4W9PA

The fk1 domain of fkbp51 in complex with (1s,5s,6r)-10-[(3,5-dichlorophenyl)sulfonyl]-5-[(1s)-1,2-dihydroxyethyl]-3-[2-(3,4-dimethoxyphenoxy)ethyl]-3,10-diazabicyclo[4.3.1]decan-2-one
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
120
Chain Sequence
b'TEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Rational Design and Asymmetric Synthesis of Potent and Neurotrophic Ligands for FK506-Binding Proteins (FKBPs).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 29
structure length 120
sequence length 121
chains with identical sequence E
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4w9pA00
3I6CA 1PINA 2JZVA 2K8IA 3JXVA 1HXVA 4DROA 1Q6HA 4BF8A 1QZ2A 2ZR6A 2DG4A 4ODPA 3UF8A 1ROTA 2RUCA 3FAPA 4LAYA 3IKDA 4TYOA 4DRKA 4DRHA 4TX0A 3UQBA 4ODNA 1Q6IA 2PV3A 1FKGA 2KFWA 2DG3A 5HW6A 2IF4A 1F40A 1ZCNA 4DRIA 3KAIA 3O5GA 2PBCA 1U79A 3O5QA 3KZ7A 2FAPA 3O5IA 3PA7A 3KADA 4W9PA 1W26A 1M5YA 2PV2A 2ZR5A 1EYMA 1A7XA 3O5EA 3PRDA 4ITZA 5B8IC 3O5JA 2KR7A 3KAHA 2XP5A 4DRPA 3KACA 1N1AA 2PV1A 1QPLA 1FD9A 4GGQA 4DRQA 3IK8A 2D9FA 2VN1A 4W9OA 4LAXA 4IQ2A 2F2DA 3O5PA 1EQ3A 3CGMA 2PPNA 5D75A 1JNTA 3O5LA 4IPXA 4QIBA 5DIUA 2F21A 1FAPA 4DZ3A 2Y78A 4ODKA 3UQIA 4TW6A 1L1PA 1ROUA 4DH0A 5HW7A 1Q6UA 4N19A 4QT2A 2L2SA 4TNSA 2PPOA 4JFMA 4IQCA 5BXJA 3TC5A 3VAWA 4DT4A 2MLZA 4U86A 4DZ2A 1Q1CA 1TCOC 2MPHA 4O2TA 4MGVA 2KO7A 4U85A 5GPGA 5HUAA 4LAWA 3O5OA 4ODLA 1NSGA 1PBKA 2VCDA 1D7HA 1FKFA 2DG9A 2LPVA 2MNTA 2OFNA 4JYSA 4U84A 5HKGA 2N87A 2XP6A 2MLXA 3O5MA 3O5FA 1FKRA 1JNSA 2LKNA 3NTPA 1P5QA 3TDBA 1D6OA 4JFKA 3O5DA 2KGJA 4C02B 2M1IA 1C9HA 2ITKA 2FKEA 2ZQTA 3ODKA 4JFIA 5HT1A 3PRBA 2KE0A 1NMVA 2XP7A 1BL4A 2XP9A 2ZQUA 3H9RB 1FKHA 2RURA 4J4OA 4TW8A 3UQAA 2RSEA 3MDYB 4DRJA 3B7XA 1FKLA 2LJ4A 5I98A 1D7IA 3NI6A 2XP8A 1FKKA 2ZR4A 4FN2A 4G50A 1FJDA 1J4RA 2MLYA 1J4HA 3IHZA 1YW5A 5HWBA 2AWGA 4JFLA 3KAGA 3OOBA 4R0XA 1QPFA 2RUDA 4GIVA 2M08A 4DRMA 3O5RA 1NMWA 3JYJA 3KAFA 3IKGA 2F4EA 1FKSA 1FKTA 3UI5A 4ODMA 3GPKA 4ODRA 4G2PA 3CGNA 3O5KA 3KCEA 1FKIA 2PPPA 4DRNA 2XP4A 5HTGA 4ODQA 2XPBA 4QT3A 4DIPA 1KT1A 3WH0A 5HWCA 2Q5AA 4NNRA 2M2AA 2LGOA 2ZQSA 1FKBA 3NRKA 1J6YA 1F8AB 1FKDA 2RUQA 5HW8A 2RQSA 3RGCA 1BKFA 5DIVA 1J4IA 4W9QA 4FAPA 4JFJA 1KT0A 5J6EA 4J4NA 2ZQVA 1ZK6A 1T11A 1D7JA 2UZ5A 4MSPA 1R9HA 2MF9A 5DITA 3TCZA 3UI4A 1Y0OA 2KI3A 3JYMA 2XPAA 3RFWA 3KABA 1B6CA 4TW7A 1JVWA 2XP3A 4LAVA 3EY6A 3LUOA 1FKJA 3UI6A 4ODOA 1YATA
chains in the Genus database with same CATH superfamily
1CTNA 1PINA 1Q6HA 2ZR6A 4DRHA 5JH8A 3B9AA 2PI6A 1D2KA 1NWRA 1FKGA 5HW6A 2IF4A 1F40A 4L3NA 4P8UA 2PBCA 3O5QA 1ZL1A 1X6NA 4W9PA 1W26A 2ZR5A 3O5EA 3PRDA 4ITZA 2KR7A 4ZPTR 1ZBWA 1QPLA 1ZU8A 1RD6A 2F2DA 5D75A 5DIUA 2Y78A 4KQZA 4IT4A 1E15A 3WD4A 1WAWA 1W1PA 5BXJA 3TC5A 3VAWA 3RM9A 4URIA 4DZ2A 2YBTA 1IX5A 4O2TA 4MGVA 2KO7A 5HUAA 4KR0B 3O5OA 2P4VA 5GQBA 1W9VA 2LPVA 2MNTA 2OFNA 3O5MA 3O5FA 3PR9A 2PN0A 3O5DA 2KGJA 3G6LA 2WK2A 2F23A 3WL0A 1EIBA 4XAKA 4NSBA 2ZQUA 1FKHA 3MDYB 2LJ4A 1D7IA 2XP8A 1K9TA 1FJDA 3RM4A 3IHZA 3OOBA 3ARWA 1QPFA 2RUDA 4GIVA 3EIPA 2M08A 1NMWA 3KAFA 2QF8A 2WM0A 4Q22A 4Z2LA 3AS1A 4R5EA 3CGNA 3O5KA 1W9PA 4QT3A 2DSWA 4DIPA 4DWSC 1KFWA 1WB0A 3B9EA 1J6YA 1FKDA 5HW8A 3ARXA 3RGCA 1BKFA 5DIVA 4FAPA 4JFJA 1KT0A 2A3BA 5DF0A 3UI4A 2DSVA 1JVWA 2XP3A 3CHFA 4N19A 1FKJA 1YATA 5HBFA 3GTYX 3UF8A 1H0IA 4UDMA 1GRJA 3WKZA 1HJWA 2WLZA 4TX0A 2KFWA 2DG3A 1W1TA 4WIWA 4DRIA 3KAIA 1UR8A 1U79A 3KZ7A 3KADA 5DO2A 1A7XA 1GUVA 3CHEA 4DRQA 2D9FA 1HKJA 2G41A 3O5PA 2DPEA 1JNTA 3O5LA 2F21A 1OWQA 1E9LA 4S3JA 3WD1A 2FDMA 1Q6UA 2B5UB 2L2SA 1JNDA 4TNSA 2PPOA 2B31A 4U86A 2MPHA 3CHDA 1LL6A 4LAWA 1LQ0A 4ODLA 4ZS6A 3WQVA 4MAVA 1JNEA 4JYSA 5HKGA 3BMBA 1X6LA 1E6RA 4S3KA 1C9HA 3ODKA 2WLYA 5HT1A 2O92A 3ARTA 2XP7A 1XHGA 4TW8A 2RSEA 1FKLA 4MNLA 1UR9A 1FKKA 3ARSA 1J4RA 1GOIA 1OGBA 4LGXA 1GPFA 3ARYA 3AS0A 4ML4A 4WKAA 4DRMA 3O5RA 1HKMA 1FKSA 1TFVA 4ODMA 2G8ZA 4HARA 4DRNA 1E44A 2OLHA 2XPBA 2Q5AA 4NNRA 4WKFA 1FKBA 1W1YA 2ZQVA 1ZK6A 2UZ5A 2MF9A 2XPAA 1B6CA 3G6MA 4TW7A 4LAVA 4WKHA 2YBUA 3JXVA 2JZVA 2K8IA 3ARQA 1HXVA 1ITXA 1QZ2A 2DG4A 4ODPA 3FAPA 4DRKA 2ETNA 3IKDA 4HBEA 3UQBA 4P8VA 4ZPWR 1ZCNA 3O5IA 4P8WA 2FAPA 3BXWA 1EDQA 2PV2A 2DT3A 4NZCA 4MNKA 2XP5A 3KACA 4GGQA 2VN1A 1LJYA 3ARPA 4W9OA 4IQ2A 1E6PA 2PPNA 4WK9A 4QIBA 1VF8A 3AQUA 1E6NA 4QZVB 4ODKA 3UQIA 3WL1A 3AROA 1L1PA 1ROUA 4DH0A 2DT0A 4QT2A 1W9UA 4IQCA 4ZPVR 1JCHB 1NH6A 1OGGA 3WD0A 2MLZA 1Q1CA 4U85A 5I98A 5GPGA 1EHNA 1NSGA 3WIJA 1LL4A 1FKFA 2DG9A 1LL7A 1NWTA 4U84A 1FKRA 1JNSA 1HJXA 3RM8A 1P5QA 3CH9A 1D6OA 2DSUA 4C02B 3B9DA 2ITKA 2FKEA 3ARVA 1NMVA 3H9RB 3ARZA 3UQAA 2RURA 4WJXA 1NWSA 4G50A 1J4HA 1YW5A 3QOKA 2ESCA 5HWBA 4HBOA 3JYJA 2F4EA 3ARUA 3CZ8A 3GPKA 4Z2KA 1H0GA 1FKIA 5DEZA 1KT1A 1LG1A 5HWCA 2M2AA 2ZQSA 4P8XA 3ALFA 1F8AB 2RUQA 1ZB5A 2DT2A 4W9QA 1O6IA 3PRAA 5J6EA 4J4NA 2DT1A 4Z2JA 1T11A 1ZBVA 4MSPA 5DITA 3JYMA 3KABA 4MNJA 3EY6A 4MPKA 3LUOA 4MTVA 3UI6A 4JFLA 3I6CA 4DROA 4BF8A 2A3EA 4MNMA 1ROTA 2RUCA 4LAYA 1W1VA 2EULA 4TYOA 1NWUA 1E6ZA 3RMEA 4DWSA 4Z2GA 4ODNA 1Q6IA 2PV3A 1SR0A 5GPRA 4IT6A 3O5GA 3W4RA 3PA7A 1HJVA 4AY1A 1M5YA 1EYMA 3WD2A 5B8IC 3O5JA 3KAHA 3WQWA 4DRPA 1FFQA 3GU0A 1N1AA 2PV1A 1FD9A 3IK8A 3AS3A 4LAXA 1EQ3A 3CGMA 4IPXA 1FAPA 4DZ3A 4TW6A 5HW7A 1LG2A 4JFMA 3CHCA 3OA5A 2O9OA 4DT4A 3FXYA 1TCOC 4Z2IA 1PBKA 4Z2HA 2VCDA 4DWSB 3FY1A 1D7HA 1WNOA 2N87A 2XP6A 2MLXA 1XRVA 2LKNA 3NTPA 3TDBA 4JFKA 2M1IA 4L72B 2A3CA 2ZQTA 4JFIA 4PTMA 3PRBA 2KE0A 3AS2A 1ZBCA 3ARRA 1BL4A 2XP9A 4J4OA 4DRJA 3B7XA 3NI6A 4FN2A 2ZR4A 3B8SA 2DSZA 1ZBKA 2MLYA 2AWGA 4R0XA 3KAGA 3ALGA 2AOSA 2IUZA 3IKGA 1FKTA 4W5UA 3UI5A 4ODRA 4G2PA 3KCEA 1FFRA 2PPPA 5HTGA 4ODQA 1HKIA 3WH0A 3NRKA 2LGOA 2A3AA 3WD3A 2RQSA 1J4IA 1HKKA 1SYTA 1D7JA 3TCZA 1R9HA 1Y0OA 2KI3A 3RFWA 4DWSD 4Q7NA 2XP4A 4ODOA
chains in the Genus database with same CATH topology
1CTNA 1PINA 1Q6HA 2ZR6A 4DRHA 5JH8A 3B9AA 2PI6A 1D2KA 1NWRA 1FKGA 5HW6A 2IF4A 1F40A 4L3NA 4P8UA 2PBCA 3O5QA 1ZL1A 1X6NA 4W9PA 1W26A 2ZR5A 3O5EA 3PRDA 4ITZA 2KR7A 4ZPTR 1ZBWA 1QPLA 1ZU8A 1RD6A 2F2DA 5D75A 5DIUA 2Y78A 4KQZA 4IT4A 1E15A 3WD4A 1WAWA 1W1PA 5BXJA 3TC5A 3VAWA 3RM9A 4URIA 4DZ2A 2YBTA 1IX5A 4O2TA 4MGVA 2KO7A 5HUAA 4KR0B 3O5OA 5GQBA 1W9VA 2LPVA 2MNTA 2OFNA 3O5MA 3O5FA 3PR9A 3O5DA 2KGJA 3G6LA 2WK2A 3WL0A 1EIBA 4XAKA 4NSBA 2ZQUA 1FKHA 3MDYB 2LJ4A 1D7IA 2XP8A 1K9TA 1FJDA 3RM4A 3IHZA 3OOBA 3ARWA 1QPFA 2RUDA 4GIVA 2M08A 1NMWA 3KAFA 2QF8A 2WM0A 4Q22A 4Z2LA 3AS1A 4R5EA 3CGNA 3O5KA 1W9PA 4QT3A 2DSWA 4DIPA 4DWSC 1KFWA 1WB0A 3B9EA 1J6YA 1FKDA 5HW8A 3ARXA 3RGCA 1BKFA 5DIVA 4FAPA 4JFJA 1KT0A 2A3BA 5DF0A 3UI4A 2DSVA 1JVWA 2XP3A 3CHFA 4N19A 1FKJA 1YATA 5HBFA 3UF8A 1H0IA 3WKZA 1HJWA 2WLZA 4TX0A 2KFWA 2DG3A 1W1TA 4WIWA 4DRIA 3KAIA 1UR8A 1U79A 3KZ7A 3KADA 5DO2A 1A7XA 1GUVA 3CHEA 4DRQA 2D9FA 1HKJA 2G41A 3O5PA 2DPEA 1JNTA 3O5LA 2F21A 1OWQA 1E9LA 4S3JA 3WD1A 2FDMA 1Q6UA 2L2SA 1JNDA 4TNSA 2PPOA 2B31A 4U86A 2MPHA 3CHDA 1LL6A 4LAWA 1LQ0A 4ODLA 4ZS6A 3WQVA 4MAVA 1JNEA 4JYSA 5HKGA 1X6LA 1E6RA 4S3KA 1C9HA 3ODKA 2WLYA 5HT1A 2O92A 3ARTA 2XP7A 1XHGA 4TW8A 2RSEA 1FKLA 4MNLA 1UR9A 1FKKA 3ARSA 1J4RA 1GOIA 1OGBA 4LGXA 1GPFA 3ARYA 3AS0A 4ML4A 4WKAA 4DRMA 3O5RA 1HKMA 1FKSA 1TFVA 4ODMA 2G8ZA 4HARA 4DRNA 2OLHA 2XPBA 2Q5AA 4NNRA 4WKFA 1FKBA 1W1YA 2ZQVA 1ZK6A 2UZ5A 2MF9A 2XPAA 1B6CA 3G6MA 4TW7A 4LAVA 4WKHA 2YBUA 3JXVA 2JZVA 2K8IA 3ARQA 1HXVA 1ITXA 1QZ2A 2DG4A 4ODPA 3FAPA 4DRKA 3IKDA 4HBEA 3UQBA 4P8VA 4ZPWR 1ZCNA 3O5IA 4P8WA 2FAPA 3BXWA 1EDQA 2PV2A 2DT3A 4NZCA 4MNKA 2XP5A 3KACA 4GGQA 2VN1A 1LJYA 3ARPA 4W9OA 4IQ2A 1E6PA 2PPNA 4WK9A 4QIBA 1VF8A 3AQUA 1E6NA 4QZVB 4ODKA 3UQIA 3WL1A 3AROA 1L1PA 1ROUA 4DH0A 2DT0A 4QT2A 1W9UA 4IQCA 4ZPVR 1NH6A 1OGGA 3WD0A 2MLZA 1Q1CA 4U85A 5I98A 5GPGA 1EHNA 1NSGA 3WIJA 1LL4A 1FKFA 2DG9A 1LL7A 1NWTA 4U84A 1FKRA 1JNSA 1HJXA 3RM8A 1P5QA 3CH9A 1D6OA 2DSUA 4C02B 3B9DA 2ITKA 2FKEA 3ARVA 1NMVA 3H9RB 3ARZA 3UQAA 2RURA 4WJXA 1NWSA 4G50A 1J4HA 1YW5A 3QOKA 2ESCA 5HWBA 4HBOA 3JYJA 2F4EA 3ARUA 3CZ8A 3GPKA 4Z2KA 1H0GA 1FKIA 5DEZA 1KT1A 1LG1A 5HWCA 2M2AA 2ZQSA 4P8XA 3ALFA 1F8AB 2RUQA 1ZB5A 2DT2A 4W9QA 1O6IA 3PRAA 5J6EA 4J4NA 2DT1A 4Z2JA 1T11A 1ZBVA 4MSPA 5DITA 3JYMA 3KABA 4MNJA 3EY6A 4MPKA 3LUOA 4MTVA 3UI6A 4JFLA 3I6CA 4DROA 4BF8A 2A3EA 4MNMA 1ROTA 2RUCA 4LAYA 1W1VA 4TYOA 1NWUA 1E6ZA 3RMEA 4DWSA 4Z2GA 4ODNA 1Q6IA 2PV3A 1SR0A 5GPRA 4IT6A 3O5GA 3W4RA 3PA7A 1HJVA 4AY1A 1M5YA 1EYMA 3WD2A 5B8IC 3O5JA 3KAHA 3WQWA 4DRPA 1FFQA 1N1AA 2PV1A 1FD9A 3IK8A 3AS3A 4LAXA 1EQ3A 3CGMA 4IPXA 1FAPA 4DZ3A 4TW6A 5HW7A 1LG2A 4JFMA 3CHCA 3OA5A 2O9OA 4DT4A 3FXYA 1TCOC 4Z2IA 1PBKA 4Z2HA 2VCDA 4DWSB 3FY1A 1D7HA 1WNOA 2N87A 2XP6A 2MLXA 1XRVA 2LKNA 3NTPA 3TDBA 4JFKA 2M1IA 4L72B 2A3CA 2ZQTA 4JFIA 4PTMA 3PRBA 2KE0A 3AS2A 1ZBCA 3ARRA 1BL4A 2XP9A 4J4OA 4DRJA 3B7XA 3NI6A 4FN2A 2ZR4A 3B8SA 2DSZA 1ZBKA 2MLYA 2AWGA 4R0XA 3KAGA 3ALGA 2AOSA 2IUZA 3IKGA 1FKTA 4W5UA 3UI5A 4ODRA 4G2PA 3KCEA 1FFRA 2PPPA 5HTGA 4ODQA 1HKIA 3WH0A 3NRKA 2LGOA 2A3AA 3WD3A 2RQSA 1J4IA 1HKKA 1SYTA 1D7JA 3TCZA 1R9HA 1Y0OA 2KI3A 3RFWA 4DWSD 4Q7NA 2XP4A 4ODOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I6C A;  1PIN A;  2JZV A;  2K8I A;  3JXV A;  1HXV A;  4DRO A;  1Q6H A;  4BF8 A;  1QZ2 A;  2ZR6 A;  2DG4 A;  4ODP A;  3UF8 A;  1ROT A;  2RUC A;  3FAP A;  4LAY A;  3IKD A;  4TYO A;  4DRK A;  4DRH A;  4TX0 A;  3UQB A;  4ODN A;  1Q6I A;  2PV3 A;  1FKG A;  2KFW A;  2DG3 A;  5HW6 A;  2IF4 A;  1F40 A;  1ZCN A;  4DRI A;  3KAI A;  3O5G A;  2PBC A;  1U79 A;  3O5Q A;  3KZ7 A;  2FAP A;  3O5I A;  3PA7 A;  3KAD A;  4W9P A;  1W26 A;  1M5Y A;  2PV2 A;  2ZR5 A;  1EYM A;  1A7X A;  3O5E A;  3PRD A;  4ITZ A;  5B8I C;  3O5J A;  2KR7 A;  3KAH A;  2XP5 A;  4DRP A;  3KAC A;  1N1A A;  2PV1 A;  1QPL A;  1FD9 A;  4GGQ A;  4DRQ A;  3IK8 A;  2D9F A;  2VN1 A;  4W9O A;  4LAX A;  4IQ2 A;  2F2D A;  3O5P A;  1EQ3 A;  3CGM A;  2PPN A;  5D75 A;  1JNT A;  3O5L A;  4IPX A;  4QIB A;  5DIU A;  2F21 A;  1FAP A;  4DZ3 A;  2Y78 A;  4ODK A;  3UQI A;  4TW6 A;  1L1P A;  1ROU A;  4DH0 A;  5HW7 A;  1Q6U A;  4N19 A;  4QT2 A;  2L2S A;  4TNS A;  2PPO A;  4JFM A;  4IQC A;  5BXJ A;  3TC5 A;  3VAW A;  4DT4 A;  2MLZ A;  4U86 A;  4DZ2 A;  1Q1C A;  1TCO C;  2MPH A;  4O2T A;  4MGV A;  2KO7 A;  4U85 A;  5GPG A;  5HUA A;  4LAW A;  3O5O A;  4ODL A;  1NSG A;  1PBK A;  2VCD A;  1D7H A;  1FKF A;  2DG9 A;  2LPV A;  2MNT A;  2OFN A;  4JYS A;  4U84 A;  5HKG A;  2N87 A;  2XP6 A;  2MLX A;  3O5M A;  3O5F A;  1FKR A;  1JNS A;  2LKN A;  3NTP A;  1P5Q A;  3TDB A;  1D6O A;  4JFK A;  3O5D A;  2KGJ A;  4C02 B;  2M1I A;  1C9H A;  2ITK A;  2FKE A;  2ZQT A;  3ODK A;  4JFI A;  5HT1 A;  3PRB A;  2KE0 A;  1NMV A;  2XP7 A;  1BL4 A;  2XP9 A;  2ZQU A;  3H9R B;  1FKH A;  2RUR A;  4J4O A;  4TW8 A;  3UQA A;  2RSE A;  3MDY B;  4DRJ A;  3B7X A;  1FKL A;  2LJ4 A;  5I98 A;  1D7I A;  3NI6 A;  2XP8 A;  1FKK A;  2ZR4 A;  4FN2 A;  4G50 A;  1FJD A;  1J4R A;  2MLY A;  1J4H A;  3IHZ A;  1YW5 A;  5HWB A;  2AWG A;  4JFL A;  3KAG A;  3OOB A;  4R0X A;  1QPF A;  2RUD A;  4GIV A;  2M08 A;  4DRM A;  3O5R A;  1NMW A;  3JYJ A;  3KAF A;  3IKG A;  2F4E A;  1FKS A;  1FKT A;  3UI5 A;  4ODM A;  3GPK A;  4ODR A;  4G2P A;  3CGN A;  3O5K A;  3KCE A;  1FKI A;  2PPP A;  4DRN A;  2XP4 A;  5HTG A;  4ODQ A;  2XPB A;  4QT3 A;  4DIP A;  1KT1 A;  3WH0 A;  5HWC A;  2Q5A A;  4NNR A;  2M2A A;  2LGO A;  2ZQS A;  1FKB A;  3NRK A;  1J6Y A;  1F8A B;  1FKD A;  2RUQ A;  5HW8 A;  2RQS A;  3RGC A;  1BKF A;  5DIV A;  1J4I A;  4W9Q A;  4FAP A;  4JFJ A;  1KT0 A;  5J6E A;  4J4N A;  2ZQV A;  1ZK6 A;  1T11 A;  1D7J A;  2UZ5 A;  4MSP A;  1R9H A;  2MF9 A;  5DIT A;  3TCZ A;  3UI4 A;  1Y0O A;  2KI3 A;  3JYM A;  2XPA A;  3RFW A;  3KAB A;  1B6C A;  4TW7 A;  1JVW A;  2XP3 A;  4LAV A;  3EY6 A;  3LUO A;  1FKJ A;  3UI6 A;  4ODO A;  1YAT A; 
#chains in the Genus database with same CATH topology
 1CTN A;  1PIN A;  1Q6H A;  2ZR6 A;  4DRH A;  5JH8 A;  3B9A A;  2PI6 A;  1D2K A;  1NWR A;  1FKG A;  5HW6 A;  2IF4 A;  1F40 A;  4L3N A;  4P8U A;  2PBC A;  3O5Q A;  1ZL1 A;  1X6N A;  4W9P A;  1W26 A;  2ZR5 A;  3O5E A;  3PRD A;  4ITZ A;  2KR7 A;  4ZPT R;  1ZBW A;  1QPL A;  1ZU8 A;  1RD6 A;  2F2D A;  5D75 A;  5DIU A;  2Y78 A;  4KQZ A;  4IT4 A;  1E15 A;  3WD4 A;  1WAW A;  1W1P A;  5BXJ A;  3TC5 A;  3VAW A;  3RM9 A;  4URI A;  4DZ2 A;  2YBT A;  1IX5 A;  4O2T A;  4MGV A;  2KO7 A;  5HUA A;  4KR0 B;  3O5O A;  2P4V A;  5GQB A;  1W9V A;  2LPV A;  2MNT A;  2OFN A;  3O5M A;  3O5F A;  3PR9 A;  2PN0 A;  3O5D A;  2KGJ A;  3G6L A;  2WK2 A;  2F23 A;  3WL0 A;  1EIB A;  4XAK A;  4NSB A;  2ZQU A;  1FKH A;  3MDY B;  2LJ4 A;  1D7I A;  2XP8 A;  1K9T A;  1FJD A;  3RM4 A;  3IHZ A;  3OOB A;  3ARW A;  1QPF A;  2RUD A;  4GIV A;  3EIP A;  2M08 A;  1NMW A;  3KAF A;  2QF8 A;  2WM0 A;  4Q22 A;  4Z2L A;  3AS1 A;  4R5E A;  3CGN A;  3O5K A;  1W9P A;  4QT3 A;  2DSW A;  4DIP A;  4DWS C;  1KFW A;  1WB0 A;  3B9E A;  1J6Y A;  1FKD A;  5HW8 A;  3ARX A;  3RGC A;  1BKF A;  5DIV A;  4FAP A;  4JFJ A;  1KT0 A;  2A3B A;  5DF0 A;  3UI4 A;  2DSV A;  1JVW A;  2XP3 A;  3CHF A;  4N19 A;  1FKJ A;  1YAT A;  5HBF A;  3GTY X;  3UF8 A;  1H0I A;  4UDM A;  1GRJ A;  3WKZ A;  1HJW A;  2WLZ A;  4TX0 A;  2KFW A;  2DG3 A;  1W1T A;  4WIW A;  4DRI A;  3KAI A;  1UR8 A;  1U79 A;  3KZ7 A;  3KAD A;  5DO2 A;  1A7X A;  1GUV A;  3CHE A;  4DRQ A;  2D9F A;  1HKJ A;  2G41 A;  3O5P A;  2DPE A;  1JNT A;  3O5L A;  2F21 A;  1OWQ A;  1E9L A;  4S3J A;  3WD1 A;  2FDM A;  1Q6U A;  2B5U B;  2L2S A;  1JND A;  4TNS A;  2PPO A;  2B31 A;  4U86 A;  2MPH A;  3CHD A;  1LL6 A;  4LAW A;  1LQ0 A;  4ODL A;  4ZS6 A;  3WQV A;  4MAV A;  1JNE A;  4JYS A;  5HKG A;  3BMB A;  1X6L A;  1E6R A;  4S3K A;  1C9H A;  3ODK A;  2WLY A;  5HT1 A;  2O92 A;  3ART A;  2XP7 A;  1XHG A;  4TW8 A;  2RSE A;  1FKL A;  4MNL A;  1UR9 A;  1FKK A;  3ARS A;  1J4R A;  1GOI A;  1OGB A;  4LGX A;  1GPF A;  3ARY A;  3AS0 A;  4ML4 A;  4WKA A;  4DRM A;  3O5R A;  1HKM A;  1FKS A;  1TFV A;  4ODM A;  2G8Z A;  4HAR A;  4DRN A;  1E44 A;  2OLH A;  2XPB A;  2Q5A A;  4NNR A;  4WKF A;  1FKB A;  1W1Y A;  2ZQV A;  1ZK6 A;  2UZ5 A;  2MF9 A;  2XPA A;  1B6C A;  3G6M A;  4TW7 A;  4LAV A;  4WKH A;  2YBU A;  3JXV A;  2JZV A;  2K8I A;  3ARQ A;  1HXV A;  1ITX A;  1QZ2 A;  2DG4 A;  4ODP A;  3FAP A;  4DRK A;  2ETN A;  3IKD A;  4HBE A;  3UQB A;  4P8V A;  4ZPW R;  1ZCN A;  3O5I A;  4P8W A;  2FAP A;  3BXW A;  1EDQ A;  2PV2 A;  2DT3 A;  4NZC A;  4MNK A;  2XP5 A;  3KAC A;  4GGQ A;  2VN1 A;  1LJY A;  3ARP A;  4W9O A;  4IQ2 A;  1E6P A;  2PPN A;  4WK9 A;  4QIB A;  1VF8 A;  3AQU A;  1E6N A;  4QZV B;  4ODK A;  3UQI A;  3WL1 A;  3ARO A;  1L1P A;  1ROU A;  4DH0 A;  2DT0 A;  4QT2 A;  1W9U A;  4IQC A;  4ZPV R;  1JCH B;  1NH6 A;  1OGG A;  3WD0 A;  2MLZ A;  1Q1C A;  4U85 A;  5I98 A;  5GPG A;  1EHN A;  1NSG A;  3WIJ A;  1LL4 A;  1FKF A;  2DG9 A;  1LL7 A;  1NWT A;  4U84 A;  1FKR A;  1JNS A;  1HJX A;  3RM8 A;  1P5Q A;  3CH9 A;  1D6O A;  2DSU A;  4C02 B;  3B9D A;  2ITK A;  2FKE A;  3ARV A;  1NMV A;  3H9R B;  3ARZ A;  3UQA A;  2RUR A;  4WJX A;  1NWS A;  4G50 A;  1J4H A;  1YW5 A;  3QOK A;  2ESC A;  5HWB A;  4HBO A;  3JYJ A;  2F4E A;  3ARU A;  3CZ8 A;  3GPK A;  4Z2K A;  1H0G A;  1FKI A;  5DEZ A;  1KT1 A;  1LG1 A;  5HWC A;  2M2A A;  2ZQS A;  4P8X A;  3ALF A;  1F8A B;  2RUQ A;  1ZB5 A;  2DT2 A;  4W9Q A;  1O6I A;  3PRA A;  5J6E A;  4J4N A;  2DT1 A;  4Z2J A;  1T11 A;  1ZBV A;  4MSP A;  5DIT A;  3JYM A;  3KAB A;  4MNJ A;  3EY6 A;  4MPK A;  3LUO A;  4MTV A;  3UI6 A;  4JFL A;  3I6C A;  4DRO A;  4BF8 A;  2A3E A;  4MNM A;  1ROT A;  2RUC A;  4LAY A;  1W1V A;  2EUL A;  4TYO A;  1NWU A;  1E6Z A;  3RME A;  4DWS A;  4Z2G A;  4ODN A;  1Q6I A;  2PV3 A;  1SR0 A;  5GPR A;  4IT6 A;  3O5G A;  3W4R A;  3PA7 A;  1HJV A;  4AY1 A;  1M5Y A;  1EYM A;  3WD2 A;  5B8I C;  3O5J A;  3KAH A;  3WQW A;  4DRP A;  1FFQ A;  3GU0 A;  1N1A A;  2PV1 A;  1FD9 A;  3IK8 A;  3AS3 A;  4LAX A;  1EQ3 A;  3CGM A;  4IPX A;  1FAP A;  4DZ3 A;  4TW6 A;  5HW7 A;  1LG2 A;  4JFM A;  3CHC A;  3OA5 A;  2O9O A;  4DT4 A;  3FXY A;  1TCO C;  4Z2I A;  1PBK A;  4Z2H A;  2VCD A;  4DWS B;  3FY1 A;  1D7H A;  1WNO A;  2N87 A;  2XP6 A;  2MLX A;  1XRV A;  2LKN A;  3NTP A;  3TDB A;  4JFK A;  2M1I A;  4L72 B;  2A3C A;  2ZQT A;  4JFI A;  4PTM A;  3PRB A;  2KE0 A;  3AS2 A;  1ZBC A;  3ARR A;  1BL4 A;  2XP9 A;  4J4O A;  4DRJ A;  3B7X A;  3NI6 A;  4FN2 A;  2ZR4 A;  3B8S A;  2DSZ A;  1ZBK A;  2MLY A;  2AWG A;  4R0X A;  3KAG A;  3ALG A;  2AOS A;  2IUZ A;  3IKG A;  1FKT A;  4W5U A;  3UI5 A;  4ODR A;  4G2P A;  3KCE A;  1FFR A;  2PPP A;  5HTG A;  4ODQ A;  1HKI A;  3WH0 A;  3NRK A;  2LGO A;  2A3A A;  3WD3 A;  2RQS A;  1J4I A;  1HKK A;  1SYT A;  1D7J A;  3TCZ A;  1R9H A;  1Y0O A;  2KI3 A;  3RFW A;  4DWS D;  4Q7N A;  2XP4 A;  4ODO A; 
#chains in the Genus database with same CATH homology
 1CTN A;  1PIN A;  1Q6H A;  2ZR6 A;  4DRH A;  5JH8 A;  3B9A A;  2PI6 A;  1D2K A;  1NWR A;  1FKG A;  5HW6 A;  2IF4 A;  1F40 A;  4L3N A;  4P8U A;  2PBC A;  3O5Q A;  1ZL1 A;  1X6N A;  4W9P A;  1W26 A;  2ZR5 A;  3O5E A;  3PRD A;  4ITZ A;  2KR7 A;  4ZPT R;  1ZBW A;  1QPL A;  1ZU8 A;  1RD6 A;  2F2D A;  5D75 A;  5DIU A;  2Y78 A;  4KQZ A;  4IT4 A;  1E15 A;  3WD4 A;  1WAW A;  1W1P A;  5BXJ A;  3TC5 A;  3VAW A;  3RM9 A;  4URI A;  4DZ2 A;  2YBT A;  1IX5 A;  4O2T A;  4MGV A;  2KO7 A;  5HUA A;  4KR0 B;  3O5O A;  5GQB A;  1W9V A;  2LPV A;  2MNT A;  2OFN A;  3O5M A;  3O5F A;  3PR9 A;  3O5D A;  2KGJ A;  3G6L A;  2WK2 A;  3WL0 A;  1EIB A;  4XAK A;  4NSB A;  2ZQU A;  1FKH A;  3MDY B;  2LJ4 A;  1D7I A;  2XP8 A;  1K9T A;  1FJD A;  3RM4 A;  3IHZ A;  3OOB A;  3ARW A;  1QPF A;  2RUD A;  4GIV A;  2M08 A;  1NMW A;  3KAF A;  2QF8 A;  2WM0 A;  4Q22 A;  4Z2L A;  3AS1 A;  4R5E A;  3CGN A;  3O5K A;  1W9P A;  4QT3 A;  2DSW A;  4DIP A;  4DWS C;  1KFW A;  1WB0 A;  3B9E A;  1J6Y A;  1FKD A;  5HW8 A;  3ARX A;  3RGC A;  1BKF A;  5DIV A;  4FAP A;  4JFJ A;  1KT0 A;  2A3B A;  5DF0 A;  3UI4 A;  2DSV A;  1JVW A;  2XP3 A;  3CHF A;  4N19 A;  1FKJ A;  1YAT A;  5HBF A;  3UF8 A;  1H0I A;  3WKZ A;  1HJW A;  2WLZ A;  4TX0 A;  2KFW A;  2DG3 A;  1W1T A;  4WIW A;  4DRI A;  3KAI A;  1UR8 A;  1U79 A;  3KZ7 A;  3KAD A;  5DO2 A;  1A7X A;  1GUV A;  3CHE A;  4DRQ A;  2D9F A;  1HKJ A;  2G41 A;  3O5P A;  2DPE A;  1JNT A;  3O5L A;  2F21 A;  1OWQ A;  1E9L A;  4S3J A;  3WD1 A;  2FDM A;  1Q6U A;  2L2S A;  1JND A;  4TNS A;  2PPO A;  2B31 A;  4U86 A;  2MPH A;  3CHD A;  1LL6 A;  4LAW A;  1LQ0 A;  4ODL A;  4ZS6 A;  3WQV A;  4MAV A;  1JNE A;  4JYS A;  5HKG A;  1X6L A;  1E6R A;  4S3K A;  1C9H A;  3ODK A;  2WLY A;  5HT1 A;  2O92 A;  3ART A;  2XP7 A;  1XHG A;  4TW8 A;  2RSE A;  1FKL A;  4MNL A;  1UR9 A;  1FKK A;  3ARS A;  1J4R A;  1GOI A;  1OGB A;  4LGX A;  1GPF A;  3ARY A;  3AS0 A;  4ML4 A;  4WKA A;  4DRM A;  3O5R A;  1HKM A;  1FKS A;  1TFV A;  4ODM A;  2G8Z A;  4HAR A;  4DRN A;  2OLH A;  2XPB A;  2Q5A A;  4NNR A;  4WKF A;  1FKB A;  1W1Y A;  2ZQV A;  1ZK6 A;  2UZ5 A;  2MF9 A;  2XPA A;  1B6C A;  3G6M A;  4TW7 A;  4LAV A;  4WKH A;  2YBU A;  3JXV A;  2JZV A;  2K8I A;  3ARQ A;  1HXV A;  1ITX A;  1QZ2 A;  2DG4 A;  4ODP A;  3FAP A;  4DRK A;  3IKD A;  4HBE A;  3UQB A;  4P8V A;  4ZPW R;  1ZCN A;  3O5I A;  4P8W A;  2FAP A;  3BXW A;  1EDQ A;  2PV2 A;  2DT3 A;  4NZC A;  4MNK A;  2XP5 A;  3KAC A;  4GGQ A;  2VN1 A;  1LJY A;  3ARP A;  4W9O A;  4IQ2 A;  1E6P A;  2PPN A;  4WK9 A;  4QIB A;  1VF8 A;  3AQU A;  1E6N A;  4QZV B;  4ODK A;  3UQI A;  3WL1 A;  3ARO A;  1L1P A;  1ROU A;  4DH0 A;  2DT0 A;  4QT2 A;  1W9U A;  4IQC A;  4ZPV R;  1NH6 A;  1OGG A;  3WD0 A;  2MLZ A;  1Q1C A;  4U85 A;  5I98 A;  5GPG A;  1EHN A;  1NSG A;  3WIJ A;  1LL4 A;  1FKF A;  2DG9 A;  1LL7 A;  1NWT A;  4U84 A;  1FKR A;  1JNS A;  1HJX A;  3RM8 A;  1P5Q A;  3CH9 A;  1D6O A;  2DSU A;  4C02 B;  3B9D A;  2ITK A;  2FKE A;  3ARV A;  1NMV A;  3H9R B;  3ARZ A;  3UQA A;  2RUR A;  4WJX A;  1NWS A;  4G50 A;  1J4H A;  1YW5 A;  3QOK A;  2ESC A;  5HWB A;  4HBO A;  3JYJ A;  2F4E A;  3ARU A;  3CZ8 A;  3GPK A;  4Z2K A;  1H0G A;  1FKI A;  5DEZ A;  1KT1 A;  1LG1 A;  5HWC A;  2M2A A;  2ZQS A;  4P8X A;  3ALF A;  1F8A B;  2RUQ A;  1ZB5 A;  2DT2 A;  4W9Q A;  1O6I A;  3PRA A;  5J6E A;  4J4N A;  2DT1 A;  4Z2J A;  1T11 A;  1ZBV A;  4MSP A;  5DIT A;  3JYM A;  3KAB A;  4MNJ A;  3EY6 A;  4MPK A;  3LUO A;  4MTV A;  3UI6 A;  4JFL A;  3I6C A;  4DRO A;  4BF8 A;  2A3E A;  4MNM A;  1ROT A;  2RUC A;  4LAY A;  1W1V A;  4TYO A;  1NWU A;  1E6Z A;  3RME A;  4DWS A;  4Z2G A;  4ODN A;  1Q6I A;  2PV3 A;  1SR0 A;  5GPR A;  4IT6 A;  3O5G A;  3W4R A;  3PA7 A;  1HJV A;  4AY1 A;  1M5Y A;  1EYM A;  3WD2 A;  5B8I C;  3O5J A;  3KAH A;  3WQW A;  4DRP A;  1FFQ A;  1N1A A;  2PV1 A;  1FD9 A;  3IK8 A;  3AS3 A;  4LAX A;  1EQ3 A;  3CGM A;  4IPX A;  1FAP A;  4DZ3 A;  4TW6 A;  5HW7 A;  1LG2 A;  4JFM A;  3CHC A;  3OA5 A;  2O9O A;  4DT4 A;  3FXY A;  1TCO C;  4Z2I A;  1PBK A;  4Z2H A;  2VCD A;  4DWS B;  3FY1 A;  1D7H A;  1WNO A;  2N87 A;  2XP6 A;  2MLX A;  1XRV A;  2LKN A;  3NTP A;  3TDB A;  4JFK A;  2M1I A;  4L72 B;  2A3C A;  2ZQT A;  4JFI A;  4PTM A;  3PRB A;  2KE0 A;  3AS2 A;  1ZBC A;  3ARR A;  1BL4 A;  2XP9 A;  4J4O A;  4DRJ A;  3B7X A;  3NI6 A;  4FN2 A;  2ZR4 A;  3B8S A;  2DSZ A;  1ZBK A;  2MLY A;  2AWG A;  4R0X A;  3KAG A;  3ALG A;  2AOS A;  2IUZ A;  3IKG A;  1FKT A;  4W5U A;  3UI5 A;  4ODR A;  4G2P A;  3KCE A;  1FFR A;  2PPP A;  5HTG A;  4ODQ A;  1HKI A;  3WH0 A;  3NRK A;  2LGO A;  2A3A A;  3WD3 A;  2RQS A;  1J4I A;  1HKK A;  1SYT A;  1D7J A;  3TCZ A;  1R9H A;  1Y0O A;  2KI3 A;  3RFW A;  4DWS D;  4Q7N A;  2XP4 A;  4ODO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...