1LQ0A

Crystal structure of human chitotriosidase at 2.2 angstrom resolution
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
365
structure length
365
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITOTRIOSIDASE
publication title Structure of human chitotriosidase. Implications for specific inhibitor design and function of mammalian chitinase-like lectins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 126
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1lq0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1lq0A01
3FAXA 3VIHA 5EFDA 4MB1A 4MB4A 4WSJA 3AYSA 3SEPA 1ZJAA 2PWGA 5CLTA 3W6MA 5GNYA 5I5RA 2XG9A 2WMHA 3WFZA 1M01A 3BGAA 3W26A 3WQ4A 3KZSA 1BF2A 5DEZA 5C8BB 1MFUA 1JF6A 3AYRA 4PRWA 3GNRA 6CGTA 5AC5A 3EMQA 5M5DA 1JF5A 2EBNA 1ZU8A 5CGMA 2WMGA 1CGUA 5BWFA 1EOMA 4BS0A 2FHBA 3IJ8A 2CBUA 3CGTA 3N9KA 1UUQA 1NOUA 4OOZA 3UR8A 4S3JA 4U2YA 5JBFA 4HPHA 4DWSD 1E6XM 5EB8A 5GNXA 1GOMA 1OGBA 3SCSA 2ZXBA 2IUZA 1V08A 1XV8A 4M1RA 2PI6A 2JEQA 1KWGA 4HPGA 3WQWA 1NOFA 1CGYA 1CXEA 3M7SA 4GI9A 1VJZA 4RE4A 4W8BA 2VJXA 1AQMA 3T2QA 2JFEX 3VKKA 1PAMA 1E1FA 3ZJ7A 1MW0A 1B30A 4AISA 5CLWA 3ZJ6A 3N1AA 4XZWA 2QHAA 2ESCA 1V0MA 3WD0A 5A1AA 2E0PA 1UWTA 1GOIA 3ECQA 2FH6A 4UR9A 1ISYA 2ZUTA 4LX4A 3ZMRA 3CZLA 1LQ0A 3TTYA 4AZ7A 3SUTA 4W7UA 1KGUA 2QMKA 3SUVA 3DECA 3L2LA 3AIUA 4DWSC 3M6DA 1ZBWA 4HMDA 1BQCA 1R7OA 5A3HA 2XIIA 3W24A 1TA3A 1CLVA 3T0DA 1TE1A 2VUYA 2ZX8A 1CXIA 2X0HA 4QDMA 1QHOA 1NP0A 4URIA 3MO4A 2D23A 4ZFMA 1B2YA 4NRRA 3N04A 4D6HA 1HN1A 2CNCA 1QNQA 2MANA 1MWOA 3DYPA 1KXVA 4PTVA 4OJYA 1J0ZA 3WMSA 4NI3A 3ALFA 3OB8A 3T08A 3WY1A 1V0KA 1XYFA 1MW2A 1DWIM 2V3DA 1DWGM 2J4GA 1UZ4A 1KBKA 4E4PA 1WDQA 2GK1A 3GDBA 1XH0A 2QMJA 4J3XA 3VDBA 1BLIA 1R8LA 2BVYA 1BYDA 1CGWA 2WWDA 4TX8A 1CGVA 1E6RA 5M17A 1HX0A 3K4AA 3MU7A 1ISWA 3EDFA 4DWSA 2WWCA 2ZUNA 2J7CA 3ZIZA 1W3HA 3NSNA 5DO8A 4UFHA 1GHRA 4TTGA 1OIFA 2C0HA 3AHZA 3VU2A 3VMPA 2Y24A 1H1NA 2YL5A 4TXEA 3VIJA 3WKZA 1SYTA 1CXHA 3MUAA 1JZ7A 4WF7A 1QPKA 2WYSA 2OYKA 4UFLA 4CD6A 2Y8VA 1LF1A 1E4NA 1TUXA 3SCTA 1G01A 3JUGA 2WANA 3NUKA 2W66A 3WD3A 1B3WA 2DT0A 5LA1A 2CBJA 3AMLA 1PZ3A 3AIVA 4H8UA 3MMDA 4D1JA 4P7NA 2VMFA 2E8ZA 4H41A 3NDZA 5DFAA 3VINA 4OBSA 4UOQA 1XD1A 2VZSA 1B3VA 5JBDA 1J0IA 2WHLA 4KH2A 5I23A 3AMDA 1CPUA 2OWCA 1OGGA 2VCCA 3RPMA 2CCRA 4PMUA 4MJ4A 3K8LA 1UWSA 4E8CA 2PBOA 4NSBA 2ZICA 1ZBKA 2VCBA 4FLSA 3SCPA 2WKLA 1CXLA 3LMYA 1DP0A 3KL0A 1V3HA 2WVVB 5HNNA 4PMXA 1GW1A 1JDDA 3OG2A 1QBBA 1KBBA 1W91A 2XFRA 3WUEA 1H09A 3W28A 2DT2A 4A3YA 4F8XA 4LYPA 1D3CA 3M07A 1FOBA 2CXGA 4DUVA 1CNVA 3EBVA 4M56A 3A4WA 2C7FA 4P7RA 9CGTA 2HISA 1A3HA 1W1PA 2ZUMA 2VOTA 5A6AA 4TX6A 4IUGA 3B9AA 3L4VA 3AOFA 4QCFA 4QFUA 3VNZA 4UQCA 1BFNA 2WB5A 3AHXA 1D7FA 3GYCA 4PSPA 3HU7A 2WPGA 3ARSA 2QV4A 1FH9A 1JNEA 4W93A 4LGXA 1WAWA 2FH8A 1CGTA 3CMJA 2DQXA 2PBGA 4GZJA 3SCUA 3VIKA 3HMCA 1HF6A 5CQ1A 5I2UA 3EYPA 3BLPX 3WF2A 3U5UA 1WB0A 3GZAA 1KXQA 2G4FA 2E9LA 2DPEA 2A3AA 2WHMA 1UKQA 4HP5A 1E4IA 2HVMA 1VIWA 2Y8KA 3J7HA 2WM0A 4V2XA 4MNLA 1QOXA 2D0GA 3S6TA 2XVLA 3WH7A 3L2MA 1V3IA 5JIPA 3ZSSA 3VGBA 2XVPA 4UCFA 2E9BA 1HKKA 4UFKA 5JBEA 1I1XA 4B3KA 1RP8A 1UR4A 2UY2A 5C71A 2E40A 1H41A 3CUHA 3AICA 3UETA 4M81A 4CU6A 2J7EA 2PWDA 3K4DA 1UKSA 2XHYA 4HZ8A 3GXIA 5IXEA 2DT1A 3K8MA 4W8LA 4AD1A 4ATLA 2XSAA 1F4AA 4JFTA 1CTNA 1QI5A 3BH4A 1WNOA 1W1VA 4WK9A 3MUIA 3PN8A 1CBGA 2CBIA 4U5IA 3VGEA 4B3LA 2VCAA 2E8YA 3VIOA 4DM2A 2PC8A 1PJ9A 1QVBA 3EMZA 3SURA 1HJVA 4MB5A 1XYZA 2V3GA 3W38A 1KFWA 2JEPA 4AZ5A 3VGGA 3ALGA 2WMKA 2WZEA 4W87A 3WL0A 2AMGA 4XUYA 1ODZA 3ZT5A 2BY3A 1E5NA 2CKSA 2ZUSA 4QAWA 1OD0A 3I3EA 4E8DA 4GO9A 4W85A 3ARWA 5HXMA 1F4HA 3WELA 1BHGA 3RM4A 4GO8A 3L4ZA 1W3KA 3SCRA 3TTQA 1ZL1A 4IM4A 5AYIA 3BMWA 3KE0A 4J3UA 1PIFA 1E6ZA 1UWQA 1J10A 1EQCA 2J25A 2XFFA 4PUDA 4AZ6A 4JCMA 1C7SA 1KGWA 1ZS2A 5HDRA 1V0LA 3PZGA 3VM7A 2D3NA 1ZBVA 2JIWA 1E3XA 2IXVA 4J3WA 3AHVA 5IHRA 4Z2GA 1UOKA 1QHZA 2EQDA 2GDVA 3VMOA 2XJ7A 3L4TA 1E15A 4AZHA 1KR0A 4D6EA 3MSGA 4ACZB 4XV0A 1E9LA 3VIFA 3N18A 1MXDA 3ZQ9A 3VPLA 4GPNA 1C93A 3BSHA 4UFJA 1XH1A 1MW3A 4KGLA 4PMRA 2VURA 3L4XA 2QPUA 4PN2A 2WCSA 3VX1A 4Y7EA 1CENA 2VQUA 3CLWA 4CN4A 1OB0A 4CD5A 1GPFA 1CZ1A 1UG6A 2YKKA 3CZGA 4PTMA 3W81A 4JIEA 1EHNA 2WBGA 5CXPA 3UERA 3DHPA 5IDIA 3BMVA 4W7WA 2XSBA 3WH5A 3MMWA 2WMIB 3CUGA 2WC4A 3AZSA 1VEMA 3UG4A 3ZT6A 4MAVA 2XVNA 3CUFA 1GONA 2J7FA 3W0KA 5HBFA 2W92A 3NDYA 1E4LA 3RMEA 2VQTA 1C8XA 3ZR6A 3AMCA 3NIYA 2DT3A 4EAMA 4HU0A 3PHAA 1E0WA 4UQDA 4QCEA 1I1WA 3MMUA 1TCMA 3RM8A 5D9MA 2GFTA 4RL3A 1PX8A 4P8UA 3AI0A 1UH2A 4CCCA 2W67A 1KB3A 1W9VA 4M24A 2DSZA 1SMAA 3RM9A 1DWJM 4D6DA 4LPCA 4U2ZA 4L4OA 1HJQA 1OM0A 3WNPA 2GJXB 3SUWA 1UR0A 3WNLA 2J78A 1ESWA 1XGZA 3N12A 5I0DA 2RGLA 4S3KA 1K9TA 1HL9A 4FF5A 2ZE0A 1CDGA 2ZWZA 3GH7A 4CKQA 2VRKA 4PUEA 4MDOA 4MNKA 5JIWA 2G8ZA 4X0NA 5AY7A 3WEMA 3RDKA 2YIHA 2DGAA 1V3MA 1EHAA 1GQLA 4PEEA 1H0IA 1NWSA 3MANA 3PZIA 1NWRA 1E6PA 3EDDA 3U57A 2WVUA 4MDPA 2V38A 5A6MA 1RP9A 1FP8A 3GM8A 5A2AA 5LA2A 4J27A 5ABFB 3AIWA 2WVTA 4QLKA 1JXJA 4AMCA 4PMQA 1VBUA 3BAWA 4KMQA 4W89A 3AXXA 1GOOA 1WZLA 2CHOA 3CHEA 4IPLA 1SMDA 1DTUA 1JAEA 2VX4A 3ZSTA 4JAWA 4KWUA 1R7AA 1HKMA 4MB3A 2BNJA 4CVWA 4GKLA 3ZT7A 1M53A 1VJSA 1W32A 1J9YA 3HJEA 3ZJ8A 1LG1A 1QHPA 3UCQA 5A8NA 4W7VA 4ZEPA 3WQVA 1W1YA 2J7GA 4J3SA 4AEFA 4OIFA 3WNOA 3WF3A 1U2YA 2ZXDA 5HPCA 5A8MA 3BLKA 3G6MA 1B3XA 3ZOAA 1HKIA 2V3EA 2GJPA 1MVYA 2NW0A 5ABEA 4BCEA 2VR4A 1UQYA 1KQZA 3MV11 3WIJA 2GDUA 4BQ2A 2XVKA 3MUZ1 2BHUA 1A47A 2VX7A 1JL8A 4AD3A 1PEZA 1S46A 5A6LA 3ARVA 1GQJA 2DEPA 4WKHA 3D3AA 3I3DA 3VD3A 1JD7A 1HIZA 1PPIA 3WL1A 1JI2A 4ZXLA 2BHYA 2VZTA 1MW1A 1C7TA 2YBUA 2WKGA 3QOMA 2E3ZA 3KL3A 1ITCA 1QI3A 3LPFA 1OT2A 4PTWA 3VD7A 3THDA 2XM1A 1FP9A 1UR1A 2O9PA 3NSMA 4AIEA 1DWFM 3AS1A 1C91A 2YJQA 1MQQA 3FW6A 1GORA 1XSKA 2Q8XA 1UQZA 3AS3A 2DH3A 2W4XA 2WSKA 3L4UA 1WZAA 2O9TA 2BVDA 5CJ5A 3TTSA 4A4AA 2VRJA 2UY3A 1G9HA 2XM2A 1OBAA 3BXWA 2PF0A 2BY1A 1CXKA 4MNJA 1E6QM 2XGBA 2XUCA 2YDSA 2F8QA 1UD2A 1ZB5A 4XB3A 4CD7A 3AS2A 5I79A 3K1DA 2D0HA 3PZTA 4JKLA 3OA5A 1TVNA 3T2PA 1R86A 2C8NA 4JCLA 1IT0A 1JYVA 2BY0A 5FL0A 1OINA 3W4RA 1J11A 4LYRA 1LG2A 4Z2HA 2WZIA 4UQEA 3TOPA 4TVUA 1XSJA 3VVGA 3M46A 4PCTA 4U31A 5A8OA 4U3CA 2YBTA 1CWYA 3T09A 1US3A 5FOOA 1FH7A 1X6LA 3ARUA 1EXPA 4AZCA 5HPOA 3WFLA 5GPRA 1GOQA 3WMBA 3ZO9A 3GXFA 3AMGA 4F9DA 3IANA 1G94A 1EDQA 3WDJA 4UTFA 1W9UA 3GH4A 4D1IA 5LYRA 2JF6A 2VR5A 1PX4A 4D6JA 1XRVA 2VX5A 5CSUA 1QNRA 5BXRA 3ARZA 2X0YA 1GQKA 4HMEA 3IJ7A 3PTKA 3VNYA 2GUYA 1M04A 1C90A 2PWFA 1GUVA 2CYGA 2DDXA 4AY1A 4C7FA 5A6JA 2QF8A 4N0RA 4D72A 3VOCA 7A3HA 4FLOA 3WQ5A 3BAXA 1UKOA 4YPJA 3AXIA 1O7AA 4PYSA 1JZ4A 5GNZA 4W86A 5IFTA 3VD4A 1X6NA 5E0FA 4ACYA 5CSYA 1JFHA 1BVZA 2ZIDA 2A3EA 1K9FA 3B8SA 2WHKA 1V3LA 1BYCA 1XSIA 5I77A 1GVIA 2G3IA 3BC9A 1W9XA 2GJXA 4IISA 6A3HA 2XWDA 2ZX6A 4KRTA 3THCA 1WZKA 4X9YA 4CN1A 1JZ2A 3NJ3A 1PX3A 4AXNA 3POCA 1J0JA 3CZJA 2EJ1A 3SCWA 1W2PA 1UHVA 1JFXA 3WDRA 2J77A 2YA2A 1FA2A 2Z1KA 1GJUA 2DSVA 5KZ6A 4Q22A 4HA4A 1NWTA 1HL8A 1EO7A 3KEHA 1JYWA 5BRPA 4GXPA 3VIIA 5BROA 3UESA 5BYWA 1JZ6A 3WBEA 1V3KA 1HVXA 3U7BA 1E0XA 3WEOA 3WF1A 1KQYA 5ABFA 4PMOA 3T0BA 1OSEA 2BXZA 2OSYA 2XGIA 1ZJBA 1EGZA 1RH9A 2D1ZA 2G3MA 5DF0A 4QP0A 4CD8A 4B15A 4M29A 2V5CA 1US2A 1ODUA 1B3ZA 1UR2A 1VB9A 4JZ5A 3W82A 1JG9A 3VX0A 1XCXA 4HA1A 1W9BM 2OYMA 1OGSA 4D6CA 2CEQA 2D0FA 3NCOA 1B9ZA 4GI8A 3T0AA 1E1EA 2D22A 1CGXA 3N15A 2BY2A 2W62A 5I24A 2YL9A 4UOZA 5HOSA 1L0PA 3WH8A 4UFMA 3W25A 3GXDA 3WN6A 1QNSA 4P8XA 1E3ZA 5A2BA 3EMCA 3CHFA 1BYAA 2VX6A 2NSXA 1BTCA 1J12A 5A95A 3WDIA 1V02A 3II1A 2PB1A 1OIMA 3CUIA 3GBEA 3MUY1 1OCQA 4HTYA 1QI4A 4OOUA 3FHAA 1B90A 1E0VA 3S2CA 7TAAA 1Q6FA 2A3HA 3PZQA 3ZR5A 4IPNB 4CCDA 4JHOA 3AISA 1TA3B 1HXJA 5DMYA 3PZVA 2WMJA 5FKYA 2YLLA 1QNPA 4J3TA 3RJYA 3CUJA 4RE3A 4GINA 1U33A 3ARQA 3CMGA 4LYQA 4H7VA 1B0IA 3GH5A 3PTMA 2WNWA 2B31A 5BRQA 2EPNA 5A69A 3CZEA 4C7GA 1CEOA 1E40A 1IZJA 2XIBA 3ZM8A 5A6BD 1W9PA 3OGSA 3B9EA 4B9YA 1H3GA 2WMFA 2J7DA 4M8UA 3K8KA 2WW5A 3WNMA 1JZ5A 2ZX7A 3RCNA 2VNCA 4QLJA 1KXHA 4H2CA 1TR1A 5JH8A 3D5HA 3PZUA 2VC9A 4X0VA 4CD4A 1PBGA 3ZJKA 3W37A 3PZNA 1JZ8A 4PMVA 4DWSB 3W6LA 3SUSA 1V0NA 5CGTA 3VMNA 3VD5A 3W27A 4CU8A 3WF0A 2VZUA 3WBAA 1UH4A 1LL7A 2DSWA 3L4WA 5E09A 3AXHA 2OWWA 3AIBA 1J01A 4PMDA 3VDCA 1D2KA 4GQQA 3B9DA 1Q6CA 4BF7A 4B16A 5A6KA 1V6YA 4YN5A 1BAGA 1RPKA 1W9DM 4TOQA 4U33A 3AHYA 3GBDA 1UD6A 3VTRA 3UR7A 1EO5A 3WSUA 2F2HA 4AD4A 1WE5A 4E2OA 1CLXA 4NZCA 4RE2A 3OLIA 1B1YA 2EPKX 1K6AA 4CVUA 4ATDA 1EA9C 4CU7A 3FY1A 5KEZA 1H0GA 4GZIA 1B3YA 3SCOA 5A8PA 4AEEA 4YHGA 2VI0A 4FLQA 3BAIA 1HT6A 2UY4A 2A3BA 2PWHA 1E5JA 4KGJA 3EDKA 3QHOA 1OD8A 4EKJA 2WVVA 2EPMX 4U3AA 5FD0A 1GJWA 5FIPA 4MJ2A 3WNKA 2YA1A 3VM5A 2J79A 2J47A 3VDAA 3MS8A 1L8NA 2WC7A 4HZ6A 4GIAA 4UZSA 3AIEA 1QI0A 3AFBA 4U5KA 3FN9A 2VTFA 1GQIA 1IZKA 1N82A 3OGVA 1UD3A 4H8HA 5A6BA 2JIEA 1JAKA 2J8GA 4ML4A 4DM1A 1V6WA 2BVTA 4W5UA 2BV9A 1WO2A 3WDPP 3AQUA 1JYNA 2YDRA 1TFVA 1KCLA 5AYBA 4PSRA 2JALA 2WZHA 1NOWA 2ZX5A 4PMNA 4V28A 1H2JA 3DC0A 5CG0A 2GSJA 3IAQA 5IFPA 5C70A 4WIWA 6TAAA 1UD4A 1UD8A 5D8ZA 1GOWA 4ZE4A 3TTOA 1C3FA 1TMQA 1UWIA 2XVGA 2YOCA 1E73M 5DT5A 5JUVA 2X05A 2G3JA 1NQ6A 1O6IA 3GNOA 1MQPA 2OSWA 1XD0A 1OWQA 3CZ8A 4ZXOA 2A3CA 1H4PA 1UA7A 1FHDA 1J0YA 4AC1X 4BQ3A 2FHFA 3BCFA 4P7OA 3T2OA 2GJRA 4D6IA 1UA3A 2ZX9A 5A94A 1E55A 2OLHA 2ZXQA 1LL4A 3PZMA 5ABGA 2WXDM 3BAJA 4AZBA 4JFWA 1JIBA 5A2CA 4AW7A 2VO5A 4AWEA 5EFFA 1LWJA 2J74A 3A3HA 4HA3A 4JKMA 4OKDA 3SUUA 1PZ2A 4J3VA 1E72M 1W3JA 1Q6DA 2DIJA 1R87A 2CERA 1UR8A 2VVNA 4BZYA 2D2OA 1YQ2A 2EEXA 1JXKA 3CIVA 4BQ5A 1IV8A 1DWAM 1G1YA 5D8WA 3IK2A 1XHGA 1E43A 2WBKA 1U30A 5A8QA 4CN6A 1PIGA 2Z1SA 4OBRA 5ECUA 4FMVA 3VILA 2CITA 2CBVA 2V3FA 3F4VA 1E6SM 4AIUA 1TVPA 1HJXA 4Z2KA 1C92A 4WKAA 1JGIA 1VF8A 2TAAA 3OBAA 2W61A 1QNOA 3OGRA 4AYSA 3IAPA 4MTVA 3VGDA 2WK2A 4UNIA 1XCWA 2BFGA 1WCGA 2VRQA 5D9PA 1KXTA 1WDRA 3VD9A 1AVAA 4NF7A 2YL6A 3WD4A 4JL2A 3VIGA 3GTNA 3MKKA 2QLYA 2O9RA 1V6XA 1EQPA 4P7QA 4OUEA 3SCQA 3CHCA 3OZOA 3O6AA 4JKKA 4JFVA 5LA0A 1VFMA 1VRXA 4AD5A 2VL4A 2CKRA 1H49A 1X1NA 1EIBA 4D6GA 3DHUA 1UD5A 2NT1A 3N11A 2ZXAA 4W84A 3A6OA 4ACZA 1JYXA 3AIQA 3PTQA 1XC6A 5BXSA 4J7RA 4UZUA 3WNNA 4EANA 4BQ4A 3WDHA 8CGTA 2WC3A 1UWUA 2RGMA 4Q7NA 1HJWA 5M3WA 5E6YA 1BSIA 2J7HA 3BAYA 5I78A 2ZWYA 1QI2A 4QLLA 3GXMA 3UG5A 2X8RA 3A47A 5EMYA 4CUCA 1UYQA 1GCYA 2BS9A 1QW8A 2E9MA 4MADA 1C8YA 2J62A 2NT0A 3IJ9A 4B9ZA 3E1F1 1AQHA 3HN3A 1LLOA 3ARXA 2W5FA 5EBAA 3VUPA 3TONA 1WPCA 1UZ1A 5BXPA 1C8QA 1WKYA 5I3DA 4PBGA 2WMIA 2E4TA 3WMCA 3ARTA 3A4XA 4AD2A 3AHTA 3RJXA 4KRUA 2DSKA 4TVDA 1GOKA 4HOZA 1QW9A 5F7UA 4D6FA 1NP2A 2AOSA 3SIMA 3QHMA 2EXOA 4H04A 3L4YA 3BCDA 2UWFA 2AAAA 2W91A 1VFOA 3DYOA 3OZPA 4HOXA 2XPKA 3QR3A 1K9DA 4AD0A 4P7LA 4HU8A 2FGZA 1HKJA 2G3NA 2WAGA 1VAHA 4PMYA 3WD1A 1GZJA 4GZEA 4WJXA 2J75A 1MYRA 1H11A 5E9AA 2D20A 2PWEA 1UKTA 3UEQA 3PZ9A 1ISXA 4MAZA 3N17A 3WD2A 1JNDA 3I3BA 2X2YA 1V02E 3U5YA 1WDPA 1E71M 2CHNA 2ZUUA 4WSKA 2WLZA 3WDQA 4OZOA 4LQ1A 2BXYA 3CO4A 5E6ZA 1Q6GA 1SR0A 5IHSA 4UFIA 4W88A 1V03A 3G6LA 5AC4A 1HP5A 3DYMA 1E56A 2VT0A 5FL1A 1NARA 1NM9A 3VGFA 4V27A 1MXGA 4L4PA 3GNPA 5I6SA 3F5LA 4AIOA 4GQRA 4M80A 1GNXA 1P6WA 5D9OA 2EPOA 2CETA 8A3HA 1EDTA 7CGTA 1FFQA 2V5DA 4NRSA 2CIPA 4JFSA 3ARYA 1XH2A 3CZKA 3WH9A 3O9NA 4UQBA 4R5EA 1VENA 4Z2JA 3CH9A 3UG3A 2UY5A 3WQ8A 4CGTA 4AZGA 1I75A 2WLYA 1G5AA 1WDSA 1J0HA 3QHNA 1HJSA 4PCSA 4HOWA 1YHTA 1QBAA 3AMKA 1JD9A 3AJ7A 5A6SA 1OT1A 2J7BA 4PMZA 4K68A 2XTKA 5E70A 3ARRA 1V6VA 4M82A 4UOJA 2X09A 4EE9A 4BA0A 4W8AA 1JDCA 3WQ6A 3WUFA 3F5JA 5DT7A 1VFFA 3KL5A 1V3JA 4Z2LA 4TTUA 3QOKA 4WKFA 2DIEA 3CPUA 4J28A 1BPLB 2X1IA 3LPPA 1KWKA 4DUWA 4H8VA 3K46A 5E0CA 1B31A 1R85A 4JFUA 4YHEA 3FXYA 1ZBCA 2CPUA 2ZOXA 5CPTA 3NYDA 1KGXA 3CHDA 4PTXA 3NSXA 1ISVA 3SCNA 4ZENA 4HZ7A 1EDGA 1BG9A 2VVSA 1BVNP 3PBGA 2CESA 4XX6A 1W1TA 5CPSA 1J0KA 3LPGA 4ATWA 1KCKA 1KR1A 2YDQA 1W2VA 1CECA 1UKPA 2EO7A 1AQ0A 4JHZA 5M03A 4LXFA 1HNYA 4HMCA 1Q6EA 4ZE5A 3OLDA 2QPSA 5ABHA 4P8WA 4A3HA 1E70M 3VDHA 2WHJA 5BCAA 1LL6A 1AMYA 3RO8A 2O92A 4XZBA 1VFUA 4C7DA 2J8FA 2FGLA 3EDJA 1BGGA 1J18A 3AZTA 4TVCA 4UQAA 2GK1B 2GVYA 3KWXA 3APGA 2YA0A 3WUGA 3LPOA 1EOKA 5CZKA 1TG7A 1E6NA 4WLCA 3FAWA 1VBRA 3TP4A 1DHKA 3AZRA 3AS0A 5CPQA 2OSXA 1BYBA 2D24A 2WCGA 4FK9A 3U7VA 2DSUA 2ZUWA 1H5VA 2EPLX 4UQ9A 1MQRA 1VEPA 5FCZA 3MV01 2XFYA 1Z32X 2IXUA 3A4AA 1FFRA 4N42A 2VZOA 1JI1A 3RILA 1DEDA 4MPKA 4P8VA 1Q4NX 3BAKA 2FDMA 4R27A 4W5ZA 1UWRA 3WH6A 3POHA 1HP4A 3QGVA 1WZMA 1NWUA 3WENA 1ITXA 1UH3A 4AZCB 2G41A 5GQBA 1G0CA 4F79A 2OWXA 4TUFA 3FHQA 2JF7A 2D3LA 1LWHA 3PZOA 3RIKA 1V6UA 3VIPA 1JZ3A 1CYGA 4MNMA 1BG4A 2BHZA 3MSDA 2Y4SA 4F66A 2XWEA 2YL8A 4JL1A 2WVSA 3O2LA 3VO0A 3N13A 2XYLA 1E4MM 1FH8A 3BSGA 2OYLA 1FHLA 4DUXA 4GI6A 2O9OA 1HJUA 3OLEA 5D9NA 3FNDA 4CCEA 3WUBA 1SFSA 1K9EA 1ISZA 3W29A 1GVYA 2WCAA 1EH9A 1WP6A 1M03A 1W3LA 3AIRA 1TZ7A 1LJYA 4D71A 4F9JA 4FLRA 2Y5EA 1JDAA 3ARPA 3TA9A 2JE8A 1RD6A 1ECEA 3OLGA 3EDEA 3CTTA 1CXFA 1GHSA 4EK7A 1DWHM 1M7XA 1BGAA 2FHCA 3W53A 1HVQA 3WEZA 1MFVA 3AROA 4AZIA 2W63A 3VGHA 1UR9A 1CIUA 3SCVA 5D4YA 2YLAA 4Z2IA 3VIMA 2Y2WA 3OIHA 1NH6A 1Y7VA 1VEOA 2F61A 3F5KA 2VZVA 3CBWA 5BXTA 2ZUVA 2WSPA 2DH2A 5TD4A 3WF4A
chains in the Genus database with same CATH superfamily
3QTPA 3VIHA 4MB1A 1ONRA 1QK0A 3AYSA 5HWJA 1ZJAA 3W6MA 1R0MA 4MLRA 2XG9A 2GVLA 2YYUA 3S1XA 3N73A 1OYCA 4XZLX 3HFYA 3WQ4A 4I7UA 4AXKA 2PDXA 3KZSA 1BF2A 4XAYA 5DEZA 2JQXA 4PRRA 3AYRA 1Z7AA 4JFJA 4UDMA 2PSNA 3TJ4A 4DO7A 3OODA 3TJIA 1DE5A 1EOMA 3QGAC 3BVJA 4PB3A 1GG0A 4BS0A 3IJ8A 3QW4B 1XISA 2CZVA 3N9KA 3W1QA 3TC5A 2VEGA 1XUUA 3QRHA 4U2YA 2LJ4A 4DWSD 4HNCA 5GNXA 4WSHA 1OGBA 5JH2A 3NOEA 1XV8A 4LRSA 3KOYA 1DXIA 1WUFA 3CXOA 3E02A 1NOFA 3B05A 2RURA 1CXEA 3T40A 1VJZA 2MNTA 2VJXA 5C54A 3S46A 4IMDA 3WG6A 1TPB1 1MW0A 1B30A 1WQ5A 1M5YA 1UPPA 3GU9A 3ZJ6A 4JTFA 3N1AA 2VDHA 2ESCA 4M51A 4US5A 1OJXA 3USBA 4LUSB 2HE5A 1BEUA 4UR9A 2VGBA 3ODKA 3PSVA 1LQ0A 2B7PA 3TTYA 4W7UA 1SJCA 1KGUA 4AWUA 3L2LA 4KCTA 3A9IA 4S2BA 4YYCA 3F4CA 4HSNA 1TA3A 1YPFA 2V8ZA 4DXKA 2VUYA 2ZX8A 4BF8A 3MO4A 2WPBA 1G7VA 1TJ0A 3W3OA 1A5NC 3UZJA 3COTA 1KXVA 4AVNA 3H24A 1J0ZA 3ANUA 4GY7A 4NI3A 3OB8A 1XYFA 1MW2A 2GVGA 4NILA 1DWIM 1OX4A 2N87A 3H55A 1EYEA 2XZ9A 1BKSA 1KBKA 1XH0A 1DKWA 1QPFA 2IPJA 3E0WA 4J3XA 1KFLA 3R79A 4GUIA 4TX8A 1IEIA 3MZNA 1E6RA 1A5UA 4O10A 3AYVA 3H26A 2ISVA 1I6NA 4XSLA 1PTAA 3ZIZA 2YFNA 2PN0A 4IQCA 4TTGA 2G37A 2C0HA 2PDBA 3C61A 5I3HA 3MSYA 3L5LA 2YL5A 1OC6A 1W8GA 3WKZA 1K4GA 1WDDA 3W9ZA 2VGGA 1JZ7A 1IXOA 1QPKA 2WYSA 1E1CA 3C2EA 4XD5A 2Y8VA 3A64A 4FAPA 1B3WA 5LA1A 3AMLA 1VLWA 3MMDA 3B7XA 4P7NA 2VMFA 2E8ZA 3PBWA 5EMJA 5DFAA 1FWAC 4C60A 1FCVA 4GJIA 2V5LA 1H60A 3NQBA 1OK4A 4EXQA 4KEZA 1TPFA 5I23A 1CPUA 1JEZA 2OWCA 1QK2A 1ZP3A 4RNFA 1OABA 3EY6A 1PV8A 2ZRYA 4A8NA 2IPFA 3PRAA 1DXFA 3QPYA 2WKLA 1CXLA 1MUWA 4JEJA 5HNNA 3B04A 3IPWA 4DZ2A 1GW1A 2FQIA 2Y88A 4L9YA 4LAWA 1QBBA 1KBBA 1FKRA 3T44A 2XFRA 2PPNA 1H09A 2Z0IA 3O5MA 4A3YA 2QAFA 2NQ5A 4F8XA 2GGIA 3P62A 3PFRA 3M07A 3DG3A 4DUVA 3O5IA 1CNVA 3EBVA 2CLOA 4LOCA 2C7FA 3B03A 4LVDA 2OX1A 3DC8A 1A3HA 1BF6A 4JX6A 2ZUMA 7ODCA 3GVVA 4Y90A 4IUGA 3H2NA 3WLPA 1OX5A 3L4VA 4N9CA 3UCDA 1ZJHA 3STPA 2Q3OA 3TYEA 1PCWA 4ODPA 3IGSA 4Q8NA 3AHXA 1TPUA 1S5MA 3HU7A 1X8FA 2WPGA 2YW3A 2QV4A 1JNEA 5LIXX 1X38A 2QGYA 4PUWA 2ZBTA 3CMJA 2DQXA 3APYA 4REQA 3SCUA 1DJXA 1IXPA 4KWWA 2P3EA 3GDTA 5KSWA 3EYPA 2G50A 2PDWA 4FAMA 1LUCB 3H4GA 5GVJA 3CV1A 1X97A 4PC8A 1UKQA 3P81A 1RBLA 2DW7A 1VYSX 4HP5A 2Y1HA 6ALDA 1LWIA 3WO8A 4GVGA 1VIWA 2Y8KA 3J7HA 2WM0A 4MNLA 4NASA 4QIUA 1ZK6A 3L2MA 2OODA 3VGBA 1Z48A 4UFKA 1RP8A 2UY2A 3EWCA 3JRKA 3ZLGA 4GLEA 3UETA 2PWDA 1UKSA 2XHYA 3GXIA 1U1UA 4AD1A 3W1RA 5I3FA 1AFSA 3LG3A 1CTNA 2GGJA 1FQ0A 4BEUA 1W1VA 3HMJG 1KV8A 3GKFA 3VGEA 4B3LA 2E8YA 3VIOA 3NQGA 5LXXA 3FLUA 2OKOA 3IIPA 3SURA 2XP8A 2A7PA 4EWJA 1IEXA 2IS7A 2DZVA 3ITCA 2O56A 4YWIA 3QKZA 3O06A 4W87A 3WL0A 3OBKA 5C9UA 2Q02A 1IZCA 2BDQA 2PD5A 1FWDC 2G0WA 3ARWA 4LALA 3GVGA 3KDOA 1JUEA 4L3NA 3WELA 4LBRA 1SZNA 2LKNA 4PEKA 3EOUA 4CNNA 1OHLA 3SCRA 4QIBA 4MVAA 3VZXA 3CAKA 4J3UA 1E0UA 4JNZA 2Z24A 3NQ2A 3PS7A 1J10A 5HDRA 1V0LA 1IT7A 1UROA 2VENA 1YBQB 5FAJA 2E77A 4LAKA 2IXVA 3ES8A 3AHVA 2Y7GA 5IHRA 4YVPA 5DY2A 2M2AA 3K1GA 3VMOA 2C15A 3VDGA 3W7RA 4AZHA 1KR0A 4D6EA 4KW2A 3E2VA 3HPFA 1E9LA 1U1HA 4S3EA 5F4XA 4JFLA 3ATZA 4GH3A 4I8YA 1V7AA 4GPNA 4A21A 3BSHA 4NX0A 4GOAA 1JVWA 4KGLA 4GQGA 2ZR6A 3L4XA 4HT3A 3MY9A 2PFHA 4GFSA 5FF0A 4JIPA 4JYFA 4HPXA 3E96A 3R13A 2QEZA 1PIIA 2F6KA 4JIEA 2QULA 4H9UA 5CXPA 3UERA 4HU4A 3BMVA 3WMLA 3LNMA 3WH5A 2PMQA 5L9FA 1Q65A 4FI4A 5HINA 2PLJA 5HMSA 2BGQA 3AZSA 4K36A 1YEYA 3W7HA 3UG4A 5CH9A 2XFWA 3HBLA 1AL7A 3W0KA 5HBFA 2W92A 1E4LA 3T55A 4EAMA 3TDBA 1IE7C 2GGEA 4MKVA 4YVXA 4GXMA 1RBOB 1I1WA 1ECQA 3TVAA 3W7KA 1M68A 4FNSA 2PDHA 2BSLA 3RM8A 1PX8A 3BLOA 4AWSA 4IGMA 1KB3A 2DSZA 4D6DA 2W6RA 4U2ZA 2GUBA 3WNPA 1PHQA 2UZ5A 1UR0A 1ESWA 2RGLA 4S3KA 2ZWZA 3GH7A 4DYJA 3EEZA 4LYKA 3PR9A 4MNKA 4DJDD 2YIHA 2BOEX 1IIHA 2DGAA 3CLMA 1RK6A 3ABOA 5TAOA 4HSOA 1CX9A 3PZIA 4NZ4A 4WX2A 2Z6IA 2V38A 2BXVA 1RP9A 1FP8A 5A2AA 4ZS6A 4DHGA 1JUBA 4QLKA 1JXJA 4AMCA 5M2FX 3RFAA 4IMFA 4DH0A 3NZGA 2XIQA 1UWAA 4QXIA 3OZMA 3REQB 4JAWA 4KWUA 3H4XA 2G3FA 5LIUX 4JTSA 2BNJA 2Y8UA 5H2ZA 3UZZA 3DHFA 3CB8A 4M7TA 2WSQA 3WQVA 3NQAA 1FTXA 1SJAA 3WNOA 3GHRA 4DWDA 2ZXDA 4FOKA 1VFHA 1XCFA 1ZUAX 2OT1A 3IK8A 1VQTA 1B3XA 3ZOAA 1MVYA 3O5QA 5CEWA 5ABEA 3G1HA 3G3MA 4J9JA 3G1VA 4ZTXA 2QQ6A 3ERPA 1UQYA 1KQZA 1Z3NA 3JW7A 3PG9A 4BQ2A 3L68A 3EPNA 2VX7A 2Q8ZA 2YXXA 4MZYA 4UUIA 4WKHA 4RW5A 3BV4A 3I3DA 1HIZA 3MTWA 4FZIA 1TIWA 1W5PA 1THFD 4F0MA 3QOMA 2E3ZA 4U28A 3BGGA 3QLLA 1OFQA 3MT1A 1ITCA 1QI3A 1TWZA 1LOSA 2V69A 4LC6A 2O9PA 1DWFM 1B3OA 1R9YA 4UWMA 4J5NA 1GORA 1UQZA 3AS3A 2WSKA 3NG3A 2MUCA 4K8HA 1WZAA 2BVDA 4HHLA 3TTSA 5KITA 3DENA 4PUJA 2VRJA 3UR5A 3TIMA 5DITA 1G9HA 1ZJIA 4U4MA 1UCWA 2BTMA 2XGBA 4AG0A 1K3UA 2YDSA 3QPZA 3NZQA 5CBIA 3A23A 3AS2A 2ZC8A 4AHQA 4H9ZA 2HVOA 2PU0A 3O5PA 1R86A 2C8NA 4L64A 1JYVA 3MHFA 3G1SA 4IFKA 3RX3A 1X1OA 3M47A 4ASTA 1LG2A 4ODLA 4Z2HA 5HANA 1XSJA 3VNIA 4RZ5A 4PCTA 4U31A 4U3CA 2DORA 1XDLA 1PTDA 2ZA2A 1QU4A 3T09A 5FOOA 2IMRA 3KOZA 3ARUA 3CV7A 4WUIA 4AZCA 3WFLA 5GPRA 3HZ3A 4UIOA 3GXFA 3IANA 1G94A 1B5TA 4UTFA 2Z6JA 3TC3A 1W6TA 4TO8A 5LNWA 4IQEA 3FDGA 1Q7QA 2VR5A 4D6JA 3EAUA 1AQFA 3ATYA 1XRVA 3M5YA 2VX5A 3O05A 4N4PA 2X0YA 3W7PA 2Y85A 4Y2WA 4KESA 1M04A 1KTBA 3IJIA 3K4WA 1FWWA 4M1BA 1ZAIA 1GUVA 1VKFA 1A3XA 3TNOA 2QF8A 2A5HA 3VOCA 3WQ5A 1OC7A 3BAXA 3P74A 3CPRA 3B8IA 4UTUA 5IFTA 4ZB5A 1NEYA 1BVZA 2ISSA 2A3EA 2ZIDA 4RPQA 3RITA 2WHKA 1V3LA 1XSIA 3UXLA 2G3IA 4CLMA 2QGHA 2A7RA 3PR2A 3LHUA 3O0FA 4IISA 3H7RA 1WZKA 4EVZA 2ZE3A 1I2OA 1ICQA 3GU0A 5ECVA 2YGYA 1KLYA 2FFCA 1W2PA 1JFXA 1J4RA 4K6AA 3W85A 5HWCA 2CHRA 1FA2A 3MP4A 3R58A 3UJRA 2Z1KA 3UFYA 5DIVA 4A3QA 2DSVA 4IIHA 4ZQMA 1TSIA 2V81A 1EO7A 1JYWA 4DYKA 5D04C 4B4FA 3P7YA 4JQ3A 2VM8A 5I07A 2A85A 5XIMA 4H3DA 3GUGA 5ABFA 2DG4A 1PB0A 2QCEA 4ORIA 1TX0A 2BXZA 2NXHA 2OSYA 3PM6A 2D1ZA 5DF0A 1FCQA 4INFA 4BF5A 2ZZ2A 4OVXA 2HS6A 5D2TA 5CPLA 2V5CA 1A5KC 2YCJA 4A05A 1B3ZA 3W1AA 3MUCA 1E0TA 4NQ1A 3AO0A 3TN6A 4HA1A 3AALA 1W9BM 3G22A 4DYEA 4HCDA 5FAGA 4R85A 4DRQA 1L6YA 4HBKA 2D22A 4C6FA 2OQHA 3N15A 2BY2A 2DP3A 3PNZA 4FNTA 1REQA 4IHCA 3HQ1A 3SAZA 3F4DA 1OFEA 1SM9A 5CAHA 1L0PA 2PDLA 5LNRA 3W25A 2Z00A 4ICCX 3WN6A 4TMBA 1QNSA 4P8XA 3C2VA 1AW5A 5CC5A 5F1UA 2PLMA 3N14A 5G5IA 2TSYA 2CXEA 1FHVA 2YR1A 3VKJA 1F61A 3T6CA 1V02A 4N9DA 3TAKA 3DH7A 4HTYA 1X8CA 5H1WA 1ZCCA 1B90A 1NU5A 3RRXA 3HIJA 1WOAA 4NYUA 4Q4QA 3VKCA 3UI4A 4XVDA 3TQVA 3O5GA 4O8AA 4CCDA 4JHOA 1C9WA 3GW0A 2YLLA 1QNPA 3EXTA 2ZZ3A 1Y0EA 3RX2A 1KM0A 3CMGA 1FWSA 3NGJA 1KCZA 2WNWA 5T9CE 2B31A 3IWPA 2V63A 3L66A 2WZTA 3UW6A 1CEOA 4G7EA 1E40A 4GYFA 4MM1A 4WHBA 2H9AB 1VRDA 2WMFA 4PL1A 3CB3A 4LY4A 1DV7A 3GTIA 2J24A 4N6FA 3PPHA 1PCKA 2ZX7A 3ABZA 4ZOCA 1PZ1A 5JH8A 2HBXA 2F9RA 5J04A 3PZNA 1MI3A 3W6LA 2F38A 1XI3A 3VD5A 3W27A 3EA3A 3EWYA 5D03A 1RY8A 2Y7FA 3CWNA 4KQNA 2KFWA 4ZTYA 4NHVA 2OWWA 3AIBA 3S6OA 4GQQA 3TYZA 4N4QA 2CZDA 6PTDA 2DIKA 5A6KA 4KKXA 3GYEA 4U33A 3AHYA 4HK7A 1UD6A 3VTRA 3LCLA 3SN0A 4E2OA 4NZCA 3TLQA 5U7SA 4GI4A 2PV1A 4ZPWR 4CVUA 3UA4A 1EA9C 4Y96A 3FY1A 1FDYA 4M5PA 3UYCA 4O53A 2Y62A 2V0TA 4LF2A 3RLGA 1YXCA 3AWNA 3EDKA 3LQGA 4S3CA 4C6DA 4A22A 5FIPA 3TFXA 1WA3A 3RRAA 1FDZA 5TIMA 2J47A 1L8NA 5AOUA 4L61A 2C19A 4GIAA 3AIEA 1Q4WA 3FN9A 2VTFA 1LTDA 2FIQA 1GQIA 1XBYA 3W74A 5LGZA 1BD0A 1UD3A 3OHMB 1H62A 4JTTA 1V6WA 3H12A 4H4IA 1FJDA 5AHNA 1DIEA 3AQUA 1JYNA 3UWQA 1KCLA 1AL8A 3HGOA 3V0UA 3MWAA 2WZHA 4PMNA 4LEQA 2NQZA 3DU0A 1WBJA 2I9EA 5FSDC 4LRTA 3UCCA 1RY0A 1GOWA 4ZE4A 3S1WA 3M7WA 1QWGA 2V67A 2XVGA 3W02A 2Q5AA 2ASHA 4YTUA 5JUVA 2G3JA 3V35A 3AXKA 3LB0A 2OSWA 1SJDA 3XISA 1YATA 1J0YA 4L56A 1LUCA 2FHFA 4A6GA 3LBOA 4AY8A 3MJMA 4ZPVR 1X98A 3CAWA 4XO7A 2E67A 4FSAA 1XJBA 5DBTA 4JY9A 1IEVA 2WXDM 2QAPA 5HULA 3BAJA 4JFWA 1JIBA 5A2CA 4LS1A 4AWEA 4XKYA 4AMAA 2G96A 1MEIA 5MKGB 4L5ZA 4FEZA 1M65A 4FS9A 1KRBC 5LNVA 1LBMA 3Q45A 4HA0A 5G2HA 3A3HA 1RPXA 1XIJA 3W87A 2VFFA 4HA3A 1UJPA 4FXSA 4OKDA 5AC8A 1XLAA 1Q6DA 2DIJA 1R87A 2CERA 4Y9PA 3MA8A 3O7UA 4GBUA 2AL1A 4HK5A 4B5UA 5CG7A 1G1YA 4J40A 3IK2A 2M08A 5A8QA 3QFEA 3M6YA 4PUMA 2CBVA 5TF0A 5HR6A 4CNOA 3K13A 4H6EA 2EJAA 1VF8A 1S2CA 5EBUA 3OBAA 2X0SA 2WK2A 4UNIA 3PPFA 2BFGA 2LLEA 4GYJA 3O5EA 4PODA 1VBJA 3WQOA 5D9PA 5EYWA 4GUHA 3E38A 3VD9A 5EL1A 3R8GA 3UWVA 3VNDA 5C2GA 3WD4A 3SFKA 3GTNA 2O9RA 1GVQA 1Z89A 4P7QA 4OUEA 5H8UA 3NR0A 4Z1CA 5JH1A 3O6AA 4O1DA 3G1RA 1YBQA 2ZRZA 1RBAA 4B5NA 1P48A 5HT1A 3SRHA 3VA8A 2CKRA 1N7KA 4KCUA 5AHFA 2WJEA 1EIBA 1QJWA 4J3ZA 3C3NA 2Y5JA 5BXSA 4J7RA 5D2XA 4EANA 4BQ4A 4O2TA 1VC4A 1XLCA 3IJQA 1UWUA 3S5SA 2RGMA 5M3WA 4B5WA 1OCNA 4AAJA 4UNLA 1BSIA 3DBNA 3RHGA 5I78A 3LMZA 3UG5A 5KZMA 4LAUA 4XAGA 2X8RA 1FWIC 4DJFD 3A47A 4CUCA 1GCYA 2H8XA 3HGSA 4HYWA 4J2PA 1C8YA 2NT0A 4JTKA 4X9SA 4B9ZA 3E1F1 3G77A 1XLLA 3LV6A 3ARXA 1UBPC 4LUYA 1WPCA 4IZGA 2LGOA 2X7VA 4HNTA 2VKZG 2REQB 4POCA 4AD2A 4MIMA 3AHTA 1PDZA 4K38A 4CEXC 3CV2A 3ITVA 5AFDA 3DUGA 3W7DA 4HJWA 2NWRA 3QHMA 3DFTA 2XN2A 1EB3A 2GQ8A 2I1OA 1GEHA 4AD0A 2FGZA 1FWRA 2J9YA 2WAGA 4ODQA 2PWVA 1H11A 2D20A 2PWEA 1UKTA 1EX5A 5A6TC 3PZ9A 1ISXA 4QQ3A 5C6MA 3H53A 4MAZA 4U10A 4QE5A 4B5TA 3N17A 5K2ZA 3MHUA 5CZ0A 3IUDA 1R3QA 2IKJA 3GTHA 4RXGA 4IMAA 4WCJA 1ZPTA 3CO4A 5E6ZA 4M6UA 1SR0A 2ZZ6A 1KBJA 1IT8A 3HG5A 2PTWA 7REQA 1OZQA 4Z17A 4HN4A 4YJ5A 2MLXA 3VGFA 4QG8A 5EGRA 3IUIA 5I6SA 2YCLA 4AIOA 4GQRA 1JULA 4F2BA 3NRKA 1P6WA 4Q7BA 2EPOA 3OHIA 2PODA 1EDTA 3GFXA 3KP1A 7CGTA 3KM8A 4ZMGA 1FFQA 4NRSA 1LOQA 5TNVA 1EXBA 4JFSA 5E1QA 3WH9A 1C9DA 2HCVA 1MEWA 3PUDA 3EB4A 3FKKA 4CGTA 4AZGA 1J0HA 1XP3A 2NLYA 4LT9A 1YHTA 3Q2DA 1M9HA 5A6SA 1OT1A 2F84A 4GBDA 4PMZA 2QIWA 2QVHA 1IEQA 3GVQA 3CWOX 4H6RA 1YDVA 1TRDA 3V0TA 3H2EA 2DG3A 1UJQA 4FNQA 2EF9A 2R14A 4EE9A 1JDCA 3WQ6A 5DT7A 1S1PA 2HPIA 3CL6A 4Z2LA 3CPUA 3LPPA 2J88A 2B7QA 4H8VA 4GCXA 1B31A 5C55A 4YHEA 3FXYA 2ZOXA 3NYDA 1KGXA 4O8RA 3MKVA 1AW2A 4KFPA 2H6RA 3G2GA 3MYOA 4RDZA 4ZENA 4XO6A 2I5IA 1BVNP 3PJTA 3GG1A 4YXGA 5LNSA 4GISA 3UWEA 5G1MA 2VUNA 4CQAA 4ZZ9A 4BHYA 4DRSA 2DV0A 4I9MA 5DCEA 3ZWSA 5M03A 1HNYA 4WQ6A 1DL3A 4ZE5A 1E70M 4LBSA 3VNKA 4AVOA 2MLYA 3BANA 4O1FA 3KTSA 1XL9A 4C7DA 4ROPA 1BGGA 4L4MA 4BI5A 5DELA 3OOQA 4ZCWA 2GK1B 4HHPA 5CZSA 4IL0A 4QG6A 3MWCA 1XDJA 5HW7A 4GYPA 1J8VA 3FYPA 3PRBA 3KOXA 1J79A 3FAWA 3N2TA 1VBRA 1DHKA 3ISIX 1IR2A 3A21A 1N1AA 3AS0A 2Z27A 2OSXA 1BYBA 2D24A 3SY8A 3U7VA 2ZUWA 4NZFA 1GQNA 4UQ9A 1VBHA 1VEPA 4Q4SA 3I6EA 1A5CA 1BKFA 3FVMA 1B4KA 1Z32X 3IGUA 1G67A 4N42A 2VZOA 3RILA 5FSEC 1TV4A 4DJEA 4MPKA 2XU2A 4GE8A 2ZDRA 1OADA 3FJ6A 4W5ZA 5DMMA 3GE7A 4JHMA 2XH0A 1EF3A 3BQ5A 4NIRA 4WJEA 5I00A 4DT4A 2E25A 1I0BA 2VN1A 5BWAA 4MYAA 5KZDA 2NLIA 1K7EA 8XIAA 3FHQA 3E5BA 3UNTA 2IKGA 5JU6A 2ABAA 3BOXA 5FEWA 6TIMA 1A5AA 1GJPA 3CT7A 3RU6A 2BX7A 3FA5A 4IIDA 2Y4SA 3MSDA 2A6LA 2XWEA 2YL8A 4MFDA 3VO0A 4HYRA 3JR2A 1FH8A 3BSGA 3PTDA 4AUBA 1FHLA 3MCMA 4DUXA 2O9OA 4K39A 4GMEA 2ONEA 5K3VA 3LTSA 4GGQA 1ISZA 2NXGA 3W29A 2WCAA 1WP6A 4US5D 1EZWA 4RKAA 4PGLA 3AIRA 1W1B1 2Z7KA 4FO4A 2A79A 1JDAA 2F2DA 3TA9A 2JE8A 3M9YA 3BPWA 3LXAA 3BURA 1S2VA 1EBHA 4O52A 1GHSA 1ME8A 1C8VA 1A80A 4NZ1A 1M7XA 4E2BA 3QPEA 5F2GA 5EKYA 3PG8A 3WEZA 4YVVA 3AROA 1A5OC 2X1RA 4DBWA 2HV5A 3LX9A 3CV6A 2MNRA 5F4WA 3VC5A 2KAUC 1NH6A 1QTWA 3R12A 2VZVA 1RQHA 1F8AB 5BXTA 4HVXA 3WF4A 3STFA 8RUCA 3SEPA 3S2LA 4JN8A 1OF6A 1DBTA 2P8BA 3W26A 3PANA 5B7ZA 4Q7IA 1JF6A 3KVJA 1J93A 3GNRA 2HJPA 2QJGA 2EBNA 3MC5A 3WZ0E 3UNDA 3TYCA 1F05A 3QMRA 2FHBA 5HJYA 4OBTA 1UUQA 1O5QA 1E6XM 5EB8A 1GOMA 3OYZA 4ROQA 3AC0A 4Q3MA 4M1RA 3CL8A 2JEQA 1KWGA 1O5KA 1A3WA 1XGEA 3KRZA 3M7SA 2P5NA 1AMKA 4JYSA 2OPJA 4W8BA 1AQMA 3RF9A 5CLWA 4RCXA 1N8FA 1GVRA 2NVAA 3WD0A 3IV8A 5A1AA 3CQJA 3TQKA 2L2SA 2H90A 2DZTA 4DLMA 3QM3A 1T8QA 2ZUTA 4Q8MA 3W88A 6ENLA 4NNBA 3SUVA 2ISFA 3DECA 3AIUA 4DWSC 4WDXA 1ZBWA 1X7IA 4HMDA 3L0KA 1R7OA 4R9OA 3W24A 1GVSA 3CUZA 4BK9A 1CLVA 3SY5A 1QHOA 2HNHA 1ELSA 3UXKA 2D23A 4ZFMA 4NRRA 1P1MA 3N04A 2RAGA 5BXJA 2MANA 1MWOA 3KBVA 3LLDA 4DBUA 1ENUA 3ALFA 2ABBA 3NQ7A 5XINA 1V0KA 2J4GA 4JQ4A 3GDBA 2QMJA 2XN0A 4GUJA 4YTSA 3A3XA 1RCXB 3WQGA 3VDBA 1BLIA 1R8LA 1S5WA 1BYDA 1CGWA 4X22A 3H22A 5AYZA 1Q6RA 1GKRA 1W3NA 5M17A 1ZALA 5BNKA 2WWCA 2FB2A 3T07A 2ZUNA 4W4QA 3NM1A 4RNIA 4K1GA 3SRFA 3HO8A 5DANA 3NSNA 1XRTA 1GHRA 3VFLA 4Z42C 2V5BA 2Y24A 4IFOA 3MI6A 4TXEA 5C2CA 2RUCA 3GHUA 3R8HA 3H7VA 3HM7A 4I8DA 1ZNNA 3KFTA 4WF7A 2PBCA 2OYKA 2AQVA 1V8EA 1J4EA 1UB3A 3M0MA 4HNNA 1VBGA 1BXNA 4MGGA 3H21A 1D7IA 3D3FA 1ZSXA 4GIVA 4D1JA 4H41A 5T26A 4QS6A 2VZSA 1DJNA 5KTLA 4H1ZA 1SVDA 1EJWC 4N2YA 4DRIA 4AC7C 5JBDA 3N4AA 4I6VA 1N55A 1YX1A 1W1ZA 4PH6A 2HE8A 4MGVA 4E8CA 2QXWA 2JKEA 4LAZA 2ZICA 2DJLA 2O55A 1AA1B 2RHGA 4FLSA 3PUEA 3QV7A 3SCPA 4HHMA 1DP0A 1V3HA 2WVVB 4FXRA 4PMXA 1VYRA 4B5SA 1R5YA 5AYXA 3B40A 1Q13A 3CAVA 3W28A 4L9XA 3U8GA 4NG3A 4YL2A 4LYPA 3F7JA 5DY3A 1QR7A 4R33A 2OB3A 2E6FA 2HISA 3PRDA 1Q2RA 1S39A 4TX6A 1XFCA 1HO1A 4QCFA 4QFUA 3VNZA 2EG7A 4UQCA 1BFNA 2Z4GA 2DY3A 2C71A 3K5XA 3U2ZA 1FH9A 1H5YA 2XP9A 4AHOA 2UBPC 1CGTA 2ATSA 4LVAA 2G4JA 3U4AA 4IP7A 4L72B 3VIKA 3HMCA 4ES4A 3WF2A 1WB0A 3M0XA 3GZAA 5BU6A 2QVNA 1SZEA 2E9LA 4XIAA 2A3AA 3EOLA 4LVBA 4XKMA 4Z1YA 1A0CA 1E4IA 1JCLA 3S6TA 1ZAHA 3O6CA 3WH7A 3EXSA 2C6QA 3ZSSA 3ITXA 4UCFA 3VCRA 3OIXA 5JBEA 1YMYA 3QKEA 3CUHA 1J6PA 3AICA 3RCYA 3GC2A 2P53A 3CHVA 5KZEA 4ZPTR 1TTQA 3K8MA 1UUMA 4W8LA 2XSAA 4JFTA 3MUIA 1CBGA 4U5IA 3NTPA 3DHDA 9XIMA 2VCAA 2PC8A 3UP8A 4ZOBA 4C6LA 4H2HA 1HJVA 3ONCA 1XYZA 2V3GA 3W38A 3M0HA 2WMKA 1FKJA 5F2MA 1US0A 4X63A 3NFUA 1E5NA 4RPPA 3C86A 3WK1A 2JKAA 1GGOA 2IKHA 3I3EA 4RNHA 2OZ8A 2B5UB 4GX8A 2NV1A 1BHGA 3RM4A 3L4ZA 3TTQA 2Z1VA 5AYIA 3C0JA 3GTXA 2Z1BA 1E6ZA 2QUVA 4MY1A 1PKLA 3R4IA 4HGXA 4AZ6A 1C7SA 1KGWA 1TWDA 1ZS2A 1FXPA 4ZFCA 3IEBA 3BO9A 1VFSA 3VM7A 2W3ZA 2D3NA 1E3XA 4C5YA 3NXFA 4QT3A 3IUHA 4J3WA 4NNRA 4Z2GA 1UOKA 1QHZA 1D7JA 5AYYA 4D2JA 2XN1A 1E15A 2FZ8A 1BXCA 4ACZB 4MY9A 2J66A 1FKKA 4XV0A 1XUZA 3UJFA 3U9IA 5DN1A 2O4QA 2Q09A 1FKFA 4A29A 3N18A 5FEPA 1MXDA 2VFHA 3R5EA 3ITYA 1C93A 1GZGA 3TWAA 4X60A 4PMRA 2VURA 2WCSA 3O0KA 4IMCA 4HNUA 4Y7EA 1CENA 1R3SA 1QPNA 1OG6A 2VQUA 1SW0A 4CNTA 3P0XA 2CFFA 1ADSA 4LS0A 1CZ1A 2VEIA 2REQA 4PTMA 1EPVA 1OFAA 4NJHA 1TRIA 3H54A 5FACA 2WBGA 1K70A 2G95A 3DHPA 4W7WA 3TXZA 2XSBA 3DN5A 4I6KA 2WMIB 3CUGA 2R1MA 3O5DA 1Q45A 2WC4A 2FPVA 2KI3A 5B8IC 3ZT6A 4MAVA 2XVNA 3CUFA 3LM7A 2J7FA 2QIIA 3IVSA 3WLSA 3T05A 2YW4A 3ABXA 2PDUA 3AMCA 3NIYA 3GLCA 4HU0A 3L67A 4UTHA 1ZP4A 1TMHA 1G7UA 4RZ6A 1KBLA 1R3RA 1F3TA 3MMUA 4KETA 3FGCB 2NZLA 4RL3A 3S5OA 3NI6A 4E38A 4MKSA 3NYZA 3AI0A 2W67A 3N3TA 1XIHA 1QOPA 2HWGA 2DZBA 3W2LA 1N2VA 1A5SA 4KEMA 4LB3A 2NUXA 3OZYA 2GJXB 3SUWA 3WNLA 3NZRA 3QQWA 1K9TA 1M7PA 1HL9A 4NAFB 3LQLA 1CDGA 3CS2A 3H8AA 4PB4A 2ZRXA 1DIDA 4ILSA 3WEMA 3RDKA 1RVGA 4F3HA 4UTIA 4O11A 3NQ6A 1EHAA 1GQLA 2OT0A 4PEEA 3CL7A 4FXJA 1NWSA 3EWDA 4MLJA 2QDHA 1I2PA 1E6PA 1NFGA 3NQ8A 1S2TA 2WVUA 5FEXA 2IPGA 4YNGA 2RQSA 3RGTA 3QYSA 4ZA0A 2GUUA 4CCZA 2D69A 5LA2A 1PTGA 4K8EA 4J27A 2WQDA 3AIWA 3HOJA 2WVTA 3QC0A 2V5JA 4PMQA 1VBUA 3BAWA 4KMQA 3AXXA 4JQAA 1V7YA 1SMDA 2X2GA 2Q8LA 1JAEA 4MKNA 5G2IA 2VX4A 1TPDA 3ZSTA 4EAYA 3N6JA 3B9NA 1OFBA 2EPHA 3R10A 2YB4A 1AH0A 1VJSA 1BRLA 5I03A 4ICNA 2PDYA 3HJEA 3HPSA 3VKAA 3VOGA 1V4YA 1QHPA 2HRWA 3ZYZA 4PUUA 2YBVA 1D6OA 4TNSA 3OU8A 4J3SA 4AEFA 4NJIA 2DZPA 3WF3A 1U2YA 5HPCA 3BLKA 2GJPA 1LLZA 1QOQA 3WLTA 4FP1A 4BCEA 3O6DA 2VR4A 5DLCA 4KCWA 1GYNA 3JYJA 1TKKA 1DJHA 4AF0B 1QASA 2GDUA 3HF3A 2XVKA 3MUZ1 3W71A 1A47A 3A3WA 1PEZA 2PDCA 1A5MC 1GQJA 2QJNA 3TCZA 4JQ2A 4ZO7A 4NNCA 4R53A 4DAIA 4AWTA 3WL1A 1SPQA 4LUTB 2BHYA 1MW1A 3IRDA 4QGCA 2AGKA 1C7TA 3BG3A 3KBNA 4LAXA 2ITKA 2WKGA 2CLIA 2RDUA 1AD1A 3LPFA 1IWBA 2ISWA 3VD7A 3LDVA 4IIGA 5HUAA 1WKDA 4HARA 3CIWA 4WY0F 1MQQA 1W54A 2Q8XA 1V6TA 3D0CA 2O9TA 5CJ5A 1OX6A 2OLSA 2VELA 3N3MA 2XP4A 2XM2A 3BXWA 2PF0A 1P5QA 4QG9A 2E1DA 4HK6A 2WJFA 2XUCA 4A3RA 2F8QA 4C65A 3WLIA 1UD2A 4CD7A 5AZ1A 1P6BA 3SQLA 1FCBA 2D0HA 4WD0A 1E51A 3OA5A 1W3IA 2ZKMX 2VWTA 3MHGA 1HFBA 4JCLA 1IT0A 4NI8A 5FL0A 4PZVA 3OQEA 1OINA 4HIBA 4IIFA 3KLLA 4MMWA 3TOPA 4TVUA 2HDJA 3BJSA 4XQ6A 2PTZA 2SFPA 1JPKA 3M46A 2GVJA 5A8OA 5CPMA 1GK8A 2OMAA 1GTHA 4QSHA 5C9ZA 1E9IA 1XYCA 4WXYA 1IHIA 1CWYA 1US3A 1WYIA 3FOKA 1LT7A 1FH7A 5HPOA 1XIIA 3XIMA 3M0IA 4UTMA 3ZLFA 5D38A 1NELA 3A9BA 3QR1A 3AMGA 3TCSA 4F9DA 1TV8A 1EDQA 3QZAA 4R3UA 2J13A 4F4RA 4XVEA 1EEPA 4DVOA 2J9ZA 5K9CA 2H8ZA 1D8WA 2C1IA 3MJYA 3B0YA 2PAJA 4MUZA 1YDOA 1GQKA 4IGHA 3IJ7A 3FJ4A 4ADUA 2IW0A 4JTAA 2EGZA 5JQ9A 3RO6A 4EOUA 1U5JA 2UZ9A 4AY1A 4C7FA 5A6JA 4ENLA 4D72A 4AVFA 4BF9A 1UKOA 4PCFA 3Q67A 1GVFA 3QSTA 1FHUA 5GNZA 4G8TA 1KFEA 4UC5A 4W86A 3VD4A 1X6NA 3E12A 3CQIA 4GC3A 1KM3A 1K9FA 1GVIA 3TW7A 1W9XA 4UB9A 1AZ2A 3G1XA 3YPIA 4KRTA 2RUDA 2ZX6A 1DJQA 4G6CA 5EPDA 3RPDA 4CN1A 3W07A 4ZODA 3KCOA 1EJVC 3M44A 2DW6A 2PLCA 1KO0A 1FWBC 2EJ1A 1LP6A 1UHVA 2G97A 2Z2AA 3WDRA 2J77A 4E2VA 3KCEA 3B8DA 5KZ6A 3RUBL 3UJEA 2PGFA 3TAOA 5BRPA 3VK5A 1JZ6A 1YLVA 4RV8A 1TMLA 4DJFA 4BWLA 1HVXA 1E0XA 3WEOA 2HSAA 2XGIA 2WSRA 4QP0A 1FVPA 4N9BA 2EG8A 3S5ZA 3NZPA 5D2WA 2FAPA 1TQJA 4QSFA 1UR2A 2Q6ZA 4JZ5A 3W82A 4A2SA 2ACRA 4JIHA 3VX0A 3BW2A 3UQAA 4D6CA 3TW9A 2CEQA 1JGMA 3W73A 4X61A 4H83A 2D0FA 3NCOA 2KE0A 1QPOA 5BZAA 4FF7A 3Q94A 3T0AA 4QRNA 4WZHA 1MZRA 1MRAA 4GVIA 4QR6A 5G4HC 3UXIA 2W62A 5I24A 3WLMA 2VYOA 3C2RA 5B80A 1H1ZA 4UOZA 5HOSA 4IQLA 3KTCA 5K9XA 3ID7A 3NPXA 5G4EA 2W0UA 4UFMA 5CGQA 2VC5A 1DXEA 4EPEC 4DRNA 4E8GA 1KT1A 4JDBA 4JEQA 4C02B 1DJWA 4TW6A 2VX6A 2NSXA 3P84A 5A95A 4B3ZA 3U2EA 2HNEA 2PB1A 1OIMA 2R91A 3WK3A 3LCFA 1XBVA 1QI4A 1DPMA 3MI2A 2VFDA 3FHAA 3S2CA 2DZUA 5AC6A 3PZQA 3RX4A 3ZR5A 3BMXA 4IPNB 3KCLA 1Q6QA 3H23A 3P5ZA 5DMYA 3UD6A 2WMJA 3N4FA 3OPSA 3UXAA 4J1OA 2TMDA 4LH8A 4G2DA 4F48A 3EIPA 1I2NA 1EKOA 4XD4A 1SJBA 4H7VA 5F1VA 1B0IA 1DJYA 3GH5A 2A7NA 5BRQA 1EA0A 3H9RB 3CZEA 1LROA 3DFPA 4C5ZA 3MKCA 3ZM8A 1WX0A 3G8RA 1W9PA 3OGSA 3TYBA 4PUKA 3B9EA 3LA4A 3M1ZA 4MY8A 1FKXA 1QPQA 1XLMA 1FCUA 3WNMA 1JZ5A 4OU1A 5D05A 2Z2UA 4H2CA 1NF7A 1TR1A 1ALDA 4JTIA 5J5RA 2E5DA 2VC9A 4M6QA 5G1YA 1G6CA 4WVXA 2QCMA 4ZR8A 3ZJKA 1IGSA 7XIMA 4JTEA 3IJ6A 1V0NA 3SUSA 3VMNA 3FEQA 5I3GA 1Z42A 2JGYA 3WBAA 5AHMA 3OOBA 4K7YA 2B7NA 5CSRA 1LT8A 1PO9A 4IT6A 3HG2A 4KWSA 1YADA 2CLMA 3NOYA 4YN5A 4B16A 4C90A 1BAGA 1W9DM 3LUTA 3UR7A 1SQ7A 2F2HA 3B97A 4RE2A 2CW6A 4ZVJA 1OG0A 1UMLA 4LS2A 1B1YA 2FZMA 3UWZA 1DE6A 2OEKA 1H0GA 1B3YA 3UR2A 1DJGA 1GVEA 2ZTKA 5TBOA 1G4SA 4FLQA 3BAIA 5HQMA 5AC7A 1I2QA 1T5AA 3TKFA 1X39A 2X7WA 4ZB0A 3L21A 3F4NA 4EKJA 1OD8A 2WVVA 5FD0A 2DJXA 3V75A 2OFJA 3KLKA 2VEPA 1GJWA 1OC5A 4MJ2A 3WNKA 3WJZA 3E0FA 2YA1A 3VDAA 1GWJA 1Q6UA 4HZ6A 4UZSA 4U5KA 2HXTA 1C9HA 3S42A 3WK0A 4XAPA 2AWGA 1IZKA 4OE7A 4C1KA 4H9MA 1TV3A 2JIEA 2VD8A 2BBFA 3R43A 1NTHA 4I7WA 3TMLA 3TNBA 1GOXA 1MMFA 3N34A 4PSRA 4AX6A 1ML1A 3UYIA 2KR7A 1NOWA 5LIKX 4S3FA 1H7OA 3DC0A 4D8ZA 4MWAA 2GSJA 1F2JA 3GSMA 2RFGA 4IXXA 1J2WA 5C70A 4UMAA 1NJJA 5HUPA 1TMQA 5D2VA 4DX3A 3QEZA 4E3VA 2YXGA 3G3DA 3RLUA 1NQ6A 5K7JA 2PGWA 4IP4A 1P0DA 4JN7A 1FKSA 3CZ8A 3S1GA 4C6OA 3OG3A 3PVFA 4IX2A 4P61A 2QPXA 2A1YA 3T2OA 3VXGA 1BSLA 1GKQA 3VNMA 1ONWA 3QY6A 1MXSA 5A94A 3O5JA 3D47A 1H63A 1NQKA 1U83A 5HATA 3G1FA 3DFOA 1K8YA 2RDXA 3MCNA 5I7GA 3WLQA 4OHQA 4YCOA 2R1LA 1PZ2A 1F6YA 3QH2A 4IQ2A 4ZB2A 1JCYA 2ZRVA 3R0UA 2VVNA 3B0XA 4BZYA 2D2OA 3W1XA 1JXKA 4HCLA 4DZHA 3DI0A 3CIVA 4MSPA 1IV8A 1DWAM 4DLFA 4XWUA 3LLXA 2WBKA 1U30A 4LY8A 4CN6A 1PIGA 2FZDA 4OBRA 1F40A 3DX5A 2OKTA 1R38A 2OGYA 2OGJA 2I17A 4IG2B 2HXUA 1E6SM 4AIUA 3APTA 4Z2KA 2W61A 3P8IA 2CWNA 4AYSA 5I3JA 3IAPA 2POZA 3VGDA 1XCWA 4IUOA 4QROA 2VRQA 2INFA 1KXTA 3BOFA 1AVAA 3IHZA 3NTYA 3UPMA 4JL2A 3VIGA 4V15A 1EUAA 4UNKA 3MKKA 1BL4A 1EQPA 3G0UA 2QUUA 3BJTA 3Q37A 4W9PA 1UP3A 3UWWA 4PUNA 4JKKA 4FOJA 1WDWA 5CPNA 1VS1A 4TR9A 2VL4A 4IF2A 1H49A 3RXZA 3GU2A 3KAFA 2AQOA 4KFNA 3CC1A 2NT1A 3N11A 4G5DA 2ZXAA 1S2UA 3JU2A 2RH9A 2PCEA 4ACZA 1NFBA 5HWNA 3E49A 1IQ8A 8CGTA 6XIMA 2P0IA 2PF8A 3NL5A 4NP7A 4Y8EA 1HJWA 4O4VA 2ZWYA 3UPBA 1UR3M 1OQFA 4E0CA 1T7LA 2QF7A 4IJBA 2NQJA 3S5YA 4Z0JA 1RJRA 3QLDA 5I02A 3S5NA 1D7KA 2VFIA 3KW3A 5JMUA 2NUYA 3O5RA 1LLOA 4UTTC 4CQBA 5AZ0A 5EBAA 1UZ1A 5BXPA 1C8QA 5I3DA 2WMIA 2E4TA 3WMCA 4GACA 4JFIA 1A50A 1B54A 3RJXA 4G2PA 3PWIA 1KM2A 4HOZA 4I5XA 3FJLA 3CNYA 1TPVA 2EAWA 4D6FA 1NP2A 2AOSA 1H7XA 2EXOA 2UWFA 2CU0A 1DYSA 1D3GA 1A0DA 3DYOA 2QCFA 2XPKA 1KV5A 3QR3A 4DJFC 3P2VA 4NX5A 4HU8A 2M1IA 4OECA 1XBZA 4PL2A 2CLEA 2INZA 3FGCA 1PXGA 4GZEA 1XBXA 4WJXA 3DAQA 3XINA 5E9AA 2MF9A 4O18A 3AWOA 4WGXA 3T8LA 4DIPA 4GGBA 2BASA 1O1ZA 3I3BA 3QC3A 4XTDA 2P76A 3FAPA 3U5YA 3GTYX 1WDPA 3UI6A 1A49A 2CHNA 4NAFA 4OZOA 3KZ7A 1K8ZA 4UTLA 4W88A 3TZFA 1SZGA 3G6LA 3EX1A 4L1WA 5AC4A 1HP5A 3URQA 3JXVA 1NARA 3OW1A 1KM5A 3GNPA 3T81A 4M80A 3CPGA 3KBSA 8A3HA 2CLPA 1W31A 1EWEA 2OLAA 4HKPA 3M0KA 3CZKA 4UTKA 2VXNA 3O9NA 4UQBA 4R5EA 4K37A 3C0SA 2UY5A 2WLYA 1WDSA 4PCSA 4DF0A 2R24A 4HOWA 3AMKA 3P61A 2EKCA 1BWKA 3N29A 4K68A 2XTKA 4YTTA 3WLJA 4L9ZA 1V79A 4JX4A 3EOOA 4UOJA 2GYIA 2X09A 3LZ5A 4BA0A 2VC6A 2A6NA 3F5JA 4AY7A 4F0RA 3TYAA 2GQAA 2QUNA 3KL5A 3D6NA 4TTUA 4WKFA 4DJED 1O66A 3W70A 4AU0A 4BJHA 4W9OA 1XLEA 1M6JA 3PWGA 3KZPA 5C7VA 2CPUA 4NZ3A 5CPTA 2CLHA 4WRHA 4ORMA 2EHHA 3V5CA 3NSXA 5CAKA 1BKHA 4C6CA 1KKOA 3KS5A 2PPPA 1R2TA 2V2DA 3PWAA 3PBGA 2ADAA 5CPSA 2HK0A 1W2VA 2NVCA 4LUIA 4E6MA 1UKPA 1EGMA 1AQ0A 3FYOA 4LEFA 4LXFA 1TE6A 2X41A 1J4HA 5HNRA 2F21A 3VDHA 3KTXA 1XLKA 3QGKC 4B2DD 5BCAA 1LL6A 1JCTA 3KP0A 4GA8A 1TJPA 2FVKA 1XKYA 1VFUA 4DZIA 1EP2A 3TN5A 1J18A 4TVCA 4UQAA 2V2HA 3GNXA 1EP3A 4G56A 1FWGC 5KETA 4FNRA 4WDWA 1PINA 1O60A 4GVFA 3TV8A 3WUGA 1FUYA 3LPOA 4O1CA 2ZR4A 1EOKA 4PBFA 5BRBA 3NXLA 4H9TA 4WLCA 2Z28A 3TP4A 1W26A 3PB2A 4FK9A 3R11A 2DSUA 1H5VA 4JS3A 5AECA 2XIJA 3A4AA 1OVDA 3DKJA 5C9XA 1FFRA 4G7FA 1G69A 2I16A 1WV2A 4R27A 4TV6A 3EX4A 1OCJA 3WQDA 4Q8UA 1L2QA 4OV4A 1E1CB 3LBMA 3WENA 1S5TA 1DQWA 1UH3A 3M16A 3R25A 3L5AA 4RK8A 3SZ8A 2OWXA 5J5DA 4MWAC 3SSJA 4EPDC 1LLWA 3RIKA 3AAMA 1JZ3A 1CYGA 2BHZA 1PBKA 3S2JA 2XPAA 5EU9A 4HNVA 3O2LA 1QW7A 3JS3A 3W2NA 3N13A 1E4MM 4O54A 2OYLA 2C18A 1HJUA 3OLEA 3FVDA 3CYJA 5D9NA 4N19A 1D8CA 4CCEA 3DFNA 4ODOA 3R2GA 1SFSA 4OUIA 1M03A 1W3LA 2NSOA 3V36A 4F9JA 2JKPA 2Y5EA 1DVJA 4IT4A 1D3HA 3QN3A 5AKQA 2PDMA 1XXXA 4FA3A 3KCJA 3DERA 4JIIX 2FHCA 1R3VA 2CLFA 1MFVA 3VGHA 1UR9A 1J5SA 3IARA 3ZWTA 3SCVA 1K02A 4Z2IA 3OIHA 4A35A 3F5KA 1MEHA 2IKIA 2DH2A 4G50A 2RDWA 3SQMA 4S23A 3SN4A 3WLOA 1XG4A 4F0KA 4XD6A 2Y5SA 3P93A 2PWGA 5CLTA 2W27A 5GNYA 5EMUA 5I5RA 4ZO6A 2WMHA 3WFZA 4GCAA 3RPTA 3BGAA 4LCQA 2BB0A 5C0QA 2V9DA 1VZWA 4DZ5A 3LD5A 3EMQA 1KD0A 3RN6A 1ZU8A 1F3EA 1TJ2A 5BWFA 5B7YA 4GNJA 2WJZA 2CBUA 3CGTA 1NOUA 4IQJA 3PAJA 4OOZA 3UR8A 1DIOA 4S3JA 5JBFA 4HPHA 5HK4A 1T6MA 3SCSA 2E1WA 4FX8A 1S38A 2IUZA 1V08A 2DU2A 5DMLA 2PI6A 4HPGA 5K4ZA 3WQWA 4QAIA 2HQAA 4NZJA 2CWXA 4H7CA 4IPPA 3NGFA 3W00A 1K8XA 3BG5A 1E1FA 3ZJ7A 3EKGA 3N2XA 5HW8A 2YCIX 4AISA 4RDYA 1OYAA 4XZWA 2QHAA 4CQ8A 1UIOA 5DX7A 1GOIA 5AB3A 4XZ9A 3QXBA 5L6UA 2FH6A 4LWWA 2PRLA 4LX4A 3CZLA 4IL2A 3BLEA 3FA4A 5I06A 3LOTA 1JQXA 2RKXA 5F2IA 1IYXA 5A3HA 3LHZA 1EYWA 2DZSA 2X0HA 4QDMA 5FF4A 1D7HA 4ZOAA 3W75A 1EEXA 4I5UA 1B2YA 1WKFA 4JTCA 4D6HA 3MI3A 3NEHA 3PC0A 1PYFA 4PTVA 1PKMA 4JOMA 4OJYA 4U85A 3WMSA 4JYDA 4GJJA 3VABA 2C13A 3SM0A 4Y9NA 1UZ4A 1BWVA 4E4PA 4DNMA 1WDQA 1YTDA 5H8MA 5HJXA 4KBXA 3CAQA 1VCGA 2OXNA 2WWDA 3SRDA 1CGVA 3RGCA 3K4AA 3DFSA 1SGJA 1IF2A 1M7OA 1AK5A 3C5QA 2PD9A 2UV8G 3W7IA 2Z2BA 5DO8A 1HG3A 4UFHA 3AHZA 3VU2A 1RJQA 3VMPA 4H6KA 2ZZ5A 3VIJA 4R34A 1GRJA 3NO1A 3MUAA 4UFLA 4CD6A 2ZVIA 1TUXA 4RX0A 3JUGA 2WANA 5CC3A 2CBJA 3UVAA 4GVHA 1ZY9A 3AIVA 3SY1A 4YYFA 3NDZA 4JFKA 3VINA 3EPMA 4MJMA 4H9VA 4LCRA 4UOQA 4M3PA 1XD1A 3ZXWA 1FDJA 1BTMA 4LAVA 4J35A 4H6QA 3UA3A 3O1NA 2A3LA 1W3TA 3AMDA 4K3ZA 1OGGA 3RPMA 2OFNA 2CCRA 4PMUA 1MUCA 3VKDA 5C9RA 3K8LA 2PBOA 4NSBA 2OCZA 5CSSA 2VCBA 5U4NA 3UQBA 2P88A 5I09A 5FF7A 2PDQA 1JDDA 1POJA 3OG2A 1SZFA 3EWWA 3SRKA 2IQ0A 3T78A 2X42A 3SSZA 3QBUA 4GC4A 1SSDA 3DESA 2QCNA 1Z9AA 2VHLA 3E2SA 1XRSA 3W1MA 3EX2A 4LAYA 3TROA 3O16A 4OTKA 3F1QA 4P7RA 1OFDA 3UZYA 9CGTA 3W7NA 4LBUA 1W1PA 1QPRA 3LI0A 1O4UA 5AHIA 3M0JA 3U0HA 4S2CA 3AOFA 1LQAA 2XPBA 3GIQA 3VOHA 1RSCA 3NQFA 1XWYA 2WB5A 3GYCA 1XGDA 3PJXA 4JIQA 3IJDA 1XW8A 2R1KA 1E44A 1ADDA 2PBGA 1G4TA 3BK0A 3UWYA 4FB7A 3SADA 5I2UA 3TC7A 3BLPX 1TZ9A 1NFPA 1KXQA 2G4FA 5H8PA 4C6MA 2F4EA 4PCPA 2GVEA 4V2XA 4DROA 4WGHA 2PWUA 2KZHA 1K8CA 4R0XA 1HTIA 4HCHA 2Q71A 4FNUA 1YPIA 5JIPA 4KIEA 2XVPA 4YTQA 2BOGX 2FKPA 1ME7A 6XIAA 2CZ5A 1UR4A 5EMLA 5C71A 2WZMA 4B5VA 3L0GA 2E40A 3GWQA 4M81A 4CU6A 2J7EA 1ME9A 3K4DA 3LM3A 5IXEA 4HZ8A 4O0QA 2DT1A 3N19B 3E0LA 3GRIA 4LUSA 1F4AA 1QI5A 3R89A 3PN8A 4WK9A 3TSDA 4IG2A 4DM2A 1QVBA 2YDAA 1KA9F 1TPWA 2OEMA 3SBFA 3KRUA 4MB5A 3CU2A 3W7CA 2JEPA 3VGGA 3ALGA 4ITZA 3C3UA 3PA7A 4OFCA 2H3BA 3EB3A 3NL2A 4L1GA 2BY3A 2CKSA 4ZQRA 2ZADA 3S2MA 4DXXA 2ZUSA 4QAWA 1OD0A 5BOFA 1XLGA 4GO9A 4E8DA 2GOKA 1F4HA 1XIEA 3CK5A 2VWSA 1V51A 3NVTA 1V77A 4GO8A 4B5XA 3OBEA 1W3KA 4FOUA 3S1VA 1ZL1A 1EQ3A 4IM4A 3KE0A 1FKBA 1EQCA 2WJDA 1U79A 2XFFA 1FBAA 4PUDA 3B8VA 3TN3A 4X3ZA 9XIAA 3HTWA 1ZBVA 2JIWA 3PBVA 3KHDA 1TREA 4EP8C 3L4TA 3LY0A 3I4KA 3MSGA 4O14A 4B4HA 1TJ1A 1IWPA 4MWAE 2JK2A 3HG3A 3ZQ9A 1N8IA 3AU6A 3VPLA 3DKLA 1XH1A 1MW3A 4YCPA 2VFEA 3M0ZA 1F74A 4IFRA 4ICMA 3MVTA 4IFKB 3CLWA 4CN4A 1ONEA 2P0OA 4YIWA 1GPFA 1BVWA 1UG6A 1ZAJA 3W81A 1LZOA 4IGSA 5J6EA 1Y5VA 2JBMA 3PBMA 5IDIA 1SO6A 4DO6A 1WOBA 4LVFA 3GB6A 3R6IA 3IKDA 5GJPA 1WKEA 4I9JA 5LGXA 2V68A 4QHRA 1FY6A 3NPVA 3ZFHA 1VEMA 4G1NA 3QF0A 4WR3A 1GONA 2Z29A 2I5QA 4KIRA 1J6YA 3TH6A 3HPAA 5ABTA 2VQTA 2DT3A 1XIFA 1W8SA 3PHAA 1AH4A 3A24A 3G8EA 4GG9A 4QCEA 3NWRA 2YZRA 3W2KA 1EC7A 4X2PA 4KCVA 2GOUA 5D9MA 4DELA 1XF0A 1GPWA 4L4LA 4P8UA 1AH3A 1XIGA 1ZZMA 4S39A 1E9ZB 2NQLA 1W9VA 1H51A 3RM9A 1DWJM 4LPCA 3OVGA 1AJZA 4L4OA 1ONXA 3FJNA 4O50A 1HJQA 1OM0A 4IQDA 4KS0A 1L6GA 4PFMA 1J96A 5I0DA 5MF5A 3GIPA 2OOGA 4FF5A 2VC7A 4QM1A 3NL3A 2FVLA 4CKQA 1XINA 1P4CA 2VRKA 5LHEA 4MDOA 5JIWA 5AY7A 1QCWA 3GD6A 1QXLA 3NDOA 5IM51 3OVRA 4MZ1A 1YTKA 3THUA 4DQWA 4HSHA 4XG1A 1LBFA 3U57A 4MDPA 4MOZA 3AUOA 3NQVA 2VP8A 4M6VA 5HMEA 3B4YA 4JR5A 4DNHA 3GM8A 1W17A 3BARA 5ABFB 1ICSA 2ZZ1A 3L9CA 3KAOA 2VD9A 4W89A 1B57A 4DBDA 3TC6A 1WZLA 3LBCA 2CHOA 1R47A 1DTUA 3OQ8A 1XLIA 3R94A 4WDTA 2XH7A 4WY0B 2A4AA 4MB3A 3ZT7A 3NZ1A 1I45A 2OU4A 4EF9A 3U3HA 1J9YA 3W86A 2YXOA 3ZJ8A 3P8JA 4W7VA 4ZEPA 1W1YA 2J7GA 4RZBA 1NVMA 3TCEA 3KAGA 4IGNA 1FWFC 1R9XA 1XICA 4DRKA 3W2MA 3QJAA 5EA9A 4C6PA 3G6MA 1HKIA 3WQCA 2V3EA 2NW0A 4JFMA 3I7RA 3S0CA 1REQB 2D2JA 3KS6A 3PUGA 4PMJA 3CMFA 3MV11 5FF2A 3WIJA 1KRAC 3M64A 1P43A 1JL8A 3ABQA 3VD3A 1JD7A 3GNDA 1UASA 4LVGA 1JI2A 3EWBX 2VZTA 5CZTA 4QJ4B 1D9EA 4K1WA 1FWJC 4DN1A 3KL3A 3GG7A 3TSMA 4PTWA 1OT2A 4DXVA 1YRRA 3THDA 1FP9A 4GQBA 1T99A 5BMWA 3LS9A 3NSMA 4IXHA 3IJLA 1GW9A 1Q85A 1C91A 3DG7A 1VCVA 1YIXA 3FW6A 1XSKA 1FKWA 1QATA 1Q7ZA 3C6CA 2W4XA 5FJTA 1F8IA 4DIAA 2W9MA 4XZNX 3U48A 1ADOA 3EA2A 3HQNA 2PDKA 5IDZA 2YPIA 1FWTA 1NDVA 1E6QM 3E0IA 3GDKA 1ZB5A 2E28A 4XB3A 4G7EB 4Q4RA 3AXMA 1LM1A 3V4BA 4E4UA 1SUXA 4GKTA 5I79A 2ZFAA 3MP3A 2DUZA 3K1DA 1P0NA 4EXAA 4JKLA 3T7VA 1XRFA 3GG8A 4GYKA 3R1ZA 3H70A 3M5VA 3MPGA 4Q4KA 2BY0A 1ITUA 4XZIA 1EC9A 4LAMA 3FIGA 1AUSL 1F5ZA 2GLKA 2ACQA 3W4RA 4LYRA 2WZIA 3TJXA 2PV3A 3TJLA 2EULA 2ON3A 3VC6A 1IEWA 3R8RA 2PCQA 2ZRWA 1X6LA 2VGIA 2PP3A 4Q8VA 1T96A 4LCSA 3KBMA 5DRIA 5I3KA 1KBIA 1W9UA 5DIUA 1VR6A 3GH4A 5LYRA 2JF6A 1HUVA 2PDNA 1KCXA 3G5EA 3B0VC 2OG9A 1LDCA 5LIWX 5CSUA 2PDPA 1Q5MA 1QWKA 3ABSA 1VYPX 5BXRA 3ARZA 1KM1A 3UVIA 2PS2A 1ICPA 3NQDA 1BWLA 2QJJA 2DDXA 1M41A 4FLOA 1DJIA 4I9AA 1O7AA 4PYSA 4FX7A 1JZ4A 1Y5WA 2IF4A 2ACUA 4XTIA 5E0FA 5CSYA 4O19A 3T1GA 3BLFA 4DY1A 4J4NA 1O5XA 3HA1A 3B8SA 3B4UA 3RU8X 1BYCA