3AQUA

Crystal structure of a class v chitinase from arabidopsis thaliana
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
344
structure length
344
Chain Sequence
TVVKASYWFPASEFPVTDIDSSLFTHLFCAFADLNSQTNQVTVSSANQPKFSTFTQTVQRRNPSVKTLLSIGGGIADKTAYASMASNPTSRKSFIDSSIRVARSYGFHGLDLDWEYPSSATEMTNFGTLLREWRSAVVAEASSSGKPRLLLAAAVFYSNNYYSVLYPVSAVASSLDWVNLMAYDFYGPGWSRVTGPPAALFDPSNAGPSGDAGTRSWIQAGLPAKKAVLGFPYYGYAWRLTNANSHSYYAPTTGAAISPDGSIGYGQIRKFIVDNGATTVYNSTVVGDYCYAGTNWIGYDDNQSIVTKVRYAKQRGLLGYFSWHVGADDNSGLSRAASQAWDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords At4g19810
publication title A class V chitinase from Arabidopsis thaliana: gene responses, enzymatic properties, and crystallographic analysis
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 120
structure length 344
sequence length 344
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3aquA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3aquA01
1KXVA 3NSNA 2EQDA 5CPSA 1WE5A 2BVDA 4WLCA 1OD0A 1XSKA 2D23A 4AD0A 1QPKA 4GO8A 5BXPA 2O9PA 2NW0A 1VBRA 4LPCA 4GI6A 2YBTA 3RMEA 2E9BA 3WMSA 3WQ4A 3U7VA 5AY7A 3OZPA 2D20A 1VENA 4U5IA 1DWIM 1DHKA 4AZCA 1OD8A 1H5VA 3PZNA 2ZXDA 3AYRA 3AS3A 1V02E 4GZEA 4KRUA 1X6NA 4CCCA 1W9XA 4QCEA 4CGTA 3AIEA 1TE1A 1KCLA 1M04A 1LG2A 3MMDA 1HKKA 3VX1A 4LYPA 1WZMA 2PWDA 5CLTA 3M07A 1CWYA 4PTVA 4AZGA 5EB8A 1E6XM 1WZAA 2J78A 1U2YA 5EFFA 4PCTA 2A3CA 2PWFA 1E4IA 1V3JA 1U33A 3VIGA 3W4RA 4P7LA 1FFQA 3AHVA 5ABHA 4QLLA 2WAGA 3NDYA 2X09A 5C70A 3EDFA 2BV9A 3L4VA 3F5KA 5A1AA 3CZ8A 4RE4A 1E4MM 3WUBA 1V3KA 4PMXA 2VRQA 3CMGA 2XPKA 4B3KA 4GI9A 5CJ5A 1I1XA 1LWJA 1Q4NX 3L4XA 4B9ZA 1LWHA 1E3XA 1F4AA 1PZ2A 5M3WA 2W63A 1UH2A 3WF0A 2XFFA 3NDZA 3VU2A 1EXPA 3LMYA 4BQ3A 1KQYA 4MNKA 3M6DA 5BXRA 3D5HA 4H8VA 3F4VA 1BVZA 1MQQA 4DWSC 1GNXA 2VVNA 4S3KA 4LXFA 4W8AA 2W66A 3WH8A 1EHNA 1MVYA 1JZ6A 1VRXA 1S46A 2O92A 5D8ZA 5JBDA 1WP6A 5KEZA 4HU0A 2CBIA 2EBNA 4A4AA 1LL4A 2V5CA 3U7BA 1QHOA 3W24A 4E8DA 3GM8A 1XRVA 1NWRA 3BXWA 4PTMA 3WY1A 1WPCA 2WWDA 1GQKA 2ZUTA 4U33A 2FH6A 1PIFA 1XSIA 1H0IA 4AZ7A 1XCWA 1E15A 1W9UA 1CDGA 2CYGA 4FLSA 2NT1A 2ZWZA 1KFWA 1BF2A 4BQ2A 2ZUMA 3PBGA 5DT7A 3THCA 2X05A 2J7FA 5BROA 1SYTA 3UR7A 1JGIA 2J77A 3D3AA 3ALFA 3MMUA 4W5ZA 5FL1A 5I6SA 1V02A 4Q22A 3RDKA 1AQHA 5EFDA 4OIFA 1HJXA 1X6LA 5GPRA 1W3HA 2XFYA 1JFXA 2WBGA 3RJYA 4W89A 3PTMA 2GFTA 4M56A 1B30A 4UOZA 2VT0A 1JZ8A 5A8OA 3ZT6A 5LA1A 4D1JA 3AROA 2VX4A 1UA7A 1QHZA 3W37A 1JNDA 4JCLA 3ARSA 3HN3A 2WZIA 3DYMA 2E40A 1GONA 3T0DA 2O9TA 5HBFA 4U3CA 4L4PA 2FHFA 3O9NA 5HXMA 4UFHA 1MW1A 2OYMA 1GZJA 3WN6A 4D6IA 2X8RA 3A4XA 4PYSA 4D6GA 3BAJA 5IDIA 9CGTA 1CLVA 3WD0A 1CXEA 3GXMA 1OINA 2XWEA 2A3BA 1UR8A 3NIYA 5IFTA 4AEFA 1JYWA 3IK2A 3TTOA 5A2CA 1W2PA 1E0WA 2EEXA 1XYFA 4AD1A 3APGA 3RM9A 4CCEA 1GJUA 2WMHA 1E40A 4AIUA 1TUXA 3VILA 5A6MA 1XH0A 3MS8A 4CVWA 4AY1A 1G01A 4P8WA 1UWRA 4WF7A 1HKIA 3B9DA 4PUEA 1E6QM 2X2YA 4U3AA 1E4LA 1EQCA 2Y24A 1E5JA 3KZSA 4N0RA 4U31A 4JZ5A 3BSGA 5EMYA 5A6KA 3PZTA 4WK9A 2WZEA 1UKQA 2BY0A 2EJ1A 8A3HA 1V0MA 5A3HA 2E8ZA 4CD7A 3GXDA 3QHMA 2ZX5A 5A95A 2PBOA 1CXHA 1HXJA 2VOTA 4HA3A 4OOUA 2XIBA 2ZXBA 3WEOA 1HVXA 4QAWA 4UFMA 3S6TA 1J9YA 5A8NA 4TVCA 4HA4A 1RD6A 1R7AA 2G8ZA 2X1IA 1NOFA 2WHKA 3SCTA 4ACZA 3T08A 5CPQA 7CGTA 2EO7A 1NWUA 1TVPA 1HJQA 1ECEA 4PMYA 1HP5A 5E6YA 1L8NA 3GH4A 4JFUA 3G6MA 1BVNP 4AZBA 4IM4A 5HOSA 2VL4A 3ZJ7A 3RM4A 1CBGA 1V6YA 4FLQA 4E2OA 1OGGA 2A3AA 4YHGA 1R85A 2YA2A 4CCDA 1W9VA 4DM1A 3WEZA 4OBSA 1DWAM 2WK2A 3W6LA 2WB5A 2DSWA 1O6IA 1J0IA 4IUGA 3JUGA 1XH2A 4WKAA 1K9TA 2FHBA 1HL9A 5JIPA 5CGTA 1VBUA 4LGXA 1FOBA 3GYCA 1V3IA 4M8UA 2WHJA 1E0XA 2UY3A 2CKSA 3POCA 2V3FA 1PPIA 2J74A 3BAIA 4AZHA 3MKKA 4J3XA 3N04A 1C91A 1E6ZA 3CHCA 2RGMA 3WDQA 2JIWA 3VM5A 1YQ2A 2IUZA 1OSEA 4K68A 3WD2A 3B9EA 4Z2HA 3WDIA 3B8SA 1B3YA 2E9MA 5GNZA 3BAKA 4HU8A 2HISA 1ISYA 1JF6A 2XFRA 4Y7EA 3IAQA 1V0LA 1HJSA 4MB3A 1RP9A 4GO9A 4PTWA 4JKKA 1PAMA 3AS2A 2EPLX 3LPFA 2WC3A 3PZVA 1H0GA 3PZ9A 4DWSA 3WL1A 3II1A 4PMUA 3AICA 1VEPA 3CUJA 1OGBA 2CETA 3QOKA 1GQJA 3SUSA 4CD5A 3IJ7A 1NH6A 2GJRA 3SCSA 1BAGA 3UESA 4TX6A 4IISA 3I3BA 4C7DA 1GOKA 1GVYA 4M1RA 1UWIA 1JDDA 1LL6A 1H1NA 4LYQA 4NZCA 3TP4A 1V0NA 2XM1A 2WMIB 3AMDA 4DUVA 1KXTA 1GOQA 3MV11 2WCSA 3VIPA 3CZJA 5A2AA 3UG5A 5I77A 1PEZA 3TA9A 2AMGA 4MJ2A 3QGVA 1TA3B 1TMQA 4ZEPA 5F7UA 1XV8A 4JHOA 4B9YA 3M46A 3BLKA 1UQZA 1RP8A 4JL2A 3S2CA 4W7WA 2YOCA 3WQ5A 3NJ3A 1XH1A 4U5KA 5I5RA 1G5AA 3DC0A 3VMOA 3AZSA 2QPUA 1LJYA 2YL5A 5AYIA 2PWEA 2W67A 3LPOA 2WMJA 4HPGA 1HP4A 2J25A 4QP0A 5LA2A 2ZX8A 4MAZA 2WWCA 1HVQA 1GJWA 3VDBA 4RE3A 1P6WA 1UH3A 3ZOAA 4ZE5A 4JIEA 3CZKA 4CU8A 3ZT7A 1E55A 5JUVA 3N15A 1UR9A 5ECUA 1UUQA 3EDKA 1ZS2A 2YIHA 5JIWA 1HKJA 5D9OA 1JZ3A 2D2OA 2OLHA 1E43A 2FGZA 3MUZ1 2OWXA 3N9KA 3RJXA 4N42A 1CIUA 4HOWA 3AS1A 3T2PA 1ITXA 2V3EA 4AZIA 5IHSA 4UNIA 1IZKA 3KE0A 4TTGA 3GXFA 3EDJA 1Y7VA 3VO0A 1UHVA 2D3LA 5I0DA 3GNPA 1EA9C 2DSZA 5BYWA 4D6JA 3WF2A 4E8CA 1UKOA 4U2YA 1E73M 1I1WA 3I3DA 1PBGA 4PSRA 3WF4A 5FCZA 3IJ9A 4AISA 4H04A 1W91A 1UR0A 2J62A 3WQWA 4RE2A 2VZVA 1BHGA 2Y8VA 4MDPA 1W1PA 1K6AA 1ODUA 4AEEA 1X1NA 2OSYA 3MU7A 1K9FA 2XVKA 2ZX6A 1FFRA 1BG4A 1W9BM 1IT0A 2Y5EA 5A69A 3MSDA 3DECA 1J12A 1MXDA 4BS0A 1TZ7A 3N13A 1B3XA 2E8YA 4GPNA 1W3JA 1H2JA 2W62A 3W26A 1EDTA 3MO4A 1HT6A 4MADA 5DF0A 2ZOXA 1WDRA 2DQXA 4OBRA 4PRWA 3OGSA 3W6MA 3ZT5A 2BHUA 2FDMA 3NYDA 5CSYA 2QHAA 3J7HA 2XGBA 2E9LA 4JFSA 3F5LA 5A2BA 3ARVA 2Q8XA 4NSBA 4CD6A 2CBJA 4HMCA 2GK1B 4D71A 4FLRA 3VTRA 1F4HA 3ZMRA 2QV4A 3K4AA 1KR0A 1C92A 5FKYA 3L4UA 2YDRA 2XGIA 1HL8A 1WNOA 1UOKA 5D9NA 2DT1A 1KGWA 1HJVA 3KL5A 1QNQA 1H49A 4KGJA 4UFIA 5CSUA 1QNSA 1ESWA 3BSHA 2D3NA 1UZ4A 4W84A 1UWQA 4KMQA 3SEPA 2CBUA 4HPHA 4B15A 1J0YA 2J8FA 2BVYA 2GJXB 1Q6DA 1E70M 3FNDA 1W1TA 2W5FA 3VX0A 1W3KA 2YA0A 3WH7A 3WL0A 4ML4A 1W1VA 4HZ6A 2EPKX 4CD4A 1BYCA 1MW3A 1D7FA 1UA3A 3UERA 1V3MA 2B31A 4CU6A 2RGLA 2XM2A 5LYRA 3WELA 3O6AA 1E72M 4WKHA 4QCFA 3CO4A 2WKGA 1E6SM 1LF1A 1JXJA 4PTXA 3L4WA 3ZR6A 4BF7A 5I2UA 4HA1A 3VM7A 3TOPA 3AIRA 2WVVA 4HZ7A 4BCEA 5CGMA 1MFVA 2Z1SA 2Y8KA 3ZQ9A 3A47A 1ODZA 4V27A 3WUGA 2ZWYA 1C3FA 1CTNA 4GQQA 2NT0A 1KCKA 4P8VA 4M82A 1C90A 2WLZA 3VKKA 4FLOA 3RPMA 1YHTA 2PF0A 2ZUVA 1BPLB 3W0KA 1E1FA 3EBVA 1HJWA 1CGXA 3GH5A 1QOXA 3AJ7A 5C71A 2J7GA 2VX6A 3PZUA 5DT5A 1UQYA 4J7RA 4ZE4A 3DHPA 4PMVA 3OB8A 1JZ4A 2C8NA 4ZFMA 5A8PA 1UD4A 1SFSA 2VQTA 5I78A 1UD5A 3VGEA 5HPOA 1LLOA 4QLJA 1CEOA 5DFAA 4WIWA 3AHZA 1GOMA 1DTUA 1B3ZA 2Y2WA 4DUXA 3CPUA 1L0PA 1B90A 3SURA 2FGLA 3ZO9A 1E6RA 1BYAA 2WMKA 2NSXA 1J10A 4JL1A 1DWGM 2WC7A 2V5DA 4AC1X 1OM0A 2VNCA 3AIVA 1H41A 2OWWA 3W53A 3A4WA 2PI6A 4J27A 3QR3A 1GUVA 2W61A 3BMVA 1IZJA 4B16A 5DMYA 3LPGA 3VDAA 1ZB5A 4ZENA 2XG9A 1UD2A 3E1F1 3MANA 1JF5A 1MWOA 4WJXA 4D6FA 1NOWA 5FIPA 3TONA 1WB0A 2AAAA 3ARQA 1DWFM 1RPKA 4X0VA 2ZUSA 3ARXA 4UQDA 4QDMA 1MW0A 3WH6A 4HOXA 4P7NA 5ABFB 1O7AA 4A3YA 4AZ5A 3T0BA 2PB1A 5BWFA 1QNOA 3FN9A 3N18A 1OT2A 3OLGA 1C93A 2IXUA 3ALGA 2J7DA 3K8KA 1UKSA 2YLAA 1AQ0A 1R7OA 3L4TA 3PZIA 3AXHA 4D1IA 4MJ4A 3W28A 4GXPA 1DP0A 4R5EA 1EQPA 2VCCA 3DHUA 3K1DA 1A3HA 1XHGA 2EPMX 5D9PA 2BS9A 5CG0A 5JBEA 1Z32X 2WMGA 4J3VA 1WDQA 2WMIA 3AS0A 3VVGA 2C0HA 3WFZA 1FHDA 2DDXA 4PMNA 5I79A 3AZRA 4J3TA 1EGZA 5GNYA 2WSPA 1E0VA 3UETA 5A8QA 1TA3A 2YDQA 2ZUNA 1EDGA 1ZBVA 2F61A 4BQ5A 3WDJA 1DWHM 4TX8A 2WNWA 1MW2A 4FMVA 4GINA 3CHEA 3WD4A 3BGAA 4PBGA 1CGTA 1OCQA 3WQ8A 1HN1A 1PIGA 2BHYA 1N82A 2VCAA 3ECQA 1GCYA 3LPPA 2XWDA 4TVUA 1UD3A 1IV8A 3DYPA 3VOCA 2D0FA 1QBBA 2VRJA 4Z2LA 3EYPA 4HMEA 4PUDA 2VVSA 4XUYA 2GSJA 4M80A 3AHTA 4F79A 3AHXA 2VX7A 1C8XA 2VO5A 1NWTA 4GZJA 5FL0A 2Y4SA 1OWQA 2DSKA 1KWGA 4GZIA 1BQCA 4AD5A 2DSUA 5HPCA 3DYOA 2DT3A 4MNMA 4XB3A 2D1ZA 3T09A 5M5DA 2DSVA 2JFEX 3WFLA 2D0GA 3U5YA 2BVTA 1KXHA 5AC5A 4D6DA 5A8MA 4X0NA 4P7QA 2ZIDA 3ARTA 4W88A 5A6SA 4D6CA 3VGFA 1HKMA 3ZR5A 3VGHA 2BHZA 1H09A 2XYLA 2F8QA 2WHMA 4UQ9A 4R27A 3ZSTA 1KB3A 1QI2A 2DEPA 4Z2GA 1J11A 2XHYA 1ISZA 2J7EA 3FW6A 2QMKA 3CIVA 3L2MA 2QPSA 2UWFA 3CZLA 3BMWA 4M81A 5A6JA 1W9DM 4MDOA 1JZ2A 4W8LA 4JKLA 1OB0A 1UZ1A 4MAVA 1VIWA 2V38A 1CZ1A 2E4TA 4UZSA 4WSKA 1E6PA 4ZXOA 4P8XA 4QFUA 3GZAA 4PMRA 4XV0A 3SCVA 1QNPA 1EHAA 2EXOA 3VIFA 1UKPA 2WKLA 3CZGA 2D24A 3WQVA 2GUYA 3CBWA 3AMLA 1JI2A 4PEEA 3VIMA 1KBKA 1CGWA 4W87A 1I75A 1FHLA 3WNNA 2FHCA 1CXFA 1J0JA 1KQZA 1SR0A 3WUFA 3KWXA 1QI5A 1ISXA 2GK1A 3PZMA 3NCOA 3BAYA 1SMDA 2XUCA 1JL8A 2UY5A 3CUHA 1E1EA 3OIHA 1JD7A 1GW1A 1QHPA 3VIHA 2CIPA 1W32A 3OA5A 1HNYA 1ZBKA 2D22A 1M7XA 2J7CA 4KRTA 1B9ZA 2A3HA 1JZ7A 2CHOA 3UR8A 4OUEA 5JBFA 3AXXA 4W7VA 3U57A 4E4PA 2ESCA 3BC9A 3THDA 1BFNA 3CUIA 2WSKA 1XSJA 3KEHA 1JD9A 1WO2A 3AMGA 5AYBA 4YN5A 1W9PA 4DM2A 3OLIA 4PMOA 2E3ZA 3EDDA 4D72A 4TOQA 3SCPA 1VF8A 1MQRA 3ARRA 3EMQA 1TFVA 1UD8A 3GDBA 1CLXA 3FAXA 1CXIA 3HJEA 5E09A 1H11A 5FD0A 3ARPA 5D4YA 3ZM8A 3I3EA 1W2VA 2J4GA 3GXIA 1K9EA 3VIJA 1CGUA 4LQ1A 2YA1A 5FOOA 1RH9A 1B3VA 1UWSA 3L4YA 4D6HA 2ZE0A 1WZKA 3VD3A 1FP8A 3WSUA 1E4NA 2XSBA 2J75A 2CNCA 2CXGA 1B0IA 1BLIA 2D0HA 5BXTA 3N11A 2VI0A 1KR1A 1HJUA 1VEMA 4PMZA 4LYRA 4Z2IA 1M01A 2DPEA 5HNNA 4GKLA 3TTSA 2WBKA 3CMJA 3AMCA 5CPTA 1OBAA 1BTCA 2J79A 3GBEA 3WMCA 1UG6A 1FA2A 1EO7A 3RCNA 3RM8A 1ZBCA 5E70A 1PX8A 2ZX7A 3G6LA 4EE9A 5IFPA 1CPUA 1UKTA 4J3SA 3AYSA 3NUKA 4DWSB 3BCDA 5GQBA 1FH9A 3BH4A 3VPLA 4Z2KA 3N12A 3PN8A 3PZQA 2VCBA 4V2XA 4H7VA 1WKYA 5IXEA 1FP9A 5CZKA 2ZXAA 4YHEA 3WENA 5BRPA 1J0KA 1UWTA 1E5NA 3PTKA 2GDUA 2VRKA 3RO8A 3GNRA 4H8HA 4UFKA 2CPUA 1MYRA 3N1AA 4TXEA 3MUIA 1V6WA 4MPKA 5E0CA 1EOMA 2CEQA 3HU7A 2GJPA 2G3IA 4Z2JA 3EDEA 1UH4A 1WDPA 1KGXA 4GIAA 1G94A 2VQUA 1UR4A 1Q6EA 1PX3A 3SCRA 2FH8A 3WDPP 2BY2A 1US2A 4FF5A 3VMPA 3WNMA 4WSJA 2WLYA 2CERA 2VTFA 1D3CA 2WVSA 2PWHA 5E6ZA 1MXGA 1ITCA 4W93A 2VZTA 3GNOA 4AD3A 1DEDA 1WZLA 2EPOA 2ZUUA 1V6XA 4H8UA 3WF1A 5ABEA 3OGVA 3L2LA 1US3A 3CUFA 3WDHA 1VFMA 4GI8A 1GOOA 4LX4A 4PSPA 1WAWA 2VX5A 4AD2A 5ABFA 2XVGA 4OKDA 1WDSA 4W7UA 4XX6A 2OYLA 4OOZA 4JKMA 1JFHA 3ARWA 2F2HA 4UR9A 4EAMA 1ZL1A 1VJSA 4HZ8A 1GOIA 1JNEA 1NP2A 2J7BA 3WUEA 5EBAA 4MNJA 3VNZA 1E9LA 2CKRA 8CGTA 1VFUA 1BYBA 1XC6A 2J8GA 1CENA 1E71M 2VC9A 4DUWA 3WNKA 2YL8A 2TAAA 3ZSSA 1JI1A 4EANA 4V28A 1SMAA 1EH9A 4F9DA 2QF8A 4CU7A 4EK7A 3AOFA 4NRSA 2G3MA 6A3HA 1E6NA 1G9HA 4ZXLA 1QW8A 2WYSA 4UZUA 2GDVA 4HTYA 4JFTA 4QLKA 3MV01 2JEQA 1HIZA 1M53A 4MNLA 3GBDA 4JFWA 3WH5A 4B3LA 2HVMA 4CVUA 2OSWA 3A3HA 1QNRA 3PZGA 4CN6A 4M29A 1CGYA 3AMKA 2WCGA 2ZICA 1BGAA 3T2OA 2BXZA 4NRRA 1MFUA 1HF6A 3ARYA 1B1YA 3VD9A 1E56A 1V0KA 5D9MA 1TR1A 1NOUA 3W27A 3KL3A 4AW7A 2ZUWA 4EKJA 1FH8A 2YL9A 4TTUA 3W25A 3FAWA 4F9JA 3AZTA 3CTTA 2XVNA 4L4OA 2WANA 3B9AA 1XD1A 2CBVA 2VZUA 2YJQA 3VIOA 1VB9A 2G4FA 5DEZA 4AZCB 3POHA 4W5UA 4URIA 1GQIA 4J3UA 3WD1A 2BY3A 2JIEA 1B31A 1CNVA 3AIQA 4C7FA 2ZXQA 4UQBA 3WIJA 3UCQA 1J0HA 1V6UA 4C7GA 3WBEA 3BAWA 4NI3A 1CXKA 4UFLA 2WCAA 2E0PA 1BGGA 2UY2A 3CGTA 3VNYA 4MB1A 3SUUA 2XIIA 3WNPA 4CUCA 2JF6A 1OGSA 1ZJAA 1Q6CA 2C7FA 3VD4A 6CGTA 1NQ6A 2DT0A 3SCQA 4JCMA 4OZOA 1KWKA 1TVNA 2WVUA 3K8LA 3MSGA 3WMBA 1QW9A 3SUVA 2CHNA 2XVPA 4X9YA 3CZEA 1JXKA 3UG3A 4AIOA 1VAHA 1GPFA 3SUTA 3ARZA 4PCSA 3WNLA 2WXDM 3WD3A 2VR5A 2VJXA 1UWUA 1M03A 3VDCA 3UG4A 1R8LA 1R86A 2WZHA 1B2YA 4BZYA 2JEPA 3AIWA 2PC8A 4W85A 3IAPA 2MANA 1QBAA 2WHLA 1GQLA 2BY1A 4AIEA 2OSXA 1TG7A 1J0ZA 2CITA 1EIBA 5AC4A 4S3JA 3HMCA 4DWSD 3VDHA 4F66A 2WM0A 1GOWA 2IXVA 3BCFA 4H2CA 4XZWA 2EPNA 2WMFA 4BA0A 1OT1A 1NARA 3SCWA 4AWEA 4F8XA 3AQUA 1U30A 3VIKA 1W1YA 4UTFA 1HX0A 1LQ0A 5D8WA 3AIBA 1EO5A 2DIJA 2WVVB 1V3LA 1CXLA 4FK9A 1XGZA 2VZSA 1VFFA 5BRQA 1AQMA 1R87A 2W4XA 1UYQA 4CN1A 5JH8A 4Q7NA 1JDCA 2DIEA 1D2KA 3F5JA 3TTQA 3TTYA 1JYXA 4AZ6A 3WH9A 4KWUA 1VEOA 1JIBA 3ZJ6A 3WF3A 1CYGA 1XCXA 1LL7A 3WQ6A 3K8MA 4J28A 4A3HA 1DWJM 4TVDA 2YBUA 3IANA 7A3HA 1K9DA 4AXNA 4UFJA 3ZIZA 2DH2A 2O9RA 4NF7A 3BLPX 5E0FA 3CH9A 1OIMA 1UD6A 1GORA 1XD0A 3L4ZA 1JG9A 3N17A 3IJ8A 2XJ7A 1JYNA 1ZBWA 4TUFA 2XVLA 3ZJKA 3FHAA 1JAEA 1PZ3A 4JHZA 1EOKA 3WNOA 2OYKA 3OLDA 2G3JA 1KBBA 2OWCA 4AD4A 1BSIA 2VURA 3PHAA 3FHQA 1CECA 3GH7A 2DGAA 3KL0A 3W82A 1QI4A 2WC4A 5A94A 1W3LA 5A6AA 1BYDA 3OBAA 1AMYA 4ATDA 3MUAA 1B3WA 4WKFA 3VMNA 3VD5A 3SCNA 2BFGA 1J01A 1ZU8A 4CKQA 3AISA 2V3DA 5CXPA 2W92A 1JAKA 5E9AA 3VUPA 2GVYA 3M7SA 4JFVA 2AOSA 1CGVA 3W81A 3T0AA 3T2QA 4AYSA 1QI0A 1OIFA 1NP0A 3PZOA 2ZX9A 2J7HA 3A4AA 3CUGA 1Q6FA 1TCMA 2X0HA 4YPJA 1JDAA 1UR2A 5BXSA 5I24A 3UEQA 2JF7A 4BQ4A 3VGBA 3O2LA 4ACYA 3VIIA 1V6VA 4JAWA 4W86A 1J18A 5GNXA 4RL3A 5BCAA 2CCRA 4XZBA 4HMDA 2DT2A 2VMFA 5A6BD 3WEMA 2YLLA 1QVBA 4PMDA 2DH3A 3EMZA 1Q6GA 1QI3A 1BG9A 2G41A 2WPGA 5A6LA 4D6EA 1MQPA 2UY4A 1WCGA 3SIMA 2YKKA 3AIUA 1A47A 4AMCA 3VGGA 1ISWA 3NSMA 2G3NA 2Z1KA 1NWSA 3QOMA 5C8BB 1C8QA 2VZOA 5KZ6A 1PX4A 3VINA 2BXYA 3VGDA 4MB5A 4UQCA 2X0YA 4IPLA 2XSAA 4U2ZA 4CD8A 4UCFA 2YDSA 5LA0A 5CLWA 3CHDA 3OGRA 3OLEA 4UOQA 2QLYA 1G0CA 7TAAA 2CESA 4UQEA 5ABGA 1PJ9A 2VUYA 4ATLA 2QMJA 2V3GA 5TD4A 3RILA 4HP5A 4IPNB 4KH2A 4H41A 3CLWA 1FH7A 3SCUA 3OZOA 2JE8A 3FXYA 3PTQA 1VFOA 1G1YA 1GVIA 1H3GA 3NSXA 4GQRA 4ACZB 3FY1A 5IHRA 3AHYA 4MTVA 3U5UA 2PWGA 4OJYA 2GJXA 1UR1A 4PMQA 4P7RA 1AVAA 2VR4A 4HOZA 2YL6A 4KGLA 4UQAA 4UOJA 2J47A 4ATWA 3MMWA 4M24A 5HDRA 1V08A 3SCOA 4W8BA 1LG1A 2XTKA 3GTNA 1GHSA 2JALA 5I23A 4MB4A 3VD7A 5M17A 3WKZA 1E3ZA 3WBAA 1C7TA 3CHFA 4P7OA 3OG2A 3SUWA 3RIKA 1ISVA 1V03A 2WVTA 3QHOA 3WDRA 3K4DA 2O9OA 4CN4A 2PBGA 1KGUA 4J3WA 4P8UA 3EMCA 1V3HA 1VJZA 1KXQA 3K46A 3BAXA 6TAAA 1C7SA 4PN2A 2A3EA 5CQ1A 3A6OA 3W38A 1C8YA 2WW5A 1JZ5A 3AXIA 3W29A 3ZJ8A 3MUY1 3QHNA 1H4PA 3AI0A 5DO8A 1NM9A 1ZJBA 1EDQA 1XYZA 5I3DA 1JYVA 5M03A 3AFBA 5A6BA 3ARUA 1GHRA 2W91A 2BNJA
chains in the Genus database with same CATH superfamily
2EQDA 2BVDA 4WLCA 3NQEA 4GO8A 5BXPA 1EFZA 1FKLA 2EHHA 3MMTA 3OZYA 4QS6A 2KZHA 2YBTA 3TWBA 3U7VA 2D20A 1DHKA 4IWWA 3NFUA 3SGGA 1RLDA 3AYRA 3P67A 3V35A 1M68A 1X6NA 5B8IC 4LRSA 2HBVA 1K7XA 4F3HA 1LG2A 4HYRA 4S39A 3VX1A 2PWDA 3KZ7A 5AC6A 1N8FA 2ZDRA 5ABTA 4PTVA 4AZGA 1RQEA 1ECQA 1YMYA 2J78A 3F4DA 1U33A 3VIGA 5IBXA 2MUCA 4P7LA 1FFQA 3O63A 2DJXA 3BUVA 3UZZA 4QLLA 5BU6A 1DE5A 2VGIA 2WAGA 1Q2SA 5C70A 4OV9A 2ICSA 3L4VA 4GNVA 2VWTA 1YX1A 3PR2A 2X1SA 4A8LA 4RE4A 4OECA 4PMXA 3CAKA 4RZ5A 1M6JA 2XP9A 3T81A 5I3FA 1QWKA 2TPSA 3L4XA 4E6MA 1T0OA 4PCNA 2HVOA 3NDZA 1WYIA 4BQ3A 3NL3A 1KQYA 3D5HA 3RK8A 2KI3A 3MHFA 1GT8A 2XISA 4S3KA 4JTDA 1POJA 4WVXA 5EYWA 1VRXA 2A2IA 1S46A 5D8ZA 1WP6A 1MNSA 4INFA 1ZY9A 1DJXA 2CBIA 4GYFA 4MWAE 4C02B 3QVQA 1QHOA 3L0GA 3W24A 1S5VA 1KD0A 1XBYA 2YXOA 3H7UA 1XRVA 3GM8A 1SZNA 1NWRA 2BDQA 4Z17A 3N29A 3H53A 4US6A 3HPFA 4OQVA 1LQ2A 2B4GA 4U10A 4TMCA 1G7UA 1CDGA 3M41A 4NUWA 2IKGA 3D6NA 4NVTA 2CYGA 4LAOA 3ANUA 2NT1A 2ZWZA 1BF2A 7REQA 3B9NA 1JPMA 4PBFA 2XP3A 4DRSA 1TV3A 2J7FA 5BROA 1JGIA 1WXZA 3TA6A 3UY8A 3ALFA 3MMUA 3RDKA 5EFDA 4EIVA 2LKNA 5AHIA 3IV8A 4AU0A 3ITLA 1TJ0A 4M56A 3EAUA 4UOZA 3A23A 2X1RA 1JZ8A 3NL6A 1X96A 5A8OA 2R1KA 5D37A 4LT9A 3R5EA 3N2OA 1QWGA 1ONEA 3ZFHA 3NQVA 4L5ZA 4XAKA 3QV7A 4EF8A 1KRCC 2VX4A 3APTA 5CH9A 2OEJA 4JX5A 3T0CA 2OZ8A 1JNDA 3LBMA 1GG0A 4L6DA 1M5WA 3QJAA 3DYMA 2I1OA 5C2CA 1GONA 3G8EA 3GNDA 1JCHB 6REQB 3T0DA 2O9TA 5HBFA 1R6WA 1EIXA 4LAYA 3KAOA 4UFHA 2EG8A 5C9UA 4D6IA 2X8RA 3RU6A 4KT2A 5JQ9A 4C6CA 1KFCA 3WLRA 5BNKA 1OINA 1OJXA 2FZ9A 3L68A 2XWEA 3WJYA 1YATA 3NQCA 5U4NA 1KM3A 4MMWA 4XIAA 1IF2A 1E0WA 2P1FA 1KV8A 1ZENA 3Q67A 2O56A 3NQFA 4AD1A 3AU6A 3GU2A 1GJUA 3IGHX 3B4UA 1JRBA 3MSYA 3S2LA 4FNTA 1POKA 2C0AA 3WQGA 4AY1A 4P8WA 1UWRA 3IVUA 4ZB0A 5LNRA 4NAEA 4JNYA 5AN7A 3MCMA 4GGBA 4JX4A 1VPQA 1QPOA 4JZ5A 2PUZA 3BSGA 5EMYA 3KOFA 1W5MA 2PLJA 3V16A 4IPJA 1EYWA 1G4TA 2FB2A 8A3HA 3N4FA 3RX3A 1M1BA 3NQ7A 5KITA 4AVNA 1CXHA 5AZ1A 5D2TA 3SQLA 2XIBA 4QAWA 3CQIA 4XWUA 1ICQA 4LNCA 3PJTA 1A5CA 3REQB 2X1IA 3N25A 4WUIA 1EQ3A 5DLCA 2WHKA 4UTWA 1Z6KA 7CGTA 1KRAC 3N2CA 1EJVC 1JDEA 1HP5A 3PG8A 3MVIA 4JFUA 3SN0A 3TE9A 4F2TA 4Z42C 2OQHA 4ODOA 2VL4A 3ZJ7A 1CB7B 4X2PA 1EBGA 2PBCA 4E2OA 3TTEA 1NTHA 2YA2A 4DM1A 3IIZA 4WY0F 1SVDA 4BEQA 1J0IA 1XLBA 1HL9A 4AIBA 2A7NA 4HMNA 2VEMA 2ZQSA 1VBUA 4REQA 1V3IA 1J4RA 4M8UA 2WHJA 4O10A 1KO0A 2UY3A 2CKSA 1ZJIA 1PPIA 2V3FA 3SN4A 4HJFA 3SECA 4RDWA 1C91A 1PUDA 2J27A 2ZYFA 4PUJA 4L1WA 1K8YA 4C65A 2ZZ6A 1OSEA 4K68A 3QM3A 1ISYA 4XVEA 4Q4SA 1P6CA 3VNJA 1QO2A 3IAQA 1DKWA 1RP9A 1OHLA 4JKKA 2QDHA 1R46A 5LIYX 1Q6LA 3IGXA 4PMUA 3WQDA 3AICA 5C9ZA 2KX9A 5HMDA 4L61A 4NJGA 4LRTA 3A5VA 4BWLC 4CQCA 4B5SA 4NAFA 2GJRA 2WQDA 4MM1A 4IISA 3I3BA 1KM6A 1GVYA 1UWIA 1JDDA 4CNOA 1LL6A 1F8AB 2NLIA 3VCCA 3GE7A 2IMRA 2PDJA 4DUVA 1KXTA 2XIJA 1GOQA 1K70A 3AAMA 4ILSA 3W7GA 3NURA 3Q37A 1DV7A 3QGVA 3CIWA 1O5RA 4IOTA 1TA3B 4ZEPA 1OABA 4B9YA 3IJLA 3S1WA 3QZAA 4W7WA 3R43A 4MFEA 4BF9A 3QQ1A 3OODA 4PGLA 1NELA 1OX5A 4XKYB 2BODX 3N2TA 3HBLA 5AYIA 3S5ZA 3YPIA 3LPOA 4CNSA 2PE4A 5CC5A 3OU8A 2WWCA 3VDBA 1HGYA 3NDOA 4ZE5A 4JIEA 4AXKA 3ZT7A 4CU8A 5JUVA 1UR9A 3URQA 4Z08A 1FKJA 2YIHA 1HKJA 4DI9A 1XFBA 1P0NA 4N42A 3RJXA 5I00A 3C2FA 3LK6A 1JCLA 3PJXA 2BG5A 5HTGA 4UNIA 4KF1A 3N6QA 4TTGA 3EWBX 3DH7A 9XIMA 3NQMA 3W01A 1EA9C 3W72A 5BYWA 4D6JA 4PFHA 1UKOA 4G1NA 1E73M 1Z3NA 1PBGA 4J2MA 3IJ9A 4H04A 3W88A 4IIHA 3MT1A 5CPLA 2J62A 4E2DA 1AODA 4GIYA 4RE0A 1LLZA 4IUOA 4KETA 1Z48A 2Z00A 2M08A 1JCYA 1ODUA 4AEEA 2OSYA 1K9FA 4KESA 5I02A 1FFRA 2UZ9A 1T40A 4BS0A 4GPNA 3N13A 3OOBA 2W62A 1H2JA 4G5DA 2DP3A 4TW7A 2OGJA 3TLLA 3W26A 1EDTA 4JR5A 3PPHA 4MADA 2POTA 1WDRA 1XGDA 3ZT5A 1Z69A 1RA5A 2FDMA 4O8RA 2FLIA 2E9LA 3GFYA 5CPMA 3STGA 4XAYA 4JFSA 1WKDA 2DVUA 3FKKA 1PKLA 1GW9A 5A2BA 4LB4A 1YDYA 4QDWA 3DESA 1OADA 4ODKA 4DEFA 3KBVA 4GYJA 4GGHA 2YDRA 2ZRZA 3R94A 4GNKB 1UOKA 3GB6A 4XZMX 3G24A 4AY7A 5FJPA 2ZE3A 1ESWA 3UVIA 4GXMA 2D3NA 1US0A 3ENLA 4KMQA 1UIOA 3LM7A 4HPHA 3BJSA 5KMYA 2TMDA 2BVYA 5C2XA 1J2WA 4LB3A 3FNDA 3TMQA 2WSYA 2H9AB 3FSTA 2YA0A 2ACSA 1UBSA 4ML4A 4JFJA 2CWNA 4QJ5B 2A21A 3M0JA 3T6CA 1RK5A 1MZRA 3PF3A 2B31A 3HQOA 2FVLA 1OC5A 5G2WA 1EB3A 1E72M 3VKBA 2Q3RA 2B7NA 3LERA 3PWGA 4GX8A 3AXKA 3CO4A 3UNTA 2VFDA 3L4WA 5I2UA 2RH9A 1UP0A 2WVVA 2GQ9A 4IQJA 5CGMA 5LNVA 1MFVA 3ZQ9A 4ODQA 3GXNA 2PPNA 1PE1A 3WLMA 3WUGA 3GHRA 4ZSTA 3O0FA 4GQQA 2NT0A 3G77A 3HFTA 3O15A 3VKKA 5REQA 4CNNA 3EBVA 1R30A 1AL7A 4O16A 2BBFA 1YNPA 1CGXA 2P50A 4Q32A 5ENLA 2VX6A 3NO5A 1UQYA 2W3ZA 3D46A 3KOYA 3GW3A 4O0ZA 3APYA 5HJLA 3T4WA 1ME9A 3OB8A 1OK6A 3ZS4A 2C8NA 4ZFMA 1K7FA 1UD4A 4JTHA 4S3DA 8XIMA 1SFSA 4K36A 2VQTA 3VGEA 3NPWA 2ISVA 3TW7A 5G5IA 2CW6A 1B3ZA 3MJMA 4DUXA 1JGMA 4NNRA 2V82A 1E6RA 1BYAA 1V8EA 4YTSA 3N14A 2ZR4A 2WC7A 2PSNA 2VNCA 3AWNA 1FY6A 1H41A 2I5IA 2XH0A 4J27A 1JVWA 3GR8A 4NHVA 3BMVA 2PDGA 3VCRA 3KZPA 4QM1A 2XG9A 4WRHA 3E1F1 4ZQRA 3W1MA 4WJXA 1NOWA 2AAAA 2FB3A 4IL0A 4X0VA 3BPWA 3ARXA 5D04C 4RW3A 3I65A 2AQVA 4QDMA 3IVSA 2VEPA 2J88A 4P7NA 3T0BA 4IPPA 3WQOA 1HUVA 4YNGA 1TPH1 2J7DA 4K37A 2EULA 2DU2A 3K8KA 3WLTA 1QPRA 4ZOBA 2XU2A 3PZIA 1EEPA 1OFRA 3KCLA 3UYCA 3K1DA 1XKYA 1XX1A 7ENLA 4ZB2A 3S1VA 1X1OA 3M6YA 3T05A 5H2ZA 2IPFA 1S5TA 1A3WA 1VFSA 2HSAA 3ABXA 4I9JA 1YXCA 3AS0A 3VVGA 2C0HA 3WFZA 1FHDA 3ITYA 1WX0A 3BQ5A 2DDXA 3TQVA 2WJEA 1FWWA 2VUNA 4O28A 5GNYA 3UETA 3QXBA 2A85A 4LBSA 3STPA 2B81A 3WDJA 2R1MA 4TX8A 3DFHA 2PDMA 2DJLA 4FMVA 3RITA 5G4EA 1CGTA 3EKLA 3WQ8A 1TPWA 3LXAA 1N82A 3MWAA 3ECQA 1EL3A 1DIDA 2YZ5A 5HWMA 3IIPA 3O3RA 3TSDA 4F79A 4OV4A 4GFIA 5HMSA 1AJZA 1C8XA 3TAOA 3HA1A 4S2CA 3KDNA 4YXGA 3MBDA 1OWQA 4PUUA 4A05A 1KWGA 1ONWA 4ZL1A 1I60A 3MWCA 1R2TA 2DSUA 2DT3A 4MNMA 4XB3A 4PB5A 2V81A 2DSVA 5CCZA 4GJIA 3V1PA 1ONRA 3U5YA 3DFOA 4D6DA 3SO7A 2YFNA 4AUBA 4DAFA 5A8MA 2RQSA 4MUPA 3UXKA 4G2PA 3SW6A 3KBJA 4JYSA 4IL2A 3EA1A 1IEXA 2ZZ1A 3MP5A 3JRKA 2YCKX 5JH1A 3VDGA 1YDOA 3VGHA 3ZR5A 1AK5A 2XYLA 1PBKA 4PC8A 3CJPA 3CQKA 1SUXA 1TWWA 2PPOA 1O12A 4PTDA 1KB3A 2G3FA 3TXZA 1J11A 4JTQA 2XHYA 2FMOA 1J6PA 4EPBC 3URAA 4W9OA 3L2MA 2QPSA 3BMWA 4M81A 2OVLA 1Q7QA 3CGNA 3LGGA 1W9DM 1JQXA 3M5VA 2NXGA 4JKLA 2QJGA 3B0YA 4LCRA 1D8WA 2BGQA 3EX1A 3QW4B 4HHHA 4P61A 2E4TA 3LZ3A 4WSKA 1E6PA 4DO4A 2GVGA 4QFUA 3W1LA 3QV9A 4HZMA 1FWDC 2GUBA 2X7WA 4PUWA 1UKPA 2HVNA 4MJZA 3AALA 1W3TA 2GUYA 5G1MA 5AKQA 1CGWA 4W87A 1I75A 3E5PA 3T0TA 5AC7A 3WUFA 4JD4A 1QI5A 4CNPA 2UY5A 3CUHA 1E1EA 3MZNA 2FZBA 5CBJA 1CCWB 5CC3A 3OA5A 2D22A 1ZBKA 4JS3A 2HDJA 4NXKA 4BR1A 2INFA 3UPBA 3VNMA 4M19A 1J4HA 3HV8A 3R8HA 5JBFA 4O18A 2FDSA 3U57A 1R3VA 1MEHA 3KEHA 1JD9A 3AMGA 4YN5A 4PMOA 3HIJA 1F61A 4D72A 3W2JA 2Q09A 1PL9A 5E0KA 3M16A 5AHMA 2REQA 1XGEA 3ARRA 2HE8A 3GDBA 3WLKX 1X8CA 4R33A 1J2BA 1Q6HA 3EOOA 2LJ4A 3ARPA 5D4YA 3VOHA 3S5OA 4B5TA 2J4GA 4U85A 4LU0A 2B5UB 4I90A 4LQ1A 4R9XA 5FOOA 3E5BA 1MEIA 1B3VA 3R89A 3L4YA 4HPXA 2ZE0A 1LLWA 1WZKA 2C15A 4ZO8A 4D6HA 3PA7A 3SI9A 3BMBA 1XP3A 3BICA 1KT1A 1E4NA 3V1HA 2OFNA 3C56A 4AX7A 4QE5A 1F9CA 1TPB1 4DB7A 2V63A 3N11A 1R38A 1EYMA 4Z2IA 5HNNA 3LQGA 1IWBA 1BRLB 1QOQA 3KRBA 1NMWA 3CMJA 5CPTA 1OBAA 1S2WA 1LBMA 4GOAA 6ALDA 1ZBCA 3WQFA 1UP3A 4HKPA 2EPHA 2ZCGA 3SN1A 2B7OA 3O5RA 3EPNA 3VPLA 1AZ2A 1AA1B 3PN8A 2FZNA 3PZQA 3O16A 4H9UA 3NQ8A 2R14A 1FP9A 2ZA3A 2LPVA 1J0KA 4NAFB 1S2CA 2OO0A 2X40A 4IFRA 3PTKA 1SJBA 1E0UA 1YLVA 1TPEA 2RSEA 3RO8A 3NQ2A 1MYRA 3N1AA 4LCQA 4O1CA 4XTIA 8XIAA 1EOMA 3URBA 3QZ6A 4D8ZA 1EJ7L 1X1ZA 2YW4A 4NNBA 1MZHA 4Z2JA 1I2OA 3E38A 4WY0A 3AU2A 4GIAA 1RHCA 1YPFA 2QDGA 3DCPA 4FALA 3ZLGA 4FF5A 2Y78A 4WSJA 1FRBA 1ZLPA 4BI6A 5CKSA 3S3GA 5D2XA 2ZQ0A 1ITCA 3THQA 2BXVA 2XN2A 4PODA 1NIUA 4C5YA 1M41A 2ZQVA 2EPOA 2ZUUA 2M1IA 2CZEA 2RUSA 3WF1A 4O1FA 3L2LA 4GUIA 4GI8A 5BW6A 4PL2A 4LX4A 4S3BA 4NKCA 2RDWA 2VX5A 4ORMA 3VC5A 2FGBA 4PTNA 3W6YA 1ZRQA 3EWXA 3QW3A 4UR9A 4EAMA 3LHTA 1KNWA 2XN1A 3TOYA 4KCTA 1VFUA 3F7JA 3B8IA 2TAAA 4WZHA 1EH9A 3Q4DA 1FKKA 2QF8A 4EK7A 4MWAD 2GLKA 4UZUA 1OEPA 4JFTA 2R24A 1HIZA 1XG4A 4KR0B 3TN6A 4QISA 5K9DA 2Z2BA 3GG7A 4M29A 1AG1O 1BGAA 4NRRA 2OJPA 4L1XA 1QFEA 5E9XA 4LBRA 1B1YA 3HG4A 4DJEC 2VELA 2ZRYA 3AYTA 3W27A 2IQTA 1FH8A 4TTUA 3W25A 4WOZA 4F9JA 2EAWA 1S3TC 2QCNA 5DIVA 5RUBA 2WANA 5AC8A 3W76A 3L2IA 1XD1A 1DE6A 2CBVA 3DENA 3UQBA 2J9YA 3F4NA 1VB9A 3BLLA 3IJDA 4C6KA 4W5UA 4URIA 1IIHA 1QTWA 1TQXA 3GAYA 4XAFA 1W54A 3S0CA 1J0HA 2W79A 3KBNA 3GDRA 1OYAA 3A9IA 5HUAA 2E0PA 4AMAA 3V5FA 3KABA 3VNYA 3T40A 4XZIA 2XIIA 4UNKA 1OC6A 1QNVA 1ZJAA 3UWQA 4FSAA 2YCLA 1VPXA 3GAKA 2HK0A 2QJJA 4OZOA 1I9CB 4ZSUA 1KWKA 1TJPA 3BQ6A 3W02A 3WMBA 2A6NA 2CHNA 4X9YA 4MY1A 3CZEA 3UG3A 4AIOA 1XYCA 1FKDA 3H4GA 1GPFA 3D47A 3ARZA 3H2OA 3W7KA 3ID7A 3WNLA 3EWUA 2WXDM 2CXEA 1XS2A 4GYPC 1XG3A 3R2GA 3VDCA 3P81A 1I0BA 4LANA 3I7QA 1B2YA 4WEVX 1BXCA 5PTDA 5CZJA 4F40A 3O0KA 4IQDA 1Q7MA 4MZYA 3PULA 4DWSD 2YR1A 3DGBA 2IXVA 5FA5A 3BCFA 3L5AA 2BASA 4H8NA 4BA0A 2XINA 1UMYA 1FWFC 1NARA 4IIDA 4AWEA 1NJJA 3AQUA 1P5BA 3AIBA 2WVVB 3C8FA 1S5MA 1CXLA 2F7FA 5D09A 5IOBA 2W4XA 3PR9A 4C6IA 4RLIA 1D6OA 4I6VA 2ACQA 4CN1A 1JPHA 2FTYA 2P8CA 1R9HA 1BKHA 1D7HA 4IT6A 4WCJA 1JDCA 3DHDA 5REQB 2QPXA 5G2IA 1I6NA 4HBOA 4JQ3A 1JYXA 1TO3A 4O4VA 3ZJ6A 5FESA 1KFKA 1LL7A 1QPNA 5HQMA 2QJNA 2C1GA 4A3HA 1GTEA 5DBUA 4WGXA 1C8VA 5IBXC 2Y63A 4M6PA 2YBUA 5K4ZA 1P6BA 2Y61A 3PTDA 5A8GA 3WYZA 4AXNA 1ZCCA 1PKMA 2O9RA 3PNZA 1Q6RA 3KVKA 2ASHA 1UD6A 1GORA 1XD0A 5G4HC 1JG9A 3N17A 4DNHA 3W7HA 1WV2A 1FUYA 4HNCA 4TUFA 3E9AA 1OFOA 3ZJKA 3FHAA 1JAEA 4GY7A 1EOKA 3DG7A 5F1UA 3V5OA 3GU9A 3H70A 4AF0B 1KBBA 1BQGA 4GMEA 1TPVA 1X7FA 2GSHA 1QI4A 2WC4A 3OOQA 1WBHA 5TAOA 5A94A 1ME8A 1W3LA 3RX4A 3OBAA 1TV4A 4ATDA 1IR2A 4WJEA 1IEWA 4QEHA 3VMNA 4GUHA 3EGJA 3LHVA 1J01A 3ZZ1A 1ZU8A 1KM2A 2W92A 1JAKA 1SFLA 3M7SA 1ZALA 4U86A 2AOSA 3W81A 1IHIA 3T2QA 4Y9MA 2NWSA 3T4CA 4PUNA 1H7NA 3O5OA 2ZX9A 1XDJA 1NMVA 2V5JA 2PDIA 3QV6A 5HKGA 2CHRA 4JTLA 4YPJA 1JDFA 3VGBA 4ACYA 4WDUA 3EY6A 2XIMA 1GZ1A 4JAWA 2G95A 4RL3A 5BCAA 4XZBA 3TJ4A 2DT2A 3WEMA 1LWIA 3DXIA 4UBPC 2DH3A 4DT4A 1QI3A 2G41A 1H7RA 1DPMA 2OB3A 4EAYA 3UXIA 3MUXA 1IXPA 2YKKA 2ZR6A 3UZWA 4AMCA 3LQLA 3QOMA 1C8QA 5D33A 5HAOA 5EMKA 4U2ZA 2YDSA 4ML9A 3W3OA 4IX2A 7TAAA 4G2DA 4C60A 3V0TA 3W07A 3EB3A 2VUYA 3WLSA 1KCXA 5TD4A 4EX4A 4IPNB 1XIHA 5CPOA 3SCUA 1Y8BA 2JE8A 3BARA 3OP2A 5T8GA 1GVIA 3MP3A 4ACZB 5IHRA 1TPC1 1EF3A 2QNEA 1XYAA 2XZ9A 5LNUA 1YKWA 2WZTA 4PMQA 3MYOA 5DCBA 1SO4A 3UFYA 4FHAA 3CYJA 1EPVA 3SCOA 1LG1A 2XTKA 3GTNA 1O66A 1GTHA 1E3ZA 1TYGA 2INZA 4FNQA 3WBAA 3NM1A 3B97A 2NX1A 5AHFA 5EU9A 3CWNA 5C7VA 2VFIA 1ISVA 1XLHA 4ODNA 5CBIA 3NQDA 4C6OA 2FZMA 3VKDA 1IZCA 3WDRA 1Y5VA 3TZFA 4CN4A 3NI6A 3U6WA 4DRPA 1VJZA 1F05A 3N73A 2A3EA 1SJAA 2ZQUA 3W38A 4JEJA 4MGGA 1JZ5A 1Z44A 3ZJ8A 3MUY1 8TIMA 3ZXWA 4UDMA 4C6FA 2WNNA 4WQ6A 2E6FA 1ZJBA 1KTNA 4ZMGA 1R2RA 5I3DA 3R12A 3OPSA 4MIMA 3HQ1A 1YIXA 2QVHA 2G5WA 2QZRA 3IACA 1J79A 2MNRA 1GHRA 4M51A 2BNJA 4YVXA 4QJ1A 3ABSA 2VDIA 1WE5A 4AEOA 2JBMA 2NXIA 4AD0A 1UWAA 2O9PA 1XLEA 2HZGA 3WMSA 2I5QA 4FO4A 4GIRA 3M47A 5AECA 1F73A 3OZPA 1N8WA 1VENA 5FJJA 4AZCA 1OD8A 5HJYA 4DUOA 2QUNA 1XI3A 3PZNA 4Q8VA 3KFTA 3NYZA 3SSJA 4K39A 1GRJA 4EACA 2DQWA 1W9XA 4QCEA 4C6JA 3AIEA 1HKKA 1BD0A 3UVAA 4LAZA 9RUBA 2OTDA 3LB0A 2BX7A 4M0XA 3LGDA 4I9MA 3UGRA 4DI8A 1LRTA 4PCTA 1E4IA 3TR2A 2P5NA 4F0MA 2W6RA 3EDFA 3CASA 1VYSX 3F5KA 3B03A 5HNTA 3CV6A 3IK4A 1V3KA 1OVDA 1A5MC 3E2QA 2VRQA 1XRTA 1SQ7A 1FBAA 5CJ5A 4JPGA 4ZO9A 1I1XA 3WLIA 2XDFA 1LWJA 1TJ1A 4B9ZA 1LWHA 1F4AA 5M3WA 2W63A 1UH2A 5FJIA 3WF0A 2IF4A 2REQB 3VU2A 1EXPA 3CWHA 1XF0A 2ACUA 2HCVA 1WXJA 5BXRA 3F4VA 2C1IA 3PSVA 1BVZA 2VVNA 4LV4A 4DRIA 4LXFA 2W66A 1Q85A 2PDXA 1Q6QA 3LTPA 5JBDA 3T44A 4DRJA 1W1ZA 4FN2A 2GYIA 1YW5A 4JTJA 3UNDA 3QGKC 4E8DA 2HWGA 1H60A 4WXZA 3IUDA 1X38A 1XBZA 2AL2A 3TQKA 2A1YA 1RQBA 1XSIA 2NZLA 1PZ0A 4AZ7A 1XCWA 4A8NA 4GKTA 3PS7A 4MKSA 3PBGA 5DT7A 3NTYA 3UR7A 1OG6A 3T1GA 4W5ZA 5FL1A 1AQHA 4Q22A 4ODPA 4OIFA 2YB1A 1NDYA 1XINA 5J6EA 2XFYA 4LAUA 2WBGA 1XR2A 2HNEA 1Q8AA 4W89A 3PTMA 4US5A 3NO1A 4B91A 1B30A 4FR1A 3G0UA 4NIRA 7ODCA 4A35A 4HK7A 3L65A 3P5ZA 3H54A 5K7JA 2PLKA 2RJGA 4FEZA 3MUCA 1HO4A 1RR2A 3IARA 3R7MA 1HO1A 3VE7A 3W1AA 3N6HA 1ADOA 1EJTC 1W5PA 4LJ3A 4XO7A 3N6JA 3H7RA 1NDZA 3M0HA 4HCDA 1RJPA 4U3CA 4L4PA 3MI3A 2O4QA 2FHFA 4FS9A 4GCXA 1V77A 4ZQPA 3HGJA 5AYYA 4GIVA 1GZJA 3A4XA 3BAJA 1OYBA 5IDIA 2ATSA 3LBCA 3DFYA 2H6RA 2O4MA 1DJYA 1UR8A 2OX1A 1TV7A 2IS7A 2X0SA 4YMZA 1TMHA 3URNA 1KA9F 1KM0A 3VOIA 3PJUA 2DZVA 1BTMA 1W2PA 3OZMA 2PGWA 1XYFA 4N2YA 3APGA 4IGSA 3CV1A 4MWAA 4MGVA 3RFWA 1DYSA 1S1RA 3GVGA 4AH7A 3MS8A 3K2GA 4CVWA 5HJXA 4ZFCA 2BWGA 4C6BA 4YWSA 4PUEA 1E6QM 1N55A 2HS6A 2X2YA 3F4WA 2XP5A 1OG0A 1EQCA 3KZSA 4N0RA 4U31A 4RKAA 4RV3A 3E3HA 3WK1A 3IKGA 2WZEA 1Y0EA 4XSLA 2E8ZA 2NVAA 1GZGA 4PUKA 3GIYA 1YNQA 4O1AA 2ZZ7A 2PTXA 4RPPA 1H61A 2PBOA 4OOUA 2ZXBA 1HVXA 4O0QA 4UFMA 5KTLA 5A8NA 4FX8A 1VYRA 1G69A 3SADA 2PU0A 3G1SA 3SB0A 2EKGA 2D2GA 1RD6A 2WSRA 1X8FA 2JGQA 1FQ0A 1NWUA 1U1UA 1HJQA 1L8NA 4QHRA 4DJED 3BTNA 2E25A 4IM4A 4DYJA 5HOSA 4FLQA 4YHGA 1R85A 3SQSA 3FGCA 4OBSA 2CLHA 4LEFA 2WK2A 4X60A 1N1AA 2WB5A 4WKAA 1K9TA 5HW6A 1TIWA 4IT1A 2FHBA 3AJXA 4RXGA 5F1VA 1FOBA 4PA8A 3DIPA 1UASA 5J8LA 1FDZA 4QNEA 1RCXB 1TV5A 3TK7A 3O07A 2H8ZA 2J74A 3VNIA 4BF8A 3N04A 1E6ZA 2RGMA 3W1XA 4IGMA 5J04A 5GVJA 3VM5A 3T7VA 1A50A 5HNRA 3WLQA 5GNZA 4HU8A 2HISA 2PV3A 5DN1A 4QT2A 1IX5A 2YCIX 2PRHA 1B6CA 1FCVA 4ZPTR 4C1NB 1HJSA 4MB3A 1K77A 4PTWA 2EPLX 4DWSA 3M4HA 1XIJA 3BOFA 1VEPA 2Y5JA 4R7WA 3EWCA 3WO8A 1VLIA 1OGBA 2BP1A 4NYUA 1WBJA 1GQJA 3I68A 3QSRA 1NH6A 3SCSA 4HQVA 4QIBA 3KS6A 4D2JA 1H1NA 5EKYA 2XM1A 3P80A 4L9ZA 2WMIB 1PKYA 2P76A 4G56A 2DUAA 3VIPA 3DOPA 2AMGA 4HHPA 3GTHA 4WGHA 3WLNA 1KCZA 1OYCA 1TMQA 5F7UA 3UZJA 1XV8A 4FIRA 4JHOA 3KTSA 3HPSA 2EGZA 3TEVA 3K5XA 3S83A 1UQZA 1RP8A 4JL2A 3O5PA 3LHUA 3WQ5A 4L72B 1T7LA 3KVMA 3ORWA 3HV9A 2PP1A 4TIMA 3LCIA 2I57A 5I5RA 5H8MA 1P5QA 3VMOA 3U4AA 3BW2A 3GC5A 4HPGA 4LW7A 1TTQA 2GQ8A 3QQ0A 4QP0A 2DG3A 2VN1A 3GU0A 4GIEA 3IJ6A 3W1NA 2X42A 2QIWA 5F2IA 5T91A 3ICJA 3EWWA 2RJHA 3N15A 1FWNA 4ASTA 4N4QA 3WLJA 3DU0A 4AY8A 3QN3A 4DJFD 4I9TA 1JZ3A 2PTDA 4LF2A 2OLHA 3ITCA 1EZ2A 2OWXA 3BGGA 4E2BA 3GC2A 3RHGA 3H6OA 4HOWA 3GFXA 3WK3A 3T2PA 1QK2A 1HKVA 2ZA1A 2Q3OA 3PSWA 4AZIA 3VKAA 1NFPA 5IHSA 1IZKA 3ABRA 4Q8UA 4R85A 1J8VA 3GXFA 4I8DA 3EDJA 2IPJA 3P0XA 4MOZA 5FAGA 3KBWA 1LP6A 3K13A 2DZAA 4WXYA 3SGZA 4MKNA 4O15A 1I1WA 4LEQA 1VS1A 1XLGA 3GYEA 1X97A 3WF4A 5FCZA 1PHQA 3EPMA 3AWOA 4X63A 4LAXA 4U84A 3A3WA 3GO2A 3CB8A 4TQTA 4RE2A 4YL2A 1BHGA 3RLVA 1FDJA 4MDPA 2VFGA 1W1PA 4GH1A 2HE5A 3FS2A 1X1NA 1BG4A 1W9BM 3GLCA 1UPPA 2CLOA 3MSDA 4Q6XA 1J12A 2E8YA 4GVHA 4E4FA 4DBDA 3MO4A 1W0MA 1HT6A 5DF0A 2ZOXA 3GVRA 2DQXA 2BOFX 3ES8A 4ZQMA 3IHZA 1MI3A 5D2VA 3W1RA 2ONEA 3U2ZA 3NYDA 1M65A 3CMFA 4HSNA 4IZGA 4UMAA 3N3MA 1R47A 4TX9A 3DFPA 1PCWA 1QO5A 2ZZ4A 1B57A 4NSBA 5I06A 1VJIA 2G0WA 2CBJA 3M44A 2GK1B 3U3HA 3VTRA 1AH4A 1LOSA 1VIZA 2OQYA 3LS9A 4HHMA 1U22A 2R1NA 4HN8A 3LY0A 3BG5A 3L4UA 2AWGA 1VGAA 1WNOA 3MVTA 3KL5A 5GJPA 1YXDA 3DKJA 4C1KA 4L4LA 1XIIA 3EEZA 3PUDA 1UWQA 6ENLA 1EEXA 4B15A 1J0YA 1F8IA 4AG0A 1GVRA 1KT0A 3KAHA 4F0RA 5C9WA 3O5KA 1W3KA 2UV8G 3WL0A 4ADUA 3WQEA 3TYAA 4CD4A 5D03A 1D7FA 3LENA 3VOGA 3QY6A 2E5BA 1V3MA 1Y5WA 3M1ZA 2P8BA 5DXYA 3O6AA 1WDDA 1TX2A 4QCFA 3ES7A 2CFFA 3IS4A 2WKGA 2P0OA 1IYXA 4BF7A 3VM7A 4JEQA 4EPEC 4HZ7A 2PLCA 4D8AA 3Q94A 3A47A 2GJLA 4V27A 3AC0A 5CGQA 3BE7A 1KCKA 4M82A 2I7GA 4XBSA 3UD6A 2PRLA 3GDMA 1WQ5A 1YHTA 2ZUVA 3W0KA 1DJZA 2NQHA 3OVGA 3TR9A 5FACA 3GH5A 3AJ7A 3RCYA 4PFMA 1K4HA 3REQA 3EWZA 2J7GA 4IFOA 3MJYA 1AQFA 4ZE4A 3G1DA 3DHPA 3CK5A 3L12A 4XD3A 1EJRC 4HNTA 5I78A 1UD5A 2OX4A 4H4IA 4LF1A 4WIWA 5H8UA 3AHZA 1GOMA 3NQGA 1F40A 3RYSA 2Y2WA 1B54A 2ISSA 3UWEA 2XP6A 2VD8A 3S2NA 1IWPA 2FGLA 4HSHA 2NSXA 1DWGM 3T78A 2R9RA 2V5DA 3O5GA 4IFKB 1GYNA 3AIVA 3V18A 4FP1A 2XIOA 4H9VA 3M0ZA 1VD6A 3QC0A 2PI6A 1W3NA 5CZSA 4KWWA 1GUVA 2MF9A 4YYCA 1JEZA 4B16A 3ONBA 5DMYA 3IKDA 2WJZA 3VDAA 1ZB5A 1I8JA 3KACA 1S2VA 4DX3A 1X7IA 3MANA 4DZAA 1A49A 2W9MA 3QTPA 3S1XA 2R91A 4TX0A 4NYYA 1RQHA 4ICCX 3S1GA 4UQDA 3VC6A 2P10A 3WH6A 1QR7A 4ZQOA 5ABFB 1O7AA 4M6UA 5HQLA 2ZZ3A 2Z7KA 2QCFA 3FN9A 3N18A 3OLGA 2YFOA 1C93A 1XRFA 1YW1A 4N4PA 4W9TA 5HW7A 1R7OA 1QJWA 1HGWA 2VEFA 3B40A 4GXPA 3GTXA 1FVPA 1A3HA 5DXXA 3LHZA 5EMJA 4DN1A 2BS9A 4S1FA 5JBEA 1DVJA 2QUMA 4PMNA 2NX3A 5I79A 1YYAA 4J3TA 2OG9A 2VENA 1EGZA 2WSPA 1E0VA 1H7OA 5A8QA 3H4XA 1TA3A 2YDQA 3TSMA 2JGYA 2PFHA 2F61A 2Y88A 2YPIA 3BVJA 2WV8A 1PYMA 2OLAA 1WAUA 1RBAA 1DWHM 1FXQA 1U1JA 1L2UA 1MW2A 4GINA 2CLMA 3R79A 3CHEA 4YTRA 4AAJA 4XKYA 1HN1A 1PIGA 2BHYA 2VCAA 1ICPA 3LPPA 2ABBA 2W0UA 1KBIA 4TVUA 1UD3A 5C7HA 2D0FA 1QBBA 4GJJA 4XUYA 1YBQB 5H8PA 4M80A 3HMJG 4YVVA 3DFQA 2Y4SA 1KC7A 1V51A 1NQKA 1B4KA 1LT8A 1BQCA 2QJHA 1OFEA 1TJRA 4GABA 2D1ZA 2JFEX 5D05A 1NSJA 1NDVA 2I56A 4E3TA 2YYTA 5D30A 2DUZA 2ZIDA 2WNZA 1LCOA 3IUIA 3W1UA 3CL6A 2Z4GA 3EPOA 4WX2A 3BLOA 2F8QA 4M6VA 3NXLA 3M5ZA 4JNMA 4UQ9A 2PV1A 3T8LA 5HINA 4HNLA 4KEMA 4I9AA 5I03A 1P48A 1QI2A 5E1QA 1XJBA 4Z2GA 4XIMA 1ISZA 5AHLA 3MDUA 2QMKA 4L1GA 3CZLA 1V4YA 2QGHA 2ZA2A 3E2VA 4L64A 3TDBA 4KKXA 4MSPA 3IVTA 4JX6A 4A8RA 1OB0A 1P0DA 2PTYA 5TNVA 4NASA 1VIWA 1MUWA 1CZ1A 1KM5A 3TYEA 4DBEA 3TYZA 2TYSA 2EXOA 2Q02A 3VIFA 3R1ZA 3C0QA 3WJXA 2OO6A 2D24A 3VFCA 5LHEA 4PEEA 1JI2A 1KBKA 3G5EA 1DBTA 1O68A 2FHCA 5FSEC 3S6DA 1E1CB 3SFWA 4R34A 4HU4A 1ENUA 3WZ0E 1WKEA 3KWXA 2NVDA 1XLIA 1ISXA 4GQGA 2HEJA 2Q8LA 2XH7A 3PZMA 1U79A 1L6SA 1SMDA 4DJEA 1AJ0A 1JL8A 2CLFA 2NUXA 2QAPA 3UWVA 3OIHA 1C9DA 4DHGA 3CL8A 5DANA 1ZHAA 4LYKA 2A3HA 5C5YA 1P1MA 1GVSA 1B4EA 2G96A 1P7TB 1U1HA 4E4PA 3KRZA 1BFNA 4FOJA 4JTUA 4I3GA 3Q2DA 4MZ1A 5AYBA 4DM2A 3HPZA 2E3ZA 3EDDA 3PPGA 4TOQA 2UZ5A 1W17A 2H9AA 1MQRA 3VYLA 1TFVA 3M0YA 2Y70A 3UZYA 1CLXA 3FAXA 3LG3A 4QTGA 3ZLHA 3TCZA 1OFQA 4QT3A 1TELA 3VIJA 3MCNA 1DL3A 3WSUA 1EC7A 3FYPA 1B0IA 4QNWA 3JR2A 2ZKMX 4YLWA 3EX2A 2VI0A 1GJPA 1M01A 3IPWA 2HROA 2ZR5A 2VGGA 3KAIA 1QK0A 3W2NA 2CZDA 3AMCA 5F2GA 1BWLA 3LBOA 2OPJA 4GC4A 1UG6A 1FA2A 1EO7A 3HGOA 3RCNA 3VXGA 5DO2A 3QTGA 2QUTA 5E70A 3PAJA 4EE9A 2YBVA 4WD0A 5IFPA 2PS2A 2PZNA 4EVZA 1RAKA 3NUKA 4QIUA 4G7EB 3QEZA 4DWSB 4FF7A 1PV8A 3BCDA 2XIQA 3FVDA 3RCMA 2ZADA 3BH4A 4FB7A 4V2XA 4H7VA 5TF0A 4IMEA 1WKYA 5IXEA 5CZKA 1VFTA 3OBEA 4LS2A 4YHEA 4A21A 5BRPA 4LUTB 2ZC8A 3GHSA 4XSMA 2GDUA 4IMGA 4DRNA 3GNRA 4UFKA 2CPUA 4TXEA 3M9YA 4ITZA 4CCZA 4MPKA 5E0CA 4JTEA 4QE1A 4KERA 2G3IA 1ME7A 2L2SA 3UJEA 1TV2A 2Z0IA 2VQUA 1UR4A 1Q6EA 5CZTA 2BY2A 1US2A 3HQNA 1LRNA 4PB4A 3VMPA 1BSLA 3LI1A 4DXXA 1I4NA 3QSTA 1LORA 5DBTA 1XLLA 3M5XA 4DAIA 2PGEA 4IP4A 5E6ZA 3C61A 1VCVA 2VZTA 4AD3A 1DEDA 3JW7A 1BKFA 2YZRA 3STCA 1E9ZB 1QT1A 3VAVA 5CAHA 3O7UA 4DJFA 3GIPA 1SFJA 3OGVA 1KFLA 2HRWA 3W2MA 1XQKA 1US3A 3CUFA 1VFMA 3NPXA 1R9YA 3JS3A 1WDSA 5MF5A 4KIRA 3P6LA 2RDTA 3ARWA 1KRBC 4I7VA 1PYFA 4ZO7A 1ZL1A 1VJSA 4HZ8A 1TR9A 4KCUA 2JZVA 4DF2A 3N9SA 3S4TA 3S9YA 4UTMA 2ZFAA 3GXTA 2I14A 1E9LA 4S23A 8CGTA 1XC6A 2J8GA 4DUWA 4J9JA 3WNKA 3ZSSA 1JI1A 4EANA 4QGCA 1LBFA 2DORA 3CT7A 5I3KA 4NRSA 1W8SA 4CQ9A 6A3HA 1E6NA 2PWUA 4ZXLA 4CEXC 1QW8A 2VM8A 3MV01 2JEQA 5I09A 4MNLA 3GBDA 4JN7A 5SWUA 4Q8QA 3NOYA 4NZ4A 2HVMA 2AMXA 5I3HA 2I16A 1KBJA 1SJCA 4R7JA 2OSWA 2Y0FA 3GG0A 2CLPA 4JQ1A 1QNRA 3C0SA 3PZGA 4RJEA 4ADTA 3LHYA 3E0IA 3GDLA 3AMKA 2WCGA 3T2OA 1EGVA 2BXZA 6XIMA 2R82A 2Q6ZA 3L21A 1HF6A 4ODLA 2A3LA 2QF7A 1E56A 1TR1A 1HTIA 3MKVA 2AGKA 1JCMP 3NEVA 3QY8A 2XVNA 1JUEA 2F23A 3NAVA 1FWSA 2EG7A 5JH2A 3MHGA 4QDPA 4AHPA 2VZUA 1P43A 2K8IA 2G4FA 3Q65A 2IQDA 2VEKA 3UXDA 3GKFA 3POHA 1MEWA 3VA8A 3SSZA 3QQWA 3WD1A 1K8XA 2BY3A 2JIEA 3B0PA 3KUMA 1QDSA 3CUZA 4C7GA 3BAWA 5D02A 2F38A 1H62A 3P8IA 1RBOB 3W7DA 3CGTA 3W70A 4C6QA 1J6YA 1F3WA 4PEKA 4H19A 1X6UA 3NQBA 3WNPA 4CUCA 1FCQA 1VZWA 2JF6A 3CYVA 3FSUA 3VD4A 1H7WA 3SCQA 1Q1CA 1TVNA 1A5UA 1F7BA 1DJGA 3O6CA 1QW9A 3SUVA 2XVPA 1OF6A 5DMNA 4GLEA 4ENLA 4RNIA 5FAJA 4XQ6A 2VR5A 1Q45A 3TROA 3JXVA 2VJXA 1IXQA 1M03A 3TN5A 3UG4A 3C2RA 3MKCA 4UWMA 3IAPA 1QUMA 3TNBA 4EPKA 1K4GA 4ERIA 4AIEA 1RCQA 4QX4A 5LIUX 3GVQA 1TG7A 1J0ZA 2GGHA 3V36A 3XIMA 4G9PA 3S42A 5AC4A 1QRQA 3EX3A 3VDHA 3M64A 3GTYX 3EX4A 1TX0A 2EPNA 2WMFA 1YEYA 3CL7A 4ZODA 3TWAA 1OT1A 3SCWA 3VNDA 1Q4WA 4JFKA 4F8XA 3F03K 1XISA 1W1YA 1EP3A 3OHIA 1HX0A 3OBKA 1EO5A 4W9QA 1UUMA 4HPJA 3E0LA 3UI5A 4GUJA 1FX6A 4PL1A 3SR7A 1R87A 3RNDA 4G7FA 2WZMA 4DJDD 1UYQA 2D73A 5I98A 2FVMA 1KRMA 3S9IA 3NM3A 2E1WA 3WCZA 1A53A 3TVAA 1D2KA 3EA2A 4O12A 3F5JA 3H12A 2QW5A 3TTYA 3JVAA 4KWUA 3RPTA 1CYGA 4GYKA 1Y0OA 2RAGA 4TVDA 3E49A 5EMUA 4OTKA 2PDBA 2FTPA 4GQ0A 3UWUA 4L6OA 5E0FA 1OIMA 3UR2A 4M3PA 2Z24A 1XIGA 3TC7A 3UQIA 1D7KA 5EBUA 5I07A 3TJXA 1PZ3A 4JHZA 2OYKA 4AD4A 1JNSA 5DMLA 3KL0A 5B7ZA 2IKHA 1UOZA 4Q8WA 3S46A 5A6AA 4XAGA 2PP3A 4QBXA 3FA5A 2DZXA 4A6GA 3DAQA 3SCNA 1MO0A 1MSSA 3A5FA 4H00A 2Z25A 3BDKA 4LUSB 4ZVJA 2FMNA 1DIEA 4UB9A 4JFVA 4XD4A 1BRLA 4H7ZA 1FWRA 4H9XA 5DELA 4ZO6A 1U5VA 2QXWA 3VZXA 2C71A 3DUGA 3FJ6A 3KX6A 1F76A 3CUGA 3LGEA 4JTRA 4IGNA 1Q7ZA 4PZVA 1ZNNA 3CWOX 1A0EA 2X0HA 2ZDSA 5BXSA 5I24A 3LD5A 2JF7A 2GJNA 2HK1A 3CNYA 1H63A 1V6VA 4W86A 2Y7EA 3FCPA 1NFBA 4IQCA 3E0VA 3O8AA 4DZ2A 4DBWA 1LDCA 6TIMA 4GACA 3AUOA 1A5AA 1Q6GA 1BG9A 3NZQA 4UIOA 2UY4A 4QG8A 3O6DA 1JCJA 3ONCA 3PRDA 1YTDA 3RLGA 1XKJA 2KE0A 2G3NA 1NWSA 2VZOA 5KZ6A 3MYPA 4IIFA 4KRZA 3N2XA 1V7YA 1EC8A 2XSAA 4CD8A 2J9ZA 3UG8A 3OGRA 2WJFA 3NZ1A 4Z1DA 3EOSA 4GCAA 1BXBA 3KCJA 5ABGA 4ATLA 1GKPA 2V3GA 4JN6A 3OIXA 4V1XA 2NVCA 4HP5A 1RPXA 4H41A 2PODA 3SAZA 2HMCA 3FXYA 4PB3A 3PTQA 1VFOA 1G1YA 3FY1A 3AHYA 4DZHA 1QPFA 1EBHA 3U5UA 4OJYA 1KTCA 2FKPA 2C1HA 4UQAA 2J47A 3QY7A 6PTDA 1TE6A 3WJSA 4W8BA 3LCHA 1DJHA 4UMBA 3QFWA 1FKTA 2OQLA 1XW8A 5I23A 1FD9A 4MB4A 5M17A 2Z2UA 3VNKA 3ANVA 3QF0A 3SUWA 5K2ZA 2PDCA 3NPUA 1NU5A 4TW6A 3PWIA 4NI8A 3BLFA 4J3WA 1GGOA 4P8UA 3E6EA 2BZNA 3K46A 1KXQA 3BAXA 4MWAC 3G3MA 2Z1BA 4AHOA 1C7SA 1XIBA 4C6NA 3F2BA 1T41A 4K1WA 1XUZA 4ZOCA 3AXIA 3MPGA 3W73A 4JGDA 4X2RA 1IGSA 3MCOA 1IT7A 4UXDA 3ISIX 1GKRA 2YX0A 4RPQA 1VC4A 4JIRA 1NM9A 4QG6A 4RZBA 1WDWA 3B3DA 5M03A 1L6YA 2NX9A 1Q63A 1Q5MA 4RDZA 3AFBA 5A6BA 4TO8A 1F6PA 3E0FA 2W91A 2NQJA 2Z7GA 4XISA 3M43A 1KXVA 3NSNA 1SW7A 1XLCA 4L56A 1OD0A 2AKZA 4HTBA 2BGSA 2NW0A 1TJ2A 4O14A 3RMEA 3WBXA 2VGFA 1XDLA 2NV1A 4U5IA 3UQAA 4M5PA 4LNYA 4I5XA 5F4XA 1H5VA 3BOLA 3GDTA 3GNXA 1V02E 3W7PA 4GZEA 4KRUA 1LTDA 4UNLA 5FEXA 2P53A 1TE1A 1KCLA 1M04A 2GVJA 2TRSA 2NQLA 4LYPA 4AQLA 1WZMA 3P2VA 3MA8A 3SIZA 4S3GA 1QPQA 3CV2A 1C9HA 5EB8A 2TODA 4ZOAA 2CLKA 1I2NA 1YE4A 2PWFA 2J66A 3Q45A 1V3JA 4DVOA 3MZ2A 2FPYA 3AHVA 5G1TA 2A79A 3QKEA 3RRAA 1SZEA 3NDYA 4MYXA 3D3FA 3I6TA 5CJNA 5FF2A 3QPZA 3QZEA 1EGMA 1TRIA 4Y9OA 1ADDA 4LH8A 1CI1A 4LVFA 2M2AA 4Q4PA 4FAMA 4B3KA 3W7NA 4QRNA 3A9BA 3BZGA 3KAFA 1R3SA 1Q4NX 2OZTA 4W9PA 3VNLA 1E3XA 2C91A 2V6AA 3JZUA 3M6DA 4H8VA 3TYCA 2N87A 3CUXA 4AVFA 3BSMA 1MQQA 4DWSC 1JCTA 1REQB 3WH8A 1EHNA 1MVYA 1FWHC 3CLMA 2FAPA 2W27A 3UA4A 1TTIA 5KEZA 2QUUA 4MKVA 2OELA 2EBNA 1LL4A 2Y5SA 3UA3A 1V5XA 3LXCA 3RR1A 5T9CE 1Q66A 1R3WA 1FDYA 3K30A 3BXWA 5MKGA 4PTMA 1WPCA 1GQKA 4U33A 4GA8A 2PWVA 2E6YA 3W1TA 1E15A 1W9UA 4J35A 4B4FA 1UW9A 4IPIA 1E51A 4IXHA 4DLMA 5KZEA 4BQ2A 2Z28A 2ZUMA 4GX9A 4N6EA 2DZBA 2V8ZA 2X05A 4LVDA 1SYTA 2J77A 1S2UA 2OMAA 4JOMA 4IJRA 4C90A 4DO7A 3S2MA 4HBKA 3LCWA 1HJXA 1X6LA 5GPRA 1H50A 1W3HA 2FZDA 4GFSA 2XP8A 1JFXA 4H1ZA 3HOJA 2PRMA 3DBPA 2VT0A 4DRMA 1CLKA 2V2HA 4D1JA 4NNCA 1XFCA 3AROA 1FKIA 3L23A 5LIXX 2ATMA 3A64A 1XIDA 4AF0A 1Q13A 5DCEA 1RVKA 3I6RA 1LZOA 4I8YA 4JCLA 3ARSA 2PD5A 3HN3A 2Y7FA 3LTYA 5AYXA 2WZIA 2EG6A 2E40A 5FEWA 2FIQA 2PDLA 4J4OA 3GX9A 3O9NA 3L0NA 1A3XA 3CH0A 3RR4A 5HXMA 1MW1A 3B7XA 2FVKA 3DKLA 4FZIA 3WN6A 3NL5A 1ZGDA 3BOXA 4NZ1A 2QCDB 3W9ZA 1CLVA 3GVWA 2PDKA 3P7YA 4LS0A 3WD0A 1CXEA 1P1XA 2E5CA 1L9WA 2A3BA 3AYVA 3MY9A 3NIYA 5KINA 5IFTA 4AEFA 4KS0A 4FXFA 1B5TA 3ITGA 1VH7A 4MF4A 2C16A 4GVIA 3IK2A 1F3XA 1RJRA 4Q7IA 2VCDA 1T11A 3PPFA 1TWIA 4LAVA 1SW3A 3G0SA 3V5CA 1VLWA 3M0MA 4CCEA 5I3GA 1K1DA 2WMHA 1K8CA 4AIUA 5A6MA 1XH0A 2F6UA 4HA0A 4WDTA 3W2KA 4L9XA 3LM3A 3EWYA 1HKIA 2V67A 4U3AA 3DDMA 3GG8A 2Y24A 1E5JA 4JHMA 4MG4A 4B5NA 4B5XA 3FAPA 3UXAA 4WK9A 5LXXA 4HGXA 2F6XA 4M7TA 2GGJA 3QMSA 4CD7A 1XBXA 3B05A 2ZX5A 3R8GA 5A95A 2YXXA 3BK0A 2VOTA 3UW6A 4JTFA 3OHMB 1AL8A 4YVPA 3S6TA 4GH3A 2IQ0A 3C2EA 1THFD 4TVCA 3DBNA 3LCFA 4FOKA 1R7AA 2G8ZA 1NOFA 3NL2A 4YU1A 4KQNA 4ACZA 1IR1A 3TZNA 2EO7A 1TVPA 2GL5A 1ECEA 4PMYA 5E6YA 3G6MA 1LUCB 1BVNP 4UC5A 1XYBA 1FWJC 1KFBA 1CBGA 1V6YA 1SGJA 3B9OA 4HCHA 3IJQA 2XP7A 1OGGA 3E2RA 5CPNA 4PBEA 4MLJA 4CCDA 1W9VA 1KKOA 3NNTA 1KKRA 2FTWA 3WEZA 3MDWA 3ITOA 1C9WA 4LTSA 4NJIA 3JUGA 1XH2A 2PDWA 2AL1A 4RR4A 4ZCWA 4BI5A 3R0KA 1LQAA 5CGTA 4KEVA 4LGXA 3SY5A 1TCOC 4GQBA 1E0XA 5DRIA 5JU6A 1H7PA 1OFDA 3MW7A 3JYMA 3IRDA 2PAJA 4XKMA 3TC6A 3MKKA 5DCDA 3CHCA 1NEYA 3WDQA 4R3UA 3UCCA 1ZTVA 3PRBA 1YQ2A 1RY8A 4R7OA 5EL1A 5A6TC 2VDGA 1PCKA 3B9EA 4Z2HA 3WDIA 4S2BA 3B8SA 1B3YA 1VPYA 2XFRA 5HWJA 1QAPA 1T8QA 3N9RA 4GO9A 1EC9A 5AOUA 1KTBA 3LPFA 3PZVA 1H0GA 3PZ9A 2VR2A 4KWVA 3WL1A 4QZVB 5B80A 3LRLA 4ONVA 4QJ3B 5FJOA 2CETA 3QOKA 1VBJA 3GRIA 4CD5A 3XISA 5K9XA 4TNSA 3GVVA 2ZC1A 3UESA 4HJWA 4C7DA 2GPTA 4GC3A 1L6WA 2FJKA 1IE7C 4MHBA 3EXSA 4HU3A 2OGYA 4NZCA 3C2VA 3TP4A 1XDMA 3U0HA 1FCUA 5AZ0A 3C0JA 3MV11 2PURA 3NQAA 1GEQA 3UG5A 5I77A 4QXIA 1PEZA 1XLAA 3ABZA 3W84A 4RX0A 3NWRA 4UUIA 2GWGA 3M46A 3BLKA 1G4EA 4EXBA 4F0KA 1W37A 2YOCA 2CZ5A 7PTDA 3AO0A 1A4MA 4JTCA 3NJ3A 2O0TA 4U5KA 1G5AA 3PJWA 4XVDA 3NTPA 3DC0A 1UPMB 3AZSA 1ZZMA 1DTNA 2YL5A 2W67A 1E9YB 2WMJA 3SRFA 3O06A 5G1YA 4L80A 3TH6A 1OX6A 2OKOA 2J25A 4AHQA 1XIEA 4O54A 1P6WA 3NGJA 2GWNA 1T6MA 4ZPVR 4Q8TA 1E55A 1U83A 5ECUA 1RK6A 1UUQA 3P60A 2PLMA 1FWBC 1A4LA 5D9OA 2D2OA 3VCNA 3LNMA 4FAPA 3N9KA 4TR9A 2D9FA 2A7RA 1IXNA 3TW9A 4B90A 3RAOA 3PB0A 1ITXA 2V3EA 3WBYA 1UIPA 3CAQA 4GZ7A 4LAWA 2QAFA 1FHVA 1VHCA 1UHVA 2D3LA 5I0DA 2DSZA 3JU2A 1P0KA 2YW3A 4E8CA 1AH3A 3L9CA 4U2YA 2Z26A 4JXCA 3N34A 4PSRA 3B04A 4WDXA 3I7SA 3WJWA 1S38A 3S8HA 4Z1YA 1W91A 3W2UA 1H7XA 1UR0A 3QR1A 2FFCA 4EP8C 3WQWA 2VZVA 3R10A 4JNZA 1XUUA 4PE8A 3OQEA 3HM7A 1AFSA 3KOZA 1K6AA 5BU9A 3MU7A 3U8GA 3UPMA 2PDPA 2WKJA 2OCZA 5A69A 1MXDA 1B3XA 4QAIA 1W3JA 2WPBA 4C6DA 1KM4A 1W5OA 1QZ2A 1W6TA 2FJUB 3BV4A 3RFAA 3OGSA 3W6MA 1EX1A 5HATA 4B2DD 3VI2A 3CHVA 3W85A 3QGAC 3CXOA 1MDLA 2QHAA 2NQZA 5BXJA 3OJGA 2VOMA 3UYIA 4LUYA 2OT0A 4AWTA 1I2PA 5DITA 3ARVA 2Q8XA 4N7QA 1DJNA 3U2CA 1PO9A 3L66A 4HT3A 4ZQNA 3GS6A 3DFSA 4E4UA 1A0CA 3K4AA 3NZPA 1TZ9A 1KR0A 3KS5A 1UJQA 4KFPA 4EOUA 3KP0A 4OGZA 5FKYA 3UZXA 4P5UA 1RA0A 4O0KA 2DT1A 1KGWA 4DBUA 4HARA 5EPDA 1R3TA 3BANA 3BSHA 1GKQA 2J24A 3TN4A 1UZ4A 4W84A 5D75A 3SEPA 2CBUA 4N9DA 5CEWA 2Z6JA 1TWZA 1DIOA 1HXVA 3GXPA 3KVLA 3SJ3A 1E70M 4C6PA 1DJIA 1W1TA 3UQNA 2W5FA 1Q8JA 1L8PA 1UJPA 1AUSL 4O2TA 3TLQA 1W1VA 2EPKX 4HNNA 1A5OC 1UA3A 3CQ0A 3UERA 2RGLA 3P84A 3V0SA 2XM2A 5LYRA 3WELA 5LGXA 3ZYZA 3MBFA 3IIVA 1TWSA 3G1HA 1ML1A 5KSWA 5FF7A 1E6SM 5CSRA 5B7YA 4PTXA 4I5RA 4QQUA 3CQJA 4W4QA 3ZR6A 3G1RA 3WLLA 2PDYA 4PRTA 3GFZA 3MI2A 1TWDA 3LCLA 3ZLFA 2Y8KA 5HQEA 1W1IE 1ODZA 2O55A 1Z9AA 1K8ZA 3WX7A 1C3FA 3TQPA 3H21A 2CC0A 2WLZA 1BXNA 3OQ8A 4FLOA 3RPMA 1D8CA 1WUFA 1N2VA 1E1FA 4KFOA 4NY2A 1HJWA 3B8UA 3ATYA 1QOXA 5BWAA 3TN3A 1TPUA 3UJSA 5DT5A 3PZUA 1UB3A 1W5NA 3W75A 5F4WA 3STEA 5DMMA 4PMVA 1BEUA 3OVRA 4PR4A 5BMWA 3VKCA 4B5VA 1EP2A 6XIAA 3MQTA 3PAOA 5HPOA 3PK7A 1LLOA 4HIBA 1T5AA 2PPPA 1RJQA 8RUCA 4Y8FA 2F2KA 1B90A 3SURA 1RSCA 4JL1A 3SQMA 3O5FA 3L5MA 4NILA 1OM0A 3MB9A 2OWWA 3W53A 4CQBA 3A4WA 1ALDA 1KM1A 3EEGA 3QR3A 2W61A 4K38A 3WH0A 3LPGA 2QDDA 3T07A 1F6YA 4V33A 3UZ5A