3AQUA

Crystal structure of a class v chitinase from arabidopsis thaliana
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
344
structure length
344
Chain Sequence
TVVKASYWFPASEFPVTDIDSSLFTHLFCAFADLNSQTNQVTVSSANQPKFSTFTQTVQRRNPSVKTLLSIGGGIADKTAYASMASNPTSRKSFIDSSIRVARSYGFHGLDLDWEYPSSATEMTNFGTLLREWRSAVVAEASSSGKPRLLLAAAVFYSNNYYSVLYPVSAVASSLDWVNLMAYDFYGPGWSRVTGPPAALFDPSNAGPSGDAGTRSWIQAGLPAKKAVLGFPYYGYAWRLTNANSHSYYAPTTGAAISPDGSIGYGQIRKFIVDNGATTVYNSTVVGDYCYAGTNWIGYDDNQSIVTKVRYAKQRGLLGYFSWHVGADDNSGLSRAASQAWDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords At4g19810
publication title A class V chitinase from Arabidopsis thaliana: gene responses, enzymatic properties, and crystallographic analysis
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 120
structure length 344
sequence length 344
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3aquA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3aquA01
5A95A 2A3HA 4KWUA 2EPKX 5A6LA 3L4ZA 2Q8XA 4W87A 3K8KA 2WKLA 3B9AA 2D0GA 2VCBA 1UR8A 4JHOA 3HU7A 4HA1A 2EBNA 5CSUA 4WKAA 1W3JA 4AZIA 1UA7A 4AIEA 3WF0A 4B9ZA 1VAHA 1JXKA 5I79A 4DWSA 1VBUA 3W27A 4PBGA 2E40A 2QPSA 1XSJA 3ZJ8A 1D2KA 3VD7A 4PUDA 4YN5A 1GJWA 1KXTA 3W24A 3VIIA 3I3DA 3N11A 5LA1A 3EBVA 3UG3A 1FP9A 1UWUA 2AMGA 1ZS2A 3IJ9A 1UWQA 3MMDA 2VC9A 2WBGA 3SIMA 1V6YA 3GYCA 4PUEA 4W8AA 3M6DA 3OG2A 4KMQA 5IDIA 3VOCA 4W8LA 3WDQA 3UCQA 2ZE0A 1D7FA 1MW1A 3BH4A 2VX4A 3WUFA 2G3NA 1JNDA 4UQCA 2ZX9A 1OCQA 3GNPA 2CYGA 1ZU8A 4KGJA 4CU7A 3OIHA 4UCFA 5A2BA 3SCRA 3AZSA 2VQUA 1EDQA 1CBGA 4M81A 2O9PA 4W7UA 4LGXA 2J79A 2YA2A 1LF1A 1OGSA 1BTCA 5AYIA 5KZ6A 4URIA 3BSHA 3WMSA 1Q6FA 3WFLA 2ZUSA 4JIEA 4HMDA 3POHA 5I77A 1J12A 3E1F1 4PMUA 2A3EA 3AFBA 3GH7A 3WH7A 3ZMRA 1I1WA 2GJXB 3N1AA 3OLGA 4D6IA 4NRRA 3AS3A 1NARA 1QVBA 3GXFA 1ISWA 2EPLX 4FK9A 3SUVA 1JZ4A 1TUXA 3GBDA 1U2YA 1UH2A 1UR1A 2ZWYA 5IHRA 2WVUA 2G8ZA 3DYMA 2EO7A 3RIKA 2ZXBA 3VIMA 1GOMA 3SCVA 2QMKA 2UY5A 1C8YA 1V3KA 1LJYA 1B2YA 4D6DA 4GZIA 5A6BA 4IPLA 1MXGA 4FF5A 1B3VA 3B9DA 2E3ZA 1PZ3A 4R27A 4F8XA 2FH8A 3AS1A 3AHVA 3AIWA 1UD5A 4OUEA 4PCSA 4X0VA 1Q6GA 1CXFA 3RPMA 4HOWA 3L4VA 4EAMA 2FDMA 5A8MA 3B9EA 1BYCA 4FLRA 3A4AA 5GNXA 2XIBA 2YDQA 5I0DA 3BCDA 1QHPA 1DWFM 5C8BB 4ZEPA 1HJVA 3D5HA 4UQBA 1HJSA 3SUUA 1V3HA 1KBBA 5I24A 1JIBA 5E6ZA 2VJXA 5DO8A 3BMVA 1UKQA 3CZLA 1QHOA 4HP5A 2D20A 3AXIA 4MB4A 2D1ZA 3K46A 4J3SA 1JZ7A 2J75A 1WZMA 1R8LA 1K9FA 4MNMA 1M04A 1ZBVA 3F5LA 1B9ZA 3IAPA 1GVIA 2HVMA 4DUWA 3WH8A 4A3YA 1UR4A 1VFMA 5FIPA 2BVYA 1JYWA 4WKHA 4UR9A 1WKYA 3MO4A 4DWSB 1K9DA 3CIVA 3BXWA 2CKRA 3GH4A 3TP4A 1E40A 1OT2A 3WMCA 4MTVA 3RM9A 1E4IA 3AMGA 5D9NA 1W3HA 5BCAA 3K4DA 1XH0A 3CHCA 2WLZA 4TXEA 1CGTA 2VT0A 4W5ZA 4PMRA 4GXPA 1H09A 1WO2A 1XYFA 4DM2A 1KXQA 2VVSA 4Z2LA 1CDGA 3VIHA 4BF7A 3A47A 1CNVA 1E6RA 3N12A 1UYQA 5E9AA 1NWRA 3UG5A 3KE0A 4D6CA 1W9DM 4AD0A 4U31A 7TAAA 4JZ5A 1H3GA 4HPHA 2VCAA 2BHYA 1VIWA 3RCNA 4NSBA 1PIGA 3AIRA 2FHBA 4JFVA 1QNOA 3EDEA 3UR8A 1KXVA 4CCCA 4J3WA 2Y8VA 2WHMA 4HOZA 3T2QA 5IHSA 2WWCA 3SCWA 1WNOA 3D3AA 1VEOA 1E73M 5A2AA 2V3FA 4ATDA 1GHSA 2MANA 1MQRA 4S3KA 1UWSA 3ZJ6A 3EMZA 1C3FA 1IZKA 3VIGA 4BZYA 1H1NA 3VPLA 1V3MA 4KGLA 1OINA 1JDDA 3VMPA 2WWDA 3UETA 2V5CA 2W61A 2D3LA 1RPKA 1W2VA 1CLXA 2J62A 5A8QA 3VX1A 3EDJA 3NSMA 3O9NA 3PTKA 4JHZA 2J7DA 1JFXA 4LX4A 2PF0A 5E09A 2J7EA 5C70A 4W85A 1JNEA 1KGWA 2YL9A 1QI5A 4D71A 1VB9A 1OD0A 5HDRA 5A1AA 1GVYA 3FAWA 3W81A 1W2PA 4CKQA 5ECUA 5EBAA 1KQZA 3ZM8A 3VIOA 2Y8KA 3W38A 1NWUA 2RGMA 3GXIA 4JL1A 1AQ0A 3NCOA 5JBDA 1SFSA 4DM1A 1V6UA 2CETA 4J3VA 1GONA 1CYGA 1R7OA 5BRQA 4U2ZA 3WNLA 4EKJA 1KB3A 1QOXA 3W53A 2Y2WA 4PMVA 1V08A 1H11A 2QPUA 1TE1A 1V3IA 4AW7A 1CEOA 1GOWA 3L4XA 1H0GA 3MUZ1 1E43A 2YIHA 2J7CA 5E70A 3LPGA 3MUAA 1C92A 2WHJA 3NJ3A 2WVSA 2WMGA 3W26A 5CPQA 1J0KA 1E0WA 1EQCA 1EOMA 1W9XA 1W1TA 2WYSA 1FHDA 2XWEA 1LG1A 3ZSSA 4LPCA 3UR7A 5DFAA 3VX0A 4CUCA 1HJWA 2WMJA 1CECA 3OLIA 3EDDA 4HOXA 2GJRA 1JF5A 3MS8A 2VR4A 1KQYA 3WH5A 3WBEA 3SCSA 1SMDA 1UQYA 3TTYA 3AROA 4MJ4A 1BF2A 3VO0A 2X0HA 1E72M 4JCLA 4B9YA 4TX8A 1CTNA 1WE5A 5BWFA 3APGA 1AMYA 4JKLA 3ECQA 1VRXA 1JG9A 4HMEA 4OOUA 1NH6A 4U2YA 2XFYA 3VIPA 3PTMA 4PCTA 3RO8A 1QW8A 1HNYA 1UZ1A 3A3HA 1JZ2A 4M56A 4AD1A 4M8UA 2OSYA 2XTKA 3W6MA 2O9TA 3RJXA 4PMZA 4LQ1A 2XSBA 1OM0A 3KWXA 2WZEA 2F2HA 2V3DA 2W67A 3VDBA 5CZKA 3T08A 5A6KA 3L2MA 5HPOA 4WLCA 1B3YA 2WSPA 5BYWA 1E3XA 1Z32X 4OOZA 3AQUA 1CXHA 3NIYA 1OBAA 2CBUA 3BAIA 3ZR6A 2XFRA 3T0AA 4E8CA 1J0IA 5JUVA 5M17A 2J7GA 6CGTA 2J78A 5GPRA 1E5JA 3OBAA 4CD5A 1US3A 1HKJA 1ODZA 2DPEA 1VJZA 1CGUA 2A3AA 4B3KA 7A3HA 1VFOA 4MJ2A 3CLWA 1E6SM 5I2UA 1W3KA 2XM2A 3J7HA 2RGLA 5LA2A 4HZ8A 3AOFA 1GJUA 4QLJA 1UWIA 3A4WA 4AEFA 3AHZA 4KRUA 5JBFA 3VNZA 3N17A 4UFKA 2JFEX 1X6NA 4AZ7A 2ZOXA 5E0FA 2PBOA 3PZTA 2WZHA 1EA9C 4N42A 1NWTA 1PZ2A 1GHRA 4PMNA 1M03A 4UOJA 3PZIA 3GXMA 2XPKA 1CXEA 2WBKA 1B1YA 3DYOA 4CN1A 2DSVA 2OYLA 5D4YA 5JIPA 5A8OA 1JXJA 1VBRA 5CPSA 3PN8A 1MQPA 5BROA 2VOTA 5GNYA 1FFRA 4U3CA 1O7AA 3MMUA 3WMBA 1H41A 1DP0A 1CENA 2HISA 2ZUVA 5I23A 2WVVB 3FHQA 4GIAA 3WNOA 3EMCA 4RL3A 1PPIA 1CPUA 4MB5A 4TVCA 3N13A 5JH8A 3F5KA 1XSIA 1CXIA 3VTRA 3EYPA 3VKKA 3BSGA 1XCWA 3ARZA 4B15A 4U5IA 3CZGA 1X1NA 3PBGA 1UD4A 3WSUA 4AZ5A 5CJ5A 2EPMX 1W9VA 1OIFA 3UESA 2VNCA 2CPUA 4AZBA 1SR0A 3W4RA 1E56A 2OYMA 3DECA 4M1RA 5A6JA 1DWIM 3SCPA 2TAAA 3SUWA 1WCGA 3BMWA 1QPKA 3JUGA 1I75A 2ZX8A 4GZEA 3TTQA 2GK1A 3PZOA 3IANA 3AICA 4V27A 3U5YA 2EPOA 2VO5A 2WW5A 3T0BA 2ZUWA 2W91A 3MV01 4NF7A 3HMCA 2YKKA 1PX8A 3ZIZA 1VEPA 1GPFA 1TMQA 3NDYA 3QHNA 2G3JA 3WF2A 1QBBA 3IJ8A 2CXGA 1V02E 2B31A 3F4VA 2VRKA 5CSYA 2J74A 3VIJA 1SYTA 3QOMA 3ALFA 1WDQA 2WB5A 3HJEA 4GO8A 3VM7A 4D6EA 2EQDA 4JFUA 1UKOA 1NP0A 1EH9A 2PBGA 3PZUA 1HVQA 1JI1A 3OZPA 1UD8A 3LPFA 2V38A 4X0NA 1G94A 3KZSA 1NOUA 2EEXA 2XFFA 1JYXA 1GORA 2BHZA 1FH7A 3M46A 2CKSA 1V0KA 1GW1A 3FY1A 1JDAA 1AVAA 2PB1A 4ZXOA 1E6QM 2D24A 4BQ3A 2EJ1A 4HA3A 1P6WA 1QI0A 4U5KA 2VI0A 4J27A 2DSWA 3VM5A 2GDUA 2YDSA 3VDCA 4X9YA 1PX3A 4AD2A 1J0JA 4PMYA 1V6XA 4D72A 4BS0A 3NSNA 4P8VA 4GI9A 5ABFB 3CUHA 3EDKA 1WDPA 2WC4A 1E4MM 2WSKA 1MXDA 4PSPA 1JD9A 1QI2A 3ARWA 2YL8A 3W28A 4J3XA 2J7HA 3PHAA 1EGZA 1WZAA 3CMGA 2V5DA 3UERA 1TFVA 1AQHA 1HJXA 4L4OA 3VD5A 4ACZA 1J0YA 4HTYA 2J4GA 1EOKA 1JD7A 2XVPA 3CTTA 1BVZA 3BAYA 3AIVA 4WK9A 3VNYA 4CD8A 3VD4A 1XD0A 1PX4A 3OGSA 2WM0A 5E0CA 3WEMA 4TOQA 3QR3A 5BXSA 2WVTA 4MB3A 3K8LA 3AMDA 4NRSA 3AZTA 2D23A 1QI3A 3QHOA 4TTUA 1E5NA 1E0VA 2XWDA 3K8MA 2VCCA 4IPNB 2X8RA 1RP8A 4UTFA 4DWSD 3CHDA 4QP0A 1JGIA 3POCA 5A69A 5FKYA 3WBAA 4MNJA 1MVYA 1JDCA 2AAAA 2YA0A 1NOWA 2CNCA 5D9MA 2ESCA 4DWSC 3PZGA 1ZBKA 1HJUA 5DMYA 2JIEA 5A8PA 4UQ9A 2XSAA 2NT0A 2W66A 2DH2A 3K1DA 3L2LA 4AZHA 4Z2JA 2NW0A 3RM8A 2WK2A 1ESWA 1DWGM 1XH1A 3NDZA 2J7FA 1LL4A 1TA3A 3ALGA 3A4XA 4JKKA 2QHAA 1DHKA 1J9YA 4CGTA 1HT6A 1UD3A 5C71A 1F4AA 4P8WA 1ECEA 3A6OA 4D1JA 2VZSA 3WD0A 4CU6A 1XD1A 2A3CA 1XGZA 1GQIA 1JL8A 4LYQA 2DDXA 5EMYA 1SMAA 1CGWA 1W9BM 1E15A 4UQAA 1EO7A 3MU7A 4PSRA 1E70M 2YBTA 2BVTA 1J11A 1M53A 4UFMA 1BYAA 1UQZA 2WCAA 2XUCA 2G3IA 5ABEA 3OZOA 4Q22A 2W63A 2XHYA 4FLSA 3UEQA 3T09A 1JYNA 2PWGA 3QHMA 2WCGA 3G6MA 3NSXA 3WL1A 1B30A 5FL0A 1TCMA 1B31A 1UZ4A 1WDRA 1L8NA 9CGTA 3AISA 3FNDA 2ZX7A 1UR2A 1V0LA 3PZVA 2EXOA 4D6FA 3BGAA 4UOQA 4UZUA 1J18A 3WUBA 4HMCA 2ZUNA 4AC1X 1UKPA 2BFGA 1TG7A 4OZOA 4PTVA 5A6BD 2WAGA 1E6PA 3LMYA 3T2OA 4L4PA 1H0IA 4MADA 4D1IA 2PWEA 2E4TA 3AHYA 4K68A 1J01A 1WZLA 2YLAA 1BSIA 5DEZA 3N18A 1ZJBA 4GQQA 2DSZA 2UY3A 4WKFA 1CGVA 1Q6DA 1H2JA 3CUGA 3PZMA 3W25A 3L4WA 2D0FA 2VZOA 1XRVA 2O92A 3DYPA 1HN1A 3GDBA 1KWGA 3NYDA 4D6JA 1V6WA 1ISVA 4XB3A 2JF7A 1A47A 1I1XA 4HPGA 1EHAA 4CCEA 4AD4A 1E6XM 2VX6A 1IV8A 4KH2A 2VX7A 4ACZB 3DHPA 3OB8A 2Y24A 3CZEA 4W93A 2OSWA 2JALA 5I6SA 1OWQA 4F79A 4TUFA 4HU8A 1JAEA 1J0HA 4PMXA 4AIUA 1E3ZA 1OT1A 1RD6A 5DF0A 3VGEA 3CZ8A 2BXZA 6A3HA 4ZENA 2W92A 3VD3A 3AIEA 3AHTA 5FL1A 5A6MA 3SCQA 1ISYA 1DEDA 2VMFA 1R86A 2VRJA 2CBIA 3VGHA 3ZOAA 2XJ7A 2JIWA 1LWHA 3WN6A 2FH6A 1ITXA 3ZSTA 1E71M 5M3WA 1DWAM 4NZCA 4E2OA 1V3LA 1UKSA 5IFTA 5HNNA 1E55A 2VUYA 3VINA 5D9PA 3FHAA 5A6SA 3WQ4A 3AMKA 1B90A 2UY4A 2BHUA 4CCDA 2CBJA 4H8VA 1BQCA 1MYRA 1A3HA 3WL0A 3LPPA 1CGYA 1GOIA 2WPGA 3CZJA 4MNLA 4M82A 2WC7A 2CIPA 4WSJA 5CLWA 2G41A 1WDSA 2J8FA 1C90A 3VGDA 4A3HA 3W29A 3W82A 1GZJA 2J77A 4AZGA 1OD8A 1X6LA 3WUGA 2DT0A 3AJ7A 3ZR5A 3ZT7A 3QOKA 4QLKA 2YDRA 4QDMA 4F9DA 4JFWA 4YPJA 1J0ZA 1KR0A 4P8UA 4ZFMA 4A4AA 1CIUA 4DUXA 3VILA 3GXDA 3AHXA 3WQ8A 1VENA 4EANA 2J7BA 1ZB5A 2BY3A 1W9UA 4B3LA 3TTOA 4R5EA 1G1YA 2X05A 2GUYA 5AYBA 5CG0A 4AZ6A 4BA0A 1EHNA 1H4PA 1FA2A 3VU2A 4QCEA 3U5UA 1HJQA 4AD3A 3T2PA 1BG4A 4JL2A 4AZCA 1JZ5A 2Y5EA 3BAWA 1KR1A 1UHVA 3WDPP 1GQJA 5DT5A 2F8QA 2ZUUA 3W6LA 4QCFA 4ATLA 2DH3A 4BQ2A 2VRQA 4H8UA 4P8XA 5AC4A 4N0RA 3IAQA 3SCOA 2VR5A 1R7AA 4EE9A 2J8GA 4MDOA 4TTGA 3G6LA 2V3EA 4Q7NA 5F7UA 3GNRA 1JF6A 4AY1A 2D0HA 4UFHA 2NT1A 1W32A 1V0NA 3WDJA 3VGBA 3CBWA 4PEEA 5AY7A 1WB0A 4Z2IA 1GCYA 1E1FA 2JEPA 1GQKA 3EMQA 4XV0A 3U7VA 3AS2A 4P7RA 5ABHA 1YHTA 3VGFA 4BQ4A 1UR9A 3MUY1 4JFTA 4S3JA 1BFNA 2ZWZA 2E0PA 4RE4A 8CGTA 4D6GA 3SEPA 2DQXA 4KRTA 3WQWA 1G01A 4P7LA 2AOSA 4GPNA 4J7RA 2IXVA 3TTSA 4AD5A 1BLIA 4OBSA 4YHGA 1K6AA 3VMNA 5HOSA 2PI6A 1JZ6A 1B3XA 4EK7A 1LL7A 4PMQA 1BYDA 1BGGA 3N9KA 1NP2A 3BCFA 3WKZA 1RP9A 1TZ7A 1BPLB 3TA9A 1MFUA 4ZXLA 4W5UA 1LWJA 3OLEA 4D6HA 3AZRA 2VVNA 2FGZA 4P7OA 3T0DA 1QBAA 4FLQA 5FD0A 4IM4A 4LXFA 1S46A 4PTXA 4Y7EA 4CVUA 4W7WA 1QI4A 1JI2A 2VTFA 4J3UA 3UG4A 3WDRA 3VDHA 2CERA 1EIBA 4CD4A 1KGXA 3WUEA 4HA4A 1UR0A 1O6IA 2YOCA 1GOQA 3WQ6A 1FP8A 3F5JA 2DSUA 4WSKA 3ZT6A 1KXHA 1Q6CA 4UQEA 3QGVA 1LG2A 3AMLA 1BAGA 4JCMA 1TVNA 1W91A 3OGVA 4V28A 3SCUA 3VMOA 2Y4SA 1CGXA 2E8ZA 4GO9A 4CD6A 4JKMA 1VEMA 1OGBA 3MV11 4H7VA 5D8WA 1HP5A 4GKLA 2BY2A 4UFIA 3AXHA 3AYSA 2Z1SA 4C7GA 4P7QA 3CHFA 3I3BA 3MSDA 1KCLA 2WZIA 5FOOA 3BAJA 3I3EA 4AXNA 3MUIA 1MFVA 3VIFA 3S2CA 2WKGA 3CO4A 1C7SA 2ZICA 1M01A 4PMDA 3CHEA 3AIQA 4W88A 1Q4NX 4XX6A 4DUVA 3ARXA 5HBFA 2VZUA 3DHUA 2X0YA 5CGMA 1GNXA 5GQBA 1KCKA 5BXRA 2CITA 4OKDA 4ZE5A 2CCRA 3GZAA 4AMCA 4GI8A 2IXUA 3SCTA 3WF1A 5D8ZA 2VX5A 4BCEA 4AZCB 1NOFA 1BGAA 1E6ZA 3WNKA 1BG9A 3FW6A 4MDPA 2WLYA 2C7FA 1UOKA 1ODUA 4AWEA 2XVLA 1ISXA 4W86A 1LL6A 1XCXA 2DSKA 5E6YA 1EQPA 2QF8A 4Z2GA 3VDAA 1CZ1A 3WELA 4GINA 1MQQA 3BC9A 1DTUA 5ABGA 2OWWA 1HIZA 3AYRA 1ZL1A 1KWKA 1LQ0A 1ITCA 2C0HA 1VFUA 1G5AA 3BAKA 3WIJA 5CGTA 5CQ1A 3PZNA 4UFJA 5BXPA 2VZTA 3ZJKA 3BAXA 2D3NA 3ARVA 3SCNA 4MAVA 2V3GA 4ML4A 1JYVA 1DWHM 1H5VA 5IXEA 3BLPX 2XVKA 1GOKA 1B3ZA 2OWXA 3CGTA 4XZWA 2OLHA 2GDVA 2DEPA 1HVXA 4HZ6A 3WEZA 2CBVA 1D3CA 2X09A 4MNKA 2GFTA 4RE2A 5LYRA 1LLOA 2WMKA 2WMIA 2E8YA 1C8QA 1WPCA 2JEQA 3WNPA 4F66A 2WMFA 2EPNA 2ZXDA 3CPUA 1UWTA 1EXPA 4PRWA 2QV4A 1XV8A 5M5DA 1B0IA 5GNZA 4C7DA 1OB0A 2XGIA 4PN2A 1ISZA 4B16A 3MKKA 4WF7A 3WDHA 3PZ9A 1HKKA 1R87A 3WD1A 4PTWA 5KEZA 3SUTA 3GH5A 3OLDA 2WHKA 2DT3A 2GSJA 5FCZA 1TR1A 1UH3A 2VQTA 2PWDA 2BS9A 3ARUA 1E1EA 1KGUA 2GVYA 2WC3A 1PBGA 3ZO9A 2YBUA 4QFUA 2YJQA 4H8HA 2JE8A 1E9LA 1PAMA 3GNOA 3WEOA 1ZBWA 3WQVA 1JZ3A 1TVPA 2PWFA 4LYRA 1J10A 3OGRA 4ATWA 1GQLA 2ZIDA 4AISA 4H2CA 2YL6A 4J3TA 4Z2KA 2GK1B 1NM9A 2BY1A 2OSXA 4MPKA 4M80A 4U3AA 2WMHA 5JIWA 5TD4A 1VFFA 4AIOA 1XC6A 1XH2A 4HZ7A 2OYKA 4CD7A 3WH6A 3O6AA 2X2YA 1CWYA 4LYPA 2O9OA 1W9PA 1IZJA 2ZUTA 3AS0A 1V02A 3CZKA 2J47A 4W7VA 1EDGA 2XM1A 1C7TA 3WNMA 1QHZA 2VURA 1EDTA 1UD6A 1HKIA 1FH8A 2QLYA 4UFLA 4UOZA 1HKMA 3FAXA 4GQRA 1KBKA 1UWRA 4QLLA 4TX6A 2D22A 2ZX6A 4CU8A 1FFQA 2C8NA 1Q6EA 2XVGA 1V3JA 3MSGA 1L0PA 5EB8A 1U30A 1E6NA 1DWJM 3LPOA 3VUPA 1HL9A 2FGLA 2ZUMA 2G3MA 4TVUA 2BNJA 3CMJA 1ZBCA 3AIUA 3RJYA 5A6AA 5I78A 2UY2A 3WFZA 4GZJA 4PTMA 3IK2A 2G4FA 3U7BA 3ARYA 4YHEA 1WP6A 5A2CA 1NQ6A 3B8SA 3RDKA 3L4TA 6TAAA 1HF6A 2A3BA 4ZE4A 2O9RA 1W3LA 3BLKA 1QW9A 2DGAA 4E8DA 5LA0A 4W8BA 3WDIA 3KL0A 1C91A 2IUZA 3K4AA 3WF3A 1B3WA 1UH4A 2GJPA 2WVVA 2BXYA 3WF4A 4M29A 3GBEA 3GTNA 4W84A 1XHGA 3KL5A 1GUVA 1G0CA 1N82A 1E4LA 5HPCA 2W62A 3ARSA 2W5FA 4XUYA 3AMCA 1FOBA 1V0MA 1XSKA 4FLOA 3ZT5A 3TONA 3ZQ9A 4IISA 1HP4A 1IT0A 2XYLA 5BRPA 2BVDA 2DIEA 4U33A 1GOOA 7CGTA 3MANA 2XG9A 1V6VA 1K9EA 5EFDA 5I3DA 4UQDA 2E9BA 2XGBA 3AIBA 2F61A 1G9HA 2WMIB 3ARTA 8A3HA 3ARRA 1JAKA 1QNQA 4JAWA 3EDFA 4H04A 1RH9A 1JZ8A 2CESA 3RMEA 2WCSA 3HN3A 4FMVA 1QNSA 2OWCA 5M03A 2YLLA 2WANA 2ZXAA 3KEHA 2DT1A 1PEZA 4TVDA 4CN4A 4MAZA 5JBEA 2D2OA 3THCA 2FHFA 1VF8A 4UNIA 1W1YA 4AYSA 2WXDM 4OBRA 1PIFA 1OIMA 1PJ9A 1TA3B 2VL4A 3WH9A 3KL3A 1BYBA 4P7NA 2YA1A 1ZJAA 1UG6A 2J25A 1QNPA 4J28A 4UZSA 4WIWA 2DT2A 1MWOA 3W0KA 1BHGA 3CUFA 1M7XA 1MW3A 1Y7VA 4WJXA 1MW2A 4IUGA 3M7SA 1XYZA 3SURA 4MB1A 1VJSA 3WD4A 3PZQA 4AEEA 5CPTA 4RE3A 1HXJA 1WZKA 3WY1A 3AXXA 3WENA 1CXKA 4E4PA 1HL8A 2ZXQA 2WHLA 3CUIA 2YL5A 3ARPA 1US2A 3CUJA 2FHCA 3FN9A 4HU0A 5A3HA 1F4HA 3OA5A 5AC5A 2GJXA 4GI6A 5BXTA 3VD9A 1BVNP 5IFPA 1UKTA 1CLVA 2X1IA 1WAWA 4BQ5A 5D9OA 3WD3A 1U33A 2BY0A 3WQ5A 4XZBA 4H41A 1R85A 2DIJA 1H49A 4CN6A 3MMWA 1OSEA 3W37A 1UA3A 3U57A 3GM8A 5ABFA 1EO5A 1V03A 5A8NA 4C7FA 4Z2HA 2BV9A 3SUSA 5I5RA 2JF6A 4W89A 1KFWA 1NWSA 1CXLA 1K9TA 1MW0A 4M24A 3ZJ7A 3VGGA 4NI3A 3RILA 4V2XA 3RM4A 3O2LA 1OGGA 3CH9A 3DC0A 3L4UA 2NSXA 1UD2A 2UWFA 1W1PA 2E9LA 3ARQA 3WD2A 4ACYA 5A94A 2PC8A 1YQ2A 3VIKA 3NUKA 2WNWA 3L4YA 1QNRA 4F9JA 4PYSA 3PTQA 1C93A 5EFFA 4JFSA 3S6TA 3TOPA 2PWHA 2Z1KA 2ZX5A 3II1A 1JFHA 3WNNA 1E0XA 1FHLA 2QMJA 3IJ7A 2CHOA 2W4XA 1UUQA 1HX0A 5HXMA 4PMOA 2CHNA 4OJYA 1E4NA 5CLTA 3AI0A 4OIFA 1AQMA 1W1VA 4QAWA 4CVWA 1C8XA 5CXPA 2CEQA 2XVNA 1FH9A 5DT7A 3N04A 2VZVA 3FXYA 3N15A 3M07A 3VVGA 2E9MA 3THDA 2XIIA
chains in the Genus database with same CATH superfamily
5FF0A 1G7UA 3M47A 2REQA 2ZR5A 2PBCA 3DG3A 3L4ZA 1W17A 2Q8XA 5HNTA 3U0HA 4G6CA 1OX4B 1KKRA 2D0GA 1FWSA 2YR1A 4ODKA 4JHOA 5PTDA 4PUWA 2EBNA 4TMCA 4ECLA 1WDWA 3P7YA 2ZQTA 4AZIA 3FGCB 4AIEA 1J5SA 3N19B 4DYKA 3WF0A 4B9ZA 1H1ZA 3ITYA 4L9YA 1JXKA 4IGSA 3FFSA 3ZXWA 1DTNA 1VBHA 2Y89A 3GHRA 2E40A 3T40A 1YYAA 1XSJA 2XH0A 1C9WA 4QT3A 3GU2A 7PTDA 4ZPWR 1I6NA 4YN5A 3W24A 3BOFA 1JUKA 3N11A 4RZBA 3GVQA 4C5YA 1FP9A 3VC6A 2AMGA 3G1RA 3KOXA 1UP0A 1ICPA 2VC9A 4DF0A 1NTHA 1QXLA 2AQOA 3OG2A 3T6CA 4MLJA 4GRSA 3VOCA 3L9CA 4CQCA 2X1SA 3CV2A 3UCQA 2FAPA 1MW1A 2QW5A 1YXYA 3M41A 1JNDA 3LENA 3PULA 4CNUA 4WDUA 3BVJA 3Q67A 3T07A 1LP6A 1IWBA 2FFIA 4UQCA 4KGJA 3B4YA 3V0SA 3W1MA 4NZJA 4KEMA 3BOXA 4JIPA 2B7NA 4M81A 2O9PA 4LGXA 3BQ5A 1I0DA 2YA2A 1XUUA 3LYEA 5KZ6A 4EPBC 1XP3A 4Z08A 1ML1A 4JIEA 4C6MA 1V93A 1TV3A 3E1F1 1XISA 2A3EA 2YYTA 1JCTA 2TMDA 3WH7A 4L72B 4HBEA 3C2YA 1QVBA 3GXFA 3ANYA 2EPLX 4BKNA 3SUVA 1JZ4A 1TUXA 1UR1A 3QXBA 2WVUA 1THFD 1K8ZA 3RIKA 3VIMA 3LTYA 5F1VA 4NG3A 1P5QA 3W2LA 4B2DA 1C8YA 4WJ8A 1B2YA 4ZR8A 4GZIA 5A6BA 4IPLA 4FX6M 3BK0A 5CC5A 1XLCA 3EXTA 3JU2A 1QO2A 3KLLA 3LV5A 1QWKA 2PRMA 1REQA 4IPIA 4OUEA 3QR0A 4FX8A 1CXFA 3RPMA 4HOWA 3LCFA 1T8XA 1VP5A 5HWNA 1BYCA 3LHYA 4FLRA 2E28A 4NQ1A 1TWIA 2HVNA 1PYFA 3LLXA 2YDQA 4KERA 4DH0A 3KBJA 1QHPA 1W5NA 4ZEPA 3UFYA 4AVOA 2J13A 3W07A 7REQB 2ZADA 3SUUA 1EZ2A 3F2DA 3VZZA 3NZGA 3ENLA 4O1EA 3UYCA 5DO8A 1QOPA 4AHQA 3D3FA 3QZEA 2DFAA 2D20A 1WXZA 4O8RA 2PU0A 3BL3A 4JHMA 2PDCA 1K9FA 1M04A 1ZBVA 4M7TA 3F5LA 1GVIA 2HVMA 3LUOA 3GRIA 2XP3A 2DUAA 5K7JA 3H12A 3UG8A 3IEBA 4Q32A 2A7RA 5HINA 4H9YA 1S2TA 3MDUA 2C15A 2OQYA 2PDLA 1W3HA 4LAMA 1BXNA 3AAMA 3NZPA 3NL2A 1W3TA 2BOGX 4YTUA 2GUUA 1J93A 2E1DA 4GXPA 4GYKA 2IKHA 1WO2A 4HK6A 1KXQA 1JGMA 4Z2LA 3VIHA 1QPLA 3A5FA 4JX5A 2XP9A 3A47A 1CNVA 5GPGA 1Z48A 3L65A 4RPQA 5ABTA 4YYFA 1SSGA 3BTNA 3DKJA 3PPHA 1VIWA 2Y7DA 4KF1A 3C4UA 2MNTA 1R3YA 3GIQA 1V4YA 3H4XA 3EDEA 2RJHA 1KXVA 4H9VA 4CCCA 4M1BA 2NVCA 3DKLA 3N4FA 4P61A 5IHSA 3GFXA 1ZRQA 1S1RA 1VEOA 4JXCA 4R53A 3EMZA 2GGHA 1C3FA 3EWBX 3M0HA 3VPLA 5BWAA 1V3MA 3MSRA 1OINA 1JDDA 3CB8A 2J6VA 3V0TA 3G0XA 1Z7AA 2J62A 4PB3A 3W1XA 3EDJA 3CV7A 4L9ZA 1ZLPA 3O9NA 4YL2A 4HKPA 5CPMA 3NL6A 2PF0A 1K8CA 2YL9A 2R24A 2EPHA 4D71A 1VB9A 4O1BA 1VYSX 3ZLGA 4LAKA 2O7QA 3W81A 4CKQA 5EBAA 4O0ZA 2CWNA 4JQ4A 3VIOA 4A2SA 4YXGA 3GR7A 2Y8KA 5FSDC 2V5LA 3RX2A 1NWUA 1MEWA 3B4UA 4XZ9A 1AQ0A 4A3UA 3GS6A 1DJYA 3GIPA 2OB3A 2WKJA 1ZENA 3WNLA 3APTA 2RUSA 1V08A 1H11A 2QPUA 3IJ6A 4A2RA 3DUGA 5FJIA 2IPGA 3MUZ1 3KVJA 3P82A 5E70A 1KNWA 4BEQA 5G2HA 1SQ7A 1ZFJA 1NFPA 4OTKA 1EQCA 1S39A 1EOMA 1BVWA 1W1TA 2WYSA 5BU6A 2XWEA 3EY6A 2XP6A 3M0YA 5TIMA 3C2FA 4IMEA 5DFAA 1HJWA 1EJSC 1X7FA 3KBVA 1KM5A 1M65A 1TV8A 3R11A 3BLLA 3LCHA 3UU0A 3EX2A 1UQYA 3BG9A 2B5UB 2QUNA 2BSLA 3HM7A 3T1GA 4FZIA 4MJ4A 1Q5MA 3N2XA 3NTYA 3TOYA 5BWFA 1C9HA 4K1GA 4AU0A 3ECQA 4HCLA 3QZ6A 3K5XA 4NASA 4OOUA 1LLZA 4U2YA 5FJJA 3UGVA 3SRKA 4RZ4A 1KM0A 1HNYA 3A3HA 3T9PA 4Q8VA 1DJQA 1Q85A 4M8UA 5B7YA 3KTCA 4I6KA 3RJXA 2R1PA 1KCXA 2G95A 2WZEA 3VE7A 4ZO9A 2W67A 3Q45A 5A6KA 3F2CA 1F76A 1XLBA 3ID7A 2QUTA 1M6JA 5CGQA 1E3XA 3ITOA 2XH4A 2BG5A 1OBAA 4ZSTA 1Q6RA 1J0IA 4G8TA 4BY3A 1XFCA 5M17A 2J7GA 4R7WA 5F2GA 3A4JA 1J4HA 5GPRA 4KEVA 3P74A 1E5JA 4GQ0A 3HV8A 3CT7A 3PPCA 4XBKA 3RAOA 3UJSA 3TDBA 1ODZA 3L0KA 1FCUA 5DX7A 1UC4A 3E12A 3QM3A 3M43A 3R12A 4O18A 3B0YA 4FNUA 4WOQA 3FV9A 5DIUA 2O4QA 4B3KA 7A3HA 1VFOA 3UY7A 1T0OA 5EMKA 3E2SA 3VABA 1PV8A 3DFNA 4KCWA 3P14A 3CWOX 3MW7A 4N9DA 4UFKA 4WGHA 3OIXA 2ZVRA 2QJHA 3S6OA 3LZ5A 2ZOXA 3OBEA 2G0WA 1TTPA 3PZTA 5FF7A 3LHUA 2E6FA 3WLJA 4N42A 4M6VA 1ME8A 2NQZA 4O15A 2WBKA 4IT6A 1TTQA 3H53A 3RMJA 3V5CA 3DBNA 5JIPA 5A8OA 1JXJA 3PN8A 4AY8A 5CBJA 5HWMA 3G3MA 4IQDA 5BROA 5GNYA 2L2SA 3H9RB 3G22A 3NQ7A 1WAUA 4DYEA 3WLPA 3W7LA 3PNUA 3PB2A 3IPWA 3B0XA 2TODA 4JPGA 3EPNA 3IVSA 5I23A 2RAGA 4QGCA 3REQB 1XBYA 4A21A 2OU4A 1YTDA 5JH8A 1F3TA 1TJRA 4KR0B 1CXIA 4I9JA 5AHFA 3EYPA 4QDWA 4QIBA 3CK5A 3BSGA 3WH0A 3N3TA 2WM1A 2PTZA 3CZGA 4F3HA 3L0GA 1AL8A 4YMZA 2X7WA 2BOEX 4XZIA 2PDFA 4IXXA 5REQB 3L66A 3O63A 2CPUA 3R8HA 1ZALA 4ZOAA 1YPIA 1E56A 4M1RA 4RJEA 5A6JA 5CC6A 1Z3NA 2CZEA 3GHSA 5IBXA 3JUGA 3SI9A 2ZX8A 4GZEA 3KDNA 4IIDA 2OTDA 2GK1A 4MHBA 3COTA 1JVWA 1OFQA 3CWHA 4AX7A 3C3NA 5HMFA 2VO5A 3W7RA 2XP8A 3MV01 2YKKA 3ZIZA 3BARA 3WF2A 2NQHA 4Q4MA 3W1AA 4KWWA 1MRQA 1V02E 2HMCA 2B31A 3SQMA 4JIRA 3ZR4A 3B8IA 5CSYA 1OFPA 1SYTA 3LGDA 3BLIA 4HYRA 4W9OA 4ZOCA 2OEJA 2WB5A 2NX1A 5LNUA 1D7KA 4OWGA 1NP0A 4GUGA 2PBGA 1HVQA 2RDWA 3Q4DA 4XSMA 4PC8A 1UD8A 3O0FA 4O53A 1L2QA 1F9CA 1LDCA 1GORA 1FWEC 1OEPA 5C9RA 2CKSA 1KM1A 3GE7A 3FY1A 1JDAA 2PB1A 4W9TA 1QCWA 2EJ1A 2Q71A 4QNEA 4UTWA 4HA3A 4J27A 4DJDC 2GDUA 2YDSA 4X9YA 3MYOA 4Q4PA 3M0LA 2V68A 1MUCA 4D72A 1R2TA 3NSNA 4GI9A 5ABFB 2WC4A 4FI4A 1E4MM 3NZRA 3ARWA 3XINA 3U2ZA 1LQ2A 4FOUA 3W28A 3CMGA 2OODA 4PEKA 1NF0A 2G3FA 1HJXA 4IIFA 4HNUA 4C60A 4ACZA 4HTYA 2XVPA 3CTTA 3Q65A 4HCHA 1RAKA 3VNYA 3L21A 4LYKA 3L2IA 1AZ1A 5E0CA 3TXVA 5BXSA 3AU2A 3ATZA 1RK6A 4IT1A 5EGRA 2VFHA 3GYEA 3AMDA 1QI3A 1E5NA 1E0VA 2XWDA 3W7PA 2ZA2A 4NAEA 1GKPA 1WYIA 2X8RA 4DWSD 3CHDA 3DG7A 1JGIA 3POCA 4GUIA 5A69A 5FKYA 3WBAA 4MNJA 4MYXA 1JDCA 3UA3A 4KKXA 2AAAA 2YA0A 3EAUA 1EWDA 2FZNA 1Y5XA 1EC9A 1FKLA 3I6CA 5H8UA 3H6OA 3PZGA 1P0KA 2LPVA 4LAOA 1Q6HA 3BG5A 1Z9AA 2XSAA 2NT0A 1J4RA 2W66A 2DH2A 2XIOA 3EGJA 4O13A 4K8EA 4Z2JA 5AECA 2NW0A 3RM8A 3KRZA 2WK2A 1XH1A 1DWGM 3L68A 2I57A 3Q58A 3WLNA 4JKKA 1TPDA 1XF0A 1TREA 5FACA 5KETA 2DP3A 5I07A 3CC1A 5HUAA 3KBMA 2ZCGA 2Z29A 4TYOA 2PDMA 4FOJA 1JVNA 3E5BA 4EP8C 2QUVA 2VZSA 3IUHA 5FF2A 1FX6A 4DJFD 2QDGA 2LJ4A 1GQIA 2DDXA 1CGWA 1OCNA 4UQAA 2POTA 3MU7A 4MSPA 1OZMA 2YBTA 1A5LC 2A1YA 1P7TB 5A5WA 4DRJA 1BYAA 2QKFA 3OZOA 1L2UA 5D2VA 2RSEA 1YNQA 2BGQA 3HFYA 3E38A 4Y9OA 1QJWA 3LHTA 4NJHA 3H4GA 2I16A 1JYNA 3QHMA 1OFRA 4UMBA 4CCZA 4YVPA 1TV4A 1KM3A 1XQLA 4UTTA 2PDYA 4H9TA 1L8NA 9CGTA 4C6LA 1U5JA 3AISA 4Y8EA 1UR2A 2EXOA 4UOQA 1S2AA 3MDYB 4E3TA 3QY8A 3STGA 2HROA 2GL5A 2PD5A 4KFOA 4GJIA 3WJSA 1B6CA 3DI0A 2F2DA 3LMYA 4DRMA 1SW7A 1UCWA 3VOIA 3WO8A 1PHQA 2PWEA 4QE4A 4Q8OA 2E4TA 5C6MA 3AHYA 4RNIA 3QMTA 1WZLA 5DEZA 1W37A 3VCCA 5F1UA 3TSMA 3HTWA 3CUGA 3W25A 1R30A 3MO7A 5I06A 1HZYA 3DYPA 3A9IA 3A24A 1EYEA 4Z1CA 4XB3A 3EKGA 4NJIA 3PUOA 4AD4A 1OHLA 4KH2A 1RV8A 2BWGA 4ML9A 1X38A 2OSWA 4W93A 3CAKA 4IQCA 1JAEA 1KFLA 2Z2AA 5DF0A 3CZ8A 2BXZA 2W92A 1FCVA 5FL1A 5GVJA 4GVFA 1ISYA 4DT4A 1DEDA 3NOEA 1R86A 4A8IA 4ODMA 4MJMA 2CBIA 2ZZ6A 1N2VA 3VGHA 2XJ7A 3G1XA 3FJLA 2PDXA 2C1IA 3ZSTA 1E71M 1DWAM 3VFLA 1TUFA 2EG8A 3KP0A 3TC6A 4DZIA 1E55A 4E6MA 3ZVHA 2F21A 3VINA 5A6SA 1LRNA 3AMKA 2BHUA 1BQCA 1PWMA 1GOIA 4MNLA 4M82A 5CLWA 1XM3A 2G41A 1W8SA 2VUNA 1C90A 3W82A 1GZJA 4JYSA 2DT0A 3QOKA 1IR2A 1JCNA 1QPOA 3TDFA 4QLKA 3SJ3A 4F9DA 3RUBL 1TPFA 4A4AA 2IW0A 4DUXA 3IKGA 1O68A 3E2RA 3KAHA 5MHBA 3U2EA 3TTOA 2Y63A 4AZ6A 4BA0A 4ICMA 3LGEA 3R0KA 1XIMA 1FA2A 2BXVA 1QPQA 4HK5A 1HJQA 1NFBA 1VQTA 3KW3A 4F0SA 3T2PA 1BG4A 4ZQNA 4B5VA 1ZPTA 3E0LA 1UHVA 4HU4A 3QC0A 1HG3A 1GQJA 4M6QA 5DT5A 1KFKA 4HNNA 4ZPVR 2F8QA 3CPGA 1SZGA 5D2XA 2VRQA 4FR1A 4F4RA 1IQ8A 3QR1A 2DZXA 2V2DA 3BMXA 3TZNA 4RPPA 4IHCA 3URBA 1DIKA 4FAMA 3TJIA 2IPFA 2YFOA 1M7OA 4Q7NA 2V5BA 1JF6A 1VJIA 2M2AA 4UFHA 3U48A 1EYWA 4Z2IA 3NAVA 1E1FA 2JEPA 3EMQA 2ISFA 2PTDA 4P7RA 2QVHA 3VGFA 2ZWZA 4Q8QA 2WQDA 1MZHA 3S2MA 4KIEA 2AAMA 3SEPA 4KRTA 3WLKX 3WQWA 3DU0A 3W2KA 4GH3A 4KWVA 4YHGA 4S2BA 3T8QA 2YFNA 3NPVA 2QULA 5I3KA 2PI6A 4ZVJA 1XFBA 1B3XA 4EK7A 3MWCA 4PMQA 3RK8A 1YXDA 3E49A 1E0TA 1KT1A 2FLIA 3BCFA 1LLWA 4FS9A 3H2FA 5B7ZA 4ZXLA 2WJFA 1OZQA 5JH2A 1QW7A 4NL1A 4EPKA 3IJIA 3B97A 3WK2A 3RFWA 1B3OA 4FLQA 3KDOA 4XTIA 1ZZMA 1OFBA 4LXFA 3GTIA 1ITQA 4I5UA 1FVPA 4MY9A 4RXGA 4A3QA 3ZWSA 4J3UA 1XIFA 3IRSA 1BKSA 1UR0A 3LOTA 4IMAA 2YOCA 3QYQA 1NDWA 4WSKA 3N6HA 4R7JA 5LIUX 1W56A 4UQEA 3RGCA 3PUGA 3DH7A 1BAGA 4JCMA 4JDBA 1W91A 4NJKA 3PNZA 2Y4SA 4GFIA 1ADSA 1CT5A 2VGFA 2DUXA 4E5TA 3TZFA 4TMBA 1O1ZA 4D8AA 1OGBA 4QJ1A 1HP5A 3UPMA 1KFBA 1J2WA 2Y0FA 3AYSA 5AHIA 3HPZA 5I3FA 1A0EA 2BX7A 1YNPA 3BSMA 4C65A 1S2UA 1IIHA 3PC0A 2WZIA 1GVOA 4X2RA 4GJJA 3U4AA 4NXKA 3MUIA 2QYGA 3VIFA 2PA6A 3CO4A 4MJZA 4X22A 3OHIA 4W88A 3ARXA 2VZUA 3RO6A 1O95A 1W8GA 2X0YA 1QO5A 2CITA 3PRAA 1HTIA 3BJTA 4LY8A 3EOOA 4J5NA 3FYYA 4AMCA 2JGYA 4GI8A 3WF1A 1R0MA 2VX5A 1YTEA 3UXKA 3GR8A 1BGAA 2QJNA 4IPPA 3EZ4A 4LB3A 1UOKA 1XBXA 3NQMA 2QCNA 1LL6A 2FZBA 4IZGA 3MP5A 3WELA 5IDZA 4J35A 2OWWA 1HIZA 2FKPA 3THAA 2PD9A 1PVNA 3TA6A 1LQ0A 2J6XA 1Q6LA 1G5AA 5TNVA 3WIJA 3D6NA 4FN2A 4UFJA 3TE9A 4J40A 3UNTA 3S0CA 3R1ZA 5BXPA 3KAFA 4Z1YA 3AUOA 3EKZA 1G69A 4P2VA 2V3GA 2G4JA 2PC4A 1DWHM 5IXEA 2AKMA 4HSNA 1AODA 4O4WA 1GOKA 3FSTA 5LSMA 2PLMA 4C6FA 4QROA 4R3UA 3T0TA 1V79A 3T7VA 1VHNA 1WPCA 2JEQA 4GIEA 1PKMA 3WNPA 4F66A 4JQ3A 3TK7A 2ZXDA 3CPUA 1EXPA 5HANA 3V7PA 5H2ZA 1EPVA 1B0IA 4PUKA 4C7DA 4RKAA 1RQHA 3NGFA 1D7HA 1B57A 4B16A 2ZZ1A 3MKKA 4WF7A 4J4OA 1YXCA 1Y65A 1HKKA 4XG1A 4DAIA 5KEZA 5LZLA 1R3QA 3CASA 3SUTA 4QAIA 2GSJA 1TR1A 5RUBA 2PWDA 2BS9A 4QEHA 4LCQA 4QFUA 1FKTA 1PAMA 2VD8A 5D2WA 2I56A 1V7YA 1TVPA 4LBUA 3BANA 3FEQA 4LB4A 1YKWA 2ZIDA 5C9ZA 1XLEA 5M2FX 2XISA 4Z2KA 1MNSA 2GK1B 3E0VA 4GIRA 3WG6A 3GG8A 2Y5JA 2QT3A 3KBNA 2WMHA 2QJGA 4XISA 1X6UA 3FXGA 1ICQA 4OHQA 2QCLA 1W1A1 1XH2A 1I2NA 2X2GA 3DFSA 4AB4A 5L6UA 1QPFA 2CLIA 3EWXA 4U85A 4YTSA 4KQNA 4H9XA 3U8GA 5HWCA 4O19A 3NZQA 3O5KA 3A22A 2OGYA 3N29A 1BRLA 1AA1B 4GX9A 1ADDA 1EDTA 5FEWA 3DN5A 3SGZA 3KBSA 4UOZA 1X39A 1KBKA 4QLLA 2PDWA 4UTWC 3GNDA 2AGKA 4JICA 1FFQA 2INEA 2XVGA 4QNWA 4CU8A 4U10A 1BQGA 3T81A 3VUPA 3HJZA 5MKGB 4DIAA 1QASA 1SZFA 2G3MA 3TSBA 2BNJA 3GKAA 1QRQA 1P6BA 7XIMA 2X16A 2PDBA 2CU0A 3AIUA 3RJYA 5I78A 3E5PA 5JXQA 1ONEA 3ES8A 1ME9A 3BO9A 2G4FA 1EP3A 4YHEA 2RUQA 3RRAA 1FWRA 3NTPA 2PCQA 2P8BA 1DYSA 4IGMA 3XIMA 5LNSA 1HF6A 4Z1AA 3N9RA 3O5IA 3MUXA 3NQ6A 1QW9A 3OP2A 3Q94A 4W8BA 3INPA 1C91A 4N4PA 3ITGA 2QR6A 5JQ9A 1B3WA 4DRSA 1UH4A 2GJPA 2WVVA 2ZRWA 5D32A 2BXYA 2EGZA 2QCHA 4M29A 2X41A 3C5QA 2QDDA 2QJMA 4BF9A 3KL5A 1N82A 3V0UA 3CWNA 4HPXA 1JR1A 1TJ0A 4GGBA 3AMCA 1KKOA 2IS7A 4FLOA 4QG9A 4IISA 1HP4A 2XYLA 1XLJA 5B8IC 4NAEB 3KVMA 1UPMB 1CB7B 3S1UA 4MZ1A 4XAGA 4DO7A 3V75A 1V6VA 2F7FA 5G5IA 5I3DA 3CXOA 2E9BA 2WMIB 3MCMA 4UNKA 3PS7A 1A5NC 3RMEA 1KA9F 3EXSA 3HN3A 4FMVA 1ZP4A 4DXVA 2YLLA 1SGJA 2WANA 4C1NA 4WDXA 1NQKA 2DT1A 4TVDA 5JBEA 1GZ1A 3WLTA 4L64A 2FHFA 3S5YA 3G18A 1W1YA 3G8RA 3I4KA 2WXDM 2OO6A 3UJFA 1OIMA 4PFMA 1LOSA 5A6TC 4G7FA 4HA0A 1ZJAA 1UG6A 2J25A 2DW7A 3G1HA 1RBAA 2DT2A 3LHZA 3BLOA 5KSWA 3CUFA 9RUBA 3FCPA 3MQTA 3M7SA 3UCDA 3SURA 1BWKA 4MB1A 4IJBA 1W5PA 4IJRA 2VN1A 3EX6A 3PG8A 3C2OA 3AXXA 4E4PA 1HL8A 3CUIA 1M7PA 3KCJA 3BOLA 3JXVA 4AQLA 2Q3RA 2D2JA 4H00A 1F4HA 2GJXA 1AL7A 4GI6A 3LX9A 3SSJA 1BVNP 2PLCA 5IFPA 1CLVA 5AHEA 4BQ5A 1GEQA 1JRCA 3N2OA 2Z2UA 1GQNA 4XZBA 4H41A 1S5VA 1H49A 2RURA 3MMWA 3W37A 1EGMA 3U57A 1RY0A 1EO5A 1V03A 4FALA 1W0MA 4Q4OA 5A8NA 5I5RA 3L5MA 4W89A 1KFWA 1CXLA 1K9TA 3GTHA 2ZZ7A 4NI3A 3RM4A 3O07A 3E3HA 3CH9A 3DC0A 3L4UA 1UD2A 1FWHC 1W1PA 1F7BA 2PC8A 1D8WA 1M9HA 3SN4A 3VIKA 3NUKA 1H7OA 1DJZA 2WNWA 3ABZA 3S1XA 3L4YA 2DZSA 4NZ4A 3UVIA 2ODOA 3S6TA 4B4FA 2OKTA 1I2RA 3WNNA 1K70A 2QMJA 3IJ7A 3PA7A 1HX0A 1QR7A 3O7UA 3LGGA 4PMOA 2CHNA 2NXHA 1HQTA 3KTXA 3GTFA 1UUMA 3GW3A 3LUTA 1W1VA 3T4WA 1C8XA 5CXPA 2VFDA 1FH9A 3N04A 1SO4A 3W9ZA 1M3UA 1IF2A 2E1WA 5AKQA 3PRBA 1M5WA 3VVGA 3VKBA 3THDA 2XIIA 3MJYA 4DRQA 2GGJA 2ZQ0A 4KWUA 2YDAA 2J9ZA 5DELA 3NQDA 5A6LA 3JYJA 4DQWA 3K8KA 1AUSL 4WVXA 2E5CA 1UR8A 1PSCA 4FXSA 2CLFA 5CSUA 5F2MA 3APYA 2GGIA 1A7XA 1UA7A 4K3ZA 1LCOA 4JTRA 4K2SA 3H8AA 1TMHA 2YB1A 3B0UX 5I79A 4DWSA 4B90A 4DBSA 2ZQVA 4FEZA 4ODLA 2VEGA 1YDOA 3QSTA 2NQLA 3TQPA 2UV8G 4PBGA 3W70A 5AVNA 3IRDA 1E51A 1H7PA 4G2DA 1JULA 3VD7A 1XIEA 5KITA 4JFLA 3LK6A 1XYAA 4LVDA 4K6AA 4PODA 3VNJA 4Z42C 5LA1A 2JQXA 2MLYA 2ITKA 1LUCA 1UOZA 3B04A 3IJ9A 1ZS2A 1UWQA 1FD9A 1FDJA 4O1DA 1DJGA 3SIMA 3WMLA 4PUEA 4LV4A 4W8AA 3M6DA 5IDIA 5K9DA 4YYCA 5I02A 4XKYB 2XGZA 4JNYA 4JY9A 1D7FA 1EC8A 3BH4A 2ATMA 2GVJA 1MEIA 3IWPA 3NR0A 2YCEA 1OCQA 2YXOA 1ZU8A 1MXSA 2LGOA 1YPFA 4O2TA 4DJFA 3OIHA 1F6KA 5HNUA 4Q8TA 2VQUA 5T26A 2KX9A 4ONVA 2TPSA 2ZRVA 2A0NA 3PPGA 3BSHA 1Q6FA 4AG0A 2GQAA 3WFLA 4LU0A 3FEMA 2CC0A 5I77A 1J12A 1HGWA 1HFBA 2Y88A 5F4SA 4DJDD 3TV8A 2FPTA 4IPXA 1VPYA 4D6IA 1NARA 3G1SA 4WXZA 4HU3A 3FS2A 4FK9A 4JBRA 5IHRA 1UH2A 4UBPC 2G8ZA 4FNTA 2BGNE 2EO7A 3HPFA 1XDMA 4WEVX 2ZXBA 1X8FA 3C3UA 4FIQA 4L3NA 1NMVA 1FHVA 1V3KA 2PTXA 2YW4A 3BCJA 1P6CA 4WY0F 5HJLA 1HGYA 4JTHA 2WO5A 4REQA 2RDTA 3H7VA 2FH8A 3C56A 4BR1A 1UD5A 3IS4A 4L7ZA 1Q6GA 4IF2A 2HVOA 2OPJA 4IQ2A 4FNRA 3B9EA 3LMZA 5GNXA 3GU1A 2XIBA 2PN0A 3B8TA 3IIXA 5AB3A 3CAQA 3S5NA 4HSHA 3MCNA 3THQA 2RDUA 1KRBC 2QAFA 4CQ8A 5LNRA 4DIPA 1V3HA 1KBBA 5I24A 1JIBA 3P3BA 1FWFC 2VJXA 4RDZA 4DZ3A 3BMVA 3U9IA 3DG6A 3CZLA 2FKEA 4MB4A 4KIRA 3HGJA 2J75A 1WZMA 3OODA 2P5NA 3S2JA 3FSUA 1R8LA 3IUDA 1B9ZA 4DUWA 4A3YA 5F4WA 3RITA 1VFMA 3RG6A 6XIMA 1JYWA 1VPQA 1WKYA 4O54A 4A3RA 3W7KA 2CKRA 4L4LA 1AD1A 3IACA 4MSSA 2V67A 5HQEA 1OT2A 1KM4A 5LXXA 1UROA 4MTVA 2KR7A 3H24A 2E6DA 4WGXA 4MWAC 4MMWA 3CHCA 2WLZA 1Z42A 5A8GA 3JZUA 2GJLA 2VT0A 1QK0A 1FKDA 4PMRA 4Q8NA 1H09A 1ZAJA 1XYFA 2VVSA 1CDGA 3S9ZA 2ADAA 2YB4A 3RPTA 4BF7A 5AN7A 1E6RA 2NWRA 3NQVA 1UYQA 1NWRA 3UG5A 1TRDA 2Y61A 3H70A 4U31A 1LT8A 4JZ5A 3FAPA 1LQAA 3MZ2A 4NXSA 4H1ZA 2BHYA 1RJRA 3UYIA 4AHPA 1QNOA 2FZ9A 1TPUA 2PDQA 4B5XA 3RRXA 1OFDA 5I03A 4Q4RA 5JU6A 4LRTA 2ZA1A 5EU9A 1EZWA 1KLZA 1E73M 1RUSA 2V3FA 4S3KA 4HNVA 1UWSA 1YBQA 3TNOA 1KV5A 1LRTA 4BZYA 3QW3A 2FQIA 4IX2A 2V5CA 2W61A 3IIZA 4L65A 1EC7A 1W2VA 2AWGA 4PUJA 5EMLA 5A8QA 1GZGA 3WQPA 4JHZA 1O94A 4JS3A 2ZKMX 4OU1A 3TWBA 4LX4A 5E09A 2J7EA 5C70A 4W85A 3CEPA 1JNEA 1KGWA 1PB0A 3CTLA 4HN8A 2FYMA 5A1AA 5DRIA 3RF9A 3W2NA 1GVYA 4GC3A 5T91A 2CW6A 5C0QA 2HPMA 1Q45A 3WQGA 1MMFA 1KQZA 4F40A 4B5TA 3W38A 1FKWA 4LVGA 2P50A 3GXIA 2VFIA 4HN4A 3NCOA 5JBDA 4WY0A 4O0QA 1EB3A 1QDSA 4J3VA 3MI3A 3O1NA 4ZQCA 4DI8A 1AJ0A 1EYMA 2ZBTA 4U2ZA 4EKJA 1QOXA 2Y2WA 4GE8A 1AZ2A 4PMVA 1A53A 4QJ4B 3UJRA 1Q7ZA 2FZMA 5G2IA 3FVMA 5JVLA 1GOWA 3ZWTA 3L4XA 1H0GA 3GAYA 2I1OA 2QS8A 3FVDA 3M16A 2YIHA 3MUAA 3NJ3A 2WMGA 3TYUA 1TR9A 3BJFA 1W9XA 3GQYA 1ONXA 1FHDA 4M51A 3ZS4A 2D69A 4RLIA 4XO6A 8TIMA 3DENA 4H7CA 3PSVA 1JF5A 2VP8A 4WSHA 2OVLA 4O12A 3DESA 2OGJA 3GFYA 4O1CA 1EJ7L 1QZ2A 4I8YA 4B9YA 3P61A 2CFFA 1R3WA 4JOMA 2PS2A 5CZJA 4OQVA 2ETNA 1VRXA 1NH6A 2A5HA 5CJMA 2XFYA 4O1AA 4IMGA 4PCNA 5I7GA 4PFHA 1JZ2A 4AD1A 1P0DA 1SW3A 1RK5A 3W74A 2XTKA 4BK9A 3SIZA 4LQ1A 1S3TC 3R8GA 1OM0A 3KWXA 3VE9A 2F2HA 4PE8A 2ZZ4A 2GVLA 3VDBA 3T08A 3WLRA 5HPOA 1S5TA 1FY6A 1B3YA 1KRCC 3RXZA 1Z32X 4OOZA 2YCLA 1PUDA 3NIYA 4A35A 2XFRA 3T0AA 4QJ5B 1DQXA 1D3HA 4HPJA 2XN0A 2VGGA 1OYCA 3CL6A 3OBAA 4CD5A 3I6RA 1US3A 2Q5AA 1XKJA 1S38A 2JZVA 2DPEA 1G6CA 3MHUA 3CB3A 1US0A 3W2JA 3ABRA 4AMAA 5I2UA 1W3KA 2ZR6A 5LA2A 3VZYA 5CJNA 3R94A 3AOFA 1W5QA 3HB9A 4IQEA 4AEFA 1UWIA 3A4WA 3AHZA 3NGJA 5EMJA 3N17A 4E3VA 1UJPA 1U5VA 1QUMA 4AZ7A 3M7WA 2PBOA 3D0CA 1E0UA 1EEXA 4UMCA 1EA9C 2ACSA 2QDEA 4K8GA 1PTAA 3UXAA 3KS6A 3W1UA 5D4YA 1Y0OA 2C18A 4KCTA 2VOTA 5I3HA 1FFRA 4H83A 4G9PA 3MMUA 4PB5A 2ZUVA 2WVVB 3CH0A 2DVTA 3TYDA 4TW6A 3WNOA 3EMCA 1W1B1 4N9BA 5LNVA 3DXIA 3N13A 5H8MA 4LS2A 1TX0A 3VTRA 5FJTA 3BG3A 4Y9NA 3VKKA 1WOBA 3C8FA 4B15A 3PBGA 1UD4A 3WSUA 2WV8A 4AZ5A 3RLVA 3BV4A 1NVMA 1OIFA 3UESA 2I17A 1EPXA 3RU8X 2XU2A 2XN1A 3GX9A 3W7NA 3WLHA 1ZHAA 1R47A 1W54A 1SR0A 1EXBA 1ZCOA 4LF1A 3ZVIA 5I3IA 2OYMA 2VHLA 1DWIM 4TW7A 1AG1O 2TAAA 3QYSA 3BMWA 3QRHA 1HUVA 1QPKA 4ICNA 2GOUA 3TTQA 4NT0A 3IANA 1E9ZB 3R79A 2F9RA 3UQIA 4OVXA 2CZDA 4V27A 4MZYA 4C1NB 3U5YA 3MSYA 3WQOA 2EJAA 2EPOA 1LORA 3T0BA 5EY5A 2ZUWA 1FWWA 3P0XA 1DJXA 4AEOA 3QVQA 3NYZA 1E1CA 1TMQA 3NDYA 1EQ3A 4ODQA 3RR1A 3D46A 2O0TA 3LBMA 3F4VA 3P93A 2VRKA 3IV3A 1CB2A 3W86A 3QOMA 1F8IA 2C0AA 2JBMA 1WDQA 1EP2A 5J5RA 2EQDA 3QQ0A 3PZUA 4H9MA 3H23A 1NFGA 1DIEA 3A64A 1OC6A 1G94A 1MSSA 1NOUA 2PDIA 1JYXA 1H1YA 4ZB2A 1FH7A 2PGFA 1KFJA 3SQLA 3SN1A 3TKFA 1GW1A 1K7FA 4XVEA 4BQ3A 3O5JA 4HARA 5C7VA 2ZE3A 4U5KA 3RFAA 3NPXA 2VI0A 3UF8A 2BMBA 4F2UA 1HO4A 1G67A 3UNDA 4BS0A 3KVLA 3CUHA 3EDKA 1RLDA 3OHMB 2PWUA 3ONBA 3B0PA 2H9AA 4H6EA 4RNFA 2YL8A 2J7HA 4ZMGA 4S38A 4BI5A 2HZGA 1TFVA 3MY9A 1AMKA 4QR6A 3K2GA 1J0YA 3TEVA 4AFYA 1P0BA 3TC5A 3RCYA 1BVZA 3BAYA 3AIVA 4PUMA 4WK9A 3RHGA 4CD8A 4MGVA 1VLWA 3W7QA 3OGSA 2WM0A 1O66A 3EWYA 3WEMA 5FA5A 3NVDA 2VEMA 3MC5A 4MB3A 3KCLA 4UTMA 4EPEC 4NRSA 3QHOA 3SFKA 5J5DA 3SR7A 2NX3A 3BJSA 1Q7QA 1Q1CA 1RP8A 1DBTA 5D2YA 4IXHA 2GYIA 3Q37A 2DIKA 4O14A 3TH6A 3KLKA 3KAGA 3A21A 4KBXA 1NOWA 5D9MA 2ESCA 4DWSC 1ZBKA 2FJUB 3M0ZA 4MLRA 4I5XA 3KADA 4LVAA 4UQ9A 1ELSA 3LM7A 4O11A 3HURA 3K1DA 1GVRA 3L2LA 3OW1A 4PA8A 2HS8A 3NO5A 1PYMA 3BICA 2R1LA 2JKEA 3B7XA 2J7FA 2IPJA 1SFJA 1TA3A 5E93A 3SO7A 2QHAA 1DHKA 3NEHA 3CQKA 4ZOBA 1ZUAX 2AGTA 1HT6A 5C71A 5HJYA 4XZNX 2PODA 3C6CA 2E67A 4D1JA 4EF9A 1LUCB 1J5TA 3LRLA 2KFWA 1RCXB 4LYQA 2YCIX 3W71A 5EMYA 2HBVA 3ODKA 4PSRA 3H2EA 3RU6A 4NKCA 4GY1A 1M53A 2DU2A 4DJFC 4EACA 2XUCA 4Q22A 2W63A 3N14A 2XHYA 4W4QA 4O8AA 2XH7A 1K4HA 2NXGA 4FLSA 3O06A 3T09A 2PWGA 3UZXA 2WCGA 8RUCA 3NSXA 4C6IA 1XIHA 5FL0A 3CNYA 4Q8PA 3CO8A 3N4AA 3IJDA 4DF1A 2ZX7A 4POCA 1J18A 4HBKA 3WUBA 3O6CA 2CWXA 2ZUNA 2KAUC 2BFGA 4OZOA 2EG6A 3UZWA 4LEQA 2OFJA 2LKNA 4IGNA 1Q6UA 5HKGA 4FXFA 5CAHA 1U83A 2CLEA 3L7RA 1YDVA 3T2OA 3PWGA 3H2NA 1TWSA 4PRRA 4K68A 4DRIA 1XUZA 2GQ9A 4NNAA 1NDVA 1BXBA 3L4WA 3TW7A 1XRVA 2WSYA 1HN1A 1ECQA 3NYDA 1V6WA 1RVGA 1ISVA 1RJQA 4AHOA 4CEXC 2JF7A 3QN3A 3N6QA 1E6XM 3GDRA 1IV8A 4FXRA 4PZVA 1OWQA 1N8WA 1FWNA 3M5VA 1UASA 3OQ8A 2Z0IA 1S1PA 3BGGA 1C9DA 2VFFA 3FDKA 3IIPA 2HK0A 4W9PA 4QHRA 4PB4A 3ZOAA 2OZ0A 3M9YA 1LBFA 2FH6A 1ITXA 1QK2A 2ISSA 4GVHA 5M3WA 1A4MA 3QEZA 1V3LA 2HEJA 4AAJA 5DCEA 2B4GA 4OGZA 2QCDA 4GABA 5D9PA 1UW9A 3WQ4A 1B90A 2Z6IA 3KWSA 4S3DA 2V2CA 1Q6OA 4QDPA 4CCDA 4H8VA 3WL0A 3WLIA 3CZJA 4UTIA 2QDHA 1SSDA 1Q8JA 2WNQA 2VENA 3LI1A 1EF3A 1T41A 1X6LA 4UTUA 3FDGA 1TVLA 3ZR5A 5HWJA 2PDUA 2W0UA 4QSHA 4HD5A 1DL3A 4BF8A 4R34A 3VILA 4HB7A 3LA4A 5G4EA 1SO5A 2P8CA 3WQ8A 4QITA 3WX7A 4EANA 2J7BA 2BY3A 2PGWA 3W83A 4B3LA 3M6YA 2QJIA 2X05A 2ZFAA 1D3GA 3LCIA 4KWSA 4DAFA 4RW5A 2R91A 3W2UA 4AZCA 4A22A 4QZVB 1VPXA 1TELA 3KVKA 3WDPP 5H1WA 3H26A 3EA2A 4GLEA 1O4UA 3M5ZA 2X40A 5C5YA 5K4ZA 1SZEA 3UF9A 3O5FA 4BQ2A 2R6OA 1QU4A 1JEZA 4P8XA 1OC7A 1D7JA 5HW6A 4IFKA 3SCOA 1VLIA 2Y7EA 3UT0A 5DRCA 3WK0A 4CQBA 4IH3A 1YBQB 4EE9A 3PG9A 2E09A 4MDOA 3N34A 4TW8A 4TTGA 3MMTA 3GNRA 4LY4A 4DJDA 2NT1A 1W32A 1V0NA 3KRUA 3PBYA 3WDJA 4PEEA 1A5UA 1X1ZA 1R3TA 4M7SA 2Y5SA 1XRFA 1YMYA 2FVLA 1GQKA 1P0EA 4XV0A 2E5BA 5ABHA 2PGRA 3MUY1 6REQB 4U86A 3LLFA 4ZODA 3B40A 2DQXA 5AC7A 1GVSA 1EKOA 2AOSA 3M5XA 4GPNA 1W5MA 4H9ZA 3R5EA 3SGUA 4BI6A 1YRRA 1BLIA 1JCJA 1XS2A 2FTWA 1K6AA 1MO0A 5HOSA 1B5TA 3QKZA 3S9YA 1UP2A 1LL7A 2F2KA 3W7IA 1WXYA 4KS0A 3G3DA 3N9KA 1FKIA 2CLHA 3TX9A 1TZ7A 3TA9A 4UTJA 3TMQA 1MFUA 4C6OA 2D9FA 4W5UA 1LWJA 4DO6A 4D6HA 3AZRA 2FGZA 5HQMA 4DPPA 2XDFA 1QBAA 4C6PA 3E96A 1XLMA 2Y85A 1VYPX 2ZZ3A 4XTDA 4IIBA 2Y1HA 4PTXA 5I3GA 3CMFA 4QIUA 4W7WA 1QI4A 1JI2A 4IP7A 2VTFA 4BI7A 3UG4A 4R33A 3VDHA 5K3VA 4FOKA 1MZRA 2CERA 1EIBA 1SO6A 1ALDA 4YJ5A 4HA4A 1O6IA 1GOQA 3WQ6A 2DSUA 4DRPA 1HL2A 3ZT6A 1Q6CA 3BW4A 1KC7A 1LG2A 4MKSA 1FJDA 3GDMA 2FB2A 3LCXA 3VNKA 1XLAA 4ZSUA 2E8ZA 3ZFHA 1PO9A 1QAPA 3SY5A 4GO9A 1EJXC 4DXXA 4CD6A 5EMUA 1UPPA 5D8WA 4H7VA 4GKLA 3TTEA 3G5EA 5DN1A 3AXHA 3VAVA 2Z1SA 4YIWA 4C7GA 1AQFA 1QMLA 4MFEA 4O16A 3USBA 4ZO6A 3I3BA 2G97A 5FOOA 4FB7A 3BAJA 4CNTA 4JFJA 1MFVA 5AOUA 3BMBA 2ZR4A 1C7SA 2ZICA 3LB0A 4DZHA 1S3HA 2VWTA 3AIQA 1Q4NX 4I3GA 4XX6A 4DUVA 1P0NA 4LTSA 4F48A 3NFUA 5GQBA 3MYPA 2HRWA 4MY8A 3CLMA 2YW3A 5BXRA 2QJJA 3O6YX 4R9XA 2VWSA 3SM0A 3GZAA 3UR5A 4JIQA 2IXUA 3SCTA 3W7CA 2CXEA 3NPUA 1NOFA 1BG9A 2WLYA 2C7FA 1F3WA 3UQBA 1R38A 3H2CA 4AWEA 3P81A 4C6CA 3I65A 1XCXA 1EQPA 4DX3A 4Z2GA 4XZLX 4J2MA 1VR6A 4NILA 5KZDA 4GINA 5LIKX 4DUOA 1F2JA 1ZL1A 4H9UA 1KTCA 1W1ZA 5CZSA 1DV7A 1ITCA 5CGTA 3BAKA 5CQ1A 4AWTA 3PZNA 1KBLA 1X96A 2C6QA 1VFTA 2DZWA 2PDKA 2VZTA 1GKRA 3ARVA 4MAVA 2QXWA 5C2CA 2A4AA 4G50A 2WOQA 3R13A 1M5YA 1XYBA 1JCMP 2XVKA 1SO3A 3O5LA 3LI0A 3TYEA 4KCVA 3R2GA 4XZWA 4XSLA 2ISDA 2DEPA 2HNHA 4H19A 3H7RA 3WEZA 3OEXA 4GISA 3GU9A 2X09A 3R0UA 4RE2A 4MKNA 1UBSA 4ZS6A 3A9BA 4HBOA 1WXJA 5D37A 5HR6A 3STPA 5CZ0A 3R7MA 4TX9A 1RBLA 2UZ5A 1UWTA 1TO3A 1XV8A 4G5DA 5GNZA 3KACA 2MPHA 5AC6A 4PN2A 3WK3A 3CS2A 4ZCWA 3E0FA 1SZRA 1R87A 4PTWA 4RW3A 3B9OA 3GH5A 3OLDA 4HNLA 4EAYA 3N2CA 4GCXA 2VDGA 1TCOC 2GVYA 4PBFA 3GC5A 2A79A 2WC3A 1R3SA 1VCGA 3ZO9A 2YBUA 3VZXA 1XG4A 3HPAA 2YJQA 4ERAA 2VC5A 4H8HA 3PJTA 2ALDA 1E9LA 4JQ1A 2Q01A 1ZBWA 4MWAD 2VCDA 2PWFA 3WJWA 3Q2DA 2PTWA 1J10A 4NNBA 3WFAA 2YPIA 4AISA 4H2CA 4NX0A 3QV7A 1TB3A 3C0QA 2QQ6A 2OSXA 4IQLA 3DDMA 3N73A 5EKYA 3W2MA 2UBPC 3XISA 3CAWA 1A5AA 1SU5A 1RALA 2PDNA 4M5PA 4LW7A 2AQWA 4GX8A 4HZ7A 3UJ2A 3EB3A 2P0OA 4DJED 9XIAA 3WH6A 3SRDA 3O6AA 2M1IA 2O9OA 2ZUTA 3UBPC 3RLGA 2VM8A 1E1CB 3FA4A 4W7VA 4G1NA 3W7JA 5K2ZA 4DBUA 2TRSA 3KM8A 3LERA 3M44A 3WNMA 1QHZA 4EPDC 3LS9A 1HKIA 5EA9A 2QLYA 4UFLA 5C2XA 5XIAA 2XP5A 2RUDA 4YVXA 2BDQA 3FAXA 3DC8A 1TMLA 1UWRA 2ZX6A 1Q6EA 5EB8A 4CLMA 3LPOA 4TIMA 3LZ3A 2FGLA 3MA8A 4GYFA 3IK8A 3CMJA 1N55A 1ZBCA 3VCNA 1JUBA 1PZ0A 5HUOA 1Z8AA 4S3AA 3FJNA 5L9FA 2CZVA 3VNDA 2H6RA 4ROPA 3T78A 5EYWA 3TROA 3UZZA 4Q7IA 4ZE4A 1RPXA 4O28A 2O9RA 1LROA 2H9AB 5HQLA 2NQ9A 4NZFA 4JFIA 2PPGA 2R1NA 1A0CA 4M3PA 1IWAA 4E8DA 1GG0A 1Q4WA 2IUZA 4DEFA 3WF3A 1F73A 3NQFA 3U4FA 1OX4A 2ONEA 3GTNA 4GKTA 4PBEA 4CNOA 3PRDA 1NF7A 1IEWA 1IEQA 3UXIA 4UR8A 3FGCA 4I8DA 5BZAA 2W62A 3ARSA 5HR7A 4D8ZA 3DFTA 3ZT5A 3ZQ9A 3EIPA 2BVDA 4S23A 4A29A 1PWLA 3THUA 3LV6A 2XG9A 3LEPA 4JYEA 1OX5A 2PCEA 2F61A 1G9HA 1R6WA 3MVTA 1ZJIA 3EX4A 4JAWA 1Z44A 1RH9A 1XLFA 3OOQA 1L6WA 2OWCA 3VOFA 1TTJA 2R94A 4E4FA 1PEZA 2C79A 3PUEA 3CUXA 4MAZA 1VF8A 4UNIA 5AHLA 2KZHA 1PJ9A 1TA3B 3A23A 1BYBA 2YA1A 4GI4A 1XIIA 1F07A 3HPXA 4JN6A 1BHGA 1XGDA 1M7XA 1Y7VA 9XIMA 4WJXA 1MW2A 1DE5A 3O5GA 1OF6A 1YDNA 4L5ZA 3T4CA 3WD4A 3PZQA 1NY1A 3ZYZA 4AEEA 2HQAA 4RE3A 1WZKA 3WY1A 4IICA 3WENA 1J6OA 1CXKA 2ZTJA 1P5BA 4WUIA 1I8JA 3CUJA 4WCJA 3TW9A 3FN9A 3CQJA 1LT7A 1CLKA 1XX1A 2QCFA 4IL2A 1B4EA 1LRQA 1UKTA 3GW0A 1U33A 2BY0A 4MPQA 3WQ5A 1I45A 1KLYA 1R85A 2DG4A 3O5EA 1OSEA 2GPTA 1UA3A 5DXYA 3GM8A 5HMDA 3VDGA 4Z2HA 3GXNA 1M1BA 2O7SA 3PFRA 4NI8A 1TWZA 3ZJ7A 4JTFA 4RDVA 3RILA 3PWAA 3O5PA 3I68A 3O2LA 1OGGA 5A94A 3ARQA 1ONWA 2QCEA 2GDQA 1PCWA 3GB6A 1C93A 3DI1A 1EF2A 1TPWA 3B8UA 2PWHA 2Z1KA 1WKFA 3II1A 3TR9A 1H61A 1V7AA 2CHOA 4JY8A 3SECA 1EJTC 4IIEA 2IQTA 1E4NA 1SM9A 4OIFA 2QF7A 2CEQA 3LHVA 4CEUC 2OLSA 5DT7A 4GY7A 2QUMA 1VKFA 2VZVA 1RBOB 1VFSA 2DG9A 2XZ7A 2E9MA 3GG0A 3NI6A 1WA3A 4LAVA 4HGXA 5A95A 2A3HA 1QWGA 1YX1A 3E9AA 4Y6GA 4Q3MA 4NIRA 1BKFA 2VCBA 3VK5A 4QBXA 1XXXA 3HU7A 1A4LA 2BB0A 3TYBA 4E2DA 2CLPA 4BWLA 2XIQA 1VAHA 4Q4SA 3C86A 1VBUA 3W27A 4FXJA 1MRAA 2ACRA 4GMEA 2V5JA 4H6KA 1L6GA 3EA1A 1F6YA 1RD5A 2G37A 1LTDA 1KXTA 1T7LA 1UR3M 4FAPA 2XN2A 5LHFA 4HNTA 3I3DA 2QCDB 3HBLA 2EAWA 3EBVA 3UG3A 2FPYA 3JZEA 4B92A 1UWUA 1VYRA 3OQEA 4DXKA 4KETA 1V6YA 4LAXA 2M08A 4RCXA 1L1PA 5J04A 4Q6JA 5FJUA 4ZQOA 4IX0A 5G4WA 3WDQA 4H7ZA 2ZE0A 4C6DA 4ODOA 2VX4A 2G3NA 3F1QA 4RV8A 3SJNA 4I90A 3BDKA 2ZX9A 4HNCA 3M0KA 2CYGA 4CU7A 1UUOA 3BLEA 5A2BA 3SCRA 4EVZA 4XAPA 3AZSA 3R43A 2HS6A 1EDQA 4JD4A 5C55A 3C2EA 1R9ZA 2PGEA 2INFA 1OGSA 1TWWA 4XBSA 1KBIA 3UWUA 4DELA 1VHCA 3UXDA 3QMSA 2FPVA 4JTAA 3LTSA 2R14A 3AFBA 2V9DA 3GH7A 4IFRA 3PANA 1PTGA 3ZMRA 1XDLA 1I1WA 3N1AA 3OLGA 1WBJA 4NRRA 4GVGA 1ISWA 3HZ3A 4I7WA 1YADA 1TZ9A 1U2YA 2KI3A 2ZWYA 2C13A 3GVVA 1GOMA 4AYGA 4W9QA 2QMKA 4PUUA 3F4DA 1LJYA 5FJPA 4D6DA 3DFQA 2Z7GA 1ITUA 1JQXA 4GYPC 1JQVA 3ATYA 1B3VA 3B9DA 1PZ3A 4R27A 4F8XA 3AS1A 3FYPA 4X0VA 2OEKA 4PTNA 3KUMA 1DORA 3F7JA 3L4VA 2QIIA 2FZ8A 5A8MA 4HK7A 1VFLA 2KE0A 5BOEA 4FO4A 5LIXX 3BCDA 3EWZA 1DWFM 5C8BB 2ZA3A 5TBOA 3EWUA 3HO8A 1HJVA 1HKVA 3NQBA 3D5HA 4LC6A 1MNZA 1HJSA 2QGYA 5E6ZA 5G4HC 3EEZA 4X63A 4HP5A 3AXIA 4GNJA 2YCKX 2D1ZA 4C91A 3K46A 2REQB 2QVNA 3QPEA 2E6AA 1UWAA 1FTXA 4GK8A 2NQ5A 4MNMA 1XYLA 1R9HA 4JTIA 7TIMA 1X97A 1UR4A 2Z28A 4GIVA 4RK8A 3ELFA 4FP1A 5BXJA 3CL7A 4DBWA 1FHUA 4US5D 4UWMA 3GH4A 1RZMA 5U4NA 2C71A 1VIZA 5D9NA 3AMGA 3CQ0A 2NVDA 1XH0A 1O12A 1U22A 3NEVA 3MDWA 4TX0A 4LAZA 4W5ZA 4Y9AA 1OYAA 2QUUA 5DMNA 3N12A 4ODNA 4GC4A 5E9AA 1C8VA 3KE0A 4B5SA 1W9DM 4NY2A 1D6OA 7TAAA 1H3GA 2VCAA 4GUHA 3RCNA 4XD5A 4NSBA 1PIGA 3AIRA 5FEZA 3MT1A 1FCQA 4JFVA 4S2CA 2Z00A 4A05A 4KEUA 4J3WA 2Y8VA 2WHMA 2XPBA 4LS0A 1ME7A 3GDLA 3T2QA 2WWCA 3SCWA 1R2RA 1LBMA 2IMRA 2VEKA 2X1UA 4NUWA 1H51A 3KAOA 3ZJ6A 5HW7A 3IJQA 4KGLA 2HV5A 3UETA 2D3LA 1CLXA 1OABA 5CC7A 5E5CA 3SY1A 3VX1A 4JTKA 2J7DA 1UZHA 3RR4A 1OJXA 5HMSA 2FTPA 1JFXA 4KRZA 3WQDA 4DBDA 1F05A 5D30A 1OD0A 3EOEA 1TPEA 2GUBA 3FAWA 1W2PA 2ZC1A 3FK4A 3P80A 1S2VA 4J9JA 2LLEA 2V2HA 3PJWA 3ZM8A 3VYLA 1IT7A 1UIOA 1DXIA 2RGMA 3P8IA 3HQPA 4GHRA 1SFSA 3MBDA 3ZLFA 4R88A 1V6UA 3P2VA 2YBVA 1DQUA 4O17A 1GONA 4TR9A 3CQIA 3S46A 3W73A 5BRQA 1KB3A 1JCXA 1REQB 3W02A 1TE1A 1V3IA 4AW7A 3ANVA 1CEOA 2DV0A 3HFTA 4XKMA 4QEEA 5REQA 2J7CA 4Q7BA 3NG3A 3IGSA 2GGEA 4AIBA 4JX4A 1XRTA 4G56A 1E0WA 5LGZA 2YGYA 2MNRA 1LG1A 3TYAA 4LPCA 4QE5A 3UR7A 2I5GA 1NELA 4CUCA 1S2WA 2WMJA 3EOLA 2A7NA 3OLIA 3EDDA 4K7YA 3V36A 5XIMA 1KQYA 2R9RA 3WK1A 3TTYA 2NUYA 1AK5A 3W7GA 1BF2A 3VO0A 2X0HA 3A3XA 4L9XA 5HATA 1E72M 4JCLA 5HTGA 1F3XA 1NDYA 4EXBA 5H8PA 1AMYA 1WDDA 1XBVA 1FWJC 1GYNA 3KOYA 3I7SA 4Q8MA 1JG9A 4E8GA 4C90A 4HMEA 3QZAA 3SRFA 1FBAA 2WSRA 4IMFA 3VIPA 4UTHA 2NSOA 3RO8A 2GOKA 1TZZA 4M56A 2OSYA 1SJBA 4MOZA 3W6MA 3LN3A 3FYOA 4MM1A 4DVOA 1HXVA 3K1GA 2V3DA 3W1TA 2DY3A 5CZKA 3H2AA 3L2MA 4WLCA 3PAJA 4Q8WA 3S47A 1WBHA 4QG6A 2VEFA 5T8GA 1GOXA 1EX1A 3BAIA 3G0SA 1GYLA 3GSMA 3LXAA 4E8CA 4YWSA 1ZGDA 5IRPA 2J78A 1SFLA 2V69A 4NAFA 2XFWA 2MLZA 1K03A 1RQBA 5C7HA 2D2GA 1CGUA 4V1XA 3UI6A 3QKEA 1DJHA 1BTMA 3VFCA 3CM4A 4MJ2A 2GVGA 1E6SM 2FMOA 5D09A 2P3ZA 5FSEC 4C5ZA 2C1HA 6ALDA 2W27A 2WPBA 3GVRA 1DOSA 1GJUA 4QLJA 1TCDA 3DZ1A 3PY2A 4KRUA 3VNZA 5JBFA 4UUIA 5D04C 2JFEX 2R82A 3LLDA 4Y8FA 2NQJA 2W79A 1I2QA 3BURA 3O5QA 3TJLA 2HPIA 1NWTA 1PZ2A 4PMNA 1M03A 3PZIA 1L9WA 5FJOA 1ZQ5A 2JK2A 3DYOA 3PVFA 3STCA 2OYLA 2J88A 1PINA 3LXCA 1VBRA 4NYYA 5CPSA 1MQPA 3VKJA 4QJ3B 4ROQA 4U3CA 1DJNA 3G2GA 1O7AA 3WMBA 1H41A 4MVAA 1CENA 4IG2A 5DITA 3F4NA 3URQA 1PPIA 1GVFA 4HHPA 3PPFA 1E9YB 3O15A 4TVCA 3LCWA 1IZCA 4Y9MA 2C1GA 3F5KA 1N7KA 1XSIA 4IIGA 2ZZ5A 1Q2SA 2GSHA 4IL0A 1YW5A 2HXTA 4U5IA 1X1NA 3CU2A 4JTSA 4G2PA 3TQ0A 1W9VA 4J4KA 4DF2A 5F2IA 1BKHA 3IARA 4L1WA 4AZBA 5HAOA 2QGHA 1D7IA 3O8AA 3W4RA 1GVQA 3DECA 3EX3A 2FFCA 1NEYA 3SUWA 3A12A 1I75A 2PFHA 1H60A 3PZOA 4MG4A 2F6KA 3AICA 2PPNA 3BQ6A 1P7TA 3WLLA 1RQEA 3NL5A 4XIMA 3LSBA 2YZRA 1K7EA 2ZQUA 2MLXA 2W91A 4NF7A 1PX8A 3EOUA 3QGAC 3I10A 5FF4A 1L8PA 3QHNA 2VC7A 2P1FA 3ZLHA 1LOQA 3GTXA 4MWAA 3LBOA 3VCRA 2CLOA 1V77A 2GJNA 4QG8A 2HNEA 3QPZA 4LCRA 2J74A 3VIJA 3ALFA 3QFEA 4HSOA 3HJEA 3VM7A 1Y5VA 2YYUA 4L1XA 4LUTA 1UKOA 1E44A 1FAPA 1KTBA 4QX4A 4DJEA 3T8LA 5HA7A 3CHVA 2ZRYA 3BWWA 2V38A 3EXRA 1IXQA 4S3GA 3KZSA 2XFFA 2HE5A 2BHZA 4J4NA 1IEIA 4ZB0A 3W1RA 2VXNA 4LNYA 1AVAA 1H5YA 4DRHA 5DIVA 1E6QM 4JX6A 2QNEA 1P6WA 4NJGA 1QI0A 4LBRA 1IXPA 1JUEA 3VM5A 3TVAA 2MF9A 3VDCA 3V5OA 1PX3A 4IJCA 1J0JA 4AD2A 1Y5WA 4PMYA 1V6XA 4E2BA 4P8VA 2HK1A 5CAKA 1F61A 1GEHA 4M0XA 4J3XA 1KRMA 3PHAA 4LCSA 2ZYFA 4G1KA 4RDYA 3UERA 3UD6A 1UBPC 1AQHA 1EBHA 4HT3A 4C6QA 1K3UA 3VD5A 2ZC8A 3OPSA 3UWVA 1O1HA 4MUZA