3AQUA

Crystal structure of a class v chitinase from arabidopsis thaliana
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
344
structure length
344
Chain Sequence
TVVKASYWFPASEFPVTDIDSSLFTHLFCAFADLNSQTNQVTVSSANQPKFSTFTQTVQRRNPSVKTLLSIGGGIADKTAYASMASNPTSRKSFIDSSIRVARSYGFHGLDLDWEYPSSATEMTNFGTLLREWRSAVVAEASSSGKPRLLLAAAVFYSNNYYSVLYPVSAVASSLDWVNLMAYDFYGPGWSRVTGPPAALFDPSNAGPSGDAGTRSWIQAGLPAKKAVLGFPYYGYAWRLTNANSHSYYAPTTGAAISPDGSIGYGQIRKFIVDNGATTVYNSTVVGDYCYAGTNWIGYDDNQSIVTKVRYAKQRGLLGYFSWHVGADDNSGLSRAASQAWDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords At4g19810
publication title A class V chitinase from Arabidopsis thaliana: gene responses, enzymatic properties, and crystallographic analysis
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 120
structure length 344
sequence length 344
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3aquA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3aquA01
3NDZA 2X8RA 4CCCA 3L2MA 1UZ4A 4PTMA 2EEXA 1KBKA 2XG9A 3ZR6A 2VRJA 3TTSA 1WB0A 5I77A 1BYBA 4BQ4A 2V3FA 1MXGA 2VCCA 2DGAA 3WEMA 2VRKA 2EQDA 6TAAA 2BNJA 3OLEA 1HJWA 1UR9A 2W61A 2Z1KA 1PX4A 2GDUA 1J18A 3M7SA 1X6LA 2DSZA 1IV8A 5ABGA 4M1RA 1LWHA 1UH4A 1TR1A 1OGGA 1ZB5A 3D5HA 1M03A 2FH6A 1DWJM 4PEEA 2D3NA 3AIUA 3NSMA 5CPQA 4CN1A 2WKGA 1O7AA 1GONA 4V27A 3BSHA 5A6BD 4F9JA 2XSAA 3WENA 4UOJA 2IUZA 2GDVA 5A2CA 1JZ5A 3BAIA 1E0XA 5I78A 1JZ8A 1CEOA 2DH3A 4IM4A 2X05A 1JZ6A 3GM8A 5JUVA 4QAWA 4GIAA 1V6WA 1W3LA 2QPUA 1OM0A 4UNIA 3ZIZA 2G8ZA 3ZJ8A 3PZMA 2XTKA 3VD9A 2PC8A 2F2HA 3SUWA 1FH9A 4GI6A 4TVDA 4C7DA 3M46A 1EQCA 3UG4A 2ZOXA 1VFOA 3SCVA 2V3DA 2BVDA 1MQPA 4RE3A 2CHNA 3ARXA 1EDTA 1H3GA 3WKZA 1MQRA 3W38A 4CD5A 3SUTA 3TTOA 3OGRA 4D6HA 1HT6A 4Z2LA 4HP5A 2W4XA 2ESCA 1GQKA 1N82A 1C8XA 5TD4A 5GNYA 2GK1A 1JI2A 1G9HA 3AICA 4P7QA 4AD0A 2VZOA 1E9LA 4ZEPA 4NF7A 2DT1A 3L4TA 2VC9A 4W7UA 1G0CA 1GOKA 3T2PA 3PTQA 2ZUMA 3NJ3A 3E1F1 4QLJA 3AS3A 1J12A 1DHKA 5CSUA 2D22A 5AYIA 4OJYA 1J11A 1C7SA 1J0HA 2E8YA 3T2QA 2YDRA 3GH7A 3PTMA 2WLYA 1BF2A 4Q7NA 1EO5A 1CXFA 2XGIA 3IJ7A 3CUJA 2A3AA 1HN1A 1JYWA 1ECEA 1E1FA 1I75A 1HVQA 1DWHM 1HJSA 1XGZA 3A47A 3QHOA 4LYRA 3VDBA 2WVTA 5GPRA 1KQZA 4W93A 3CMGA 2X0HA 1K9FA 2XVNA 2CERA 4J27A 1E43A 1GCYA 1EIBA 3QOKA 4AZ6A 3BAWA 3CPUA 2OSXA 3RJXA 2E4TA 1UOKA 1PX3A 4F79A 1JGIA 3VIIA 1ZJBA 3ALGA 4WSKA 2CKRA 3KWXA 2VVSA 2WMJA 4AW7A 1CXLA 3TTYA 1JZ7A 1XYFA 3J7HA 3FAXA 1XH1A 4LQ1A 2WMIB 2ZUTA 4AZ5A 3ZJ6A 3BXWA 2WKLA 1UD5A 4HU8A 5JBDA 2WVVB 2E8ZA 4AZIA 3TP4A 4J3UA 4DWSA 4YPJA 3VDHA 4AIUA 1VJZA 5A2AA 4JHZA 4ZFMA 5JIWA 1BPLB 1VRXA 1BYDA 4HZ6A 1H41A 3N17A 4MAZA 1W1YA 4ACZB 4A3YA 3VTRA 1O6IA 1UR4A 2EO7A 4P7LA 2BVTA 1UKOA 2DT0A 4PUEA 3CMJA 3MUZ1 4AD4A 2VX5A 4AZHA 3I3BA 3MV01 3WELA 3WDQA 3VIFA 3THDA 3T0DA 3SCNA 1CXHA 3B9EA 4JZ5A 2VZTA 3CLWA 3OGSA 1J9YA 1OCQA 4B9YA 2PWEA 1HP4A 2CBVA 2J7BA 4M8UA 3ZSSA 4OUEA 2WWCA 4CVUA 2ZE0A 3SUSA 4PMZA 3OZOA 3KEHA 1DWIM 2CCRA 4UFMA 3WH6A 5GQBA 2X0YA 4KRUA 4V28A 3PZ9A 5DF0A 1OSEA 2JEQA 4UTFA 3WQ4A 3CBWA 1MFUA 2ZIDA 3SIMA 1KFWA 1HX0A 1UQYA 3AXIA 2YA0A 4MB5A 2VX4A 1HVXA 1SR0A 5BRPA 3CZ8A 4AD1A 4WKFA 5ABFA 4X0NA 2W62A 4JKKA 3SCWA 3RJYA 1CLVA 1XD1A 2ZWZA 5E70A 1SYTA 2G3NA 3G6MA 3RM9A 5BXTA 1RP9A 1C91A 2VX6A 3TA9A 1VFMA 2CETA 4JFTA 4NRRA 1C8QA 4HTYA 1PIGA 1A3HA 4GI9A 3WF4A 2W66A 1GJUA 1LQ0A 3OLGA 1QOXA 2QMJA 1M01A 1MW0A 1MVYA 4AD2A 2ZUNA 2RGMA 4WK9A 1ISZA 4H2CA 5DMYA 3KL3A 3NDYA 4AIEA 1B3YA 4L4OA 5I23A 3RCNA 4BZYA 2WLZA 1OB0A 2WZHA 4RE2A 2TAAA 1W1VA 3VIOA 1H5VA 3WDJA 1WZLA 2PBOA 4GO8A 2PWHA 3AMGA 3ARUA 4U2YA 2FHBA 4CN4A 1MXDA 4A4AA 2OYLA 1V6VA 2J77A 4UQ9A 4JFWA 4F8XA 4LX4A 3MANA 3K8MA 4W5UA 1QW9A 4DM2A 2VVNA 2VR5A 2J7EA 1WAWA 4GI8A 1C93A 3IJ8A 4M81A 1ISVA 4W8LA 1UD3A 2VUYA 2C7FA 2NT0A 5HPCA 4F9DA 5M3WA 2VCAA 1ISWA 5IHRA 3W6LA 3WNKA 5C8BB 2WYSA 1Q6EA 4DWSD 1CDGA 2XFYA 4E8DA 5E09A 3ARSA 1BYCA 3GXFA 3MMDA 4R5EA 1KXTA 3ALFA 1E6PA 2BXYA 2YA2A 4JIEA 1V3KA 1BYAA 4EANA 3UESA 2J25A 3WDIA 1E6SM 3WNLA 1S46A 3WMSA 5A6BA 3AMCA 3RMEA 2DIEA 2DT2A 3ZOAA 4Z2IA 4J3WA 2PB1A 2D0FA 2WCSA 3L4VA 3A6OA 4GQQA 1KB3A 3WF3A 3MMWA 1LLOA 1XC6A 3AMLA 2WNWA 4UCFA 3N12A 4XX6A 4J3XA 3BCFA 2PBGA 2WHJA 1B31A 4Y7EA 5IDIA 4EKJA 3L4YA 2BHZA 1EHNA 4CD6A 1OT2A 1W9PA 1H11A 3SCSA 1KQYA 1KXVA 3UETA 2W67A 3TTQA 3WEZA 4QLLA 2J47A 1MW3A 4H7VA 6A3HA 2ZXDA 2GFTA 1LL4A 4WJXA 3WQVA 5A6LA 5A8PA 3AI0A 2E3ZA 5GNXA 1MW1A 4PUDA 2ZXBA 3AYRA 3VGBA 1WPCA 3VUPA 1J0KA 2E9LA 2D23A 2JE8A 4AISA 4AZCB 3O2LA 1UD4A 1CTNA 1GQIA 5CXPA 1HKIA 5HBFA 2FGLA 3BAYA 5A8NA 2V38A 3N11A 1WDRA 2WSPA 4MTVA 3MUAA 1BGAA 1UHVA 3EBVA 3LPPA 3N9KA 2ZUVA 5GNZA 1BTCA 2FHFA 2VCBA 1KR1A 3MSGA 4BQ3A 1E4MM 1TG7A 4AXNA 4ACYA 1G1YA 4J28A 1WNOA 4D6DA 4QCFA 4OIFA 4JKLA 1UD6A 1M7XA 1CLXA 3QHMA 3GDBA 2YDSA 3NSNA 3NCOA 2WHKA 1QI5A 1JNEA 1BFNA 2AOSA 2BHUA 2YJQA 4CKQA 1KBBA 8CGTA 3AIBA 4UOZA 4QCEA 4AWEA 1GPFA 4U3AA 1PBGA 2DSVA 5LA0A 3AXXA 2DSUA 1B3ZA 4E4PA 1UKPA 3QOMA 7TAAA 1BVNP 1KXQA 2WZIA 3GXMA 4W86A 5DT7A 1JZ2A 5M17A 1E5NA 4XZWA 2BS9A 3BGAA 1E56A 2V5DA 1FFRA 2CBJA 3BLPX 4JFUA 3II1A 4M56A 3L4WA 4FLSA 1PEZA 3ZJ7A 4HPHA 2VZUA 1CGWA 3WD1A 3VGGA 2CPUA 2CNCA 3ARRA 3K4AA 2WVSA 4B3LA 4W7VA 4KMQA 5LA1A 1UWUA 2ZX5A 2VZSA 3L4XA 4U31A 2BV9A 3FW6A 5F7UA 1AVAA 3W81A 2WC7A 4IUGA 4PMRA 4D1IA 4HMCA 1WKYA 2E40A 1Z32X 3T2OA 3EDEA 1E15A 5C70A 3VGEA 4W84A 1I1WA 2ZX9A 3DHPA 4WKHA 1J10A 1QNOA 4AYSA 1JD7A 2YL8A 1WDQA 1E3XA 3BMWA 3WNNA 3OBAA 3WBEA 1TVNA 4BA0A 4P7NA 4JL1A 3W4RA 1XRVA 5HNNA 2G41A 5ECUA 4U5IA 5CQ1A 4RE4A 3MUY1 1Y7VA 5E9AA 2VMFA 3KE0A 3B8SA 3CZLA 3PZGA 5JBEA 2Q8XA 5FKYA 1QW8A 2VT0A 2WMIA 1E0WA 4CU8A 1X1NA 4PSRA 1KGUA 2MANA 2HVMA 2WVVA 3VKKA 4QFUA 1JF6A 3GZAA 4Z2HA 4X9YA 5DT5A 2OLHA 2EPOA 4Z2KA 4GKLA 3WD2A 5BXSA 3WDHA 2J62A 3WQ8A 4AZ7A 3ZSTA 2OWCA 3PZOA 4WKAA 5HPOA 4ACZA 3MSDA 3SCTA 3WEOA 3U7VA 3GH4A 1HKMA 2ZXQA 3NIYA 1CGYA 3VINA 4W88A 2J7DA 4UFKA 3F5LA 1HJVA 4QLKA 3WDPP 3NUKA 3OLIA 1HKJA 2O9RA 3PTKA 2CBUA 3K46A 3GNOA 2GJRA 1LG1A 1V6YA 2WMGA 1JNDA 1JF5A 1TA3B 1NM9A 3SCUA 1K9DA 2O9OA 3APGA 1WZAA 1QNSA 2JIWA 2WWDA 1ITCA 4MB4A 3WF2A 2YDQA 2J7CA 2VURA 4CU6A 3CZJA 3WQ6A 4HA4A 4ATLA 4BF7A 1W3HA 3RM8A 3WH9A 1AMYA 2BFGA 4FLQA 2FGZA 2V3EA 4K68A 3UG5A 2E9BA 1UKSA 2GJXA 3WQWA 3RM4A 1NH6A 3OLDA 1ZBKA 3WUEA 2ZUSA 1HXJA 4BQ5A 1D2KA 5D4YA 1WDPA 4MNMA 1OBAA 2XIIA 4D6IA 3VD5A 1F4HA 4MADA 1WO2A 2EPLX 3MV11 5D9NA 4AD5A 5ABHA 2VTFA 1NP0A 4PBGA 1K9TA 1WZKA 3T08A 4OBSA 1YHTA 3CO4A 2WBKA 4CD7A 5I3DA 4L4PA 3ZT7A 4URIA 2D0GA 2J78A 1PAMA 1FOBA 2W63A 3K4DA 1EA9C 4D1JA 2BY1A 4Z2JA 2J4GA 1CPUA 2WMHA 2CXGA 2XM2A 1CZ1A 3HU7A 5CSYA 3SCRA 1H09A 3ARWA 4GO9A 4W89A 1E73M 9CGTA 1ODUA 2UY2A 1WP6A 4PMQA 1R85A 1CENA 1H4PA 4LYQA 2D0HA 5BXRA 3W37A 1VJSA 3WBAA 1R8LA 3ZT5A 3GBDA 4D6JA 2ZX6A 1QVBA 4MJ4A 3WD0A 2WZEA 4QDMA 5EB8A 1X6NA 4P8UA 1EOMA 1E6ZA 2W92A 2IXVA 1J0ZA 3EMZA 5HDRA 3RIKA 2WANA 2YKKA 1NOUA 4N42A 2E0PA 2V3GA 2X2YA 1OIMA 2DDXA 1R7OA 3POHA 3SEPA 1NWSA 1VIWA 4RL3A 3DYMA 2GK1B 1SFSA 1VFFA 2YL5A 1BHGA 1JFHA 2VL4A 3VU2A 3ECQA 1B0IA 1JIBA 3ARZA 4P8VA 3AISA 4XUYA 2YOCA 3EDJA 3VIHA 5I24A 4U3CA 4UQCA 1H2JA 2XYLA 3AIRA 1V6UA 2GVYA 4TTUA 3VDCA 2DT3A 4PN2A 2YA1A 3CZKA 3VVGA 1CIUA 1U30A 2WMFA 3WD4A 3EYPA 4HPGA 3FAWA 3AIEA 1E72M 3HJEA 3CUHA 4OOUA 1XSJA 2OWWA 3FHAA 1HL9A 2Y5EA 3CZEA 2IXUA 4PMNA 5I6SA 1GHSA 2YL9A 3VX0A 3VX1A 3ZT6A 4TTGA 2J7HA 1JDDA 2Z1SA 1RPKA 2JEPA 2YIHA 1H49A 5A6AA 1UR8A 2Y8VA 3AZRA 3AS2A 4W8BA 3UR8A 4PMVA 4AMCA 4DUWA 2WB5A 1W9BM 2OYKA 1V02A 1DWAM 4JHOA 2WHMA 1BLIA 3CHFA 3AHTA 4TX6A 1GOMA 2WBGA 4JFVA 3LPFA 1XV8A 4JKMA 2XVLA 1E70M 1NOWA 1RP8A 4TVUA 1E4LA 1OD8A 2PF0A 5KEZA 2BY3A 3AMKA 3THCA 3VOCA 1CXKA 4S3KA 3SUVA 4WLCA 2XWEA 4JL2A 1ZBWA 1PX8A 2CBIA 1CGXA 2UY5A 1M53A 1HP5A 1UD2A 1JYVA 1YQ2A 3U57A 3AZTA 2AMGA 4ATWA 1GW1A 3CHEA 1QHZA 2XSBA 2CITA 5FD0A 4NZCA 4MDOA 1ESWA 2JFEX 3WN6A 2C8NA 1PJ9A 1K6AA 3WUGA 1CGVA 1QNQA 1UYQA 4UFJA 3SUUA 2WC3A 4PSPA 3CH9A 3G6LA 1EXPA 4MNLA 1MQQA 1QI0A 1JZ3A 2XIBA 4AZCA 1PZ2A 2YL6A 3MKKA 3W0KA 1BAGA 1JYXA 3OB8A 1IZJA 3O6AA 1XHGA 4P7OA 3CUGA 3AHYA 1D7FA 4D72A 4YN5A 1V6XA 4MAVA 2AAAA 2ZXAA 5LA2A 2CKSA 2Y24A 2F61A 4B16A 4JCLA 3LPGA 1ZBCA 1JAEA 2JALA 1BSIA 1MW2A 3WNOA 3NYDA 4OKDA 1W1TA 1QI4A 2EPNA 4PMYA 1LF1A 1Q4NX 4ZENA 5C71A 3IAPA 3ZM8A 2YBTA 1PIFA 5A95A 3VIMA 2J8GA 5E0FA 3MS8A 3VD3A 3PZQA 3BLKA 5CLTA 2D2OA 5D8WA 3CIVA 2EXOA 1RD6A 3JUGA 1R86A 5DFAA 3BAJA 2NSXA 3WF1A 3DYOA 1BG9A 1ZBVA 1NARA 2OYMA 2XFRA 1E40A 3EMQA 3AMDA 3WQ5A 2XVGA 2F8QA 1EGZA 4QP0A 4HZ8A 2G3MA 5D9PA 5ABFB 4OBRA 3KL5A 1LJYA 1HNYA 1BQCA 2QF8A 3GBEA 3IJ9A 2VQUA 3IANA 1J0JA 4CD4A 2X1IA 1ZS2A 1DEDA 1VEMA 1E6QM 1OINA 1V02E 4HA3A 1TE1A 3N04A 3AHVA 2NT1A 1MYRA 1QI3A 2ZICA 2D20A 1HJXA 2VQTA 4MB3A 5JH8A 1TFVA 3ARQA 1LWJA 2FDMA 3FY1A 1JDCA 1GJWA 3CHCA 1CXIA 4PRWA 1W3KA 3O9NA 2WXDM 5BXPA 3WY1A 2PI6A 5HOSA 4KGJA 3AFBA 3PN8A 1UKQA 2VNCA 4BQ2A 3SURA 4D6GA 4Q22A 5A8QA 1UWTA 4H8HA 5M03A 4PMXA 2G3JA 3AS0A 3KZSA 3WMCA 1JXJA 3WNMA 3QR3A 4M80A 1GORA 3VIJA 4UZUA 1B1YA 4HMEA 3WL0A 1VF8A 1UR1A 2QLYA 3VNZA 3UERA 3PBGA 2XFFA 1H0IA 3K8LA 1UQZA 1EQPA 4IPNB 1LG2A 1W9XA 2C0HA 4M24A 2CESA 4UFHA 1Q6DA 3F4VA 3IK2A 4D6CA 1W9UA 1SMDA 4PYSA 2EPKX 3VD4A 3U5UA 2XM1A 1KGXA 3N18A 1UWQA 3N1AA 3CHDA 2DSKA 4CVWA 5AC5A 3EMCA 1KCLA 4Z2GA 1US3A 1JXKA 1E6RA 4CCDA 1E5JA 2WW5A 4ZE5A 1UWRA 4B3KA 1OD0A 3U5YA 4PCSA 2OSWA 3VIKA 2Y4SA 1FP9A 3IAQA 2XHYA 2WSKA 5A69A 1XH0A 2HISA 4HMDA 4H8UA 2XWDA 1KCKA 3CUFA 3VGFA 4HU0A 1VEPA 2ZUUA 3MU7A 1UA7A 1CGUA 2ZX8A 4AD3A 4HOXA 3M6DA 3GNPA 2VZVA 1TA3A 1FP8A 3KL0A 3FXYA 3LMYA 2ZWYA 4C7FA 1G01A 1XSIA 3WDRA 2VJXA 1A47A 3W53A 2ZX7A 1KWGA 1TMQA 3VNYA 4U5KA 1VBUA 3WF0A 1R87A 4PMDA 4S3JA 3PZIA 4H04A 3OA5A 3WL1A 1UWSA 1QI2A 2WC4A 2G4FA 3AXHA 4XV0A 4D6FA 1E55A 3DECA 3PZNA 1B3XA 1UUQA 3K1DA 3EDFA 1W32A 1AQMA 1C92A 4KRTA 4BS0A 3CUIA 4MPKA 1V0MA 3VM7A 1QBBA 3NSXA 4LYPA 1J01A 4LGXA 5AC4A 1NWRA 3UEQA 2ZUWA 2VO5A 5BYWA 1QHOA 4UFLA 3AOFA 4FF5A 3N13A 1V3MA 3QHNA 3VGHA 1NQ6A 1GVYA 5A94A 1OT1A 1HJQA 3GYCA 1BGGA 4HOWA 4U2ZA 3BSGA 3QGVA 1UWIA 2BY2A 5A6JA 3I3DA 2VR4A 2QV4A 4UQAA 1XSKA 2OWXA 4TVCA 5KZ6A 1OIFA 3DHUA 2V5CA 2Y8KA 1KR0A 5EBAA 1ISYA 3TONA 2GSJA 4H8VA 2W5FA 5BCAA 1CXEA 4ML4A 4AIOA 5E0CA 4LXFA 2O92A 4PCTA 4N0RA 5BRQA 3VIPA 1QHPA 3UCQA 2UY4A 2B31A 3MO4A 4IPLA 4JAWA 2D3LA 5A8MA 5FCZA 4JFSA 3T0AA 1CGTA 2GJPA 3S6TA 4HA1A 5FIPA 4P8WA 2CEQA 3TOPA 4H41A 3ZO9A 4DM1A 2D1ZA 5A3HA 1W2VA 3SCPA 1US2A 4A3HA 7CGTA 1V3JA 3OG2A 4CU7A 4GPNA 3U7BA 1I1XA 4TX8A 1SMAA 1W91A 1GHRA 5I5RA 1E1EA 2WMKA 3HMCA 5A1AA 4HZ7A 1IZKA 3VPLA 1UR2A 5DO8A 3A3HA 5I2UA 1TVPA 3W27A 1M04A 2VX7A 4XZBA 4DUXA 4ZXLA 3VD7A 2BXZA 4CD8A 4UOQA 2YLLA 4PMOA 1PZ3A 1LL7A 3A4XA 3ZR5A 5A2BA 4DWSC 1V08A 3EDKA 5D9OA 1EDGA 4UQEA 1WCGA 5AY7A 4W8AA 3ARPA 3ARTA 1HJUA 1V3LA 5M5DA 5A6KA 2WM0A 4EK7A 2A3CA 1NWTA 3AIVA 3PHAA 2J7FA 2O9TA 1VB9A 1JZ4A 1V3HA 3GTNA 1FA2A 1C90A 2J7GA 2WVUA 5IFTA 1E6NA 3I3EA 5A6MA 4HOZA 1E71M 1HF6A 2XJ7A 1IT0A 1JD9A 5ABEA 1UA3A 3FNDA 4DUVA 1V3IA 3RPMA 3RILA 2VOTA 4UQBA 3L4ZA 3F5JA 4FLOA 2FH8A 5D8ZA 1B30A 1P6WA 3WNPA 4NI3A 3WUFA 4UQDA 2BHYA 3SCQA 3T0BA 2EPMX 4GQRA 3ARVA 1H1NA 5EFDA 4NSBA 1W2PA 1B9ZA 1GOOA 2GUYA 2WAGA 2A3BA 1W9VA 4GINA 3ZJKA 4MB1A 5AYBA 3L2LA 3K8KA 4U33A 2BVYA 3N15A 4B15A 1QNRA 3WH7A 1RH9A 3AZSA 1XH2A 2DSWA 1JL8A 2OSYA 3ARYA 2JF7A 4TXEA 5E6YA 4FMVA 4OOZA 1TCMA 3SCOA 3AHZA 5FOOA 5HXMA 3OGVA 3WIJA 3WD3A 3F5KA 2PWDA 2UY3A 2CIPA 1ITXA 7A3HA 3MMUA 3A4WA 2XGBA 4TOQA 1GOQA 1JG9A 3S2CA 4M29A 1Q6GA 4AC1X 3LPOA 3BAKA 1JYNA 3POCA 1CYGA 1UH3A 1JI1A 5I0DA 3GXDA 1GNXA 1TZ7A 3BC9A 1HIZA 3VILA 4ATDA 4GZEA 4MJ2A 1W3JA 3EDDA 5CPTA 1C3FA 2D24A 2WPGA 3WH8A 4GZJA 3MUIA 3GXIA 2PWFA 1GQLA 1L8NA 4B9ZA 1G94A 1FHDA 5CGTA 5FL0A 4CCEA 3GNRA 1CECA 1VEOA 3W25A 3BAXA 2UWFA 1VAHA 1H0GA 1U33A 4PTVA 3W28A 2A3HA 4D6EA 1GUVA 4W85A 1ISXA 2Y2WA 4XB3A 2GJXB 3FHQA 3VDAA 4CUCA 8A3HA 1AQHA 5IFPA 4UR9A 3VGDA 2WCAA 4ZE4A 1GQJA 2WCGA 1GOWA 4WSJA 1V0NA 1ZJAA 6CGTA 1E6XM 3B9DA 1G5AA 2YBUA 1EOKA 3PZUA 5CPSA 1GVIA 1K9EA 1FH7A 4KGLA 2NW0A 3OZPA 3BMVA 1CBGA 4W87A 4PMUA 2RGLA 1L0PA 1OGBA 1WE5A 4ZXOA 4F66A 5I79A 3AHXA 1UH2A 3ZMRA 4DWSB 1AQ0A 1B2YA 1KGWA 3W82A 5CG0A 4KWUA 5JBFA 1GOIA 2CYGA 2QMKA 2J74A 3HN3A 4GXPA 2JF6A 4EAMA 3AS1A 1ZL1A 5CZKA 4KH2A 1ZU8A 4FLRA 1OGSA 2QHAA 3PZTA 5A6SA 1QPKA 2JIEA 4P7RA 1PPIA 4TUFA 5EFFA 1E3ZA 3GH5A 1DWFM 4MNKA 1U2YA 2DH2A 1W9DM 3DC0A 4V2XA 5IHSA 1WZMA 1MFVA 4M82A 2XPKA 5CLWA 1C8YA 1HKKA 2EBNA 4MNJA 3CGTA 2FHCA 1ODZA 2QPSA 4J3SA 1GZJA 1Q6FA 3CTTA 2X09A 1V0LA 4J3TA 4D71A 3AROA 4X0VA 4E2OA 3VMPA 3CZGA 1FHLA 4YHEA 5FL1A 5D9MA 3VM5A 2EJ1A 4AZGA 1OWQA 1B3WA 3FN9A 1CNVA 1KWKA 4NRSA 3M07A 4GZIA 1B90A 1UD8A 5A8OA 2DEPA 1W1PA 1J0IA 4UFIA 1JAKA 1NP2A 1D3CA 3L4UA 5E6ZA 4BCEA 3UG3A 1NWUA 2E9MA 1HL8A 3WH5A 1VFUA 4W7WA 4P8XA 2PWGA 4R27A 4AEFA 1EO7A 5CJ5A 2VI0A 1EDQA 1B3VA 5BWFA 1UR0A 2XVKA 1VBRA 4JCMA 5EMYA 3W24A 5LYRA 3AQUA 3VMNA 3A4AA 3ZQ9A 3AYSA 4LPCA 3RDKA 3T09A 3VIGA 4AY1A 1JDAA 5DEZA 1Q6CA 3AIQA 1J0YA 3B9AA 3WMBA 1BG4A 2W91A 3WFZA 1VENA 4WF7A 1QNPA 1DTUA 1BVZA 4FK9A 4EE9A 1EHAA 4CGTA 1FFQA 3AJ7A 1UZ1A 1UG6A 4CN6A 3DYPA 1XD0A 2WK2A 4WIWA 5BROA 1FH8A 2DPEA 1WDSA 3W6MA 1R7AA 3WSUA 3UR7A 3PZVA 2J8FA 1MWOA 2DQXA 1KXHA 4IISA 3RO8A 3WFLA 5JIPA 4E8CA 3VMOA 4MDPA 2VRQA 3W29A 1V03A 4J7RA 2WHLA 2G3IA 1C7TA 3D3AA 1LL6A 4YHGA 2XVPA 1CWYA 1V0KA 2BY0A 2A3EA 4AZBA 1E4NA 1DP0A 1DWGM 4UZSA 1F4AA 2CHOA 2YLAA 2XUCA 1E0VA 1EH9A 1UKTA 1TUXA 4C7GA 4W5ZA 2DIJA 1XYZA 3OIHA 3W26A 2J75A 2O9PA 2J79A 1XCXA 1XCWA 3WUBA 1NOFA 5IXEA 4AEEA 5CGMA 3BH4A 1QBAA 3AIWA 4J3VA 4PTXA 1JFXA 1E4IA 4PTWA 3BCDA 3VO0A 4OZOA
chains in the Genus database with same CATH superfamily
3NDZA 3NEVA 3U2EA 4UBPC 3TZFA 4GQ0A 5FAJA 1X7IA 4JTGA 2XG9A 1EGVA 1BYBA 1MXGA 4LVDA 3T4CA 2VCCA 2DGAA 1B3OA 1H7PA 6TAAA 4IX2A 2QDGA 1UR9A 3C2FA 4RNFA 4RNJA 2ZADA 3DFPA 2Z1KA 1J18A 1X6LA 2OX4A 2V68A 4UNLA 5ABGA 1I2OA 1UH4A 1TR1A 2YXOA 5C0QA 2MNRA 2K8IA 1ZENA 4Q8QA 5HJXA 2DVXA 3NSMA 3QY8A 3SZ8A 2IQTA 4V27A 4NQ1A 2XSAA 3VCCA 3WENA 4PUNA 3PRBA 1OCNA 1JZ5A 4GNVA 4FR6A 4CQ8A 3DFNA 2QCLA 1W3LA 4IIHA 1OM0A 4UNIA 3ITCA 3FJLA 2G8ZA 4Z1AA 4WCJA 4K39A 2PEVA 4MM1A 4FIQA 1D3GA 3MKVA 4GI6A 1J4RA 4JFIA 1FKRA 3TC7A 1VZWA 3VZXA 4C7DA 5C6MA 4IT4A 1RBLA 3GLCA 2PLMA 4PUKA 3SCVA 1L1PA 2PDIA 1M7PA 1WKFA 1XLKA 2NQHA 3GZ3A 2I9EA 3A21A 3ARXA 1X1OA 4HB7A 3SN1A 3W38A 2HJPA 3OGRA 2D2GA 2DZXA 4M6PA 3CLMA 4D6HA 1HT6A 2XP3A 4Z2LA 4HP5A 2P5NA 1EUNA 2W4XA 2ESCA 3KCEA 1N82A 4BJHA 5GNYA 1L6YA 4P7QA 1PKMA 3GG1A 3N2MA 5LHEA 3TH6A 3SFKA 2X16A 2HBVA 2ZZ2A 1DHKA 1GVQA 3R0UA 1J0HA 2RAGA 3T2QA 2YDRA 4EF9A 2WLYA 3P62A 2XGIA 3CUJA 2X1TA 1DIEA 1ECEA 1JYWA 1PWLA 4F48A 1W26A 1HVQA 4DJEA 3VDBA 4DJFD 2WVTA 1GVSA 3TLQA 1HG3A 1KQZA 3R8GA 4W93A 3CV7A 2XVNA 2MNTA 4JY8A 5HA7A 4QITA 1GCYA 3QFWA 3QOKA 4PH6A 4TX9A 3CPUA 3CWOX 2OSXA 3SAZA 1K4GA 1PX3A 1JGIA 2BGNE 1DHPA 3O6YX 1N55A 4O1AA 3UXAA 1TE6A 2CKRA 2DZUA 2PUZA 3MI2A 3NOYA 1XH1A 4FALA 3DU0A 1XQLA 3G1DA 2ZUTA 3KOXA 5BWAA 1F74A 1IXPA 2X1UA 2WVVB 4EF8A 4J40A 4YPJA 3KRSA 3DKJA 1KKRA 4KRZA 4DJDD 2HDJA 3MCMA 2QJJA 1VJZA 3UPWA 5T26A 5JIWA 4IQLA 1XLDA 1ZSXA 1BWVA 3BG5A 5K9CA 3N17A 2OLAA 1XUZA 2Y0FA 3EA3A 5GPGA 1UKOA 5I3JA 3UWVA 2QCDA 3W7RA 3CMJA 2AAMA 2QUTA 3WELA 4LAVA 4CNNA 1NU5A 3HPSA 3THDA 3TUUA 3T0DA 1T41A 1A5NC 3W83A 4WHBA 1JEZA 1TIWA 3BL3A 4B9YA 4CVUA 2QDEA 1K70A 1N7KA 5I3KA 4NAFA 1EX5A 4NJIA 1ZNNA 5GQBA 2X0YA 3PZ9A 5DF0A 1OSEA 2ABBA 3WQ4A 1MFUA 3NGFA 4G2DA 4RZ4A 1A5CA 3NQ8A 3W7CA 1HX0A 2WSRA 5C54A 4MB5A 4YNGA 4HHMA 4FOJA 5ABFA 5C2CA 1KFBA 3C3UA 1OYCA 2W62A 1D7HA 2HS6A 3MJMA 3RJYA 3M1ZA 4NNAA 2OXNA 2FZNA 3RR4A 3RM9A 3MVTA 3HG5A 3UGRA 1C91A 2VX6A 3TA9A 3MYOA 4HTYA 2ISWA 2DQWA 5TAOA 4QROA 2ZQ0A 3C2VA 1SFLA 1E9ZB 5K9DA 3ID7A 4ML9A 3TROA 3UQAA 1RPXA 4NZJA 1MVYA 4AD2A 2ZUNA 2GZXA 1K8XA 1WDDA 4WK9A 1IEWA 3O63A 1CCWB 4H2CA 4DBDA 5BXJA 5I23A 3FCPA 3SM0A 2PP0A 4AWUA 1ZZMA 3MUCA 1W1VA 4NNBA 3TC6A 2PBOA 1XXXA 4HBOA 1VHNA 4LRSA 3ARUA 3W84A 2FHBA 4UQ9A 4F8XA 5I09A 3K8MA 1TV3A 2GQ9A 2VVNA 1F76A 2J7EA 4M81A 5LIXX 1LCOA 4A8LA 5HPCA 1XR2A 3DERA 3H9RB 3BO9A 5IHRA 3WNKA 3JS3A 2QJNA 3MWCA 1P0BA 1OG6A 1M5WA 3ALFA 3T55A 5AHNA 3PJTA 5AC7A 4EANA 3UESA 3W1XA 1B4KA 1V79A 3OOQA 3RMEA 2P50A 2DT2A 3C61A 1VD6A 5CZSA 2ZA3A 4Q7IA 5GJNA 2GGIA 3UJRA 4GQQA 2VGBA 4DXVA 2VD9A 3I7QA 1XC6A 2OZTA 1G4SA 3K1GA 4G7EB 3LYEA 4UCFA 3BMXA 4GFSA 4DRIA 1AJ0A 3G1SA 4CQ9A 2PBGA 2NSOA 2Y70A 4HQVA 3LBOA 5I3HA 3R89A 1B31A 1W5PA 1MRQA 1JPDX 1M9HA 2REQA 5XINA 4U10A 3WK2A 1KXVA 2W67A 2ZR4A 3O1NA 1CI1A 1F3XA 5AOUA 4H7VA 2FQIA 2ZXDA 2GFTA 4WJXA 2CXEA 2F6XA 4OUIA 4H6KA 4LANA 1ADOA 3VNMA 2RJGA 2E3ZA 1BWKA 1OC5A 2EULA 2CZEA 2UZ9A 3VZYA 3AYRA 3TSMA 1IYXA 3MQTA 3W7QA 1AK5A 3HOJA 2D23A 2RDXA 1UD4A 1CTNA 5CXPA 1AW1A 2CLLA 2FGLA 2MUCA 5A8NA 3TN6A 4U4MA 3N11A 2JKEA 1F6YA 4MTVA 3EBVA 1FKDA 3E5BA 3PJUA 3DG6A 3N9KA 2PODA 2ZUVA 5FI8A 3PWIA 3VKCA 1BTCA 1XGDA 1PDYA 1PDZA 2Q01A 2Z6IA 3GE7A 3MA8A 2HE8A 3LTYA 4AXNA 4IMGA 2C1HA 2JQXA 4PUWA 1Q66A 4OIFA 2Z2UA 3LDVA 1I9CB 4FO4A 3UWUA 4GCAA 4OHQA 3NSNA 4UMAA 3ZLHA 2XINA 1JNEA 1BFNA 3AXKA 2W79A 1L6GA 4Z1DA 1XIDA 1PBGA 2DSVA 4YTUA 1RLDA 2WJFA 4A29A 1BVNP 1DKWA 2JKAA 4ZPTR 1EPXA 1JZ2A 3G8EA 1E44A 3BGAA 3G77A 4O11A 1RQBA 2CBJA 3BLLA 3R1ZA 1IEQA 4M56A 1UUOA 2VZUA 3IIOA 3ES7A 4I5XA 1CGWA 4ZQPA 3PPFA 3BOFA 3BQ6A 3IKDA 2YCLA 3I6EA 1UWUA 3FW6A 4H7ZA 2F9RA 3W81A 2WC7A 4IUGA 3OVQA 1UP0A 1X96A 1WKYA 2E40A 1Z32X 1ME8A 1HL2A 4ZVJA 2ZX9A 2KZHA 3DHPA 4C02B 1B4EA 1K7EA 1I60A 2Z28A 1J10A 3UU0A 3R4IA 1H61A 2YL8A 4FS9A 4LVBA 4IGHA 3W4RA 5HNNA 4XO7A 1FDYA 3PPCA 3O05A 4JY9A 4RE4A 5G5IA 1R9YA 3BJFA 3MUY1 5E9AA 1XIIA 2VOMA 2VMFA 2GQ8A 2P0OA 1GEQA 1T8XA 1A50A 4DBSA 3QYSA 1DIDA 5JBEA 3QFEA 1JRBA 1YTKA 1QW8A 3QYQA 2WMIA 2B7OA 3IIXA 4CU8A 1T8QA 1RR2A 1FWIC 1YW1A 2QIIA 3G1AA 4QFUA 3GZAA 3DFTA 3RUBL 4HTBA 2Y6ZA 1JCYA 3E0LA 1EEPA 2EPOA 3KOZA 3M0HA 4Z0JA 1FWFC 2IF4A 3SECA 4WKAA 5HPOA 3EOUA 4RDZA 3MYPA 3MSDA 2ZZ6A 3GH4A 5KINA 4BF9A 2OMAA 2PD5A 4Q8NA 3C2EA 2FFCA 1TO3A 2VXNA 4ZO9A 3NQAA 3WDPP 1R9ZA 3OLIA 1HKJA 3WK3A 2O9RA 2CBUA 1L8PA 3CIXA 4NIRA 3BANA 5BU9A 1JF5A 4I9AA 5DCBA 2O9OA 5C9WA 4MB4A 3HTWA 4LOCA 3WF2A 2PDBA 1FKHA 4BHYA 1IR2A 4AH7A 1EQ3A 3N19B 4JFLA 5I3FA 3Q58A 1AMYA 1YDYA 3AWOA 2H3BA 8TIMA 2BWGA 3OLDA 2GJXA 3WQWA 1NH6A 3CQKA 1HXJA 4BQ5A 1D2KA 3H4WA 5I98A 4Z1BA 3EWWA 1OBAA 1O60A 5CG7A 1FWNA 1F4HA 1CT5A 3LGGA 1BXBA 3U8GA 5ABHA 3MUXA 3PG8A 3QJAA 3B0VC 1JCLA 3N2OA 3T08A 2NVAA 4PB5A 4DAFA 2X1RA 4CD7A 3QBUA 1T99A 3S4TA 1BRLB 2W63A 2BY1A 5E0KA 3GKAA 1S5NA 3N25A 3T78A 5CSYA 2HMCA 4GO9A 3LU2A 3KX6A 3FSTA 1XRSA 1WP6A 3WCZA 1H4PA 5CEWA 4LYQA 5BXRA 3W37A 3GAKA 4CNPA 2ZA2A 3WBAA 4DT4A 1XICA 2B0MA 1QR7A 2ZX6A 9RUBA 3GTIA 3PAOA 4MJ4A 2WZEA 4WJEA 3LLXA 1EOMA 4L6HA 1E6ZA 2IXVA 3EMZA 4BY3A 3QKZA 1PO9A 1X1ZA 3EWUA 4N42A 3T8QA 4DBWA 2X2YA 2DDXA 2H3DA 2ZQVA 3POHA 4ODPA 2WQPA 1NWSA 1VIWA 4RL3A 3DYMA 5LGZA 2GK1B 3LGEA 1VFFA 2VL4A 3E2RA 3BV7A 3ECQA 3VOJA 3JU2A 1JIBA 4R0XA 3HFYA 3AISA 3QQ0A 4XUYA 1KV8A 3VIHA 3W1LA 4UQCA 4B5NA 3RFWA 1H60A 2XYLA 4WOZA 1GEHA 1V6UA 2DT3A 1JULA 1KRAC 4EPEC 1CIUA 3S2LA 3QTGA 2QUNA 3R5EA 2WMFA 4O53A 2A7PA 3WD4A 2Y78A 1VFTA 1E72M 4NAEA 3HJEA 1T7LA 1TQXA 2ZRXA 2F21A 3FHAA 2EKCA 2Y5EA 1XDJA 4LVAA 1GHSA 3ZT6A 2DVTA 2Z1SA 1W8SA 2JEPA 4GE8A 2BOEX 2Y8VA 3AZRA 4W8BA 5ENLA 3CQ0A 1W9BM 4GVIA 4C6DA 2WHMA 1XX1A 4TX6A 1ZJIA 4GG9A 2PDNA 2XGZA 4GVHA 3WLMA 2LJ4A 4H1ZA 4NX5A 2OJPA 4DO4A 3NPUA 4QDPA 3FAPA 1CXKA 4HJFA 3B04A 5AECA 3KBJA 3MY9A 1Q7QA 3TR9A 3OHIA 3QF0A 1QT1A 2OOFA 2AMGA 5I3GA 1JCJA 4ATWA 1GW1A 4LUSB 3GTXA 4MF4A 2XSBA 5CSSA 3DEQA 3TC3A 6REQB 4NZCA 1GTHA 3EGJA 4C1KA 1ITQA 2JFEX 1ZJHA 2C8NA 3TC5A 4LEFA 1UYQA 4UFJA 1IEVA 2B81A 2C71A 3CH9A 4MNLA 1MQQA 4H6RA 1S38A 2GOKA 1VBHA 4JYDA 4AZCA 3DH7A 2ZRUA 3W0KA 4LJ3A 3A4JA 3W1RA 1UPMB 1XHGA 3RRAA 3B8UA 3AHYA 1YE6A 2AAAA 4IWWA 1QXLA 1N2VA 2CKSA 2Y24A 3W7MA 4L61A 3PG9A 4UIOA 5EBUA 1BSIA 3NYDA 4OKDA 2ISDA 1QO2A 4G9PA 1LF1A 4IH3A 3IAPA 3ZM8A 3TK7A 3GQYA 1NDWA 1DE6A 1XLHA 3GTYX 2ZZ7A 4M1BA 2J8GA 4HA0A 3EX2A 1OFEA 3PZQA 4Q4PA 5D8WA 3CIVA 5EYWA 5C7HA 4ZSTA 2ISVA 4XSMA 1MO0A 1QWKA 1DQXA 3WF1A 3COTA 1TJ2A 2F23A 4RDWA 1RA5A 1AODA 2XFRA 4Y9AA 1A53A 2ZQUA 2FB3A 4HZ8A 3M0MA 2P8CA 3UYIA 1CB2A 3W2LA 4QJ1A 3VKBA 4GACA 1FTXA 3PPGA 1XC4A 1XIFA 3IVTA 1X97A 3IANA 2J8TA 1DEDA 3CS2A 1VEMA 3REQA 1ONWA 1C9DA 2W6RA 2DUXA 1TE1A 3N04A 1OCBA 3AHVA 1ROUA 4QRNA 3CAVA 2ZICA 1P0EA 4MB3A 3CAWA 5F2IA 1M7OA 4XZMX 2HZGA 2PP1A 1YDNA 1X38A 1CXIA 1JVNA 4PRWA 3H2MA 1W3KA 1LT8A 3BTNA 4O2TA 3VA8A 2PDFA 2PI6A 3N3MA 4D6GA 2E5CA 1XBYA 3A23A 5BU6A 1I8JA 3O16A 3W02A 2GVLA 4MSPA 4XAFA 5KETA 1B1YA 4K37A 2OGYA 3GKFA 2PRHA 4FEZA 1JUBA 2NV1A 2QEZA 4Q7BA 2P53A 4IPNB 3GS6A 3MCNA 1LG2A 1H63A 2QJHA 4H00A 2PLKA 2CESA 1Q6DA 5DELA 1W9UA 4LBUA 1FWBC 4PYSA 3BGJA 2EPKX 3CEPA 3HPAA 3O5KA 4EXAA 1ME7A 5AC5A 3OYXA 1PWMA 3GFZA 1D8WA 1US3A 1JXKA 3K4WA 3CWHA 4ZA0A 4XD6A 2WNQA 4ZE5A 3WLJA 3F7JA 4YCPA 4GVGA 1K7FA 4GMEA 1SZGA 1RQEA 4DJDC 2OSWA 1AQFA 3TQ0A 1FP9A 3CPRA 5AB3A 2WSKA 1KM0A 4H8UA 1KD0A 2XWDA 1KCKA 4Q4QA 3RLHA 1CX9A 5HQMA 3VGFA 1VEPA 2ZX8A 4DUOA 4LRTA 4DI9A 3GO2A 2ZRYA 1TA3A 2P8BA 1Q1CA 3KL0A 4RCXA 3N9SA 3V4BA 2ZX7A 3EEGA 1TJ1A 1TMQA 4TU1A 4U5KA 3HO8A 2Y5JA 3V0UA 1R3RA 3WL1A 3WQOA 3T0TA 4UTWC 2FVMA 4ODLA 1XBXA 1MDLA 1XIEA 3K1DA 1VKFA 1M5YA 2J6XA 3QN3A 1QBBA 4B5SA 1YMYA 4LYPA 1E1CB 3M47A 3TQVA 3DCPA 2Q8LA 4KETA 3G1XA 1WBHA 2L2SA 2KO7A 2ZBTA 4JTJA 1GJPA 2VO5A 3IS4A 2YCKX 1TZ9A 4FF5A 3CASA 3S0CA 1S2CA 3N13A 1S2AA 4JQ3A 2IQDA 3VGHA 1R0MA 1GVYA 4AYGA 4KCVA 1HJQA 3GYCA 1BGGA 3F2CA 2BY2A 3I3DA 4JIPA 1M68A 2TODA 3DHUA 2GVGA 2V5CA 9XIMA 4BK9A 1ISYA 4TMCA 3FGCA 3KVJA 4NZ4A 3G1HA 2VC5A 2AL2B 1ZUAX 1BVWA 4F3HA 4ML4A 4AIOA 3VIPA 3AXMA 4LY4A 4N0RA 3V1HA 3L0GA 2RUCA 1V51A 5IDZA 3HB9A 3VNIA 1CGTA 2ZZ4A 3S6TA 3UI4A 1EZWA 1FUYA 1U79A 3S9ZA 1E9YB 1RA0A 2Z0IA 3ZO9A 2KE0A 4DM1A 5A3HA 2QDDA 3SCPA 4MUZA 1XLCA 3UZ5A 2PN0A 3NVDA 5AKQA 5I3IA 4IXXA 1I1XA 2QJIA 3EA1A 5I5RA 1E1EA 3W2MA 2WMKA 3BMBA 3HG3A 5DO8A 1IT8A 2FYMA 3EA2A 3W27A 1Z9AA 3ORWA 3BPWA 5KMYA 4ZXLA 3VD7A 2YX0A 1F05A 1YTDA 4PMOA 4QIBA 5KITA 4YYCA 3EDKA 3ZLFA 3M41A 4CNOA 3B7XA 1A5SA 3GDKA 3ANYA 4IMDA 1R30A 3ARPA 3ARTA 1YBQA 4IFKB 2O4QA 1ME9A 1V3HA 4ERIA 3V5CA 3GTNA 4B3ZA 5IFTA 1E6NA 3WJYA 4HOZA 1E71M 4XKYA 5AHFA 2XJ7A 1JD9A 5ABEA 4MGVA 1OX4A 3E6EA 3RPMA 4H01A 1FKFA 4Q8WA 2AWGA 3EXRA 4OFCA 4FLOA 1ADSA 1P6WA 4GUJA 4DEFA 5D2XA 3T0BA 4H9YA 5EFDA 5FJRA 4MY9A 1GOOA 1LORA 2FFIA 5AYBA 2FTPA 4R34A 4FNQA 3E12A 4GUFA 1JPHA 2ZTKA 3FS2A 2QVNA 1ELSA 3VOFA 3N15A 4B15A 3WH7A 5IRPA 2DSWA 4GNKB 2JF7A 4FMVA 4C6QA 3SCOA 1GKRA 3AHZA 3MHUA 3BQ5A 1CW2A 2QZRA 1GKQA 1JDFA 4IMEA 2PDLA 1ITXA 3KBWA 2QR6A 1Q6GA 1D7JA 1Q6HA 2HK1A 3LPOA 4DRNA 1EJTC 3SB0A 1YRRA 4M51A 3GVQA 1MRAA 1JI1A 4JYEA 4ATDA 2FMNA 1C9HA 3ODKA 4XBKA 4AC7C 3EZ4A 2WPGA 3QR1A 4RW3A 3B9OA 3S2JA 3QY6A 5F2LA 4KR0B 1TTQA 2I56A 3PNUA 4FSAA 5FF0A 3HFTA 5CGTA 5DLCA 1WBJA 4JTRA 3NQEA 4LAZA 3W25A 3LERA 2UWFA 1VAHA 1U33A 3JVAA 4PTVA 4JNYA 3ITXA 4I90A 4XB3A 1AQHA 3R8HA 3W7PA 5IFPA 4QZVB 3R0DA 3GK0A 4UR9A 1FCUA 2VR2A 4KWVA 4ZE4A 4H19A 3OOBA 2R91A 4HGXA 4DBUA 4LNCA 3BLFA 3LY0A 1K9EA 1TJ0A 4GIVA 1QK2A 2QCGA 2V5JA 1V8EA 1LQ2A 1VYRA 1TPDA 1L0PA 4FXSA 3I6CA 3TAOA 5I79A 1OCJA 5ABTA 5HULA 4L72B 3KABA 3VC6A 5CG0A 3IV3A 2VGGA 4KWUA 5JBFA 3KADA 2CYGA 3NQGA 3TOYA 1C29A 2J74A 4GXPA 4Z08A 4PB3A 5A6SA 3GW3A 2YSWA 2JIEA 4P7RA 2B7NA 2QCDB 1WOBA 1BQGA 4NU7A 5DIUA 4O15A 2EAWA 1ADDA 5HW6A 1KA9F 3M0LA 1WZMA 1MFVA 4M82A 3W7GA 1DXEA 1BSLA 4ZL1A 4HYWA 3UQIA 4R88A 1EB3A 1CLKA 1QPOA 3TYDA 4J3SA 1GZJA 1Q6FA 4NAFB 2PC4A 1VP5A 2VFHA 4QE4A 2H6RA 4D8LA 3U48A 5FA5A 4KEVA 2PTYA 2R9RA 3G0UA 1OF8A 1E9IA 2EJ1A 3UI6A 3MBDA 4C6OA 1CNVA 3PBYA 1KWKA 2V69A 4Y9NA 1R3VA 3M07A 5A8OA 2HQAA 4UFIA 2ZFAA 3TYCA 5E6ZA 3EOSA 3QPYA 3EPNA 3WH5A 1VFUA 4W7WA 2D9FA 2PWGA 2I5IA 3E02A 1RXOB 1EO7A 2HVOA 2MLYA 2ZCGA 3GVVA 2V9DA 4G50A 3THQA 4JTDA 1UR0A 2XVKA 4QJ3B 2CHRA 3M43A 1TCDA 3B97A 5EMYA 4H7CA 2NVCA 2QKFA 2J13A 3AQUA 4XD3A 3VMNA 3ZQ9A 3MPGA 3CAQA 3LCWA 1NVMA 3AYSA 3RDKA 2HXUA 4NG3A 3T09A 3B05A 4RLIA 3MSYA 1ZP4A 2PDHA 4UTLA 4AHOA 4C6NA 4ZO6A 3N6QA 3NO1A 3WMBA 1Z48A 1BG4A 1VENA 4LF1A 4LAUA 4GYJA 1W8GA 1ICPA 1ML1A 1UZ1A 1L2UA 4O54A 1HGWA 1MXSA 1V7AA 4WIWA 4RZBA 1IT7A 3PM6A 1QDSA 1GQNA 3NPXA 3NZGA 3B8TA 4J2PA 4GCXA 4E8CA 1FHUA 3GVRA 2R82A 2FAPA 2G3IA 4M6QA 3M16A 4IJRA 5CCZA 1LL6A 3V5OA 1KFCA 5LKYA 2R1NA 4V1XA 1V0KA 1KV5A 5B80A 4UZSA 3HV8A 4LT9A 1FY6A 3H2FA 1AZ1A 2CHOA 4HJWA 3RGTA 1XIBA 4GGHA 1QUMA 3OIHA 3W26A 1IGWA 3ABZA 3SIZA 2MF9A 3WUBA 1S2VA 1NOFA 2F6UA 3UVIA 5CGMA 3W1QA 2DW7A 3UFYA 1YNPA 1K03A 3UJ2A 1E4IA 2E28A 3BCDA 4CCCA 4R7OA 1LT7A 1ONEA 1D3HA 5F2MA 1WB0A 1LOQA 5I77A 3W1MA 3C52A 1D7KA 4BQ4A 4UXDA 3DG7A 3G18A 2F2KA 3E96A 3E0WA 1XLEA 2BNJA 1PL9A 1HJWA 4F0SA 3V35A 2GDUA 4MG4A 1NTHA 3ONBA 1IV8A 4LVGA 1LWHA 1ZB5A 3CU2A 5H8UA 5G1MA 3S2NA 1M03A 1KM1A 2REQB 3NOEA 4MSSA 1VC4A 1EBHA 2VWTA 3NI6A 4CN1A 3OZYA 4TR9A 1TRIA 2Y89A 2Q09A 5CPMA 5G1TA 1DL3A 4TO8A 4F9JA 2FZDA 3WLNA 5EMKA 1KRBC 2IUZA 4NZ5A 3N2CA 1H5YA 2XP6A 4IQ2A 1FJDA 4DWDA 4GUGA 3RO6A 3C8FA 3ZZ1A 4C6BA 1Q7MA 2G97A 5JUVA 4NP7A 1RY0A 2QPUA 2PAJA 3T8LA 4LF2A 3ZJ8A 4FAPA 2C19A 4YVVA 1UBSA 4FN2A 3VD9A 4UTWA 2E1DA 3NZ1A 4MWAC 1FH9A 4TVDA 2ISFA 3M46A 3UG4A 1I0DA 1VFOA 2ZRZA 4JS3A 3U4FA 3RGCA 3G3MA 5L6UA 2BVDA 2OZ3A 1GVOA 1ZHAA 1MQPA 4ORIA 3WKZA 1MQRA 2WKJA 4WRHA 2FTWA 4CD5A 3SUTA 3HQOA 2QIWA 3BLEA 1GQKA 4FA3A 3UA3A 4ORMA 1AZ2A 2AGKA 4W7UA 1G0CA 2ON3A 4LTSA 1GOKA 2DORA 3LHWA 3NJ3A 3EX1A 1TV8A 4K3ZA 1RK5A 2Z1XA 5CSUA 2D22A 4WY0F 1ZAIA 5AYIA 1J11A 1MEIA 3IIZA 1C7SA 3H12A 4IPJA 1Z7AA 2E8YA 3RNDA 3TIMA 3PTMA 3FEMA 1BF2A 2HV5A 1MSSA 4V33A 3SQMA 4F2UA 2YFNA 1HN1A 1E1FA 3JYJA 4C6PA 4I9JA 3DN5A 1HJSA 1XGZA 3QHOA 4LYRA 4FX8A 3A5VA 3P5ZA 3DOPA 1EP2A 3R94A 1LOLA 2OX1A 2CERA 3HQ1A 3CGMA 1EIBA 5F1UA 2NXGA 3EXSA 3B4YA 4QNEA 5IBXC 4TW8A 5K4ZA 2NQLA 3LHZA 5DQPA 3W2UA 4C6KA 2HSAA 1UIPA 3C5QA 4WSKA 3KLLA 4HCDA 2DZAA 5FEWA 3KWXA 4AW7A 1CXLA 2OFJA 3FJNA 2KX9A 3PULA 1JZ7A 2IPGA 1XYFA 3FAXA 3EWDA 1KCXA 2WMIB 4AZ5A 4H4IA 3BXWA 2WKLA 1JGMA 1OZMA 1OJXA 1WXYA 2E67A 4DHGA 3LNPA 4AZIA 4XBJA 3TP4A 1TWSA 2TSYA 1AW2A 3GNXA 2DUZA 3PVFA 4JHZA 1BYDA 4S3AA 4PB4A 4I8DA 3NZQA 1H41A 3FXGA 3W88A 4OECA 4P7LA 5K7JA 4U84A 4PUEA 3Q94A 3MUZ1 4B5XA 4AD4A 5LNUA 2OZ8A 4AZHA 3M5XA 3WDQA 3VIFA 1BWLA 4XBSA 2WJZA 5TQLA 4FZIA 5CJMA 1VJIA 3B9EA 1DJIA 7REQA 3SJ3A 2GVEA 4JFJA 1HP4A 2J7BA 7PTDA 4M8UA 5U4NA 1JCXA 8XIMA 4KEZA 4IGMA 2G4JA 1U5JA 2CCRA 4UFMA 3LHTA 3NL6A 3LN3A 3GUGA 4KRUA 1UUMA 2JEQA 3HGSA 2ZIDA 2QCMA 4EWJA 1RJPA 3A9BA 3KBSA 3KXQA 4UTUA 1TRDA 5BRPA 3CZ8A 4WKFA 4X0NA 5FSEC 3SN0A 3CV6A 2M1IA 4AY8A 3SCWA 4PUJA 1T0OA 4N6EA 4PC8A 5E70A 3G6MA 5BXTA 2WJDA 3SY5A 1A4LA 1RP9A 4DH0A 1VFMA 2CETA 4TYOA 1TV2A 1C8QA 4HN4A 4LAWA 5D2VA 2ZRVA 3YPIA 1PIGA 1A3HA 3DBPA 3URQA 1HO1A 3FEQA 4I6KA 3WF4A 1QNVA 2RDWA 4FXRA 1LQ0A 2XP9A 3SBFA 3MSRA 5BRBA 4N6FA 4DRPA 3E2SA 2RGMA 1WDWA 2Y7DA 4HPNA 4TQTA 3RCNA 4BZYA 3O5LA 4RE2A 2VEKA 3R10A 3S5ZA 4OU1A 4PBEA 4XG1A 3QPZA 1HKVA 1PE1A 1ZFJA 3VIOA 2Z7KA 1K7XA 3GD6A 5HR6A 3IJQA 4U2YA 5CC7A 1KLZA 3SADA 3ITYA 4DBEA 3FYOA 3I6TA 1MXDA 1XBVA 2OYLA 1V6VA 3MANA 2Y88A 3KDNA 2GJLA 3WLLA 1NDYA 1KT0A 5F2GA 4RXGA 5LNVA 1KFJA 3IJ8A 1ISVA 4W8LA 2FGBA 1N8IA 5H6HA 4XZNX 4DF2A 2BODX 5M3WA 3UQNA 1Y0OA 3W00A 3W6LA 5C8BB 4DWSD 2ACSA 1TWIA 2D69A 2JKPA 4RZ6A 1PS9A 4PFMA 3NQCA 4KWOA 4LW7A 1E6PA 2BXYA 2FJUB 2YA2A 4NAEB 4JIEA 4I9TA 2KI3A 4Q4RA 2XFWA 1IEIA 4XQ6A 3WDIA 5D2WA 1SJDA 3I4KA 3WNLA 3H55A 5A6BA 2X40A 4LEQA 3GVGA 4QXIA 3ZOAA 3E9AA 4FHAA 3PC0A 3UBPC 2XZ9A 4Q4KA 4LS1A 3A6OA 2NQ5A 5EMJA 3UY7A 4KWWA 4E3TA 3AMLA 3DGRA 3R11A 4GX8A 3STEA 2PZNA 2A5HA 4XX6A 4J3XA 4CEUC 5HMDA 2WHJA 1POJA 1DJWA 4EWND 2PV3A 2ZC1A 3L4YA 1O5XA 3PANA 1A0DA 1WKEA 5C9ZA 1UJQA 4LAMA 4PTNA 3DFOA 3L2IA 2M08A 5DRCA 3NDOA 3R2GA 2J47A 3WQVA 1JUEA 4FXJA 2DG4A 1KTNA 3P0XA 5GNXA 1MW1A 2I5QA 1RCQA 2ZXBA 5LXEA 3P84A 4AZCB 4HSOA 2HK0A 2OU4A 5AVNA 1GQIA 2OODA 5HBFA 3BAYA 1S2TA 3S1XA 2R8WA 1UHVA 3B03A 3W87A 3LPPA 1EX1A 2FHFA 2N87A 4KCUA 3G1VA 4H8NA 2I16A 3IJLA 4K6AA 1Q65A 3PWAA 3V3WA 1MEWA 4ACYA 1G1YA 4HCLA 3ABRA 1WNOA 1P0NA 4NYUA 4PL1A 1V77A 3GDBA 2YDSA 3T05A 2KFWA 4HBEA 2WHKA 1QI5A 2Z2BA 3NGJA 8CGTA 4UOZA 4QCEA 4U3AA 1PTGA 3FLUA 4K8HA 5FJJA 4IP4A 2CWXA 4LC8A 1GVRA 3EWZA 1MUCA 3CK5A 6XIAA 3QC3A 3TCSA 1FFRA 4AHQA 2FB2A 4FLSA 3ZJ7A 1PYMA 4B91A 1KT1A 2UV8G 1A7XA 2YZ5A 3UVAA 3K4AA 2NVDA 4W7VA 5CH9A 1IXOA 1BXCA 5LA1A 2FLIA 4ODQA 2CC0A 3REQB 1US0A 3F4NA 2VZSA 1JNSA 5F7UA 2P3ZA 1IEXA 3THUA 3UWZA 1UIOA 1IF2A 1W37A 1P6CA 3L0KA 1LTDA 4IP5A 2XIQA 3M9YA 3GG8A 3T2OA 4PCPA 4YTRA 3OYZA 4Q8UA 3VGEA 4H6QA 3GC5A 3W7IA 4K38A 1I1WA 2NLIA 2ZVRA 4GBUA 2QGYA 3OA3A 1PKNA 4AYSA 3KS5A 1JD7A 4QHRA 4QT3A 1TVNA 4JL1A 4QR6A 2B5UB 2G41A 1JQVA 8RUCA 2UBPC 1KM6A 2O56A 1KRMA 3TMLA 4HYRA 5AHLA 1S2WA 5D30A 3VKJA 4XZIA 3VCNA 3PZGA 1IGSA 2CLFA 3A9IA 4GIRA 2GQ3A 2DFAA 2ZA1A 1E0WA 5G4EA 1X1NA 2HVMA 3VNKA 4Q8TA 2QQ6A 4E4UA 4Z2HA 4X9YA 2BASA 2I7GA 3FFSA 1DQWA 1Q85A 4GKLA 2I17A 2IW0A 1A0CA 3OVRA 4EXBA 3SCTA 3P0WA 4H9XA 3WEOA 2ZXQA 1VCVA 3NIYA 4IMCA 3C0LA 4W88A 1C8VA 1QO5A 5C2XA 4YTTA 4O1EA 2H8XA 4CQBA 3UZJA 3LV5A 1UASA 2PTZA 2NUWA 3O5QA 1QFEA 2Y85A 3GR8A 3IJDA 4FF7A 4MWAA 2JGYA 4W9OA 4NZ3A 3KLKA 3JXVA 1EIXA 1J4IA 1LG1A 1ENUA 4AHPA 3EOOA 1TA3B 1NM9A 3OW1A 3T9PA 1WZAA 4DZ2A 1YNYA 3BJSA 2WWDA 1SW0A 2ZDSA 1ITCA 4JNMA 3R58A 2F2DA 2R1KA 2VURA 1JCMP 1YPIA 3KTCA 4NYYA 3AU6A 4XTDA 1W3HA 2B7QA 3WH9A 4FLQA 2FGZA 3UG5A 4YJ5A 1R3YA 2E9BA 1UKSA 2NQJA 3M6YA 1JPIA 3G2GA 3ZXWA 3ANUA 4K1GA 3WUEA 2ZUSA 1FWRA 4O18A 4U28A 3VI2A 3OO2A 3LI0A 1WDPA 4MNMA 2XIIA 3VD5A 4QISA 3LX9A 2PDQA 3PR9A 4LUTA 3M5ZA 1NP0A 4JQ1A 1KC7A 4A2SA 1OADA 3IK8A 4OBSA 1RBAA 1YHTA 3CO4A 2C3ZA 2BTMA 3QH2A 1IIGA 4L4PA 2D0GA 4P2VA 2NXHA 3K4DA 3UT0A 5G4HC 2CLKA 1G69A 3HU7A 1SO5A 3ARWA 3OVGA 4W89A 4XD4A 4Q33A 1FWCC 1ODUA 4HNUA 4O19A 1YADA 4OGZA 4WDTA 1R85A 1A4MA 5JH2A 4O13A 2YYUA 3C6CA 1TZZA 3FGCB 1VJSA 1KRCC 1Z42A 4I3GA 2HROA 4QJ5B 2V2DA 4NI8A 4IHCA 1KTCA 5EB8A 3OHMB 4WDWA 4QM1A 1OK4A 1X6NA 5I00A 5CPLA 1TYGA 1B5TA 2W92A 1IIHA 1J0ZA 4X2PA 5HDRA 3PR2A 3F4DA 3DENA 3EPOA 4YL2A 1OIMA 1LOSA 1O1HA 1YPFA 3SEPA 1KM5A 3QMTA 1SFSA 1S5TA 2G5WA 2YL5A 1K3UA 3EXTA 2KGJA 4P8VA 4O28A 2QCCA 1NELA 4HBKA 3PUDA 2C79A 2GVYA 3W1TA 3VDCA 4Q4OA 4PN2A 3UWYA 4LBSA 3CZKA 3VVGA 3U2CA 4A21A 4HPGA 2YCJA 3WLTA 4E2DA 1XSJA 2OWWA 5RUBA 4WVXA 4K36A 4PMNA 2XH2A 3LZ3A 2YIHA 1H49A 1KBIA 1UR8A 3AS2A 3EX6A 3M44A 3UR8A 4PMVA 1UCWA 2AKZA 4DUWA 4QS6A 3P93A 1DWAM 1LRQA 4JHOA 4DROA 1BLIA 3AHTA 1YBQB 1YXYA 1ECQA 3NO3A 3LCFA 2WBGA 4JFVA 3LPFA 1OZQA 2ACUA 2A79A 1E70M 1NOWA 4TVUA 5HWMA 1OD8A 4F0LA 1FXPA 5KEZA 3VOCA 3KZ7A 4S3KA 3M5YA 3SUVA 4XKYB 1ZBWA 2G50A 1RSCA 1KM3A 1FKKA 4QNWA 1JYVA 3QMSA 3FKRA 2PDCA 3CHEA 2BXVA 3N6HA 4PE8A 4E4FA 2VFGA 4MDOA 1TPB1 4MOZA 3WN6A 4FNRA 4YYFA 4KFPA 3WUGA 1CGVA 5LZLA 1RV8A 4PSPA 1ITUA 3OP2A 2XIBA 3KFTA 2YL6A 3MKKA 5HUAA 4IT6A 3O6AA 1QPFA 4PEKA 3U6WA 3L67A 1TMHA 3EB4A 4ZO7A 3CUGA 3RLGA 3SRKA 1XPGA 5HANA 1D7FA 4N9BA 1W5QA 2ZXAA 4N4QA 3NO5A 4CQDA 3IJ6A 4O1CA 1L6SA 2HTMA 4JCLA 2QF7A 1JAEA 3WNOA 1QI4A 4JTCA 2B4GA 5C71A 4A3RA 2YBTA 1PIFA 3VIMA 5E0FA 4DELA 3WLOA 1M65A 1R2SA 3BLKA 2D2OA 5BOEA 2EXOA 1RD6A 3JUGA 5DFAA 1AG1O 1KO0A 2DUAA 2NSXA 3DYOA 4X9SA 1BG9A 1ZBVA 2OYMA 3GY1A 3MT1A 1JCHB 2F8QA 4Y8FA 4IPPA 1U22A 4QP0A 2G3MA 1S3HA 1BL4A 1MNZA 1HTIA 1QOPA 2GGHA 3KL5A 1FWWA 2VFEA 1JNTA 6TIMA 5BNKA 4ZB5A 5CZTA 1J0JA 1K6WA 1ZS2A 5H2ZA 5H1WA 4US5A 3SJNA 4IP7A 4A8RA 2BSLA 3O5JA 2HNHA 1TWZA 3CQJA 1QI3A 2VQTA 3IHZA 2FDMA 3O8AA 1AFSA 5JQ9A 2VWSA 4MPQA 2WXDM 1GPWA 4O12A 3IGSA 3WY1A 4DRMA 3V7PA 3AFBA 3PN8A 3GDRA 1EC9A 1UKQA 3B3DA 2VNCA 2PE4A 1UZDA 3PTDA 2XSXA 1VLWA 5DMMA 3BARA 5M03A 4GX9A 3H2AA 3KZSA 1JXJA 3WNMA 1E0UA 3QR3A 5DBTA 4UZUA 7ENLA 1N8WA 4A6GA 3UQBA 2HPMA 4JIIX 4V1YA 4LSBA 3QZ6A 3O0KA 1J96A 2XFFA 1EQPA 1ZP3A 3NRKA 2C0HA 2BOGX 1TIMA 3QV8A 4UFHA 5GJMA 3F4VA 2QDHA 4X22A 4J2MA 1SMDA 5FF3A 4RNIA 2XM1A 3N18A 1UWQA 5CC3A 3N1AA 2EF9A 1M3UA 1IR1A 2R14A 5BW6A 5LXXA 4HSHA 3S83A 4INFA 4O10A 5M1TA 3PS7A 4MYAA 4WSHA 2POTA 3APYA 1E5JA 4BF8A 5LNWA 3VFLA 1UWRA 4B3KA 3MC5A 3U5YA 3VFCA 2PSNA 4PRTA 3NQ6A 3CQHA 2Y4SA 5JU6A 3TW7A 3IAQA 2XHYA 1KW1A 3FDKA 1LBMA 3D46A 4XTIA 2ISSA 3ITTA 4HMDA 3FK4A 4HU0A 2OKOA 1L6WA 3M6DA 2VZVA 2ZWYA 4POCA 4C7FA 1W1ZA 4OT7A 5KZMA 3WDRA 2VJXA 4B5VA 4NUWA 3W1NA 4ZQNA 1I6NA 4JFMA 1VBUA 1XI3A 1R87A 4PMDA 3W7LA 2KR7A 3OA5A 1UWSA 4LCSA 2VD8A 1QI2A 3AXHA 4XV0A 2MLXA 4IXHA 4S3CA 1Z69A 4C5ZA 3EDFA 1Z44A 2YW4A 5E93A 1AQMA 1C92A 1Q6QA 3CUIA 2PF8A 3BICA 1V0MA 1WX0A 1YDOA 2CLOA 1NWRA 2ATSA 4OV4A 3VAWA 1H7WA 4NJGA 5BYWA 3UNTA 1VPYA 4RX0A 4GISA 4CLMA 4MGGA 5JMUA 2ZVIA 2NX1A 3V36A 5LNRA 2P3EA 3TN3A 6ENLA 3LCIA 4HOWA 5A6JA 2GSEA 2JBMA 4JPGA 3QVQA 2QV4A 3NQBA 3Q4DA 1XSKA 4TVCA 4RPPA 1FWGC 2Y8KA 4AAJA 3PY2A 2OT1A 1FWAC 4WXZA 4F40A 2WNZA 3SRHA 4I5UA 1JPKA 5BCAA 3HBLA 1OFAA 4G8TA 5CJNA 5EY5A 1A5OC 4Z17A 4LXFA 4ADSA 3E5PA 3SQSA 5BRQA 4IZGA 4KF1A 3UCQA 2UY4A 4FPSA 2D3LA 5A8MA 5FCZA 5DCEA 5FJOA 1SJAA 4JFSA 3GAYA 3UCCA 2CEQA 4YWSA 3LBCA 4H6EA 1F73A 3T81A 1G6CA 1XRTA 4UWMA 2QCHA 1FKBA 3LBMA 4X60A 2HVNA 2QCNA 4FIRA 3TQKA 2I57A 4LBRA 4TX8A 3A12A 1B6CA 1IHIA 3UGVA 4EIVA 4YMZA 1B9BA 5A1AA 1UR2A 1OY0A 4OV9A 3NM3A 5KZEA 1TVPA 4MVAA 3PUOA 2VX7A 2B7PA 4XZBA 3GSMA 3KDOA 2OB3A 4BR1A 2NUYA 4ZR8A 4CD8A 4UOQA 1OX6A 1LM1A 3NTPA 2YXGA 2BX7A 3ZR5A 4DWSC 1V08A 5D9OA 4K7YA 4QDWA 2A4AA 3S1VA 4RV3A 2A21A 5AY7A 2PDUA 4JR5A 5CGQA 5A6TC 2FZMA 5A6KA 2WM0A 2A3CA 1FKWA 4GJIA 2J7FA 2J27A 4L64A 4KESA 3CL7A 2O55A 3N4FA 1I45A 2WVUA 3H26A 3NTYA 1FWSA 1HF6A 3DHDA 2Q8ZA 4DUVA 2GUUA 3VC5A 4LS2A 3S9IA 1OFRA 2VOTA 3T44A 4UQBA 5FESA 3KRBA 2FH8A 5D8ZA 3G1RA 1GK8A 1F9CA 1MNSA 4XKMA 2BHYA 3CV1A 2IKJA 2VN1A 1AW5A 6PTDA 3MO7A 3ARVA 1RLCL 3ATYA 1W2PA 2GUYA 2VFFA 2A3BA 5K9XA 3ZJKA 3TE9A 2Y7FA 3D3FA 3RR1A 2GL5A 3L2LA 2DG9A 3K8KA 5FJTA 4DRKA 2BVYA 5AHMA 4LUJA 5BMWA 3THAA 1RH9A 5HW8A 3TFCA 1XH2A 2WV8A 1JL8A 2V8ZA 2OSYA 1FKTA 4EP8C 2A7NA 3OGVA 2PZ0A 3GU1A 1XS2A 3F5KA 3QXBA 2PWDA 4KCTA 5A5WA 2CIPA 3GPKA 7A3HA 3MMUA 1MEHA 3NA8A 3KM8A 3P74A 1CB7B 3BAKA 3OJGA 4B90A 3KHJA 1CYGA 3UJFA 2WM1A 7ODCA 5I0DA 1QK0A 3GXDA 1TZ7A 3BC9A 4MJ2A 1R3WA 1W3JA 3PSVA 2IPFA 1C3FA 2D24A 3MUIA 4XAGA 3CUXA 1GQLA 1G94A 5HT1A 2VELA 4FOUA 2OEJA 3L5MA 5FL0A 4YVPA 3ZVIA 4CCEA 3BDKA 4UR7A 1VEOA 3M0IA 1XG3A 3IV8A 4ZS6A 2A3HA 3UF8A 5HJYA 4QAIA 4D6EA 1ISXA 3VDAA 3PP7A 2INEA 4H83A 2PPOA 3HGJA 4IX0A 2FPYA 2WCGA 4XZ9A 1GOWA 4WSJA 3O5RA 4WZHA 1ZJAA 3GHRA 1G4EA 3DFSA 3VK5A 2FTYA 2E1WA 1G5AA 5CPSA 1EOKA 1TPVA 3GX9A 3EKLA 3OZPA 3L7RA 1GYMA 2WNNA 2PGFA 2RGLA 3MTWA 3KRUA 1WE5A 3ZMRA 1B2YA 4KWSA 3BLDA 3W70A 1WAUA 3AWNA 4JN7A 3GWQA 4PCNA 2JF6A 4EAMA 3EWXA 1ZU8A 4FLRA 5EA9A 2E6DA 4C6MA 2R6OA 4GWEA 1OGSA 1R2TA 4M6UA 3NZRA 4IIEA 2VEPA 3TJIA 1FAPA 3KBVA 3LEPA 4KFOA 1XRFA 1PB0A 1S1PA 3LM7A 3CB8A 3WLQA 4R33A 4HT3A 1DWFM 3PBMA 3HG2A 4IJBA 1P1MA 2JZVA 1U2YA 2DH2A 4DNMA 3ZVHA 4BI7A 2ETNA 4JGDA 3MVIA 2YBVA 3MI6A 4UMCA 1HKKA 2EBNA 1EYEA 1ODZA 4GGBA 1XYBA 1REQA 3TDFA 4DZ3A 1EL3A 4D71A 3AROA 4X0VA 4NJKA 2CLHA 3VMPA 3CZGA 3TW6A 5FL1A 2HEJA 1AL8A 3VM5A 3FKKA 1GVEA 1VQTA 1KFEA 1HQTA 1EP3A 1Y65A 2J66A 4DZAA 1VGAA 1W1PA 3L4UA 4BCEA 3PB0A 1OK6A 2HNEA 3G1YA 2IS7A 1WUEA 1UC4A 1SZEA 1TCOC 1YE4A 2VENA 5HINA 4Q8VA 5CJ5A 1RAKA 3C4UA 4H3DA 2HE5A 5BWFA 4JCMA 1VBRA 1A5MC 2ODOA 4UCGA 5LYRA 1KM4A 4N2YA 2OFNA 3VOHA 4CNSA 4AY1A 1Q6CA 4LAXA 4QIUA 2VC7A 3RF9A 3N2TA 5TF0A 2GYIA 1ZAHA 4TMBA 4WF7A 3QV6A 7TIMA 3QV9A 3MMTA 5D04C 3UR5A 4M3PA 1TPEA 4CN6A 4J4KA 3P82A 2OO6A 5BROA 4IIDA 1DORA 3W6MA 3E38A 3RMJA 3VCRA 1IZCA 4GQGA 3FJ4A 3WZ0E 4R9OA 1MWOA 1OC6A 4ES4A 4AXKA 1KXHA 2ACRA 3D0CA 3VMOA 5J5DA 2VRQA 2TRSA 3N4EA 4AMAA 1V03A 2ZZ1A 4GA8A 4ICMA 3UPBA 2PTXA 4J1OA 3VZZA 4YHGA 2XVPA 4H9ZA 1CWYA 1Q8JA 2ZR5A 2QXWA 1EH9A 1TUXA 4W5ZA 4F0MA 2DIJA 1XYZA 5FACA 1XLJA 3HGOA 1XCXA 4G56A 3H23A 3QV7A 1XCWA 1ZCOA 1DV7A 4AEEA 3SN4A 1QBAA 3TWAA 5HW7A 3DDMA 4J3VA 4PTXA 3TTEA 1FDZA 2W27A 3W7JA 3L2MA 4G2PA 4PTMA 2EEXA 3CYVA 3DKLA 3ZR6A 1O5KA 1O94A 3TTSA 2DIKA 4J3ZA 4UNKA 3H7UA 2Q5AA 4A3UA 2ZYFA 3C56A 5T9CE 3RAOA 4C5YA 2W61A 4C65A 3QLLA 1UZHA 1EP1A 1FKJA 4M1RA 3KP1A 1A5AA 4AVNA 3D5HA 5JXQA 2FH6A 2PPGA 2V6AA 4PEEA 3CYJA 1T40A 4A8IA 2D3NA 1XIGA 4AUBA 4KFNA 3GC2A 4DO6A 4DIPA 1QCWA 2XN1A 1EFZA 1HW6A 2GSHA 1R46A 5A6BD 2C6QA 3PJWA 3BUVA 4ICNA 2GDVA 1O1ZA 1S39A 1TTIA 3URAA 5LIKX 1XW8A 3LLDA 4ZGYA 5I78A 1CEOA 4IM4A 1BRLA 2GQAA 1JZ6A 3GM8A 1YXDA 1SM9A 3O5MA 4GIAA 2EG7A 3NPVA 4KEMA 1DXIA 3UCDA 1XINA 3PZMA 1FVPA 2PC8A 3W85A 4JNZA 2F84A 3SUWA 2PDGA 3FVMA 3USBA 1VR6A 2BOFX 3BZJA 1FWTA 1SJCA 2P0IA 2DJXA 1EQCA 3XINA 1P7TA 4YXGA 2NZLA 1M1BA 2V5KA 3KVLA 5FF7A 1MMFA 2CHNA 1H3GA 3DIPA 1RVGA 1OEPA 3SGZA 5HMEA 4IMAA 1JCNA 4HYVA 2GPTA 1SSDA 2GK1A 1JI2A 1G9HA 3AICA 1Q6RA 4AD0A 2E6AA 1W1A1 4NF7A 2ANUA 3RHGA 2GWGA 2VC9A 3T2PA 4HKPA 3PTQA 2VEGA 4KQNA 2ONEA 4IIGA 4OJYA 4O17A 3RG6A 1XQKA 1EJRC 1IWAA 2FZ8A 1OF6A 4IMFA 3IJ7A 1U5VA 1I75A 1DWHM 3A47A 2VEMA 5AYXA 2GVJA 3UW6A 8XIAA 4ZCWA 3D6NA 1YLVA 3CMGA 3FIGA 4HMNA 5CPOA 1MI3A 3TNBA 1E43A 5MF5A 1NY1A 4AZ6A 3SO7A 3VYLA 4BFAA 1UOKA 4Z0SA 1ZJBA 5H8PA 4DZ5A 3R12A 3NNTA 3BOXA 3EWCA 2Z24A 1Q6IA 2CZFA 3H7VA 2YB4A 1KCZA 1I2QA 3TTYA 5FSDC 3J7HA 4LUSA 4IL0A 3ZJ6A 1UD5A 5C55A 6REQA 3C0QA 1AL7A 4MY8A 3S46A 4DWSA 1RHCA 2PWVA 1EXBA 1TELA 3VDHA 2CLMA 4JTFA 4ZPVR 4GI4A 2PMQA 1K1DA 5A2AA 4ZFMA 4RJEA 1VRXA 4M7SA 4DF0A 1QPRA 2VGFA 3S6DA 5H91A 2PURA 3B4UA 4MAZA 1O6IA 2EO7A 2BVTA 4JN8A 2DT0A 4LS0A 1W0MA 3UA4A 2VX5A 3WLKX 3MV01 3SCNA 5D32A 1CXHA 4JZ5A 4E5TA 2PDYA 1HKWA 2VZTA 3CLWA 4MKSA 2M2AA 4MWAB 1J9YA 3GFXA 1ICSA 6ALDA 5TNVA 2YW3A 4AWTA 2WWCA 4IOTA 4PMZA 5C2GA 3OZOA 2EKGA 1DWIM 2ZQSA 3WH6A 1EEXA 5EU9A 4JXCA 4YTSA 4V28A 1UWAA 3WJXA 5C9UA 3NYZA 3CBWA 1PV8A 3DI1A 1DIKA 3SIMA 1IXQA 4N19A 3TYUA 3AXIA 2J88A 2YYTA 1HVXA 4AD1A 4ROPA 2OELA 4W9QA 2A7RA 4GYPA 4Q4MA 4JKKA 1CLVA 1XD1A 2OGJA 2RKXA 1SYTA 3WQEA 2G3NA 3Q67A 4AF0B 1LLZA 5F4XA 3CQIA 4LUTB 5DITA 1S5MA 5AZ0A 3NG3A 4G7FA 4MWAD 1J6OA 1XWYA 3W23A 4REQA 2PCEA 3FV9A 2OPJA 4E2BA 1GJUA 3HA1A 4TV5A 2INFA 1QOXA 3IGUA 3M4HA 4TX0A 3FA5A 4I7WA 1YKWA 1MW0A 2PU0A 3A3XA 3P14A 4GUHA 1ISZA 4JDYA 3KL3A 3NDYA 4AIEA 4OTKA 2V82A 4N7QA 4JICA 2WLZA 2WZHA 2TAAA 4JIQA 2GJNA 4M7TA 3OQ8A 1H5VA 3KAGA 2P4VA 4H2HA 1U83A 5E9XA 1P1XA 3TN4A 2PWHA 3AMGA 3B0UX 1NFBA 1F8AB 4JFWA 3TSDA 4G5DA 4DVOA 3ABXA 1WXJA 4W5UA 4DM2A 2VR5A 1C93A 3GU2A 2EGZA 1UD3A 2VUYA 4PULA 3DI0A 4F4RA 2NT0A 4I6VA 4A05A 3PRDA 4U85A 1QRQA 4F9DA 2JGQA 3BLIA 5G2HA 3MHGA 5HMFA 5AN7A 1QOQA 2GLKA 3WBYA 3ABSA 5E09A 3ARSA 3GXFA 3MMDA 3KVMA 4WOQA 3SDOA 1KXTA 3GR4A 3L5LA 2NQ9A 2CWNA 3QMRA 1XFBA 2XIOA 5EKYA 4FAMA 1E6SM 1S46A 4JYSA 4IIBA 3AMCA 3E0IA 2DIEA 3O5IA 4FNSA 4Z2IA 4S38A 2PB1A 4NZ1A 3KS6A 2WCSA 1AA1B 1POKA 1KB3A 3WF3A 3MMWA 1XF0A 1RD5A 1LLOA 4ECLA 1Z6KA 3N12A 3O5EA 1EZ2A 1T11A 3BCFA 1NEYA 2Z26A 3OPSA 2PA6A 3GG0A 4IFOA 3KUMA 4Y7EA 4ZQMA 2VKZG 5IDIA 3G3DA 2BHZA 1EHNA 4B4HA 2YXXA 3LXAA 1W9PA 3VOGA 1V6TA 3K30A 3LCLA 5JVLA 3TTQA 2AQWA 1TMLA 3OBKA 4QLLA 4RDYA 1MW3A 1E1CA 3OEXA 3U3HA 3W7DA 5FF2A 3GTFA 2ZZ5A 1O68A 4PUDA 4D8AA 3VGBA 1UROA 3VUPA 3W07A 1J0KA 1VCGA 2E9LA 3IUDA 3N14A 3O2LA 1X8CA 1Y8BA 5K3VA 2POZA 1SZFA 1PXGA 2AMXA 3CPGA 4N9CA 4LVFA 3UZWA 1WDRA 2WSPA 1YTEA 1AD1A 3G24A 5C9XA 2PDJA 5HATA 5GNZA 4CCZA 1Q6UA 3PF3A 2HBXA 1E4MM 2BB0A 4W4QA 4J28A 2C0AA 5DY2A 5FJUA 4QCFA 4JKLA 4PBFA 1M7XA 4EPBC 3AO0A 3GTHA 2G96A 3UI5A 3O6CA 4XAKA 2AOSA 2BHUA 1M41A 2CU0A 3UP8A 1XG4A 4BEQA 4L56A 5LA0A 3AXXA 4DO7A 1B3ZA 4E4PA 1MZRA 5FF4A 1UKPA 2V67A 3QOMA 3O06A 1KXQA 4W86A 3GXMA 5DT7A 5M17A 4XZWA 2BS9A 1DVJA 3BLPX 1V93A 3C0JA 1Y5XA 4PRRA 1PEZA 1XLAA 2E5BA 3WD1A 4YLWA 3VGGA 1OFPA 2CNCA 3ARRA 2A6NA 2WVSA 1OABA 4B3LA 3T7VA 3LK6A 4F0HA 1RCXB 2ZX5A 3L4XA 4U31A 4EOUA 4FX7A 2BV9A 3N3TA 3T42A 3QLDA 4PMRA 4D1IA 4MJMA 3CIWA 3NPWA 4C6IA 4JTTA 1BTMA 2ALDA 3H8AA 1E15A 5C70A 4WR3A 1XDMA 1SO3A 3GIQA 3KRZA 4HD5A 1NMWA 4KIEA 1B54A 1QW7A 2YCEA 4E3VA 2G37A 4IFKA 5DMNA 2XP8A 1XKYA 2GGGA 3OBAA 4MJZA 3WBEA 4JTSA 4P7NA 4BA0A 4XAYA 4S3EA 5CBBA 1Q6LA 3B06A 1TJPA 5TBOA 1Y7VA 1UBPC 3KE0A 2VC6A 3H2OA 1BKSA 4NT0A 2BGSA 1EC7A 1Z41A 3GU0A 1YXCA 4US5D 2VT0A 1XIMA 3P60A 4WGHA 2MANA 3CH0A 2C1GA 4NXKA 5DCDA 3H2CA 3VKKA 4HK5A 1FKXA 4UC5A 2D73A 4M6VA 3KAIA 4Z2KA 3WD2A 3MZ2A 3WG6A 2QW5A 3WDHA 3WQ8A 4MIMA 3Q65A 4AZ7A 3CL8A 3BURA 1WKDA 3EKZA 3PZOA 3N34A 3WLIA 1ONRA 1V4YA 4ACZA 3U7VA 1PVNA 4IF2A 3ES8A 3O0FA 3H54A 4QG9A 2J7DA 4S39A 4MY1A 3F5LA 1XLLA 4A35A 3NZPA 1R3TA 5H8MA 3FJ6A 4I5RA 3NUKA 1TPUA 4R7JA 5GVJA 3FA4A 3GNOA 1ZRQA 2DZTA 4QSFA 3S42A 3W73A 3O07A 4JTLA 1JNDA 3EB2A 1QU4A 2F4EA 3SCUA 4W9PA 3LA4A 3APGA 2XN2A 3C2OA 2JIWA 3LG3A 2VEIA 1RK6A 1RCOB 2DY3A 2J7CA 3E3HA 2V5LA 2DZBA 3WQ6A 3GVWA 4GYKA 1ZY9A 1GGOA 3RM8A 3R0KA 1EGMA 3SRDA 4J9JA 2FPTA 3L68A 3KCJA 3UZZA 1YIXA 3S2MA 1XUUA 5D4YA 4S23A 4D6IA 1KKOA 2EPLX 5D9NA 3XIMA 3MDYB 3PWGA 1XIJA 2VTFA 2WPBA 4PBGA 2PWUA 4QTGA 2FIQA 1K9TA 1WZKA 2A6LA 4AB4A 4Z42C 2WBKA 4O50A 3RLUA 3Q37A 3A5FA 5I3DA 4A8NA 2J78A 1FOBA 4GJJA 4L65A 4GBDA 3BLOA 3O5OA 1TB3A 4F2BA 1CPUA 2XM2A 1CZ1A 4CEXC 2Z1VA 2PGRA 3SCRA 3AYTA 1H09A 1E73M 9CGTA 3Q45A 4NZFA 3UZXA 2DZPA 1OQFA 4D2JA 3WBXA 2OZ0A 3IK4A 2OR2A 1JCTA 4NXSA 1BKHA 2RHGA 2PBCA 2SFPA