4W9PA

The fk1 domain of fkbp51 in complex with (1s,5s,6r)-10-[(3,5-dichlorophenyl)sulfonyl]-5-[(1s)-1,2-dihydroxyethyl]-3-[2-(3,4-dimethoxyphenoxy)ethyl]-3,10-diazabicyclo[4.3.1]decan-2-one
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
120
Chain Sequence
TEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Rational Design and Asymmetric Synthesis of Potent and Neurotrophic Ligands for FK506-Binding Proteins (FKBPs).
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 120
sequence length 121
chains with identical sequence E
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4w9pA00
3GPKA 1QPFA 4JFMA 2XPAA 2F21A 3NRKA 5BXJA 2XP3A 3O5DA 4DRJA 2MLZA 1J4RA 2LKNA 2XP7A 3RFWA 5HTGA 2XP5A 2KI3A 4LAVA 5HW7A 1PBKA 3TC5A 1FKDA 1M5YA 2PBCA 2DG9A 2XP4A 2D9FA 3CGMA 4J4NA 1EYMA 2ITKA 3O5OA 3O5GA 3O5EA 4DH0A 2PPOA 4ODMA 5B8IC 2ZR6A 3MDYB 2DG4A 4NNRA 1Q6HA 1YW5A 4W9PA 3UQIA 5HW6A 3PRBA 2PPPA 3OOBA 4TW7A 1JNSA 2MLYA 4DRMA 3IHZA 1F8AB 3O5IA 4IPXA 4O2TA 3KCEA 4R0XA 4U84A 4TW6A 1J4HA 3I6CA 3NTPA 1A7XA 1FKHA 4MGVA 4G50A 2RURA 1KT1A 4C02B 2RUDA 2Y78A 4JFIA 4TW8A 4J4OA 3UQBA 4TX0A 4DRNA 4TYOA 2UZ5A 2KR7A 3KABA 3KAGA 4ODNA 3UI6A 2LJ4A 2ZQSA 4LAYA 4LAXA 4U85A 2FKEA 1FKTA 2DG3A 3IKDA 1FD9A 1NMVA 5HWBA 3JYJA 3UF8A 3O5PA 3UI5A 2AWGA 2PPNA 1QZ2A 2F4EA 2VN1A 1FKLA 4JFJA 3UI4A 4DROA 3ODKA 1BL4A 2L2SA 3KADA 4ITZA 5I98A 4DZ3A 1Q6IA 1FKGA 1C9HA 2N87A 3H9RB 1ZK6A 4MSPA 2M2AA 4ODLA 2KFWA 3IKGA 4QT3A 3KZ7A 4DRKA 2JZVA 1FKIA 3O5FA 4U86A 2FAPA 1ZCNA 2F2DA 3EY6A 3JXVA 2XP8A 1Y0OA 4ODQA 1R9HA 1TCOC 2RUQA 4DRIA 3O5RA 4FAPA 3UQAA 3O5KA 2XP6A 3IK8A 4JFLA 1FKSA 2RQSA 2OFNA 3FAPA 1J4IA 2Q5AA 2ZR5A 4ODKA 2ZR4A 4ODOA 2PV1A 3KAIA 1BKFA 3KAHA 1NMWA 5HKGA 1L1PA 1PINA 1D6OA 3KAFA 2MNTA 4N19A 1FKKA 1D7JA 1EQ3A 1JNTA 2XP9A 2M08A 3NI6A 5HT1A 3O5LA 1YATA 3WH0A 2LPVA 2M1IA 1D7IA 2ZQVA 4FN2A 5GPGA 4IQCA 3B7XA 4W9QA 1ROUA 1FKFA 1W26A 2KGJA 2VCDA 4W9OA 4DT4A 1F40A 3RGCA 4QIBA 4JFKA 4DZ2A 4IQ2A 2IF4A 1HXVA 1FAPA 1T11A 2ZQTA 2ZQUA 4DRQA 2KO7A 3VAWA 4DRPA 4GIVA 2XPBA 3PRDA 3LUOA 2MLXA 4DRHA 1KT0A 1FKRA 4TNSA 1B6CA 3PA7A 1NSGA 2RUCA 1U79A 2PV3A 1FKBA 5HUAA 4ODRA 1JVWA 2PV2A 1ROTA 1Q1CA 1QPLA 4QT2A 4LAWA 1N1AA 3O5MA 3CGNA 3TCZA 5J6EA 4G2PA 1J6YA 1FJDA 5HW8A 5D75A 1FKJA 2MF9A 3JYMA 2MPHA 5DITA 1P5QA 4DIPA 3O5JA 4GGQA 2RSEA 2K8IA 5HWCA 4ODPA 5DIUA 3TDBA 1D7HA 3O5QA 5DIVA 4BF8A 2LGOA 2KE0A 1Q6UA 3KACA 4JYSA
chains in the Genus database with same CATH superfamily
1QPFA 4JFMA 2XP3A 3ARQA 5HTGA 4LAVA 1PBKA 1H0GA 1M5YA 1HJWA 2XP4A 4IT6A 3WQWA 1HXVA 1LL7A 2ITKA 1W1YA 3O5GA 5B8IC 2PPOA 3B9DA 2DG4A 4NNRA 4WKAA 4DRMA 3IHZA 4IPXA 4R0XA 1J4HA 2AOSA 3I6CA 2RURA 1E44A 2G41A 2RUDA 4ZS6A 1GPFA 4JFIA 4TW8A 3UQBA 3KABA 2DSWA 3KAGA 4ODNA 3UI6A 1NWSA 4Z2IA 4MAVA 4ZPWR 3WD4A 2DPEA 3UF8A 3O5PA 2WM0A 3UI4A 3WIJA 5I98A 1ITXA 3EIPA 1JCHB 1ZK6A 4QT3A 2JZVA 2F2DA 5DF0A 2RUQA 1HKKA 1ZBCA 2XP6A 4ZPTR 2DSZA 4JFLA 4ODOA 2Q5AA 2ZR4A 2G8ZA 3KAIA 4L72B 3KAHA 1NMWA 1PINA 3G6LA 1E6RA 1W9UA 3KAFA 1E6PA 4N19A 1ZBWA 5GQBA 3B8SA 3RMEA 2XP9A 5HT1A 3O5LA 1YATA 4P8WA 2DT1A 2ZQVA 4FN2A 5GPGA 4IQCA 4W9QA 4MNMA 1W26A 2VCDA 1F40A 4DZ2A 4IQ2A 1RD6A 4WIWA 2ZQUA 4DRQA 4ML4A 1HKJA 1E15A 1KT0A 3FXYA 3PA7A 2RUCA 1LG2A 1ROTA 3TCZA 3ARZA 4G2PA 5HW8A 1X6NA 3JYMA 3O5JA 4GGQA 5DEZA 4ODPA 2LGOA 1JNDA 1GUVA 2KE0A 3KACA 3O5QA 5HW6A 3NRKA 3O5DA 3OA5A 2MLZA 3RFWA 2ETNA 2KI3A 2XP5A 4XAKA 1W9VA 3TC5A 2DG9A 4DRNA 1EYMA 3O5OA 1SYTA 1Q6HA 3UQIA 2MLYA 1F8AB 3O5IA 4Q7NA 4HBEA 1CTNA 2B5UB 1A7XA 4QZVB 4Z2GA 1KT1A 2Y78A 2WLYA 4TX0A 3AQUA 4TYOA 2UZ5A 2KR7A 4DWSA 4U85A 2FKEA 4WK9A 3IKDA 1FD9A 1NMVA 4DWSB 5HWBA 4L3NA 3AROA 2PN0A 1QZ2A 1FKLA 1IX5A 3ODKA 1BL4A 2L2SA 4HBOA 1FKGA 3H9RB 4MSPA 2M2AA 2KFWA 3WD0A 3KZ7A 1FKIA 3FY1A 1ZCNA 4MTVA 3UQAA 1R9HA 3ARTA 4HARA 2PV1A 1LL4A 3W4RA 1D2KA 1EQ3A 1D7JA 1ZBKA 3NI6A 3WD2A 2M08A 1W1PA 2KGJA 4DT4A 2KO7A 3PRDA 2O92A 3AS3A 1NSGA 1U79A 2PV3A 4ODRA 1NWRA 2B31A 3PR9A 4LAWA 1FJDA 1WAWA 2MPHA 4DIPA 1UR8A 2DT3A 2YBTA 5DIUA 3O5KA 2A3CA 3GU0A 2XPAA 4DRJA 2XP7A 3AS1A 5HW7A 1FKDA 1JNEA 5JH8A 2PBCA 4WJXA 3CZ8A 4DH0A 1UR9A 3ARWA 3MDYB 1LL6A 4MNJA 3PRBA 1WNOA 1JNSA 3CHEA 1EDQA 4U84A 3NTPA 2ESCA 3BXWA 1XHGA 4G50A 3AS0A 4C02B 2LJ4A 2DG3A 4KR0B 1E6ZA 4WKHA 3JYJA 1XRVA 2A3AA 2AWGA 2EULA 2PPNA 4Q22A 3BMBA 1WB0A 4DROA 4S3KA 3KADA 4DWSD 3ARUA 4DZ3A 4ODLA 4DRKA 3IKGA 1HKIA 3O5FA 5DO2A 2FAPA 1TFVA 2DSVA 3ALGA 3JXVA 4DRIA 3GTYX 4Z2LA 4KQZA 3FAPA 2RQSA 2OFNA 4ODKA 5HKGA 3AS2A 2A3EA 4LGXA 1L1PA 2OLHA 3WQVA 4AY1A 1JNTA 1OWQA 3WH0A 1D7IA 3WL0A 4W9OA 1ROUA 1FKFA 1LJYA 2YBUA 5GPRA 3RGCA 4QIBA 2IF4A 1FAPA 4DRPA 4GIVA 2XPBA 4DRHA 3ARXA 4TNSA 1NWUA 2F23A 1B6CA 3G6MA 1LG1A 5HUAA 3CHFA 4S3JA 1N1AA 5J6EA 1J6YA 1EHNA 1FKJA 2MF9A 5D75A 4R5EA 3CH9A 3TDBA 5DIVA 1Q6UA 3ALFA 3GPKA 4MNKA 3RM9A 1HKMA 2FDMA 3ARVA 1O6IA 2F21A 5BXJA 1KFWA 4ZPVR 1X6LA 1J4RA 2LKNA 3WKZA 1H0IA 3PRAA 2D9FA 3CGMA 4J4NA 1FFQA 3B9AA 3O5EA 4ODMA 2ZR6A 1YW5A 4W9PA 1E9LA 2PPPA 3ARPA 3OOBA 4TW7A 1NWTA 2WK2A 4MNLA 4O2TA 3KCEA 2IUZA 4TW6A 1FKHA 4MGVA 4Z2KA 2DT0A 1NH6A 4J4OA 4MPKA 3RM4A 1LQ0A 1HJVA 2P4VA 2A3BA 1K9TA 5HBFA 2ZQSA 4LAYA 4LAXA 1FKTA 3WD1A 3RM8A 2DT2A 1ZB5A 1VF8A 4NSBA 3UI5A 1GRJA 2F4EA 2PI6A 2VN1A 4JFJA 1ZBVA 2WLZA 4ITZA 1Q6IA 2N87A 1C9HA 1FFRA 4U86A 4W5UA 3EY6A 2XP8A 1Y0OA 4ODQA 1TCOC 4FAPA 3O5RA 3IK8A 4WKFA 1FKSA 1SR0A 3ARRA 1J4IA 2ZR5A 4NZCA 1E6NA 4Z2JA 4Z2HA 3B9EA 1BKFA 2QF8A 1D6OA 2MNTA 1FKKA 3ARYA 1OGBA 4P8VA 1W1VA 2LPVA 2M1IA 1W9PA 3B7XA 3WD3A 2O9OA 4JFKA 4IT4A 1W1TA 1T11A 2ZQTA 3VAWA 1HJXA 3WL1A 3LUOA 2MLXA 4UDMA 3ARSA 1OGGA 1FKRA 1FKBA 1GOIA 3CHCA 4P8UA 1JVWA 4PTMA 4P8XA 2PV2A 3QOKA 1Q1CA 1QPLA 4QT2A 3O5MA 3CGNA 3CHDA 2DSUA 5DITA 1ZU8A 1P5QA 4DWSC 2RSEA 4URIA 1EIBA 2K8IA 5HWCA 1ZL1A 1D7HA 4BF8A 4JYSA
chains in the Genus database with same CATH topology
1QPFA 4JFMA 2XP3A 3ARQA 5HTGA 4LAVA 1PBKA 1H0GA 1M5YA 1HJWA 2XP4A 4IT6A 3WQWA 1HXVA 1LL7A 2ITKA 1W1YA 3O5GA 5B8IC 2PPOA 3B9DA 2DG4A 4NNRA 4WKAA 4DRMA 3IHZA 4IPXA 4R0XA 1J4HA 2AOSA 3I6CA 2RURA 2G41A 2RUDA 4ZS6A 1GPFA 4JFIA 4TW8A 3UQBA 3KABA 2DSWA 3KAGA 4ODNA 3UI6A 1NWSA 4Z2IA 4MAVA 4ZPWR 3WD4A 2DPEA 3UF8A 3O5PA 2WM0A 3UI4A 3WIJA 5I98A 1ITXA 1ZK6A 4QT3A 2JZVA 2F2DA 5DF0A 2RUQA 1HKKA 1ZBCA 2XP6A 4ZPTR 2DSZA 4JFLA 4ODOA 2Q5AA 2ZR4A 2G8ZA 3KAIA 4L72B 3KAHA 1NMWA 1PINA 3G6LA 1E6RA 1W9UA 3KAFA 1E6PA 4N19A 1ZBWA 5GQBA 3B8SA 3RMEA 2XP9A 5HT1A 3O5LA 1YATA 4P8WA 2DT1A 2ZQVA 4FN2A 5GPGA 4IQCA 4W9QA 4MNMA 1W26A 2VCDA 1F40A 4DZ2A 4IQ2A 1RD6A 4WIWA 2ZQUA 4DRQA 4ML4A 1HKJA 1E15A 1KT0A 3FXYA 3PA7A 2RUCA 1LG2A 1ROTA 3TCZA 3ARZA 4G2PA 5HW8A 1X6NA 3JYMA 3O5JA 4GGQA 5DEZA 4ODPA 2LGOA 1JNDA 3O5QA 1GUVA 2KE0A 3KACA 5HW6A 3NRKA 3O5DA 3OA5A 2MLZA 3RFWA 2XP5A 2KI3A 4XAKA 1W9VA 3TC5A 2DG9A 4DRNA 1EYMA 3O5OA 1SYTA 1Q6HA 3UQIA 2MLYA 1F8AB 3O5IA 4Q7NA 4HBEA 1CTNA 1A7XA 4QZVB 4Z2GA 1KT1A 2Y78A 2WLYA 4TX0A 3AQUA 4TYOA 2UZ5A 2KR7A 4DWSA 4U85A 2FKEA 4WK9A 3IKDA 1FD9A 1NMVA 4DWSB 5HWBA 4L3NA 3AROA 1QZ2A 1FKLA 1IX5A 3ODKA 1BL4A 2L2SA 4HBOA 1FKGA 3H9RB 4MSPA 2M2AA 2KFWA 3WD0A 3KZ7A 1FKIA 3FY1A 1ZCNA 4MTVA 3UQAA 1R9HA 3ARTA 4HARA 2PV1A 1LL4A 3W4RA 1D2KA 1EQ3A 1D7JA 1ZBKA 3NI6A 3WD2A 2M08A 1W1PA 2KGJA 4DT4A 2KO7A 3PRDA 2O92A 3AS3A 1NSGA 1U79A 2PV3A 4ODRA 1NWRA 2B31A 3PR9A 4LAWA 1FJDA 1WAWA 2MPHA 4DIPA 1UR8A 2DT3A 2YBTA 5DIUA 3O5KA 2A3CA 2XPAA 4DRJA 2XP7A 3AS1A 5HW7A 1FKDA 1JNEA 5JH8A 2PBCA 4WJXA 3CZ8A 4DH0A 1UR9A 3ARWA 3MDYB 1LL6A 4MNJA 3PRBA 1WNOA 1JNSA 3CHEA 1EDQA 4U84A 3NTPA 2ESCA 3BXWA 1XHGA 4G50A 3AS0A 4C02B 2LJ4A 2DG3A 4KR0B 1E6ZA 4WKHA 3JYJA 1XRVA 2A3AA 2AWGA 2PPNA 4Q22A 1WB0A 4DROA 4S3KA 3KADA 4DWSD 3ARUA 4DZ3A 4ODLA 4DRKA 3IKGA 1HKIA 3O5FA 5DO2A 2FAPA 1TFVA 2DSVA 3ALGA 3JXVA 4DRIA 4Z2LA 4KQZA 3FAPA 2RQSA 2OFNA 4ODKA 5HKGA 3AS2A 2A3EA 4LGXA 1L1PA 2OLHA 3WQVA 4AY1A 1JNTA 1OWQA 3WH0A 1D7IA 3WL0A 4W9OA 1ROUA 1FKFA 1LJYA 2YBUA 5GPRA 3RGCA 4QIBA 2IF4A 1FAPA 4DRPA 4GIVA 2XPBA 4DRHA 3ARXA 4TNSA 1NWUA 1B6CA 3G6MA 1LG1A 5HUAA 3CHFA 4S3JA 1N1AA 5J6EA 1J6YA 1EHNA 1FKJA 2MF9A 5D75A 4R5EA 3CH9A 3TDBA 5DIVA 1Q6UA 3ALFA 3GPKA 4MNKA 3RM9A 1HKMA 2FDMA 3ARVA 1O6IA 2F21A 5BXJA 1KFWA 4ZPVR 1X6LA 1J4RA 2LKNA 3WKZA 1H0IA 3PRAA 2D9FA 3CGMA 4J4NA 1FFQA 3B9AA 3O5EA 4ODMA 2ZR6A 1YW5A 4W9PA 1E9LA 2PPPA 3ARPA 3OOBA 4TW7A 1NWTA 2WK2A 4MNLA 4O2TA 3KCEA 2IUZA 4TW6A 1FKHA 4MGVA 4Z2KA 2DT0A 1NH6A 4J4OA 4MPKA 3RM4A 1LQ0A 1HJVA 2A3BA 1K9TA 5HBFA 2ZQSA 4LAYA 4LAXA 1FKTA 3WD1A 3RM8A 2DT2A 1ZB5A 1VF8A 4NSBA 3UI5A 2F4EA 2PI6A 2VN1A 4JFJA 1ZBVA 2WLZA 4ITZA 1Q6IA 2N87A 1C9HA 1FFRA 4U86A 4W5UA 3EY6A 2XP8A 1Y0OA 4ODQA 1TCOC 4FAPA 3O5RA 3IK8A 4WKFA 1FKSA 1SR0A 3ARRA 1J4IA 2ZR5A 4NZCA 1E6NA 4Z2JA 4Z2HA 3B9EA 1BKFA 2QF8A 1D6OA 2MNTA 1FKKA 3ARYA 1OGBA 4P8VA 1W1VA 2LPVA 2M1IA 1W9PA 3B7XA 3WD3A 2O9OA 4JFKA 4IT4A 1W1TA 1T11A 2ZQTA 3VAWA 1HJXA 3WL1A 3LUOA 2MLXA 3ARSA 1OGGA 1FKRA 1FKBA 1GOIA 3CHCA 4P8UA 1JVWA 4PTMA 4P8XA 2PV2A 3QOKA 1Q1CA 1QPLA 4QT2A 3O5MA 3CGNA 3CHDA 2DSUA 5DITA 1ZU8A 1P5QA 4DWSC 2RSEA 4URIA 1EIBA 2K8IA 5HWCA 1ZL1A 1D7HA 4BF8A 4JYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPK A;  1QPF A;  4JFM A;  2XPA A;  2F21 A;  3NRK A;  5BXJ A;  2XP3 A;  3O5D A;  4DRJ A;  2MLZ A;  1J4R A;  2LKN A;  2XP7 A;  3RFW A;  5HTG A;  2XP5 A;  2KI3 A;  4LAV A;  5HW7 A;  1PBK A;  3TC5 A;  1FKD A;  1M5Y A;  2PBC A;  2DG9 A;  2XP4 A;  2D9F A;  3CGM A;  4J4N A;  1EYM A;  2ITK A;  3O5O A;  3O5G A;  3O5E A;  4DH0 A;  2PPO A;  4ODM A;  5B8I C;  2ZR6 A;  3MDY B;  2DG4 A;  4NNR A;  1Q6H A;  1YW5 A;  4W9P A;  3UQI A;  5HW6 A;  3PRB A;  2PPP A;  3OOB A;  4TW7 A;  1JNS A;  2MLY A;  4DRM A;  3IHZ A;  1F8A B;  3O5I A;  4IPX A;  4O2T A;  3KCE A;  4R0X A;  4U84 A;  4TW6 A;  1J4H A;  3I6C A;  3NTP A;  1A7X A;  1FKH A;  4MGV A;  4G50 A;  2RUR A;  1KT1 A;  4C02 B;  2RUD A;  2Y78 A;  4JFI A;  4TW8 A;  4J4O A;  3UQB A;  4TX0 A;  4DRN A;  4TYO A;  2UZ5 A;  2KR7 A;  3KAB A;  3KAG A;  4ODN A;  3UI6 A;  2LJ4 A;  2ZQS A;  4LAY A;  4LAX A;  4U85 A;  2FKE A;  1FKT A;  2DG3 A;  3IKD A;  1FD9 A;  1NMV A;  5HWB A;  3JYJ A;  3UF8 A;  3O5P A;  3UI5 A;  2AWG A;  2PPN A;  1QZ2 A;  2F4E A;  2VN1 A;  1FKL A;  4JFJ A;  3UI4 A;  4DRO A;  3ODK A;  1BL4 A;  2L2S A;  3KAD A;  4ITZ A;  5I98 A;  4DZ3 A;  1Q6I A;  1FKG A;  1C9H A;  2N87 A;  3H9R B;  1ZK6 A;  4MSP A;  2M2A A;  4ODL A;  2KFW A;  3IKG A;  4QT3 A;  3KZ7 A;  4DRK A;  2JZV A;  1FKI A;  3O5F A;  4U86 A;  2FAP A;  1ZCN A;  2F2D A;  3EY6 A;  3JXV A;  2XP8 A;  1Y0O A;  4ODQ A;  1R9H A;  1TCO C;  2RUQ A;  4DRI A;  3O5R A;  4FAP A;  3UQA A;  3O5K A;  2XP6 A;  3IK8 A;  4JFL A;  1FKS A;  2RQS A;  2OFN A;  3FAP A;  1J4I A;  2Q5A A;  2ZR5 A;  4ODK A;  2ZR4 A;  4ODO A;  2PV1 A;  3KAI A;  1BKF A;  3KAH A;  1NMW A;  5HKG A;  1L1P A;  1PIN A;  1D6O A;  3KAF A;  2MNT A;  4N19 A;  1FKK A;  1D7J A;  1EQ3 A;  1JNT A;  2XP9 A;  2M08 A;  3NI6 A;  5HT1 A;  3O5L A;  1YAT A;  3WH0 A;  2LPV A;  2M1I A;  1D7I A;  2ZQV A;  4FN2 A;  5GPG A;  4IQC A;  3B7X A;  4W9Q A;  1ROU A;  1FKF A;  1W26 A;  2KGJ A;  2VCD A;  4W9O A;  4DT4 A;  1F40 A;  3RGC A;  4QIB A;  4JFK A;  4DZ2 A;  4IQ2 A;  2IF4 A;  1HXV A;  1FAP A;  1T11 A;  2ZQT A;  2ZQU A;  4DRQ A;  2KO7 A;  3VAW A;  4DRP A;  4GIV A;  2XPB A;  3PRD A;  3LUO A;  2MLX A;  4DRH A;  1KT0 A;  1FKR A;  4TNS A;  1B6C A;  3PA7 A;  1NSG A;  2RUC A;  1U79 A;  2PV3 A;  1FKB A;  5HUA A;  4ODR A;  1JVW A;  2PV2 A;  1ROT A;  1Q1C A;  1QPL A;  4QT2 A;  4LAW A;  1N1A A;  3O5M A;  3CGN A;  3TCZ A;  5J6E A;  4G2P A;  1J6Y A;  1FJD A;  5HW8 A;  5D75 A;  1FKJ A;  2MF9 A;  3JYM A;  2MPH A;  5DIT A;  1P5Q A;  4DIP A;  3O5J A;  4GGQ A;  2RSE A;  2K8I A;  5HWC A;  4ODP A;  5DIU A;  3TDB A;  1D7H A;  3O5Q A;  5DIV A;  4BF8 A;  2LGO A;  2KE0 A;  1Q6U A;  3KAC A;  4JYS A; 
#chains in the Genus database with same CATH topology
 1QPF A;  4JFM A;  2XP3 A;  3ARQ A;  5HTG A;  4LAV A;  1PBK A;  1H0G A;  1M5Y A;  1HJW A;  2XP4 A;  4IT6 A;  3WQW A;  1HXV A;  1LL7 A;  2ITK A;  1W1Y A;  3O5G A;  5B8I C;  2PPO A;  3B9D A;  2DG4 A;  4NNR A;  4WKA A;  4DRM A;  3IHZ A;  4IPX A;  4R0X A;  1J4H A;  2AOS A;  3I6C A;  2RUR A;  1E44 A;  2G41 A;  2RUD A;  4ZS6 A;  1GPF A;  4JFI A;  4TW8 A;  3UQB A;  3KAB A;  2DSW A;  3KAG A;  4ODN A;  3UI6 A;  1NWS A;  4Z2I A;  4MAV A;  4ZPW R;  3WD4 A;  2DPE A;  3UF8 A;  3O5P A;  2WM0 A;  3UI4 A;  3WIJ A;  5I98 A;  1ITX A;  3EIP A;  1JCH B;  1ZK6 A;  4QT3 A;  2JZV A;  2F2D A;  5DF0 A;  2RUQ A;  1HKK A;  1ZBC A;  2XP6 A;  4ZPT R;  2DSZ A;  4JFL A;  4ODO A;  2Q5A A;  2ZR4 A;  2G8Z A;  3KAI A;  4L72 B;  3KAH A;  1NMW A;  1PIN A;  3G6L A;  1E6R A;  1W9U A;  3KAF A;  1E6P A;  4N19 A;  1ZBW A;  5GQB A;  3B8S A;  3RME A;  2XP9 A;  5HT1 A;  3O5L A;  1YAT A;  4P8W A;  2DT1 A;  2ZQV A;  4FN2 A;  5GPG A;  4IQC A;  4W9Q A;  4MNM A;  1W26 A;  2VCD A;  1F40 A;  4DZ2 A;  4IQ2 A;  1RD6 A;  4WIW A;  2ZQU A;  4DRQ A;  4ML4 A;  1HKJ A;  1E15 A;  1KT0 A;  3FXY A;  3PA7 A;  2RUC A;  1LG2 A;  1ROT A;  3TCZ A;  3ARZ A;  4G2P A;  5HW8 A;  1X6N A;  3JYM A;  3O5J A;  4GGQ A;  5DEZ A;  4ODP A;  2LGO A;  1JND A;  1GUV A;  2KE0 A;  3KAC A;  3O5Q A;  5HW6 A;  3NRK A;  3O5D A;  3OA5 A;  2MLZ A;  3RFW A;  2ETN A;  2KI3 A;  2XP5 A;  4XAK A;  1W9V A;  3TC5 A;  2DG9 A;  4DRN A;  1EYM A;  3O5O A;  1SYT A;  1Q6H A;  3UQI A;  2MLY A;  1F8A B;  3O5I A;  4Q7N A;  4HBE A;  1CTN A;  2B5U B;  1A7X A;  4QZV B;  4Z2G A;  1KT1 A;  2Y78 A;  2WLY A;  4TX0 A;  3AQU A;  4TYO A;  2UZ5 A;  2KR7 A;  4DWS A;  4U85 A;  2FKE A;  4WK9 A;  3IKD A;  1FD9 A;  1NMV A;  4DWS B;  5HWB A;  4L3N A;  3ARO A;  2PN0 A;  1QZ2 A;  1FKL A;  1IX5 A;  3ODK A;  1BL4 A;  2L2S A;  4HBO A;  1FKG A;  3H9R B;  4MSP A;  2M2A A;  2KFW A;  3WD0 A;  3KZ7 A;  1FKI A;  3FY1 A;  1ZCN A;  4MTV A;  3UQA A;  1R9H A;  3ART A;  4HAR A;  2PV1 A;  1LL4 A;  3W4R A;  1D2K A;  1EQ3 A;  1D7J A;  1ZBK A;  3NI6 A;  3WD2 A;  2M08 A;  1W1P A;  2KGJ A;  4DT4 A;  2KO7 A;  3PRD A;  2O92 A;  3AS3 A;  1NSG A;  1U79 A;  2PV3 A;  4ODR A;  1NWR A;  2B31 A;  3PR9 A;  4LAW A;  1FJD A;  1WAW A;  2MPH A;  4DIP A;  1UR8 A;  2DT3 A;  2YBT A;  5DIU A;  3O5K A;  2A3C A;  3GU0 A;  2XPA A;  4DRJ A;  2XP7 A;  3AS1 A;  5HW7 A;  1FKD A;  1JNE A;  5JH8 A;  2PBC A;  4WJX A;  3CZ8 A;  4DH0 A;  1UR9 A;  3ARW A;  3MDY B;  1LL6 A;  4MNJ A;  3PRB A;  1WNO A;  1JNS A;  3CHE A;  1EDQ A;  4U84 A;  3NTP A;  2ESC A;  3BXW A;  1XHG A;  4G50 A;  3AS0 A;  4C02 B;  2LJ4 A;  2DG3 A;  4KR0 B;  1E6Z A;  4WKH A;  3JYJ A;  1XRV A;  2A3A A;  2AWG A;  2EUL A;  2PPN A;  4Q22 A;  3BMB A;  1WB0 A;  4DRO A;  4S3K A;  3KAD A;  4DWS D;  3ARU A;  4DZ3 A;  4ODL A;  4DRK A;  3IKG A;  1HKI A;  3O5F A;  5DO2 A;  2FAP A;  1TFV A;  2DSV A;  3ALG A;  3JXV A;  4DRI A;  3GTY X;  4Z2L A;  4KQZ A;  3FAP A;  2RQS A;  2OFN A;  4ODK A;  5HKG A;  3AS2 A;  2A3E A;  4LGX A;  1L1P A;  2OLH A;  3WQV A;  4AY1 A;  1JNT A;  1OWQ A;  3WH0 A;  1D7I A;  3WL0 A;  4W9O A;  1ROU A;  1FKF A;  1LJY A;  2YBU A;  5GPR A;  3RGC A;  4QIB A;  2IF4 A;  1FAP A;  4DRP A;  4GIV A;  2XPB A;  4DRH A;  3ARX A;  4TNS A;  1NWU A;  2F23 A;  1B6C A;  3G6M A;  1LG1 A;  5HUA A;  3CHF A;  4S3J A;  1N1A A;  5J6E A;  1J6Y A;  1EHN A;  1FKJ A;  2MF9 A;  5D75 A;  4R5E A;  3CH9 A;  3TDB A;  5DIV A;  1Q6U A;  3ALF A;  3GPK A;  4MNK A;  3RM9 A;  1HKM A;  2FDM A;  3ARV A;  1O6I A;  2F21 A;  5BXJ A;  1KFW A;  4ZPV R;  1X6L A;  1J4R A;  2LKN A;  3WKZ A;  1H0I A;  3PRA A;  2D9F A;  3CGM A;  4J4N A;  1FFQ A;  3B9A A;  3O5E A;  4ODM A;  2ZR6 A;  1YW5 A;  4W9P A;  1E9L A;  2PPP A;  3ARP A;  3OOB A;  4TW7 A;  1NWT A;  2WK2 A;  4MNL A;  4O2T A;  3KCE A;  2IUZ A;  4TW6 A;  1FKH A;  4MGV A;  4Z2K A;  2DT0 A;  1NH6 A;  4J4O A;  4MPK A;  3RM4 A;  1LQ0 A;  1HJV A;  2P4V A;  2A3B A;  1K9T A;  5HBF A;  2ZQS A;  4LAY A;  4LAX A;  1FKT A;  3WD1 A;  3RM8 A;  2DT2 A;  1ZB5 A;  1VF8 A;  4NSB A;  3UI5 A;  1GRJ A;  2F4E A;  2PI6 A;  2VN1 A;  4JFJ A;  1ZBV A;  2WLZ A;  4ITZ A;  1Q6I A;  2N87 A;  1C9H A;  1FFR A;  4U86 A;  4W5U A;  3EY6 A;  2XP8 A;  1Y0O A;  4ODQ A;  1TCO C;  4FAP A;  3O5R A;  3IK8 A;  4WKF A;  1FKS A;  1SR0 A;  3ARR A;  1J4I A;  2ZR5 A;  4NZC A;  1E6N A;  4Z2J A;  4Z2H A;  3B9E A;  1BKF A;  2QF8 A;  1D6O A;  2MNT A;  1FKK A;  3ARY A;  1OGB A;  4P8V A;  1W1V A;  2LPV A;  2M1I A;  1W9P A;  3B7X A;  3WD3 A;  2O9O A;  4JFK A;  4IT4 A;  1W1T A;  1T11 A;  2ZQT A;  3VAW A;  1HJX A;  3WL1 A;  3LUO A;  2MLX A;  4UDM A;  3ARS A;  1OGG A;  1FKR A;  1FKB A;  1GOI A;  3CHC A;  4P8U A;  1JVW A;  4PTM A;  4P8X A;  2PV2 A;  3QOK A;  1Q1C A;  1QPL A;  4QT2 A;  3O5M A;  3CGN A;  3CHD A;  2DSU A;  5DIT A;  1ZU8 A;  1P5Q A;  4DWS C;  2RSE A;  4URI A;  1EIB A;  2K8I A;  5HWC A;  1ZL1 A;  1D7H A;  4BF8 A;  4JYS A; 
#chains in the Genus database with same CATH homology
 1QPF A;  4JFM A;  2XP3 A;  3ARQ A;  5HTG A;  4LAV A;  1PBK A;  1H0G A;  1M5Y A;  1HJW A;  2XP4 A;  4IT6 A;  3WQW A;  1HXV A;  1LL7 A;  2ITK A;  1W1Y A;  3O5G A;  5B8I C;  2PPO A;  3B9D A;  2DG4 A;  4NNR A;  4WKA A;  4DRM A;  3IHZ A;  4IPX A;  4R0X A;  1J4H A;  2AOS A;  3I6C A;  2RUR A;  2G41 A;  2RUD A;  4ZS6 A;  1GPF A;  4JFI A;  4TW8 A;  3UQB A;  3KAB A;  2DSW A;  3KAG A;  4ODN A;  3UI6 A;  1NWS A;  4Z2I A;  4MAV A;  4ZPW R;  3WD4 A;  2DPE A;  3UF8 A;  3O5P A;  2WM0 A;  3UI4 A;  3WIJ A;  5I98 A;  1ITX A;  1ZK6 A;  4QT3 A;  2JZV A;  2F2D A;  5DF0 A;  2RUQ A;  1HKK A;  1ZBC A;  2XP6 A;  4ZPT R;  2DSZ A;  4JFL A;  4ODO A;  2Q5A A;  2ZR4 A;  2G8Z A;  3KAI A;  4L72 B;  3KAH A;  1NMW A;  1PIN A;  3G6L A;  1E6R A;  1W9U A;  3KAF A;  1E6P A;  4N19 A;  1ZBW A;  5GQB A;  3B8S A;  3RME A;  2XP9 A;  5HT1 A;  3O5L A;  1YAT A;  4P8W A;  2DT1 A;  2ZQV A;  4FN2 A;  5GPG A;  4IQC A;  4W9Q A;  4MNM A;  1W26 A;  2VCD A;  1F40 A;  4DZ2 A;  4IQ2 A;  1RD6 A;  4WIW A;  2ZQU A;  4DRQ A;  4ML4 A;  1HKJ A;  1E15 A;  1KT0 A;  3FXY A;  3PA7 A;  2RUC A;  1LG2 A;  1ROT A;  3TCZ A;  3ARZ A;  4G2P A;  5HW8 A;  1X6N A;  3JYM A;  3O5J A;  4GGQ A;  5DEZ A;  4ODP A;  2LGO A;  1JND A;  3O5Q A;  1GUV A;  2KE0 A;  3KAC A;  5HW6 A;  3NRK A;  3O5D A;  3OA5 A;  2MLZ A;  3RFW A;  2XP5 A;  2KI3 A;  4XAK A;  1W9V A;  3TC5 A;  2DG9 A;  4DRN A;  1EYM A;  3O5O A;  1SYT A;  1Q6H A;  3UQI A;  2MLY A;  1F8A B;  3O5I A;  4Q7N A;  4HBE A;  1CTN A;  1A7X A;  4QZV B;  4Z2G A;  1KT1 A;  2Y78 A;  2WLY A;  4TX0 A;  3AQU A;  4TYO A;  2UZ5 A;  2KR7 A;  4DWS A;  4U85 A;  2FKE A;  4WK9 A;  3IKD A;  1FD9 A;  1NMV A;  4DWS B;  5HWB A;  4L3N A;  3ARO A;  1QZ2 A;  1FKL A;  1IX5 A;  3ODK A;  1BL4 A;  2L2S A;  4HBO A;  1FKG A;  3H9R B;  4MSP A;  2M2A A;  2KFW A;  3WD0 A;  3KZ7 A;  1FKI A;  3FY1 A;  1ZCN A;  4MTV A;  3UQA A;  1R9H A;  3ART A;  4HAR A;  2PV1 A;  1LL4 A;  3W4R A;  1D2K A;  1EQ3 A;  1D7J A;  1ZBK A;  3NI6 A;  3WD2 A;  2M08 A;  1W1P A;  2KGJ A;  4DT4 A;  2KO7 A;  3PRD A;  2O92 A;  3AS3 A;  1NSG A;  1U79 A;  2PV3 A;  4ODR A;  1NWR A;  2B31 A;  3PR9 A;  4LAW A;  1FJD A;  1WAW A;  2MPH A;  4DIP A;  1UR8 A;  2DT3 A;  2YBT A;  5DIU A;  3O5K A;  2A3C A;  2XPA A;  4DRJ A;  2XP7 A;  3AS1 A;  5HW7 A;  1FKD A;  1JNE A;  5JH8 A;  2PBC A;  4WJX A;  3CZ8 A;  4DH0 A;  1UR9 A;  3ARW A;  3MDY B;  1LL6 A;  4MNJ A;  3PRB A;  1WNO A;  1JNS A;  3CHE A;  1EDQ A;  4U84 A;  3NTP A;  2ESC A;  3BXW A;  1XHG A;  4G50 A;  3AS0 A;  4C02 B;  2LJ4 A;  2DG3 A;  4KR0 B;  1E6Z A;  4WKH A;  3JYJ A;  1XRV A;  2A3A A;  2AWG A;  2PPN A;  4Q22 A;  1WB0 A;  4DRO A;  4S3K A;  3KAD A;  4DWS D;  3ARU A;  4DZ3 A;  4ODL A;  4DRK A;  3IKG A;  1HKI A;  3O5F A;  5DO2 A;  2FAP A;  1TFV A;  2DSV A;  3ALG A;  3JXV A;  4DRI A;  4Z2L A;  4KQZ A;  3FAP A;  2RQS A;  2OFN A;  4ODK A;  5HKG A;  3AS2 A;  2A3E A;  4LGX A;  1L1P A;  2OLH A;  3WQV A;  4AY1 A;  1JNT A;  1OWQ A;  3WH0 A;  1D7I A;  3WL0 A;  4W9O A;  1ROU A;  1FKF A;  1LJY A;  2YBU A;  5GPR A;  3RGC A;  4QIB A;  2IF4 A;  1FAP A;  4DRP A;  4GIV A;  2XPB A;  4DRH A;  3ARX A;  4TNS A;  1NWU A;  1B6C A;  3G6M A;  1LG1 A;  5HUA A;  3CHF A;  4S3J A;  1N1A A;  5J6E A;  1J6Y A;  1EHN A;  1FKJ A;  2MF9 A;  5D75 A;  4R5E A;  3CH9 A;  3TDB A;  5DIV A;  1Q6U A;  3ALF A;  3GPK A;  4MNK A;  3RM9 A;  1HKM A;  2FDM A;  3ARV A;  1O6I A;  2F21 A;  5BXJ A;  1KFW A;  4ZPV R;  1X6L A;  1J4R A;  2LKN A;  3WKZ A;  1H0I A;  3PRA A;  2D9F A;  3CGM A;  4J4N A;  1FFQ A;  3B9A A;  3O5E A;  4ODM A;  2ZR6 A;  1YW5 A;  4W9P A;  1E9L A;  2PPP A;  3ARP A;  3OOB A;  4TW7 A;  1NWT A;  2WK2 A;  4MNL A;  4O2T A;  3KCE A;  2IUZ A;  4TW6 A;  1FKH A;  4MGV A;  4Z2K A;  2DT0 A;  1NH6 A;  4J4O A;  4MPK A;  3RM4 A;  1LQ0 A;  1HJV A;  2A3B A;  1K9T A;  5HBF A;  2ZQS A;  4LAY A;  4LAX A;  1FKT A;  3WD1 A;  3RM8 A;  2DT2 A;  1ZB5 A;  1VF8 A;  4NSB A;  3UI5 A;  2F4E A;  2PI6 A;  2VN1 A;  4JFJ A;  1ZBV A;  2WLZ A;  4ITZ A;  1Q6I A;  2N87 A;  1C9H A;  1FFR A;  4U86 A;  4W5U A;  3EY6 A;  2XP8 A;  1Y0O A;  4ODQ A;  1TCO C;  4FAP A;  3O5R A;  3IK8 A;  4WKF A;  1FKS A;  1SR0 A;  3ARR A;  1J4I A;  2ZR5 A;  4NZC A;  1E6N A;  4Z2J A;  4Z2H A;  3B9E A;  1BKF A;  2QF8 A;  1D6O A;  2MNT A;  1FKK A;  3ARY A;  1OGB A;  4P8V A;  1W1V A;  2LPV A;  2M1I A;  1W9P A;  3B7X A;  3WD3 A;  2O9O A;  4JFK A;  4IT4 A;  1W1T A;  1T11 A;  2ZQT A;  3VAW A;  1HJX A;  3WL1 A;  3LUO A;  2MLX A;  3ARS A;  1OGG A;  1FKR A;  1FKB A;  1GOI A;  3CHC A;  4P8U A;  1JVW A;  4PTM A;  4P8X A;  2PV2 A;  3QOK A;  1Q1C A;  1QPL A;  4QT2 A;  3O5M A;  3CGN A;  3CHD A;  2DSU A;  5DIT A;  1ZU8 A;  1P5Q A;  4DWS C;  2RSE A;  4URI A;  1EIB A;  2K8I A;  5HWC A;  1ZL1 A;  1D7H A;  4BF8 A;  4JYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...