4W9PA

The fk1 domain of fkbp51 in complex with (1s,5s,6r)-10-[(3,5-dichlorophenyl)sulfonyl]-5-[(1s)-1,2-dihydroxyethyl]-3-[2-(3,4-dimethoxyphenoxy)ethyl]-3,10-diazabicyclo[4.3.1]decan-2-one
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
120
Chain Sequence
TEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design and Asymmetric Synthesis of Potent and Neurotrophic Ligands for FK506-Binding Proteins (FKBPs).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 29
structure length 120
sequence length 121
chains with identical sequence E
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4w9pA00
3KAIA 2PV2A 3KABA 4LAXA 4NNRA 2ZQSA 3H9RB 2KR7A 2RUDA 3LUOA 4ODKA 5D75A 2OFNA 4TW6A 4R0XA 4IQCA 1BL4A 1Q6UA 1QPFA 3PRBA 4DRJA 1FJDA 3NRKA 1JVWA 1R9HA 2KO7A 4ODRA 4ODNA 5HWBA 2JZVA 1FKJA 1FKRA 2ITKA 3UQIA 4DROA 1EYMA 3CGNA 4BF8A 2KFWA 3RGCA 2MLZA 3UQBA 2PBCA 1J4IA 2FKEA 2MLYA 2VCDA 3JYJA 5HKGA 4C02B 3NI6A 3KCEA 1FKSA 4ODOA 4QT2A 5HWCA 2ZQVA 5GPGA 2IF4A 2RQSA 1JNTA 2DG3A 1D7HA 2XP5A 2DG9A 3KAGA 4TNSA 4W9PA 5HW6A 1NSGA 2LKNA 4JYSA 4LAVA 3VAWA 1TCOC 1T11A 1C9HA 2ZQUA 3O5EA 4QT3A 2XPAA 2PPPA 3KZ7A 4FN2A 1YW5A 4W9OA 3WH0A 1W26A 4J4NA 4DRPA 1BKFA 5HTGA 1P5QA 1YATA 4LAYA 4U86A 3TDBA 4DRKA 1QPLA 4JFIA 3GPKA 2RUCA 1J4RA 2M1IA 2PPOA 2N87A 3IK8A 1J4HA 2LGOA 1FD9A 4JFMA 3PRDA 4DRIA 1ROTA 1F8AB 2M08A 2DG4A 1FKTA 3O5DA 1D7JA 3UI4A 2XP4A 5BXJA 2KE0A 3KACA 3IKDA 2KI3A 2LJ4A 2AWGA 3O5MA 1FKBA 4JFJA 5DITA 1NMWA 1Q6IA 3O5OA 2RSEA 3O5QA 4O2TA 4TYOA 4DZ3A 4FAPA 4DRQA 1Q1CA 3I6CA 3O5KA 2XP9A 3O5LA 3IKGA 2F2DA 3O5RA 4MSPA 2XP6A 4U84A 2Q5AA 4DZ2A 2MLXA 2D9FA 4TW7A 3O5IA 1QZ2A 1PINA 4MGVA 5HUAA 4GGQA 5DIUA 2M2AA 5DIVA 1FKFA 2XP8A 2PPNA 2VN1A 4JFKA 4ITZA 3UI5A 1D7IA 4IQ2A 1FKKA 1M5YA 2UZ5A 1U79A 1Y0OA 1FKDA 2RURA 3IHZA 3JXVA 4TW8A 2F4EA 4U85A 4ODPA 5HW8A 1L1PA 2ZR6A 1PBKA 4QIBA 4N19A 3JYMA 1FKLA 3O5JA 3ODKA 1FAPA 1N1AA 3TC5A 5HT1A 1J6YA 1HXVA 1FKIA 1NMVA 3O5PA 4JFLA 2PV1A 4W9QA 3EY6A 3KAFA 1ZCNA 3UI6A 4DT4A 2L2SA 2MNTA 2F21A 4LAWA 4ODLA 5B8IC 2ZR5A 4ODMA 3UQAA 2ZR4A 4G2PA 3CGMA 3PA7A 4DRMA 2KGJA 2LPVA 1A7XA 4TX0A 2XPBA 2K8IA 3O5GA 2RUQA 5HW7A 4IPXA 1FKHA 1FKGA 1D6OA 1ROUA 2ZQTA 2XP7A 4DIPA 4GIVA 4J4OA 1KT0A 1ZK6A 2XP3A 1EQ3A 3NTPA 3OOBA 4ODQA 3UF8A 1KT1A 2FAPA 2MPHA 2Y78A 2PV3A 3KADA 4G50A 5J6EA 1JNSA 1B6CA 3B7XA 3RFWA 4DRNA 5I98A 3MDYB 1F40A 3O5FA 4DRHA 3FAPA 3KAHA 1Q6HA 2MF9A 4DH0A 3TCZA
chains in the Genus database with same CATH superfamily
3CHFA 4KR0B 1OWQA 1FFRA 3OA5A 3H9RB 4ODKA 3LUOA 4WKAA 4R0XA 4IQCA 1BL4A 3CH9A 1JVWA 4ODRA 5HWBA 1FKJA 1FKRA 3ARSA 3UQIA 4NZCA 1EYMA 2MLZA 2PBCA 1J4IA 1HJWA 2FKEA 2MLYA 5HKGA 5HWCA 1FKSA 2DT0A 2G8ZA 1ZB5A 1HJVA 1E6NA 3W4RA 3CZ8A 4LAVA 3VAWA 2ZQUA 3O5EA 3ARVA 1UR9A 1BKFA 4DRKA 3GPKA 1ZL1A 2WK2A 3IK8A 3WIJA 1FD9A 4JFMA 1SR0A 1ROTA 1F8AB 4MAVA 3UI4A 2XP4A 4ZS6A 4ML4A 1NWRA 2LJ4A 1EDQA 3O5MA 4P8XA 3CHDA 4JFJA 1LJYA 3O5OA 1JCHB 4TYOA 1Q1CA 3I6CA 1E6PA 4MSPA 4MTVA 2XP6A 3CHEA 2Q5AA 1EHNA 5HUAA 2DPEA 3WD3A 4URIA 2M2AA 1X6NA 2XP8A 2VN1A 3AROA 1W1TA 4TW8A 2F4EA 4Z2LA 4ODPA 1JNEA 1FKLA 3O5JA 3ODKA 4DWSB 3FXYA 1FKIA 1NMVA 3O5PA 1KFWA 1ZBWA 2MNTA 3UQAA 4G2PA 3CGMA 3PA7A 1WB0A 1A7XA 4TX0A 2RUQA 1W9PA 2IUZA 3GTYX 4IT6A 1D6OA 1ROUA 2XP7A 4S3JA 4J4OA 4Z2JA 1ZK6A 1ZBKA 1EQ3A 4ODQA 1GRJA 2FAPA 2Y78A 5J6EA 1JNSA 1UR8A 1B6CA 3RFWA 1F40A 1ZBCA 3MDYB 1O6IA 3KAIA 1CTNA 2G41A 4LAXA 1LQ0A 2KR7A 5D75A 1Q6UA 1R9HA 2F23A 5GPRA 4BF8A 1HKKA 4WIWA 3B9EA 2ZQVA 4ZPVR 1VF8A 4Q7NA 2DG3A 1D7HA 3ARUA 3WD2A 4L72B 5HW6A 1NSGA 1W1VA 1OGGA 2LKNA 4W5UA 2WLYA 1C9HA 4DWSA 4QT3A 1YW5A 4Z2IA 4W9OA 4MNJA 3WH0A 4LAYA 4U86A 3TDBA 4L3NA 2RUCA 2PPOA 1LL6A 1TFVA 3FY1A 3PRDA 2DG4A 1XHGA 1E9LA 3IKDA 3B9DA 3WL0A 3GU0A 4S3KA 2AOSA 4O2TA 2RSEA 3O5QA 4IT4A 3O5LA 4WK9A 3O5RA 2O92A 4DZ2A 1GUVA 3O5IA 2DSZA 5DIVA 3WL1A 4ITZA 3ALFA 3UI5A 1H0IA 1D7IA 1FKKA 1M5YA 3IHZA 1U79A 1Y0OA 4U85A 3RM9A 5BXJA 5HW8A 1L1PA 1PBKA 1FAPA 1N1AA 5HT1A 1FFQA 1IX5A 4KQZA 4P8VA 1HXVA 2PV1A 4UDMA 3KAFA 1E15A 4DT4A 2F21A 1ZBVA 5B8IC 2PI6A 2ZR5A 4ODMA 4WKHA 1E44A 4Z2KA 5HW7A 4IPXA 1LL4A 3AS2A 1KT0A 2DT1A 4DWSC 1SYTA 3NTPA 1KT1A 3ARPA 3KADA 4G50A 1W9VA 4DRNA 3FAPA 3KAHA 2DSUA 4P8WA 4DH0A 3KABA 2P4VA 4TW6A 4DRJA 1QPFA 1FJDA 2A3AA 2KO7A 4ODNA 5DEZA 1LL7A 3CGNA 3RGCA 1ZU8A 4MNKA 5DO2A 3JYJA 2VCDA 3B8SA 3KCEA 4ODOA 5GPGA 3PRAA 3ARQA 4TNSA 2XP5A 2DG9A 1TCOC 1T11A 2XPAA 3KZ7A 4FN2A 1JNDA 3WKZA 1YATA 4P8UA 1QPLA 3QOKA 4JFIA 4R5EA 1J4RA 2N87A 4MNMA 1J4HA 2LGOA 2M08A 3O5DA 1D7JA 3WD4A 2DT3A 2KE0A 2KI3A 2QF8A 2ETNA 3ARWA 1FKBA 2B5UB 1LG2A 2OLHA 5DITA 3ARYA 1Q6IA 4DZ3A 3AS3A 3O5KA 1K9TA 2YBUA 3IKGA 4U84A 5GQBA 2MLXA 2D9FA 1PINA 4HBEA 3ARTA 3WQVA 4GGQA 5DIUA 4JFKA 4IQ2A 3JXVA 2ZR6A 4QIBA 1GPFA 1J6YA 1WAWA 4AY1A 2FDMA 3EY6A 3UI6A 2L2SA 4ODLA 2KGJA 1NWSA 1FKHA 2PN0A 1FKGA 4DIPA 4GIVA 1XRVA 1ITXA 2MPHA 4Q22A 1RD6A 4DRHA 2O9OA 1Q6HA 2MF9A 1GOIA 2PV2A 4NNRA 1HKJA 2ZQSA 1HJXA 2RUDA 3WD0A 2OFNA 3PRBA 4WJXA 2DT2A 3AQUA 3NRKA 3RM4A 2JZVA 2EULA 2ITKA 4DROA 4ZPTR 3G6MA 2KFWA 2YBTA 3UQBA 2A3EA 5JH8A 4C02B 3NI6A 4QT2A 2IF4A 2RQSA 2A3CA 1JNTA 3KAGA 4W9PA 1NWTA 1HKMA 4Z2HA 4JYSA 3ARRA 4MNLA 4HARA 2PPPA 1LG1A 1W26A 4J4NA 4QZVB 4DRPA 1P5QA 5HTGA 1X6LA 2DSWA 1E6ZA 3ARXA 2M1IA 4DWSD 3G6LA 1EIBA 1NH6A 3ARZA 4DRIA 3RMEA 1W9UA 1FKTA 4WKFA 2ESCA 3KACA 2AWGA 3BMBA 1NMWA 3AS0A 4FAPA 2XP9A 3CHCA 3WD1A 1OGBA 2B31A 3PR9A 2F2DA 3ALGA 4PTMA 4NSBA 4TW7A 1D2KA 1QZ2A 4MGVA 1NWUA 1FKFA 2PPNA 3EIPA 2WLZA 1HKIA 2UZ5A 4DRQA 1FKDA 2RURA 1E6RA 3BXWA 4N19A 3JYMA 3TC5A 4ZPWR 3WQWA 2WM0A 4JFLA 4W9QA 1ZCNA 1W1PA 4LAWA 4LGXA 2ZR4A 4DRMA 1H0GA 4MPKA 2LPVA 2XPBA 2K8IA 3O5GA 1WNOA 3RM8A 2ZQTA 2DSVA 4Z2GA 3B9AA 2A3BA 4HBOA 2XP3A 3OOBA 3UF8A 5DF0A 1W1YA 4XAKA 2PV3A 3B7XA 5I98A 5HBFA 3O5FA 3AS1A 3TCZA
chains in the Genus database with same CATH topology
3CHFA 4KR0B 1OWQA 1FFRA 3OA5A 3H9RB 4ODKA 3LUOA 4WKAA 4R0XA 4IQCA 1BL4A 3CH9A 1JVWA 4ODRA 5HWBA 1FKJA 1FKRA 3ARSA 3UQIA 4NZCA 1EYMA 2MLZA 2PBCA 1J4IA 1HJWA 2FKEA 2MLYA 5HKGA 5HWCA 1FKSA 2DT0A 2G8ZA 1ZB5A 1HJVA 1E6NA 3W4RA 3CZ8A 4LAVA 3VAWA 2ZQUA 3O5EA 3ARVA 1UR9A 1BKFA 4DRKA 3GPKA 1ZL1A 2WK2A 3IK8A 3WIJA 1FD9A 4JFMA 1SR0A 1ROTA 1F8AB 4MAVA 3UI4A 2XP4A 4ZS6A 4ML4A 1NWRA 2LJ4A 1EDQA 3O5MA 4P8XA 3CHDA 4JFJA 1LJYA 3O5OA 4TYOA 1Q1CA 3I6CA 1E6PA 4MSPA 4MTVA 2XP6A 3CHEA 2Q5AA 1EHNA 5HUAA 2DPEA 3WD3A 4URIA 2M2AA 1X6NA 2XP8A 2VN1A 3AROA 1W1TA 4TW8A 2F4EA 4Z2LA 4ODPA 1JNEA 1FKLA 3O5JA 3ODKA 4DWSB 3FXYA 1FKIA 1NMVA 3O5PA 1KFWA 1ZBWA 2MNTA 3UQAA 4G2PA 3CGMA 3PA7A 1WB0A 1A7XA 4TX0A 2RUQA 1W9PA 2IUZA 4IT6A 1D6OA 1ROUA 2XP7A 4S3JA 4J4OA 4Z2JA 1ZK6A 1ZBKA 1EQ3A 4ODQA 2FAPA 2Y78A 5J6EA 1JNSA 1UR8A 1B6CA 3RFWA 1F40A 1ZBCA 3MDYB 1O6IA 3KAIA 1CTNA 2G41A 4LAXA 1LQ0A 2KR7A 5D75A 1Q6UA 1R9HA 5GPRA 4BF8A 1HKKA 4WIWA 3B9EA 2ZQVA 4ZPVR 1VF8A 4Q7NA 2DG3A 1D7HA 3ARUA 3WD2A 4L72B 5HW6A 1NSGA 1W1VA 1OGGA 2LKNA 4W5UA 2WLYA 1C9HA 4DWSA 4QT3A 1YW5A 4Z2IA 4W9OA 4MNJA 3WH0A 4LAYA 4U86A 3TDBA 4L3NA 2RUCA 2PPOA 1LL6A 1TFVA 3FY1A 3PRDA 2DG4A 1XHGA 1E9LA 3IKDA 3B9DA 3WL0A 4S3KA 2AOSA 4O2TA 2RSEA 3O5QA 4IT4A 3O5LA 4WK9A 3O5RA 2O92A 4DZ2A 1GUVA 3O5IA 2DSZA 5DIVA 3WL1A 4ITZA 3ALFA 3UI5A 1H0IA 1D7IA 1FKKA 1M5YA 3IHZA 1U79A 1Y0OA 4U85A 3RM9A 5BXJA 5HW8A 1L1PA 1PBKA 1FAPA 1N1AA 5HT1A 1FFQA 1IX5A 4KQZA 4P8VA 1HXVA 2PV1A 3KAFA 1E15A 4DT4A 2F21A 1ZBVA 5B8IC 2PI6A 2ZR5A 4ODMA 4WKHA 4Z2KA 5HW7A 4IPXA 1LL4A 3AS2A 1KT0A 2DT1A 4DWSC 1SYTA 3NTPA 1KT1A 3ARPA 3KADA 4G50A 1W9VA 4DRNA 3FAPA 3KAHA 2DSUA 4P8WA 4DH0A 3KABA 4TW6A 4DRJA 1QPFA 1FJDA 2A3AA 2KO7A 4ODNA 5DEZA 1LL7A 3CGNA 3RGCA 1ZU8A 4MNKA 5DO2A 3JYJA 2VCDA 3B8SA 3KCEA 4ODOA 5GPGA 3PRAA 3ARQA 4TNSA 2XP5A 2DG9A 1TCOC 1T11A 2XPAA 3KZ7A 4FN2A 1JNDA 3WKZA 1YATA 4P8UA 1QPLA 3QOKA 4JFIA 4R5EA 1J4RA 2N87A 4MNMA 1J4HA 2LGOA 2M08A 3O5DA 1D7JA 3WD4A 2DT3A 2KE0A 2KI3A 2QF8A 3ARWA 1FKBA 1LG2A 2OLHA 5DITA 3ARYA 1Q6IA 4DZ3A 3AS3A 3O5KA 1K9TA 2YBUA 3IKGA 4U84A 5GQBA 2MLXA 2D9FA 1PINA 4HBEA 3ARTA 3WQVA 4GGQA 5DIUA 4JFKA 4IQ2A 3JXVA 2ZR6A 4QIBA 1GPFA 1J6YA 1WAWA 4AY1A 2FDMA 3EY6A 3UI6A 2L2SA 4ODLA 2KGJA 1NWSA 1FKHA 1FKGA 4DIPA 4GIVA 1XRVA 1ITXA 2MPHA 4Q22A 1RD6A 4DRHA 2O9OA 1Q6HA 2MF9A 1GOIA 2PV2A 4NNRA 1HKJA 2ZQSA 1HJXA 2RUDA 3WD0A 2OFNA 3PRBA 4WJXA 2DT2A 3AQUA 3NRKA 3RM4A 2JZVA 2ITKA 4DROA 4ZPTR 3G6MA 2KFWA 2YBTA 3UQBA 2A3EA 5JH8A 4C02B 3NI6A 4QT2A 2IF4A 2RQSA 2A3CA 1JNTA 3KAGA 4W9PA 1NWTA 1HKMA 4Z2HA 4JYSA 3ARRA 4MNLA 4HARA 2PPPA 1LG1A 1W26A 4J4NA 4QZVB 4DRPA 1P5QA 5HTGA 1X6LA 2DSWA 1E6ZA 3ARXA 2M1IA 4DWSD 3G6LA 1EIBA 1NH6A 3ARZA 4DRIA 3RMEA 1W9UA 1FKTA 4WKFA 2ESCA 3KACA 2AWGA 1NMWA 3AS0A 4FAPA 2XP9A 3CHCA 3WD1A 1OGBA 2B31A 3PR9A 2F2DA 3ALGA 4PTMA 4NSBA 4TW7A 1D2KA 1QZ2A 4MGVA 1NWUA 1FKFA 2PPNA 2WLZA 1HKIA 2UZ5A 4DRQA 1FKDA 2RURA 1E6RA 3BXWA 4N19A 3JYMA 3TC5A 4ZPWR 3WQWA 2WM0A 4JFLA 4W9QA 1ZCNA 1W1PA 4LAWA 4LGXA 2ZR4A 4DRMA 1H0GA 4MPKA 2LPVA 2XPBA 2K8IA 3O5GA 1WNOA 3RM8A 2ZQTA 2DSVA 4Z2GA 3B9AA 2A3BA 4HBOA 2XP3A 3OOBA 3UF8A 5DF0A 1W1YA 4XAKA 2PV3A 3B7XA 5I98A 5HBFA 3O5FA 3AS1A 3TCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAI A;  2PV2 A;  3KAB A;  4LAX A;  4NNR A;  2ZQS A;  3H9R B;  2KR7 A;  2RUD A;  3LUO A;  4ODK A;  5D75 A;  2OFN A;  4TW6 A;  4R0X A;  4IQC A;  1BL4 A;  1Q6U A;  1QPF A;  3PRB A;  4DRJ A;  1FJD A;  3NRK A;  1JVW A;  1R9H A;  2KO7 A;  4ODR A;  4ODN A;  5HWB A;  2JZV A;  1FKJ A;  1FKR A;  2ITK A;  3UQI A;  4DRO A;  1EYM A;  3CGN A;  4BF8 A;  2KFW A;  3RGC A;  2MLZ A;  3UQB A;  2PBC A;  1J4I A;  2FKE A;  2MLY A;  2VCD A;  3JYJ A;  5HKG A;  4C02 B;  3NI6 A;  3KCE A;  1FKS A;  4ODO A;  4QT2 A;  5HWC A;  2ZQV A;  5GPG A;  2IF4 A;  2RQS A;  1JNT A;  2DG3 A;  1D7H A;  2XP5 A;  2DG9 A;  3KAG A;  4TNS A;  4W9P A;  5HW6 A;  1NSG A;  2LKN A;  4JYS A;  4LAV A;  3VAW A;  1TCO C;  1T11 A;  1C9H A;  2ZQU A;  3O5E A;  4QT3 A;  2XPA A;  2PPP A;  3KZ7 A;  4FN2 A;  1YW5 A;  4W9O A;  3WH0 A;  1W26 A;  4J4N A;  4DRP A;  1BKF A;  5HTG A;  1P5Q A;  1YAT A;  4LAY A;  4U86 A;  3TDB A;  4DRK A;  1QPL A;  4JFI A;  3GPK A;  2RUC A;  1J4R A;  2M1I A;  2PPO A;  2N87 A;  3IK8 A;  1J4H A;  2LGO A;  1FD9 A;  4JFM A;  3PRD A;  4DRI A;  1ROT A;  1F8A B;  2M08 A;  2DG4 A;  1FKT A;  3O5D A;  1D7J A;  3UI4 A;  2XP4 A;  5BXJ A;  2KE0 A;  3KAC A;  3IKD A;  2KI3 A;  2LJ4 A;  2AWG A;  3O5M A;  1FKB A;  4JFJ A;  5DIT A;  1NMW A;  1Q6I A;  3O5O A;  2RSE A;  3O5Q A;  4O2T A;  4TYO A;  4DZ3 A;  4FAP A;  4DRQ A;  1Q1C A;  3I6C A;  3O5K A;  2XP9 A;  3O5L A;  3IKG A;  2F2D A;  3O5R A;  4MSP A;  2XP6 A;  4U84 A;  2Q5A A;  4DZ2 A;  2MLX A;  2D9F A;  4TW7 A;  3O5I A;  1QZ2 A;  1PIN A;  4MGV A;  5HUA A;  4GGQ A;  5DIU A;  2M2A A;  5DIV A;  1FKF A;  2XP8 A;  2PPN A;  2VN1 A;  4JFK A;  4ITZ A;  3UI5 A;  1D7I A;  4IQ2 A;  1FKK A;  1M5Y A;  2UZ5 A;  1U79 A;  1Y0O A;  1FKD A;  2RUR A;  3IHZ A;  3JXV A;  4TW8 A;  2F4E A;  4U85 A;  4ODP A;  5HW8 A;  1L1P A;  2ZR6 A;  1PBK A;  4QIB A;  4N19 A;  3JYM A;  1FKL A;  3O5J A;  3ODK A;  1FAP A;  1N1A A;  3TC5 A;  5HT1 A;  1J6Y A;  1HXV A;  1FKI A;  1NMV A;  3O5P A;  4JFL A;  2PV1 A;  4W9Q A;  3EY6 A;  3KAF A;  1ZCN A;  3UI6 A;  4DT4 A;  2L2S A;  2MNT A;  2F21 A;  4LAW A;  4ODL A;  5B8I C;  2ZR5 A;  4ODM A;  3UQA A;  2ZR4 A;  4G2P A;  3CGM A;  3PA7 A;  4DRM A;  2KGJ A;  2LPV A;  1A7X A;  4TX0 A;  2XPB A;  2K8I A;  3O5G A;  2RUQ A;  5HW7 A;  4IPX A;  1FKH A;  1FKG A;  1D6O A;  1ROU A;  2ZQT A;  2XP7 A;  4DIP A;  4GIV A;  4J4O A;  1KT0 A;  1ZK6 A;  2XP3 A;  1EQ3 A;  3NTP A;  3OOB A;  4ODQ A;  3UF8 A;  1KT1 A;  2FAP A;  2MPH A;  2Y78 A;  2PV3 A;  3KAD A;  4G50 A;  5J6E A;  1JNS A;  1B6C A;  3B7X A;  3RFW A;  4DRN A;  5I98 A;  3MDY B;  1F40 A;  3O5F A;  4DRH A;  3FAP A;  3KAH A;  1Q6H A;  2MF9 A;  4DH0 A;  3TCZ A; 
#chains in the Genus database with same CATH topology
 3CHF A;  4KR0 B;  1OWQ A;  1FFR A;  3OA5 A;  3H9R B;  4ODK A;  3LUO A;  4WKA A;  4R0X A;  4IQC A;  1BL4 A;  3CH9 A;  1JVW A;  4ODR A;  5HWB A;  1FKJ A;  1FKR A;  3ARS A;  3UQI A;  4NZC A;  1EYM A;  2MLZ A;  2PBC A;  1J4I A;  1HJW A;  2FKE A;  2MLY A;  5HKG A;  5HWC A;  1FKS A;  2DT0 A;  2G8Z A;  1ZB5 A;  1HJV A;  1E6N A;  3W4R A;  3CZ8 A;  4LAV A;  3VAW A;  2ZQU A;  3O5E A;  3ARV A;  1UR9 A;  1BKF A;  4DRK A;  3GPK A;  1ZL1 A;  2WK2 A;  3IK8 A;  3WIJ A;  1FD9 A;  4JFM A;  1SR0 A;  1ROT A;  1F8A B;  4MAV A;  3UI4 A;  2XP4 A;  4ZS6 A;  4ML4 A;  1NWR A;  2LJ4 A;  1EDQ A;  3O5M A;  4P8X A;  3CHD A;  4JFJ A;  1LJY A;  3O5O A;  1JCH B;  4TYO A;  1Q1C A;  3I6C A;  1E6P A;  4MSP A;  4MTV A;  2XP6 A;  3CHE A;  2Q5A A;  1EHN A;  5HUA A;  2DPE A;  3WD3 A;  4URI A;  2M2A A;  1X6N A;  2XP8 A;  2VN1 A;  3ARO A;  1W1T A;  4TW8 A;  2F4E A;  4Z2L A;  4ODP A;  1JNE A;  1FKL A;  3O5J A;  3ODK A;  4DWS B;  3FXY A;  1FKI A;  1NMV A;  3O5P A;  1KFW A;  1ZBW A;  2MNT A;  3UQA A;  4G2P A;  3CGM A;  3PA7 A;  1WB0 A;  1A7X A;  4TX0 A;  2RUQ A;  1W9P A;  2IUZ A;  3GTY X;  4IT6 A;  1D6O A;  1ROU A;  2XP7 A;  4S3J A;  4J4O A;  4Z2J A;  1ZK6 A;  1ZBK A;  1EQ3 A;  4ODQ A;  1GRJ A;  2FAP A;  2Y78 A;  5J6E A;  1JNS A;  1UR8 A;  1B6C A;  3RFW A;  1F40 A;  1ZBC A;  3MDY B;  1O6I A;  3KAI A;  1CTN A;  2G41 A;  4LAX A;  1LQ0 A;  2KR7 A;  5D75 A;  1Q6U A;  1R9H A;  2F23 A;  5GPR A;  4BF8 A;  1HKK A;  4WIW A;  3B9E A;  2ZQV A;  4ZPV R;  1VF8 A;  4Q7N A;  2DG3 A;  1D7H A;  3ARU A;  3WD2 A;  4L72 B;  5HW6 A;  1NSG A;  1W1V A;  1OGG A;  2LKN A;  4W5U A;  2WLY A;  1C9H A;  4DWS A;  4QT3 A;  1YW5 A;  4Z2I A;  4W9O A;  4MNJ A;  3WH0 A;  4LAY A;  4U86 A;  3TDB A;  4L3N A;  2RUC A;  2PPO A;  1LL6 A;  1TFV A;  3FY1 A;  3PRD A;  2DG4 A;  1XHG A;  1E9L A;  3IKD A;  3B9D A;  3WL0 A;  3GU0 A;  4S3K A;  2AOS A;  4O2T A;  2RSE A;  3O5Q A;  4IT4 A;  3O5L A;  4WK9 A;  3O5R A;  2O92 A;  4DZ2 A;  1GUV A;  3O5I A;  2DSZ A;  5DIV A;  3WL1 A;  4ITZ A;  3ALF A;  3UI5 A;  1H0I A;  1D7I A;  1FKK A;  1M5Y A;  3IHZ A;  1U79 A;  1Y0O A;  4U85 A;  3RM9 A;  5BXJ A;  5HW8 A;  1L1P A;  1PBK A;  1FAP A;  1N1A A;  5HT1 A;  1FFQ A;  1IX5 A;  4KQZ A;  4P8V A;  1HXV A;  2PV1 A;  4UDM A;  3KAF A;  1E15 A;  4DT4 A;  2F21 A;  1ZBV A;  5B8I C;  2PI6 A;  2ZR5 A;  4ODM A;  4WKH A;  1E44 A;  4Z2K A;  5HW7 A;  4IPX A;  1LL4 A;  3AS2 A;  1KT0 A;  2DT1 A;  4DWS C;  1SYT A;  3NTP A;  1KT1 A;  3ARP A;  3KAD A;  4G50 A;  1W9V A;  4DRN A;  3FAP A;  3KAH A;  2DSU A;  4P8W A;  4DH0 A;  3KAB A;  2P4V A;  4TW6 A;  4DRJ A;  1QPF A;  1FJD A;  2A3A A;  2KO7 A;  4ODN A;  5DEZ A;  1LL7 A;  3CGN A;  3RGC A;  1ZU8 A;  4MNK A;  5DO2 A;  3JYJ A;  2VCD A;  3B8S A;  3KCE A;  4ODO A;  5GPG A;  3PRA A;  3ARQ A;  4TNS A;  2XP5 A;  2DG9 A;  1TCO C;  1T11 A;  2XPA A;  3KZ7 A;  4FN2 A;  1JND A;  3WKZ A;  1YAT A;  4P8U A;  1QPL A;  3QOK A;  4JFI A;  4R5E A;  1J4R A;  2N87 A;  4MNM A;  1J4H A;  2LGO A;  2M08 A;  3O5D A;  1D7J A;  3WD4 A;  2DT3 A;  2KE0 A;  2KI3 A;  2QF8 A;  2ETN A;  3ARW A;  1FKB A;  2B5U B;  1LG2 A;  2OLH A;  5DIT A;  3ARY A;  1Q6I A;  4DZ3 A;  3AS3 A;  3O5K A;  1K9T A;  2YBU A;  3IKG A;  4U84 A;  5GQB A;  2MLX A;  2D9F A;  1PIN A;  4HBE A;  3ART A;  3WQV A;  4GGQ A;  5DIU A;  4JFK A;  4IQ2 A;  3JXV A;  2ZR6 A;  4QIB A;  1GPF A;  1J6Y A;  1WAW A;  4AY1 A;  2FDM A;  3EY6 A;  3UI6 A;  2L2S A;  4ODL A;  2KGJ A;  1NWS A;  1FKH A;  2PN0 A;  1FKG A;  4DIP A;  4GIV A;  1XRV A;  1ITX A;  2MPH A;  4Q22 A;  1RD6 A;  4DRH A;  2O9O A;  1Q6H A;  2MF9 A;  1GOI A;  2PV2 A;  4NNR A;  1HKJ A;  2ZQS A;  1HJX A;  2RUD A;  3WD0 A;  2OFN A;  3PRB A;  4WJX A;  2DT2 A;  3AQU A;  3NRK A;  3RM4 A;  2JZV A;  2EUL A;  2ITK A;  4DRO A;  4ZPT R;  3G6M A;  2KFW A;  2YBT A;  3UQB A;  2A3E A;  5JH8 A;  4C02 B;  3NI6 A;  4QT2 A;  2IF4 A;  2RQS A;  2A3C A;  1JNT A;  3KAG A;  4W9P A;  1NWT A;  1HKM A;  4Z2H A;  4JYS A;  3ARR A;  4MNL A;  4HAR A;  2PPP A;  1LG1 A;  1W26 A;  4J4N A;  4QZV B;  4DRP A;  1P5Q A;  5HTG A;  1X6L A;  2DSW A;  1E6Z A;  3ARX A;  2M1I A;  4DWS D;  3G6L A;  1EIB A;  1NH6 A;  3ARZ A;  4DRI A;  3RME A;  1W9U A;  1FKT A;  4WKF A;  2ESC A;  3KAC A;  2AWG A;  3BMB A;  1NMW A;  3AS0 A;  4FAP A;  2XP9 A;  3CHC A;  3WD1 A;  1OGB A;  2B31 A;  3PR9 A;  2F2D A;  3ALG A;  4PTM A;  4NSB A;  4TW7 A;  1D2K A;  1QZ2 A;  4MGV A;  1NWU A;  1FKF A;  2PPN A;  3EIP A;  2WLZ A;  1HKI A;  2UZ5 A;  4DRQ A;  1FKD A;  2RUR A;  1E6R A;  3BXW A;  4N19 A;  3JYM A;  3TC5 A;  4ZPW R;  3WQW A;  2WM0 A;  4JFL A;  4W9Q A;  1ZCN A;  1W1P A;  4LAW A;  4LGX A;  2ZR4 A;  4DRM A;  1H0G A;  4MPK A;  2LPV A;  2XPB A;  2K8I A;  3O5G A;  1WNO A;  3RM8 A;  2ZQT A;  2DSV A;  4Z2G A;  3B9A A;  2A3B A;  4HBO A;  2XP3 A;  3OOB A;  3UF8 A;  5DF0 A;  1W1Y A;  4XAK A;  2PV3 A;  3B7X A;  5I98 A;  5HBF A;  3O5F A;  3AS1 A;  3TCZ A; 
#chains in the Genus database with same CATH homology
 3CHF A;  4KR0 B;  1OWQ A;  1FFR A;  3OA5 A;  3H9R B;  4ODK A;  3LUO A;  4WKA A;  4R0X A;  4IQC A;  1BL4 A;  3CH9 A;  1JVW A;  4ODR A;  5HWB A;  1FKJ A;  1FKR A;  3ARS A;  3UQI A;  4NZC A;  1EYM A;  2MLZ A;  2PBC A;  1J4I A;  1HJW A;  2FKE A;  2MLY A;  5HKG A;  5HWC A;  1FKS A;  2DT0 A;  2G8Z A;  1ZB5 A;  1HJV A;  1E6N A;  3W4R A;  3CZ8 A;  4LAV A;  3VAW A;  2ZQU A;  3O5E A;  3ARV A;  1UR9 A;  1BKF A;  4DRK A;  3GPK A;  1ZL1 A;  2WK2 A;  3IK8 A;  3WIJ A;  1FD9 A;  4JFM A;  1SR0 A;  1ROT A;  1F8A B;  4MAV A;  3UI4 A;  2XP4 A;  4ZS6 A;  4ML4 A;  1NWR A;  2LJ4 A;  1EDQ A;  3O5M A;  4P8X A;  3CHD A;  4JFJ A;  1LJY A;  3O5O A;  4TYO A;  1Q1C A;  3I6C A;  1E6P A;  4MSP A;  4MTV A;  2XP6 A;  3CHE A;  2Q5A A;  1EHN A;  5HUA A;  2DPE A;  3WD3 A;  4URI A;  2M2A A;  1X6N A;  2XP8 A;  2VN1 A;  3ARO A;  1W1T A;  4TW8 A;  2F4E A;  4Z2L A;  4ODP A;  1JNE A;  1FKL A;  3O5J A;  3ODK A;  4DWS B;  3FXY A;  1FKI A;  1NMV A;  3O5P A;  1KFW A;  1ZBW A;  2MNT A;  3UQA A;  4G2P A;  3CGM A;  3PA7 A;  1WB0 A;  1A7X A;  4TX0 A;  2RUQ A;  1W9P A;  2IUZ A;  4IT6 A;  1D6O A;  1ROU A;  2XP7 A;  4S3J A;  4J4O A;  4Z2J A;  1ZK6 A;  1ZBK A;  1EQ3 A;  4ODQ A;  2FAP A;  2Y78 A;  5J6E A;  1JNS A;  1UR8 A;  1B6C A;  3RFW A;  1F40 A;  1ZBC A;  3MDY B;  1O6I A;  3KAI A;  1CTN A;  2G41 A;  4LAX A;  1LQ0 A;  2KR7 A;  5D75 A;  1Q6U A;  1R9H A;  5GPR A;  4BF8 A;  1HKK A;  4WIW A;  3B9E A;  2ZQV A;  4ZPV R;  1VF8 A;  4Q7N A;  2DG3 A;  1D7H A;  3ARU A;  3WD2 A;  4L72 B;  5HW6 A;  1NSG A;  1W1V A;  1OGG A;  2LKN A;  4W5U A;  2WLY A;  1C9H A;  4DWS A;  4QT3 A;  1YW5 A;  4Z2I A;  4W9O A;  4MNJ A;  3WH0 A;  4LAY A;  4U86 A;  3TDB A;  4L3N A;  2RUC A;  2PPO A;  1LL6 A;  1TFV A;  3FY1 A;  3PRD A;  2DG4 A;  1XHG A;  1E9L A;  3IKD A;  3B9D A;  3WL0 A;  4S3K A;  2AOS A;  4O2T A;  2RSE A;  3O5Q A;  4IT4 A;  3O5L A;  4WK9 A;  3O5R A;  2O92 A;  4DZ2 A;  1GUV A;  3O5I A;  2DSZ A;  5DIV A;  3WL1 A;  4ITZ A;  3ALF A;  3UI5 A;  1H0I A;  1D7I A;  1FKK A;  1M5Y A;  3IHZ A;  1U79 A;  1Y0O A;  4U85 A;  3RM9 A;  5BXJ A;  5HW8 A;  1L1P A;  1PBK A;  1FAP A;  1N1A A;  5HT1 A;  1FFQ A;  1IX5 A;  4KQZ A;  4P8V A;  1HXV A;  2PV1 A;  3KAF A;  1E15 A;  4DT4 A;  2F21 A;  1ZBV A;  5B8I C;  2PI6 A;  2ZR5 A;  4ODM A;  4WKH A;  4Z2K A;  5HW7 A;  4IPX A;  1LL4 A;  3AS2 A;  1KT0 A;  2DT1 A;  4DWS C;  1SYT A;  3NTP A;  1KT1 A;  3ARP A;  3KAD A;  4G50 A;  1W9V A;  4DRN A;  3FAP A;  3KAH A;  2DSU A;  4P8W A;  4DH0 A;  3KAB A;  4TW6 A;  4DRJ A;  1QPF A;  1FJD A;  2A3A A;  2KO7 A;  4ODN A;  5DEZ A;  1LL7 A;  3CGN A;  3RGC A;  1ZU8 A;  4MNK A;  5DO2 A;  3JYJ A;  2VCD A;  3B8S A;  3KCE A;  4ODO A;  5GPG A;  3PRA A;  3ARQ A;  4TNS A;  2XP5 A;  2DG9 A;  1TCO C;  1T11 A;  2XPA A;  3KZ7 A;  4FN2 A;  1JND A;  3WKZ A;  1YAT A;  4P8U A;  1QPL A;  3QOK A;  4JFI A;  4R5E A;  1J4R A;  2N87 A;  4MNM A;  1J4H A;  2LGO A;  2M08 A;  3O5D A;  1D7J A;  3WD4 A;  2DT3 A;  2KE0 A;  2KI3 A;  2QF8 A;  3ARW A;  1FKB A;  1LG2 A;  2OLH A;  5DIT A;  3ARY A;  1Q6I A;  4DZ3 A;  3AS3 A;  3O5K A;  1K9T A;  2YBU A;  3IKG A;  4U84 A;  5GQB A;  2MLX A;  2D9F A;  1PIN A;  4HBE A;  3ART A;  3WQV A;  4GGQ A;  5DIU A;  4JFK A;  4IQ2 A;  3JXV A;  2ZR6 A;  4QIB A;  1GPF A;  1J6Y A;  1WAW A;  4AY1 A;  2FDM A;  3EY6 A;  3UI6 A;  2L2S A;  4ODL A;  2KGJ A;  1NWS A;  1FKH A;  1FKG A;  4DIP A;  4GIV A;  1XRV A;  1ITX A;  2MPH A;  4Q22 A;  1RD6 A;  4DRH A;  2O9O A;  1Q6H A;  2MF9 A;  1GOI A;  2PV2 A;  4NNR A;  1HKJ A;  2ZQS A;  1HJX A;  2RUD A;  3WD0 A;  2OFN A;  3PRB A;  4WJX A;  2DT2 A;  3AQU A;  3NRK A;  3RM4 A;  2JZV A;  2ITK A;  4DRO A;  4ZPT R;  3G6M A;  2KFW A;  2YBT A;  3UQB A;  2A3E A;  5JH8 A;  4C02 B;  3NI6 A;  4QT2 A;  2IF4 A;  2RQS A;  2A3C A;  1JNT A;  3KAG A;  4W9P A;  1NWT A;  1HKM A;  4Z2H A;  4JYS A;  3ARR A;  4MNL A;  4HAR A;  2PPP A;  1LG1 A;  1W26 A;  4J4N A;  4QZV B;  4DRP A;  1P5Q A;  5HTG A;  1X6L A;  2DSW A;  1E6Z A;  3ARX A;  2M1I A;  4DWS D;  3G6L A;  1EIB A;  1NH6 A;  3ARZ A;  4DRI A;  3RME A;  1W9U A;  1FKT A;  4WKF A;  2ESC A;  3KAC A;  2AWG A;  1NMW A;  3AS0 A;  4FAP A;  2XP9 A;  3CHC A;  3WD1 A;  1OGB A;  2B31 A;  3PR9 A;  2F2D A;  3ALG A;  4PTM A;  4NSB A;  4TW7 A;  1D2K A;  1QZ2 A;  4MGV A;  1NWU A;  1FKF A;  2PPN A;  2WLZ A;  1HKI A;  2UZ5 A;  4DRQ A;  1FKD A;  2RUR A;  1E6R A;  3BXW A;  4N19 A;  3JYM A;  3TC5 A;  4ZPW R;  3WQW A;  2WM0 A;  4JFL A;  4W9Q A;  1ZCN A;  1W1P A;  4LAW A;  4LGX A;  2ZR4 A;  4DRM A;  1H0G A;  4MPK A;  2LPV A;  2XPB A;  2K8I A;  3O5G A;  1WNO A;  3RM8 A;  2ZQT A;  2DSV A;  4Z2G A;  3B9A A;  2A3B A;  4HBO A;  2XP3 A;  3OOB A;  3UF8 A;  5DF0 A;  1W1Y A;  4XAK A;  2PV3 A;  3B7X A;  5I98 A;  5HBF A;  3O5F A;  3AS1 A;  3TCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...