3O5GA

Fk1 domain of fkbp51, crystal form i
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5gA00
2RUQA 3CGNA 1JVWA 3RFWA 2JZVA 5HKGA 1J4IA 2Y78A 4TYOA 4JFIA 4FAPA 1FKTA 1NMWA 2LKNA 3FAPA 1Q6IA 5HW6A 1QPLA 4FN2A 4DRJA 3O5IA 3O5QA 3KZ7A 2KE0A 3O5JA 4ODRA 5HT1A 2ZR5A 4DRHA 1FD9A 3IKGA 3JYJA 3UQBA 1FKIA 4QT3A 4ODLA 4ODNA 4DRMA 1ROUA 2DG4A 3LUOA 2XPBA 4TNSA 4ODPA 1FKFA 3EY6A 1Y0OA 2ZQVA 2K8IA 4IQCA 4MGVA 4ODKA 3TCZA 3B7XA 2LJ4A 4GIVA 1QZ2A 2ZR4A 3KAHA 3KAFA 2F4EA 1C9HA 2MLZA 2IF4A 3MDYB 2FAPA 4JFLA 4QT2A 4U85A 2RUDA 2L2SA 2XPAA 4ITZA 5HWBA 1R9HA 2F21A 4DZ3A 3NI6A 5I98A 1W26A 2KFWA 2DG3A 5DIUA 2XP9A 2KR7A 4TW8A 2MPHA 4DRIA 4DROA 4LAXA 5HWCA 3O5PA 4DRPA 5DIVA 1P5QA 1TCOC 3RGCA 2XP6A 2RUCA 4IPXA 2XP3A 3O5MA 1BKFA 1J4HA 1FKJA 1FKSA 1A7XA 4C02B 3UF8A 2PV3A 1PBKA 2PPPA 3H9RB 1FJDA 3O5FA 2ZR6A 4W9QA 4IQ2A 1J4RA 3KAGA 5HTGA 1F40A 4NNRA 2XP7A 3KADA 4G50A 1JNSA 4LAWA 4N19A 5J6EA 3UI4A 1ZCNA 1HXVA 2PBCA 2KGJA 2N87A 3IK8A 3UI5A 1FKHA 2D9FA 2XP5A 2LPVA 4QIBA 1D6OA 2LGOA 3PRBA 1L1PA 4BF8A 1FAPA 4ODQA 1D7HA 1B6CA 2F2DA 1D7IA 4JFKA 4U84A 3TC5A 1EQ3A 2M1IA 1FKKA 3O5LA 1ROTA 4DH0A 1JNTA 2MLYA 2PPOA 3OOBA 4JFMA 4J4NA 1FKLA 5DITA 2M2AA 3O5EA 2Q5AA 4DRKA 2AWGA 2FKEA 2XP4A 1N1AA 3VAWA 5BXJA 2ITKA 1YW5A 2KI3A 4U86A 2VN1A 1PINA 3GPKA 3O5RA 3KACA 3PRDA 4G2PA 1Q1CA 3KCEA 2RQSA 4LAYA 3WH0A 1KT1A 2MF9A 3JYMA 1F8AB 3PA7A 3KAIA 2PV2A 4ODMA 1FKBA 4W9OA 4O2TA 3UQIA 5B8IC 4R0XA 2DG9A 4ODOA 2PPNA 3ODKA 2M08A 2KO7A 3CGMA 3NTPA 5HW8A 3O5GA 4JFJA 4DRNA 2VCDA 5HUAA 1FKGA 3O5DA 3IHZA 1FKRA 4DT4A 4DZ2A 2OFNA 1EYMA 1BL4A 2MLXA 1Q6UA 4MSPA 5HW7A 3O5KA 4TX0A 1ZK6A 4J4OA 1T11A 3NRKA 2RURA 2XP8A 4GGQA 4DRQA 1U79A 3JXVA 1FKDA 4LAVA 1NSGA 1Q6HA 2ZQSA 3I6CA 5D75A 4TW7A 3UI6A 2RSEA 4TW6A 2ZQTA 1NMVA 3IKDA 1KT0A 1YATA 1D7JA 3KABA 5GPGA 2MNTA 2UZ5A 3UQAA 3TDBA 3O5OA 1M5YA 4W9PA 4DIPA 1QPFA 1J6YA 2ZQUA 2PV1A 4JYSA
chains in the Genus database with same CATH superfamily
3RFWA 1J4IA 1HKJA 4FAPA 1NMWA 4KR0B 2A3AA 3PRAA 3ALGA 4DRJA 3ARRA 2KE0A 2P4VA 4ZPVR 5HT1A 1HJXA 1LG2A 1SYTA 3JYJA 4ODNA 1D2KA 1W9UA 3PR9A 3LUOA 3EY6A 1GRJA 2K8IA 4MGVA 2LJ4A 1NWRA 4JFLA 1C9HA 2IF4A 4ITZA 4WK9A 2F21A 3NI6A 1OGBA 2XP9A 2KR7A 4TW8A 1XRVA 2MPHA 1ZB5A 4DRIA 1W1PA 3ARXA 3WL0A 4ML4A 4DWSA 4IPXA 3RM9A 1FKJA 1FKSA 3UF8A 5GPRA 4LGXA 3O5FA 2ZR6A 4W9QA 1J4RA 3KAGA 4P8XA 5HTGA 4Z2KA 5J6EA 3UI5A 2DSUA 2XP5A 2LPVA 4Q22A 2LGOA 1D7HA 4U84A 4NSBA 1EQ3A 1ZBKA 1KFWA 3AS0A 1LL4A 2MLYA 3ARSA 4ZPWR 4XAKA 5JH8A 4U86A 1OWQA 4WIWA 3PRDA 4G2PA 2WLYA 2MF9A 4P8WA 2PI6A 3KAIA 4NZCA 3UQIA 1FKBA 5B8IC 4Z2HA 3ARWA 2M08A 2KO7A 3NTPA 3O5GA 2VCDA 3IHZA 4DT4A 2A3CA 1T11A 4MNJA 4Q7NA 1H0GA 4LAVA 1NSGA 2IUZA 4TW6A 2ZQTA 3IKDA 1D7JA 1UR8A 4P8UA 3WD3A 5DEZA 3TDBA 3O5OA 1NH6A 3CZ8A 4DIPA 1WNOA 2RQSA 1QPFA 4LAYA 3ARPA 1WAWA 4JYSA 2DT1A 2WM0A 3CGNA 1JVWA 2Y78A 2LKNA 3FAPA 1Q6IA 5HW6A 4FN2A 4R5EA 3O5IA 3ARZA 4P8VA 3O5JA 4ODRA 2ZR5A 3AS2A 1HJVA 3WKZA 4IQCA 4S3KA 2ZR4A 2F4EA 2MLZA 3BXWA 4MNMA 2XPAA 1JCHB 4Z2IA 3ARYA 4DZ3A 1EIBA 4DROA 1ZBCA 4LAXA 1X6NA 1UR9A 3WQWA 4DRPA 3G6LA 1P5QA 1TCOC 3RGCA 4IT6A 2XP6A 2RUCA 2XP3A 1BKFA 1A7XA 4URIA 2PV3A 4IQ2A 2DT0A 1LL6A 1F40A 4NNRA 3GTYX 4G50A 1ZCNA 1OGGA 2KGJA 3ARUA 2N87A 3ARVA 3G6MA 1L1PA 3PRBA 4BF8A 2F2DA 3TC5A 1D7IA 1ZBVA 4ZPTR 1ROTA 2G41A 3WL1A 4Z2GA 4J4NA 1FKLA 5DITA 2Q5AA 5GQBA 1FFQA 2XP4A 3RM4A 1NWTA 2DSZA 3GPKA 3KACA 3WH0A 4Z2LA 3JYMA 1F8AB 4IT4A 1ZU8A 5DO2A 3B8SA 4R0XA 3QOKA 2DG9A 4MTVA 1W9VA 3WIJA 4DWSD 4L3NA 2WLZA 5HUAA 4DRNA 1FKGA 1EYMA 4HARA 1GPFA 4TX0A 1ZK6A 4J4OA 4WKFA 1GOIA 4DRQA 1ITXA 4DWSC 1U79A 2QF8A 1LL7A 1Q6HA 3I6CA 3W4RA 4TW7A 3UI6A 3OA5A 2UZ5A 1M5YA 4W9PA 1J6YA 2ZQUA 3WD2A 5HKGA 4TYOA 1FKTA 3B9AA 1X6LA 1QPLA 3O5QA 2PN0A 3IKGA 1ROUA 3AS1A 2DG4A 5DF0A 1E6NA 1VF8A 4ODPA 2FDMA 2ZQVA 4ODKA 1LJYA 3B7XA 4GIVA 3MDYB 3KAFA 3KAHA 4U85A 4QT2A 3ARQA 3GU0A 1R9HA 2DSWA 1HKIA 5I98A 1W26A 4MNKA 4WJXA 5DIUA 3WD4A 2O92A 3O5PA 5DIVA 1JNDA 3O5MA 1J4HA 4ZS6A 4C02B 1E9LA 3CHDA 3H9RB 1FJDA 1GUVA 2XP7A 3KADA 1JNSA 1E44A 1SR0A 4LAWA 4N19A 2F23A 1HXVA 2PBCA 1NWUA 5HBFA 1FKHA 2D9FA 3CHFA 4QIBA 1IX5A 1B6CA 3ALFA 1FFRA 1EDQA 2M1IA 1FKKA 4DH0A 1W1YA 1JNTA 1W1VA 2M2AA 4DRKA 2AWGA 2FKEA 3VAWA 1N1AA 3CHCA 3FY1A 5BXJA 3AQUA 2KI3A 1O6IA 2VN1A 4MPKA 3WD0A 1Q1CA 3KCEA 2PV2A 4ODMA 4S3JA 4O2TA 2B31A 1W1TA 2DT3A 4JFJA 1FKRA 1K9TA 1BL4A 1ZBWA 2MLXA 1Q6UA 4QZVB 5HW7A 4W5UA 3NRKA 4GGQA 1WB0A 2G8ZA 2XP8A 4L72B 2EULA 3JXVA 1NWSA 1FKDA 3RM8A 2ZQSA 5D75A 1HKMA 2RSEA 4HBOA 5GPGA 1YATA 2MNTA 1XHGA 2A3EA 2RUQA 2O9OA 2JZVA 4JFIA 4MNLA 2YBUA 4WKHA 3KZ7A 4DRHA 1E6RA 1FD9A 3UQBA 1FKIA 2WK2A 4ODLA 4QT3A 1ZL1A 4DRMA 3RMEA 2XPBA 4TNSA 1FKFA 1Y0OA 1LG1A 3TCZA 3ARTA 1QZ2A 2FAPA 1JNEA 2RUDA 2L2SA 5HWBA 3EIPA 2DPEA 3BMBA 2KFWA 2DG3A 1TFVA 3AROA 5HWCA 3B9EA 2AOSA 2ETNA 4HBEA 4UDMA 2YBTA 1PBKA 2PPPA 3UI4A 1CTNA 2A3BA 1RD6A 3IK8A 4WKAA 1D6OA 1FAPA 4ODQA 3AS3A 4JFKA 4Z2JA 1E6ZA 3O5LA 3B9DA 4AY1A 2PPOA 1E15A 3OOBA 3CHEA 3CH9A 4JFMA 4PTMA 3O5EA 2ITKA 1YW5A 1PINA 2ESCA 3O5RA 1KT1A 2OLHA 3PA7A 4W9OA 1HJWA 1HKKA 4ODOA 4KQZA 2PPNA 3ODKA 2DT2A 3WD1A 3CGMA 5HW8A 3O5DA 4MAVA 1LQ0A 4DZ2A 2OFNA 4MSPA 3O5KA 2RURA 1W9PA 3WQVA 4DWSB 2DSVA 2B5UB 1EHNA 1NMVA 3KABA 1KT0A 3UQAA 3FXYA 1E6PA 2PV1A 1H0IA
chains in the Genus database with same CATH topology
3RFWA 1J4IA 1HKJA 4FAPA 1NMWA 4KR0B 2A3AA 3PRAA 3ALGA 4DRJA 3ARRA 2KE0A 4ZPVR 5HT1A 1HJXA 1LG2A 1SYTA 3JYJA 4ODNA 1D2KA 1W9UA 3PR9A 3LUOA 3EY6A 2K8IA 4MGVA 2LJ4A 1NWRA 4JFLA 1C9HA 2IF4A 4ITZA 4WK9A 2F21A 3NI6A 1OGBA 2XP9A 2KR7A 4TW8A 1XRVA 2MPHA 1ZB5A 4DRIA 1W1PA 3ARXA 3WL0A 4ML4A 4DWSA 4IPXA 3RM9A 1FKJA 1FKSA 3UF8A 5GPRA 4LGXA 3O5FA 2ZR6A 4W9QA 1J4RA 3KAGA 4P8XA 5HTGA 4Z2KA 5J6EA 3UI5A 2DSUA 2XP5A 2LPVA 4Q22A 2LGOA 1D7HA 4U84A 4NSBA 1EQ3A 1ZBKA 1KFWA 3AS0A 1LL4A 2MLYA 3ARSA 4ZPWR 4XAKA 5JH8A 4U86A 1OWQA 4WIWA 3PRDA 4G2PA 2WLYA 2MF9A 4P8WA 2PI6A 3KAIA 4NZCA 3UQIA 1FKBA 5B8IC 4Z2HA 3ARWA 2M08A 2KO7A 3NTPA 3O5GA 2VCDA 3IHZA 4DT4A 2A3CA 1T11A 4MNJA 4Q7NA 1H0GA 4LAVA 1NSGA 2IUZA 4TW6A 2ZQTA 3IKDA 1D7JA 1UR8A 4P8UA 3WD3A 5DEZA 3TDBA 3O5OA 1NH6A 3CZ8A 4DIPA 1WNOA 2RQSA 1QPFA 4LAYA 3ARPA 1WAWA 4JYSA 2DT1A 2WM0A 3CGNA 1JVWA 2Y78A 2LKNA 3FAPA 1Q6IA 5HW6A 4FN2A 4R5EA 3O5IA 3ARZA 4P8VA 3O5JA 4ODRA 2ZR5A 3AS2A 1HJVA 3WKZA 4IQCA 4S3KA 2ZR4A 2F4EA 2MLZA 3BXWA 4MNMA 2XPAA 4Z2IA 3ARYA 4DZ3A 1EIBA 4DROA 1ZBCA 4LAXA 1X6NA 1UR9A 3WQWA 4DRPA 3G6LA 1P5QA 1TCOC 3RGCA 4IT6A 2XP6A 2RUCA 2XP3A 1BKFA 1A7XA 4URIA 2PV3A 4IQ2A 2DT0A 1LL6A 1F40A 4NNRA 4G50A 1ZCNA 1OGGA 2KGJA 3ARUA 2N87A 3ARVA 3G6MA 1L1PA 3PRBA 4BF8A 2F2DA 3TC5A 1D7IA 1ZBVA 4ZPTR 1ROTA 2G41A 3WL1A 4Z2GA 4J4NA 1FKLA 5DITA 2Q5AA 5GQBA 1FFQA 2XP4A 3RM4A 1NWTA 2DSZA 3GPKA 3KACA 3WH0A 4Z2LA 3JYMA 1F8AB 4IT4A 1ZU8A 5DO2A 3B8SA 4R0XA 3QOKA 2DG9A 4MTVA 1W9VA 3WIJA 4DWSD 4L3NA 2WLZA 5HUAA 4DRNA 1FKGA 1EYMA 4HARA 1GPFA 4TX0A 1ZK6A 4J4OA 4WKFA 1GOIA 4DRQA 1ITXA 4DWSC 1U79A 2QF8A 1LL7A 1Q6HA 3I6CA 3W4RA 4TW7A 3UI6A 3OA5A 2UZ5A 1M5YA 4W9PA 1J6YA 2ZQUA 3WD2A 5HKGA 4TYOA 1FKTA 3B9AA 1X6LA 1QPLA 3O5QA 3IKGA 1ROUA 3AS1A 2DG4A 5DF0A 1E6NA 1VF8A 4ODPA 2FDMA 2ZQVA 4ODKA 1LJYA 3B7XA 4GIVA 3MDYB 3KAFA 3KAHA 4U85A 4QT2A 3ARQA 1R9HA 2DSWA 1HKIA 5I98A 1W26A 4MNKA 4WJXA 5DIUA 3WD4A 2O92A 3O5PA 5DIVA 1JNDA 3O5MA 1J4HA 4ZS6A 4C02B 1E9LA 3CHDA 3H9RB 1FJDA 1GUVA 2XP7A 3KADA 1JNSA 1SR0A 4LAWA 4N19A 1HXVA 2PBCA 1NWUA 5HBFA 1FKHA 2D9FA 3CHFA 4QIBA 1IX5A 1B6CA 3ALFA 1FFRA 1EDQA 2M1IA 1FKKA 4DH0A 1W1YA 1JNTA 1W1VA 2M2AA 4DRKA 2AWGA 2FKEA 3VAWA 1N1AA 3CHCA 3FY1A 5BXJA 3AQUA 2KI3A 1O6IA 2VN1A 4MPKA 3WD0A 1Q1CA 3KCEA 2PV2A 4ODMA 4S3JA 4O2TA 2B31A 1W1TA 2DT3A 4JFJA 1FKRA 1K9TA 1BL4A 1ZBWA 2MLXA 1Q6UA 4QZVB 5HW7A 4W5UA 3NRKA 4GGQA 1WB0A 2G8ZA 2XP8A 4L72B 3JXVA 1NWSA 1FKDA 3RM8A 2ZQSA 5D75A 1HKMA 2RSEA 4HBOA 5GPGA 1YATA 2MNTA 1XHGA 2A3EA 2RUQA 2O9OA 2JZVA 4JFIA 4MNLA 2YBUA 4WKHA 3KZ7A 4DRHA 1E6RA 1FD9A 3UQBA 1FKIA 2WK2A 4ODLA 4QT3A 1ZL1A 4DRMA 3RMEA 2XPBA 4TNSA 1FKFA 1Y0OA 1LG1A 3TCZA 3ARTA 1QZ2A 2FAPA 1JNEA 2RUDA 2L2SA 5HWBA 2DPEA 2KFWA 2DG3A 1TFVA 3AROA 5HWCA 3B9EA 2AOSA 4HBEA 2YBTA 1PBKA 2PPPA 3UI4A 1CTNA 2A3BA 1RD6A 3IK8A 4WKAA 1D6OA 1FAPA 4ODQA 3AS3A 4JFKA 4Z2JA 1E6ZA 3O5LA 3B9DA 4AY1A 2PPOA 1E15A 3OOBA 3CHEA 3CH9A 4JFMA 4PTMA 3O5EA 2ITKA 1YW5A 1PINA 2ESCA 3O5RA 1KT1A 2OLHA 3PA7A 4W9OA 1HJWA 1HKKA 4ODOA 4KQZA 2PPNA 3ODKA 2DT2A 3WD1A 3CGMA 5HW8A 3O5DA 4MAVA 1LQ0A 4DZ2A 2OFNA 4MSPA 3O5KA 2RURA 1W9PA 3WQVA 4DWSB 2DSVA 1EHNA 1NMVA 3KABA 1KT0A 3UQAA 3FXYA 1E6PA 2PV1A 1H0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RUQ A;  3CGN A;  1JVW A;  3RFW A;  2JZV A;  5HKG A;  1J4I A;  2Y78 A;  4TYO A;  4JFI A;  4FAP A;  1FKT A;  1NMW A;  2LKN A;  3FAP A;  1Q6I A;  5HW6 A;  1QPL A;  4FN2 A;  4DRJ A;  3O5I A;  3O5Q A;  3KZ7 A;  2KE0 A;  3O5J A;  4ODR A;  5HT1 A;  2ZR5 A;  4DRH A;  1FD9 A;  3IKG A;  3JYJ A;  3UQB A;  1FKI A;  4QT3 A;  4ODL A;  4ODN A;  4DRM A;  1ROU A;  2DG4 A;  3LUO A;  2XPB A;  4TNS A;  4ODP A;  1FKF A;  3EY6 A;  1Y0O A;  2ZQV A;  2K8I A;  4IQC A;  4MGV A;  4ODK A;  3TCZ A;  3B7X A;  2LJ4 A;  4GIV A;  1QZ2 A;  2ZR4 A;  3KAH A;  3KAF A;  2F4E A;  1C9H A;  2MLZ A;  2IF4 A;  3MDY B;  2FAP A;  4JFL A;  4QT2 A;  4U85 A;  2RUD A;  2L2S A;  2XPA A;  4ITZ A;  5HWB A;  1R9H A;  2F21 A;  4DZ3 A;  3NI6 A;  5I98 A;  1W26 A;  2KFW A;  2DG3 A;  5DIU A;  2XP9 A;  2KR7 A;  4TW8 A;  2MPH A;  4DRI A;  4DRO A;  4LAX A;  5HWC A;  3O5P A;  4DRP A;  5DIV A;  1P5Q A;  1TCO C;  3RGC A;  2XP6 A;  2RUC A;  4IPX A;  2XP3 A;  3O5M A;  1BKF A;  1J4H A;  1FKJ A;  1FKS A;  1A7X A;  4C02 B;  3UF8 A;  2PV3 A;  1PBK A;  2PPP A;  3H9R B;  1FJD A;  3O5F A;  2ZR6 A;  4W9Q A;  4IQ2 A;  1J4R A;  3KAG A;  5HTG A;  1F40 A;  4NNR A;  2XP7 A;  3KAD A;  4G50 A;  1JNS A;  4LAW A;  4N19 A;  5J6E A;  3UI4 A;  1ZCN A;  1HXV A;  2PBC A;  2KGJ A;  2N87 A;  3IK8 A;  3UI5 A;  1FKH A;  2D9F A;  2XP5 A;  2LPV A;  4QIB A;  1D6O A;  2LGO A;  3PRB A;  1L1P A;  4BF8 A;  1FAP A;  4ODQ A;  1D7H A;  1B6C A;  2F2D A;  1D7I A;  4JFK A;  4U84 A;  3TC5 A;  1EQ3 A;  2M1I A;  1FKK A;  3O5L A;  1ROT A;  4DH0 A;  1JNT A;  2MLY A;  2PPO A;  3OOB A;  4JFM A;  4J4N A;  1FKL A;  5DIT A;  2M2A A;  3O5E A;  2Q5A A;  4DRK A;  2AWG A;  2FKE A;  2XP4 A;  1N1A A;  3VAW A;  5BXJ A;  2ITK A;  1YW5 A;  2KI3 A;  4U86 A;  2VN1 A;  1PIN A;  3GPK A;  3O5R A;  3KAC A;  3PRD A;  4G2P A;  1Q1C A;  3KCE A;  2RQS A;  4LAY A;  3WH0 A;  1KT1 A;  2MF9 A;  3JYM A;  1F8A B;  3PA7 A;  3KAI A;  2PV2 A;  4ODM A;  1FKB A;  4W9O A;  4O2T A;  3UQI A;  5B8I C;  4R0X A;  2DG9 A;  4ODO A;  2PPN A;  3ODK A;  2M08 A;  2KO7 A;  3CGM A;  3NTP A;  5HW8 A;  3O5G A;  4JFJ A;  4DRN A;  2VCD A;  5HUA A;  1FKG A;  3O5D A;  3IHZ A;  1FKR A;  4DT4 A;  4DZ2 A;  2OFN A;  1EYM A;  1BL4 A;  2MLX A;  1Q6U A;  4MSP A;  5HW7 A;  3O5K A;  4TX0 A;  1ZK6 A;  4J4O A;  1T11 A;  3NRK A;  2RUR A;  2XP8 A;  4GGQ A;  4DRQ A;  1U79 A;  3JXV A;  1FKD A;  4LAV A;  1NSG A;  1Q6H A;  2ZQS A;  3I6C A;  5D75 A;  4TW7 A;  3UI6 A;  2RSE A;  4TW6 A;  2ZQT A;  1NMV A;  3IKD A;  1KT0 A;  1YAT A;  1D7J A;  3KAB A;  5GPG A;  2MNT A;  2UZ5 A;  3UQA A;  3TDB A;  3O5O A;  1M5Y A;  4W9P A;  4DIP A;  1QPF A;  1J6Y A;  2ZQU A;  2PV1 A;  4JYS A; 
#chains in the Genus database with same CATH topology
 3RFW A;  1J4I A;  1HKJ A;  4FAP A;  1NMW A;  4KR0 B;  2A3A A;  3PRA A;  3ALG A;  4DRJ A;  3ARR A;  2KE0 A;  2P4V A;  4ZPV R;  5HT1 A;  1HJX A;  1LG2 A;  1SYT A;  3JYJ A;  4ODN A;  1D2K A;  1W9U A;  3PR9 A;  3LUO A;  3EY6 A;  1GRJ A;  2K8I A;  4MGV A;  2LJ4 A;  1NWR A;  4JFL A;  1C9H A;  2IF4 A;  4ITZ A;  4WK9 A;  2F21 A;  3NI6 A;  1OGB A;  2XP9 A;  2KR7 A;  4TW8 A;  1XRV A;  2MPH A;  1ZB5 A;  4DRI A;  1W1P A;  3ARX A;  3WL0 A;  4ML4 A;  4DWS A;  4IPX A;  3RM9 A;  1FKJ A;  1FKS A;  3UF8 A;  5GPR A;  4LGX A;  3O5F A;  2ZR6 A;  4W9Q A;  1J4R A;  3KAG A;  4P8X A;  5HTG A;  4Z2K A;  5J6E A;  3UI5 A;  2DSU A;  2XP5 A;  2LPV A;  4Q22 A;  2LGO A;  1D7H A;  4U84 A;  4NSB A;  1EQ3 A;  1ZBK A;  1KFW A;  3AS0 A;  1LL4 A;  2MLY A;  3ARS A;  4ZPW R;  4XAK A;  5JH8 A;  4U86 A;  1OWQ A;  4WIW A;  3PRD A;  4G2P A;  2WLY A;  2MF9 A;  4P8W A;  2PI6 A;  3KAI A;  4NZC A;  3UQI A;  1FKB A;  5B8I C;  4Z2H A;  3ARW A;  2M08 A;  2KO7 A;  3NTP A;  3O5G A;  2VCD A;  3IHZ A;  4DT4 A;  2A3C A;  1T11 A;  4MNJ A;  4Q7N A;  1H0G A;  4LAV A;  1NSG A;  2IUZ A;  4TW6 A;  2ZQT A;  3IKD A;  1D7J A;  1UR8 A;  4P8U A;  3WD3 A;  5DEZ A;  3TDB A;  3O5O A;  1NH6 A;  3CZ8 A;  4DIP A;  1WNO A;  2RQS A;  1QPF A;  4LAY A;  3ARP A;  1WAW A;  4JYS A;  2DT1 A;  2WM0 A;  3CGN A;  1JVW A;  2Y78 A;  2LKN A;  3FAP A;  1Q6I A;  5HW6 A;  4FN2 A;  4R5E A;  3O5I A;  3ARZ A;  4P8V A;  3O5J A;  4ODR A;  2ZR5 A;  3AS2 A;  1HJV A;  3WKZ A;  4IQC A;  4S3K A;  2ZR4 A;  2F4E A;  2MLZ A;  3BXW A;  4MNM A;  2XPA A;  1JCH B;  4Z2I A;  3ARY A;  4DZ3 A;  1EIB A;  4DRO A;  1ZBC A;  4LAX A;  1X6N A;  1UR9 A;  3WQW A;  4DRP A;  3G6L A;  1P5Q A;  1TCO C;  3RGC A;  4IT6 A;  2XP6 A;  2RUC A;  2XP3 A;  1BKF A;  1A7X A;  4URI A;  2PV3 A;  4IQ2 A;  2DT0 A;  1LL6 A;  1F40 A;  4NNR A;  3GTY X;  4G50 A;  1ZCN A;  1OGG A;  2KGJ A;  3ARU A;  2N87 A;  3ARV A;  3G6M A;  1L1P A;  3PRB A;  4BF8 A;  2F2D A;  3TC5 A;  1D7I A;  1ZBV A;  4ZPT R;  1ROT A;  2G41 A;  3WL1 A;  4Z2G A;  4J4N A;  1FKL A;  5DIT A;  2Q5A A;  5GQB A;  1FFQ A;  2XP4 A;  3RM4 A;  1NWT A;  2DSZ A;  3GPK A;  3KAC A;  3WH0 A;  4Z2L A;  3JYM A;  1F8A B;  4IT4 A;  1ZU8 A;  5DO2 A;  3B8S A;  4R0X A;  3QOK A;  2DG9 A;  4MTV A;  1W9V A;  3WIJ A;  4DWS D;  4L3N A;  2WLZ A;  5HUA A;  4DRN A;  1FKG A;  1EYM A;  4HAR A;  1GPF A;  4TX0 A;  1ZK6 A;  4J4O A;  4WKF A;  1GOI A;  4DRQ A;  1ITX A;  4DWS C;  1U79 A;  2QF8 A;  1LL7 A;  1Q6H A;  3I6C A;  3W4R A;  4TW7 A;  3UI6 A;  3OA5 A;  2UZ5 A;  1M5Y A;  4W9P A;  1J6Y A;  2ZQU A;  3WD2 A;  5HKG A;  4TYO A;  1FKT A;  3B9A A;  1X6L A;  1QPL A;  3O5Q A;  2PN0 A;  3IKG A;  1ROU A;  3AS1 A;  2DG4 A;  5DF0 A;  1E6N A;  1VF8 A;  4ODP A;  2FDM A;  2ZQV A;  4ODK A;  1LJY A;  3B7X A;  4GIV A;  3MDY B;  3KAF A;  3KAH A;  4U85 A;  4QT2 A;  3ARQ A;  3GU0 A;  1R9H A;  2DSW A;  1HKI A;  5I98 A;  1W26 A;  4MNK A;  4WJX A;  5DIU A;  3WD4 A;  2O92 A;  3O5P A;  5DIV A;  1JND A;  3O5M A;  1J4H A;  4ZS6 A;  4C02 B;  1E9L A;  3CHD A;  3H9R B;  1FJD A;  1GUV A;  2XP7 A;  3KAD A;  1JNS A;  1E44 A;  1SR0 A;  4LAW A;  4N19 A;  2F23 A;  1HXV A;  2PBC A;  1NWU A;  5HBF A;  1FKH A;  2D9F A;  3CHF A;  4QIB A;  1IX5 A;  1B6C A;  3ALF A;  1FFR A;  1EDQ A;  2M1I A;  1FKK A;  4DH0 A;  1W1Y A;  1JNT A;  1W1V A;  2M2A A;  4DRK A;  2AWG A;  2FKE A;  3VAW A;  1N1A A;  3CHC A;  3FY1 A;  5BXJ A;  3AQU A;  2KI3 A;  1O6I A;  2VN1 A;  4MPK A;  3WD0 A;  1Q1C A;  3KCE A;  2PV2 A;  4ODM A;  4S3J A;  4O2T A;  2B31 A;  1W1T A;  2DT3 A;  4JFJ A;  1FKR A;  1K9T A;  1BL4 A;  1ZBW A;  2MLX A;  1Q6U A;  4QZV B;  5HW7 A;  4W5U A;  3NRK A;  4GGQ A;  1WB0 A;  2G8Z A;  2XP8 A;  4L72 B;  2EUL A;  3JXV A;  1NWS A;  1FKD A;  3RM8 A;  2ZQS A;  5D75 A;  1HKM A;  2RSE A;  4HBO A;  5GPG A;  1YAT A;  2MNT A;  1XHG A;  2A3E A;  2RUQ A;  2O9O A;  2JZV A;  4JFI A;  4MNL A;  2YBU A;  4WKH A;  3KZ7 A;  4DRH A;  1E6R A;  1FD9 A;  3UQB A;  1FKI A;  2WK2 A;  4ODL A;  4QT3 A;  1ZL1 A;  4DRM A;  3RME A;  2XPB A;  4TNS A;  1FKF A;  1Y0O A;  1LG1 A;  3TCZ A;  3ART A;  1QZ2 A;  2FAP A;  1JNE A;  2RUD A;  2L2S A;  5HWB A;  3EIP A;  2DPE A;  3BMB A;  2KFW A;  2DG3 A;  1TFV A;  3ARO A;  5HWC A;  3B9E A;  2AOS A;  2ETN A;  4HBE A;  4UDM A;  2YBT A;  1PBK A;  2PPP A;  3UI4 A;  1CTN A;  2A3B A;  1RD6 A;  3IK8 A;  4WKA A;  1D6O A;  1FAP A;  4ODQ A;  3AS3 A;  4JFK A;  4Z2J A;  1E6Z A;  3O5L A;  3B9D A;  4AY1 A;  2PPO A;  1E15 A;  3OOB A;  3CHE A;  3CH9 A;  4JFM A;  4PTM A;  3O5E A;  2ITK A;  1YW5 A;  1PIN A;  2ESC A;  3O5R A;  1KT1 A;  2OLH A;  3PA7 A;  4W9O A;  1HJW A;  1HKK A;  4ODO A;  4KQZ A;  2PPN A;  3ODK A;  2DT2 A;  3WD1 A;  3CGM A;  5HW8 A;  3O5D A;  4MAV A;  1LQ0 A;  4DZ2 A;  2OFN A;  4MSP A;  3O5K A;  2RUR A;  1W9P A;  3WQV A;  4DWS B;  2DSV A;  2B5U B;  1EHN A;  1NMV A;  3KAB A;  1KT0 A;  3UQA A;  3FXY A;  1E6P A;  2PV1 A;  1H0I A; 
#chains in the Genus database with same CATH homology
 3RFW A;  1J4I A;  1HKJ A;  4FAP A;  1NMW A;  4KR0 B;  2A3A A;  3PRA A;  3ALG A;  4DRJ A;  3ARR A;  2KE0 A;  4ZPV R;  5HT1 A;  1HJX A;  1LG2 A;  1SYT A;  3JYJ A;  4ODN A;  1D2K A;  1W9U A;  3PR9 A;  3LUO A;  3EY6 A;  2K8I A;  4MGV A;  2LJ4 A;  1NWR A;  4JFL A;  1C9H A;  2IF4 A;  4ITZ A;  4WK9 A;  2F21 A;  3NI6 A;  1OGB A;  2XP9 A;  2KR7 A;  4TW8 A;  1XRV A;  2MPH A;  1ZB5 A;  4DRI A;  1W1P A;  3ARX A;  3WL0 A;  4ML4 A;  4DWS A;  4IPX A;  3RM9 A;  1FKJ A;  1FKS A;  3UF8 A;  5GPR A;  4LGX A;  3O5F A;  2ZR6 A;  4W9Q A;  1J4R A;  3KAG A;  4P8X A;  5HTG A;  4Z2K A;  5J6E A;  3UI5 A;  2DSU A;  2XP5 A;  2LPV A;  4Q22 A;  2LGO A;  1D7H A;  4U84 A;  4NSB A;  1EQ3 A;  1ZBK A;  1KFW A;  3AS0 A;  1LL4 A;  2MLY A;  3ARS A;  4ZPW R;  4XAK A;  5JH8 A;  4U86 A;  1OWQ A;  4WIW A;  3PRD A;  4G2P A;  2WLY A;  2MF9 A;  4P8W A;  2PI6 A;  3KAI A;  4NZC A;  3UQI A;  1FKB A;  5B8I C;  4Z2H A;  3ARW A;  2M08 A;  2KO7 A;  3NTP A;  3O5G A;  2VCD A;  3IHZ A;  4DT4 A;  2A3C A;  1T11 A;  4MNJ A;  4Q7N A;  1H0G A;  4LAV A;  1NSG A;  2IUZ A;  4TW6 A;  2ZQT A;  3IKD A;  1D7J A;  1UR8 A;  4P8U A;  3WD3 A;  5DEZ A;  3TDB A;  3O5O A;  1NH6 A;  3CZ8 A;  4DIP A;  1WNO A;  2RQS A;  1QPF A;  4LAY A;  3ARP A;  1WAW A;  4JYS A;  2DT1 A;  2WM0 A;  3CGN A;  1JVW A;  2Y78 A;  2LKN A;  3FAP A;  1Q6I A;  5HW6 A;  4FN2 A;  4R5E A;  3O5I A;  3ARZ A;  4P8V A;  3O5J A;  4ODR A;  2ZR5 A;  3AS2 A;  1HJV A;  3WKZ A;  4IQC A;  4S3K A;  2ZR4 A;  2F4E A;  2MLZ A;  3BXW A;  4MNM A;  2XPA A;  4Z2I A;  3ARY A;  4DZ3 A;  1EIB A;  4DRO A;  1ZBC A;  4LAX A;  1X6N A;  1UR9 A;  3WQW A;  4DRP A;  3G6L A;  1P5Q A;  1TCO C;  3RGC A;  4IT6 A;  2XP6 A;  2RUC A;  2XP3 A;  1BKF A;  1A7X A;  4URI A;  2PV3 A;  4IQ2 A;  2DT0 A;  1LL6 A;  1F40 A;  4NNR A;  4G50 A;  1ZCN A;  1OGG A;  2KGJ A;  3ARU A;  2N87 A;  3ARV A;  3G6M A;  1L1P A;  3PRB A;  4BF8 A;  2F2D A;  3TC5 A;  1D7I A;  1ZBV A;  4ZPT R;  1ROT A;  2G41 A;  3WL1 A;  4Z2G A;  4J4N A;  1FKL A;  5DIT A;  2Q5A A;  5GQB A;  1FFQ A;  2XP4 A;  3RM4 A;  1NWT A;  2DSZ A;  3GPK A;  3KAC A;  3WH0 A;  4Z2L A;  3JYM A;  1F8A B;  4IT4 A;  1ZU8 A;  5DO2 A;  3B8S A;  4R0X A;  3QOK A;  2DG9 A;  4MTV A;  1W9V A;  3WIJ A;  4DWS D;  4L3N A;  2WLZ A;  5HUA A;  4DRN A;  1FKG A;  1EYM A;  4HAR A;  1GPF A;  4TX0 A;  1ZK6 A;  4J4O A;  4WKF A;  1GOI A;  4DRQ A;  1ITX A;  4DWS C;  1U79 A;  2QF8 A;  1LL7 A;  1Q6H A;  3I6C A;  3W4R A;  4TW7 A;  3UI6 A;  3OA5 A;  2UZ5 A;  1M5Y A;  4W9P A;  1J6Y A;  2ZQU A;  3WD2 A;  5HKG A;  4TYO A;  1FKT A;  3B9A A;  1X6L A;  1QPL A;  3O5Q A;  3IKG A;  1ROU A;  3AS1 A;  2DG4 A;  5DF0 A;  1E6N A;  1VF8 A;  4ODP A;  2FDM A;  2ZQV A;  4ODK A;  1LJY A;  3B7X A;  4GIV A;  3MDY B;  3KAF A;  3KAH A;  4U85 A;  4QT2 A;  3ARQ A;  1R9H A;  2DSW A;  1HKI A;  5I98 A;  1W26 A;  4MNK A;  4WJX A;  5DIU A;  3WD4 A;  2O92 A;  3O5P A;  5DIV A;  1JND A;  3O5M A;  1J4H A;  4ZS6 A;  4C02 B;  1E9L A;  3CHD A;  3H9R B;  1FJD A;  1GUV A;  2XP7 A;  3KAD A;  1JNS A;  1SR0 A;  4LAW A;  4N19 A;  1HXV A;  2PBC A;  1NWU A;  5HBF A;  1FKH A;  2D9F A;  3CHF A;  4QIB A;  1IX5 A;  1B6C A;  3ALF A;  1FFR A;  1EDQ A;  2M1I A;  1FKK A;  4DH0 A;  1W1Y A;  1JNT A;  1W1V A;  2M2A A;  4DRK A;  2AWG A;  2FKE A;  3VAW A;  1N1A A;  3CHC A;  3FY1 A;  5BXJ A;  3AQU A;  2KI3 A;  1O6I A;  2VN1 A;  4MPK A;  3WD0 A;  1Q1C A;  3KCE A;  2PV2 A;  4ODM A;  4S3J A;  4O2T A;  2B31 A;  1W1T A;  2DT3 A;  4JFJ A;  1FKR A;  1K9T A;  1BL4 A;  1ZBW A;  2MLX A;  1Q6U A;  4QZV B;  5HW7 A;  4W5U A;  3NRK A;  4GGQ A;  1WB0 A;  2G8Z A;  2XP8 A;  4L72 B;  3JXV A;  1NWS A;  1FKD A;  3RM8 A;  2ZQS A;  5D75 A;  1HKM A;  2RSE A;  4HBO A;  5GPG A;  1YAT A;  2MNT A;  1XHG A;  2A3E A;  2RUQ A;  2O9O A;  2JZV A;  4JFI A;  4MNL A;  2YBU A;  4WKH A;  3KZ7 A;  4DRH A;  1E6R A;  1FD9 A;  3UQB A;  1FKI A;  2WK2 A;  4ODL A;  4QT3 A;  1ZL1 A;  4DRM A;  3RME A;  2XPB A;  4TNS A;  1FKF A;  1Y0O A;  1LG1 A;  3TCZ A;  3ART A;  1QZ2 A;  2FAP A;  1JNE A;  2RUD A;  2L2S A;  5HWB A;  2DPE A;  2KFW A;  2DG3 A;  1TFV A;  3ARO A;  5HWC A;  3B9E A;  2AOS A;  4HBE A;  2YBT A;  1PBK A;  2PPP A;  3UI4 A;  1CTN A;  2A3B A;  1RD6 A;  3IK8 A;  4WKA A;  1D6O A;  1FAP A;  4ODQ A;  3AS3 A;  4JFK A;  4Z2J A;  1E6Z A;  3O5L A;  3B9D A;  4AY1 A;  2PPO A;  1E15 A;  3OOB A;  3CHE A;  3CH9 A;  4JFM A;  4PTM A;  3O5E A;  2ITK A;  1YW5 A;  1PIN A;  2ESC A;  3O5R A;  1KT1 A;  2OLH A;  3PA7 A;  4W9O A;  1HJW A;  1HKK A;  4ODO A;  4KQZ A;  2PPN A;  3ODK A;  2DT2 A;  3WD1 A;  3CGM A;  5HW8 A;  3O5D A;  4MAV A;  1LQ0 A;  4DZ2 A;  2OFN A;  4MSP A;  3O5K A;  2RUR A;  1W9P A;  3WQV A;  4DWS B;  2DSV A;  1EHN A;  1NMV A;  3KAB A;  1KT0 A;  3UQA A;  3FXY A;  1E6P A;  2PV1 A;  1H0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...