4QT3A

Crystal structure resolution of plasmodium falciparum fk506 binding domain (fkbp35) in complex with rapamycin at 1.4a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
QEFEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDICVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLSFRELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein (FKBP)-type peptidyl-propyl isomerase
publication title Two crystal structures of the FK506-binding domain of Plasmodium falciparum FKBP35 in complex with rapamycin at high resolution
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
total genus 31
structure length 125
sequence length 125
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4qt3A01
4TNSA 4DZ3A 4FAPA 1FKLA 2FAPA 2VCDA 4JFJA 1FKFA 2MPHA 1Q1CA 2KGJA 4DRMA 1L1PA 5BXJA 2XP6A 3NRKA 4R0XA 2XP9A 4FN2A 1ROTA 1B6CA 5DIUA 5HW7A 2XP4A 1D6OA 5HW6A 2PPOA 2PBCA 3UI4A 3NTPA 2PV3A 4TYOA 2F4EA 4IQ2A 4MGVA 1F40A 4JFIA 4J4NA 1F8AB 4DRQA 2AWGA 3ODKA 4QT2A 1FKJA 2Q5AA 2PPPA 2N87A 1FKKA 1FD9A 1QPLA 2ZR4A 1FKBA 3KADA 3CGNA 3PRDA 2KO7A 2DG3A 2XP8A 4TW7A 1FJDA 1FKSA 3JYMA 3O5OA 2F2DA 2M1IA 2K8IA 1NMVA 4TW8A 4W9PA 3IHZA 2LPVA 3IKGA 4DIPA 4DRHA 1FKRA 4ODOA 4IQCA 5J6EA 2MLXA 3RFWA 1FKHA 2KE0A 4LAVA 4ODKA 1U79A 1FKIA 2ITKA 3NI6A 3PRBA 4ODLA 4W9QA 2MF9A 4C02B 4ITZA 3KAHA 4GGQA 4U84A 3MDYB 2Y78A 3LUOA 4DH0A 4U86A 1PBKA 5DITA 3O5KA 4GIVA 1C9HA 1R9HA 3O5RA 4J4OA 3O5LA 5B8IC 2XP5A 2XP7A 1M5YA 4MSPA 1Q6IA 1QZ2A 4N19A 1YATA 1JNTA 1JVWA 2IF4A 1KT1A 1TCOC 2MLYA 3UQAA 1PINA 4DT4A 1Y0OA 5HW8A 1T11A 3H9RB 3KZ7A 1NMWA 3UQIA 3O5IA 3IK8A 2XPAA 4QIBA 3O5EA 1W26A 1J4HA 1P5QA 3I6CA 2UZ5A 5DIVA 2ZQSA 2DG4A 3JXVA 1ZCNA 2D9FA 5HKGA 3KAIA 2RSEA 2ZR6A 2ZQUA 3O5GA 3O5FA 4DZ2A 2PV1A 3KABA 1Q6UA 5HWBA 3KAFA 3O5DA 2PPNA 4LAYA 4QT3A 3TCZA 1EQ3A 2M08A 4DRPA 2RUDA 4ODRA 2L2SA 3TC5A 3O5MA 2FKEA 1Q6HA 5HTGA 4O2TA 5GPGA 2VN1A 3FAPA 1A7XA 2RUCA 4LAWA 3PA7A 4DRKA 4ODNA 3UQBA 1D7IA 1FKDA 1KT0A 3O5PA 2KFWA 4G50A 3KAGA 4JFLA 2PV2A 2ZR5A 5HUAA 4DRJA 1HXVA 1FKTA 4DRNA 3JYJA 1BL4A 1N1AA 2LGOA 4U85A 4DROA 2RQSA 4BF8A 2XP3A 2DG9A 1FKGA 3UI6A 2LKNA 5D75A 3WH0A 4ODQA 4JYSA 1BKFA 3GPKA 4G2PA 4ODPA 4W9OA 2LJ4A 2JZVA 4JFKA 1YW5A 3O5JA 5HT1A 4JFMA 4TW6A 2ZQVA 3CGMA 1J4IA 3EY6A 2KR7A 1ZK6A 3B7XA 4LAXA 5HWCA 2RUQA 4ODMA 3UF8A 1D7JA 1J6YA 3UI5A 4IPXA 1QPFA 5I98A 2ZQTA 3O5QA 3IKDA 3RGCA 4TX0A 4DRIA 3VAWA 3OOBA 2KI3A 3KCEA 2MNTA 1J4RA 2RURA 1JNSA 1EYMA 2MLZA 2F21A 1FAPA 1NSGA 2M2AA 2XPBA 3KACA 1ROUA 3TDBA 1D7HA 4NNRA 2OFNA
chains in the Genus database with same CATH superfamily
4TNSA 4WKAA 4FAPA 3RM9A 4JFJA 1EHNA 2MPHA 1E6NA 2XP6A 5DIUA 4R0XA 4FN2A 5HW6A 4L3NA 3NTPA 1W1PA 3AS3A 2YBTA 4MNMA 4MGVA 5GQBA 1F8AB 1GPFA 2Q5AA 2PPPA 2N87A 2ZR4A 1GUVA 3CGNA 3KADA 4TW7A 1FJDA 1E6PA 4S3JA 3G6MA 4DRHA 1RD6A 4IQCA 2A3CA 1FKIA 1W9UA 4W9QA 4P8UA 4U84A 1LL4A 4GGQA 1C9HA 4P8XA 1M5YA 2DT3A 1QZ2A 2B5UB 1ZBWA 4Z2KA 1T11A 3KZ7A 1ZL1A 1J4HA 3G6LA 2O9OA 4URIA 1P5QA 4NSBA 1NWTA 3JXVA 3QOKA 5HKGA 4DZ2A 4L72B 4QT3A 5HBFA 2M08A 1LJYA 2RUDA 3EIPA 4DWSA 2A3AA 3WD1A 2VN1A 3RM8A 2RUCA 1ITXA 1EDQA 1HXVA 1ZU8A 1HKMA 4U85A 2RQSA 1E6ZA 3BXWA 4P8VA 4MNLA 3RM4A 2DT1A 3ARYA 5D75A 4JYSA 1BKFA 4G2PA 4W9OA 2JZVA 1E9LA 1OGBA 4TW6A 3B7XA 2WK2A 4ZPTR 3UF8A 3B9EA 2OLHA 2ZQTA 4QZVB 1LG2A 2MNTA 2MLZA 1FAPA 1ROUA 3TDBA 1D7HA 4WK9A 2KGJA 3NRKA 1ROTA 3GTYX 2XP4A 4PTMA 3WL1A 1E6RA 2PV3A 3B9DA 2DPEA 3ALFA 4DRQA 1SYTA 1E15A 1FKKA 3AS0A 1FD9A 1ZBVA 2DG3A 2XP8A 1FKSA 3JYMA 1ZBKA 3CHDA 2F2DA 1LQ0A 1K9TA 2LPVA 4ML4A 5J6EA 4HARA 1FKHA 2KE0A 3WD3A 1IX5A 3NI6A 3PRBA 4ODLA 4C02B 3KAHA 3CH9A 3AS2A 3OA5A 4U86A 3WKZA 1PBKA 3O5KA 1R9HA 5B8IC 2XP5A 1Q6IA 1JVWA 2IF4A 1KT1A 3CHFA 4XAKA 3H9RB 1H0IA 3IK8A 3O5EA 4Q7NA 1SR0A 2UZ5A 2WLYA 5DIVA 2ZQSA 2DG4A 2QF8A 1ZCNA 2WM0A 4WKFA 2RSEA 2ZQUA 3O5FA 3RMEA 2PV1A 3KABA 1Q6UA 3O5DA 4DRPA 2L2SA 3O5MA 4AY1A 4O2TA 1NWRA 2DT0A 4DRKA 4LAWA 1FKDA 1W9PA 4JFLA 3KAGA 4Z2HA 4DRNA 1BL4A 1N1AA 2LGOA 4DROA 2XP3A 4R5EA 1H0GA 2F23A 1FFRA 4ODQA 1W1TA 1LL6A 4ODPA 5DEZA 2LJ4A 4JFKA 5HT1A 3O5JA 3WD0A 3CGMA 4Z2JA 1J4IA 3B8SA 2KR7A 1ZK6A 4LAXA 3ARXA 2RUQA 2ESCA 4WIWA 1OGGA 3ARUA 3RGCA 3VAWA 3W4RA 2KI3A 1J4RA 4HBEA 1JNSA 3KACA 2M2AA 1NSGA 3AS1A 3WD4A 3CHEA 4Z2GA 1GRJA 1FKLA 3FXYA 2VCDA 1L1PA 4DRMA 4ZS6A 5BXJA 3CZ8A 1B6CA 3ARSA 1D6OA 2PPOA 5GPRA 3ARTA 2PBCA 3UI4A 5JH8A 1EIBA 2P4VA 1HKJA 4TYOA 2WLZA 2F4EA 4IQ2A 1F40A 3ALGA 3GU0A 2AWGA 1FKJA 1X6NA 4P8WA 3PRDA 1WAWA 2B31A 3ARVA 1WB0A 3O5OA 2M1IA 4TW8A 2K8IA 4W9PA 3IHZA 1FKRA 4ODOA 3RFWA 1LG1A 2EULA 4LAVA 1D2KA 4MPKA 1U79A 5DO2A 4ITZA 1NWSA 4Z2IA 4Q22A 2IUZA 3O5RA 4J4OA 3O5LA 3ARWA 1JNTA 1HJWA 2MLYA 4DT4A 4DWSD 1Y0OA 5HW8A 1O6IA 1NMWA 3O5IA 2XPAA 3I6CA 3WQVA 3FY1A 4MNJA 1ZB5A 2ZR6A 3KAFA 1XRVA 2PPNA 3ARPA 4LAYA 2ETNA 1EQ3A 4NZCA 4MTVA 3ARZA 4IT4A 3TC5A 2FKEA 1Q6HA 1ZBCA 3FAPA 1HKKA 3O5PA 2KFWA 3WL0A 1HJXA 2ZR5A 5HUAA 4DRJA 1FKTA 4DWSC 1XHGA 2DG9A 2PN0A 2LKNA 2A3BA 3AROA 3GPKA 1KFWA 1YW5A 4JFMA 4KR0B 3EY6A 1W1YA 2AOSA 3ARQA 3B9AA 3PRAA 1D7JA 4IPXA 3O5QA 1GOIA 3BMBA 2F21A 2XPBA 4WJXA 4MSPA 4DZ3A 1W1VA 2FAPA 1FKFA 1Q1CA 1TFVA 4LGXA 2XP9A 5HW7A 3AQUA 1OWQA 4DWSB 4ZPVR 4JFIA 4J4NA 3WD2A 2YBUA 3ODKA 4QT2A 4WKHA 1HJVA 1QPLA 1FKBA 2KO7A 2DSUA 1HKIA 1NMVA 4DIPA 3IKGA 2MLXA 1NH6A 4ODKA 2ITKA 2O92A 2MF9A 1JCHB 3MDYB 2Y78A 3LUOA 4DH0A 2A3EA 5DITA 3PR9A 4GIVA 5DF0A 2XP7A 3WIJA 4N19A 4Z2LA 1YATA 2G8ZA 1TCOC 3UQAA 4W5UA 2DT2A 1PINA 3UQIA 2DSVA 4QIBA 1W26A 1CTNA 2DSZA 1UR8A 2D9FA 3KAIA 3O5GA 5HWBA 1LL7A 2PI6A 4MNKA 3TCZA 1X6LA 4IT6A 4ODRA 4ZPWR 5HTGA 5GPGA 2G41A 1A7XA 3PA7A 1VF8A 3ARRA 4ODNA 3UQBA 1D7IA 1KT0A 4G50A 1E44A 2PV2A 1JNEA 4MAVA 3JYJA 2FDMA 4BF8A 4UDMA 1NWUA 1FKGA 3UI6A 3WH0A 3WQWA 2ZQVA 2DSWA 5HWCA 4S3KA 4ODMA 1WNOA 1JNDA 1J6YA 3UI5A 5I98A 1QPFA 3CHCA 3IKDA 4HBOA 4TX0A 4DRIA 3OOBA 3KCEA 1FFQA 1UR9A 2RURA 4KQZA 1EYMA 1W9VA 4NNRA 2OFNA
chains in the Genus database with same CATH topology
4TNSA 4WKAA 4FAPA 3RM9A 4JFJA 1EHNA 2MPHA 1E6NA 2XP6A 5DIUA 4R0XA 4FN2A 5HW6A 4L3NA 3NTPA 1W1PA 3AS3A 2YBTA 4MNMA 4MGVA 5GQBA 1F8AB 1GPFA 2Q5AA 2PPPA 2N87A 2ZR4A 1GUVA 3CGNA 3KADA 4TW7A 1FJDA 1E6PA 4S3JA 3G6MA 4DRHA 1RD6A 4IQCA 2A3CA 1FKIA 1W9UA 4W9QA 4P8UA 4U84A 1LL4A 4GGQA 1C9HA 4P8XA 1M5YA 2DT3A 1QZ2A 1ZBWA 4Z2KA 1T11A 3KZ7A 1ZL1A 1J4HA 3G6LA 2O9OA 4URIA 1P5QA 4NSBA 1NWTA 3JXVA 3QOKA 5HKGA 4DZ2A 4L72B 4QT3A 5HBFA 2M08A 1LJYA 2RUDA 4DWSA 2A3AA 3WD1A 2VN1A 3RM8A 2RUCA 1ITXA 1EDQA 1HXVA 1ZU8A 1HKMA 4U85A 2RQSA 1E6ZA 3BXWA 4P8VA 4MNLA 3RM4A 2DT1A 3ARYA 5D75A 4JYSA 1BKFA 4G2PA 4W9OA 2JZVA 1E9LA 1OGBA 4TW6A 3B7XA 2WK2A 4ZPTR 3UF8A 3B9EA 2OLHA 2ZQTA 4QZVB 1LG2A 2MNTA 2MLZA 1FAPA 1ROUA 3TDBA 1D7HA 4WK9A 2KGJA 3NRKA 1ROTA 2XP4A 4PTMA 3WL1A 1E6RA 2PV3A 3B9DA 2DPEA 3ALFA 4DRQA 1SYTA 1E15A 1FKKA 3AS0A 1FD9A 1ZBVA 2DG3A 2XP8A 1FKSA 3JYMA 1ZBKA 3CHDA 2F2DA 1LQ0A 1K9TA 2LPVA 4ML4A 5J6EA 4HARA 1FKHA 2KE0A 3WD3A 1IX5A 3NI6A 3PRBA 4ODLA 4C02B 3KAHA 3CH9A 3AS2A 3OA5A 4U86A 3WKZA 1PBKA 3O5KA 1R9HA 5B8IC 2XP5A 1Q6IA 1JVWA 2IF4A 1KT1A 3CHFA 4XAKA 3H9RB 1H0IA 3IK8A 3O5EA 4Q7NA 1SR0A 2UZ5A 2WLYA 5DIVA 2ZQSA 2DG4A 2QF8A 1ZCNA 2WM0A 4WKFA 2RSEA 2ZQUA 3O5FA 3RMEA 2PV1A 3KABA 1Q6UA 3O5DA 4DRPA 2L2SA 3O5MA 4AY1A 4O2TA 1NWRA 2DT0A 4DRKA 4LAWA 1FKDA 1W9PA 4JFLA 3KAGA 4Z2HA 4DRNA 1BL4A 1N1AA 2LGOA 4DROA 2XP3A 4R5EA 1H0GA 1FFRA 4ODQA 1W1TA 1LL6A 4ODPA 5DEZA 2LJ4A 4JFKA 5HT1A 3O5JA 3WD0A 3CGMA 4Z2JA 1J4IA 3B8SA 2KR7A 1ZK6A 4LAXA 3ARXA 2RUQA 2ESCA 4WIWA 1OGGA 3ARUA 3RGCA 3VAWA 3W4RA 2KI3A 1J4RA 4HBEA 1JNSA 3KACA 2M2AA 1NSGA 3AS1A 3WD4A 3CHEA 4Z2GA 1FKLA 3FXYA 2VCDA 1L1PA 4DRMA 4ZS6A 5BXJA 3CZ8A 1B6CA 3ARSA 1D6OA 2PPOA 5GPRA 3ARTA 2PBCA 3UI4A 5JH8A 1EIBA 1HKJA 4TYOA 2WLZA 2F4EA 4IQ2A 1F40A 3ALGA 2AWGA 1FKJA 1X6NA 4P8WA 3PRDA 1WAWA 2B31A 3ARVA 1WB0A 3O5OA 2M1IA 4TW8A 2K8IA 4W9PA 3IHZA 1FKRA 4ODOA 3RFWA 1LG1A 4LAVA 1D2KA 4MPKA 1U79A 5DO2A 4ITZA 1NWSA 4Z2IA 4Q22A 2IUZA 3O5RA 4J4OA 3O5LA 3ARWA 1JNTA 1HJWA 2MLYA 4DT4A 4DWSD 1Y0OA 5HW8A 1O6IA 1NMWA 3O5IA 2XPAA 3I6CA 3WQVA 3FY1A 4MNJA 1ZB5A 2ZR6A 3KAFA 1XRVA 2PPNA 3ARPA 4LAYA 1EQ3A 4NZCA 4MTVA 3ARZA 4IT4A 3TC5A 2FKEA 1Q6HA 1ZBCA 3FAPA 1HKKA 3O5PA 2KFWA 3WL0A 1HJXA 2ZR5A 5HUAA 4DRJA 1FKTA 4DWSC 1XHGA 2DG9A 2LKNA 2A3BA 3AROA 3GPKA 1KFWA 1YW5A 4JFMA 4KR0B 3EY6A 1W1YA 2AOSA 3ARQA 3B9AA 3PRAA 1D7JA 4IPXA 3O5QA 1GOIA 2F21A 2XPBA 4WJXA 4MSPA 4DZ3A 1W1VA 2FAPA 1FKFA 1Q1CA 1TFVA 4LGXA 2XP9A 5HW7A 3AQUA 1OWQA 4DWSB 4ZPVR 4JFIA 4J4NA 3WD2A 2YBUA 3ODKA 4QT2A 4WKHA 1HJVA 1QPLA 1FKBA 2KO7A 2DSUA 1HKIA 1NMVA 4DIPA 3IKGA 2MLXA 1NH6A 4ODKA 2ITKA 2O92A 2MF9A 3MDYB 2Y78A 3LUOA 4DH0A 2A3EA 5DITA 3PR9A 4GIVA 5DF0A 2XP7A 3WIJA 4N19A 4Z2LA 1YATA 2G8ZA 1TCOC 3UQAA 4W5UA 2DT2A 1PINA 3UQIA 2DSVA 4QIBA 1W26A 1CTNA 2DSZA 1UR8A 2D9FA 3KAIA 3O5GA 5HWBA 1LL7A 2PI6A 4MNKA 3TCZA 1X6LA 4IT6A 4ODRA 4ZPWR 5HTGA 5GPGA 2G41A 1A7XA 3PA7A 1VF8A 3ARRA 4ODNA 3UQBA 1D7IA 1KT0A 4G50A 2PV2A 1JNEA 4MAVA 3JYJA 2FDMA 4BF8A 1NWUA 1FKGA 3UI6A 3WH0A 3WQWA 2ZQVA 2DSWA 5HWCA 4S3KA 4ODMA 1WNOA 1JNDA 1J6YA 3UI5A 5I98A 1QPFA 3CHCA 3IKDA 4HBOA 4TX0A 4DRIA 3OOBA 3KCEA 1FFQA 1UR9A 2RURA 4KQZA 1EYMA 1W9VA 4NNRA 2OFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TNS A;  4DZ3 A;  4FAP A;  1FKL A;  2FAP A;  2VCD A;  4JFJ A;  1FKF A;  2MPH A;  1Q1C A;  2KGJ A;  4DRM A;  1L1P A;  5BXJ A;  2XP6 A;  3NRK A;  4R0X A;  2XP9 A;  4FN2 A;  1ROT A;  1B6C A;  5DIU A;  5HW7 A;  2XP4 A;  1D6O A;  5HW6 A;  2PPO A;  2PBC A;  3UI4 A;  3NTP A;  2PV3 A;  4TYO A;  2F4E A;  4IQ2 A;  4MGV A;  1F40 A;  4JFI A;  4J4N A;  1F8A B;  4DRQ A;  2AWG A;  3ODK A;  4QT2 A;  1FKJ A;  2Q5A A;  2PPP A;  2N87 A;  1FKK A;  1FD9 A;  1QPL A;  2ZR4 A;  1FKB A;  3KAD A;  3CGN A;  3PRD A;  2KO7 A;  2DG3 A;  2XP8 A;  4TW7 A;  1FJD A;  1FKS A;  3JYM A;  3O5O A;  2F2D A;  2M1I A;  2K8I A;  1NMV A;  4TW8 A;  4W9P A;  3IHZ A;  2LPV A;  3IKG A;  4DIP A;  4DRH A;  1FKR A;  4ODO A;  4IQC A;  5J6E A;  2MLX A;  3RFW A;  1FKH A;  2KE0 A;  4LAV A;  4ODK A;  1U79 A;  1FKI A;  2ITK A;  3NI6 A;  3PRB A;  4ODL A;  4W9Q A;  2MF9 A;  4C02 B;  4ITZ A;  3KAH A;  4GGQ A;  4U84 A;  3MDY B;  2Y78 A;  3LUO A;  4DH0 A;  4U86 A;  1PBK A;  5DIT A;  3O5K A;  4GIV A;  1C9H A;  1R9H A;  3O5R A;  4J4O A;  3O5L A;  5B8I C;  2XP5 A;  2XP7 A;  1M5Y A;  4MSP A;  1Q6I A;  1QZ2 A;  4N19 A;  1YAT A;  1JNT A;  1JVW A;  2IF4 A;  1KT1 A;  1TCO C;  2MLY A;  3UQA A;  1PIN A;  4DT4 A;  1Y0O A;  5HW8 A;  1T11 A;  3H9R B;  3KZ7 A;  1NMW A;  3UQI A;  3O5I A;  3IK8 A;  2XPA A;  4QIB A;  3O5E A;  1W26 A;  1J4H A;  1P5Q A;  3I6C A;  2UZ5 A;  5DIV A;  2ZQS A;  2DG4 A;  3JXV A;  1ZCN A;  2D9F A;  5HKG A;  3KAI A;  2RSE A;  2ZR6 A;  2ZQU A;  3O5G A;  3O5F A;  4DZ2 A;  2PV1 A;  3KAB A;  1Q6U A;  5HWB A;  3KAF A;  3O5D A;  2PPN A;  4LAY A;  4QT3 A;  3TCZ A;  1EQ3 A;  2M08 A;  4DRP A;  2RUD A;  4ODR A;  2L2S A;  3TC5 A;  3O5M A;  2FKE A;  1Q6H A;  5HTG A;  4O2T A;  5GPG A;  2VN1 A;  3FAP A;  1A7X A;  2RUC A;  4LAW A;  3PA7 A;  4DRK A;  4ODN A;  3UQB A;  1D7I A;  1FKD A;  1KT0 A;  3O5P A;  2KFW A;  4G50 A;  3KAG A;  4JFL A;  2PV2 A;  2ZR5 A;  5HUA A;  4DRJ A;  1HXV A;  1FKT A;  4DRN A;  3JYJ A;  1BL4 A;  1N1A A;  2LGO A;  4U85 A;  4DRO A;  2RQS A;  4BF8 A;  2XP3 A;  2DG9 A;  1FKG A;  3UI6 A;  2LKN A;  5D75 A;  3WH0 A;  4ODQ A;  4JYS A;  1BKF A;  3GPK A;  4G2P A;  4ODP A;  4W9O A;  2LJ4 A;  2JZV A;  4JFK A;  1YW5 A;  3O5J A;  5HT1 A;  4JFM A;  4TW6 A;  2ZQV A;  3CGM A;  1J4I A;  3EY6 A;  2KR7 A;  1ZK6 A;  3B7X A;  4LAX A;  5HWC A;  2RUQ A;  4ODM A;  3UF8 A;  1D7J A;  1J6Y A;  3UI5 A;  4IPX A;  1QPF A;  5I98 A;  2ZQT A;  3O5Q A;  3IKD A;  3RGC A;  4TX0 A;  4DRI A;  3VAW A;  3OOB A;  2KI3 A;  3KCE A;  2MNT A;  1J4R A;  2RUR A;  1JNS A;  1EYM A;  2MLZ A;  2F21 A;  1FAP A;  1NSG A;  2M2A A;  2XPB A;  3KAC A;  1ROU A;  3TDB A;  1D7H A;  4NNR A;  2OFN A; 
#chains in the Genus database with same CATH topology
 4TNS A;  4WKA A;  4FAP A;  3RM9 A;  4JFJ A;  1EHN A;  2MPH A;  1E6N A;  2XP6 A;  5DIU A;  4R0X A;  4FN2 A;  5HW6 A;  4L3N A;  3NTP A;  1W1P A;  3AS3 A;  2YBT A;  4MNM A;  4MGV A;  5GQB A;  1F8A B;  1GPF A;  2Q5A A;  2PPP A;  2N87 A;  2ZR4 A;  1GUV A;  3CGN A;  3KAD A;  4TW7 A;  1FJD A;  1E6P A;  4S3J A;  3G6M A;  4DRH A;  1RD6 A;  4IQC A;  2A3C A;  1FKI A;  1W9U A;  4W9Q A;  4P8U A;  4U84 A;  1LL4 A;  4GGQ A;  1C9H A;  4P8X A;  1M5Y A;  2DT3 A;  1QZ2 A;  2B5U B;  1ZBW A;  4Z2K A;  1T11 A;  3KZ7 A;  1ZL1 A;  1J4H A;  3G6L A;  2O9O A;  4URI A;  1P5Q A;  4NSB A;  1NWT A;  3JXV A;  3QOK A;  5HKG A;  4DZ2 A;  4L72 B;  4QT3 A;  5HBF A;  2M08 A;  1LJY A;  2RUD A;  3EIP A;  4DWS A;  2A3A A;  3WD1 A;  2VN1 A;  3RM8 A;  2RUC A;  1ITX A;  1EDQ A;  1HXV A;  1ZU8 A;  1HKM A;  4U85 A;  2RQS A;  1E6Z A;  3BXW A;  4P8V A;  4MNL A;  3RM4 A;  2DT1 A;  3ARY A;  5D75 A;  4JYS A;  1BKF A;  4G2P A;  4W9O A;  2JZV A;  1E9L A;  1OGB A;  4TW6 A;  3B7X A;  2WK2 A;  4ZPT R;  3UF8 A;  3B9E A;  2OLH A;  2ZQT A;  4QZV B;  1LG2 A;  2MNT A;  2MLZ A;  1FAP A;  1ROU A;  3TDB A;  1D7H A;  4WK9 A;  2KGJ A;  3NRK A;  1ROT A;  3GTY X;  2XP4 A;  4PTM A;  3WL1 A;  1E6R A;  2PV3 A;  3B9D A;  2DPE A;  3ALF A;  4DRQ A;  1SYT A;  1E15 A;  1FKK A;  3AS0 A;  1FD9 A;  1ZBV A;  2DG3 A;  2XP8 A;  1FKS A;  3JYM A;  1ZBK A;  3CHD A;  2F2D A;  1LQ0 A;  1K9T A;  2LPV A;  4ML4 A;  5J6E A;  4HAR A;  1FKH A;  2KE0 A;  3WD3 A;  1IX5 A;  3NI6 A;  3PRB A;  4ODL A;  4C02 B;  3KAH A;  3CH9 A;  3AS2 A;  3OA5 A;  4U86 A;  3WKZ A;  1PBK A;  3O5K A;  1R9H A;  5B8I C;  2XP5 A;  1Q6I A;  1JVW A;  2IF4 A;  1KT1 A;  3CHF A;  4XAK A;  3H9R B;  1H0I A;  3IK8 A;  3O5E A;  4Q7N A;  1SR0 A;  2UZ5 A;  2WLY A;  5DIV A;  2ZQS A;  2DG4 A;  2QF8 A;  1ZCN A;  2WM0 A;  4WKF A;  2RSE A;  2ZQU A;  3O5F A;  3RME A;  2PV1 A;  3KAB A;  1Q6U A;  3O5D A;  4DRP A;  2L2S A;  3O5M A;  4AY1 A;  4O2T A;  1NWR A;  2DT0 A;  4DRK A;  4LAW A;  1FKD A;  1W9P A;  4JFL A;  3KAG A;  4Z2H A;  4DRN A;  1BL4 A;  1N1A A;  2LGO A;  4DRO A;  2XP3 A;  4R5E A;  1H0G A;  2F23 A;  1FFR A;  4ODQ A;  1W1T A;  1LL6 A;  4ODP A;  5DEZ A;  2LJ4 A;  4JFK A;  5HT1 A;  3O5J A;  3WD0 A;  3CGM A;  4Z2J A;  1J4I A;  3B8S A;  2KR7 A;  1ZK6 A;  4LAX A;  3ARX A;  2RUQ A;  2ESC A;  4WIW A;  1OGG A;  3ARU A;  3RGC A;  3VAW A;  3W4R A;  2KI3 A;  1J4R A;  4HBE A;  1JNS A;  3KAC A;  2M2A A;  1NSG A;  3AS1 A;  3WD4 A;  3CHE A;  4Z2G A;  1GRJ A;  1FKL A;  3FXY A;  2VCD A;  1L1P A;  4DRM A;  4ZS6 A;  5BXJ A;  3CZ8 A;  1B6C A;  3ARS A;  1D6O A;  2PPO A;  5GPR A;  3ART A;  2PBC A;  3UI4 A;  5JH8 A;  1EIB A;  2P4V A;  1HKJ A;  4TYO A;  2WLZ A;  2F4E A;  4IQ2 A;  1F40 A;  3ALG A;  3GU0 A;  2AWG A;  1FKJ A;  1X6N A;  4P8W A;  3PRD A;  1WAW A;  2B31 A;  3ARV A;  1WB0 A;  3O5O A;  2M1I A;  4TW8 A;  2K8I A;  4W9P A;  3IHZ A;  1FKR A;  4ODO A;  3RFW A;  1LG1 A;  2EUL A;  4LAV A;  1D2K A;  4MPK A;  1U79 A;  5DO2 A;  4ITZ A;  1NWS A;  4Z2I A;  4Q22 A;  2IUZ A;  3O5R A;  4J4O A;  3O5L A;  3ARW A;  1JNT A;  1HJW A;  2MLY A;  4DT4 A;  4DWS D;  1Y0O A;  5HW8 A;  1O6I A;  1NMW A;  3O5I A;  2XPA A;  3I6C A;  3WQV A;  3FY1 A;  4MNJ A;  1ZB5 A;  2ZR6 A;  3KAF A;  1XRV A;  2PPN A;  3ARP A;  4LAY A;  2ETN A;  1EQ3 A;  4NZC A;  4MTV A;  3ARZ A;  4IT4 A;  3TC5 A;  2FKE A;  1Q6H A;  1ZBC A;  3FAP A;  1HKK A;  3O5P A;  2KFW A;  3WL0 A;  1HJX A;  2ZR5 A;  5HUA A;  4DRJ A;  1FKT A;  4DWS C;  1XHG A;  2DG9 A;  2PN0 A;  2LKN A;  2A3B A;  3ARO A;  3GPK A;  1KFW A;  1YW5 A;  4JFM A;  4KR0 B;  3EY6 A;  1W1Y A;  2AOS A;  3ARQ A;  3B9A A;  3PRA A;  1D7J A;  4IPX A;  3O5Q A;  1GOI A;  3BMB A;  2F21 A;  2XPB A;  4WJX A;  4MSP A;  4DZ3 A;  1W1V A;  2FAP A;  1FKF A;  1Q1C A;  1TFV A;  4LGX A;  2XP9 A;  5HW7 A;  3AQU A;  1OWQ A;  4DWS B;  4ZPV R;  4JFI A;  4J4N A;  3WD2 A;  2YBU A;  3ODK A;  4QT2 A;  4WKH A;  1HJV A;  1QPL A;  1FKB A;  2KO7 A;  2DSU A;  1HKI A;  1NMV A;  4DIP A;  3IKG A;  2MLX A;  1NH6 A;  4ODK A;  2ITK A;  2O92 A;  2MF9 A;  1JCH B;  3MDY B;  2Y78 A;  3LUO A;  4DH0 A;  2A3E A;  5DIT A;  3PR9 A;  4GIV A;  5DF0 A;  2XP7 A;  3WIJ A;  4N19 A;  4Z2L A;  1YAT A;  2G8Z A;  1TCO C;  3UQA A;  4W5U A;  2DT2 A;  1PIN A;  3UQI A;  2DSV A;  4QIB A;  1W26 A;  1CTN A;  2DSZ A;  1UR8 A;  2D9F A;  3KAI A;  3O5G A;  5HWB A;  1LL7 A;  2PI6 A;  4MNK A;  3TCZ A;  1X6L A;  4IT6 A;  4ODR A;  4ZPW R;  5HTG A;  5GPG A;  2G41 A;  1A7X A;  3PA7 A;  1VF8 A;  3ARR A;  4ODN A;  3UQB A;  1D7I A;  1KT0 A;  4G50 A;  1E44 A;  2PV2 A;  1JNE A;  4MAV A;  3JYJ A;  2FDM A;  4BF8 A;  4UDM A;  1NWU A;  1FKG A;  3UI6 A;  3WH0 A;  3WQW A;  2ZQV A;  2DSW A;  5HWC A;  4S3K A;  4ODM A;  1WNO A;  1JND A;  1J6Y A;  3UI5 A;  5I98 A;  1QPF A;  3CHC A;  3IKD A;  4HBO A;  4TX0 A;  4DRI A;  3OOB A;  3KCE A;  1FFQ A;  1UR9 A;  2RUR A;  4KQZ A;  1EYM A;  1W9V A;  4NNR A;  2OFN A; 
#chains in the Genus database with same CATH homology
 4TNS A;  4WKA A;  4FAP A;  3RM9 A;  4JFJ A;  1EHN A;  2MPH A;  1E6N A;  2XP6 A;  5DIU A;  4R0X A;  4FN2 A;  5HW6 A;  4L3N A;  3NTP A;  1W1P A;  3AS3 A;  2YBT A;  4MNM A;  4MGV A;  5GQB A;  1F8A B;  1GPF A;  2Q5A A;  2PPP A;  2N87 A;  2ZR4 A;  1GUV A;  3CGN A;  3KAD A;  4TW7 A;  1FJD A;  1E6P A;  4S3J A;  3G6M A;  4DRH A;  1RD6 A;  4IQC A;  2A3C A;  1FKI A;  1W9U A;  4W9Q A;  4P8U A;  4U84 A;  1LL4 A;  4GGQ A;  1C9H A;  4P8X A;  1M5Y A;  2DT3 A;  1QZ2 A;  1ZBW A;  4Z2K A;  1T11 A;  3KZ7 A;  1ZL1 A;  1J4H A;  3G6L A;  2O9O A;  4URI A;  1P5Q A;  4NSB A;  1NWT A;  3JXV A;  3QOK A;  5HKG A;  4DZ2 A;  4L72 B;  4QT3 A;  5HBF A;  2M08 A;  1LJY A;  2RUD A;  4DWS A;  2A3A A;  3WD1 A;  2VN1 A;  3RM8 A;  2RUC A;  1ITX A;  1EDQ A;  1HXV A;  1ZU8 A;  1HKM A;  4U85 A;  2RQS A;  1E6Z A;  3BXW A;  4P8V A;  4MNL A;  3RM4 A;  2DT1 A;  3ARY A;  5D75 A;  4JYS A;  1BKF A;  4G2P A;  4W9O A;  2JZV A;  1E9L A;  1OGB A;  4TW6 A;  3B7X A;  2WK2 A;  4ZPT R;  3UF8 A;  3B9E A;  2OLH A;  2ZQT A;  4QZV B;  1LG2 A;  2MNT A;  2MLZ A;  1FAP A;  1ROU A;  3TDB A;  1D7H A;  4WK9 A;  2KGJ A;  3NRK A;  1ROT A;  2XP4 A;  4PTM A;  3WL1 A;  1E6R A;  2PV3 A;  3B9D A;  2DPE A;  3ALF A;  4DRQ A;  1SYT A;  1E15 A;  1FKK A;  3AS0 A;  1FD9 A;  1ZBV A;  2DG3 A;  2XP8 A;  1FKS A;  3JYM A;  1ZBK A;  3CHD A;  2F2D A;  1LQ0 A;  1K9T A;  2LPV A;  4ML4 A;  5J6E A;  4HAR A;  1FKH A;  2KE0 A;  3WD3 A;  1IX5 A;  3NI6 A;  3PRB A;  4ODL A;  4C02 B;  3KAH A;  3CH9 A;  3AS2 A;  3OA5 A;  4U86 A;  3WKZ A;  1PBK A;  3O5K A;  1R9H A;  5B8I C;  2XP5 A;  1Q6I A;  1JVW A;  2IF4 A;  1KT1 A;  3CHF A;  4XAK A;  3H9R B;  1H0I A;  3IK8 A;  3O5E A;  4Q7N A;  1SR0 A;  2UZ5 A;  2WLY A;  5DIV A;  2ZQS A;  2DG4 A;  2QF8 A;  1ZCN A;  2WM0 A;  4WKF A;  2RSE A;  2ZQU A;  3O5F A;  3RME A;  2PV1 A;  3KAB A;  1Q6U A;  3O5D A;  4DRP A;  2L2S A;  3O5M A;  4AY1 A;  4O2T A;  1NWR A;  2DT0 A;  4DRK A;  4LAW A;  1FKD A;  1W9P A;  4JFL A;  3KAG A;  4Z2H A;  4DRN A;  1BL4 A;  1N1A A;  2LGO A;  4DRO A;  2XP3 A;  4R5E A;  1H0G A;  1FFR A;  4ODQ A;  1W1T A;  1LL6 A;  4ODP A;  5DEZ A;  2LJ4 A;  4JFK A;  5HT1 A;  3O5J A;  3WD0 A;  3CGM A;  4Z2J A;  1J4I A;  3B8S A;  2KR7 A;  1ZK6 A;  4LAX A;  3ARX A;  2RUQ A;  2ESC A;  4WIW A;  1OGG A;  3ARU A;  3RGC A;  3VAW A;  3W4R A;  2KI3 A;  1J4R A;  4HBE A;  1JNS A;  3KAC A;  2M2A A;  1NSG A;  3AS1 A;  3WD4 A;  3CHE A;  4Z2G A;  1FKL A;  3FXY A;  2VCD A;  1L1P A;  4DRM A;  4ZS6 A;  5BXJ A;  3CZ8 A;  1B6C A;  3ARS A;  1D6O A;  2PPO A;  5GPR A;  3ART A;  2PBC A;  3UI4 A;  5JH8 A;  1EIB A;  1HKJ A;  4TYO A;  2WLZ A;  2F4E A;  4IQ2 A;  1F40 A;  3ALG A;  2AWG A;  1FKJ A;  1X6N A;  4P8W A;  3PRD A;  1WAW A;  2B31 A;  3ARV A;  1WB0 A;  3O5O A;  2M1I A;  4TW8 A;  2K8I A;  4W9P A;  3IHZ A;  1FKR A;  4ODO A;  3RFW A;  1LG1 A;  4LAV A;  1D2K A;  4MPK A;  1U79 A;  5DO2 A;  4ITZ A;  1NWS A;  4Z2I A;  4Q22 A;  2IUZ A;  3O5R A;  4J4O A;  3O5L A;  3ARW A;  1JNT A;  1HJW A;  2MLY A;  4DT4 A;  4DWS D;  1Y0O A;  5HW8 A;  1O6I A;  1NMW A;  3O5I A;  2XPA A;  3I6C A;  3WQV A;  3FY1 A;  4MNJ A;  1ZB5 A;  2ZR6 A;  3KAF A;  1XRV A;  2PPN A;  3ARP A;  4LAY A;  1EQ3 A;  4NZC A;  4MTV A;  3ARZ A;  4IT4 A;  3TC5 A;  2FKE A;  1Q6H A;  1ZBC A;  3FAP A;  1HKK A;  3O5P A;  2KFW A;  3WL0 A;  1HJX A;  2ZR5 A;  5HUA A;  4DRJ A;  1FKT A;  4DWS C;  1XHG A;  2DG9 A;  2LKN A;  2A3B A;  3ARO A;  3GPK A;  1KFW A;  1YW5 A;  4JFM A;  4KR0 B;  3EY6 A;  1W1Y A;  2AOS A;  3ARQ A;  3B9A A;  3PRA A;  1D7J A;  4IPX A;  3O5Q A;  1GOI A;  2F21 A;  2XPB A;  4WJX A;  4MSP A;  4DZ3 A;  1W1V A;  2FAP A;  1FKF A;  1Q1C A;  1TFV A;  4LGX A;  2XP9 A;  5HW7 A;  3AQU A;  1OWQ A;  4DWS B;  4ZPV R;  4JFI A;  4J4N A;  3WD2 A;  2YBU A;  3ODK A;  4QT2 A;  4WKH A;  1HJV A;  1QPL A;  1FKB A;  2KO7 A;  2DSU A;  1HKI A;  1NMV A;  4DIP A;  3IKG A;  2MLX A;  1NH6 A;  4ODK A;  2ITK A;  2O92 A;  2MF9 A;  3MDY B;  2Y78 A;  3LUO A;  4DH0 A;  2A3E A;  5DIT A;  3PR9 A;  4GIV A;  5DF0 A;  2XP7 A;  3WIJ A;  4N19 A;  4Z2L A;  1YAT A;  2G8Z A;  1TCO C;  3UQA A;  4W5U A;  2DT2 A;  1PIN A;  3UQI A;  2DSV A;  4QIB A;  1W26 A;  1CTN A;  2DSZ A;  1UR8 A;  2D9F A;  3KAI A;  3O5G A;  5HWB A;  1LL7 A;  2PI6 A;  4MNK A;  3TCZ A;  1X6L A;  4IT6 A;  4ODR A;  4ZPW R;  5HTG A;  5GPG A;  2G41 A;  1A7X A;  3PA7 A;  1VF8 A;  3ARR A;  4ODN A;  3UQB A;  1D7I A;  1KT0 A;  4G50 A;  2PV2 A;  1JNE A;  4MAV A;  3JYJ A;  2FDM A;  4BF8 A;  1NWU A;  1FKG A;  3UI6 A;  3WH0 A;  3WQW A;  2ZQV A;  2DSW A;  5HWC A;  4S3K A;  4ODM A;  1WNO A;  1JND A;  1J6Y A;  3UI5 A;  5I98 A;  1QPF A;  3CHC A;  3IKD A;  4HBO A;  4TX0 A;  4DRI A;  3OOB A;  3KCE A;  1FFQ A;  1UR9 A;  2RUR A;  4KQZ A;  1EYM A;  1W9V A;  4NNR A;  2OFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...