLOA 4HPHA 4ML4A 4PCSA 3LLXA 1Z89A 2F6XA 3VTRA 4S2BA 3BG9A 1FKDA 3SZ8A 1KKOA 2J9YA 5ABFB 5CC6A 2Y8UA 3D0CA 3FJLA 1GTHA 1J0YA 4C6IA 3AZSA 3NAVA 3KRZA 3N1AA 4ZQNA 4U5IA 3GXTA 1FKGA 2YDSA 1NFBA 3AHXA 3DGRA 1RQEA 4UFMA 3MUCA 3B8VA 4FAPA 1FWRA 4FOKA 4RNFA 5G2HA 2XINA 1FOBA 3QFEA 1NQ6A 3REQA 1WZMA 3P67A 1UJQA 4I9AA 4GI6A 3VKJA 1FA2A 4WK9A 4TX9A 1SFJA 3W2UA 2J7GA 3M44A 2QCMA 1UR9A 4TU1A 4QS6A 2OELA 3GTYX 2V5LA 1MW3A 2X7WA 3GBDA 2DW7A 1PAMA 3H2AA 3U4FA 1XIDA 4BKNA 2HQAA 4PYSA 3WLSA 3P8JA 3GX9A 2Q8LA 3VFLA 5JQ9A 2TPSA 4J3UA 2V68A 1JNSA 2EXOA 3UJEA 2HS6A 3H7RA 5D9MA 4KRTA 3E74A 4D6FA 3AC0A 4QEHA 1U79A 1N82A 1XLFA 2BSLA 3THQA 2YZ5A 1W1YA 1GOMA 1W2VA 4PODA 1CXEA 4RK8A 3AXXA 1NWSA 2MLXA 1PYMA 2ACQA 3U9IA 2QT3A 1LWJA 4LAVA 2PBGA 1R3WA 2KI3A 2V5CA 1LBFA 1BVZA 2FIQA 4J3WA 1YW1A 2Y0FA 1PPIA 4HN4A 4TTGA 1WAUA 3H2NA 1WOBA 2WJEA 4I6KA 1A0EA 1RP9A 1JXJA 3BARA 3JVAA 3GM8A 3LRLA 3ARWA 4REQA 1XCWA 3T08A 4UWMA 2ZE3A 1W3IA 5BROA 2QMJA 3HGRA 5D2XA 2F9RA 1JJKA 4IT6A 1H7RA 1E6PA 3O06A 3B8TA 2PP0A 3K1DA 1FWTA 3I3BA 4AUBA 4XSLA 3EOOA 4JTFA 4WZHA 2QCFA 1WKFA 3T4WA 1FKKA 3EXTA 2HS8A 5JBEA 1XLGA 3WQEA 1E0TA 4IFKB 2VZTA 1OX4B 3DHDA 3NSXA 1LL6A 4C6CA 3UI4A 2WW5A 2VEPA 3VGDA 1VCFA 1VJZA 3TTSA 4GIVA 4IMAA 2JF7A 4GQ0A 2Z28A 3VAWA 1A7XA 4L56A 3WL1A 2VUYA 4J2PA 3VX1A 3RLVA 5DIVA 4FMVA 4OUIA 5FF7A 2XM1A 2UV8G 3PPFA 3GXFA 2VFGA 4HPXA 3BO9A 2P8BA 1K7XA 4PCNA 1LT8A 3AXKA 4QIBA 2AL1A 3GU0A 3PBUA 3HFTA 3WD1A 2FFCA 1XR2A 3I3DA 2QJMA 1RD6A 3IJ9A 2VEKA 5AFDA 4IIGA 1RBAA 5MKGB 2QVHA 3H53A 3LTPA 4Z0JA 2CLPA 1GEHA 3M6YA 1ICSA 3EZ4A 3AROA 3M64A 3TJXA 4CKQA 2CBJA 4FIRA 1KFKA 1T99A 4DNMA 1VEPA 1TCMA 4NIRA 2ZYFA 3BGGA 3UG4A 3GH4A 2VX4A 2X09A 1TV5A 3H6OA 4JFWA 3AIWA 4GK8A 1PX3A 2ISSA 1CI1A 1GZGA 5I79A 2C3ZA 5EMKA 1N1AA 1DYSA 2F2KA 3IRDA 4DBUA 2FTWA 2DIKA 1PV8A 4IPLA 4JDYA 4KWSA 1BG9A 4W5ZA 5BOOA 4IIFA 1BGAA 1QPLA 5BYWA 1B4KA 1SO5A 3KCLA 4HMNA 4RZ4A 1FH7A 3CWOX 4LC6A 2BXYA 4DJDC 4U2ZA 1OCBA 4G5DA 5C2CA 2ISDA 1HL9A 1TUFA 5AOUA 4DB7A 3NWRA 3CUJA 3UCCA 1H7OA 4L4PA 5IRPA 4ROQA 4PMQA 2OZ3A 4ERAA 3GU1A 3V16A 3KTXA 1RR2A 1NMWA 4UQDA 1UYQA 3NPWA 2ZA1A 2YKKA 1LZOA 2VYOA 2VGBA 2HVMA 4IPJA 3NQVA 2VUNA 1O95A 3REQB 4H19A 4AY1A 1JZ3A 3NDZA 3PJUA 4F48A 2XVNA 1NMVA 1OT2A 1LCOA 3N9KA 4LC8A 3NQ2A 1L2UA 1TTPA 1G9HA 3POCA 4UNIA 4ZQPA 1VGAA 1AFSA 4HNVA 1MZRA 3MS8A 3WD3A 4K7VA 3IAQA 3STPA 3V18A 1KBIA 2ISWA 4C6JA 4ZTYA 3SO7A 3UWQA 3MZ2A 1GK8A 3GQYA 3VUSA 3ALFA 1YPXA 2UZ5A 1XD1A 2YCEA 3GC2A 5KZ6A 3GTIA 5H8MA 2VQUA 5HQMA 4IFRA 3W7IA 2GSJA 3H12A 3FGCB 3CWNA 2VEGA 4US5D 3LCFA 4IP7A 4NUWA 2Y85A 3DKLA 1E4NA 1R0MA 4M80A 3E38A 2PTDA 4RR4A 3GFXA 1MDLA 4TTUA 3U57A 2J9XA 4JDBA 1RALA 1RLCL 2PD5A 4HMDA 5JIPA 3MBDA 1TMHA 1IXQA 4UCFA 2BLEA 3RM9A 1UZHA 2F4EA 3R2GA 4O2TA 5A6AA 1TV7A 1J2BA 3SBFA 1GZ1A 3TEVA 1Q6LA 1JF5A 3UWYA 3BW4A 4HARA 2UY2A 4Q4SA 1FTXA 3NO1A 4HSNA 4IJRA 1ZS2A 3UP8A 4LEQA 1YW5A 3WMLA 3GNOA 5C8BB 2IKIA 1XXXA 3FJ6A 4X9SA 5EMYA 3T0TA 1L9WA 4KCVA 4GISA 3W07A 5GNXA 4Z2KA 3I10A 4EPEC 1EXBA 2ABBA 4WDWA 4DJFA 2DSUA 4O1EA 4F0SA 3CMFA 2OEMA 3RGTA 3ITTA 2PDBA 4TV5A 1LM1A 4G7EA 3KAIA 1JPMA 4HHHA 3CAQA 2V5KA 4GZEA 3SCTA 3O5GA 2WKLA 1DHPA 5U7SA 2Y7EA 1EP3A 3W01A 3LGDA 3OIHA 1NJJA 1J0KA 3H2FA 3UZJA 4JTLA 4ACYA 4C6KA 3T4CA 1VBHA 2NSXA 2PU0A 3KOYA 3E12A 3H21A 1XI3A 3N2CA 1CENA 4GZJA 5J6EA 4C6NA 3LCIA 3UR7A 3P81A 1G4SA 4NNRA 2R1KA 1POKA 3XISA 1JPHA 5IFPA 1BYAA 2OSYA 1TKKA 5K9CA 5LNSA 1DJHA 5A6MA 4DY1A 4LAZA 1XBYA 3EDDA 5IDIA 3QOKA 1Q6UA 3QV8A 2EPOA 1EQPA 4MADA 4Q6XA 1CEOA 3WUGA 3NL5A 3FAPA 4RJEA 3W23A 3FN9A 1OIMA 4LVFA 3ARRA 4NX5A 1QBAA 1QK2A 4NVTA 3WH5A 3RPTA 3II1A 5FF4A 1DIKA 1W3NA 3M0LA 2BMBA 3LNPA 4CD4A 3OBKA 1BAGA 3LXAA 4LFYA 4DM2A 2WANA 4UTKA 1TV2A 1W91A 1QR7A 1S2VA 2HBVA 4M0XA 5CPQA 1C8XA 4ITZA 4MYXA 2ISFA 1TJRA 1F4HA 1PVNA 3P80A 4WEVX 2V6AA 4GCXA 1UHVA 5C7HA 2IF4A 3C6CA 4RDYA 4WKFA 3EOLA 3BCDA 2GQ8A 4ICNA 2WZMA 1RY8A 1KD0A 3MMUA 3ABXA 4JNMA 2PAJA 4HHLA 3GHRA 3MUY1 4E4FA 2EPHA 1N8WA 1Q3NA 3UEQA 4GYFA 1FKHA 1XF0A 3ZOAA 3CHCA 4MYAA 1J11A 4YCPA 4GYPA 1JCMP 4N6EA 3W1XA 3F2CA 3B0XA 4J1OA 4CD8A 3ONBA 4LAKA 1M6JA 3RHGA 4O4VA 4KEVA 3CAVA 1BRLA 2DT0A 2AQOA 4RE2A 2PDWA 4NF7A 1D9EA 1Q6RA 4HU8A 3CL8A 1K9FA 4GA8A 3O6AA 5A8QA 2PV1A 1W5PA 3AWOA 3RN6A 3TN3A 2O92A 1TPUA 3P84A 3N29A 3U8GA 4BCEA 4XZMX 4B5WA 3PRAA 1V93A 1F8MA 1VENA 3BAJA 1WDRA 4A3HA 5IHRA 2PDHA 3MU7A 2OZTA 3DG7A 3EWUA 3GW0A 2BGNE 4IUOA 4J7RA 3B4YA 3VOJA 1ISXA 3ZLHA 3DFPA 3LM7A 3EKZA 5DO8A 5DMYA 1CGUA 2ZQ0A 3HV9A 1XQLA 1BVWA 1MNSA 2TMDA 3BURA 3POHA 1JVNA 4V28A 1IR1A 3JXVA 3WD2A 1L2QA 2CLFA 2CESA 3G0XA 1NH6A 3O5MA 4HCDA 2VC7A 4LQ1A 3UT0A 1I75A 4BWLA 1E6RA 1E9ZB 5AYBA 1G67A 3PNUA 4LVDA 4A35A 4FA3A 4QLJA 2WZHA 1NTHA 4ZQCA 1HL2A 3EKGA 1XL9A 3W7NA 2P10A 4AU0A 1QTWA 1HP5A 3K8MA 1EJSC 4C6OA 3DOPA 4DO6A 2FHCA 4AH7A 4P8WA 4MFDA 3ISIX 2ESCA 4AZCA 4E2VA 1VS1A 2R6OA 3SY5A 2PPOA 3WH8A 3UU0A 1ITCA 4NZFA 1RZMA 4G7EB 1TTQA 4QJ3B 4YYFA 4BY3A 4Q8OA 5A8GA 3TJIA 4ODNA 4MWAE 5A8OA 1E6NA 3GLCA 1J18A 3WBWA 4ORIA 1Q6FA 3BGJA 3BW2A 3OGVA 1WXJA 2FZMA 2IS7A 1QNOA 4IQDA 1EJTC 1XLDA 4GZ7A 4BEUA 1OVDA 1Z7AA 4MB3A 3K4DA 3GW3A 4YXGA 4W4QA 4HBOA 3AALA 1V02E 1XLBA 1NF0A 4PMUA 5LIXX 1K9TA 3AJXA 1OD0A 2X2GA 1EWEA 3SCOA 1C7TA 3WKZA 5A6LA 1SZNA 3VCNA 2DZBA 4TR9A 3A4AA 3B8IA 1UC5A 2HVNA 4F2TA 4IJBA 4R34A 1RK6A 5K2ZA 3Q94A 1IXOA 1LYXA 4QX4A 4Q4MA 4GJ1A 1GOOA 3OIXA 1YPFA 3R5EA 5DBTA 4GYJA 3S3GA 2WCGA 3QBUA 3CZ8A 1R86A 3RM8A 3CGNA 4LRTA 4BQ4A 1GRJA 2NQ9A 3WCZA 2IXUA 2BVTA 1FHVA 5AC7A 1Q2RA 1FHUA 3ZJ7A 2X1UA 3LI1A 2O9RA 4DZAA 5G1MA 1HNYA 1W1B1 1GCYA 4QSHA 3PZNA 5LSMA 3D3AA 1EXPA 2BGQA 2ZVRA 1V7AA 4FXFA 3MO4A 3VI2A 2PEVA 2XN1A 2E8YA 3E0VA 2QPSA 4MZ8A 1FWCC 3ABRA 4NNBA 4AMAA 3QW3A 4X22A 1B6CA 4HN8A 2XWDA 4NYUA 4M82A 1QRQA 4N19A 4ZQOA 4I90A 4U4MA 3AOFA 5ABEA 1X1ZA 1IV8A 3EMQA 3ZWSA 2WVTA 2ZQTA 3EDJA 2ZZ6A 1T11A 4QZVB 3GR8A 4QAIA 1NWUA 4YTRA 1JCLA 2O4MA 2C0AA 2QJIA 3UJRA 2QAPA 2GK1B 3CQHA 5HMFA 3CQJA 3LK6A 3SDOA 1Q6GA 7CGTA 3QMSA 3ZSTA 5A6BD 2YXXA 4O18A 2YOCA 1JDFA 1ENUA 3Q67A 1FWEC 1TE1A 1OFDA 3U7BA 1CGTA 1BRLB 5AECA 4MGVA 2CPUA 2G41A 1KFBA 3FYYA 2INFA 3NQ8A 1P0NA 4HGXA 3L65A 3UWEA 1E6XM 1ZGDA 4EXBA 4MJMA 3PA7A 1C9WA 2PLCA 2ETNA 4PUJA 3UQIA 3NM1A 3THUA 3VMPA 2GGIA 2HE8A 3CL6A 3DESA 4ODPA 3OHMB 4Z1DA 2DIEA 3UGRA 3E2QA 3CASA 4MTVA 4H8VA 5J5DA 6XIMA 4K6AA 2G97A 3PTMA 2XSBA 3KXQA 1CNVA 3UGVA 1UD8A 3MMTA 4Y9MA 3CQKA 2UWFA 3FVMA 1A5LC 2ZWYA 2ACSA 2WC4A 2XP3A 1VFTA 3KRUA 4XTDA 2ZRWA 5JXQA 1L1PA 1A50A 1TX0A 1TQJA 4GABA 1DJWA 3S1XA 4TOQA 4GIRA 2VVNA 2GGJA 1LJYA 3VINA 2FHBA 4DAIA 3SIMA 1HXVA 2EO7A 3KL3A 3NTPA 3SGUA 3HG2A 3WQCA 5I03A 3IHZA 2ATSA 4AYGA 1QW8A 4C6BA 3G0SA 3H54A 3C61A 3INPA 3HJZA 4LS2A 3TH6A 2W61A 3R94A 2NLIA 4LUIA 4HK7A 3M0KA 3VM5A 3O05A 3VKDA 5T9BG 5A2BA 3IEBA 1ECQA 4QTGA 3VE7A 4QBXA 3IV8A 3W6LA 4GJIA 2XP5A 2BY2A 1RHCA 2J24A 3ZR6A 1GVOA 3T0AA 1ZBKA 2CEQA 2YDRA 3GH5A 3AMKA 1TPVA 2EQDA 3MDWA 4JGDA 2Y24A 4DBWA 3VX0A 3AMGA 3OZYA 2NUXA 2VFHA 4WGHA 2VZOA 5HJXA 4G2PA 2RAGA 4OQVA 4D9PA 3S47A 1JNTA 2OMAA 1ZTVA 4ZS6A 2ISVA 3CWHA 3DX5A 3MANA 4TVDA 4NNAA 3R7MA 4GGBA 3H26A 2CKRA 4PE8A 1QU4A 2PCQA 1HKKA 3GU2A 4Y6GA 1JPIA 2ZUUA 1OCJA 4G1KA 3AHTA 1B0IA 2X1IA 1PTGA 3KL5A 3PTQA 5T8GA 2F2HA 2X42A 1YNYA 3QOMA 5F4XA 4DYKA 4NT0A 1FWFC 1AODA 2O9PA 3ARZA 4ZE4A 3PF3A 3QTPA 5TNVA 2GVYA 4HU0A 1MQPA 2YCKX 5AY7A 1BPLB 2DDXA 3TSBA 6TIMA 5I07A 4JQ4A 2VKZG 5GPGA 4PMXA 4D6JA 2HTMA 3S8HA 4AZGA 1SMAA 4PMYA 3FEMA 1W31A 3NOEA 4OZOA 4J4NA 1WKEA 4IFOA 4HOXA 5E0FA 3JW7A 1M03A 2Y6ZA 5A2AA 4NJIA 3O5LA 3WLRA 3ENLA 3FV9A 3WDQA 1KR0A 1QO5A 3EGJA 3TZFA 3BXWA 2R1MA 3T44A 1S1RA 4GG9A 3QXBA 3QSRA 4PTVA 4XAKA 1I60A 1E72M 2NX9A 2VRKA 3CZEA 4XZLX 2VZSA 6CGTA 3RITA 1IWAA 2OVLA 1XDLA 2ZR6A 3CMJA 3FHAA 5A2CA 3W0KA 1KCLA 4Q8NA 3PFRA 1LOQA 1UPPA 4H8NA 4TYOA 1EUNA 3VO0A 3EYPA 3ZVIA 3UQBA 4JTQA 1PL9A 4M8UA 1U5JA 4QJ1A 1JFHA 2DORA 3C8FA 4AD0A 1M04A 3HQNA 2X30A 4IGHA 1XSKA 5D8WA 2WNZA 2OX1A 1DJNA 4UTWA 3GHSA 4OWGA 2QW5A 3HB9A 2XTKA 2JIWA 2D1ZA 4CVWA 5FI8A 1XLJA 4HPNA 4K2SA 2QZRA 5AYIA 1KM4A 4C6PA 1XFBA 5LA0A 3H2MA 5KSWA 1LQ0A 2BZNA 3WD0A 3IJDA 1YEYA 4MWAB 1XJBA 1UD6A 3PBGA 4XBJA 3QKZA 5FOOA 2Y63A 1UMLA 3QGKC 2Y1HA 1XYMA 1C9DA 2PPGA 3BE7A