4W9PA

The fk1 domain of fkbp51 in complex with (1s,5s,6r)-10-[(3,5-dichlorophenyl)sulfonyl]-5-[(1s)-1,2-dihydroxyethyl]-3-[2-(3,4-dimethoxyphenoxy)ethyl]-3,10-diazabicyclo[4.3.1]decan-2-one
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
120
Chain Sequence
TEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design and Asymmetric Synthesis of Potent and Neurotrophic Ligands for FK506-Binding Proteins (FKBPs).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 29
structure length 120
sequence length 121
chains with identical sequence E
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4w9pA00
2RQSA 5HT1A 4MSPA 3RFWA 2ZQVA 2ZR6A 4GIVA 1FD9A 2AWGA 1QPFA 4U86A 1ZCNA 2N87A 4DZ2A 4IPXA 1W26A 1FKTA 1QZ2A 1TCOC 4JFJA 4ODOA 4TX0A 2DG3A 2MLYA 2XP3A 4TYOA 1FJDA 2MPHA 2ZR4A 1M5YA 2RUDA 2MF9A 1P5QA 3I6CA 3KCEA 4U84A 4DRIA 3O5JA 4IQ2A 5HW8A 3KABA 3EY6A 3UI6A 1Q6HA 2XP9A 3O5FA 1YATA 1F40A 4LAVA 4W9QA 2ZR5A 3UI5A 1Q6IA 1FAPA 3KZ7A 3O5OA 4DROA 4ODQA 3O5DA 2LKNA 1C9HA 3CGNA 5HKGA 1FKLA 2F2DA 3MDYB 1Q1CA 5HW7A 4JFMA 5HTGA 1D7IA 4ITZA 2Q5AA 4ODMA 3JXVA 5J6EA 1PBKA 2ZQUA 4DRHA 1JNSA 1FKFA 3TC5A 3TDBA 4JFLA 4TW8A 2PPOA 2K8IA 2PPNA 2LPVA 4DIPA 4DH0A 5HW6A 4ODKA 1FKBA 3KAGA 3NI6A 4DRNA 2UZ5A 4W9OA 3UF8A 4JFKA 1YW5A 1L1PA 4LAYA 4ODPA 2D9FA 3PRDA 4O2TA 2XP8A 2Y78A 2XP4A 4G2PA 1NMVA 1J4IA 3JYJA 4DRJA 4DRQA 1BL4A 1Q6UA 2DG9A 1ROTA 5HWBA 1BKFA 1FKRA 3KAFA 4NNRA 4JYSA 4LAWA 2XPAA 4QT2A 1FKJA 4DZ3A 1FKIA 3O5MA 4IQCA 2M1IA 3FAPA 2XP7A 4DRMA 5BXJA 1FKDA 2RURA 3TCZA 3B7XA 3NTPA 1D6OA 2KGJA 1EYMA 2ZQTA 3IHZA 4QT3A 1QPLA 2IF4A 1A7XA 2FAPA 2VCDA 3H9RB 2KO7A 4FN2A 4DT4A 2M08A 1KT1A 1NMWA 2F21A 3O5QA 2KFWA 2RSEA 2RUCA 3O5EA 3UQBA 1J6YA 2L2SA 1F8AB 2XP5A 3KAIA 4ODLA 1FKGA 2OFNA 5I98A 4JFIA 1ZK6A 2LGOA 5HWCA 4ODNA 1NSGA 1PINA 2ITKA 4TW7A 3PA7A 4R0XA 5DITA 5DIVA 5GPGA 2FKEA 3JYMA 1FKKA 4MGVA 1ROUA 3IKGA 1HXVA 2RUQA 2KI3A 2KR7A 3O5RA 4DRKA 1N1AA 3LUOA 2F4EA 1KT0A 2DG4A 4G50A 3KAHA 3KADA 2KE0A 4BF8A 1D7JA 2PPPA 1D7HA 1FKSA 3O5KA 4J4OA 2XPBA 1Y0OA 2PV3A 3CGMA 1J4HA 4U85A 3UQIA 3ODKA 4TNSA 5DIUA 2MLZA 3NRKA 4DRPA 2VN1A 2XP6A 4TW6A 2LJ4A 3O5IA 2PV2A 2ZQSA 1EQ3A 5B8IC 1JVWA 1FKHA 2JZVA 3GPKA 2MNTA 4ODRA 3WH0A 3KACA 4GGQA 1B6CA 4W9PA 3IK8A 2MLXA 3UQAA 2M2AA 3O5GA 2PBCA 3PRBA 3OOBA 4QIBA 3O5PA 4LAXA 3UI4A 4FAPA 1J4RA 3IKDA 3RGCA 1T11A 1U79A 4J4NA 1R9HA 1JNTA 5HUAA 4N19A 2PV1A 4C02B 5D75A 3O5LA 3VAWA
chains in the Genus database with same CATH superfamily
2RQSA 4MSPA 4HBEA 2N87A 4IPXA 4JFJA 1X6LA 4TX0A 2XP3A 1W9UA 4TYOA 4S3KA 2ZR4A 1M5YA 4U84A 3RM4A 2B31A 1H0IA 1Q6HA 2XP9A 4PTMA 2DSUA 4MPKA 4NZCA 4L3NA 1W1VA 2LKNA 3CGNA 3ARVA 1FKLA 3ARQA 1Q1CA 4JFMA 5HTGA 2YBUA 1W1TA 3CHDA 2P4VA 5GPRA 1JNSA 3AS1A 3TC5A 3WIJA 2K8IA 1RD6A 2LPVA 1H0GA 1YW5A 3FY1A 4ODPA 1LG2A 3B9EA 2XP8A 4DRJA 4DRQA 4P8XA 2DG9A 1BKFA 3CHCA 4JYSA 2ESCA 2XP7A 1GOIA 3AS0A 3CHFA 2RURA 3PR9A 3IHZA 2KGJA 4Z2LA 1NWRA 3AQUA 4FN2A 2RUCA 3O5EA 2XP5A 5I98A 4P8WA 2DT3A 3B8SA 4ODNA 2DT0A 3OA5A 4S3JA 1IX5A 1FKKA 4Q7NA 2RUQA 3O5RA 4DRKA 1N1AA 2B5UB 2KE0A 1LL4A 3O5KA 2XPBA 1Y0OA 3CGMA 3UQIA 2VN1A 4TW6A 3O5IA 2PV2A 1W1YA 5B8IC 1KFWA 1FKHA 3WH0A 3ALGA 2O92A 3IK8A 1E6NA 3UQAA 1LL6A 1E44A 3O5GA 4WK9A 1JNDA 3OOBA 4QIBA 1HKMA 1T11A 1HKKA 4HARA 4MNKA 2PV1A 2WK2A 2WLZA 2DPEA 2ZQVA 2DT1A 2WM0A 2ZR6A 3ARXA 1HKIA 2WLYA 1JCHB 1FKTA 4WIWA 2DG3A 1ZBCA 1JNEA 2RUDA 2MF9A 1XHGA 4DRIA 3O5JA 4R5EA 1YATA 2QF8A 3B9AA 2EULA 1E9LA 2ETNA 3O5DA 5HKGA 5HBFA 1HKJA 1D7IA 1D2KA 5J6EA 2ZQUA 1ZL1A 1FKFA 1VF8A 4TW8A 2PPOA 4MAVA 4DH0A 1FKBA 3ARSA 4DRNA 1L1PA 3WD2A 5DF0A 4NSBA 1OWQA 2Y78A 1NMVA 1UR9A 3ARRA 4NNRA 4DZ3A 4QT2A 2IUZA 2XPAA 4LAWA 1FKJA 1FKIA 3AS2A 1GRJA 5BXJA 1FKDA 3B7XA 2FDMA 1EYMA 3CH9A 2IF4A 1A7XA 2F23A 2KO7A 3BXWA 3O5QA 2RSEA 3B9DA 4HBOA 2L2SA 1ZBWA 3KAIA 4ODLA 1GUVA 4W5UA 2PN0A 3WL0A 1NSGA 1PINA 2ITKA 3PA7A 4R0XA 5DITA 3JYMA 3QOKA 4MGVA 1ROUA 3IKGA 1NH6A 2KI3A 2KR7A 2F4EA 3RM9A 3KADA 3ARZA 1D7JA 1D7HA 2PV3A 2A3CA 4DRPA 3G6MA 5DIUA 4TNSA 2XP6A 2LJ4A 2ZQSA 1EQ3A 1JVWA 1X6NA 3GPKA 4UDMA 4XAKA 5JH8A 4Z2JA 1ZBVA 3UI4A 4WKFA 1U79A 1R9HA 5HUAA 4Z2KA 4N19A 5D75A 4ITZA 3VAWA 5HT1A 4GIVA 5DEZA 1WB0A 4U86A 1ZCNA 4DZ2A 3FXYA 4ZS6A 1FFQA 1TCOC 1FJDA 1SYTA 4ML4A 1P5QA 3I6CA 4MNJA 4IQ2A 5HW8A 3EY6A 3O5FA 1WNOA 4W9QA 3UI5A 1NWUA 1FAPA 4DROA 1ITXA 1C9HA 2F2DA 3MDYB 3EIPA 1FFRA 4ODMA 1XRVA 4DRHA 4WKAA 4MNLA 3TDBA 3WD3A 4JFLA 3WQVA 1EHNA 2PPNA 4DIPA 5HW6A 3PRAA 2UZ5A 4W9OA 3WD1A 4JFKA 4LAYA 4WJXA 3GTYX 3PRDA 4O2TA 1UR8A 1J4IA 3JYJA 1BL4A 4DWSB 1FKRA 4L72B 3AROA 2A3EA 4IQCA 3FAPA 2DSWA 1HJWA 3TCZA 5GQBA 2G41A 4AY1A 2FAPA 2VCDA 1E6PA 3ARWA 1KT1A 1WAWA 2KFWA 4MTVA 3WD0A 2OFNA 4P8VA 4JFIA 2LGOA 5HWCA 3W4RA 2O9OA 5GPGA 2FKEA 1LL7A 1HXVA 3BMBA 4KR0B 1NWSA 2DG4A 4BF8A 4DWSC 4MNMA 1FKSA 4J4OA 4WKHA 1J4HA 3ODKA 1NWTA 2G8ZA 3G6LA 1E6RA 2JZVA 1E6ZA 1W9PA 4GGQA 4W9PA 2MLXA 2A3BA 4DWSD 2M2AA 1GPFA 2PBCA 4LAXA 3RM8A 3RGCA 3IKDA 4J4NA 1HJXA 1ZBKA 3WKZA 1LG1A 3RFWA 1FD9A 2AWGA 1QPFA 1HJVA 4ZPWR 1W26A 1QZ2A 4ODOA 3AS3A 2MLYA 4IT6A 2MPHA 3KCEA 2DSVA 3KABA 3UI6A 1ZU8A 1F40A 4LAVA 2ZR5A 1Q6IA 3KZ7A 3O5OA 4ODQA 4QZVB 4ZPVR 1SR0A 2AOSA 3ARYA 3WD4A 3CHEA 3CZ8A 5HW7A 2Q5AA 3JXVA 1PBKA 1W1PA 1EIBA 2OLHA 4ODKA 3KAGA 3NI6A 3UF8A 2A3AA 2D9FA 3ARTA 2DT2A 2XP4A 4G2PA 4IT4A 4URIA 1TFVA 3WQWA 1Q6UA 4Z2IA 1ROTA 5HWBA 3ARUA 3KAFA 3O5MA 5DO2A 2M1IA 4DRMA 3NTPA 1D6OA 3GU0A 2YBTA 2ZQTA 4QT3A 1QPLA 3H9RB 4DT4A 1LQ0A 2M08A 1NMWA 2F21A 2PI6A 3RMEA 1J6YA 3ALFA 3UQBA 1F8AB 1OGGA 1K9TA 1FKGA 1ZK6A 1ZB5A 1CTNA 4TW7A 5DIVA 4DWSA 1EDQA 2DSZA 4LGXA 3LUOA 4KQZA 1KT0A 4G50A 3KAHA 2PPPA 4U85A 1E15A 4Z2HA 2MLZA 3NRKA 1LJYA 4ZPTR 2MNTA 4ODRA 3KACA 4Z2GA 1B6CA 3WL1A 1OGBA 3PRBA 1W9VA 3O5PA 4Q22A 4FAPA 1J4RA 3ARPA 1O6IA 4P8UA 1JNTA 4C02B 3O5LA
chains in the Genus database with same CATH topology
2RQSA 4MSPA 4HBEA 2N87A 4IPXA 4JFJA 1X6LA 4TX0A 2XP3A 1W9UA 4TYOA 4S3KA 2ZR4A 1M5YA 4U84A 3RM4A 2B31A 1H0IA 1Q6HA 2XP9A 4PTMA 2DSUA 4MPKA 4NZCA 4L3NA 1W1VA 2LKNA 3CGNA 3ARVA 1FKLA 3ARQA 1Q1CA 4JFMA 5HTGA 2YBUA 1W1TA 3CHDA 5GPRA 1JNSA 3AS1A 3TC5A 3WIJA 2K8IA 1RD6A 2LPVA 1H0GA 1YW5A 3FY1A 4ODPA 1LG2A 3B9EA 2XP8A 4DRJA 4DRQA 4P8XA 2DG9A 1BKFA 3CHCA 4JYSA 2ESCA 2XP7A 1GOIA 3AS0A 3CHFA 2RURA 3PR9A 2KGJA 3IHZA 4Z2LA 1NWRA 3AQUA 4FN2A 2RUCA 3O5EA 2XP5A 5I98A 4P8WA 2DT3A 3B8SA 4ODNA 2DT0A 3OA5A 4S3JA 1IX5A 1FKKA 4Q7NA 2RUQA 3O5RA 4DRKA 1N1AA 2KE0A 1LL4A 3O5KA 2XPBA 1Y0OA 3CGMA 3UQIA 2VN1A 4TW6A 3O5IA 2PV2A 1W1YA 5B8IC 1KFWA 1FKHA 3WH0A 3ALGA 2O92A 3IK8A 1E6NA 3UQAA 1LL6A 3O5GA 4WK9A 1JNDA 3OOBA 4QIBA 1HKMA 1T11A 1HKKA 4HARA 4MNKA 2PV1A 2WK2A 2WLZA 2DPEA 2ZQVA 2DT1A 2WM0A 2ZR6A 3ARXA 1HKIA 2WLYA 1FKTA 4WIWA 2DG3A 1ZBCA 1JNEA 2RUDA 2MF9A 1XHGA 4DRIA 3O5JA 4R5EA 1YATA 2QF8A 3B9AA 1E9LA 3O5DA 5HKGA 5HBFA 1HKJA 1D7IA 1D2KA 5J6EA 2ZQUA 1ZL1A 1FKFA 1VF8A 4TW8A 2PPOA 4MAVA 4DH0A 1FKBA 3ARSA 4DRNA 1L1PA 3WD2A 5DF0A 4NSBA 1OWQA 2Y78A 1NMVA 1UR9A 3ARRA 4NNRA 4DZ3A 4QT2A 2IUZA 2XPAA 4LAWA 1FKJA 1FKIA 3AS2A 5BXJA 1FKDA 3B7XA 2FDMA 1EYMA 3CH9A 2IF4A 1A7XA 2KO7A 3BXWA 3O5QA 2RSEA 3B9DA 4HBOA 2L2SA 1ZBWA 3KAIA 4ODLA 1GUVA 4W5UA 3WL0A 1NSGA 1PINA 2ITKA 3PA7A 4R0XA 5DITA 3JYMA 3QOKA 4MGVA 1ROUA 3IKGA 1NH6A 2KI3A 2KR7A 2F4EA 3RM9A 3KADA 3ARZA 1D7JA 1D7HA 2PV3A 2A3CA 4DRPA 3G6MA 5DIUA 4TNSA 2XP6A 2LJ4A 2ZQSA 1EQ3A 1JVWA 1X6NA 3GPKA 4XAKA 5JH8A 4Z2JA 1ZBVA 3UI4A 4WKFA 1U79A 1R9HA 5HUAA 4Z2KA 4N19A 5D75A 4ITZA 3VAWA 5HT1A 4GIVA 5DEZA 1WB0A 4U86A 1ZCNA 4DZ2A 3FXYA 4ZS6A 1FFQA 1TCOC 1FJDA 1SYTA 4ML4A 1P5QA 3I6CA 4MNJA 4IQ2A 5HW8A 3EY6A 3O5FA 1WNOA 4W9QA 3UI5A 1NWUA 1FAPA 4DROA 1ITXA 1C9HA 2F2DA 3MDYB 1FFRA 4ODMA 1XRVA 4DRHA 4WKAA 4MNLA 3TDBA 3WD3A 4JFLA 3WQVA 1EHNA 2PPNA 4DIPA 5HW6A 3PRAA 2UZ5A 4W9OA 3WD1A 4JFKA 4LAYA 4WJXA 3PRDA 4O2TA 1UR8A 1J4IA 3JYJA 1BL4A 4DWSB 1FKRA 4L72B 3AROA 2A3EA 4IQCA 3FAPA 2DSWA 1HJWA 3TCZA 5GQBA 2G41A 4AY1A 2FAPA 2VCDA 1E6PA 3ARWA 1KT1A 1WAWA 2KFWA 4MTVA 3WD0A 2OFNA 4P8VA 4JFIA 2LGOA 5HWCA 3W4RA 2O9OA 5GPGA 2FKEA 1LL7A 1HXVA 4KR0B 1NWSA 2DG4A 4BF8A 4DWSC 4MNMA 1FKSA 4J4OA 4WKHA 1J4HA 3ODKA 1NWTA 2G8ZA 3G6LA 1E6RA 2JZVA 1E6ZA 1W9PA 4GGQA 4W9PA 2MLXA 2A3BA 4DWSD 2M2AA 1GPFA 2PBCA 4LAXA 3RM8A 3RGCA 3IKDA 4J4NA 1HJXA 1ZBKA 3WKZA 1LG1A 3RFWA 1FD9A 2AWGA 1QPFA 1HJVA 4ZPWR 1W26A 1QZ2A 4ODOA 3AS3A 2MLYA 4IT6A 2MPHA 3KCEA 2DSVA 3KABA 3UI6A 1ZU8A 1F40A 4LAVA 2ZR5A 1Q6IA 3KZ7A 3O5OA 4ODQA 4QZVB 4ZPVR 1SR0A 2AOSA 3ARYA 3WD4A 3CHEA 3CZ8A 5HW7A 2Q5AA 3JXVA 1PBKA 1W1PA 1EIBA 2OLHA 4ODKA 3KAGA 3NI6A 3UF8A 2A3AA 2D9FA 3ARTA 2DT2A 2XP4A 4G2PA 4IT4A 4URIA 1TFVA 3WQWA 1Q6UA 4Z2IA 1ROTA 5HWBA 3ARUA 3KAFA 3O5MA 5DO2A 2M1IA 4DRMA 3NTPA 1D6OA 2YBTA 2ZQTA 4QT3A 1QPLA 3H9RB 4DT4A 1LQ0A 2M08A 1NMWA 2F21A 2PI6A 3RMEA 1J6YA 3ALFA 3UQBA 1F8AB 1OGGA 1K9TA 1FKGA 1ZK6A 1ZB5A 1CTNA 4TW7A 5DIVA 4DWSA 1EDQA 2DSZA 4LGXA 3LUOA 4KQZA 1KT0A 4G50A 3KAHA 2PPPA 4U85A 1E15A 4Z2HA 2MLZA 3NRKA 1LJYA 4ZPTR 2MNTA 4ODRA 3KACA 4Z2GA 1B6CA 3WL1A 1OGBA 3PRBA 1W9VA 3O5PA 4Q22A 4FAPA 1J4RA 3ARPA 1O6IA 4P8UA 1JNTA 4C02B 3O5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQS A;  5HT1 A;  4MSP A;  3RFW A;  2ZQV A;  2ZR6 A;  4GIV A;  1FD9 A;  2AWG A;  1QPF A;  4U86 A;  1ZCN A;  2N87 A;  4DZ2 A;  4IPX A;  1W26 A;  1FKT A;  1QZ2 A;  1TCO C;  4JFJ A;  4ODO A;  4TX0 A;  2DG3 A;  2MLY A;  2XP3 A;  4TYO A;  1FJD A;  2MPH A;  2ZR4 A;  1M5Y A;  2RUD A;  2MF9 A;  1P5Q A;  3I6C A;  3KCE A;  4U84 A;  4DRI A;  3O5J A;  4IQ2 A;  5HW8 A;  3KAB A;  3EY6 A;  3UI6 A;  1Q6H A;  2XP9 A;  3O5F A;  1YAT A;  1F40 A;  4LAV A;  4W9Q A;  2ZR5 A;  3UI5 A;  1Q6I A;  1FAP A;  3KZ7 A;  3O5O A;  4DRO A;  4ODQ A;  3O5D A;  2LKN A;  1C9H A;  3CGN A;  5HKG A;  1FKL A;  2F2D A;  3MDY B;  1Q1C A;  5HW7 A;  4JFM A;  5HTG A;  1D7I A;  4ITZ A;  2Q5A A;  4ODM A;  3JXV A;  5J6E A;  1PBK A;  2ZQU A;  4DRH A;  1JNS A;  1FKF A;  3TC5 A;  3TDB A;  4JFL A;  4TW8 A;  2PPO A;  2K8I A;  2PPN A;  2LPV A;  4DIP A;  4DH0 A;  5HW6 A;  4ODK A;  1FKB A;  3KAG A;  3NI6 A;  4DRN A;  2UZ5 A;  4W9O A;  3UF8 A;  4JFK A;  1YW5 A;  1L1P A;  4LAY A;  4ODP A;  2D9F A;  3PRD A;  4O2T A;  2XP8 A;  2Y78 A;  2XP4 A;  4G2P A;  1NMV A;  1J4I A;  3JYJ A;  4DRJ A;  4DRQ A;  1BL4 A;  1Q6U A;  2DG9 A;  1ROT A;  5HWB A;  1BKF A;  1FKR A;  3KAF A;  4NNR A;  4JYS A;  4LAW A;  2XPA A;  4QT2 A;  1FKJ A;  4DZ3 A;  1FKI A;  3O5M A;  4IQC A;  2M1I A;  3FAP A;  2XP7 A;  4DRM A;  5BXJ A;  1FKD A;  2RUR A;  3TCZ A;  3B7X A;  3NTP A;  1D6O A;  2KGJ A;  1EYM A;  2ZQT A;  3IHZ A;  4QT3 A;  1QPL A;  2IF4 A;  1A7X A;  2FAP A;  2VCD A;  3H9R B;  2KO7 A;  4FN2 A;  4DT4 A;  2M08 A;  1KT1 A;  1NMW A;  2F21 A;  3O5Q A;  2KFW A;  2RSE A;  2RUC A;  3O5E A;  3UQB A;  1J6Y A;  2L2S A;  1F8A B;  2XP5 A;  3KAI A;  4ODL A;  1FKG A;  2OFN A;  5I98 A;  4JFI A;  1ZK6 A;  2LGO A;  5HWC A;  4ODN A;  1NSG A;  1PIN A;  2ITK A;  4TW7 A;  3PA7 A;  4R0X A;  5DIT A;  5DIV A;  5GPG A;  2FKE A;  3JYM A;  1FKK A;  4MGV A;  1ROU A;  3IKG A;  1HXV A;  2RUQ A;  2KI3 A;  2KR7 A;  3O5R A;  4DRK A;  1N1A A;  3LUO A;  2F4E A;  1KT0 A;  2DG4 A;  4G50 A;  3KAH A;  3KAD A;  2KE0 A;  4BF8 A;  1D7J A;  2PPP A;  1D7H A;  1FKS A;  3O5K A;  4J4O A;  2XPB A;  1Y0O A;  2PV3 A;  3CGM A;  1J4H A;  4U85 A;  3UQI A;  3ODK A;  4TNS A;  5DIU A;  2MLZ A;  3NRK A;  4DRP A;  2VN1 A;  2XP6 A;  4TW6 A;  2LJ4 A;  3O5I A;  2PV2 A;  2ZQS A;  1EQ3 A;  5B8I C;  1JVW A;  1FKH A;  2JZV A;  3GPK A;  2MNT A;  4ODR A;  3WH0 A;  3KAC A;  4GGQ A;  1B6C A;  4W9P A;  3IK8 A;  2MLX A;  3UQA A;  2M2A A;  3O5G A;  2PBC A;  3PRB A;  3OOB A;  4QIB A;  3O5P A;  4LAX A;  3UI4 A;  4FAP A;  1J4R A;  3IKD A;  3RGC A;  1T11 A;  1U79 A;  4J4N A;  1R9H A;  1JNT A;  5HUA A;  4N19 A;  2PV1 A;  4C02 B;  5D75 A;  3O5L A;  3VAW A; 
#chains in the Genus database with same CATH topology
 2RQS A;  4MSP A;  4HBE A;  2N87 A;  4IPX A;  4JFJ A;  1X6L A;  4TX0 A;  2XP3 A;  1W9U A;  4TYO A;  4S3K A;  2ZR4 A;  1M5Y A;  4U84 A;  3RM4 A;  2B31 A;  1H0I A;  1Q6H A;  2XP9 A;  4PTM A;  2DSU A;  4MPK A;  4NZC A;  4L3N A;  1W1V A;  2LKN A;  3CGN A;  3ARV A;  1FKL A;  3ARQ A;  1Q1C A;  4JFM A;  5HTG A;  2YBU A;  1W1T A;  3CHD A;  2P4V A;  5GPR A;  1JNS A;  3AS1 A;  3TC5 A;  3WIJ A;  2K8I A;  1RD6 A;  2LPV A;  1H0G A;  1YW5 A;  3FY1 A;  4ODP A;  1LG2 A;  3B9E A;  2XP8 A;  4DRJ A;  4DRQ A;  4P8X A;  2DG9 A;  1BKF A;  3CHC A;  4JYS A;  2ESC A;  2XP7 A;  1GOI A;  3AS0 A;  3CHF A;  2RUR A;  3PR9 A;  3IHZ A;  2KGJ A;  4Z2L A;  1NWR A;  3AQU A;  4FN2 A;  2RUC A;  3O5E A;  2XP5 A;  5I98 A;  4P8W A;  2DT3 A;  3B8S A;  4ODN A;  2DT0 A;  3OA5 A;  4S3J A;  1IX5 A;  1FKK A;  4Q7N A;  2RUQ A;  3O5R A;  4DRK A;  1N1A A;  2B5U B;  2KE0 A;  1LL4 A;  3O5K A;  2XPB A;  1Y0O A;  3CGM A;  3UQI A;  2VN1 A;  4TW6 A;  3O5I A;  2PV2 A;  1W1Y A;  5B8I C;  1KFW A;  1FKH A;  3WH0 A;  3ALG A;  2O92 A;  3IK8 A;  1E6N A;  3UQA A;  1LL6 A;  1E44 A;  3O5G A;  4WK9 A;  1JND A;  3OOB A;  4QIB A;  1HKM A;  1T11 A;  1HKK A;  4HAR A;  4MNK A;  2PV1 A;  2WK2 A;  2WLZ A;  2DPE A;  2ZQV A;  2DT1 A;  2WM0 A;  2ZR6 A;  3ARX A;  1HKI A;  2WLY A;  1JCH B;  1FKT A;  4WIW A;  2DG3 A;  1ZBC A;  1JNE A;  2RUD A;  2MF9 A;  1XHG A;  4DRI A;  3O5J A;  4R5E A;  1YAT A;  2QF8 A;  3B9A A;  2EUL A;  1E9L A;  2ETN A;  3O5D A;  5HKG A;  5HBF A;  1HKJ A;  1D7I A;  1D2K A;  5J6E A;  2ZQU A;  1ZL1 A;  1FKF A;  1VF8 A;  4TW8 A;  2PPO A;  4MAV A;  4DH0 A;  1FKB A;  3ARS A;  4DRN A;  1L1P A;  3WD2 A;  5DF0 A;  4NSB A;  1OWQ A;  2Y78 A;  1NMV A;  1UR9 A;  3ARR A;  4NNR A;  4DZ3 A;  4QT2 A;  2IUZ A;  2XPA A;  4LAW A;  1FKJ A;  1FKI A;  3AS2 A;  1GRJ A;  5BXJ A;  1FKD A;  3B7X A;  2FDM A;  1EYM A;  3CH9 A;  2IF4 A;  1A7X A;  2F23 A;  2KO7 A;  3BXW A;  3O5Q A;  2RSE A;  3B9D A;  4HBO A;  2L2S A;  1ZBW A;  3KAI A;  4ODL A;  1GUV A;  4W5U A;  2PN0 A;  3WL0 A;  1NSG A;  1PIN A;  2ITK A;  3PA7 A;  4R0X A;  5DIT A;  3JYM A;  3QOK A;  4MGV A;  1ROU A;  3IKG A;  1NH6 A;  2KI3 A;  2KR7 A;  2F4E A;  3RM9 A;  3KAD A;  3ARZ A;  1D7J A;  1D7H A;  2PV3 A;  2A3C A;  4DRP A;  3G6M A;  5DIU A;  4TNS A;  2XP6 A;  2LJ4 A;  2ZQS A;  1EQ3 A;  1JVW A;  1X6N A;  3GPK A;  4UDM A;  4XAK A;  5JH8 A;  4Z2J A;  1ZBV A;  3UI4 A;  4WKF A;  1U79 A;  1R9H A;  5HUA A;  4Z2K A;  4N19 A;  5D75 A;  4ITZ A;  3VAW A;  5HT1 A;  4GIV A;  5DEZ A;  1WB0 A;  4U86 A;  1ZCN A;  4DZ2 A;  3FXY A;  4ZS6 A;  1FFQ A;  1TCO C;  1FJD A;  1SYT A;  4ML4 A;  1P5Q A;  3I6C A;  4MNJ A;  4IQ2 A;  5HW8 A;  3EY6 A;  3O5F A;  1WNO A;  4W9Q A;  3UI5 A;  1NWU A;  1FAP A;  4DRO A;  1ITX A;  1C9H A;  2F2D A;  3MDY B;  3EIP A;  1FFR A;  4ODM A;  1XRV A;  4DRH A;  4WKA A;  4MNL A;  3TDB A;  3WD3 A;  4JFL A;  3WQV A;  1EHN A;  2PPN A;  4DIP A;  5HW6 A;  3PRA A;  2UZ5 A;  4W9O A;  3WD1 A;  4JFK A;  4LAY A;  4WJX A;  3GTY X;  3PRD A;  4O2T A;  1UR8 A;  1J4I A;  3JYJ A;  1BL4 A;  4DWS B;  1FKR A;  4L72 B;  3ARO A;  2A3E A;  4IQC A;  3FAP A;  2DSW A;  1HJW A;  3TCZ A;  5GQB A;  2G41 A;  4AY1 A;  2FAP A;  2VCD A;  1E6P A;  3ARW A;  1KT1 A;  1WAW A;  2KFW A;  4MTV A;  3WD0 A;  2OFN A;  4P8V A;  4JFI A;  2LGO A;  5HWC A;  3W4R A;  2O9O A;  5GPG A;  2FKE A;  1LL7 A;  1HXV A;  3BMB A;  4KR0 B;  1NWS A;  2DG4 A;  4BF8 A;  4DWS C;  4MNM A;  1FKS A;  4J4O A;  4WKH A;  1J4H A;  3ODK A;  1NWT A;  2G8Z A;  3G6L A;  1E6R A;  2JZV A;  1E6Z A;  1W9P A;  4GGQ A;  4W9P A;  2MLX A;  2A3B A;  4DWS D;  2M2A A;  1GPF A;  2PBC A;  4LAX A;  3RM8 A;  3RGC A;  3IKD A;  4J4N A;  1HJX A;  1ZBK A;  3WKZ A;  1LG1 A;  3RFW A;  1FD9 A;  2AWG A;  1QPF A;  1HJV A;  4ZPW R;  1W26 A;  1QZ2 A;  4ODO A;  3AS3 A;  2MLY A;  4IT6 A;  2MPH A;  3KCE A;  2DSV A;  3KAB A;  3UI6 A;  1ZU8 A;  1F40 A;  4LAV A;  2ZR5 A;  1Q6I A;  3KZ7 A;  3O5O A;  4ODQ A;  4QZV B;  4ZPV R;  1SR0 A;  2AOS A;  3ARY A;  3WD4 A;  3CHE A;  3CZ8 A;  5HW7 A;  2Q5A A;  3JXV A;  1PBK A;  1W1P A;  1EIB A;  2OLH A;  4ODK A;  3KAG A;  3NI6 A;  3UF8 A;  2A3A A;  2D9F A;  3ART A;  2DT2 A;  2XP4 A;  4G2P A;  4IT4 A;  4URI A;  1TFV A;  3WQW A;  1Q6U A;  4Z2I A;  1ROT A;  5HWB A;  3ARU A;  3KAF A;  3O5M A;  5DO2 A;  2M1I A;  4DRM A;  3NTP A;  1D6O A;  3GU0 A;  2YBT A;  2ZQT A;  4QT3 A;  1QPL A;  3H9R B;  4DT4 A;  1LQ0 A;  2M08 A;  1NMW A;  2F21 A;  2PI6 A;  3RME A;  1J6Y A;  3ALF A;  3UQB A;  1F8A B;  1OGG A;  1K9T A;  1FKG A;  1ZK6 A;  1ZB5 A;  1CTN A;  4TW7 A;  5DIV A;  4DWS A;  1EDQ A;  2DSZ A;  4LGX A;  3LUO A;  4KQZ A;  1KT0 A;  4G50 A;  3KAH A;  2PPP A;  4U85 A;  1E15 A;  4Z2H A;  2MLZ A;  3NRK A;  1LJY A;  4ZPT R;  2MNT A;  4ODR A;  3KAC A;  4Z2G A;  1B6C A;  3WL1 A;  1OGB A;  3PRB A;  1W9V A;  3O5P A;  4Q22 A;  4FAP A;  1J4R A;  3ARP A;  1O6I A;  4P8U A;  1JNT A;  4C02 B;  3O5L A; 
#chains in the Genus database with same CATH homology
 2RQS A;  4MSP A;  4HBE A;  2N87 A;  4IPX A;  4JFJ A;  1X6L A;  4TX0 A;  2XP3 A;  1W9U A;  4TYO A;  4S3K A;  2ZR4 A;  1M5Y A;  4U84 A;  3RM4 A;  2B31 A;  1H0I A;  1Q6H A;  2XP9 A;  4PTM A;  2DSU A;  4MPK A;  4NZC A;  4L3N A;  1W1V A;  2LKN A;  3CGN A;  3ARV A;  1FKL A;  3ARQ A;  1Q1C A;  4JFM A;  5HTG A;  2YBU A;  1W1T A;  3CHD A;  5GPR A;  1JNS A;  3AS1 A;  3TC5 A;  3WIJ A;  2K8I A;  1RD6 A;  2LPV A;  1H0G A;  1YW5 A;  3FY1 A;  4ODP A;  1LG2 A;  3B9E A;  2XP8 A;  4DRJ A;  4DRQ A;  4P8X A;  2DG9 A;  1BKF A;  3CHC A;  4JYS A;  2ESC A;  2XP7 A;  1GOI A;  3AS0 A;  3CHF A;  2RUR A;  3PR9 A;  2KGJ A;  3IHZ A;  4Z2L A;  1NWR A;  3AQU A;  4FN2 A;  2RUC A;  3O5E A;  2XP5 A;  5I98 A;  4P8W A;  2DT3 A;  3B8S A;  4ODN A;  2DT0 A;  3OA5 A;  4S3J A;  1IX5 A;  1FKK A;  4Q7N A;  2RUQ A;  3O5R A;  4DRK A;  1N1A A;  2KE0 A;  1LL4 A;  3O5K A;  2XPB A;  1Y0O A;  3CGM A;  3UQI A;  2VN1 A;  4TW6 A;  3O5I A;  2PV2 A;  1W1Y A;  5B8I C;  1KFW A;  1FKH A;  3WH0 A;  3ALG A;  2O92 A;  3IK8 A;  1E6N A;  3UQA A;  1LL6 A;  3O5G A;  4WK9 A;  1JND A;  3OOB A;  4QIB A;  1HKM A;  1T11 A;  1HKK A;  4HAR A;  4MNK A;  2PV1 A;  2WK2 A;  2WLZ A;  2DPE A;  2ZQV A;  2DT1 A;  2WM0 A;  2ZR6 A;  3ARX A;  1HKI A;  2WLY A;  1FKT A;  4WIW A;  2DG3 A;  1ZBC A;  1JNE A;  2RUD A;  2MF9 A;  1XHG A;  4DRI A;  3O5J A;  4R5E A;  1YAT A;  2QF8 A;  3B9A A;  1E9L A;  3O5D A;  5HKG A;  5HBF A;  1HKJ A;  1D7I A;  1D2K A;  5J6E A;  2ZQU A;  1ZL1 A;  1FKF A;  1VF8 A;  4TW8 A;  2PPO A;  4MAV A;  4DH0 A;  1FKB A;  3ARS A;  4DRN A;  1L1P A;  3WD2 A;  5DF0 A;  4NSB A;  1OWQ A;  2Y78 A;  1NMV A;  1UR9 A;  3ARR A;  4NNR A;  4DZ3 A;  4QT2 A;  2IUZ A;  2XPA A;  4LAW A;  1FKJ A;  1FKI A;  3AS2 A;  5BXJ A;  1FKD A;  3B7X A;  2FDM A;  1EYM A;  3CH9 A;  2IF4 A;  1A7X A;  2KO7 A;  3BXW A;  3O5Q A;  2RSE A;  3B9D A;  4HBO A;  2L2S A;  1ZBW A;  3KAI A;  4ODL A;  1GUV A;  4W5U A;  3WL0 A;  1NSG A;  1PIN A;  2ITK A;  3PA7 A;  4R0X A;  5DIT A;  3JYM A;  3QOK A;  4MGV A;  1ROU A;  3IKG A;  1NH6 A;  2KI3 A;  2KR7 A;  2F4E A;  3RM9 A;  3KAD A;  3ARZ A;  1D7J A;  1D7H A;  2PV3 A;  2A3C A;  4DRP A;  3G6M A;  5DIU A;  4TNS A;  2XP6 A;  2LJ4 A;  2ZQS A;  1EQ3 A;  1JVW A;  1X6N A;  3GPK A;  4XAK A;  5JH8 A;  4Z2J A;  1ZBV A;  3UI4 A;  4WKF A;  1U79 A;  1R9H A;  5HUA A;  4Z2K A;  4N19 A;  5D75 A;  4ITZ A;  3VAW A;  5HT1 A;  4GIV A;  5DEZ A;  1WB0 A;  4U86 A;  1ZCN A;  4DZ2 A;  3FXY A;  4ZS6 A;  1FFQ A;  1TCO C;  1FJD A;  1SYT A;  4ML4 A;  1P5Q A;  3I6C A;  4MNJ A;  4IQ2 A;  5HW8 A;  3EY6 A;  3O5F A;  1WNO A;  4W9Q A;  3UI5 A;  1NWU A;  1FAP A;  4DRO A;  1ITX A;  1C9H A;  2F2D A;  3MDY B;  1FFR A;  4ODM A;  1XRV A;  4DRH A;  4WKA A;  4MNL A;  3TDB A;  3WD3 A;  4JFL A;  3WQV A;  1EHN A;  2PPN A;  4DIP A;  5HW6 A;  3PRA A;  2UZ5 A;  4W9O A;  3WD1 A;  4JFK A;  4LAY A;  4WJX A;  3PRD A;  4O2T A;  1UR8 A;  1J4I A;  3JYJ A;  1BL4 A;  4DWS B;  1FKR A;  4L72 B;  3ARO A;  2A3E A;  4IQC A;  3FAP A;  2DSW A;  1HJW A;  3TCZ A;  5GQB A;  2G41 A;  4AY1 A;  2FAP A;  2VCD A;  1E6P A;  3ARW A;  1KT1 A;  1WAW A;  2KFW A;  4MTV A;  3WD0 A;  2OFN A;  4P8V A;  4JFI A;  2LGO A;  5HWC A;  3W4R A;  2O9O A;  5GPG A;  2FKE A;  1LL7 A;  1HXV A;  4KR0 B;  1NWS A;  2DG4 A;  4BF8 A;  4DWS C;  4MNM A;  1FKS A;  4J4O A;  4WKH A;  1J4H A;  3ODK A;  1NWT A;  2G8Z A;  3G6L A;  1E6R A;  2JZV A;  1E6Z A;  1W9P A;  4GGQ A;  4W9P A;  2MLX A;  2A3B A;  4DWS D;  2M2A A;  1GPF A;  2PBC A;  4LAX A;  3RM8 A;  3RGC A;  3IKD A;  4J4N A;  1HJX A;  1ZBK A;  3WKZ A;  1LG1 A;  3RFW A;  1FD9 A;  2AWG A;  1QPF A;  1HJV A;  4ZPW R;  1W26 A;  1QZ2 A;  4ODO A;  3AS3 A;  2MLY A;  4IT6 A;  2MPH A;  3KCE A;  2DSV A;  3KAB A;  3UI6 A;  1ZU8 A;  1F40 A;  4LAV A;  2ZR5 A;  1Q6I A;  3KZ7 A;  3O5O A;  4ODQ A;  4QZV B;  4ZPV R;  1SR0 A;  2AOS A;  3ARY A;  3WD4 A;  3CHE A;  3CZ8 A;  5HW7 A;  2Q5A A;  3JXV A;  1PBK A;  1W1P A;  1EIB A;  2OLH A;  4ODK A;  3KAG A;  3NI6 A;  3UF8 A;  2A3A A;  2D9F A;  3ART A;  2DT2 A;  2XP4 A;  4G2P A;  4IT4 A;  4URI A;  1TFV A;  3WQW A;  1Q6U A;  4Z2I A;  1ROT A;  5HWB A;  3ARU A;  3KAF A;  3O5M A;  5DO2 A;  2M1I A;  4DRM A;  3NTP A;  1D6O A;  2YBT A;  2ZQT A;  4QT3 A;  1QPL A;  3H9R B;  4DT4 A;  1LQ0 A;  2M08 A;  1NMW A;  2F21 A;  2PI6 A;  3RME A;  1J6Y A;  3ALF A;  3UQB A;  1F8A B;  1OGG A;  1K9T A;  1FKG A;  1ZK6 A;  1ZB5 A;  1CTN A;  4TW7 A;  5DIV A;  4DWS A;  1EDQ A;  2DSZ A;  4LGX A;  3LUO A;  4KQZ A;  1KT0 A;  4G50 A;  3KAH A;  2PPP A;  4U85 A;  1E15 A;  4Z2H A;  2MLZ A;  3NRK A;  1LJY A;  4ZPT R;  2MNT A;  4ODR A;  3KAC A;  4Z2G A;  1B6C A;  3WL1 A;  1OGB A;  3PRB A;  1W9V A;  3O5P A;  4Q22 A;  4FAP A;  1J4R A;  3ARP A;  1O6I A;  4P8U A;  1JNT A;  4C02 B;  3O5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...