3AQUA

Crystal structure of a class v chitinase from arabidopsis thaliana
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
344
structure length
344
Chain Sequence
TVVKASYWFPASEFPVTDIDSSLFTHLFCAFADLNSQTNQVTVSSANQPKFSTFTQTVQRRNPSVKTLLSIGGGIADKTAYASMASNPTSRKSFIDSSIRVARSYGFHGLDLDWEYPSSATEMTNFGTLLREWRSAVVAEASSSGKPRLLLAAAVFYSNNYYSVLYPVSAVASSLDWVNLMAYDFYGPGWSRVTGPPAALFDPSNAGPSGDAGTRSWIQAGLPAKKAVLGFPYYGYAWRLTNANSHSYYAPTTGAAISPDGSIGYGQIRKFIVDNGATTVYNSTVVGDYCYAGTNWIGYDDNQSIVTKVRYAKQRGLLGYFSWHVGADDNSGLSRAASQAWDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A class V chitinase from Arabidopsis thaliana: gene responses, enzymatic properties, and crystallographic analysis
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords At4g19810
total genus 120
structure length 344
sequence length 344
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3aquA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3aquA01
3T08A 3F5LA 3GNOA 4V28A 5A3HA 4Z2IA 1GOQA 2PWGA 1XD0A 1EDGA 4PMYA 1B3ZA 5GPRA 3A4AA 4PTXA 4IISA 4F8XA 4AZBA 5CG0A 3FW6A 4H41A 3RCNA 2BNJA 3RIKA 5E09A 4AZGA 4Z2JA 3VGHA 1TG7A 1VIWA 1G01A 3PZTA 1KR1A 4QFUA 4HA3A 4W89A 1M03A 5IFPA 1HT6A 5EFDA 3WUFA 1OCQA 2J77A 4MJ2A 4UFMA 1UKOA 2VMFA 3CH9A 2ZUMA 3CMGA 3CHFA 3UETA 1C8XA 4XV0A 2YL9A 2YKKA 3W28A 3N17A 1BYCA 2F8QA 1XYZA 1BYBA 3K4DA 3WNKA 3ZO9A 2IXUA 4QLLA 3SCTA 3VGEA 1BFNA 4CU6A 3OZPA 2VVNA 1F4HA 3AMCA 1XGZA 1Q6EA 3T0BA 1UWRA 1XRVA 1EDTA 4MNMA 3UG4A 4D6IA 1RD6A 4TVCA 4XZBA 3NYDA 2J8GA 3POHA 3WQ8A 4AIEA 1ISYA 4D1IA 1HJWA 3NDZA 4F79A 4HMEA 2DT3A 1CIUA 1HVXA 2DT2A 5I3DA 2IUZA 1WZAA 5FL1A 3QHMA 4R27A 1V0KA 1R7AA 1DWAM 4AD4A 5A6KA 3CUGA 3VTRA 4UFKA 1EQCA 1SR0A 3VIJA 3IK2A 2XWDA 4D6EA 1K9FA 1E70M 1OD8A 3WN6A 4BQ2A 1GOWA 1E3ZA 3ZOAA 1P6WA 4UQCA 2J25A 1EA9C 5CSUA 4WJXA 4QP0A 2E0PA 4CN4A 1UKPA 2J79A 4PYSA 5I77A 1PAMA 1C91A 1GQJA 1ZBCA 2J7CA 4CN1A 2WZEA 3DYOA 3U7VA 2X05A 5D9OA 1Q4NX 1CWYA 3VGFA 1M04A 1WP6A 5JBFA 4PMNA 1GORA 1K6AA 2J62A 3GXDA 1B1YA 1RH9A 5CPTA 5AY7A 3NDYA 3ZR5A 4H7VA 2C0HA 2WHMA 5F7UA 3AMDA 5M03A 1QNSA 5CXPA 3SUWA 3WFZA 1N82A 4ATWA 2VI0A 4AEEA 1UHVA 3BAWA 2VQUA 4TVUA 1DHKA 1TA3A 1W9VA 3WF4A 3WF3A 3T0AA 5E6ZA 4NZCA 1J0HA 4QAWA 1XSIA 4TXEA 5DT7A 1H1NA 4QDMA 3GNRA 3FXYA 1SMAA 2XPKA 4FLQA 3W24A 3GBEA 4JFWA 4CD8A 3G6MA 4HOXA 3KEHA 1CDGA 3ARPA 4AMCA 4H04A 5CQ1A 1H4PA 4PCSA 2D3LA 1OD0A 3GM8A 1E3XA 1AQHA 3K8MA 2OWWA 3AROA 5ABFB 1MQQA 1W9UA 2DIEA 3N13A 4HZ7A 3MANA 4P7NA 5IHRA 2BHYA 2O9PA 1XHGA 2VNCA 1ZBKA 1VJZA 2F2HA 1NOFA 3MV01 2O92A 4X0NA 4CVWA 4KMQA 3TTOA 1V6UA 2A3AA 3VD4A 3LPPA 2D3NA 4W85A 4E8DA 3ARVA 3EDJA 3WD1A 1E4NA 4KRTA 1H0IA 1NWTA 2V3EA 3WMSA 1JZ3A 5CPSA 3PZNA 1VJSA 4IPNB 4BQ5A 1AMYA 1QI4A 1JXKA 1V6XA 2A3HA 2O9RA 4J3VA 1VFFA 2IXVA 3GH5A 4P8UA 1WDRA 5A1AA 1K9DA 2G4FA 3PTMA 3W81A 3N12A 4GZIA 1UWSA 3VMPA 3FNDA 3WH5A 5BXSA 1HNYA 1WZKA 4ZXOA 3B8SA 3A4XA 1Q6FA 1TE1A 5A6AA 4JKMA 4HMCA 2WMFA 1TVNA 2QPUA 5M5DA 1KGWA 4GI9A 1WZMA 1PJ9A 5D9MA 4DM2A 2E40A 2D0HA 5E0CA 2VC9A 1UD2A 4D6CA 1UYQA 3CHDA 4NI3A 2BVYA 2OYLA 7TAAA 4ACYA 1V08A 1MQRA 4Z2LA 1BLIA 3CHCA 4HOZA 3WD2A 4Z2GA 1BPLB 1HJQA 1NM9A 1W3KA 1DWGM 2CIPA 4CD7A 3SUTA 3GXIA 4LPCA 4W5ZA 1ZJAA 1KBBA 1QBAA 5BROA 1QHZA 3OLEA 4J3UA 1BGAA 1GVIA 3ARWA 1XCXA 5BRQA 1R8LA 3A3HA 1QW9A 1QNPA 6A3HA 1OWQA 4GQRA 2WWDA 4MDPA 2ZUVA 2BVDA 3WQ6A 3MV11 3VD3A 2C8NA 1WE5A 3QR3A 4ATDA 1SFSA 1CXFA 3VD9A 3WEZA 4W5UA 1E4LA 5A95A 1JZ2A 4BZYA 4CCCA 2E9LA 4AEFA 5A8QA 2EPKX 1FFRA 1WDSA 3WF0A 1NWUA 5C70A 2BHZA 1EXPA 4F66A 3ZMRA 1RPKA 4DWSA 1CGTA 3GTNA 3K8KA 2VURA 1PPIA 3L4XA 2J7GA 4QLKA 3EMZA 2YLAA 3AS3A 3WF1A 3F5JA 2WC3A 4WSJA 1E6ZA 2VO5A 4UQAA 3W25A 2Z1KA 3M07A 4CN6A 1OGSA 3PZVA 2XVKA 2W61A 4Z2KA 1WO2A 4MAZA 4YHEA 1HL9A 5AC4A 3DYMA 2ZXAA 3WUGA 4PTVA 4WLCA 1H5VA 3OIHA 3CTTA 4NRSA 4P7QA 4JKLA 1BG9A 2UY4A 1DWFM 5IFTA 2FGLA 4MAVA 4MNKA 4HU8A 1B3YA 3VNYA 2WVSA 3WBEA 5JH8A 3BAJA 4QCFA 3VDHA 1UWUA 3GBDA 1JI1A 2BFGA 2J7BA 4AD1A 4U5KA 3KZSA 1JNEA 4W87A 3FAWA 1DWJM 2CBJA 2YA2A 2VCAA 2WCSA 4ZFMA 3PTQA 3WQWA 3TTSA 2D20A 4YHGA 2G3NA 1HKKA 4GI6A 2W4XA 1LL4A 2CNCA 3AIQA 4WF7A 4ATLA 1BQCA 2WCAA 5A94A 3IJ7A 1VBRA 3GZAA 2HISA 2XYLA 5DO8A 2Y4SA 5BXTA 3ARRA 2MANA 4F9JA 1MFUA 1KFWA 4P7RA 3UG3A 3AOFA 2QF8A 2XHYA 2NSXA 1YQ2A 2YA1A 3CZGA 5CZKA 1JYXA 1V3JA 5EFFA 1NP2A 1TFVA 2Y8VA 2WK2A 4HA1A 4PMVA 5EBAA 2YDQA 2ZUSA 4U33A 4WKAA 1UA3A 4AIUA 2XM2A 4JL2A 1B0IA 1G94A 1ODZA 4M80A 2J47A 4A3YA 4LYPA 3MSGA 3GXMA 4J3SA 1BAGA 2JF6A 5CJ5A 3CUHA 4GIAA 3CMJA 2VRJA 2DT0A 1W1VA 1E56A 4UOJA 3WDQA 1HX0A 2VT0A 3VIFA 1VFMA 4AD2A 3SCQA 2E9BA 4M81A 1DWHM 2VCBA 1XV8A 5CPQA 1CLVA 5HOSA 5LA0A 2DGAA 2YL8A 3VOCA 3WEOA 3RILA 3IANA 3PTKA 2PF0A 2ZX5A 1F4AA 1EIBA 3AHXA 4PUDA 2D23A 3ZIZA 5AYIA 4HPHA 5FKYA 3WF2A 1UQZA 2WMJA 1ZL1A 2EQDA 3AHVA 5LYRA 4ZENA 1IV8A 5A6JA 2WMIA 4U3CA 5E70A 3MUY1 3RMEA 4URIA 2JIEA 4AZCB 4W8LA 1Q6CA 2CESA 5JUVA 4JHZA 1WDQA 4ZEPA 2X0YA 1TZ7A 4D6HA 5CSYA 2XFFA 5A8MA 2QMJA 3VD7A 2DH2A 3OG2A 4GINA 2ZICA 3W29A 1KGXA 2JEPA 2PBGA 1CGVA 4JFUA 2NW0A 3CGTA 1D3CA 4LYRA 3SUSA 2ZX8A 3FHAA 2OLHA 1LL6A 5I79A 1OB0A 1B3XA 1FA2A 2GJRA 4V27A 5FIPA 1SYTA 3W4RA 4UQBA 3GXFA 2AAAA 3RJXA 2WW5A 4CKQA 1GCYA 1S46A 3BAXA 3VIHA 5CLTA 1C90A 4KWUA 4C7DA 3GDBA 2ZX9A 3FN9A 4XX6A 5A8OA 4D6GA 3ALGA 2OYKA 3AS1A 2D1ZA 3BLPX 3ARQA 2EPLX 1HN1A 2WMIB 2XSBA 1GQIA 1VENA 1UR9A 4PTWA 2WKLA 2DPEA 2J7DA 3W37A 1WKYA 3WNLA 3K4AA 2FGZA 4AY1A 2WCGA 1CZ1A 1ZB5A 4K68A 4U31A 1E6NA 2GFTA 3LPFA 1EHNA 5JIPA 3GH7A 3WELA 1W1YA 2J7FA 1W9BM 2PWHA 1TUXA 4HA4A 1GVYA 1W2VA 2BV9A 1JG9A 2BXZA 4IUGA 1J0YA 4AZ6A 2VZSA 1KWKA 8A3HA 1E9LA 1VB9A 4AWEA 2V3GA 5I78A 3RPMA 3WDIA 2DSUA 1H41A 1QI0A 3CHEA 3BCFA 2DSZA 3SEPA 4J3XA 2JIWA 4C7FA 2WPGA 3UERA 3VIPA 5FOOA 3BMVA 2FH8A 1CYGA 4TX6A 4RE3A 1KBKA 2UY3A 1ZBWA 4H8VA 4MB5A 1UUQA 4TOQA 3WNPA 1VFOA 4PMUA 3OGRA 3IJ9A 1BGGA 3L4ZA 3EBVA 3QOKA 1R7OA 1ISWA 1OIMA 1NWSA 3LPOA 4KGJA 1J11A 1PIFA 3RDKA 3DECA 3MUIA 4MNLA 1E6RA 5GNYA 2BVTA 3S2CA 4AZHA 1E55A 3NSNA 4M56A 3CBWA 3WQ4A 3W6MA 3AIWA 2EPMX 1UKTA 2CITA 3AISA 1BVNP 2CKRA 3CIVA 1QW8A 6TAAA 1OBAA 4PMXA 3ZT6A 3MKKA 3ARTA 4P8WA 2YJQA 3WKZA 4RL3A 3W6LA 2NT0A 5BXPA 4LQ1A 2GUYA 3E1F1 5ECUA 3U5UA 1D7FA 3WDPP 4DWSD 5M3WA 2J4GA 1V6YA 2ZOXA 2QHAA 2NT1A 4W8AA 3VX0A 3HMCA 4QLJA 4OBRA 1GOIA 3L4WA 3NCOA 5ABFA 4Y7EA 1TCMA 1KQYA 2EJ1A 1QHOA 3WUBA 3U57A 2QV4A 3SCNA 4AW7A 3VNZA 3M46A 3ARZA 3CZKA 1JAEA 1H2JA 3SCPA 2ZXQA 4FK9A 1JGIA 1ZJBA 1LG2A 3AMLA 3AIEA 2VZVA 3VIMA 2WVUA 3OLDA 3UEQA 3VX1A 4UOQA 2W5FA 2CHOA 2FH6A 4GZJA 4GPNA 1QI2A 1JZ6A 1UG6A 4JZ5A 1WPCA 3VO0A 3IAQA 3L4YA 1JAKA 5A6LA 4CD4A 1AQMA 2CBIA 3MUZ1 5D9NA 4CCEA 1R85A 1CNVA 3VGGA 2DIJA 1HKJA 3T0DA 2D0FA 5ABEA 3N04A 4HTYA 4DUVA 1O6IA 7A3HA 2FHCA 3PN8A 1MW0A 4JCLA 5HPCA 4AD5A 4RE2A 1KWGA 1JNDA 3AI0A 4OIFA 1BVZA 1HP4A 5ABHA 3IAPA 3O6AA 2BY1A 3ZM8A 3WEMA 4M29A 4S3JA 1GHSA 1B9ZA 1Q6GA 5C71A 2D2OA 5A6BD 3NJ3A 2WB5A 1OSEA 5AYBA 1M53A 3AZRA 4CD6A 1UD6A 2J75A 3NIYA 2ZWZA 3GYCA 1JZ7A 5KEZA 2B31A 3MSDA 3N9KA 3U7BA 5JBEA 1JI2A 3ZR6A 5A6SA 1IZJA 3WNOA 4CD5A 3LMYA 2VCCA 3POCA 3TONA 2J78A 4FMVA 3IJ8A 1G9HA 4R5EA 4LXFA 4JFSA 3A47A 4LX4A 1XD1A 3KE0A 1E40A 1C8QA 1IT0A 3MMWA 3B9EA 1V3IA 3HN3A 1DEDA 1ISVA 4PCTA 1NOWA 2ESCA 1W32A 4HOWA 3M7SA 2DT1A 1VEPA 4MJ4A 4LYQA 1QHPA 1GQLA 1VEOA 1UOKA 1BG4A 3ARSA 1XH1A 3AMGA 4YPJA 4NRRA 4AZ7A 2XFYA 3FAXA 2VX6A 1B30A 4WKHA 5A2BA 1QOXA 2W62A 3AXXA 2VZOA 1VFUA 2YL6A 5BYWA 3CUFA 4BQ3A 1PIGA 1QNOA 1XH0A 4PMDA 1C7SA 1HIZA 5DFAA 4P7LA 2CKSA 2QMKA 1UH2A 2XGBA 3MS8A 4IPLA 3ALFA 2CYGA 2OSXA 2PWEA 3G6LA 4PN2A 4WKFA 1UD8A 1QBBA 3THDA 2PB1A 4J27A 4F9DA 5E0FA 1U33A 1LQ0A 1EOKA 2VL4A 1KXTA 1KB3A 2Q8XA 1B90A 2DEPA 1TMQA 1MVYA 2GDUA 4QCEA 2VQTA 1B3WA 3VIKA 1U30A 3VM5A 4C7GA 4JIEA 5GNXA 4MADA 2Y5EA 3CPUA 2DSVA 1FH8A 4PBGA 5BWFA 2ZIDA 3AZTA 2RGLA 2X1IA 4JCMA 3I3DA 3D3AA 2WBKA 1H3GA 2WVVB 2YDRA 2DDXA 4AZCA 3OA5A 1J9YA 4TUFA 1WCGA 2AMGA 2PWFA 3VGBA 3RJYA 3SUVA 3VM7A 4L4OA 4U5IA 3PHAA 2WMKA 4PMRA 1Q6DA 3I3EA 3AS0A 3WD0A 4CU7A 1HJXA 1PBGA 2Y8KA 3EMQA 2YBTA 1MW3A 1NQ6A 4CUCA 4GQQA 2CBVA 2XJ7A 4W93A 2ZUWA 4MB1A 1JDAA 4EE9A 5DMYA 1AQ0A 5BCAA 4UFJA 3W0KA 1JDDA 2J7EA 1UZ1A 4D6JA 3WDRA 4UR9A 2VR4A 1C92A 3ZJ8A 1E6SM 3VINA 3BAYA 1UH3A 3SURA 1BF2A 1CGXA 1W1PA 1B3VA 5HDRA 3AHTA 1KCKA 3A4WA 3II1A 2JFEX 4BF7A 2DH3A 3NUKA 3BGAA 3WL0A 1EQPA 1J01A 3PZIA 1W3LA 2W91A 2XFRA 3SCVA 4JAWA 3MU7A 1UD5A 4JL1A 3T2PA 3ZT5A 1JFHA 1C8YA 3UR7A 3VIOA 1CTNA 4DWSB 3WIJA 1J0ZA 2VZUA 1G0CA 2G8ZA 4W84A 3CUJA 2ZX6A 1NP0A 1E4MM 1M01A 2GK1A 3VU2A 3WNNA 3AIRA 2JEQA 1R87A 5FD0A 3EYPA 4GZEA 3S6TA 4AZIA 2XM1A 2BY0A 5HBFA 4D6FA 1ITXA 2EPOA 5E9AA 1XYFA 1V02A 4XUYA 4B3KA 4P8XA 4MNJA 2OSWA 2V5DA 4X9YA 4XZWA 1HJSA 1MFVA 3RM4A 4GO9A 5D8WA 5DT5A 4UQDA 3AIBA 1UR8A 2TAAA 1JFXA 4HPGA 1E4IA 3BMWA 4OZOA 1TVPA 2Y24A 1D2KA 4HZ6A 5DEZA 4B9ZA 5IXEA 3AZSA 2E8YA 4PEEA 2WNWA 4X0VA 1MXDA 2YBUA 4W86A 1DWIM 3ARXA 8CGTA 1E5NA 2XWEA 3VUPA 4M1RA 1O7AA 2WHKA 3VIIA 3WSUA 4L4PA 1GPFA 2WVVA 3BLKA 1JZ4A 1J18A 1W3HA 1ZU8A 3J7HA 2JF7A 1QI5A 3AXIA 5HXMA 4AC1X 4GKLA 1UR1A 5I2UA 3SCOA 2G3JA 3AFBA 1ISXA 1CENA 1V3HA 3SUUA 4D1JA 3BC9A 3WQ5A 3ZJ7A 5A8PA 1UA7A 2WBGA 3VMOA 2VTFA 1K9TA 3BSGA 1CEOA 3WFLA 3PZUA 3D5HA 1CGWA 1JF5A 1YHTA 3LPGA 4W7WA 5KZ6A 5BRPA 3RO8A 1V0MA 4ZE4A 2CXGA 3ZJ6A 5A6BA 1MXGA 3AHZA 2J7HA 4ML4A 3BSHA 1E0VA 2ZXDA 3CO4A 4HP5A 4W7UA 1MWOA 2GJPA 1PX4A 3N18A 3WENA 3W26A 1E15A 4BA0A 4Q22A 4UFHA 4AYSA 3OGVA 5I0DA 3WMBA 1HJVA 4D71A 3W53A 2XVLA 5BXRA 3OB8A 3OLGA 4DM1A 5A8NA 2XVNA 5IDIA 5A2CA 5A6MA 3BAIA 3VD5A 1JDCA 1V3MA 2VRQA 3PZOA 1KXQA 1GQKA 4AD0A 4TTGA 1V02E 1NOUA 2BY2A 3PZMA 3CUIA 4E8CA 1JZ5A 3F5KA 4TTUA 1GOKA 1WB0A 4UQ9A 2GSJA 2OWCA 1TA3B 4EAMA 4UFIA 1FH7A 3VGDA 2X2YA 3K46A 3TP4A 2EEXA 2BS9A 5EB8A 3W27A 3WQVA 1LG1A 4HZ8A 4FF5A 3KL0A 1C3FA 2CERA 1MYRA 3WH9A 4TX8A 1A47A 1FHDA 1XSJA 3DC0A 1WAWA 2C7FA 3CZ8A 3THCA 3OZOA 5ABGA 2PI6A 1E0XA 1E1EA 1J0IA 3BXWA 1VRXA 2XIBA 2WC7A 4JFVA 1OINA 3JUGA 1GUVA 1C93A 3T2OA 3WD3A 2EO7A 1W3JA 2E4TA 1BYAA 2F61A 4EKJA 9CGTA 1FH9A 3WDJA 3VMNA 2W67A 1GJUA 1EO5A 4HU0A 5GNZA 1JF6A 1HF6A 5CGMA 2G41A 1UWTA 1G5AA 4UZSA 4MB3A 1B2YA 1HXJA 4XB3A 5M17A 3WH6A 1XCWA 3SIMA 1MQPA 1X1NA 4NF7A 1QNRA 3CZLA 1HKMA 2XGIA 4AXNA 3WD4A 2XUCA 2O9TA 3CZEA 1QVBA 3ZSSA 1KQZA 3B9AA 2WKGA 3PZGA 2W66A 2YIHA 7CGTA 1L8NA 3MUAA 2VRKA 1HJUA 1Z32X 2WXDM 3VDAA 3AYRA 3MMDA 1CBGA 4CU8A 1UR4A 2UY2A 3AIVA 3UR8A 3DHUA 1SMDA 1JD9A 2VX4A 2JE8A 1GZJA 1HL8A 3WY1A 2DSWA 3KL3A 3ZJKA 3WUEA 3U5YA 4Z2HA 2FHBA 2CBUA 5LA1A 1J0KA 2W63A 4PSRA 1UWQA 4V2XA 3OLIA 4B16A 3AHYA 4ACZA 4GO8A 1H09A 3T09A 4M8UA 1EGZA 3WL1A 1UZ4A 1KGUA 5D4YA 1UWIA 1KXVA 2XIIA 3ARYA 4AIOA 3RM9A 3AJ7A 2A3CA 1FFQA 4TVDA 1E73M 3PBGA 1US2A 1H11A 1KR0A 1A3HA 4BQ4A 3O2LA 1E0WA 5A69A 3PZ9A 4FLOA 3K8LA 4GXPA 1J10A 4W7VA 3EDEA 4JHOA 2WC4A 1HVQA 1UR0A 1CLXA 1XC6A 1V3KA 2XVPA 1UD4A 1QPKA 3EMCA 1EHAA 5HNNA 4J3TA 2ZUUA 4OBSA 3AS2A 1QI3A 4OJYA 1CECA 2G3MA 4E2OA 1CPUA 1PZ2A 3HU7A 2BXYA 5FL0A 4HMDA 4PTMA 5DF0A 1H0GA 4UOZA 5GQBA 2GJXA 1JD7A 1LWHA 1HKIA 3ZT7A 1EH9A 2X8RA 4W8BA 4DUWA 2YA0A 1E6PA 4ACZB 4EK7A 3A6OA 1RP9A 1J0JA 2WAGA 3I3BA 1ESWA 2WMHA 5TD4A 3ZQ9A 3VIGA 4U2YA 1KXHA 1I1WA 1VAHA 1B31A 2VJXA 2V38A 2D24A 4J3WA 3QOMA 4UNIA 4CGTA 2JALA 1G1YA 1V03A 3K1DA 5D8ZA 4J7RA 1OT1A 1NH6A 3F4VA 1J12A 2VOTA 3VDCA 4U2ZA 1GJWA 2WLYA 4FLRA 4D6DA 1IZKA 2V5CA 3AXHA 2E8ZA 3GH4A 1V0LA 1W2PA 4LGXA 4PMZA 2BY3A 1HP5A 1JYWA 3VDBA 2YL5A 2VUYA 2ZXBA 1LJYA 1L0PA 1JXJA 2CETA 1NARA 1V0NA 1ISZA 2Z1SA 1PX8A 1KCLA 4ZXLA 2PWDA 4GI8A 3HJEA 5EMYA 4N0RA 4D72A 5LA2A 2WANA 4P8VA 3EDFA 2QPSA 4M24A 2CHNA 3WH7A 1E43A 1E6QM 2FHFA 4JFTA 2GVYA 3NSMA 3ECQA 5D9PA 4JKKA 5HPOA 2O9OA 5E6YA 3SCRA 4PRWA 3BAKA 1E1FA 1M7XA 1E72M 1BYDA 2D22A 4UTFA 1CGYA 1UKQA 1FP9A 1MW1A 3WMCA 2XVGA 4B9YA 3BH4A 3QHNA 4H8UA 2YOCA 3UCQA 1CGUA 1MW2A 3EDKA 1QNQA 2WZIA 1ODUA 1PEZA 1RP8A 1ZS2A 3O9NA 3N15A 1LL7A 1CXHA 3BCDA 1H49A 3N1AA 1K9EA 4UQEA 1VBUA 2WM0A 2PC8A 1FHLA 4OKDA 5CGTA 3FY1A 3DYPA 4W88A 1UR2A 3AICA 1V6VA 4U3AA 2EXOA 4PMOA 3L2MA 2G3IA 1W9PA 3L4UA 3RM8A 3WH8A 1CXKA 2UY5A 1WNOA 2X0HA 3N11A 1CXIA 1UH4A 2YDSA 4WIWA 3WNMA 3AYSA 4H8HA 3W38A 2HVMA 2V3FA 3AIUA 3GNPA 3M6DA 2WSPA 4S3KA 3MMUA 1GW1A 4DWSC 3TTQA 1FP8A 6CGTA 3OBAA 4PUEA 3SCWA 2OSYA 1BSIA 4N42A 2WLZA 3B9DA 4AISA 2J8FA 5FCZA 2GK1B 4UZUA 1W91A 2DSKA 2W92A 4P7OA 3VKKA 1XSKA 3W82A 4CVUA 2OWXA 3KL5A 2GDVA 2D0GA 1DP0A 3TOPA 2WHLA 4DUXA 4ZE5A 1JYNA 1PZ3A 3WDHA 1CXLA 1FOBA 4M82A 5I5RA 2AOSA 4WSKA 1OIFA 1ECEA 5JBDA 3L4VA 1LLOA 2XTKA 3UG5A 3QGVA 2VX5A 3UESA 3EDDA 3OGSA 3VVGA 3NSXA 4Q7NA 4EANA 2RGMA 2J74A 2DQXA 4KGLA 1NWRA 2A3EA 3FHQA 1Y7VA 1EO7A 1UQYA 1ZBVA 3PZQA 5CLWA 1U2YA 1E6XM 2WHJA 1BTCA 2ZX7A 2XG9A 4BCEA 1JYVA 2EBNA 1OGGA 1E71M 3AMKA 2ZUNA 2CEQA 4YN5A 5I6SA 1R86A 4WK9A 3QHOA 4AD3A 1W9XA 2BHUA 2Y2WA 2WVTA 2QLYA 2WMGA 1WZLA 1VF8A 3CLWA 3SCUA 2WSKA 1OGBA 2E3ZA 4UFLA 4A3HA 4BS0A 5A2AA 2VVSA 3TTYA 3DHPA 2WWCA 1W9DM 3WBAA 2XSAA 2X09A 2VX7A 2GJXB 3VILA 4OUEA 4MTVA 4J28A 3L2LA 2A3BA 3ARUA 1GNXA 4OOUA 3L4TA 4B15A 1C7TA 1JIBA 5IHSA 1DTUA 1UKSA 1XH2A 1BHGA 1X6LA 1JL8A 1V3LA 4B3LA 1PX3A 1CXEA 2PBOA 4FLSA 5C8BB 4KRUA 1GHRA 1TR1A 1LWJA 3CZJA 2OYMA 1GOMA 3APGA 2VR5A 4MDOA 4A4AA 5I23A 4NSBA 4CCDA 3KWXA 4MB4A 3VPLA 1OM0A 1WDPA 1VEMA 2FDMA 2ZE0A 2ZWYA 1EOMA 3TA9A 4PSPA 1GONA 2CPUA 5JIWA 1X6NA 4MPKA 4OOZA 2WYSA 2VZTA 2EPNA 1UD3A 2CCRA 1US3A 1AVAA 5I24A 1JZ8A 1OT2A 4E4PA 2E9MA 2V3DA 1EDQA 5AC5A 2ZUTA 1V6WA 3MO4A 3ZSTA 1W1TA 3SCSA 2WZHA 4AZ5A 1I75A 4IM4A 1LF1A 1GOOA 3AQUA 4PMQA 1I1XA 4KH2A 1E5JA 2YLLA 4H2CA 2UWFA 3T2QA 4UCFA 4RE4A 1ITCA
chains in the Genus database with same CATH superfamily
3GDRA 4L64A 4V28A 4CQ8A 2DUZA 1XD0A 3F7JA 3GHTA 2PLJA 2OKOA 3JVAA 3FJNA 4F8XA 4AZBA 4IFKB 4H41A 4AAJA 1K7EA 4ZPWR 3VOIA 2FZBA 4B92A 1LTDA 4AHQA 3SR7A 3NQFA 4HSNA 4PODA 1G01A 3PZTA 1KR1A 1WXJA 3TQPA 3UA4A 3H6OA 3LUOA 3WUFA 1UBPC 1F07A 4J9JA 4MJ2A 1EX1A 3WMLA 3C2FA 3GG8A 4PEKA 1Q4WA 2VEPA 3CMGA 3HGJA 3UETA 1C8XA 4XV0A 3GR8A 3W28A 1OX6A 4E3TA 1BYCA 2XP7A 1XYZA 1BYBA 3R4IA 3WNKA 1MO0A 1XISA 4X61A 3F4DA 1ROTA 2FFIA 4WY0F 3OZPA 2VVNA 1XRSA 5C9RA 3T0BA 5IDZA 2ZDSA 1Q6QA 2J6VA 3IVUA 1HJWA 3KBMA 2ZQ0A 4F4RA 4F0RA 4FOJA 4Z1BA 5FL1A 4EWJA 1EIXA 3CUGA 4MJZA 2Y1HA 5FESA 5XIMA 3ZR4A 4GCAA 1ECQA 1ZAHA 3QLDA 2ISDA 4EXBA 3TA6A 1XW8A 2XWDA 1K9FA 1LOLA 2PU0A 3WN6A 4BQ2A 2NQHA 1OFPA 3ZOAA 4L6DA 3CEPA 3TYEA 3C6CA 4CN4A 5AC7A 3OG3A 1TE6A 2ZQUA 1LUCA 5I77A 1PAMA 2D73A 3U4AA 4JOMA 1ZBCA 1XWYA 1QK2A 3DYOA 3U7VA 4O8RA 5D9OA 2GYIA 1Q4NX 2A7RA 1PV8A 2BGNE 1XYAA 4IL2A 3E38A 2J62A 3OO2A 1OFBA 2VC7A 4MZ8A 1VHCA 3G1YA 4HMNA 2C0HA 5F7UA 3R58A 4LT9A 4XD6A 4AH7A 3SUWA 5CKSA 1GTHA 1N82A 4ATWA 3GU0A 4AEEA 4UB9A 1RK5A 1XYBA 2IPWA 4NZCA 1J0HA 3V3WA 5TAOA 3LI1A 1XPYA 1JVNA 1W0MA 2ZQTA 1XG4A 2QXWA 1SMAA 1KLYA 2XPKA 4FLQA 4F40A 3LV5A 3W24A 1FKKA 1B5TA 1QPOA 3GHUA 4AB4A 4JFWA 3UXDA 3G6MA 4CD8A 4AX7A 4AMCA 4MYAA 4H04A 4JYEA 5EGRA 4PCSA 4ORIA 2D3LA 3T4CA 2R1PA 1E3XA 3K8MA 3M5VA 3NL6A 2PV1A 1Q1CA 5ABFB 4QDWA 3FDKA 2DIEA 4P7NA 4HZ7A 3LZ3A 3WLHA 3BW2A 3WQPA 4R33A 4TU1A 2OT1A 4O53A 3DERA 1TWSA 1FD9A 2ZA1A 5C5YA 2O92A 1X96A 4DF1A 4MKSA 3PSVA 2FVMA 3TTOA 1EP1A 3N3MA 2NXHA 4XD4A 2D3NA 3CV7A 4W85A 4OTKA 4E8DA 2MLZA 3ARVA 4MGVA 3WD1A 1H0IA 2V3EA 3UI4A 2YYTA 3O5DA 2QDGA 5CPSA 5CSRA 3M5YA 3E0WA 4IPNB 4BQ5A 1AMYA 1JXKA 2A3HA 3LG3A 1TPUA 4J3VA 5A1AA 3GH5A 4P8UA 4N6EA 3FYPA 2ZYFA 3PTMA 3W81A 4LAUA 3VMPA 3FNDA 4H9MA 1TVLA 3A5FA 5T9BG 3EXSA 5HMEA 1TE1A 4FZIA 1TVNA 3FXGA 1PJ9A 5D9MA 3KACA 2VC9A 3UP8A 4DZIA 2K8IA 3BLFA 4L65A 2BVYA 4ACYA 3CHCA 1BPLB 4FXFA 1TWZA 4G5DA 5F2IA 4CD7A 1PTDA 2H9AA 5M2FX 3GXIA 1Y8BA 4GY1A 4W5ZA 2G3FA 2KAUC 1ZJAA 1KBBA 1QBAA 5REQB 4XZIA 3LBOA 3GU9A 3W7GA 1VPQA 4J3UA 3NTPA 3ARWA 3V4BA 4GMEA 4DNMA 2GVLA 4GQRA 3UZ5A 2ZUVA 2VWTA 3CJPA 3IJLA 3O0KA 1WE5A 3RLUA 2H9AB 2GJNA 3RK8A 4YYCA 3IHZA 3ELFA 5L9FA 1OC7A 4HYRA 3A24A 3B03A 3FDGA 1DPMA 1FFRA 4PR4A 5C70A 5I03A 3NXLA 3UF8A 4C1NB 3UJEA 2VKZG 2V68A 3EMZA 2GGHA 4JIRA 4IIFA 4KCTA 4WSJA 1NDYA 5CBIA 4C6EA 1LT8A 4AX6A 1HG3A 1IXPA 1W17A 5DXYA 2D69A 5AC4A 3DYMA 3FJ6A 1FRBA 1JNTA 2C1IA 1H5VA 1SW3A 2C6QA 1DL3A 2FGLA 3CQKA 1A0EA 3G0SA 3V75A 3BAJA 1AL8A 4K38A 5MF5A 2J7BA 4HK5A 4AD1A 5BOFA 1F61A 4W87A 1FWNA 3JR2A 1DWJM 3PULA 3ABRA 2BBFA 1EXBA 1H61A 3PTQA 5CBBA 1S2CA 2FLIA 3DFHA 2V2CA 3H4GA 3W7OA 1VLIA 4XVDA 4ATLA 1MNZA 5D38A 5A94A 3IJ7A 3GZAA 3V35A 3OOQA 2XYLA 4FNSA 3O06A 2CZDA 4B5SA 1F8MA 3NQMA 1KFWA 3N2XA 4P7RA 4Q8TA 2XHYA 4MWAB 1R3WA 2YA1A 1JYXA 3N6JA 1TFVA 2NXGA 5SWUA 1YPXA 4PMVA 5EBAA 2YDQA 4Z0SA 4U33A 2CZ5A 1J2WA 4LVAA 4WZHA 4AIUA 3LGGA 2OX4A 1TX2A 1VRDA 2X40A 2G97A 4A2SA 4KEMA 2TSYA 4GIAA 1KW1A 3O1NA 1DJXA 2GOUA 2AL2B 4XZHA 2Z1VA 3CUZA 3TR9A 3NPUA 4M6QA 3U9IA 1FAPA 3FA4A 2P3ZA 3URAA 1FWAC 1H51A 5E93A 1I8JA 3W1TA 2OLAA 1DWHM 1QR7A 5CPQA 5LA0A 2DVXA 1Q6RA 4G50A 3WG6A 1F4AA 3AHXA 2D23A 3DN5A 4C6IA 3IACA 1H1YA 1H63A 5FKYA 4JIHA 2Z29A 4IOTA 2HV5A 4ZENA 1IV8A 3HJZA 4J35A 4GNKB 2PDQA 4EPBC 1M6JA 4NVTA 4AZCB 2ZBTA 5J04A 2BDQA 1W1B1 1TZ7A 5A8MA 2BASA 2QMJA 3VD7A 2DH2A 4JN7A 5D05A 4G7EA 1VBGA 1F3EA 1IEVA 2NW0A 3KTCA 4LYRA 3UZZA 3SUSA 4S3DA 4EP8C 1YYAA 1XLLA 1I6NA 1LL6A 3FKKA 3GNXA 5I79A 4IMFA 1NFGA 1NQKA 4QT2A 3L68A 4AWTA 1M7OA 2DG4A 1QTWA 1EGMA 4O1DA 4IGSA 1SFLA 3P2VA 2D2HA 5FIPA 3BOLA 3NQ7A 4FPSA 3OTRA 2L5HA 2ZQVA 3NI6A 3NQAA 1HKWA 2AAAA 4NNBA 4CKQA 4RJEA 3BAXA 3VIHA 3HV9A 5CLTA 2QUMA 2Q8LA 2QQ6A 2V8ZA 1XIEA 4JQ3A 1US0A 1OFQA 5RUBA 4GACA 4DI9A 3AS1A 3ARQA 2EPLX 4QSHA 1UW9A 1AK5A 1GQIA 3RX3A 1UR9A 5CG7A 4PTWA 1TSIA 2Q5AA 1WKYA 3GFXA 4NY2A 2R94A 1YW5A 4JTUA 3TYUA 5BNKA 4K68A 5LSMA 3CV1A 1E6NA 2YPIA 1EHNA 2G95A 1H5YA 3LTSA 5GJPA 1KFKA 4IF2A 1TUXA 1W2VA 3SN0A 2BV9A 1GZ1A 2EPHA 1NAL1 1JG9A 1LT7A 3U2ZA 4TMBA 2VDGA 4V1YA 1KWKA 3S1UA 3URQA 3F4WA 4GGBA 1ME9A 3CPGA 1VB9A 3WQFA 4MLJA 3CHEA 2DIKA 1QCWA 3QGAC 4NZ4A 4J3XA 4YVPA 2JIWA 2WPGA 3ABSA 5HWCA 1CYGA 4N19A 4YMZA 4DXKA 2REQB 2UY3A 4D9PA 3M0MA 3VOFA 2UZ9A 1PZ0A 3TZNA 1YPIA 1XICA 3L4ZA 3MHUA 2DORA 3S5YA 1R7OA 3UQBA 3W22A 1N8IA 3EOLA 5HTGA 1PIFA 4MM1A 4UWMA 4MWAA 3S9IA 4E3VA 1AJ0A 3LHWA 1E55A 4M56A 3CBWA 3E0IA 4B91A 2B7QA 4PBEA 2VFGA 2CKRA 1T5AA 3CB3A 3A4JA 1H7PA 5I06A 4QDPA 3ZT6A 3ARTA 2B81A 1YADA 3V5OA 3WYZA 2YJQA 2FYMA 5BXPA 2XZ9A 3I6CA 1VCVA 4KWSA 1GVFA 1YXYA 2A79A 2NT1A 1MMFA 3SY8A 4GBDA 2O7QA 3HMCA 5C7HA 4IHCA 4OBRA 2J27A 3NCOA 1F74A 2INFA 1XLJA 2EJ1A 2X7VA 1VGAA 4DF0A 2QV4A 4XTDA 3ZVIA 4AW7A 3ARZA 2FDSA 3SCPA 3N2MA 1SSGA 4D2JA 2VZVA 7ODCA 3DU0A 2Y88A 3IRDA 2WJFA 5EKYA 1IEQA 2R9RA 1YEYA 5AYZA 3IIPA 4JZ5A 1WPCA 1IIHA 1QK0A 1IGWA 3F4CA 3IAQA 4LUYA 4CD4A 2ACQA 2CBIA 4PUMA 4CCEA 4AFYA 4YTUA 3H26A 3VGGA 5FF3A 1HKJA 4HTYA 2FHCA 3PN8A 4GXMA 1Q6UA 3H7VA 1JGMA 3CV6A 1R3QA 2PLMA 3AI0A 4EF9A 1BVZA 4NU7A 3O5OA 1S2VA 3GB6A 4ECLA 2MF9A 4KFPA 1L2UA 3WEMA 4DJFA 1J6PA 3N4AA 3R25A 1WKDA 1F8IA 1GHSA 2D2OA 5A6BD 3NJ3A 2WB5A 3MQTA 1ZJHA 5D04C 3R13A 4CD6A 1UD6A 5CSSA 2ZWZA 1X38A 3N9KA 2PDHA 1IZJA 1EJUC 3M64A 3LN3A 3BQ5A 3WK1A 2J78A 3TN6A 4WOQA 3IJ8A 5FSDC 3S2MA 3STEA 2XP9A 4R5EA 1UUMA 1IIGA 1IWPA 3HG2A 3A47A 5IM51 1XD1A 3ISIX 4KESA 1FY6A 1C8QA 1IT0A 5FEXA 3JYMA 4YTQA 3B9EA 2AQOA 4KCWA 5TIMA 1W32A 3SY5A 3AU2A 4HOWA 4EAYA 3PJUA 1X1ZA 4US6A 1AZ2A 3O5KA 5K4ZA 2XSXA 3VCNA 3LOTA 3EXTA 3ARSA 4NZ3A 2AL2A 4X22A 4Z1YA 3FAXA 2VX6A 1B30A 4V15A 3NEHA 2YW4A 4FR6A 5LNUA 4HK7A 2PV3A 3URBA 4ODPA 3H22A 3UZXA 3D0CA 1POJA 5BYWA 4HHLA 4PMDA 1BRLA 2QMKA 4GBUA 1ENUA 3IJQA 2F6KA 3PBYA 3TCZA 3T7VA 3QSRA 3THDA 3CT2A 4IG2A 3OIXA 3COTA 2J9XA 3E2RA 4JTSA 3KW3A 1TMQA 2GDUA 3UWZA 1W1ZA 5FF4A 1QOQA 3LERA 2HS8A 4BI5A 5G1MA 1P1XA 1DJYA 1EYWA 1MEIA 3WJYA 4PRRA 2RUSA 3I3DA 3UJFA 2WBKA 4DZHA 1H3GA 1U5VA 4NAFA 4CEXC 2G37A 2Y61A 1LRQA 3MUXA 5F4WA 2J8TA 5AC8A 1WCGA 3M0LA 4ZPVR 3DFOA 1DOSA 3VGBA 4ZVJA 5E1QA 4PL1A 1R2TA 1Q6DA 3I3EA 3AS0A 1F73A 3TWAA 3TN3A 1D8CA 2NQ5A 4CU7A 4A29A 3EZ4A 3R8GA 4EWND 2ISVA 3CLMA 3B8VA 4PUKA 4N4QA 1RXOB 4Y96A 1AQ0A 3W0KA 1JDDA 2AL1A 4OHQA 1IF2A 3M41A 3K1GA 4UR9A 3UPMA 4QHRA 2PMQA 4QE1A 1BF2A 1XIBA 4QAIA 1KC7A 1KCKA 2I7GA 4BF7A 4I9TA 5K7JA 3C2OA 4Z1CA 4JYDA 1W3LA 3SCVA 5I09A 3AAMA 3ZT5A 1C8YA 3SZ8A 3UR7A 4KF1A 1QATA 1QJWA 3BGJA 2G8ZA 1BRLB 1R3VA 4W84A 3CUJA 4LVGA 1XRFA 1GWJA 5FJUA 2BXVA 1OHLA 5LZLA 1HFBA 1SM9A 4Q8UA 1ZCNA 5HBFA 1ITXA 3N2TA 4XBKA 5E9AA 3APYA 3R8HA 1TWDA 2OO6A 2QEZA 4RPQA 2F38A 2V5DA 3E12A 3CYJA 1MFVA 3VNIA 5DT5A 3ZWSA 1Z7AA 2G50A 2ZZ6A 1IXOA 1JFXA 4HPGA 1E4IA 3RX2A 2AQVA 3H24A 1KT1A 3LX9A 5HNRA 4B9ZA 1L9WA 1EZWA 2Y85A 1CT5A 5FI8A 2QJNA 1EX5A 1NMWA 3EWBX 3NVDA 1DWIM 3QGKC 4QR6A 3GHSA 5A8GA 1F8AB 4TW6A 1GPFA 2WVVA 3IIVA 2QUTA 5CC6A 3RFWA 5AVHA 2EG6A 1ZU8A 2XP6A 2C1GA 1O60A 2PDYA 3EWZA 1PDYA 3KFTA 1QPQA 1EA0A 5HXMA 2XP3A 2I5QA 1Q6OA 5CZTA 2FIQA 4AC1X 1UR1A 4C6PA 1IYXA 2ZZ3A 3R43A 5H8UA 3QQWA 3SCOA 2G3JA 5IBXA 1EJRC 1KBJA 2DZBA 4D1JA 2RUQA 3VKCA 3W9ZA 1NVMA 3ZJ7A 3HB9A 2CLLA 5A8PA 3VMOA 1K9TA 3WFLA 1CEOA 1VFHA 3O5JA 5TNVA 3PZUA 3D5HA 1MRQA 1CGWA 5KZ6A 1GW9A 2WZTA 1SZGA 3WLNA 4NAEB 1P1MA 4PTNA 4RDVA 3DEQA 2CXGA 1RY8A 1RPXA 5A6BA 5J8LA 2OGYA 1XJBA 4H7CA 4ODOA 1E0VA 3S9YA 2ZXDA 4UNLA 2GJPA 2QCMA 3WENA 1O94A 4I5RA 4LS2A 3W26A 3Q67A 3TYAA 4AYSA 4O1AA 3RXZA 5I0DA 4XISA 1M5WA 1Q85A 3C0LA 1LOQA 2XVLA 1RLDA 3DENA 4DRMA 1RLCL 2AKZA 3I6TA 4DM1A 3VXGA 1IEXA 1KXQA 4AD0A 2OEJA 4TTGA 4GQ0A 3PZMA 1KV5A 2WSRA 4I7UA 1NSGA 1JZ5A 4XKYB 1P5QA 4TTUA 4QZVB 1W5NA 3APTA 1WB0A 4UQ9A 2DVUA 2GSJA 1FH7A 4RW3A 2X2YA 3K46A 4G2PA 1LRNA 3R10A 4DAFA 2DZAA 1JCYA 2BS9A 1LG1A 1TRIA 4WGXA 4IXHA 3KL0A 4XAZA 4JIQA 5B80A 4TNSA 2C7FA 4C6DA 3THCA 1R30A 5HMSA 4GVGA 1VKFA 3AUJA 5HATA 1O66A 3BXWA 1EF3A 4AQLA 7XIMA 2Z1XA 1P6BA 2FB3A 1F6KA 4TQTA 2EO7A 1VLWA 2E4TA 4EKJA 1A0CA 9CGTA 1T8XA 1FWTA 1W3NA 3V1PA 1HF6A 1UWTA 2NV2A 1O5KA 3CM4A 2VD9A 3KS6A 4DROA 4IQEA 4YL2A 4LYKA 1MQPA 3OQ8A 1X1NA 3INPA 3CZLA 4QJ1A 2XUCA 2O9TA 5C7VA 1JVWA 2VN1A 1QO2A 4K36A 3ZSSA 2CWNA 4F2TA 1EEPA 2KE0A 3C8FA 1JDFA 3PZGA 4U28A 4HVXA 3MCMA 3MUAA 2XFWA 4IMGA 3QM3A 3W85A 3AIVA 3UJRA 3WQDA 3N34A 1YTKA 4PC8A 5F4SA 4AG0A 3WY1A 9RUBA 1XUUA 7PTDA 3RU8X 2HDJA 4QG6A 3MHGA 5AYYA 4Z2HA 2WPBA 1J0KA 4K8EA 3H4XA 2XIMA 4FSAA 4B16A 3NQ2A 4ACZA 4HHHA 4GO8A 3ODKA 1B3OA 3WL1A 1UZ4A 2YB4A 4IMEA 5D4YA 1YLVA 3FK4A 4IPPA 1KXVA 2XIIA 2YXXA 3UBPC 4DJDA 1OC6A 1E73M 4UTLA 3PBGA 1KR0A 2VFHA 4AF0A 5CAHA 1OFAA 3MZ2A 4BQ4A 4XWUA 4EACA 3W3OA 3PZ9A 2ON3A 4KWVA 4GXPA 4JHOA 4DRSA 2WC4A 1HVQA 4O0QA 3GG7A 3T42A 3VA8A 4PE8A 1ZJIA 4RNFA 1KA9F 3PVFA 3AS2A 4LUTA 2JGYA 1S2UA 4E2OA 1JPKA 2R6OA 5FL0A 1FWRA 4IP7A 1IXNA 5XIAA 1LROA 4M19A 1XLDA 3UWUA 4KERA 5DF0A 3N14A 5GQBA 4UOZA 3ENLA 1JD7A 1LWHA 1XINA 3T4WA 4DJDC 1XKJA 4PCNA 1E6PA 3GVWA 4JS3A 2WAGA 1HGWA 2ZZ2A 1TELA 3ZQ9A 1S5VA 3DUGA 3VIGA 4M5PA 3REQA 1VAHA 1B31A 2VJXA 3A23A 1TPDA 4J5NA 3H7RA 3LZ5A 2ITKA 2A0NA 3SW6A 1G1YA 1FKHA 4ZOBA 3NGFA 1J96A 2V67A 3F4VA 3GD6A 3SJ3A 4U2ZA 1GJWA 2WLYA 4US5A 1PUDA 4LF1A 4ERAA 1I45A 1M41A 3ANVA 3CUXA 1OX4A 4XIAA 3UA3A 1SO6A 3FKRA 1SJCA 4HN4A 3GIYA 4OGZA 2QJMA 2YL5A 4HCDA 3SB0A 2ZXBA 1LJYA 3TROA 1X7FA 1Q6LA 3RNDA 4ES4A 3SSJA 4ZXLA 2PWDA 4GFIA 3EDFA 3LLDA 3WH7A 4IH3A 2Q71A 3JZEA 1E6QM 1EBHA 3NSMA 2PWUA 2YR1A 5E6YA 3SCRA 2WNQA 1E1FA 3ERPA 1Y5WA 2D22A 4E2BA 3HG3A 5CPMA 3TNOA 2PDJA 3GKFA 4CNNA 2J9ZA 3BH4A 3EB3A 2YOCA 1QUMA 4UTWA 3AUOA 2E6FA 1MW2A 3EDKA 1QNQA 4LB4A 1YNQA 2F84A 3L0KA 5D75A 1ZS2A 3CWHA 4I6VA 5CGQA 3TYZA 2YB1A 3WFAA 1LL7A 1CXHA 3BCDA 1H49A 4N2YA 5LNWA 2WQPA 1VBUA 2PC8A 1LORA 4W88A 4GX9A 3ES7A 3O5EA 4U3AA 4DJEA 2EXOA 5BU6A 5G1TA 1FXQA 4EPDC 3TH6A 3WH8A 4O12A 3EB2A 4NNRA 1WNOA 1DJHA 2CLOA 2NX1A 3R1ZA 5LHFA 2W3ZA 8XIMA 1UH4A 4F0KA 1L6FA 3C0JA 3GUGA 3AYSA 2V3FA 3UCDA 4ZOEA 3E3HA 4JTIA 5T8GA 4GFSA 3TTQA 2I9EA 2JKEA 3OBAA 3P5YA 4HNOA 2UV8G 3NPVA 3WQEA 1YXCA 1A5NC 2Q3OA 4AISA 2J8FA 3U2EA 3P80A 3UD6A 5FCZA 2W92A 3BJTA 4P7OA 2UZ5A 3MI3A 3NDOA 3G1XA 3KL5A 1ICQA 1FKGA 3UNTA 2WHLA 4DUXA 4YVVA 2QF7A 1CXLA 5DITA 1ZFJA 4M82A 5I5RA 2AOSA 4HJFA 4TYOA 4JFMA 1ECEA 3L4VA 3FOKA 2XTKA 4FOUA 1DIOA 2VX5A 3IWPA 4B5WA 3WLMA 2ZA3A 1XC4A 3G2GA 3CC1A 2DZPA 1GVQA 1OQFA 2V5BA 2YCLA 1JJKA 4BI6A 2RGMA 1JCHB 3O6CA 3SSZA 2ZQSA 2XDFA 5DIUA 3SAZA 3H2AA 1AD1A 1EO7A 1UBSA 3W1QA 3JRKA 1YX1A 1H7OA 5CLWA 1XLKA 2WHJA 1Q7QA 1BTCA 2ZX7A 3M0HA 2XG9A 2C16A 1OGGA 3B06A 1AG1O 2VFFA 3TZFA 5I6SA 3TQ0A 2Z4GA 2X42A 3EEGA 1KO0A 3Q2DA 1PIIA 2WVTA 2QLYA 3L7RA 4JICA 2WMGA 4JXCA 1KBLA 4KFNA 1WZLA 2EG8A 4DJFD 1DXEA 1FWDC 2OZTA 3W2MA 2NQLA 4RKAA 1IT7A 1EPXA 3LBMA 4UFLA 4A3HA 3QKEA 5C0QA 2PTZA 2H3BA 1OCBA 2I14A 3WBAA 2XSAA 1XBZA 3PPGA 3M0JA 2GJXB 4C6JA 2VEMA 2OPJA 4LV4A 3ARUA 1GNXA 2NX9A 4OOUA 2MNRA 3L4TA 1C7TA 3Q65A 1EEXA 1JIBA 1S5TA 2QDEA 4XZNX 3JXVA 4OBTA 1X6LA 4RLIA 1RA0A 1V3LA 1RQBA 1PX3A 2PBOA 2ZZ5A 2XH0A 1GHRA 2CW6A 4GY7A 3MJYA 3E2SA 3QY8A 2GWNA 2Z1WA 5KSWA 3KCOA 4E4FA 3QC3A 1QPNA 4Q4OA 1GONA 3O5FA 4OOZA 2ISWA 3EOOA 2GUBA 1FBAA 3A3WA 3HPAA 2M2AA 1AVAA 1CCWB 3VZYA 5JH1A 4X9SA 1EDQA 1SZNA 2OU4A 1ZSXA 2RUCA 3KS5A 3MO4A 1T7LA 3QKZA 1I75A 4IM4A 1LF1A 3LHVA 3AQUA 4ZQNA 4KBXA 4L4MA 3T81A 4H2CA 5JVLA 2UWFA 1QPLA 3MY9A 4YTRA 2OO0A 2PAJA 3F5LA 2X7WA 4Z2IA 1EDGA 4MSPA 5CG0A 4JX5A 2NQ9A 2OODA 3RCNA 3AC0A 2E1WA 5E09A 3DG6A 1P4CA 5AVNA 3G1HA 2HTMA 1M03A 5IFPA 1TYGA 3JS3A 4I90A 3PAJA 3NL2A 1FWIC 4YTSA 3MTWA 1AMKA 3CH9A 1NF0A 4FALA 1M7JA 5HQMA 2I17A 1PO9A 2VFEA 4O1EA 3K4DA 4S39A 4DIPA 3H70A 4S3AA 2IXUA 1F05A 3VGEA 5AECA 3U4FA 1XFCA 2PZNA 4NASA 1FX6A 1XRVA 2OEMA 1VPYA 4RE0A 3PUDA 1RD6A 4NKCA 4Q8WA 1FWWA 2QVNA 4AIEA 3ID7A 4F79A 3EXRA 4HMEA 1UUOA 2NUWA 3GDKA 1HVXA 3S3GA 5I3DA 1PCKA 2IUZA 3BGGA 4R27A 2VGBA 4XTIA 1DWAM 3TWBA 1K4GA 5AKQA 3T6CA 1N8WA 1D9EA 3S4TA 2V5KA 3K13A 3EA2A 1A5KC 4A6GA 2GUUA 1KBIA 3IGXA 1SZFA 1ICPA 4D6EA 2BB0A 2ZRUA 1PDZA 5HT1A 4OE7A 1QDSA 3PJXA 4NJJA 4UQCA 4J4OA 3BUVA 3CU2A 2L2SA 3SECA 3W7MA 4DJED 1H7NA 4Q4PA 4PYSA 5FSEC 4GCXA 1C91A 1NDVA 1GQJA 2VEGA 2OMAA 5T91A 2J7CA 4O57A 1H62A 4YJ5A 2O55A 4K3ZA 4LWWA 3CAKA 4ZA0A 5K9CA 2F4EA 4PMNA 2D2GA 1B1YA 4LS1A 3DOPA 1W1IE 3IEBA 5CPTA 5B7ZA 2QUNA 3AMDA 1GVOA 1N8FA 4TMCA 3PBUA 5D2XA 3WFZA 1UHVA 1KM6A 3QH2A 1TA3A 1W9VA 3WF3A 5DRIA 2PLKA 2BOEX 2GGGA 1ZCCA 2Z27A 3Q4DA 3VKAA 1H1NA 5G4EA 1AJ2A 4K8GA 4QRNA 3SADA 1QFEA 3TLLA 1EYEA 4PB4A 3ME3A 1KNWA 3LDVA 4UIOA 2RKXA 1CDGA 3MA8A 1RSCA 3SFWA 2QCEA 1AQHA 4M6VA 3PFRA 3P7YA 1NF7A 4ZO7A 1AW5A 5LIKX 3WH0A 5D2TA 5IHRA 4Q8OA 2BHYA 1XHGA 1ZZMA 3ABQA 2DZUA 1LLZA 4F2BA 2ADAA 3MV01 4KWOA 3GNDA 4CVWA 4V33A 1PKYA 3I7QA 3EDJA 3TYBA 3N29A 4KRTA 4RXFA 4J40A 3WMSA 2XIOA 4K37A 2ABAA 1A4LA 1V8EA 1FWSA 1IGSA 2QJGA 5D03A 1VJSA 1OADA 1VFFA 3D46A 3TC5A 4KQZA 4IFKA 2Q8ZA 3H4WA 5BXSA 1WZKA 3FLUA 1Q6FA 3N2OA 4DRQA 4C02B 4ODLA 2RUDA 3FSUA 1Y65A 3W7NA 1KGWA 4KRZA 4NZFA 4Y9PA 2A6LA 5C6MA 2EHHA 3OQEA 2D0HA 3R8RA 4UC5A 3PBWA 2DZWA 2PF8A 2BG5A 4LBUA 2OYLA 3PP7A 7TAAA 4Z2LA 5LNSA 3U2CA 3BG3A 3CPRA 4RZ4A 3LCGA 1XBVA 4LPCA 4ZQPA 3PBMA 3W1PA 2PLCA 3W1UA 3P8IA 3FJ4A 4PZVA 6ALDA 3BWWA 5KETA 1QHZA 3OLEA 3CQ0A 1GVIA 4PA8A 2QDDA 2HJPA 3N3TA 1OWQA 3PPHA 3W2NA 2YDAA 2EG7A 2C8NA 2Z6JA 3KP0A 4GA8A 1SFSA 4LJ3A 1CXFA 3W00A 3IIZA 4W5UA 5A95A 2WKJA 3V5CA 3RX4A 1R3TA 2WJEA 3CWNA 9XIMA 2E9LA 4GGQA 5FJRA 3VZZA 4AEFA 3G0UA 3SIZA 1WDSA 1JULA 3TW6A 3GDMA 4F66A 4DWSA 2HVNA 3K8KA 4XKMA 2VURA 3MI2A 1U1HA 4OQVA 4IFOA 3AS3A 3N25A 2WC3A 3GK0A 1JQVA 5CH9A 2J66A 2KO7A 1V7YA 2VO5A 1TTJA 1BTMA 3M47A 3M07A 4A8NA 2XVKA 4FAMA 3GZ3A 1GQNA 4Z2KA 4LY8A 1WO2A 3FYYA 4MAZA 2F2DA 3NPWA 3QV8A 1E9YB 2ZXAA 4PTVA 2DG3A 1W26A 3CTTA 4CCZA 1DWFM 4XBSA 1XI3A 3VNYA 3WBEA 4I9AA 3IUDA 1G4TA 4OFCA 3A13A 2BFGA 1HW6A 1QO5A 1XIDA 3WQCA 3EWCA 2HNHA 1OFEA 1JCMP 1Q6HA 1HGYA 2ONEA 2D20A 2G3NA 1W54A 1KM5A 4GI6A 2W4XA 4WDWA 1BQCA 2OT0A 2YSWA 1OZQA 1VBRA 5F2LA 2HISA 3E2VA 1BVWA 5BXTA 2A4AA 1VP5A 1OF6A 1I9CB 3UG3A 3AOFA 4JEJA 2LLEA 3LNPA 2V6AA 4QTGA 1K8YA 4YVXA 4MWAD 2OQHA 5EFFA 4FA3A 2Y8VA 4HA1A 4NHVA 2BODX 1XF0A 2I5GA 4HN8A 3W73A 2QAFA 4JL2A 1B0IA 1I0DA 1ODZA 4M80A 3P67A 1EF2A 5AFDA 3EA1A 4L1GA 1S1PA 2F23A 3Q37A 4J3SA 1PYFA 2QCDA 3PUGA 1X6UA 3DIPA 1GG1A 3W1RA 2DT0A 2ZTKA 1W1VA 2QCFA 1MEWA 4L56A 5B8IC 1ONXA 4O0ZA 3H7UA 2H6RA 3UQIA 1UCWA 3WX7A 3VIFA 1VFMA 4AD2A 4IGMA 2E9BA 4M81A 2VCBA 8TIMA 1TMHA 3HO8A 1GEQA 1JPIA 1K6WA 2YL8A 3RILA 3RF9A 1EIBA 2OZ0A 3K2GA 4Q4MA 3NO5A 2HEJA 4QEEA 4AIBA 2WMJA 1H50A 3AHVA 5LYRA 2WMIA 4U3CA 3MUY1 4URIA 4I8DA 4ITZA 1FDYA 2CESA 1FCUA 2EJAA 3G3MA 5CSYA 4B90A 2XFFA 4W9QA 3W87A 3P6LA 3GVGA 1KGXA 2DV0A 1CGVA 2PDPA 4B5NA 3CGTA 4XZLX 1XP3A 4BY3A 3B40A 2ZX8A 1NELA 1FHVA 3FHAA 2OLHA 1A5SA 3O15A 4D8AA 2C13A 3R0DA 4R7JA 1AODA 1SO3A 2OEKA 4ICCX 1QOPA 3U3HA 4O13A 5GVJA 5HULA 5IOBA 2ZRZA 3KRSA 1A49A 1SYTA 4ZO6A 4UQBA 2GVEA 3CEUA 3STFA 3H54A 1S46A 1C90A 4KWUA 1OC5A 1A5UA 3NL5A 3GDBA 2BOFX 3FN9A 1PHWA 4XX6A 1K1DA 1XLBA 2OYKA 4R34A 2NSOA 3BLPX 3G77A 1PVNA 2P8BA 3UY7A 5C9ZA 4OV9A 4YYFA 1KFEA 3GU2A 2WKLA 4HQVA 4FI4A 1TWWA 3WNLA 3CTLA 3K4AA 2ZRVA 1IR2A 4LAKA 4DBWA 3M4HA 3NQGA 2YFOA 4JN8A 1ZB5A 4U31A 1SFJA 3BW4A 4Y90A 5LNVA 1IWBA 5JIPA 5CZ0A 2PDKA 3WELA 2VGGA 2J7FA 1W9BM 2PWHA 4HA4A 2EKCA 2E68A 2BXZA 2V82A 1O1ZA 4JNYA 1K7XA 8A3HA 3HPZA 2XN0A 3LRLA 1RY0A 4AWEA 2NZLA 4GABA 2DSUA 1QI0A 2HRWA 1LCOA 3KAOA 2GL5A 2DSZA 2OVLA 1ZNNA 4C7FA 5JH2A 4L3NA 2YX0A 1KBKA 3TV8A 4K7VA 3CAQA 5DY3A 4NILA 3LSBA 1RCOB 1ZBWA 1M68A 4A8RA 4AVNA 3TN4A 1CX9A 1VFOA 4S38A 3OGRA 4QX4A 1BF6A 3IJ9A 3O6DA 3EBVA 3QOKA 1NWSA 3OODA 4KGJA 3RDKA 4EPKA 3DECA 3W7CA 2QUVA 4MNLA 2KZHA 2BVTA 1YE6A 3S2CA 4DYEA 3P3BA 3NSNA 3WQ4A 3AIWA 2EPMX 1X7IA 2CITA 4DX3A 4DF2A 1BVNP 3G0XA 1QW8A 6TAAA 1OBAA 3MWAA 4I5XA 4JIIX 5HUOA 3WKZA 2NT0A 1DTNA 4LQ1A 3KAIA 2PC4A 3E1F1 5ECUA 3RYSA 4DWSD 2INEA 3CL7A 4O54A 5M3WA 2ACRA 1JPHA 2ZOXA 2QHAA 4W8AA 3VX0A 4LC6A 5J6EA 3W7QA 4IGNA 3HTWA 3I4EA 4Y7EA 1TCMA 1QHOA 3UVAA 1N7KA 2AGKA 2QZRA 3SCNA 3CB8A 2GZXA 3W70A 3CZKA 1JAEA 4BF9A 5HWBA 3I68A 3LBCA 1KM0A 2GVJA 1J4HA 2R1MA 3S1XA 1VHNA 1ZJBA 1LG2A 2PTWA 4RV3A 5HR7A 4RZBA 3ZVHA 3VIMA 2WVUA 4WQ6A 5TQLA 3DFPA 5DBUA 4UOQA 2CHOA 2YCLB 2FH6A 1VCGA 1QI2A 4GPNA 3UQNA 1JZ6A 3GU1A 3VO0A 1OYCA 3EGJA 2PDGA 5A6LA 1AQMA 1D7KA 1A3WA 3E5BA 3MJMA 1F5ZA 4LY4A 3WZ0E 3MHFA 2ZVIA 1MW0A 4JCLA 4ZZ9A 5HPCA 1ZAIA 4INFA 4OIFA 4GZ7A 4JX6A 5HJYA 2A3LA 2SFPA 3O6AA 2V69A 3EWDA 4Q6XA 4TX0A 2BY1A 1C8VA 1YIXA 2QVHA 2V0TA 3N4EA 3NEVA 5AYBA 1WUEA 4DZAA 3B8IA 1KCZA 4N6FA 2J75A 3HOJA 4B5XA 1M7PA 5JBEA 1LZOA 4WXZA 5A6SA 4CD5A 2VCCA 1J6OA 1C29A 2B7OA 2P76A 3BARA 3TCSA 4C6BA 3QPYA 1E40A 1GT8A 5ABTA 2C1HA 4IIEA 3MMWA 1M5YA 3HN3A 2TMDA 2ZZ7A 4RZ6A 1Q66A 2ESCA 1AA1B 3M7SA 3TSBA 4B2DA 3GXNA 4IQ2A 1GQLA 3ZLGA 4HD5A 2PV2A 1OYAA 3AMGA 4A35A 3ZWTA 4NRRA 4AZ7A 4R0XA 1R46A 5A2BA 4WKHA 1QOXA 3GVVA 4I3GA 4L7ZA 3ABZA 4XVEA 2VYOA 3CYVA 1D3GA 1EWEA 1JR1A 1VPXA 5T9CE 3THAA 1YW1A 4O28A 4S3EA 1HIZA 2XH2A 1QXLA 1UH2A 2XGBA 4BK9A 3VAWA 2CYGA 1A7XA 1QRQA 4PN2A 4ZFCA 2OGJA 2PB1A 3DI1A 4TV5A 1U33A 1LQ0A 2VL4A 1KXTA 1PHQA 1XIJA 3WBXA 3FV9A 2FMNA 2PD9A 3EIPA 1KFCA 3VM5A 3R5EA 4C7GA 4C6MA 3QY6A 4NYYA 3KAFA 2QCLA 2QCNA 2Y5EA 3UXAA 3CPUA 1FH8A 4PBGA 5D09A 4WOZA 1RVGA 2X1IA 1FQ0A 1J9YA 4WCJA 2QJIA 2CZEA 3LS9A 4TUFA 3SO7A 1H7XA 1B9BA 4L4OA 2W0UA 2WMKA 3A9BA 3NQBA 3G1RA 1MW3A 4GQQA 2CBVA 2VP8A 4C6KA 4MB1A 2I56A 1JDAA 5DMYA 5KZEA 5BCAA 4JTAA 3W01A 3MW7A 2J7EA 1UZ1A 4A2RA 3PC0A 4QS5A 2PDWA 3S42A 1KKRA 2VR4A 1C92A 3BAYA 3VNDA 3SURA 2ABBA 1W1PA 1RBLA 3D3FA 1E51A 4R7OA 1SGJA 1DE5A 2A1YA 3TJXA 4HA0A 3EX2A 3T2PA 1TO3A 4LRSA 1CTNA 1UOZA 3EX1A 1AH4A 1KRBC 1EZ2A 1G0CA 3KP1A 2NXIA 3KTSA 3QFEA 1FWJC 1KTNA 1NP0A 1UP3A 3W1NA 2LKNA 3RCMA 4B5VA 4JTFA 2OXNA 3AIRA 2JEQA 5FD0A 3EYPA 4YU1A 1JPDX 4AZIA 4DRPA 3KOWA 4D6FA 2EPOA 2AWGA 3W75A 3NXFA 4LAVA 2BGQA 1BXBA 4B3KA 3TIMA 4P8XA 4XZWA 4QJ5B 3TLQA 4GO9A 5D8WA 6REQA 2PCEA 3NTYA 4WUIA 1TVPA 1W6TA 1GGOA 2M1IA 1WXZA 5DEZA 5IXEA 3WLOA 2QIIA 2E8YA 3AZSA 3QPEA 2V2HA 3BMXA 2PDLA 3FCPA 3GG1A 4WX2A 1FKRA 3C5QA 3ARXA 4IGHA 1E5NA 5CJNA 1R3RA 4AY8A 6XIMA 1O1HA 4M1RA 3VIIA 1NDWA 4L4PA 1A53A 1XBYA 2JKAA 1J18A 3TSMA 1W3HA 4Q4QA 5C2XA 6XIAA 1Q45A 1O4UA 1POKA 1NY1A 3T55A 5HR6A 1OY0A 4GKLA 4JTRA 3U6WA 5I2UA 4J4NA 3W23A 4UTMA 1ISXA 3SUUA 3HFYA 3N6QA 1SO5A 3TC7A 3VOHA 1MUMA 4GISA 1UA7A 3M0ZA 2VTFA 3BSGA 2FTYA 2VCDA 1O12A 1M1BA 1JF5A 1NDZA 1Y0EA 1BKSA 4W7WA 5BRPA 3RO8A 2P88A 3GFYA 5BXJA 2I9UA 1OK6A 3UGRA 1DXIA 1S5MA 3C52A 4MGGA 4QG9A 4LU0A 1ITQA 2TPSA 2J7HA 2ZKMX 1WBJA 1DVJA 3CO4A 2PGWA 1MWOA 1SQ7A 2V30A 4OV4A 3O63A 3WK0A 4E2DA 4Q22A 1YTDA 3TKFA 1HJVA 4D71A 4Z0JA 4GUJA 3NZRA 5HINA 4FO4A 3OLGA 2XVNA 4O0KA 1DORA 5A2CA 5A6MA 3VD5A 1JDCA 1V3MA 3N4FA 3PZOA 4XQ6A 2V81A 1VYRA 2BY2A 4JQ2A 4LH8A 3S2NA 2AAMA 4A21A 4XSMA 5EMMA 1GOKA 3TUUA 3MC5A 3IVTA 1TA3B 1DYSA 3QRHA 4EAMA 4OVXA 4E5TA 3WK3A 3IUHA 4IPXA 2EEXA 3EKGA 2XGZA 4Q6JA 4RK8A 4NAFB 3I10A 1D7HA 1MYRA 3RN6A 2FJKA 2FZNA 3A12A 3VKBA 3W7DA 1WAWA 2RH9A 1J0IA 1LBFA 4GXWA 2WC7A 1OINA 2E09A 3JUGA 1C93A 2XN1A 4H9ZA 1W3JA 4ZMGA 4LSBA 3R0UA 1FH9A 2ASHA 1PKMA 3VMNA 5CGMA 1JCNA 2G41A 4A3UA 4UZSA 4MB3A 1B2YA 1SJBA 4DBDA 4DIAA 3V16A 3SIMA 2X0SA 4DZ3A 5IRPA 4ALDA 1F9CA 1EP2A 3B7XA 4J3ZA 2Y5JA 5CJMA 4R9OA 3PY2A 2PPGA 2VEKA 7CGTA 1L8NA 1YNYA 1NEYA 3GAYA 1Z32X 2WXDM 3MCNA 4K2SA 3C2YA 3MMDA 4GVFA 4CU8A 1UR4A 4RX0A 3UR8A 1HL8A 1FKWA 4QNWA 1NMVA 3WUEA 2FFCA 2W63A 2PBCA 4PMJA 3IGSA 3A3XA 4Y9MA 2CLKA 3AHYA 1G7VA 1KCXA 4HPXA 2VWSA 1KM2A 1KFBA 4M8UA 1Z9AA 5BRBA 4ODQA 4P61A 2O56A 1W5PA 1GYMA 1VYSX 1XG3A 1UWIA 2PP0A 1AZ1A 2F21A 4RDYA 2F9RA 2A3CA 2ZRXA 5D32A 1FFQA 5LXEA 2C79A 3DDMA 2JBMA 2X16A 5E9XA 3RLGA 3LA4A 4EPEC 3O2LA 3CQJA 1E0WA 1L6GA 4NZJA 3K8LA 3M0IA 2EKGA 3ES8A 4CQAA 1XC6A 2Y8UA 3LNMA 1V3KA 3QYSA 1EHAA 5DX7A 1TJPA 4OBSA 4REQA 1QI3A 1CECA 4C5YA 1GYNA 1CPUA 4LVBA 3S2LA 1PSCA 1DJNA 4LFYA 1SZEA 3KM8A 4MFEA 4PCFA 2F6XA 2TYSA 4PTMA 1HKIA 1EH9A 2PN0A 4W8BA 2VR2A 3DFYA 3UR2A 3NQ8A 3GSMA 4EK7A 3LCWA 1TMLA 4LV9A 3MKVA 3P62A 2PURA 3I3BA 3V5FA 2R8WA 1FWHC 2OG9A 1U5HA 1KXHA 3CASA 1DIEA 1VBHA 2GOKA 3A9IA 1UWAA 3QOMA 2JALA 3CGMA 4H19A 4QT3A 3NWRA 3K1DA 5KTLA 3DCPA 5DIVA 4AVFA 2DFAA 1NH6A 4S2BA 1T0OA 3VDCA 2Y7FA 2I57A 4FLRA 2V5CA 1HQTA 1V0LA 1UPPA 4LS0A 1LRTA 2RURA 2GGEA 3MYOA 4PMZA 2BY3A 3P0XA 1JYWA 5DANA 4B5TA 5DCDA 4A8IA 1JXJA 5AN7A 1F3TA 1JRCA 2R1KA 1RA5A 2VENA 1J4EA 1PX8A 1TIMA 1R9XA 3RO6A 4GI8A 3HJEA 4N0RA 2QPSA 4M24A 1TB3A 2PTDA 1BWKA 1E43A 2FHFA 3ECQA 5D9PA 2NQJA 2QJJA 1MZRA 4JKKA 5HPOA 2O7SA 2RQSA 4H9YA 1M7XA 1E72M 1BYDA 4S3GA 4UTFA 4KEVA 4W9PA 1CGYA 5HMDA 3WMCA 4DB7A 5HANA 1CGUA 3OU8A 5BW6A 5FACA 2WZIA 1RP8A 4ZOAA 3N15A 1R9ZA 3C8NA 3PNUA 4N02A 3IJ6A 1K9EA 4UQEA 4LUSB 1TPWA 1ZAJA 3W07A 5HWJA 3CWOX 4XKYA 1E9IA 3F2CA 4L6OA 2Y0FA 3G18A 4PMOA 3UWVA 3L2MA 4JR5A 4LAXA 4MG4A 3PS7A 3DX5A 1CXKA 3VE7A 4L61A 4HCLA 1IZCA 1FKTA 1DBTA 1IHIA 4WIWA 1UP2A 3F03K 4N9DA 4QGCA 2WSPA 2ACUA 4IQDA 3MMUA 1FP8A 3W1LA 2X2GA 4PUEA 3THQA 5F1VA 1RALA 3KVMA 2LJ4A 1W91A 3NFUA 1TKKA 3E02A 3S5ZA 1FVPA 4JQ4A 3TOPA 2B7PA 1BL4A 3GQYA 2KFWA 3S83A 2A85A 1JEZA 2ZC1A 2NV1A 2PE4A 3UR5A 1YBQB 1LLOA 7TIMA 3T0CA 1EJ7L 1Z69A 3QGVA 3WCZA 2Z28A 4DBEA 1U1JA 2FGBA 3NSXA 4Q7NA 4EANA 4IMAA 2F7FA 4GVIA 6ENLA 3DBNA 2DQXA 4KGLA 3W84A 3MYPA 4GC4A 1Y7VA 1G67A 2PEVA 4R3UA 3QZAA 3DESA 3D6NA 7REQA 4LCRA 3S47A 3QQ1A 1X8FA 2IPJA 2ZUNA 1SFTA 2OX1A 4QIUA 3VK5A 3QHOA 2BHUA 5DELA 1XQKA 3QVQA 2DZTA 1VF8A 4M7SA 1LBMA 3CLWA 4WDUA 4LAYA 3QV6A 3IK8A 1L2QA 1LQAA 4RR4A 2E3ZA 1ADOA 3E96A 3ITXA 3QF0A 3TDBA 2DZXA 5AHEA 2WWCA 1RCXB 4IT4A 3VKJA 2QULA 3TR2A 3UQAA 2FZ9A 4Z1DA 2VX7A 4DUOA 3VILA 4QITA 3EKLA 1ZENA 5HNUA 1PWLA 3R94A 3QZEA 4J28A 3L2LA 4L5ZA 3I6RA 4DJEC 3DH7A 2YFNA 4F2UA 2MUCA 2OFJA 1UIOA 1BSLA 1XH2A 5GJMA 3MVTA 5JU6A 5H8PA 1T99A 1JL8A 4GNVA 4B3LA 1CXEA 3W1MA 3DAQA 3GXTA 5C8BB 4MF4A 2C71A 1LWJA 3PUEA 4L1XA 3HF3A 3W88A 3ITYA 3CT7A 1SU5A 1TTIA 4A4AA 2A21A 1OJXA 4D8LA 4KCUA 4UXDA 4CCDA 3KWXA 1TTQA 4MB4A 3VPLA 2RSEA 3LHZA 1OM0A 3ATZA 4OT7A 3WLPA 3EEZA 1X6NA 1D8WA 4GUHA 2VZTA 4B2DD 1UB3A 1OG0A 3P93A 3N2CA 1W3IA 2CCRA 1US3A 4ZL1A 2UBPC 1JZ8A 4E4PA 1FJDA 3EWUA 4TX9A 2WZHA 4GI4A 3KAGA 1I4NA 3LI0A 3GIQA 1XLAA 1PCWA 3KVLA 2RDTA 2PPOA 1G7UA 1ITCA 4M7TA 4A8LA 1L6WA 2XPBA 2GGJA 3ATYA 3EOUA 2PWGA 4PMYA 2C14A 1B3ZA 5GPRA 4PTXA 4IISA 4S1FA 3S46A 3FW6A 4NJHA 1UZDA 4PB5A 4ZB5A 1TJ0A 3FAPA 3D47A 4XBJA 3DGRA 3BLDA 3RIKA 4HSHA 3TYCA 4Z2JA 1TG7A 2FPYA 1VIWA 3KDOA 4FS9A 4QFUA 4W89A 4CNUA 1HT6A 3NGJA 5C2GA 5I00A 1OCQA 4I7VA 1KFJA 5EU9A 2FZDA 2PWVA 3SJNA 3CHFA 1JCTA 4FXRA 4EIVA 2YL9A 2YKKA 4CNTA 3N17A 2F8QA 3W86A 3N2BA 1PXGA 4QLLA 3SCTA 3BLLA 2R24A 1BFNA 5F2MA 4L9ZA 3IARA 3AMCA 3GS6A 1XGZA 1UWRA 2CLHA 3HGOA 3UG4A 4D6IA 4XAYA 4DRHA 4XZBA 4Q32A 2J8GA 3WQ8A 2J24A 3NDZA 1EC9A 4JFJA 4EX4A 2KI3A 1Z8AA 2BP1A 1Q3NA 1WZAA 1BEUA 4AD4A 4CLMA 5A6KA 2H8ZA 2ETNA 1BXNA 2XP8A 3VTRA 4UFKA 1EQCA 3LTYA 4KT2A 3UF9A 1SR0A 3VIJA 3IK2A 3ZLHA 1FKXA 3STPA 3IIOA 1I2OA 1EQ3A 1GOWA 3H55A 3PANA 5BU9A 4JNZA 5HAOA 2J25A 5CSUA 1U22A 3IKGA 1NU5A 4QP0A 1UKPA 2J79A 5LNRA 3B9NA 1XPGA 3WLTA 5AOUA 3XISA 1OCJA 4CN1A 1JCXA 2WZEA 1EC7A 3AYTA 3KZ7A 4ZO9A 1CWYA 4M51A 5C2CA 5JBFA 4JDYA 3GXDA 4F0MA 3BLIA 5AY7A 3TK7A 1A5LC 2WHMA 3FYOA 3SGGA 3K4WA 1QNSA 5CXPA 3PJTA 1LWIA 2HXTA 3EB4A 5DCBA 1J2BA 1W5QA 2YXGA 3QFWA 1U1UA 3R11A 1DHKA 5H8MA 4LVDA 3T0AA 1IQ8A 4QAWA 1XSIA 3HFTA 5KZMA 3CL6A 5DT7A 1TX0A 3FGCA 4AY7A 3L12A 3GNRA 3WLSA 4QJ3B 3FXYA 1TUFA 4F3HA 3AYVA 1TV3A 3S1WA 3C2RA 3GBEA 4HOXA 3KADA 3ARPA 2ZCGA 3SN4A 5CQ1A 2I1OA 2ZZ4A 1OD0A 3GM8A 4E4UA 3AROA 1MQQA 4LUIA 3OVGA 4JQ1A 2VNCA 4ZTXA 4O52A 1Q7MA 5C9UA 1NOFA 2Z00A 1PTAA 4X0NA 4KMQA 1RD5A 1V6UA 1O5RA 2A3AA 5FJOA 5KINA 3LPPA 4JEQA 3VD4A 2FQIA 3O6YX 3B3DA 4DAIA 2CZFA 3U8GA 4ZR8A 4UTTC 1JUBA 3M9YA 4M6UA 3RPDA 1QI4A 1V6XA 2O9RA 4DO6A 1WDRA 3JU2A 3WLRA 3N12A 4GZIA 1UWSA 3GFZA 3GR7A 2H90A 4G6CA 3TAOA 5DMMA 1HNYA 1DE6A 4ZXOA 1WBHA 3B8SA 3A4XA 4IP5A 3TJIA 3VZXA 5A6AA 1O5QA 2WMFA 5DCEA 5M5DA 2QPUA 2GGIA 1WZMA 2M08A 4DM2A 4RPPA 3VE9A 2E40A 1PINA 5E0CA 3CHDA 4NI3A 4DYJA 4ADTA 4C6NA 2V5LA 1V08A 1BLIA 4O8AA 2LPVA 4JTLA 2XIQA 4H00A 1HJQA 1NM9A 1W3KA 4JPGA 3A22A 2Y78A 4KWWA 2FVKA 5BROA 2IQTA 4DO7A 1XCXA 3HURA 3H2OA 3KOFA 2OJPA 3A3HA 1QW9A 3R79A 6A3HA 4GY0A 2Z25A 2WWDA 4S2CA 4HPJA 4IPJA 2BVDA 3V0SA 3LCHA 3WQ6A 2PODA 3KRZA 4ZQRA 3VD3A 3PF3A 2I16A 1V79A 3QR3A 4ATDA 3C4UA 4AHPA 3VD9A 3WEZA 1JZ2A 3WLJA 4BZYA 1CB2A 1A80A 1J5SA 3O0FA 1K77A 1UC4A 4LCQA 3I7SA 1ZGDA 3NO1A 4H9XA 5BZAA 4RXGA 3OZMA 2A6NA 4R85A 4U4MA 2ICSA 3WF0A 1NWUA 2BHZA 3ZLFA 3W6YA 3ZMRA 5AZ0A 1CGTA 2PDMA 1YNPA 3USZA 2J7GA 1G4PA 2P1FA 2Z6IA 3O7UA 2YLAA 3WF1A 4MOZA 2LGOA 3JZUA 4GQBA 5FJTA 4FIRA 4NJKA 3W25A 2Z1KA 4CN6A 3O5QA 3PZVA 5HKGA 4DELA 1BXCA 2W61A 4HCHA 5TF0A 3LCFA 5CC5A 4DY1A 5MKGB 4KIEA 2DW7A 1HL9A 2PTXA 3WUGA 3OIHA 4P7QA 1K7FA 3ANUA 5FEZA 5AC6A 5IFTA 3GW3A 4MAVA 4MNKA 3OP2A 1B3YA 2WVSA 5AHMA 5JH8A 2C19A 2QGYA 3VDHA 2HROA 1F3XA 1VD6A 3GBDA 1EJWC 2VGIA 3F2BA 5FA5A 1VFLA 1I2QA 2P53A 3C3NA 4IL0A 2HBXA 2YA2A 4KFOA 2VCAA 4F0SA 4ZFMA 3WQWA 3TTSA 4DNHA 3KABA 2E28A 4IIDA 1G69A 1LL4A 2YZ5A 4WF7A 2PRHA 3DKLA 3IGHX 3UWWA 4C6QA 4JFKA 4PB3A 3ZXWA 2Y4SA 2QYGA 2HE5A 2MANA 3CK5A 3HM7A 1MFUA 3KBWA 2QF8A 2POTA 3P84A 1FKFA 5ENLA 1YQ2A 2DW6A 4ADSA 3T05A 5BMWA 2WK2A 3PWAA 4WKAA 3NVTA 1XIIA 3WQGA 1ZUAX 3V18A 2A5HA 4AYGA 3PNZA 4O18A 4A3YA 3JW7A 4LYPA 3MSGA 5CJ5A 3CUHA 1V5XA 3V7PA 4IUOA 3BQ6A 3CMJA 4XUGA 3UZJA 3HGRA 1LUCB 5CEWA 1XXXA 3SQMA 3WK2A 3UXIA 4NYUA 3WDQA 4UNKA 2OCZA 2C91A 2IPFA 2VT0A 3DKJA 1CLVA 1BWVA 4FNPA 1UASA 2DGAA 1XLHA 4J1OA 4CNOA 1XQLA 5DO2A 3KLLA 2PF0A 4B4FA 2ZX5A 2RDWA 3KCLA 3ZIZA 2OELA 4HPHA 2Q09A 1UQZA 2R14A 4LBRA 1ZL1A 2EQDA 3BV4A 1RHCA 4HNTA 1MUWA 3RMEA 1ELSA 2Y63A 3BVJA 4TO8A 4JTEA 4W8LA 1Q6CA 4MVAA 1A5BA 2DUXA 3OA3A 1WDQA 3OBKA 2X0YA 3UXLA 4GINA 5IBXC 2ZICA 3W29A 2VDIA 3W2LA 4JFUA 3QYQA 2PPNA 1D3CA 3LM3A 3E5PA 3BSMA 2EAWA 3P74A 1P48A 1OB0A 5FEPA 2GWGA 2P50A 4NZ1A 1B3XA 2GJRA 2YCKX 1R38A 4V27A 4GIEA 3HQOA 1RQEA 3UZWA 3SGUA 2ODOA 4CQCA 4ERGA 3W4RA 2NUXA 3I6EA 4GUGA 3GXFA 3IRSA 1OX4B 3LXBA 3WJXA 3LSCA 3O05A 3MSYA 4IPIA 4C7DA 4WDTA 5A8OA 4ZGYA 3B0VC 2OQYA 3L65A 2PCQA 2R91A 1DJGA 1XLFA 1C9WA 2WMIB 4ROQA 3PB2A 4CQBA 3MB9A 3EY6A 4BR1A 2J7DA 5LIUX 3W76A 2FGZA 4FX8A 3C86A 4IP4A 4AY1A 2WCGA 5LIXX 1CZ1A 3LUTA 2HSAA 1LQ2A 2GFTA 4AHOA 3TJLA 2IS7A 5FJIA 2ATSA 3GH7A 1RQHA 4LBSA 1W1YA 2PZ0A 1LLWA 4IUGA 1J0YA 3B4UA 2QS8A 3B8DA 1PKNA 1E9LA 1GG0A 4MWAC 3HIJA 2V3GA 5HA7A 1MUCA 3H53A 3RPMA 4H9UA 1QNVA 3BCFA 3M43A 2DG9A 3CAWA 3UERA 4C6LA 4ODRA 1NSJA 1XGDA 3E0FA 4TX6A 5H6HA 2E6DA 3LEPA 6PTDA 1GEHA 2X1UA 3NG3A 1UPMB 2WOQA 3OVRA 4TOQA 2YCEA 2YXOA 3S5NA 1U5JA 3RCYA 1KV8A 1BGGA 3UG8A 3KX6A 1Q8JA 1ISWA 1OIMA 1J11A 4C6OA 5ECVA 3MUIA 4YCOA 1B4EA 4GYJA 3MO7A 2R82A 4O4WA 1N55A 4X60A 3W6MA 4F0LA 3B8WA 3TNBA 3GAKA 2CLPA 1WQ5A 1TRDA 3CIVA 3V0UA 3ITVA 4TIMA 3H2EA 4LEFA 4H9TA 4PMXA 5A6TC 3MKKA 4Y2WA 2VOMA 2QIWA 1TZZA 1WDDA 3B8TA 4Y9OA 3W6LA 4RL3A 4DZ2A 2R1LA 3GIPA 4G2DA 1QZ2A 2GUYA 4XO6A 5HK4A 1OZMA 3GTYX 2Z2AA 2J4GA 4GE8A 1V6YA 4KCVA 3R89A 5D30A 3VUSA 4XK2A 5CPLA 3RMJA 1RAKA 4QLJA 2Z26A 3L4WA 5ABFA 4BFAA 2C15A 1KQYA 2OQLA 2CC0A 3GE7A 3U57A 4Q33A 4NJGA 2J88A 3H2MA 1KLZA 4FK9A 1JGIA 4AVOA 3PRBA 3IJIA 2ISSA 4GYPA 3LU2A 3HA1A 3AWNA 4JYSA 1FKJA 3UEQA 3VX1A 4IIGA 3EPMA 4GZJA 1AH0A 2HPMA 5HJXA 1TV5A 3C2VA 1UG6A 3LQGA 3L4YA 1JAKA 3QBUA 4ZPTR 3KAHA 4HYWA 1GRJA 3LQLA 1CNVA 1W31A 3E9AA 3T0DA 2D0FA 4K1WA 5AZ1A 1J6YA