4QT3A

Crystal structure resolution of plasmodium falciparum fk506 binding domain (fkbp35) in complex with rapamycin at 1.4a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
b'QEFEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDICVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLSFRELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein (FKBP)-type peptidyl-propyl isomerase
publication title Two crystal structures of the FK506-binding domain of Plasmodium falciparum FKBP35 in complex with rapamycin at high resolution
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Isomerase
total genus 31
structure length 125
sequence length 125
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4qt3A01
1A7XA 2MPHA 4TW7A 2MLYA 2ZR6A 1JVWA 2RSEA 1D6OA 4U85A 2VN1A 5J6EA 2XP9A 5B8IC 2PPOA 4U84A 3RFWA 2PV3A 4U86A 4DT4A 2K8IA 4GIVA 4TW6A 3IKGA 4ODMA 5HUAA 1FD9A 1C9HA 2ZQUA 1TCOC 1Q6HA 2F4EA 2RUQA 4ODLA 1HXVA 3IKDA 4G50A 2N87A 4DRHA 4DZ2A 4ODKA 2LJ4A 3NTPA 4N19A 2MLXA 5HW8A 1F8AB 2DG9A 1W26A 3O5RA 4DRMA 2ZQVA 5HWCA 1QZ2A 3VAWA 2Y78A 3ODKA 3UI5A 2KE0A 2XP6A 4QT3A 4TW8A 4ITZA 4C02B 3NRKA 1PINA 4O2TA 1T11A 2DG4A 5HTGA 1J6YA 4FN2A 4NNRA 2M08A 2LGOA 3CGMA 3IHZA 2RUDA 3JYJA 2PPPA 4R0XA 1NMWA 5HW7A 4TYOA 3UQAA 1J4RA 2AWGA 2KFWA 1D7IA 4TNSA 3PRBA 2PPNA 2M1IA 4IQCA 1EYMA 2LPVA 2JZVA 3O5DA 3KZ7A 3O5IA 1QPFA 3FAPA 4DRIA 3EY6A 4DZ3A 5HW6A 4ODNA 1ZK6A 1FKFA 1JNTA 3KAGA 4W9QA 1YATA 2M2AA 2XPAA 2ZQTA 2ZR5A 3KCEA 1FKHA 1Q1CA 2RQSA 1ROTA 2UZ5A 4DRNA 1D7JA 1FKBA 4DROA 3O5FA 5HWBA 1ZCNA 4J4OA 2VCDA 3O5GA 1JNSA 1PBKA 2ITKA 2XP5A 3H9RB 2F2DA 3UI6A 1ROUA 3TDBA 2XP3A 3UI4A 5HKGA 3KACA 2Q5AA 1FKGA 4JFMA 1Q6IA 3O5LA 5DIVA 1FKDA 4ODPA 4DH0A 1Y0OA 2PV1A 3O5EA 3JXVA 1BKFA 3MDYB 4LAVA 3O5PA 2ZR4A 4FAPA 2XP7A 2PBCA 5BXJA 2KI3A 3KAIA 1FKJA 1L1PA 4GGQA 3PRDA 4LAXA 3RGCA 1J4HA 3KAFA 4LAWA 3O5OA 4ODQA 1FJDA 5DITA 1J4IA 2MLZA 4G2PA 1NSGA 1FKSA 2FAPA 2MNTA 2PV2A 3I6CA 2RUCA 1FKRA 1D7HA 1QPLA 4IQ2A 1KT0A 4BF8A 4DRKA 2FKEA 2KO7A 4ODRA 1U79A 3JYMA 3CGNA 4DRJA 4JFLA 3OOBA 3TC5A 3KADA 5D75A 2RURA 2MF9A 4ODOA 4MSPA 3KABA 3WH0A 4TX0A 3NI6A 3UQIA 4W9PA 5GPGA 4DRQA 2ZQSA 3O5QA 1P5QA 1Q6UA 4JFJA 4J4NA 2F21A 3LUOA 3UF8A 2OFNA 4QIBA 4JYSA 3B7XA 2IF4A 1FKLA 3PA7A 3O5JA 1B6CA 1FKIA 4QT2A 1KT1A 4DRPA 1M5YA 1FKTA 1R9HA 1F40A 1N1AA 3IK8A 3O5KA 2L2SA 2LKNA 3GPKA 4DIPA 3UQBA 1BL4A 1YW5A 4JFKA 4JFIA 2D9FA 4IPXA 2XPBA 2XP4A 5DIUA 5I98A 1FKKA 2XP8A 2DG3A 1EQ3A 4W9OA 3KAHA 4LAYA 1NMVA 2KGJA 3O5MA 1FAPA 4MGVA 5HT1A 3TCZA 2KR7A
chains in the Genus database with same CATH superfamily
4TW7A 1D6OA 3RFWA 4U84A 4DT4A 1LL4A 4WIWA 4Z2IA 2ZQUA 3ARYA 2RUQA 4DWSC 2MLXA 2DG9A 1X6LA 2ZQVA 3WD2A 3CHEA 4QT3A 4ITZA 5HTGA 4FN2A 4NNRA 3AS2A 1E6PA 2ETNA 2M08A 2LGOA 3CGMA 3UQAA 5HW7A 2DPEA 2G41A 1NWTA 5HW6A 4ODNA 1JNTA 2M2AA 2XPAA 1FKHA 1Q1CA 2RQSA 2UZ5A 4DROA 1FKBA 3O5FA 3O5GA 1JNSA 2ITKA 3UI6A 2Q5AA 1FKGA 1Q6IA 5DIVA 3WD4A 4ODPA 3O5EA 1BKFA 1ZBKA 1L1PA 4GGQA 3KAFA 4LAWA 1OWQA 5DO2A 1ZB5A 1J4IA 2MLZA 1FKSA 4L72B 1O6IA 3ARVA 3I6CA 1FKRA 3OA5A 4ZPWR 1E9LA 3TC5A 2RURA 2MF9A 2AOSA 3QOKA 3ARXA 1SYTA 1Q6UA 1VF8A 1LG1A 3CHFA 3UF8A 1X6NA 1H0IA 4JYSA 1FKLA 3B9EA 4P8UA 4KR0B 1FKTA 2DSVA 3O5KA 2L2SA 2LKNA 3CHCA 1BL4A 4JFKA 2XPBA 1ZBWA 4QZVB 1FKKA 3B9DA 3PR9A 1EQ3A 1GRJA 4PTMA 4MGVA 1FAPA 5DF0A 5HT1A 2MPHA 2G8ZA 2ZR6A 5J6EA 5B8IC 3BMBA 4U86A 1TFVA 2YBUA 1FD9A 1C9HA 1JNEA 4ODKA 2LJ4A 5HW8A 1NWUA 4AY1A 4NZCA 2Y78A 3UI5A 2XP6A 1PINA 3RM4A 3IHZA 1XHGA 1NMWA 5DEZA 2DT3A 2PPNA 2LPVA 2JZVA 3O5IA 1EIBA 1HJVA 4DRIA 1RD6A 1ZK6A 3ARUA 3CHDA 4LGXA 3KCEA 2WLYA 4DRNA 3WIJA 1ZCNA 4J4OA 4DWSD 1GUVA 1GPFA 2F2DA 3H9RB 1LG2A 5HKGA 3WQWA 1OGBA 1Y0OA 2PV1A 3RMEA 3MDYB 1XRVA 3CH9A 2XP7A 3RM9A 4L3NA 3ARQA 5BXJA 2KI3A 3KAIA 4LAXA 3RGCA 1J4HA 2DT1A 4ML4A 1FJDA 5DITA 4G2PA 2MNTA 5HBFA 5JH8A 1UR9A 2PV2A 4HBEA 2B5UB 1NWSA 4DRKA 4ODRA 4DRJA 4JFLA 3WQVA 4DWSA 1W1YA 3EIPA 4P8WA 3KABA 3G6MA 4DRQA 2ZQSA 4Z2KA 2A3BA 1B6CA 1FKIA 1CTNA 4QT2A 2DSWA 1N1AA 3IK8A 1HKKA 2DT2A 3G6LA 3UQBA 1HKIA 1YW5A 4JFIA 2D9FA 1H0GA 2B31A 1ZBCA 5I98A 4W9OA 3KAHA 2DSZA 2KGJA 1W1PA 1A7XA 1JVWA 2RSEA 4S3KA 2XP9A 2PPOA 1SR0A 2PV3A 4P8XA 3WD3A 2K8IA 4GIVA 3ARZA 3IKGA 4ODMA 3WL0A 5HUAA 4Q7NA 3B9AA 2F4EA 3FY1A 1W9UA 3IKDA 1W9PA 2N87A 1GOIA 4G50A 4DZ2A 3WD1A 3NTPA 1W9VA 1W26A 3O5RA 4DRMA 3VAWA 2KE0A 4TW8A 4O2TA 1T11A 1E6ZA 3AQUA 1J6YA 2RUDA 3JYJA 4R0XA 4WKFA 1W1TA 1D7IA 4TNSA 2M1IA 1EYMA 5GQBA 1ITXA 1K9TA 3KZ7A 2O92A 3EY6A 2WLZA 2WK2A 3KAGA 4WKHA 1D7JA 1PBKA 1ROUA 3TDBA 1NWRA 4NSBA 1LL6A 1FKDA 4DH0A 3JXVA 2ESCA 4LAVA 3WL1A 4FAPA 3B8SA 2PBCA 1WAWA 1FKJA 1E15A 4ODQA 2O9OA 2RUCA 1D7HA 1QPLA 3AROA 1KT0A 2P4VA 4IQ2A 4IT4A 1U79A 1FFRA 3JYMA 3OOBA 3KADA 4ODOA 4MSPA 4KQZA 4WJXA 4TX0A 2YBTA 3ARSA 1P5QA 4JFJA 3CZ8A 4J4NA 4MNLA 2PN0A 3LUOA 2OFNA 4QIBA 3B7XA 1HKJA 3O5JA 3AS3A 1JNDA 3FXYA 1R9HA 3GPKA 3AS1A 4ZPTR 4IPXA 3GTYX 2XP4A 4Z2JA 2XP8A 2DG3A 4MNJA 4Z2GA 3PRAA 4LAYA 1ZL1A 2A3CA 3O5MA 2KR7A 1IX5A 2MLYA 1ZBVA 4U85A 2VN1A 1E6RA 4TW6A 4XAKA 1TCOC 1Q6HA 4ODLA 1HXVA 1FFQA 4DRHA 1WNOA 3AS0A 4N19A 1F8AB 5GPRA 4MPKA 5HWCA 1QZ2A 3ODKA 1HKMA 4C02B 3NRKA 1NH6A 2DG4A 1HJXA 4UDMA 1HJWA 2PPPA 1JCHB 4TYOA 3BXWA 1J4RA 2AWGA 2KFWA 3PRBA 4IQCA 2F23A 4ZS6A 3RM8A 3ALGA 3O5DA 4HBOA 1QPFA 3FAPA 4DZ3A 3WKZA 1FKFA 4W9QA 1YATA 2ZQTA 4MNKA 3W4RA 2ZR5A 4Z2LA 1ROTA 4WKAA 5HWBA 2VCDA 3ALFA 4IT6A 2XP5A 3ARRA 2XP3A 3UI4A 3KACA 4MNMA 4JFMA 4WK9A 3O5LA 4Z2HA 1UR8A 2FDMA 1LJYA 3O5PA 3GU0A 4P8VA 2ZR4A 3WD0A 2OLHA 4HARA 1EHNA 2DT0A 3PRDA 3O5OA 1NSGA 2FAPA 1LL7A 4URIA 1E44A 4MTVA 4BF8A 2FKEA 2KO7A 1KFWA 3CGNA 5D75A 3WH0A 3NI6A 3UQIA 4W9PA 4MAVA 5GPGA 4R5EA 3O5QA 1EDQA 1D2KA 2IUZA 2A3AA 2WM0A 2F21A 2IF4A 4W5UA 1E6NA 3PA7A 1OGGA 3ARTA 1KT1A 4DRPA 1ZU8A 1M5YA 2EULA 3ARWA 2DSUA 1F40A 4S3JA 1LQ0A 4DIPA 1W1VA 4DWSB 3ARPA 4Q22A 2A3EA 5DIUA 2PI6A 4ZPVR 2QF8A 1NMVA 3TCZA 1WB0A
chains in the Genus database with same CATH topology
4TW7A 1D6OA 3RFWA 4U84A 4DT4A 1LL4A 4WIWA 4Z2IA 2ZQUA 3ARYA 2RUQA 4DWSC 2MLXA 2DG9A 1X6LA 2ZQVA 3WD2A 3CHEA 4QT3A 4ITZA 5HTGA 4FN2A 4NNRA 3AS2A 1E6PA 2M08A 2LGOA 3CGMA 3UQAA 5HW7A 2DPEA 2G41A 1NWTA 5HW6A 4ODNA 1JNTA 2M2AA 2XPAA 1FKHA 1Q1CA 2RQSA 2UZ5A 4DROA 1FKBA 3O5FA 3O5GA 1JNSA 2ITKA 3UI6A 2Q5AA 1FKGA 1Q6IA 5DIVA 3WD4A 4ODPA 3O5EA 1BKFA 1ZBKA 1L1PA 4GGQA 3KAFA 4LAWA 1OWQA 5DO2A 1ZB5A 1J4IA 2MLZA 1FKSA 4L72B 1O6IA 3ARVA 3I6CA 1FKRA 3OA5A 4ZPWR 1E9LA 3TC5A 2RURA 2MF9A 2AOSA 3QOKA 3ARXA 1SYTA 1Q6UA 1VF8A 1LG1A 3CHFA 3UF8A 1X6NA 1H0IA 4JYSA 1FKLA 3B9EA 4P8UA 4KR0B 1FKTA 2DSVA 3O5KA 2L2SA 2LKNA 3CHCA 1BL4A 4JFKA 2XPBA 1ZBWA 4QZVB 1FKKA 3B9DA 3PR9A 1EQ3A 4PTMA 4MGVA 1FAPA 5DF0A 5HT1A 2MPHA 2G8ZA 2ZR6A 5J6EA 5B8IC 4U86A 1TFVA 2YBUA 1FD9A 1C9HA 1JNEA 4ODKA 2LJ4A 5HW8A 1NWUA 4AY1A 4NZCA 2Y78A 3UI5A 2XP6A 1PINA 3RM4A 3IHZA 1XHGA 1NMWA 5DEZA 2DT3A 2PPNA 2LPVA 2JZVA 3O5IA 1EIBA 1HJVA 4DRIA 1RD6A 1ZK6A 3ARUA 3CHDA 4LGXA 3KCEA 2WLYA 4DRNA 3WIJA 1ZCNA 4J4OA 4DWSD 1GUVA 1GPFA 2F2DA 3H9RB 1LG2A 5HKGA 3WQWA 1OGBA 1Y0OA 2PV1A 3RMEA 3MDYB 1XRVA 3CH9A 2XP7A 3RM9A 4L3NA 3ARQA 5BXJA 2KI3A 3KAIA 4LAXA 3RGCA 1J4HA 2DT1A 4ML4A 1FJDA 5DITA 4G2PA 2MNTA 5HBFA 5JH8A 1UR9A 2PV2A 4HBEA 1NWSA 4DRKA 4ODRA 4DRJA 4JFLA 3WQVA 4DWSA 1W1YA 4P8WA 3KABA 3G6MA 4DRQA 2ZQSA 4Z2KA 2A3BA 1B6CA 1FKIA 1CTNA 4QT2A 2DSWA 1N1AA 3IK8A 1HKKA 2DT2A 3G6LA 3UQBA 1HKIA 1YW5A 4JFIA 2D9FA 1H0GA 2B31A 1ZBCA 5I98A 4W9OA 3KAHA 2DSZA 2KGJA 1W1PA 1A7XA 1JVWA 2RSEA 4S3KA 2XP9A 2PPOA 1SR0A 2PV3A 4P8XA 3WD3A 2K8IA 4GIVA 3ARZA 3IKGA 4ODMA 3WL0A 5HUAA 4Q7NA 3B9AA 2F4EA 3FY1A 1W9UA 3IKDA 1W9PA 2N87A 1GOIA 4G50A 4DZ2A 3WD1A 3NTPA 1W9VA 1W26A 3O5RA 4DRMA 3VAWA 2KE0A 4TW8A 4O2TA 1T11A 1E6ZA 3AQUA 1J6YA 2RUDA 3JYJA 4R0XA 4WKFA 1W1TA 1D7IA 4TNSA 2M1IA 1EYMA 5GQBA 1ITXA 1K9TA 3KZ7A 2O92A 3EY6A 2WLZA 2WK2A 3KAGA 4WKHA 1D7JA 1PBKA 1ROUA 3TDBA 1NWRA 4NSBA 1LL6A 1FKDA 4DH0A 3JXVA 2ESCA 4LAVA 3WL1A 4FAPA 3B8SA 2PBCA 1WAWA 1FKJA 1E15A 4ODQA 2O9OA 2RUCA 1D7HA 1QPLA 3AROA 1KT0A 4IQ2A 4IT4A 1U79A 1FFRA 3JYMA 3OOBA 3KADA 4ODOA 4MSPA 4KQZA 4WJXA 4TX0A 2YBTA 3ARSA 1P5QA 4JFJA 3CZ8A 4J4NA 4MNLA 3LUOA 2OFNA 4QIBA 3B7XA 1HKJA 3O5JA 3AS3A 1JNDA 3FXYA 1R9HA 3GPKA 3AS1A 4ZPTR 4IPXA 2XP4A 4Z2JA 2XP8A 2DG3A 4MNJA 4Z2GA 3PRAA 4LAYA 1ZL1A 2A3CA 3O5MA 2KR7A 1IX5A 2MLYA 1ZBVA 4U85A 2VN1A 1E6RA 4TW6A 4XAKA 1TCOC 1Q6HA 4ODLA 1HXVA 1FFQA 4DRHA 1WNOA 3AS0A 4N19A 1F8AB 5GPRA 4MPKA 5HWCA 1QZ2A 3ODKA 1HKMA 4C02B 3NRKA 1NH6A 2DG4A 1HJXA 1HJWA 2PPPA 4TYOA 3BXWA 1J4RA 2AWGA 2KFWA 3PRBA 4IQCA 4ZS6A 3RM8A 3ALGA 3O5DA 4HBOA 1QPFA 3FAPA 4DZ3A 3WKZA 1FKFA 4W9QA 1YATA 2ZQTA 4MNKA 3W4RA 2ZR5A 4Z2LA 1ROTA 4WKAA 5HWBA 2VCDA 3ALFA 4IT6A 2XP5A 3ARRA 2XP3A 3UI4A 3KACA 4MNMA 4JFMA 4WK9A 3O5LA 4Z2HA 1UR8A 2FDMA 1LJYA 3O5PA 4P8VA 2ZR4A 3WD0A 2OLHA 4HARA 1EHNA 2DT0A 3PRDA 3O5OA 1NSGA 2FAPA 1LL7A 4URIA 4MTVA 4BF8A 2FKEA 2KO7A 1KFWA 3CGNA 5D75A 3WH0A 3NI6A 3UQIA 4W9PA 4MAVA 5GPGA 4R5EA 3O5QA 1EDQA 1D2KA 2IUZA 2A3AA 2WM0A 2F21A 2IF4A 4W5UA 1E6NA 3PA7A 1OGGA 3ARTA 1KT1A 4DRPA 1ZU8A 1M5YA 1F40A 3ARWA 2DSUA 4S3JA 1LQ0A 4DIPA 1W1VA 4DWSB 3ARPA 4Q22A 2A3EA 5DIUA 2PI6A 4ZPVR 2QF8A 1NMVA 3TCZA 1WB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7X A;  2MPH A;  4TW7 A;  2MLY A;  2ZR6 A;  1JVW A;  2RSE A;  1D6O A;  4U85 A;  2VN1 A;  5J6E A;  2XP9 A;  5B8I C;  2PPO A;  4U84 A;  3RFW A;  2PV3 A;  4U86 A;  4DT4 A;  2K8I A;  4GIV A;  4TW6 A;  3IKG A;  4ODM A;  5HUA A;  1FD9 A;  1C9H A;  2ZQU A;  1TCO C;  1Q6H A;  2F4E A;  2RUQ A;  4ODL A;  1HXV A;  3IKD A;  4G50 A;  2N87 A;  4DRH A;  4DZ2 A;  4ODK A;  2LJ4 A;  3NTP A;  4N19 A;  2MLX A;  5HW8 A;  1F8A B;  2DG9 A;  1W26 A;  3O5R A;  4DRM A;  2ZQV A;  5HWC A;  1QZ2 A;  3VAW A;  2Y78 A;  3ODK A;  3UI5 A;  2KE0 A;  2XP6 A;  4QT3 A;  4TW8 A;  4ITZ A;  4C02 B;  3NRK A;  1PIN A;  4O2T A;  1T11 A;  2DG4 A;  5HTG A;  1J6Y A;  4FN2 A;  4NNR A;  2M08 A;  2LGO A;  3CGM A;  3IHZ A;  2RUD A;  3JYJ A;  2PPP A;  4R0X A;  1NMW A;  5HW7 A;  4TYO A;  3UQA A;  1J4R A;  2AWG A;  2KFW A;  1D7I A;  4TNS A;  3PRB A;  2PPN A;  2M1I A;  4IQC A;  1EYM A;  2LPV A;  2JZV A;  3O5D A;  3KZ7 A;  3O5I A;  1QPF A;  3FAP A;  4DRI A;  3EY6 A;  4DZ3 A;  5HW6 A;  4ODN A;  1ZK6 A;  1FKF A;  1JNT A;  3KAG A;  4W9Q A;  1YAT A;  2M2A A;  2XPA A;  2ZQT A;  2ZR5 A;  3KCE A;  1FKH A;  1Q1C A;  2RQS A;  1ROT A;  2UZ5 A;  4DRN A;  1D7J A;  1FKB A;  4DRO A;  3O5F A;  5HWB A;  1ZCN A;  4J4O A;  2VCD A;  3O5G A;  1JNS A;  1PBK A;  2ITK A;  2XP5 A;  3H9R B;  2F2D A;  3UI6 A;  1ROU A;  3TDB A;  2XP3 A;  3UI4 A;  5HKG A;  3KAC A;  2Q5A A;  1FKG A;  4JFM A;  1Q6I A;  3O5L A;  5DIV A;  1FKD A;  4ODP A;  4DH0 A;  1Y0O A;  2PV1 A;  3O5E A;  3JXV A;  1BKF A;  3MDY B;  4LAV A;  3O5P A;  2ZR4 A;  4FAP A;  2XP7 A;  2PBC A;  5BXJ A;  2KI3 A;  3KAI A;  1FKJ A;  1L1P A;  4GGQ A;  3PRD A;  4LAX A;  3RGC A;  1J4H A;  3KAF A;  4LAW A;  3O5O A;  4ODQ A;  1FJD A;  5DIT A;  1J4I A;  2MLZ A;  4G2P A;  1NSG A;  1FKS A;  2FAP A;  2MNT A;  2PV2 A;  3I6C A;  2RUC A;  1FKR A;  1D7H A;  1QPL A;  4IQ2 A;  1KT0 A;  4BF8 A;  4DRK A;  2FKE A;  2KO7 A;  4ODR A;  1U79 A;  3JYM A;  3CGN A;  4DRJ A;  4JFL A;  3OOB A;  3TC5 A;  3KAD A;  5D75 A;  2RUR A;  2MF9 A;  4ODO A;  4MSP A;  3KAB A;  3WH0 A;  4TX0 A;  3NI6 A;  3UQI A;  4W9P A;  5GPG A;  4DRQ A;  2ZQS A;  3O5Q A;  1P5Q A;  1Q6U A;  4JFJ A;  4J4N A;  2F21 A;  3LUO A;  3UF8 A;  2OFN A;  4QIB A;  4JYS A;  3B7X A;  2IF4 A;  1FKL A;  3PA7 A;  3O5J A;  1B6C A;  1FKI A;  4QT2 A;  1KT1 A;  4DRP A;  1M5Y A;  1FKT A;  1R9H A;  1F40 A;  1N1A A;  3IK8 A;  3O5K A;  2L2S A;  2LKN A;  3GPK A;  4DIP A;  3UQB A;  1BL4 A;  1YW5 A;  4JFK A;  4JFI A;  2D9F A;  4IPX A;  2XPB A;  2XP4 A;  5DIU A;  5I98 A;  1FKK A;  2XP8 A;  2DG3 A;  1EQ3 A;  4W9O A;  3KAH A;  4LAY A;  1NMV A;  2KGJ A;  3O5M A;  1FAP A;  4MGV A;  5HT1 A;  3TCZ A;  2KR7 A; 
#chains in the Genus database with same CATH topology
 4TW7 A;  1D6O A;  3RFW A;  4U84 A;  4DT4 A;  1LL4 A;  4WIW A;  4Z2I A;  2ZQU A;  3ARY A;  2RUQ A;  4DWS C;  2MLX A;  2DG9 A;  1X6L A;  2ZQV A;  3WD2 A;  3CHE A;  4QT3 A;  4ITZ A;  5HTG A;  4FN2 A;  4NNR A;  3AS2 A;  1E6P A;  2ETN A;  2M08 A;  2LGO A;  3CGM A;  3UQA A;  5HW7 A;  2DPE A;  2G41 A;  1NWT A;  5HW6 A;  4ODN A;  1JNT A;  2M2A A;  2XPA A;  1FKH A;  1Q1C A;  2RQS A;  2UZ5 A;  4DRO A;  1FKB A;  3O5F A;  3O5G A;  1JNS A;  2ITK A;  3UI6 A;  2Q5A A;  1FKG A;  1Q6I A;  5DIV A;  3WD4 A;  4ODP A;  3O5E A;  1BKF A;  1ZBK A;  1L1P A;  4GGQ A;  3KAF A;  4LAW A;  1OWQ A;  5DO2 A;  1ZB5 A;  1J4I A;  2MLZ A;  1FKS A;  4L72 B;  1O6I A;  3ARV A;  3I6C A;  1FKR A;  3OA5 A;  4ZPW R;  1E9L A;  3TC5 A;  2RUR A;  2MF9 A;  2AOS A;  3QOK A;  3ARX A;  1SYT A;  1Q6U A;  1VF8 A;  1LG1 A;  3CHF A;  3UF8 A;  1X6N A;  1H0I A;  4JYS A;  1FKL A;  3B9E A;  4P8U A;  4KR0 B;  1FKT A;  2DSV A;  3O5K A;  2L2S A;  2LKN A;  3CHC A;  1BL4 A;  4JFK A;  2XPB A;  1ZBW A;  4QZV B;  1FKK A;  3B9D A;  3PR9 A;  1EQ3 A;  1GRJ A;  4PTM A;  4MGV A;  1FAP A;  5DF0 A;  5HT1 A;  2MPH A;  2G8Z A;  2ZR6 A;  5J6E A;  5B8I C;  3BMB A;  4U86 A;  1TFV A;  2YBU A;  1FD9 A;  1C9H A;  1JNE A;  4ODK A;  2LJ4 A;  5HW8 A;  1NWU A;  4AY1 A;  4NZC A;  2Y78 A;  3UI5 A;  2XP6 A;  1PIN A;  3RM4 A;  3IHZ A;  1XHG A;  1NMW A;  5DEZ A;  2DT3 A;  2PPN A;  2LPV A;  2JZV A;  3O5I A;  1EIB A;  1HJV A;  4DRI A;  1RD6 A;  1ZK6 A;  3ARU A;  3CHD A;  4LGX A;  3KCE A;  2WLY A;  4DRN A;  3WIJ A;  1ZCN A;  4J4O A;  4DWS D;  1GUV A;  1GPF A;  2F2D A;  3H9R B;  1LG2 A;  5HKG A;  3WQW A;  1OGB A;  1Y0O A;  2PV1 A;  3RME A;  3MDY B;  1XRV A;  3CH9 A;  2XP7 A;  3RM9 A;  4L3N A;  3ARQ A;  5BXJ A;  2KI3 A;  3KAI A;  4LAX A;  3RGC A;  1J4H A;  2DT1 A;  4ML4 A;  1FJD A;  5DIT A;  4G2P A;  2MNT A;  5HBF A;  5JH8 A;  1UR9 A;  2PV2 A;  4HBE A;  2B5U B;  1NWS A;  4DRK A;  4ODR A;  4DRJ A;  4JFL A;  3WQV A;  4DWS A;  1W1Y A;  3EIP A;  4P8W A;  3KAB A;  3G6M A;  4DRQ A;  2ZQS A;  4Z2K A;  2A3B A;  1B6C A;  1FKI A;  1CTN A;  4QT2 A;  2DSW A;  1N1A A;  3IK8 A;  1HKK A;  2DT2 A;  3G6L A;  3UQB A;  1HKI A;  1YW5 A;  4JFI A;  2D9F A;  1H0G A;  2B31 A;  1ZBC A;  5I98 A;  4W9O A;  3KAH A;  2DSZ A;  2KGJ A;  1W1P A;  1A7X A;  1JVW A;  2RSE A;  4S3K A;  2XP9 A;  2PPO A;  1SR0 A;  2PV3 A;  4P8X A;  3WD3 A;  2K8I A;  4GIV A;  3ARZ A;  3IKG A;  4ODM A;  3WL0 A;  5HUA A;  4Q7N A;  3B9A A;  2F4E A;  3FY1 A;  1W9U A;  3IKD A;  1W9P A;  2N87 A;  1GOI A;  4G50 A;  4DZ2 A;  3WD1 A;  3NTP A;  1W9V A;  1W26 A;  3O5R A;  4DRM A;  3VAW A;  2KE0 A;  4TW8 A;  4O2T A;  1T11 A;  1E6Z A;  3AQU A;  1J6Y A;  2RUD A;  3JYJ A;  4R0X A;  4WKF A;  1W1T A;  1D7I A;  4TNS A;  2M1I A;  1EYM A;  5GQB A;  1ITX A;  1K9T A;  3KZ7 A;  2O92 A;  3EY6 A;  2WLZ A;  2WK2 A;  3KAG A;  4WKH A;  1D7J A;  1PBK A;  1ROU A;  3TDB A;  1NWR A;  4NSB A;  1LL6 A;  1FKD A;  4DH0 A;  3JXV A;  2ESC A;  4LAV A;  3WL1 A;  4FAP A;  3B8S A;  2PBC A;  1WAW A;  1FKJ A;  1E15 A;  4ODQ A;  2O9O A;  2RUC A;  1D7H A;  1QPL A;  3ARO A;  1KT0 A;  2P4V A;  4IQ2 A;  4IT4 A;  1U79 A;  1FFR A;  3JYM A;  3OOB A;  3KAD A;  4ODO A;  4MSP A;  4KQZ A;  4WJX A;  4TX0 A;  2YBT A;  3ARS A;  1P5Q A;  4JFJ A;  3CZ8 A;  4J4N A;  4MNL A;  2PN0 A;  3LUO A;  2OFN A;  4QIB A;  3B7X A;  1HKJ A;  3O5J A;  3AS3 A;  1JND A;  3FXY A;  1R9H A;  3GPK A;  3AS1 A;  4ZPT R;  4IPX A;  3GTY X;  2XP4 A;  4Z2J A;  2XP8 A;  2DG3 A;  4MNJ A;  4Z2G A;  3PRA A;  4LAY A;  1ZL1 A;  2A3C A;  3O5M A;  2KR7 A;  1IX5 A;  2MLY A;  1ZBV A;  4U85 A;  2VN1 A;  1E6R A;  4TW6 A;  4XAK A;  1TCO C;  1Q6H A;  4ODL A;  1HXV A;  1FFQ A;  4DRH A;  1WNO A;  3AS0 A;  4N19 A;  1F8A B;  5GPR A;  4MPK A;  5HWC A;  1QZ2 A;  3ODK A;  1HKM A;  4C02 B;  3NRK A;  1NH6 A;  2DG4 A;  1HJX A;  4UDM A;  1HJW A;  2PPP A;  1JCH B;  4TYO A;  3BXW A;  1J4R A;  2AWG A;  2KFW A;  3PRB A;  4IQC A;  2F23 A;  4ZS6 A;  3RM8 A;  3ALG A;  3O5D A;  4HBO A;  1QPF A;  3FAP A;  4DZ3 A;  3WKZ A;  1FKF A;  4W9Q A;  1YAT A;  2ZQT A;  4MNK A;  3W4R A;  2ZR5 A;  4Z2L A;  1ROT A;  4WKA A;  5HWB A;  2VCD A;  3ALF A;  4IT6 A;  2XP5 A;  3ARR A;  2XP3 A;  3UI4 A;  3KAC A;  4MNM A;  4JFM A;  4WK9 A;  3O5L A;  4Z2H A;  1UR8 A;  2FDM A;  1LJY A;  3O5P A;  3GU0 A;  4P8V A;  2ZR4 A;  3WD0 A;  2OLH A;  4HAR A;  1EHN A;  2DT0 A;  3PRD A;  3O5O A;  1NSG A;  2FAP A;  1LL7 A;  4URI A;  1E44 A;  4MTV A;  4BF8 A;  2FKE A;  2KO7 A;  1KFW A;  3CGN A;  5D75 A;  3WH0 A;  3NI6 A;  3UQI A;  4W9P A;  4MAV A;  5GPG A;  4R5E A;  3O5Q A;  1EDQ A;  1D2K A;  2IUZ A;  2A3A A;  2WM0 A;  2F21 A;  2IF4 A;  4W5U A;  1E6N A;  3PA7 A;  1OGG A;  3ART A;  1KT1 A;  4DRP A;  1ZU8 A;  1M5Y A;  2EUL A;  3ARW A;  2DSU A;  1F40 A;  4S3J A;  1LQ0 A;  4DIP A;  1W1V A;  4DWS B;  3ARP A;  4Q22 A;  2A3E A;  5DIU A;  2PI6 A;  4ZPV R;  2QF8 A;  1NMV A;  3TCZ A;  1WB0 A; 
#chains in the Genus database with same CATH homology
 4TW7 A;  1D6O A;  3RFW A;  4U84 A;  4DT4 A;  1LL4 A;  4WIW A;  4Z2I A;  2ZQU A;  3ARY A;  2RUQ A;  4DWS C;  2MLX A;  2DG9 A;  1X6L A;  2ZQV A;  3WD2 A;  3CHE A;  4QT3 A;  4ITZ A;  5HTG A;  4FN2 A;  4NNR A;  3AS2 A;  1E6P A;  2M08 A;  2LGO A;  3CGM A;  3UQA A;  5HW7 A;  2DPE A;  2G41 A;  1NWT A;  5HW6 A;  4ODN A;  1JNT A;  2M2A A;  2XPA A;  1FKH A;  1Q1C A;  2RQS A;  2UZ5 A;  4DRO A;  1FKB A;  3O5F A;  3O5G A;  1JNS A;  2ITK A;  3UI6 A;  2Q5A A;  1FKG A;  1Q6I A;  5DIV A;  3WD4 A;  4ODP A;  3O5E A;  1BKF A;  1ZBK A;  1L1P A;  4GGQ A;  3KAF A;  4LAW A;  1OWQ A;  5DO2 A;  1ZB5 A;  1J4I A;  2MLZ A;  1FKS A;  4L72 B;  1O6I A;  3ARV A;  3I6C A;  1FKR A;  3OA5 A;  4ZPW R;  1E9L A;  3TC5 A;  2RUR A;  2MF9 A;  2AOS A;  3QOK A;  3ARX A;  1SYT A;  1Q6U A;  1VF8 A;  1LG1 A;  3CHF A;  3UF8 A;  1X6N A;  1H0I A;  4JYS A;  1FKL A;  3B9E A;  4P8U A;  4KR0 B;  1FKT A;  2DSV A;  3O5K A;  2L2S A;  2LKN A;  3CHC A;  1BL4 A;  4JFK A;  2XPB A;  1ZBW A;  4QZV B;  1FKK A;  3B9D A;  3PR9 A;  1EQ3 A;  4PTM A;  4MGV A;  1FAP A;  5DF0 A;  5HT1 A;  2MPH A;  2G8Z A;  2ZR6 A;  5J6E A;  5B8I C;  4U86 A;  1TFV A;  2YBU A;  1FD9 A;  1C9H A;  1JNE A;  4ODK A;  2LJ4 A;  5HW8 A;  1NWU A;  4AY1 A;  4NZC A;  2Y78 A;  3UI5 A;  2XP6 A;  1PIN A;  3RM4 A;  3IHZ A;  1XHG A;  1NMW A;  5DEZ A;  2DT3 A;  2PPN A;  2LPV A;  2JZV A;  3O5I A;  1EIB A;  1HJV A;  4DRI A;  1RD6 A;  1ZK6 A;  3ARU A;  3CHD A;  4LGX A;  3KCE A;  2WLY A;  4DRN A;  3WIJ A;  1ZCN A;  4J4O A;  4DWS D;  1GUV A;  1GPF A;  2F2D A;  3H9R B;  1LG2 A;  5HKG A;  3WQW A;  1OGB A;  1Y0O A;  2PV1 A;  3RME A;  3MDY B;  1XRV A;  3CH9 A;  2XP7 A;  3RM9 A;  4L3N A;  3ARQ A;  5BXJ A;  2KI3 A;  3KAI A;  4LAX A;  3RGC A;  1J4H A;  2DT1 A;  4ML4 A;  1FJD A;  5DIT A;  4G2P A;  2MNT A;  5HBF A;  5JH8 A;  1UR9 A;  2PV2 A;  4HBE A;  1NWS A;  4DRK A;  4ODR A;  4DRJ A;  4JFL A;  3WQV A;  4DWS A;  1W1Y A;  4P8W A;  3KAB A;  3G6M A;  4DRQ A;  2ZQS A;  4Z2K A;  2A3B A;  1B6C A;  1FKI A;  1CTN A;  4QT2 A;  2DSW A;  1N1A A;  3IK8 A;  1HKK A;  2DT2 A;  3G6L A;  3UQB A;  1HKI A;  1YW5 A;  4JFI A;  2D9F A;  1H0G A;  2B31 A;  1ZBC A;  5I98 A;  4W9O A;  3KAH A;  2DSZ A;  2KGJ A;  1W1P A;  1A7X A;  1JVW A;  2RSE A;  4S3K A;  2XP9 A;  2PPO A;  1SR0 A;  2PV3 A;  4P8X A;  3WD3 A;  2K8I A;  4GIV A;  3ARZ A;  3IKG A;  4ODM A;  3WL0 A;  5HUA A;  4Q7N A;  3B9A A;  2F4E A;  3FY1 A;  1W9U A;  3IKD A;  1W9P A;  2N87 A;  1GOI A;  4G50 A;  4DZ2 A;  3WD1 A;  3NTP A;  1W9V A;  1W26 A;  3O5R A;  4DRM A;  3VAW A;  2KE0 A;  4TW8 A;  4O2T A;  1T11 A;  1E6Z A;  3AQU A;  1J6Y A;  2RUD A;  3JYJ A;  4R0X A;  4WKF A;  1W1T A;  1D7I A;  4TNS A;  2M1I A;  1EYM A;  5GQB A;  1ITX A;  1K9T A;  3KZ7 A;  2O92 A;  3EY6 A;  2WLZ A;  2WK2 A;  3KAG A;  4WKH A;  1D7J A;  1PBK A;  1ROU A;  3TDB A;  1NWR A;  4NSB A;  1LL6 A;  1FKD A;  4DH0 A;  3JXV A;  2ESC A;  4LAV A;  3WL1 A;  4FAP A;  3B8S A;  2PBC A;  1WAW A;  1FKJ A;  1E15 A;  4ODQ A;  2O9O A;  2RUC A;  1D7H A;  1QPL A;  3ARO A;  1KT0 A;  4IQ2 A;  4IT4 A;  1U79 A;  1FFR A;  3JYM A;  3OOB A;  3KAD A;  4ODO A;  4MSP A;  4KQZ A;  4WJX A;  4TX0 A;  2YBT A;  3ARS A;  1P5Q A;  4JFJ A;  3CZ8 A;  4J4N A;  4MNL A;  3LUO A;  2OFN A;  4QIB A;  3B7X A;  1HKJ A;  3O5J A;  3AS3 A;  1JND A;  3FXY A;  1R9H A;  3GPK A;  3AS1 A;  4ZPT R;  4IPX A;  2XP4 A;  4Z2J A;  2XP8 A;  2DG3 A;  4MNJ A;  4Z2G A;  3PRA A;  4LAY A;  1ZL1 A;  2A3C A;  3O5M A;  2KR7 A;  1IX5 A;  2MLY A;  1ZBV A;  4U85 A;  2VN1 A;  1E6R A;  4TW6 A;  4XAK A;  1TCO C;  1Q6H A;  4ODL A;  1HXV A;  1FFQ A;  4DRH A;  1WNO A;  3AS0 A;  4N19 A;  1F8A B;  5GPR A;  4MPK A;  5HWC A;  1QZ2 A;  3ODK A;  1HKM A;  4C02 B;  3NRK A;  1NH6 A;  2DG4 A;  1HJX A;  1HJW A;  2PPP A;  4TYO A;  3BXW A;  1J4R A;  2AWG A;  2KFW A;  3PRB A;  4IQC A;  4ZS6 A;  3RM8 A;  3ALG A;  3O5D A;  4HBO A;  1QPF A;  3FAP A;  4DZ3 A;  3WKZ A;  1FKF A;  4W9Q A;  1YAT A;  2ZQT A;  4MNK A;  3W4R A;  2ZR5 A;  4Z2L A;  1ROT A;  4WKA A;  5HWB A;  2VCD A;  3ALF A;  4IT6 A;  2XP5 A;  3ARR A;  2XP3 A;  3UI4 A;  3KAC A;  4MNM A;  4JFM A;  4WK9 A;  3O5L A;  4Z2H A;  1UR8 A;  2FDM A;  1LJY A;  3O5P A;  4P8V A;  2ZR4 A;  3WD0 A;  2OLH A;  4HAR A;  1EHN A;  2DT0 A;  3PRD A;  3O5O A;  1NSG A;  2FAP A;  1LL7 A;  4URI A;  4MTV A;  4BF8 A;  2FKE A;  2KO7 A;  1KFW A;  3CGN A;  5D75 A;  3WH0 A;  3NI6 A;  3UQI A;  4W9P A;  4MAV A;  5GPG A;  4R5E A;  3O5Q A;  1EDQ A;  1D2K A;  2IUZ A;  2A3A A;  2WM0 A;  2F21 A;  2IF4 A;  4W5U A;  1E6N A;  3PA7 A;  1OGG A;  3ART A;  1KT1 A;  4DRP A;  1ZU8 A;  1M5Y A;  1F40 A;  3ARW A;  2DSU A;  4S3J A;  1LQ0 A;  4DIP A;  1W1V A;  4DWS B;  3ARP A;  4Q22 A;  2A3E A;  5DIU A;  2PI6 A;  4ZPV R;  2QF8 A;  1NMV A;  3TCZ A;  1WB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...