3AQUA

Crystal structure of a class v chitinase from arabidopsis thaliana
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
344
structure length
344
Chain Sequence
TVVKASYWFPASEFPVTDIDSSLFTHLFCAFADLNSQTNQVTVSSANQPKFSTFTQTVQRRNPSVKTLLSIGGGIADKTAYASMASNPTSRKSFIDSSIRVARSYGFHGLDLDWEYPSSATEMTNFGTLLREWRSAVVAEASSSGKPRLLLAAAVFYSNNYYSVLYPVSAVASSLDWVNLMAYDFYGPGWSRVTGPPAALFDPSNAGPSGDAGTRSWIQAGLPAKKAVLGFPYYGYAWRLTNANSHSYYAPTTGAAISPDGSIGYGQIRKFIVDNGATTVYNSTVVGDYCYAGTNWIGYDDNQSIVTKVRYAKQRGLLGYFSWHVGADDNSGLSRAASQAWDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A class V chitinase from Arabidopsis thaliana: gene responses, enzymatic properties, and crystallographic analysis
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords At4g19810
total genus 120
structure length 344
sequence length 344
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3aquA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3aquA01
4D6HA 2DSUA 1QOXA 1GOKA 3N11A 1W9UA 5A8OA 4GZJA 1H0IA 4Z2JA 4LQ1A 1WKYA 1V3JA 3BAJA 1FH8A 1GOQA 1ODZA 2VOTA 2G41A 1DTUA 1HT6A 3PZUA 2QLYA 3VU2A 5CGTA 1JXJA 5IXEA 4GPNA 4BQ4A 2CBIA 5FL0A 3KEHA 3WY1A 4FLOA 2G3NA 2OYMA 3ZSSA 2BFGA 5BRPA 4EK7A 1KGUA 2VTFA 2WAGA 2X0YA 3AMDA 3W53A 3BAXA 3CUJA 2FGZA 3CUIA 3W29A 1GQJA 3AISA 1W1TA 3VGHA 4U5KA 4KGJA 3SUVA 4CN6A 2VZVA 1H0GA 5FCZA 2D3LA 3VINA 3MUIA 4S3KA 3CZLA 1N82A 4KRTA 2AAAA 1V0LA 3WNLA 1XHGA 2DSVA 3NJ3A 2CBJA 4DM1A 5JBEA 3GH5A 5DFAA 3ARVA 3JUGA 1DWJM 3UG4A 1HIZA 5CSYA 5AYIA 4D6EA 3WUGA 1Q6GA 1CNVA 4H8VA 2DT1A 3W0KA 4B16A 2YLLA 2O92A 1QI5A 1DEDA 2E9LA 2YA0A 3PTMA 3AZRA 1F4AA 4FMVA 1CEOA 1RPKA 3UR8A 4NZCA 3UG3A 1I75A 2WVSA 2J4GA 4ACZB 2VX5A 1C7SA 2JIWA 4F9JA 3ZJKA 3AJ7A 2XFFA 2VZOA 3CHFA 3MMWA 4FLSA 2D1ZA 4PMXA 4HOWA 2WZEA 2X0HA 4DUXA 1V0KA 2WSKA 5A3HA 3G6MA 1LL4A 2CHNA 2NT0A 3POHA 1UWTA 5HBFA 5ABEA 4OKDA 1V02A 1NOWA 1W3JA 4AIOA 1BPLB 2FH6A 2VRKA 3CIVA 4LYPA 2ZX6A 1E70M 1I1WA 1VBUA 2OWXA 1XV8A 3M6DA 2J74A 1CZ1A 2EEXA 5HPOA 3EDKA 1WZKA 1V02E 4YHEA 3VIOA 4OZOA 1JZ5A 5ABGA 1PX3A 3A4WA 3WQ8A 1KGWA 1JYXA 3LMYA 5I5RA 1UR8A 3IAQA 1VEMA 1NWSA 4QLKA 3VD3A 1K9EA 4PN2A 2EXOA 2WWDA 4U31A 5BXSA 1W91A 1Q6CA 1W9DM 1UYQA 4GIAA 1E0XA 3OZOA 4UQAA 5BYWA 1JZ6A 1V03A 4W7WA 1UWQA 1JIBA 5I2UA 3T0BA 1JAKA 1B3XA 3ZT7A 3WQWA 1JDAA 5A6BA 3QOKA 3MSDA 1DWAM 3VMPA 2DEPA 4AD2A 3DYOA 1E55A 1V6UA 1KBKA 4J3UA 1HJUA 1TFVA 4KH2A 3WMCA 2DSKA 4V27A 3RMEA 5ECUA 1H49A 1KXHA 2ZWZA 1E4IA 1KXTA 5CLWA 3QHOA 4IPNB 2QMKA 1UD3A 1C8QA 4HA4A 3AIRA 4Z2HA 1XD0A 1JYVA 2BY3A 1KWGA 3GXDA 5CPSA 1HKKA 2XTKA 4ZEPA 2UY5A 3L4YA 6TAAA 2MANA 1CXIA 1E6PA 1B3WA 1OWQA 1AQHA 4CVWA 5AC4A 1E0VA 3B8SA 1HXJA 1XRVA 4P8WA 1OINA 4BQ2A 2VNCA 2WVTA 2RGLA 2DH2A 2EPNA 5DT7A 1M53A 3VIIA 4AD3A 4D6DA 1NP2A 4TVUA 4P7LA 3OB8A 3N1AA 4LX4A 1OD8A 3I3BA 1VEPA 1J0JA 3W24A 4GINA 4D1IA 4H8HA 2WXDM 3AXIA 3TTSA 1HJXA 7A3HA 2WMJA 1SMDA 3N18A 1BVZA 3A4AA 5D9PA 2WYSA 2BY1A 4PTWA 3MV01 1OSEA 1NOUA 4HA3A 3WUBA 2NW0A 2O9OA 5A1AA 4P7QA 1E73M 4MJ2A 3MANA 2XJ7A 4Z2IA 1PX8A 4UFHA 2FHFA 1OGBA 4LYRA 2J7FA 3VD9A 2IUZA 1GJUA 3S6TA 1NQ6A 2JALA 1H09A 1EHNA 1FP9A 2Y8KA 3N9KA 1JYNA 4W85A 3W37A 3BAIA 1Q6DA 1VFUA 2EPMX 5A94A 1NP0A 3ZIZA 1ZB5A 3CHEA 2VR4A 3PHAA 2V3EA 3CBWA 4MAZA 1OIFA 3AYSA 1HJWA 4BA0A 3E1F1 3DC0A 1UOKA 1EH9A 1W9XA 1AQ0A 3SEPA 3NSNA 2WW5A 1R7AA 3AMCA 4C7FA 1WDPA 4OUEA 1UWIA 1AMYA 3N15A 4AZ7A 3UG5A 1QBAA 3EDEA 4WKHA 1SYTA 2G3JA 1E71M 1US3A 5I79A 4M1RA 3WDIA 2BHYA 2YA1A 2XSBA 3WNPA 4WKAA 3W38A 1S46A 1BF2A 2ZUVA 1XSJA 4H41A 1KR1A 3VMNA 2EO7A 1B3VA 2XSAA 1W3HA 4UQCA 3WEOA 1GQIA 4K68A 2Z1SA 4NRRA 2PBOA 2F8QA 3VNYA 1TA3B 4TX6A 1C8YA 3ZOAA 4OBSA 4DM2A 3WBEA 2CYGA 2WKGA 3AZSA 3WNKA 1C3FA 1JZ7A 2YBUA 4JKLA 3OLDA 2CCRA 2PF0A 3BSGA 1QNQA 2GDVA 4PMRA 5GPRA 3VNZA 1J18A 1W32A 3WDQA 2G8ZA 2G4FA 4JAWA 1OGSA 1WDQA 5CQ1A 4CKQA 1PZ2A 1W9VA 2XUCA 1UD2A 4W89A 3ARUA 5FOOA 4GKLA 3W4RA 3WDHA 1W1VA 1CDGA 4ZXOA 2YDSA 2VUYA 1DP0A 1LLOA 2D23A 2CKSA 5HXMA 1GPFA 1U30A 1FA2A 3HMCA 2X8RA 4F66A 5HPCA 1HKJA 1JXKA 1V08A 3T0DA 1J9YA 1UKOA 1R85A 1XSKA 3UEQA 2XYLA 2X05A 4PMQA 4D6JA 4XV0A 2WK2A 2GJXB 2W63A 3T09A 4V28A 1SMAA 2X1IA 1V3LA 4B3LA 1FH7A 2W4XA 4M82A 1UD4A 1HKMA 2D0GA 3BLPX 4X0VA 3PZMA 1KXVA 1XH0A 2WZHA 3VUPA 4WSKA 2VC9A 1E1EA 5DEZA 3EYPA 3FNDA 2ZUWA 2JIEA 1PIFA 3BMVA 1ITCA 1MQPA 1JD9A 1BGAA 1GW1A 2VZSA 1ODUA 3TTQA 5A6KA 2OYLA 1QI3A 2YA2A 4UCFA 2V3DA 1L0PA 3AZTA 5D8WA 4W86A 4Z2LA 1E4NA 3BCFA 1MXDA 3G6LA 1J10A 4QCEA 1E5NA 2UY3A 2VVSA 1BAGA 2V3FA 4P8XA 3N17A 1IT0A 2A3AA 5ABFB 4JHZA 4CCEA 4BF7A 2D2OA 2E40A 2WCSA 3WQ5A 4GO8A 4AC1X 1KWKA 4HZ6A 2OLHA 4GI6A 4U3CA 2E0PA 1X6LA 1ZS2A 5IHRA 3MUZ1 3IJ9A 3CZ8A 1G1YA 3IAPA 1CPUA 2EPOA 4QLJA 3OIHA 4MB3A 1VEOA 3WUFA 4OJYA 4JFWA 4EAMA 1HP4A 1K9DA 1XSIA 3U7BA 1J0ZA 1JF6A 4P7OA 1OT1A 2J75A 3AHXA 1V0NA 3WH6A 1PIGA 1BSIA 2VL4A 3BCDA 2FH8A 1V6VA 4N42A 2D24A 1M7XA 2CETA 4HPGA 3U5UA 2ZOXA 3T08A 3ZJ6A 2QHAA 4W7VA 1PX4A 3GH7A 1ISZA 3VD7A 4B15A 3WUEA 1ECEA 2VURA 4UOJA 1W3KA 2NSXA 2CPUA 3WMBA 3SCTA 1BHGA 1SFSA 4BCEA 1GHSA 2PBGA 2ZWYA 1UA3A 3VDBA 1B1YA 2WSPA 1EDTA 3WF1A 2QPUA 3K8KA 1E40A 1WDRA 1XH1A 2WMHA 3IANA 3WH7A 2AMGA 2ZIDA 4M24A 1J0YA 3WEMA 3CZEA 1ZJBA 3CTTA 2BS9A 2BHUA 3AIQA 2G3MA 1KFWA 1E6QM 2ZICA 4QCFA 2IXUA 3WQVA 1C90A 3GBDA 3S2CA 4UTFA 1BGGA 2XG9A 1G5AA 1JF5A 2PB1A 1HVXA 2C0HA 5AC5A 3ZJ7A 5DT5A 1NH6A 5I24A 4CU8A 3EBVA 4TVDA 4PMDA 3AIBA 4J3SA 2WBGA 1ITXA 1OB0A 4IUGA 4AW7A 1TA3A 3TONA 2D0FA 1XCWA 1JYWA 4PTMA 5DF0A 3PZOA 3ZSTA 1VRXA 3WF2A 4ATLA 1P6WA 1AVAA 1QNSA 1BTCA 4UQEA 3RIKA 1C91A 3UR7A 1CGVA 4LXFA 4DUWA 2Z1KA 4J28A 4IISA 4DWSA 1MW0A 1WPCA 3KL0A 1BG9A 1UR4A 2YL6A 3TP4A 1C7TA 1WP6A 3SCUA 1FH9A 4V2XA 5A8PA 1IZJA 3GXMA 5A6AA 1I1XA 1E9LA 4FK9A 1R87A 4IPLA 1UR1A 1EDGA 2J47A 2ZXAA 3CHDA 4UOZA 4Z2GA 4PRWA 2WCAA 3WL0A 3VKKA 1XH2A 3OGRA 1UWUA 5EFDA 5E70A 1J0KA 1J12A 2C8NA 1ZBVA 4QFUA 2CESA 2PWHA 4H8UA 4JFVA 4HOXA 1WE5A 1EOMA 1HJQA 2WBKA 5F7UA 1J0IA 5D9NA 4H7VA 1QPKA 1RD6A 4TX8A 5BXRA 2WVVB 3VGGA 4WLCA 4DWSD 2WWCA 2O9PA 2VRQA 1JI2A 1RP8A 5JBFA 1EQCA 1WB0A 1GOOA 3SCWA 4BZYA 2FHBA 2ZUNA 3SIMA 2Y5EA 3CPUA 4GI9A 1LG2A 5D8ZA 3PZVA 3VGBA 2A3HA 3OLIA 4UFIA 2BY2A 3AQUA 4WIWA 3WD1A 3RO8A 1CGYA 3ARZA 5CLTA 4D72A 1CLXA 1X1NA 4PMUA 4QDMA 5I78A 1B3ZA 4AZGA 3AOFA 4WJXA 4ATWA 5E6ZA 4TVCA 1H1NA 1GVIA 3APGA 4ATDA 3MMUA 2XHYA 1C8XA 1CGUA 1EHAA 2J7EA 3BSHA 3SCPA 3FHQA 3PZ9A 5I23A 3AS1A 2VZTA 5EFFA 4LYQA 3DHUA 1KBBA 1EQPA 2UY2A 3AIUA 5A6JA 2ZXDA 1UUQA 1KR0A 5EMYA 1CENA 1QW8A 4AZCA 3OZPA 4UFJA 3WELA 1O7AA 4IM4A 1F4HA 4JHOA 2WC3A 4X9YA 3W81A 3GYCA 1NOFA 1U2YA 3K8MA 2WCGA 4W8BA 4W93A 1PBGA 5M17A 7CGTA 2O9RA 1R7OA 4GZEA 3RDKA 1EA9C 3CGTA 4FLQA 3VMOA 1GHRA 3WDPP 5IFPA 1GOIA 1FFQA 4PYSA 1C93A 1M01A 3KL5A 2WLZA 4P8VA 4PTVA 1W1YA 1JDDA 3WFLA 4AZHA 1NWTA 4DWSB 1OM0A 1UH4A 4HA1A 5FKYA 1K6AA 2J7BA 1G94A 2YDQA 2OSYA 3RM4A 4JL1A 3T2OA 2WMIA 2WB5A 4UZUA 3SCOA 3ZT5A 4W5ZA 1EIBA 1KXQA 4TXEA 2BY0A 5BXPA 2EQDA 3DHPA 4XB3A 4DUVA 2JEPA 1JD7A 3PZGA 3LPFA 1VF8A 4ZE4A 3WD0A 1JL8A 4AD5A 4HMEA 3PZNA 4ZE5A 2GJRA 2GFTA 3T2PA 3PZQA 3SCSA 3WF3A 4PSRA 2QV4A 2FDMA 4AZ6A 4MDPA 2WKLA 1UR2A 3GM8A 4W84A 5M5DA 1TCMA 1EO7A 1GQLA 1NARA 4YN5A 4RE4A 3PN8A 3FN9A 4PUEA 1EXPA 3MUY1 1H4PA 4RL3A 5CPQA 1UD8A 1PJ9A 4L4PA 1KCLA 2WHLA 4YHGA 3W27A 3D3AA 1E15A 2E9MA 4U2ZA 4BS0A 2FGLA 1BYBA 3ARSA 3WKZA 1BYCA 3II1A 4JFTA 3SCQA 1V3MA 1D7FA 3GBEA 5CGMA 1UKTA 2DH3A 3I3EA 3L4XA 4CD4A 4PMYA 4Y7EA 3HJEA 1QHZA 1OBAA 4TTUA 1MW3A 1MVYA 1Z32X 2VMFA 3K1DA 1WAWA 2YOCA 1AQMA 1R8LA 2XIIA 2G3IA 3L4UA 5IDIA 3SCVA 5E0CA 2OYKA 4MNMA 3GNOA 4ACYA 1UWSA 1ZBWA 4OBRA 1OGGA 3IJ8A 1OCQA 4E8CA 1H11A 3ARRA 3WIJA 2XM2A 3GXFA 4M80A 4KWUA 1QI4A 2GDUA 4PUDA 4CD5A 1UH2A 1ZBCA 1UZ4A 4HMCA 1QHPA 1TR1A 2YL5A 1ZL1A 1TVPA 5I0DA 3VIKA 1K9TA 1HF6A 1US2A 2DDXA 3ZM8A 3KWXA 1JAEA 4JFSA 2X09A 4TTGA 3NIYA 4UFMA 3AICA 1XYZA 9CGTA 1QNPA 4MB1A 5IFTA 1FHDA 1VAHA 3CZKA 7TAAA 1B31A 1HP5A 5BRQA 1PAMA 4UOQA 1GVYA 3EMQA 3WQ6A 1ISXA 3GZAA 1WCGA 1W2VA 1W1PA 5A6LA 4JL2A 3WBAA 3K4AA 4W88A 1B2YA 2HISA 3VGEA 1Q6FA 1GOMA 1O6IA 3EDFA 4MNLA 3WD2A 4CU7A 4J27A 1DWIM 1Q6EA 1BLIA 2Y2WA 5E0FA 1ISYA 4URIA 4D6FA 2BHZA 5A8NA 2DT2A 5BROA 2VT0A 1CGXA 1WNOA 1XYFA 1E5JA 3VIGA 5DO8A 1E43A 4M81A 3F5JA 1CGWA 3W28A 2CBVA 4W8LA 2DT3A 5FIPA 2WANA 2WHJA 4C7DA 3PTQA 4BQ5A 2W67A 4PMVA 3ZO9A 1RP9A 1GOWA 1V6WA 1H5VA 4YPJA 4OOUA 1DHKA 1MW2A 4L4OA 3WF0A 4UQBA 1ZBKA 1DWGM 5M3WA 3LPGA 4CD6A 3UESA 2NT1A 4AIUA 2WM0A 3U57A 1MYRA 1HL9A 2YL9A 4UNIA 2QF8A 2QPSA 2CKRA 4J3WA 3WNOA 5CPTA 1HKIA 4AZ5A 4EKJA 1JG9A 2D20A 3OA5A 4XUYA 4AD0A 2VCAA 3WN6A 3SUUA 2D22A 3HU7A 3CMGA 3L4TA 2A3CA 3AI0A 2PWEA 3NDYA 4AIEA 1X6NA 2XGBA 4FF5A 1JNDA 1QNRA 4A3HA 4WF7A 3AYRA 4OIFA 3GH4A 3AFBA 1UHVA 3THDA 3RJXA 3PZIA 5FD0A 1W9BM 3AS0A 1HL8A 2IXVA 3TTOA 3CUHA 2VQTA 1CXEA 3B9AA 1ISVA 4M56A 3WNNA 1FP8A 1GNXA 4MTVA 1E6SM 3K8LA 3AS3A 1KB3A 2ZE0A 3W6MA 1UKSA 5C71A 1G0CA 1QHOA 3ZT6A 3WD4A 3BH4A 1G9HA 4HU0A 4W87A 1B3YA 1VJZA 3CLWA 2D3NA 3TOPA 2J62A 2VVNA 2WVVA 4J7RA 4HU8A 3VM7A 1HNYA 1E3ZA 1LL6A 2W66A 4GQQA 2V5CA 4MB5A 3VO0A 3L4WA 5BCAA 1V6XA 4AWEA 1LG1A 5CJ5A 3KL3A 1UD6A 5FL1A 2XWDA 2XVNA 3BLKA 3CHCA 3FAWA 3EDJA 1NWRA 2J7DA 2HVMA 4F9DA 4U33A 2XPKA 1V0MA 2WHKA 4MNKA 2ZX7A 2JEQA 4LGXA 3OGSA 3CMJA 2XGIA 5EBAA 1VENA 3ZQ9A 2GJXA 2BVTA 2DQXA 2BVYA 2DSWA 1CBGA 2WC4A 5A95A 4HPHA 5A2BA 2WLYA 1UG6A 4E2OA 1BYDA 3ALFA 3L4ZA 2EJ1A 5HDRA 5LYRA 6A3HA 2F61A 2GSJA 5BWFA 3RILA 1GONA 2WMKA 3DYMA 4S3JA 1M04A 2BNJA 2XM1A 2V3GA 5M03A 3AHVA 4R5EA 2WMFA 1H3GA 1VB9A 4PCSA 4GQRA 1TE1A 4LPCA 3AIEA 1UA7A 1VFMA 4W8AA 1TZ7A 2VI0A 1HN1A 1XGZA 1XD1A 4OOZA 4W5UA 1G01A 1CWYA 2CBUA 1SR0A 1QW9A 2BXYA 4RE2A 5EB8A 2W91A 3UCQA 4HOZA 1E4MM 1YQ2A 1MXGA 4MJ4A 3ZJ8A 4R27A 1U33A 4QP0A 4CUCA 5A8MA 1M03A 4UQ9A 1UQYA 1C92A 4MAVA 1GORA 3A3HA 1GCYA 1QI2A 2E4TA 3MO4A 1WZAA 3OG2A 4MDOA 3GXIA 3NDZA 1UKQA 5D9OA 3AIVA 1HJSA 4GZIA 3BC9A 4U2YA 4H04A 3VIPA 4GO9A 3B9DA 3VVGA 4TUFA 2WPGA 4CU6A 1OIMA 1NWUA 3CH9A 3RCNA 4B9ZA 4TOQA 2ZX8A 1RH9A 2VR5A 2DT0A 4CCDA 1UZ1A 1CGTA 3AHTA 3CZJA 1JZ2A 2BXZA 2ZUMA 3AMKA 3ALGA 3W6LA 2EPKX 3WD3A 3O6AA 1D2KA 3GTNA 1B0IA 3A47A 3BAKA 3RM9A 2CEQA 4HZ8A 4F8XA 4JCLA 1J01A 2Y24A 1UWRA 2Y4SA 4P7RA 1E1FA 2CIPA 4PTXA 4UFLA 2JFEX 4DWSC 4Q7NA 4C7GA 5D9MA 1LWHA 3ZMRA 4JKMA 2PWFA 5AYBA 1JFXA 3W25A 4AZCB 4B9YA 4PBGA 3BAYA 1E4LA 2OWWA 3FY1A 3VIJA 4D71A 3VDCA 8CGTA 1CYGA 2XFRA 3VIMA 3DYPA 5JIPA 3CUGA 2W92A 5C8BB 2VZUA 1W3LA 1WZLA 1E0WA 3N12A 3NUKA 2YBTA 3OBAA 3ECQA 2WMIB 3L2MA 4W7UA 3SUSA 3BAWA 4J3TA 3FAXA 2J7GA 4XZWA 3K4DA 3SUWA 2GUYA 3CZGA 3VOCA 4UFKA 1GJWA 1LL7A 1H2JA 3WDJA 3EDDA 1JZ4A 5CZKA 4JFUA 4UR9A 4AD4A 2W5FA 2E3ZA 1UQZA 1MQQA 2A3EA 2YL8A 1GQKA 4MADA 4FLRA 1QVBA 5A2CA 4U3AA 3AXXA 1V3KA 5IHSA 1CTNA 4JCMA 1TUXA 1WO2A 4MPKA 1XC6A 3MUAA 1BQCA 1GUVA 2X2YA 2PWGA 1XCXA 4X0NA 3HN3A 4JIEA 3GNRA 2V38A 2WC7A 2ZUSA 4RE3A 3MV11 5JUVA 3LPPA 2DIEA 3QHMA 1LWJA 5ABFA 3ARQA 2DIJA 2PC8A 2GK1A 2VCCA 4PCTA 1VJSA 5GNZA 1HJVA 1TMQA 3O2LA 4KMQA 2BV9A 1OD0A 1JDCA 3WH8A 1KQYA 1V3IA 2J25A 4PMOA 1NM9A 4XZBA 1JNEA 3QHNA 5LA2A 3F5KA 4A3YA 4AZIA 1KCKA 4ML4A 4NRSA 1ZJAA 2D0HA 2GVYA 3SCNA 1W2PA 1UD5A 3OGVA 3TTYA 1HVQA 2O9TA 4ZFMA 3SCRA 1JI1A 3A6OA 2CITA 1VBRA 3RM8A 3L2LA 2V5DA 2VX6A 3BGAA 2W62A 5HNNA 3WL1A 4KRUA 3U5YA 6CGTA 4Q22A 3AHYA 3WFZA 5A2AA 2XVPA 2EBNA 3WH9A 1B9ZA 1EGZA 3BMWA 1OT2A 3VM5A 5GNYA 4A4AA 1MWOA 1V3HA 4HP5A 5BXTA 4E4PA 3NYDA 1Q4NX 2VRJA 1D3CA 5A6MA 2J7HA 2OWCA 5TD4A 5CSUA 4CCCA 5E09A 3PBGA 3VX1A 3ARPA 3N04A 1DWHM 2PWDA 1E6ZA 1E72M 2XVLA 3POCA 1BFNA 2GJPA 1PEZA 2WHMA 5LA1A 3CO4A 2ZUTA 3QGVA 4ZXLA 1VIWA 3WNMA 3U7VA 2CNCA 4ACZA 3WMSA 4NI3A 3VPLA 1JZ3A 2B31A 1QI0A 1CXFA 2EPLX 3SURA 4QLLA 4P7NA 2VX4A 1E3XA 4ZENA 2UY4A 2GK1B 4AISA 2A3BA 2DPEA 4J3XA 2AOSA 3VGDA 3KE0A 3VD4A 1V6YA 1LF1A 2DSZA 4U5IA 1FHLA 4KGLA 1UR9A 4QAWA 3MSGA 1J11A 3IJ7A 1ISWA 3W26A 4HZ7A 5JH8A 5D4YA 1A3HA 3QR3A 1LJYA 4CD8A 4JKKA 2YIHA 5A6SA 3NCOA 3PTKA 4AXNA 4NF7A 2PI6A 4J3VA 1FOBA 3AMGA 4D6CA 1E6NA 1EO5A 3AS2A 1MQRA 4PSPA 5AY7A 3FW6A 5I77A 1CLVA 3D5HA 3EMCA 1EOKA 3FHAA 2OSXA 2W61A 4UZSA 2RGMA 3WDRA 3DECA 2YLAA 5I3DA 3WENA 2E9BA 3WSUA 4BQ3A 3WF4A 2Y8VA 3OLEA 4WKFA 1L8NA 4AYSA 2YKKA 1MFUA 5LA0A 2J8GA 3MMDA 1CXHA 3THCA 3VIHA 3VDHA 3AIWA 2ZXBA 1JZ8A 2XVGA 4CVUA 1UKPA 3RPMA 4PEEA 4PMNA 2WMGA 3F4VA 5ABHA 2YJQA 3M46A 2CXGA 2J8FA 3AHZA 2XFYA 1PZ3A 3CUFA 1FFRA 3OLGA 1WZMA 2VQUA 1HX0A 1BVNP 3T0AA 3ARWA 3UERA 2BVDA 4M8UA 4AEFA 5E9AA 1E6XM 2XIBA 4GI8A 3WH5A 3NSXA 4D1JA 3AMLA 3AXHA 1CIUA 4F79A 1QBBA 3M07A 4Z2KA 3VX0A 3GNPA 3A4XA 5JBDA 2ZX5A 5E6YA 4HTYA 3F5LA 4CD7A 4WSJA 4D6IA 1CXLA 1JFHA 3ARTA 1ZU8A 2ZUUA 1ESWA 1MW1A 4EE9A 2FHCA 2VCBA 3L4VA 5CXPA 4M29A 1YHTA 1E6RA 2F2HA 3QOMA 2J78A 5A8QA 3RJYA 4E8DA 1W9PA 3T2QA 3ARXA 3J7HA 2E8YA 2CERA 5HOSA 1IV8A 3AROA 2JE8A 1LQ0A 5DMYA 4AMCA 3EMZA 3UETA 3KZSA 1TVNA 2ZXQA 3LPOA 3MKKA 1B90A 4AEEA 2WNWA 1VFFA 2JF6A 2CHOA 3ZR5A 5KZ6A 1UR0A 2J79A 2XWEA 4GXPA 2WVUA 1WDSA 1B30A 5GNXA 4P8UA 2JF7A 3ARYA 5GQBA 4AD1A 1H41A 5I6SA 1Y7VA 1E56A 3BXWA 1KGXA 4AY1A 1BYAA 4N0RA 3O9NA 1GZJA 5CG0A 2J7CA 2VO5A 4WK9A 1DWFM 3VDAA 4PMZA 4B3KA 1TG7A 1A47A 4CGTA 2E8ZA 3WEZA 2ESCA 5KEZA 4JZ5A 3TA9A 2Q8XA 3NSMA 3ZR6A 2XVKA 3PZTA 3K46A 2J77A 2YDRA 3VILA 3W82A 4UQDA 5C70A 1R86A 2OSWA 1PPIA 5A6BD 4NSBA 4EANA 3SUTA 3VD5A 2VX7A 4D6GA 3VGFA 3B9EA 4CN1A 3IK2A 2QMJA 1MFVA 8A3HA 1IZKA 1J0HA 4HMDA 3VTRA 1QNOA 3VIFA 3FXYA 3I3DA 1VFOA 3GDBA 1UH3A 3WQ4A 5JIWA 4MNJA 3M7SA 2TAAA 2VJXA 1K9FA 3MU7A 4XX6A 1CECA 4AZBA 1JGIA 1EDQA 5A69A 1CXKA 4MB4A 2UWFA 2DGAA 2ZX9A 1KQZA 3MS8A 1BG4A 4H2CA 2WZIA 3N13A 4CN4A 2C7FA
chains in the Genus database with same CATH superfamily
2DSUA 4MM1A 5DCEA 4JY9A 4S2BA 3LS9A 5C0QA 3N11A 5A8OA 4GIYA 4H7ZA 4O1AA 2OPJA 2OT1A 4E4UA 7XIMA 3UWVA 4ZQMA 3PZUA 5CGTA 4TW6A 1JXJA 1EA0A 1J4IA 5IXEA 4BQ4A 4D8AA 4BI5A 2PPPA 1DTNA 4FLOA 2Q01A 4ZSUA 4XD4A 3LG3A 2X0YA 4FIRA 1UPMB 4GY0A 5K4XA 3VGHA 4KGJA 2VELA 4IL0A 2VZVA 1H0GA 2PDBA 4R3UA 4KRTA 3NRKA 4G6CA 1QU4A 4EP8C 3K13A 3VZXA 2EAWA 2HVNA 2QAPA 5JBEA 5DFAA 1Q85A 3BLIA 3GU9A 1DWJM 1J93A 3APTA 3GDLA 3RFWA 3WK1A 1XIMA 2H3BA 3G1VA 3H26A 3FYPA 2G37A 5BOOA 4FAMA 2HPMA 2O92A 3N4AA 3O5EA 2C6QA 3W76A 5HUAA 4FMVA 5KZDA 2OT0A 3W2JA 3LLFA 1G4EA 2XIQA 3GTXA 3UR8A 2GVGA 4S3EA 3UG3A 4WOQA 1I75A 2WVSA 2J4GA 2WNZA 4QGCA 2VX5A 2LLEA 5C2XA 2JIWA 1JCYA 3E12A 5FF7A 3AJ7A 2Z2BA 1G7VA 2WPBA 3O6YX 4DBEA 2WZEA 5J5RA 1V0KA 3DU0A 4O0ZA 3M47A 3M64A 3IV8A 3QF0A 1LL4A 2BOGX 2NT0A 5CPMA 5HBFA 5ABEA 4OKDA 2DUZA 3D6NA 1NOWA 5EPDA 4AIOA 2ISFA 3HZ3A 2MLYA 2FH6A 3CIVA 3T55A 3PUEA 4J4KA 4Y6GA 3LA4A 1I1WA 1XV8A 2F21A 3H9RB 4LBUA 3EDKA 4GC3A 1WZKA 1V02E 1FWHC 4OZOA 1I8JA 3CM4A 4HHHA 5ABGA 4AVFA 1PX3A 4GCXA 3EWXA 3WQ8A 4AUBA 4C6OA 1QK2A 1UR8A 1I45A 4CQDA 4FHAA 1NWSA 3ANYA 1U1JA 3CIWA 4HSOA 1P7TB 3U2ZA 4S38A 3OODA 1VYSX 1V7AA 2EXOA 5BXSA 1TO3A 4IQDA 5AECA 5A6TC 3R79A 1UYQA 3WG6A 1QPFA 3GDKA 4UQAA 1ONRA 4JFJA 3STEA 4ICNA 1JAKA 1B3XA 3ZT7A 3GVWA 2HE5A 4LVDA 1BXCA 1DWAM 1TV8A 1GEQA 3DYOA 2D2HA 4DIAA 1JRCA 4J3UA 1Q2SA 1TTJA 1TFVA 4MIMA 2MLZA 4GFSA 3IARA 1H49A 1TYGA 2EGZA 2XP8A 4QTGA 1LBMA 3S5YA 1E4IA 5CLWA 3AALA 1XYAA 3W7OA 2QJIA 3B8DA 4E4FA 5EMKA 5K9CA 4KWOA 1UD3A 1C8QA 5BNKA 3VA8A 1JYVA 2W9MA 4LY8A 3GXDA 1CB7B 1PTGA 3C56A 4OHQA 3CGNA 6TAAA 2MANA 3MVTA 3Q4DA 2RH9A 1B3WA 5BXJA 4O0KA 1DE5A 1HXJA 4BQ2A 3E2RA 5U7SA 4L1GA 2DH2A 2YYUA 5DT7A 3VIIA 4D6DA 1ZP4A 2VWSA 1Q6RA 3HFTA 4JDBA 4GY7A 4TVUA 1IGWA 2PDYA 3R1ZA 1OD8A 1VEPA 1J0JA 3FA5A 4GINA 4D1IA 4H8HA 3H53A 4GVGA 4RNJA 2PU0A 3TTSA 1HJXA 3LV5A 4X63A 4P2VA 2PMQA 4UTKA 2AL1A 4YTQA 4B2DA 3M0XA 3DEQA 1RY0A 1SMDA 1TR9A 3N18A 5CZTA 3RX3A 4IMEA 5D9PA 4TX9A 2WYSA 1KFEA 4XZNX 4JIHA 2ONEA 1OSEA 3WUBA 4HA3A 4IMDA 2O9OA 1EF3A 4GVFA 1JQVA 1BRLB 1RQBA 1X7FA 4LH8A 3H2EA 4MJ2A 5EGRA 4R7OA 5I3IA 4ADUA 1PX8A 4B4HA 3MB9A 1GJUA 2FTWA 3D47A 2JALA 1EHNA 4I9MA 2V81A 1IWAA 4W4QA 1ITQA 3S4TA 4W85A 3MSRA 1Q6DA 1SJBA 2GQ8A 1NP0A 2VP8A 4B90A 1ZB5A 2Z1BA 3R7MA 3CHEA 5FJRA 3B8WA 3PHAA 4MAZA 3LM7A 1OIFA 4AB4A 1S2CA 4G2DA 1F76A 2H9AB 5ENLA 4BA0A 5CG7A 2VDIA 2X0SA 3NQVA 3GVQA 2OQHA 3C52A 1B3OA 4H7CA 5AC8A 1S5MA 3MBDA 1VS1A 1NDYA 3SEPA 3NSNA 2Y85A 2AQWA 4DLFA 4LVBA 1WDPA 2CZ5A 4QEHA 4ODPA 3EX1A 1AMYA 1TX0A 4WUIA 4AZ7A 5HQLA 2E6AA 4Q6XA 5I79A 2QXWA 2XSBA 1R6WA 2CZFA 3W7QA 3KVMA 3WNPA 1XGEA 5AHIA 3WH0A 2XN2A 3QYQA 3B9OA 2FQIA 1GQIA 1AW1A 1FHUA 2DG3A 3A9BA 4Q8VA 3S0CA 1C8YA 3VFLA 3ZOAA 3HG3A 4H83A 3R12A 2CYGA 2WKGA 1FAPA 1C3FA 3V1PA 2C18A 3OVPA 2I56A 4NJKA 1JZ7A 3KXQA 1SM9A 2CCRA 3VCNA 3KOFA 3W1UA 1F9CA 1QNQA 1FJDA 1GOXA 3OEXA 1DVJA 1NQKA 5CBBA 2G8ZA 1WDQA 3FGCA 4JTKA 3N9SA 2ZQ0A 4W9OA 3M0YA 4QT2A 1F6YA 1R9ZA 1S5WA 1RALA 3WDHA 1W1VA 1I0DA 1L2UA 1DP0A 1TREA 4H9ZA 1MEWA 4PRRA 1FA2A 1BKSA 1TCOC 3HMCA 4F66A 1V08A 4IGHA 3WQFA 1EBGA 4DRMA 2V82A 2F9RA 4ZPWR 4HKPA 4MYAA 2WK2A 3MJMA 4S3CA 3SB0A 2W63A 3S6DA 3T09A 1XJBA 4S1FA 1RD5A 4F0SA 2NSOA 2D69A 3PBYA 2PE4A 4B3LA 3A22A 2W4XA 3MCOA 2QZRA 2D0GA 2VFGA 1KXVA 2G50A 1OZMA 5HMFA 1XH0A 4YVXA 4WSKA 2VC9A 4H9VA 5H8MA 2VGGA 2ZUWA 3BMVA 1MQPA 3HPFA 4LB3A 1JD9A 4N2YA 4J2MA 1BGAA 3NEVA 1LLZA 1RK5A 4ICCX 2ZA1A 3TTQA 5A6KA 2V2DA 4NAFB 3VDGA 4UCFA 2V3DA 4ADTA 3KOYA 4UTUA 4W86A 2POZA 2R1NA 4PUKA 3EA1A 1F05A 1VBJA 1MXDA 2DUAA 4QCEA 1BAGA 3LLXA 3C2FA 3HOJA 2Y7FA 1SJCA 3PK7A 3CO8A 4F0LA 4KETA 1YTKA 3IGSA 4AC1X 8XIAA 2QPXA 5LHEA 1MZHA 2NV9A 1QW7A 2E0PA 5JVLA 2IPGA 3W74A 2GJNA 1CPUA 5AYZA 3TZNA 4LY4A 3GZ3A 4QG8A 2YYTA 1HP4A 1XSIA 1BXBA 3U7BA 3MTWA 1JF6A 1OT1A 1SZNA 3AHXA 1V0NA 3R0UA 3KVJA 3W1TA 2ZZ2A 1A3WA 3P60A 3BCDA 2CWNA 3KTSA 1M7XA 2CETA 1WDWA 5B7ZA 5MF5A 3T08A 1GWJA 1KW1A 5K9XA 1VPYA 3I4EA 3SGZA 2QHAA 1LQAA 2VDGA 4F0HA 3W7RA 2QCCA 1B6CA 3VD7A 1QFEA 1YTDA 5FF4A 2VURA 4UOJA 1W3KA 1NMVA 3IIVA 1BHGA 4NZFA 1TPC1 4UXDA 4BCEA 1QWGA 2PDQA 3TSBA 3PSVA 2ZWYA 3BOLA 2WJFA 3K8KA 1WDRA 1XH1A 2ZC8A 1R3QA 4G1KA 3W23A 2AMGA 5D2TA 3ZVHA 1ONEA 3NZPA 5TIMA 1DIEA 5I3GA 3MO7A 2BS9A 3LLDA 1GJPA 3AIQA 4LUTA 3C0SA 1E6QM 2ZICA 4QCFA 1XPGA 3S2CA 3GBDA 4UTFA 3U4FA 2XG9A 1VYRA 5LHFA 1JF5A 4XTDA 3YPIA 3FSUA 3ZJ7A 2HXTA 3V36A 5I24A 2P8BA 4YVPA 4TVDA 1EZWA 1I2RA 5KITA 3WMLA 1LOLA 1NSJA 2J13A 3KLLA 3W7NA 4JFLA 2Q3OA 1YEYA 4J40A 3VNLA 1JYWA 5DF0A 2NUYA 3O0KA 3PZOA 3SR7A 2GGEA 3UA3A 4A3UA 2ICSA 1JCMP 1K7EA 4UQEA 4DUWA 4DWSA 3T4CA 2Y7EA 5C55A 1NTHA 2PCEA 1S5TA 1F6KA 3TP4A 1WP6A 1YDVA 3MZ2A 3IVTA 3DKJA 1IIHA 5A6AA 1I1XA 3OQ8A 4ZOBA 5EMMA 2J47A 1EDGA 2ZXAA 3CHDA 1KM3A 4Z17A 4K7YA 5DELA 2XN0A 4NZ4A 3VKKA 1PTAA 3OGRA 5EFDA 3CL6A 4IIFA 3TCSA 1J0KA 5ABTA 2B5UB 3IIZA 3VOJA 3I68A 4JTQA 4DF2A 1PHWA 1ZBVA 4QFUA 4WDWA 1HGWA 2AWGA 2PWHA 1QASA 3CQHA 1LOQA 1WE5A 1DQUA 2NQZA 2VGIA 3GX9A 3BW3A 1J0IA 5E9XA 2EF9A 3CGMA 3ITCA 3VGGA 1PHQA 3WLIA 4C6NA 1BTMA 1XYCA 1JI2A 1FRBA 2QDHA 1R3TA 2C15A 3RLHA 2E68A 2ZUNA 3KRSA 2PRMA 4LFYA 5D8ZA 3OLIA 3NXFA 4IMGA 3E2QA 3WCZA 4D2JA 1R3WA 2PFHA 1OX4A 3GC4A 4D72A 4JDYA 3SW6A 8RUCA 1TV4A 2VXNA 3GG7A 5TAOA 4B2DD 1H1YA 4L61A 5DMLA 3W7KA 4K6AA 2BWGA 4IUOA 1H1NA 1TJ2A 1PO9A 4I7WA 1GVIA 3APGA 3ITGA 3R94A 4GRSA 3MMUA 4DWDA 4IJBA 1C8XA 2J7EA 5D2VA 5I23A 2PSNA 1QT1A 3H7RA 2UY2A 3S2LA 2FVLA 4BKNA 1B9BA 5HUOA 3F03K 1GYLA 4KRZA 2ZTKA 5LNSA 4ILSA 3MVIA 4L5ZA 3W81A 1XINA 1SPQA 3VE7A 4W93A 3K8MA 3GC2A 4TQTA 4DZAA 3QJAA 5FESA 3RDKA 3CGTA 3MZNA 4JTHA 3H22A 1DQWA 2VFFA 1GHRA 4HQVA 1DV7A 4ENLA 1E1CB 2VM8A 4P8VA 3BJTA 2X7VA 1X8FA 1OCNA 1Q6HA 1JDDA 2HNHA 4C6MA 1ICPA 4B5TA 4XAYA 3WFLA 5AOUA 2QCDA 4DWSB 1G94A 3VAWA 4LAXA 3RM4A 3T2OA 4IQJA 1YX1A 1Q7QA 4IOTA 3LRLA 2V5KA 3WLHA 3PC0A 3M4HA 3IJ6A 1FD9A 3IUDA 4ZE5A 3IPWA 3PZQA 1FKJA 4MFDA 4IX0A 3UT0A 3ME3A 3WLLA 1QPRA 2ZVRA 4B5XA 2J6XA 1WOBA 1UR2A 3GM8A 2ZRXA 4W84A 2Z27A 1TCMA 1EO7A 1FY6A 5U4NA 4NX5A 3G8EA 1GQLA 1NARA 2RDUA 3FN9A 1XYMA 1LUCA 3LZ5A 1EYWA 5CPQA 2QJNA 2VENA 4G7EA 3BWWA 4EPKA 3D3AA 1E15A 4U2ZA 3TMQA 3WKZA 4YJ5A 4Q8QA 3II1A 2XH4A 4DQWA 4FI4A 1F5ZA 3LHYA 3GBEA 3SADA 3MBFA 1L8PA 5FJPA 4HN4A 1K4GA 3HJEA 5EYWA 4NJGA 3S1UA 1RY8A 3K1DA 3UVIA 2HS6A 4OV4A 1R8LA 2FZDA 3KHJA 3FJLA 4GIEA 3GNOA 2QCFA 1RA0A 2R1PA 3QR1A 1IGSA 3WIJA 4Q8OA 4HCDA 1QI4A 2PPGA 2A3LA 2GDUA 3JXVA 1UH2A 1ZL1A 3MPGA 2C1HA 4DJFC 4KQNA 4BF5A 1XLLA 2DDXA 3EA2A 4OVXA 1VPQA 3ZM8A 2V6AA 3NEHA 3KWXA 5G1YA 4TTGA 3AICA 1XIGA 9CGTA 1FHDA 4N4PA 3EOSA 1AL8A 2PODA 2PLJA 3KADA 4XO7A 1B31A 3H21A 5BRQA 1YATA 1VYPX 3MP3A 3T9PA 5CAKA 2NUXA 1I9CB 5AVHA 2ZRZA 2XP3A 3GU1A 2NVAA 3E2SA 1WCGA 1W2VA 3P0WA 3WBAA 3LI1A 1B2YA 3BLOA 1TJ1A 3VGEA 2OQYA 4DJEC 1LUCB 2DZAA 1U5JA 3NL3A 2DG4A 3UU0A 4BK9A 2JKEA 4MY9A 1XRFA 4ZR8A 2A0NA 3H24A 2DT2A 3A5FA 2ZZ6A 1CGXA 1CLKA 4K2SA 3VIGA 4S39A 1E43A 4AU0A 1DQXA 1KCXA 4LS2A 3N6HA 2VKZG 4PUWA 3KAOA 2CBVA 4W8LA 3REQB 3V0UA 1GOWA 3VKAA 1V6WA 1L6GA 4I9TA 5CZJA 5RUBA 2VEFA 3E0WA 4ODKA 1OX4B 3WLKX 5M3WA 3LPGA 4CD6A 2E5BA 1P43A 3QYSA 2WM0A 4JFMA 3U57A 4DRIA 3TC6A 1H50A 4UNIA 3JZUA 2CKRA 1SW7A 4EKJA 2REQB 2XFWA 2ZZ4A 3O1NA 2PDNA 1XLHA 2A3CA 3HPAA 2PWEA 3NDYA 1XL9A 4FF5A 1QNRA 3S2MA 3AYRA 4QJ5B 4RXFA 3M1ZA 2NX9A 4IH3A 3H54A 3BLFA 3FDKA 1W9BM 4NY2A 2XZ7A 3TN4A 2IXVA 3TTOA 3OJGA 2BODX 4M56A 1GVFA 3IJDA 4QROA 1FKTA 4Q8UA 4MTVA 3P5ZA 3AS3A 1KB3A 2POTA 2ZE0A 5C71A 3N2TA 3ZT6A 4QG9A 3MUXA 3HV8A 4HU0A 1B3YA 4PMJA 3W87A 4HU8A 2XP9A 1U79A 4Q4KA 1E3ZA 1HGYA 4GQQA 4K1GA 2V5CA 5I00A 4O52A 3VNDA 1ITUA 3LCXA 4IMCA 1FWTA 2Z1VA 3EDJA 1NWRA 1LYXA 4DRJA 1FCQA 2HSAA 1F3EA 1SZEA 2XPKA 4DO6A 2WHKA 4RKAA 3CMJA 1AZ2A 3B7XA 2BG5A 2DJXA 1VENA 4PODA 3UPBA 3EWBX 1ZLPA 2DQXA 2BVYA 3O5IA 2DSWA 5I06A 1SZFA 1CBGA 3H12A 5A95A 5A2BA 2WLYA 1UG6A 2X1TA 5HDRA 2XP7A 3R13A 3GXTA 3RILA 3HB9A 4S3JA 1M04A 3C2OA 1XLCA 1X39A 3AHVA 2TODA 4R5EA 4RR4A 2PGEA 3O5JA 4GQRA 1TE1A 3HGOA 5I3KA 3CL7A 1EWEA 2Q09A 1VFMA 3O3RA 4XD3A 1WOAA 4I5RA 1XGZA 4OOZA 4W5UA 2CBUA 3RGTA 4HOZA 3PPFA 3THUA 1MXGA 4FR1A 3ZJ8A 2QJGA 4QISA 3VNJA 4CUCA 3P61A 1UQYA 3O07A 5HULA 4PCPA 2DVUA 3NZ1A 4MAVA 1GORA 3TFCA 1WZAA 3OG2A 3KCEA 2ODOA 1TUFA 2V5LA 2XISA 1UKQA 2PP3A 5M2FX 4C6EA 3URQA 2ZBTA 3R4IA 4GX9A 4BEQA 4GZIA 3BC9A 4U2YA 5JH2A 4GO9A 4TUFA 4CU6A 2RURA 5C9RA 1K8YA 3RFAA 1F8AB 1ZUAX 4ZQRA 1LRTA 2FVKA 3UWQA 3S42A 1XUZA 3CZJA 1UB3A 2BXZA 2MUCA 3AMKA 4C6QA 3W6LA 2QIIA 3O6AA 4S2CA 4GE8A 5DIVA 4IIGA 1B0IA 4RDZA 3TYUA 2CEQA 2CLMA 4F8XA 1EQ3A 2CIPA 2ZZ3A 3LBCA 3WQEA 4DH0A 4NP7A 1LDCA 1ZAHA 3FS2A 1LWHA 2PWFA 4HNUA 5AYBA 2O56A 4JX6A 3W25A 3KAIA 1QR7A 3HPSA 4N6FA 2XFRA 3INPA 3VIMA 5JIPA 2NWSA 4TIMA 4QIBA 4I7UA 3HGRA 4HHPA 1WZLA 3H8AA 4N9CA 4NNAA 3S46A 1Q7MA 3N12A 3NVTA 2NV2A 4W7UA 1O68A 5HATA 4R88A 3FAXA 2J7GA 1ADDA 3WJWA 2GUYA 3RO6A 1LL7A 3WDJA 1A50A 4JYFA 4UR9A 2PF8A 4AD4A 3NYZA 4RLIA 2HCVA 2YL8A 4MADA 3GDRA 3E02A 4U3AA 3GXNA 3AXXA 1V3KA 5FF2A 2Y7GA 2LPVA 4DAIA 1CTNA 3BANA 4FP1A 6ALDA 1TUXA 4MPKA 2DU2A 3S3GA 2BX7A 2W3ZA 3LNPA 2O7SA 3A4JA 1UPPA 2WC7A 2ZUSA 4DJFD 4DXVA 5JUVA 3EEZA 1LWJA 2PTXA 2DIJA 4UB9A 2QF7A 4H9UA 2REQA 4J5NA 4LC8A 1WDDA 2VCCA 2TMDA 1TMQA 4KMQA 2BV9A 1JDCA 4KIEA 3L5AA 3ZWSA 1V3IA 4PMOA 2VOMA 2PZ0A 3F5KA 3SY1A 1KCKA 4ML4A 1RCXB 2D0HA 1S39A 3F4DA 3NQCA 4WRHA 3SCNA 3PVFA 1KTBA 2V2CA 2V67A 2QR6A 3OGVA 4UIOA 2GGJA 1P5QA 2YCLA 4U10A 1JI1A 3OIXA 3UYCA 3N6QA 4RX0A 5DITA 5E5CA 3Q58A 4KRUA 4NL1A 4HD5A 4RV3A 2XVPA 4RNFA 1PVNA 3G1FA 7PTDA 1X7IA 4LB4A 4UWMA 2J7HA 5G5IA 2OWCA 3BQ6A 5CSUA 4WGXA 3G0SA 4JX4A 4NILA 5CZSA 1XG4A 1VBGA 1VFLA 3FX4A 3CH0A 2NXIA 3ITVA 1FBAA 5HWNA 4ACZA 1RJRA 3BJSA 4NI3A 4GY1A 3VI2A 2B31A 3ABSA 1CXFA 3HO8A 4QLLA 2UY4A 3P2VA 1P5BA 4UR8A 2DPEA 4B5NA 3IIPA 3KE0A 3RU8X 4U5IA 4G9PA 3UQNA 3W6YA 2VEIA 4YMZA 5BWAA 1UC4A 1PZ1A 1V79A 4RPPA 5D09A 3E0FA 1KBLA 4UTTC 1ME7A 5C54A 2BDQA 4MZYA 2IQTA 2EHHA 4JKKA 2RJGA 3PTKA 4LS1A 4AXNA 3W7EA 3BV7A 4D6CA 1E6NA 2GL5A 1P4CA 1MQRA 3QFWA 4AVOA 3FW6A 5I77A 3QMRA 4HU3A 3GHRA 4DNMA 4UZSA 2RGMA 2O0TA 3NAVA 2PZNA 2E9BA 3BICA 3WF4A 3NO5A 3W88A 2YKKA 5DRIA 1MFUA 3AU2A 3L67A 1RJPA 1Q6QA 2O4QA 4PTNA 3Q37A 2MNTA 1U1HA 4ODRA 3VDHA 1TTIA 4RW5A 1OCBA 1ADSA 2ZXBA 1JZ8A 3QMSA 4LRTA 4US5D 2PDXA 1YDOA 4UUIA 1KM2A 2WNNA 1PINA 4UR7A 5CPOA 3G1HA 1TB3A 1S5NA 4FNPA 1QPQA 3I65A 1DKWA 4LW7A 3W72A 1GRJA 4WDXA 4B91A 2WKJA 3W7JA 3T0AA 3CYVA 1NEYA 4M8UA 4RNHA 3KTCA 3KCOA 3LB0A 3Q45A 4C90A 4AEFA 3AMLA 1AD4A 3AXHA 1CIUA 2F2KA 2AL2A 4ZL1A 5EMLA 1W37A 1KCZA 2M08A 5BMXA 4W9QA 3ABZA 4I6VA 4OFCA 5AHMA 3GU0A 1K70A 1CXLA 1VLIA 2F38A 4Z1CA 1W3TA 1P6BA 1ZU8A 4HPXA 1ESWA 3GTIA 1K03A 2VCBA 1P0EA 2AGKA 5CXPA 1CCWB 2XP4A 4M29A 3SY8A 2Y89A 2F2HA 1XQKA 3QOMA 4AH7A 5LNUA 3RJYA 1HO4A 1OY0A 3T2QA 3J7HA 4YTRA 3VOFA 1B54A 1BWKA 2CERA 2VC7A 3MY9A 1H7WA 2IF4A 4JQ2A 4AMCA 1HUVA 2KR7A 1V5XA 1W31A 5KZ6A 5LIYX 3ZR5A 5FEZA 4BR1A 3GG8A 4I9AA 1KFJA 1S3HA 3CB8A 3RU6A 2UV8G 5GNXA 3E38A 3QM3A 3UVAA 4O11A 4LUSB 5GQBA 1D8WA 4AD1A 1Y7VA 2OFJA 3BXWA 4B5VA 3ERPA 3BW4A 3JS3A 4AY1A 2B7NA 3O9NA 4JN6A 1GZJA 1GKRA 2P10A 1E44A 3B06A 3A12A 4US5A 5TF0A 3MWAA 1FKLA 3LRKA 2UZ9A 4JEQA 3V35A 1A47A 3F7JA 3WEZA 1KRAC 5KEZA 4C6JA 2QCDB 4JZ5A 2IPJA 4B4FA 1MI3A 1VCVA 3NQBA 2YPIA 3L68A 3QR0A 1R86A 1PPIA 3BQ5A 2QJJA 4NSBA 4FS9A 3W2NA 3B9EA 1GK8A 5F2IA 1Q65A 2QDDA 2GQ3A 4L6DA 4Q8TA 8A3HA 2GGHA 3CQJA 1IZKA 1R38A 4HMDA 3KTXA 1ELSA 1E0TA 3VIFA 3FXYA 3A21A 5FJIA 1ZFJA 4KFPA 3CLMA 4BEUA 2IW0A 3IKGA 1VFOA 3GDBA 4PBEA 5JIWA 1V4YA 3E3HA 4JTUA 2H8XA 1JGIA 1EDQA 2Y70A 4D8LA 2J27A 1UZDA 4DUOA 2UWFA 2DGAA 1KQZA 2N87A 1BG4A 2WZIA 1W26A 2YB4A 2C7FA 4HNOA 1QPLA 3ODKA 1ZCOA 2R24A 3G1AA 2R8WA 1W9UA 4GZJA 1J6PA 1US0A 2OVLA 4Z2JA 3TN5A 1UBPC 1V3JA 3BAJA 3LGEA 3V5OA 3C6CA 1ODZA 3GIQA 3T44A 2VOTA 4J35A 2L2SA 4I3GA 1DTUA 1HT6A 2QLYA 2DZUA 3S1XA 2CBIA 1V77A 5FL0A 3UD6A 3G3MA 1GG0A 2OYMA 4IQEA 2BFGA 1YKWA 2VTFA 4JTSA 3BAXA 4ZSTA 3VC6A 3W29A 1GQJA 3BUVA 1FWGC 1SW3A 4AX6A 4YTSA 1N2VA 3UQAA 1FKFA 5G1MA 5C9UA 3DG7A 1KV5A 3MUIA 4S3KA 2A6LA 2DSVA 3NJ3A 3UZYA 3QGAC 1E1CA 1V7YA 3UG4A 1HIZA 5CSYA 9RUBA 2OZTA 3QV6A 2P4VA 1Q6GA 1ZPTA 4H8VA 1ME8A 3W0KA 3CU2A 3LHZA 4C1NB 2YA0A 5GJPA 3LXBA 4UTWC 4GOAA 2C13A 1CEOA 3ABRA 3E6EA 5EBUA 4KFNA 4NZCA 3R6IA 3R0DA 2Y6ZA 3WJSA 4ACZB 1C7SA 3ZJKA 3O15A 4O10A 3TCZA 1JCTA 1UIPA 3MMWA 3WQCA 2ADAA 4O12A 4HOWA 4S3BA 4A2SA 4O0QA 3BPWA 3TC3A 4I8DA 2I9UA 1KBJA 2FJUB 3G6MA 1XYBA 4G50A 2DIKA 4L6OA 1ZQ5A 3POHA 1UWTA 4BFAA 3GFZA 5CGQA 1V02A 1W3JA 3L66A 4NU7A 4DBUA 1LZOA 2VRKA 4C6CA 3JYMA 1E70M 1VBUA 4HNVA 4TYOA 2J74A 1LWIA 4FB7A 3DH7A 5FEPA 3MDWA 2R91A 1OYBA 4GJJA 1KGWA 4YCPA 2V5BA 4H2HA 3ABQA 3QGKC 3M0VA 2Y61A 3EEGA 3LNMA 4BHYA 3KBSA 1AZ1A 4HHMA 4GC4A 3GKAA 1SW0A 4QE4A 1Q6CA 3GNDA 1W9DM 2DW6A 4U28A 4GIAA 3TCEA 3EB2A 5BYWA 1V03A 4DT4A 2PTYA 1JIBA 4ZTYA 1OX5A 5I2UA 3T0BA 1T0OA 2YFOA 1TZ9A 2NUWA 3DG3A 1JDAA 4ZO9A 3MSDA 2F84A 3UWEA 3RMJA 2E09A 4AD2A 3QH2A 2VYOA 1Y0OA 3WMCA 1BVWA 3EY6A 1LBLA 4O16A 4QNEA 1PKMA 1VHCA 4JNMA 2TYSA 4MYXA 5CC7A 1TWIA 2QAFA 4IPNB 4HA4A 5AZ0A 5B80A 5CPSA 3S1WA 1HKKA 2XTKA 4ZEPA 2Y8UA 2VD9A 4CVWA 3B8SA 5HA7A 4IGNA 3VCRA 3O06A 3LHUA 5DN1A 5XIMA 2RGLA 1M53A 4P7LA 3O5LA 2Y0FA 2P3EA 1DXEA 2F6KA 3W24A 1F8MA 3U2EA 1LT8A 3AXIA 4MJZA 2WMJA 1J5TA 1TQXA 4QX4A 4GH1A 1BVZA 3URAA 3QY7A 3QSTA 5A1AA 2BOFX 3HURA 2V2HA 3C3NA 3KRBA 4WXYA 4Z2IA 3P80A 1OGBA 1V8EA 4E38A 3D3FA 1RJQA 2HNEA 3W70A 3S6TA 3TQKA 3N4FA 4C6BA 3GHTA 1H09A 1G4TA 2Y8KA 4FA3A 4IHCA 1JYNA 5HW6A 1CW2A 4L80A 1PB0A 1TV3A 5A94A 1K7XA 3NI6A 2WZMA 2YZRA 2VR4A 3MA8A 3TJLA 3L12A 1A5OC 3M6YA 3AYSA 1HJWA 4I5XA 1M7PA 5HAOA 3RPDA 3P81A 2XH2A 1TQJA 1ZTVA 1A0EA 1FVPA 2VEGA 4DAFA 4JICA 4H00A 1SFJA 4C7FA 4OUEA 2OFNA 2OEJA 4JTFA 3UZZA 3M0IA 3UG5A 4MVAA 1E71M 1US3A 4M1RA 3WK2A 3WDIA 4ONVA 4LT9A 3LCFA 1BF2A 1XRSA 1A5SA 1KR1A 1WUFA 4FNRA 1VKFA 3VMNA 4G56A 1B3VA 4WR3A 3O5GA 1OEPA 4RNIA 5AVNA 4HT3A 4LCSA 3VNYA 3OW1A 4HBKA 4DM2A 1YYAA 3SQMA 4IG2B 2R1LA 5G4WA 4GMEA 4O8RA 3H2FA 1F3XA 4Q8WA 2YBUA 1J4RA 2PF0A 3K2GA 1MSSA 4PMRA 5GPRA 3B3DA 1J18A 3VNZA 3BV4A 1EP1A 3Q94A 3I7RA 3UPMA 3SY5A 4IPPA 2G4FA 1OGSA 5IRPA 3LU2A 4AEOA 3FA4A 3TU9A 2ZQVA 5I07A 3ARUA 3CIXA 4GKLA 3W4RA 3I6RA 4ZXOA 2YDSA 1SO6A 3UFYA 2CKSA 5HXMA 1U30A 2YCKX 3TW6A 3NNTA 2X8RA 1T41A 5JU6A 1Z7AA 1UKOA 1XSKA 1EJRC 1OK6A 3UEQA 4Y90A 3FJ6A 3RRXA 2X05A 4XAPA 4UDMA 4GGBA 3U2CA 1ONXA 4A29A 2G96A 4NZ5A 2CHRA 1V3LA 4EPEC 1HKMA 1ZCCA 2PRLA 4XKMA 3EWWA 3I6CA 3EXTA 3L21A 4WDUA 3AWNA 2A7PA 4AAJA 3VUPA 1X38A 1XS2A 4MPQA 4C5YA 4PR4A 4GABA 1PIFA 4Y8EA 3OP2A 4PZVA 1GW1A 4UCGA 3MUCA 4H6KA 4B5UA 1Q63A 4E0CA 3S9YA 1ME9A 4AQLA 1ODUA 4AG0A 1QI3A 2WJEA 5CEWA 1EIXA 2XIJA 3P62A 1L0PA 1K02A 3AZTA 2A5HA 3QFEA 1E5NA 2UY3A 4IL2A 3KX6A 2RUQA 2SFPA 1IT0A 4KCUA 2F6XA 2E5DA 5C6MA 4Q6JA 1AG1O 4CCEA 2D2OA 3BGJA 2E40A 2Z6IA 3WQ5A 5EMJA 5HJYA 3L65A 4QG6A 2OLHA 5K3VA 1GQNA 1OHLA 1ZS2A 1RCOB 4KEZA 3IJ9A 4R53A 3IAPA 4BWLA 4PUMA 3OIHA 1I2PA 1FDYA 4O8AA 3UG8A 3FJNA 5DY3A 1GVQA 4UMBA 2QUMA 4DO4A 4QE5A 2ANUA 3WH6A 1K8ZA 1PL9A 1IR1A 4DJDC 2C3ZA 1XM3A 1TJPA 4HPGA 3U5UA 1BF6A 3NPXA 3ZJ6A 1VFSA 3GFYA 1XBYA 4W7VA 3S1GA 3IKDA 1DL3A 2AKZA 2FZ8A 3PF3A 2NQ5A 4MWAB 4A3QA 2DQWA 2XP5A 3HGJA 4CQCA 4B15A 1ECEA 3WMBA 2CPUA 2PLMA 1EPXA 1GHSA 2OB3A 1UA3A 2JBMA 4AIBA 3WF1A 2QPUA 2DZVA 1KRMA 1E40A 1VFTA 1R47A 3GIPA 3G77A 4X61A 2Q5AA 5I02A 2ZIDA 4M24A 1J0YA 2HWGA 3EPOA 2BHUA 2QNEA 1J8VA 1KFWA 1AMKA 4EPDC 1G5AA 1LRQA 1O4UA 2PB1A 4EXAA 5FEWA 2PA6A 3OBEA 4DIPA 2C0HA 1REQB 3USBA 1MNSA 2VDHA 4J2PA 2ZYFA 3SN1A 3AIBA 1MO0A 1AH4A 4J3SA 4FXSA 3QW3A 3TC7A 1OB0A 4XVEA 1RVKA 3W2KA 1Z6KA 4M6QA 4PTMA 3ZSTA 4ATLA 1RA5A 1QNSA 1EKOA 1CGVA 1N55A 4Y2WA 1MW0A 1UR4A 1MUWA 1C7TA 3SCUA 1IZJA 3GXMA 1UC5A 4IX2A 1E9LA 3E0IA 4FK9A 4IPLA 4FX6M 1UOZA 4JTEA 4M19A 4Z2GA 4PRWA 1XBZA 3STPA 1HFBA 4KR0B 2KI3A 2GVLA 4X3ZA 4XAGA 4A21A 3HGSA 1J12A 1UIOA 3PRBA 4LYKA 3TJ4A 2AL2B 4LANA 3VNIA 2DORA 3M5ZA 1EOMA 1QWKA 4DXKA 2P1FA 4TMCA 4H7VA 5BXRA 1E9ZB 4ZOCA 1MDLA 4WLCA 4Y9AA 2WWCA 3K1GA 1JPHA 3CUXA 1WB0A 1G7UA 1GOOA 4ZBCA 2FHBA 4ODLA 2OR2A 2PRHA 4DJED 3BE7A 3XISA 4GI9A 1ROTA 1LG2A 1Q7ZA 5A5WA 3WD1A 2D2GA 3ARZA 1L2QA 1CLXA 5D02A 1X1NA 3PB2A 4CQBA 3M0MA 1QJWA 3AUJA 3TV8A 4UMCA 1J2BA 4QDMA 1B3ZA 1LT7A 4I5UA 1Z48A 3NWRA 4D9PA 3NQAA 5E6ZA 3IEBA 4LEFA 4Z1DA 1ZNNA 4JIRA 4F0KA 1CGUA 1EHAA 4N9DA 1FWAC 1JCJA 4UTIA 1KFLA 3FHQA 1KTNA 1T11A 4YS1A 3AIUA 4ODQA 2FMOA 4LVFA 5A6JA 5HMSA 1KR0A 4KQZA 3QQWA 1NIUA 4JPGA 4OTKA 5EMYA 3V16A 4AZCA 4MFEA 1W5MA 4PUJA 3S5NA 3SSJA 3WELA 1F4HA 4X9YA 2AMXA 1BEUA 1TJ0A 4W8BA 3H2AA 1PBGA 1RV8A 3E96A 4JFIA 7CGTA 3AAMA 4GYFA 1EX1A 1R7OA 4L7ZA 4FLQA 1OFEA 4JGDA 1QNVA 5D2YA 3RAOA 3FOKA 4AZHA 5FKYA 2QDEA 3MT1A 4PL2A 4DRKA 1K3UA 2OSYA 3CWOX 3FCPA 2Z1XA 2ZQTA 4W5ZA 1EIBA 4TXEA 4C6KA 3W7MA 5BXPA 1JD7A 1ZAJA 4IPXA 5F1VA 3LPFA 1F40A 1VF8A 2IKHA 4NAEB 1OC7A 4Q8MA 1DJZA 1EB3A 4PSRA 2QV4A 5DRCA 2FDMA 1BQGA 4MDPA 2WKLA 4AHOA 5M5DA 4V15A 2E1WA 1WA3A 4S23A 4YN5A 1M65A 4RE4A 3NXLA 3MUY1 1H4PA 1J4EA 1TE6A 6REQB 1YRRA 1W5NA 1U5HA 1F07A 1UD8A 1PJ9A 1OK4A 2DZTA 3B97A 2Z1WA 1FWIC 3NQ2A 4YHGA 1F7BA 3N3TA 1BYBA 2HMCA 1BYCA 1XBXA 3HQPA 1FKSA 4IIEA 4O28A 3I3EA 2Z00A 4Y7EA 3AUOA 1QHZA 3G8RA 3FKKA 5GVJA 1WAWA 2YOCA 1AQMA 2X41A 4IQLA 3P84A 6TIMA 1L6WA 1NFPA 4JQ4A 1VC4A 3SCVA 5E0CA 2OYKA 2V8ZA 1RPXA 4XTIA 1OCQA 1FWJC 1H11A 4E3TA 3DFYA 5FF3A 4M80A 3QSRA 1O66A 1WKEA 4N9BA 1QO5A 1ZBCA 1EEPA 3BLDA 3K30A 1TR1A 5I0DA 4DRQA 1TVPA 3FKRA 3P0XA 3FV9A 3VKCA 1US2A 3S5SA 4JTRA 4M7SA 2DZSA 1PZ0A 5HQEA 4C91A 4IQ2A 2WQDA 3UF8A 1QPNA 2X09A 3EX3A 3IIOA 3FFSA 4R7WA 4DRSA 3NL2A 4DX3A 1DJNA 1D7JA 4MB1A 5IFTA 3BMXA 1GVOA 3CZKA 4H9TA 7TAAA 4B92A 1T99A 3QY8A 1DJGA 2OJPA 1QXLA 2A85A 4HBOA 1SJAA 3HPXA 1GVYA 3EMQA 5DCDA 1UROA 1ZK6A 3G0UA 4GX8A 4LAUA 1CT5A 1I6NA 2WO5A 5IM51 3UQBA 4MNLA 3DC8A 3QLDA 4RZBA 3KUMA 1AODA 4J27A 3ID7A 1Q6EA 1K8XA 3PJUA 1ISYA 3VOIA 4D6FA 3IACA 1TZZA 5BROA 2VT0A 1WNOA 1QCWA 1XYFA 1E5JA 3EX2A 5DO8A 4LUTB 4ZODA 3LUOA 1XG3A 2FZMA 1KA9F 1R2TA 3B05A 3WO8A 3F5JA 5KMYA 2W79A 2DVXA 2LKNA 3PTQA 4HK5A 2W67A 4PMVA 2QGHA 2HV5A 1W17A 3NG3A 4K8HA 1OC6A 1EYMA 2ZR5A 4YPJA 3VFCA 1MW2A 2R14A 3EB4A 4L4OA 3RCMA 4UQBA 1ZBKA 4QNWA 1FKHA 2NX1A 2EPHA 3UESA 4O53A 1MYRA 2YCEA 3P93A 2OZ8A 2YL9A 4XO6A 4J3WA 1JDFA 1HKIA 4CQ9A 2C0AA 1YNPA 5CPLA 3TYEA 5IOBA 4AD0A 1VQTA 2P3ZA 1M7JA 3BARA 3GW0A 4GYKA 3W1XA 2XDFA 3TWBA 5K2ZA 3PRDA 3L4TA 4A3HA 4WF7A 2CXEA 3NO3A 2FPVA 4OIFA 3SO7A 3GH4A 4DROA 1QOPA 3AFBA 1VHNA 4Q8PA 2RDTA 3ES8A 3A24A 5F1UA 4GXMA 4WZHA 3KOWA 1CXEA 1ISVA 3WNNA 3DN5A 1GNXA 3UXKA 4RZ4A 1G0CA 1QHOA 3LERA 3UI4A 3C8NA 1VJZA 3CLWA 2D3NA 3TOPA 4J7RA 1BD0A 2PAJA 3CTLA 3MCMA 3HA1A 5JH1A 5J04A 1LL6A 2W66A 3CHCA 1SO3A 5IBXA 3CT2A 2QIWA 4FN2A 1F6PA 1YTEA 2HVMA 4F9DA 4U33A 3R43A 4MNKA 5J5DA 1H61A 3NZRA 4RJEA 4LGXA 5CAHA 2J9ZA 1Y0EA 4ZZ9A 3HJZA 2OX1A 2GJXA 2QT3A 2BVTA 4JD4A 3GW3A 3T0TA 1SUXA 2PU1A 4HPHA 3THAA 4ODMA 1BYDA 3QLLA 3KVKA 2EJ1A 5LYRA 4FOJA 3VKJA 4R34A 2HBVA 4NXKA 1YDNA 3KDNA 3U8GA 2WMKA 1K77A 2XM1A 4AY8A 3PB0A 2ZZ5A 1VB9A 1W3IA 4PCSA 1YADA 3M0KA 1F74A 3PNUA 3LBOA 4ORIA 1DJXA 1IHIA 4W8AA 2J9XA 1POJA 2Z2AA 1FXQA 1XD1A 3H55A 1YLVA 2W91A 4E5TA 4TR9A 4INFA 3N9RA 5JMUA 4F48A 1U33A 2GWGA 3DKLA 1C92A 2OG9A 1Q8AA 4GKTA 1AW5A 4PGLA 5AHLA 4DZ2A 2CW6A 4WCJA 3GKFA 3CV1A 5AHNA 4MDOA 1JQXA 3VNKA 2OKTA 2Y5JA 2GJLA 1PCWA 1WBJA 4YXGA 5D9OA 3E74A 3CV2A 4H04A 3VIPA 3B9DA 2RDWA 5B8IC 1DHPA 1I2OA 3VVGA 1IT8A 5CBJA 2WPGA 4IJRA 4J3ZA 4JTCA 4TOQA 4Q4RA 2R6OA 1OFQA 2PGWA 2VR2A 2VGFA 3E0VA 2DT0A 5CKSA 2E5CA 4RW3A 1UZ1A 3AHTA 2ZUMA 3ALGA 5MHBA 3PM6A 4ZO7A 4LAWA 3KBJA 4QSHA 1P0NA 3CAVA 3ZWTA 2EG7A 4UTWA 3V75A 3WZ0E 2M1IA 1XDMA 1UWRA 5G4EA 1E1FA 4N9EA 1IYXA 4RDYA 4UFLA 5I3JA 1XR2A 4DWSC 4LJ3A 4MUZA 4FEZA 4C7GA 1JFXA 4PBGA 3BAYA 2OWWA 3FY1A 3VDCA 8CGTA 2ETNA 3MYPA 1CYGA 3W07A 3DYPA 4JIPA 3CUGA 1W3LA 1IZCA 1HKWA 1FTXA 3PJWA 4A22A 1E0WA 3WLSA 2OZ0A 1EBHA 3NUKA 5B7YA 4LNCA 4BF8A 2XP6A 4US6A 2C1GA 3R11A 1D3GA 1Z8AA 3L2MA 3SUSA 2B81A 4J3TA 5EU9A 4FOKA 3R0KA 4AWSA 1MNZA 5DXYA 1JZ4A 5CZKA 5E93A 2ACSA 2ZRYA 4L9XA 2P0OA 3TAOA 5LSMA 2Y1HA 2E3ZA 2GVEA 3G2GA 4FLRA 1NSGA 4QSFA 2OZ3A 4XZMX 3TQPA 3CS2A 3MYOA 4KCVA 4JN8A 3UF9A 2X1UA 4KWWA 3JW7A 2X2YA 4DY1A 3HN3A 5FJJA 4JIEA 4FOUA 2BTMA 1KRCC 3EOLA 3M41A 1M41A 2V38A 3PAJA 4KESA 2INZA 2A7NA 4RE3A 4MSSA 4GH3A 3LPPA 2IKGA 5ABFA 5CBIA 3MKVA 4DN1A 2GK1A 4IPJA 4WX2A 2P88A 4PCTA 3GDMA 1VJSA 3W2UA 1A7XA 3GDTA 5GNZA 3TN3A 3UWWA 4K7VA 1W54A 4XZLX 1X8CA 2EULA 2J25A 4XZBA 3O5OA 4EF8A 4O1FA 4JFKA 2WOQA 3QHNA 5LA2A 2R94A 1ZJAA 5REQB 4S3AA 3UGVA 1KM1A 1UD5A 4V1YA 3PRAA 4GYJA 3TTYA 4FNSA 3COTA 4DXXA 1J79A 1NY1A 3W3OA 3BK0A 3ITTA 3RM8A 3L2LA 1DIOA 3FA3A 2Y5SA 3E5PA 3WL1A 3U5YA 4Q22A 2ON3A 3OOQA 3AJXA 1F8IA 3LCWA 2X40A 5EA9A 4EXBA 1EGZA 1A5CA 4LBRA 4FNTA 3UWUA 3W7HA 2M2AA 4AWUA 3NYDA 1Q4NX 1R30A 3QEZA 1ENUA 3VX1A 3N04A 2PWDA 1E6ZA 3R58A 1E72M 2XVLA 2KFWA 2GJPA 1PEZA 3UNDA 2WHMA 1FUYA 1MEHA 1H5YA 4ZQPA 3WMSA 3BTNA 3CK5A 5JXQA 4P7NA 2ITKA 4ZENA 4GYPC 1W5OA 3VGDA 3OVRA 1M7OA 1V6YA 1LF1A 1VPXA 4KGLA 1UR9A 1ROUA 3MSGA 1ZCNA 2XU2A 3T4WA 4Q4OA 1FKGA 1FWWA 3EKLA 4HZ7A 1BKFA 2PDJA 2J24A 3QQ0A 1UW9A 4L56A 3QR3A 5HNTA 3NCOA 4REQB 4B5SA 3O16A 5DMMA 1EO5A 4J1OA 3AS2A 3RYSA 5AY7A 2FGBA 1CLVA 4O4VA 2X42A 1EOKA 3FHAA 2OSXA 1EUNA 3DECA 4GUIA 1T6MA 2J6VA 3WENA 3IRSA 3WSUA 2B7QA 1L8NA 2X7WA 4HVXA 2PDLA 4QAIA 3DI0A 4MSPA 5LA0A 1IWPA 4YVVA 3MMDA 3VNMA 1P6CA 3UXIA 3VIHA 4LCRA 1JVNA 3NQ8A 3AIWA 5MKGB 3QVQA 1FHVA 3V18A 1ZGDA 2VFDA 2GUBA 4FALA 1IXNA 1FCVA 3HQ1A 4PMNA 1WV2A 1LROA 3RXZA 2WMGA 3M46A 1JCXA 2CXGA 4MWAA 4I9JA 1YNQA 4O18A 2HS8A 2WJDA 5C5YA 3SRHA 2HQAA 1HX0A 1TPDA 2XPBA 2BVDA 5AN7A 1H60A 2CLOA 2I16A 1TPVA 2XIBA 1Q6UA 4GI8A 3RLGA 3NSXA 1KFBA 3LOTA 4F79A 4TU1A 4MY8A 5D37A 1QBBA 3STGA 3Q2DA 2VC6A 3EB3A 3VX0A 1C29A 4LEQA 2FPYA 1XGDA 1Y65A 3G5EA 3NQGA 2ZX5A 5E6YA 1T96A 3F5LA 4F40A 2PDFA 1ADOA 4LU0A 1IXQA 4H9MA 1MW1A 4EE9A 2FHCA 1VFHA 3L4VA 3TEVA 4ZB2A 3VZZA 1E6RA 4J4OA 2A21A 3EZ4A 1NMWA 5A8QA 1W9PA 2MF9A 3ARXA 2G95A 2Z29A 4GJIA 5HOSA 1TIWA 3GB6A 3NQEA 5DMYA 5F2LA 4IWWA 3KZSA 3NR0A 1SQ7A 4JNZA 1B90A 4QDWA 1JCNA 1UR0A 4GXPA 2QCHA 1B30A 4P8UA 2JF7A 3ARYA 2NZLA 1OG6A 5I6SA 1WXZA 4K8GA 1XFBA 3KBNA 2BB0A 4YCOA 5CC5A 2J7CA 5CJMA 3LDVA 4G2PA 3W86A 3KRUA 2Y63A 2Z26A 2CLFA 4BJHA 1LM1A 2ESCA 4ZPTR 2RUSA 3GD6A 3P5YA 3TA9A 2Q02A 1KM4A 2XVKA 3PZTA 3EWCA 2PCQA 3IGUA 1XFCA 4TMBA 2YDRA 3VILA 3W82A 3NL5A 3GG0A 4XWUA 3Q67A 3S2JA 5C70A 2I5QA 5A6BD 5HMEA 4O57A 3DHFA 4D6GA 3VGFA 4CN1A 1XLBA 5KINA 3I3DA 1FCBA 2P76A 4GWEA 1A5UA 3S9ZA 1OX6A 4IIHA 3SZ8A 4MKVA 4Y8FA 3BLLA 2TAAA 1W6TA 3MU7A 4AZBA 1CECA 3GVVA 1CXKA 4FSAA 2YX0A 2ZX9A 4Y9OA 3LBMA 3M44A 4Z08A 2IPFA 4K3ZA 1KFCA 5AZ1A 4F3HA 1XLJA 4DHGA 1H0IA 5LGXA 4LQ1A 1WKYA 4KEMA 4GCAA 1FH8A 4UTMA 4JIIX 4XAZA 1GOQA 3VU2A 4MJMA 1XRTA 4IFRA 1D7KA 4DF0A 2C79A 2G3NA 2KGJA 2GUUA 3TH6A 4HB7A 5BRPA 3OO2A 1KGUA 1TWDA 2DP3A 3AMDA 3W53A 3VUSA 2FGZA 3CUIA 3BL3A 3CWNA 2E6YA 3RLUA 1IWBA 4U5KA 4CN6A 4M6UA 3PA7A 4KEVA 2ZR4A 1Q6OA 3KBMA 5FCZA 3VINA 3CZLA 3V5FA 1N82A 2V30A 5KETA 3PJXA 2ZC1A 3CQKA 4L65A 3ANVA 1O5KA 3N4EA 3GH5A 1OC5A 3SECA 3EWUA 3JUGA 3E2VA 2F23A 3V4BA 3ZYZA 4D6EA 4JTDA 1CNVA 1VJIA 2DT1A 2YLLA 1QI5A 1DEDA 2R1KA 3AZRA 3W1MA 3LV6A 3NVDA 4FXJA 2FJKA 4W9PA 1OVDA 3SJ3A 1MMFA 3VKBA 5LXXA 1KM6A 4F9JA 4MGVA 2XFFA 4DZHA 2VZOA 2VWTA 3GAKA 3CHFA 3UGRA 2H8ZA 2C71A 2BSLA 4KIRA 4FLSA 1AH0A 2D1ZA 3EXRA 5FJOA 4DUXA 3ZVHB 3L0NA 2WSKA 1SR9A 3H6OA 5A3HA 1QMLA 1ZSXA 2TSYA 3IS4A 2JKAA 3DFHA 4S3DA 5HANA 3TYBA 2CHNA 2PDIA 2ZADA 3GXPA 3NTPA 1AD1A 1BPLB 3LK6A 4P5UA 3BMBA 4K36A 4LYPA 5FA5A 3M7WA 2Q8ZA 3LYEA 3LHVA 1CZ1A 2EEXA 5HPOA 4QEEA 1CB2A 2PD5A 3VIOA 1SJDA 3OU8A 4WSHA 1EJXC 1F73A 4ZFCA 3LMYA 3UR5A 4HYRA 5HR6A 3GTHA 3IAQA 1VEMA 1XIEA 4N6EA 4PBFA 4V1XA 2XH7A 4O19A 2BASA 1Z44A 1JVWA 3PP7A 4X60A 4U31A 3V7PA 1W91A 2GGIA 2ZTJA 3HQOA 2G97A 3EOEA 3OZOA 1G4PA 5C2GA 4N4QA 3W00A 1UWQA 1YBQA 1UP0A 3WQWA 5A6BA 4H1ZA 4LUIA 1KBKA 1A5LC 1HJUA 4KH2A 4V27A 5ECUA 4GUGA 1RHCA 1IE7C 3SRFA 1DPMA 9XIMA 1F61A 3A23A 4AF0B 3R10A 3ITOA 3AIRA 4Z2HA 4H19A 4NX0A 2BY3A 1RUSA 4BI6A 2UY5A 1R3YA 2GQ9A 3L4YA 1CXIA 1EC8A 1AQHA 2OCZA 1E0VA 1XCFA 1JR1A 3QPYA 3UXAA 1TSIA 2WZTA 1PKLA 3T05A 3UWZA 5G2HA 4AD3A 2ACQA 2XIMA 1MXSA 3OB8A 4LX4A 3I3BA 3B8IA 2GWNA 2YXXA 1D7HA 2D2JA 2WXDM 4GG9A 4MZ8A 1B5TA 4HCLA 1XP3A 2ZDRA 4RZ6A 3TFXA 4HSNA 1GKPA 2QJHA 7A3HA 4Q4PA 2EG8A 5LIWX 1MRQA 3O8AA 2QQ6A 2BY1A 3KVLA 4FIQA 1NOUA 3OTRA 3GRIA 3CC1A 1H51A 4DBDA 4RDWA 3ZFHA 2FZBA 1E73M 4P7QA 2OEMA 3IJLA 4YL2A 5DANA 4GFIA 4KT2A 3MANA 5FSEC 4XUGA 2FHFA 4LYRA 2DZWA 2PURA 4UTLA 4ITZA 5LIXX 1UUOA 3VD9A 3WLMA 5EMUA 1NQ6A 2B0MA 1FP9A 4IQCA 5G4HC 4L64A 2PDCA 1RBOB 4ADSA 3W37A 2PV2A 3UI6A 3CWHA 4ZA0A 2EPMX 1R46A 2IPWA 2E67A 3SFWA 1L6SA 1A5AA 1JULA 1NFGA 3QV9A 4XISA 2WQPA 3DC0A 4A05A 2ZA2A 1EH9A 1BXNA 1W9XA 1AQ0A 3CV6A 2QV5A 1PKYA 4C6LA 1RBLA 3Q65A 4KW2A 3AMCA 4V33A 2UBPC 1UWIA 3LQLA 5FAJA 3N15A 1XIBA 1KV8A 3BZGA 1XIIA 3EDEA 4R0XA 2G3JA 4QJ4B 2D73A 3HTWA 2BHYA 2YA1A 4FNUA 4NKCA 5ECVA 3M0JA 3EA3A 3DENA 4HPJA 4WKAA 4DYKA 4O4WA 1RSCA 4HNTA 1OYCA 2ZUVA 4H41A 4YTUA 4AHQA 3DXIA 1NAL1 2XSAA 3C2VA 3VCCA 3F4NA 4UQCA 3WEOA 3ZLGA 3V1HA 4NRRA 3N2BA 2PBOA 4FX8A 5H91A 1JNSA 4TX6A 1SSDA 3LGGA 3W1LA 3CB3A 4GBUA 1TTPA 3OVQA 1TKKA 3VK5A 5K7JA 3M5XA 4HYWA 3WNKA 1VD6A 1YPIA 4C65A 3O05A 2PDHA 3UXLA 3OLDA 1H63A 4LOCA 1W32A 4TV6A 4JAWA 2YR1A 5CQ1A 2X16A 3PUOA 3KP1A 1T8XA 1PZ2A 2XUCA 1Z41A 4W89A 5J8LA 2HPIA 2X2GA 4DJEA 1FKKA 5FOOA 2CU0A 2VUYA 4GD0A 1LLOA 2D23A 1Q45A 4EF9A 1A0CA 3TR9A 2RJHA 1DXIA 5HWMA 3QV7A 1HKJA 3DBNA 1J9YA 1P0KA 1R85A 3USZA 2XYLA 3B0UX 4PMQA 1H7OA 4V28A 1EPVA 3GVGA 2G5WA 3OOBA 3M9YA 1FH7A 4M82A 5HR7A 3BLPX 4X0VA 3PZMA 3AC0A 4BWLC 3TYZA 2WZHA 4C1NA 3UYIA 2OXNA 3PBVA 1E1EA 5DEZA 3EYPA 3FNDA 3UR2A 3FVMA 1AW2A 1G67A 1ITCA 4PULA 2YDAA 2VUNA 1GGOA 2VZSA 3KACA 2Q6ZA 4IT4A 2OEKA 1OABA 4XZIA 3BOXA 2OYLA 4RV8A 4Q32A 3MKCA 5D8WA 4XG1A 3IWPA 4Z2LA 2JKPA 2ZDSA 5D04C 3CXOA 4Z0JA 3BCFA 4UC5A 5MKGA 1J10A 2WSRA 3A3XA 4QT3A 2VVSA 2V3FA 1XKYA 1W0MA 1EXBA 2A3AA 1J6YA 1KFKA 2EJAA 3BURA 4JHZA 2DUXA 3C8FA 3P8IA 2WCSA 2Z2UA 4GO8A 1YNYA 2FLIA 1BKHA 4HZ6A 1KWKA 4EOUA 4ZQNA 2OTDA 4U3CA 2ISSA 1QATA 1FKBA 3MUZ1 4YWSA 3CZ8A 2A1YA 3CPRA 3DBPA 2EPOA 4QLJA 2OO0A 4MB3A 1VEOA 3WUFA 3HQNA 4XK2A 4IFOA 4EAMA 1K9DA 4P7OA 2J88A 2QDGA 4GUHA 2J75A 1WUEA 1QZ2A 4ZQOA 4E3VA 3HG5A 2YGYA 2NQJA 1BSIA 3MW7A 1TPB1 1V6VA 1XIJA 3QXBA 1GEHA 4D8ZA 4M5PA 2O7QA 3QC0A 1POKA 2ZOXA 4IP7A 3NPWA 2B7PA 2PS2A 1SO5A 3UY7A 2KE0A 1TPUA 1VR6A 4L1WA 1PX4A 1ICSA 3GH7A 1QOQA 4MUPA 2NSXA 2QJMA 2ABBA 3A9IA 2OGYA 3JU2A 3QC3A 3AXMA 3VDBA 1B1YA 2WSPA 1EDTA 4IZGA 1AQFA 3V5CA 4NHVA 3WH7A 2HTMA 1IEWA 5EY5A 1Y5WA 3RX4A 3UWYA 3PSWA 1MDRA 3RCYA 3CZEA 2ZRVA 4TX0A 4NXSA 1ZJBA 3CTTA 1PWLA 4OT7A 3ES7A 3KBWA 4KERA 2G3MA 2L5HA 1K8CA 2IXUA 3KLKA 4DB7A 3PPHA 1W3NA 5BOEA 1BGGA 1NF7A 4DVOA 3KP0A 1R9YA 3WJYA 1HVXA 1SFTA 5AC5A 3A13A 2ALDA 4PCNA 4CU8A 3O5PA 3UJSA 2WBGA 3UP8A 1ITXA 4IUGA 4ZOEA 3IRDA 1XIHA 3TONA 3C86A 3S5OA 2PTWA 3OBKA 1VRXA 1P6WA 5T26A 1AVAA 4X2PA 3UR7A 2Z1KA 3P14A 4O17A 2YL6A 1FH9A 2VEMA 5A8PA 3MJYA 1U22A 4K39A 3WK0A 1Q8JA 1R87A 1B4KA 1TX2A 1Z42A 1YPFA 4UOZA 1R2RA 1PS9A 1BSLA 3WL0A 4A8IA 3WLPA 4NJHA 1UWUA 5E70A 3RLVA 1XUUA 1R9XA 3GO2A 1OYAA 4JTAA 3W84A 1W8GA 3VAVA 2QCLA 1SU5A 4H8UA 4JFVA 4HOXA 4E2VA 2QULA 1AJ0A 4PFHA 1HJQA 3D0CA 2WBKA 5F7UA 3PBUA 5D9NA 4TX8A 4XBSA 5DX7A 2VRQA 1RP8A 3T42A 5JBFA 1EQCA 3CHVA 4BZYA 3TDBA 3T78A 3W85A 2YCJA 4EVZA 4LV9A 1T8QA 3H70A 1W5QA 2Y5EA 3ITXA 2VHLA 3B4UA 3QY6A 1SGJA 1IT7A 3PZVA 2A3HA 4UFIA 2BY2A