3O5GA

Fk1 domain of fkbp51, crystal form i
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5gA00
3WH0A 3NI6A 4BF8A 4DRNA 1BL4A 4LAYA 4TW6A 2ZR6A 3RFWA 1N1AA 3O5OA 3FAPA 2XP5A 1FAPA 5D75A 2L2SA 2PPOA 2KFWA 2PV3A 2XP8A 3NTPA 4TW7A 1FKSA 3KAHA 2ZQTA 1FKLA 1QZ2A 2RUCA 4QT3A 1EYMA 2KE0A 1J4IA 1QPLA 2XP7A 2F21A 4JFLA 2XPBA 3UQBA 2PPNA 3UI5A 4JFJA 1KT1A 1B6CA 5DIVA 4U84A 2VCDA 2IF4A 3O5RA 4J4NA 5HW7A 3I6CA 4W9QA 1T11A 2LPVA 4U86A 3KABA 1R9HA 3CGMA 4DIPA 4JFMA 4MGVA 1Q6IA 2UZ5A 4FN2A 4C02B 3KAGA 2Y78A 3O5IA 3TC5A 1FKIA 3O5MA 3O5EA 3O5JA 2M08A 4DROA 3KADA 2JZVA 2PBCA 1D7IA 3O5FA 2MNTA 1J6YA 2ITKA 3IHZA 4FAPA 1A7XA 1F40A 1YATA 2RQSA 1PBKA 3IKDA 1FKTA 2PV2A 5HT1A 1Q1CA 3JXVA 3IKGA 3KAIA 4N19A 5HW6A 1Y0OA 1ROTA 1P5QA 1ZCNA 2F2DA 4MSPA 2ZR5A 3KCEA 3OOBA 4G50A 5HW8A 3UQAA 1NMWA 1J4HA 5HUAA 5HWCA 3O5LA 4LAVA 1KT0A 4JFKA 4IQCA 4IQ2A 3PRBA 4TYOA 1FKHA 4DH0A 4DZ3A 2M2AA 3TCZA 4W9PA 2RUDA 4ODKA 2M1IA 4ITZA 1NSGA 2LGOA 4LAWA 4DRIA 1ZK6A 4ODPA 4ODQA 4QIBA 1PINA 4ODNA 1D6OA 3B7XA 1U79A 4W9OA 3PA7A 4GIVA 1Q6UA 4J4OA 5HTGA 2XP3A 5HKGA 2FKEA 3ODKA 4TW8A 3VAWA 4DRPA 5I98A 1FJDA 4DRHA 3O5DA 1FKRA 2MLYA 4ODOA 1EQ3A 3EY6A 2AWGA 1C9HA 5DITA 1FD9A 2DG4A 2KGJA 2XPAA 5BXJA 5J6EA 3JYMA 2MPHA 1J4RA 5GPGA 2FAPA 2ZQUA 3NRKA 4JYSA 4DRMA 4U85A 1BKFA 2MLZA 2ZQVA 3UQIA 4NNRA 3CGNA 2KO7A 4ODMA 4O2TA 2XP9A 1HXVA 1W26A 5HWBA 1JVWA 3H9RB 1JNSA 1F8AB 5B8IC 1YW5A 3UF8A 2XP4A 3MDYB 1D7JA 2KR7A 2LJ4A 1L1PA 4ODRA 1M5YA 2ZR4A 3GPKA 4QT2A 4DRJA 2PV1A 3UI6A 2Q5AA 3O5GA 2F4EA 4ODLA 1TCOC 4DRQA 2RSEA 1QPFA 2K8IA 4DT4A 2RUQA 1FKGA 2PPPA 2VN1A 1NMVA 3KAFA 3KZ7A 1FKDA 2DG3A 3O5PA 2LKNA 3LUOA 3PRDA 3RGCA 1D7HA 1FKJA 1JNTA 1Q6HA 2DG9A 2N87A 5DIUA 3TDBA 3IK8A 3KACA 4JFIA 3JYJA 4R0XA 4LAXA 3O5QA 4DRKA 3O5KA 4IPXA 3UI4A 2ZQSA 1FKFA 2MF9A 4G2PA 4GGQA 4TX0A 2XP6A 4TNSA 1FKKA 2D9FA 1ROUA 4DZ2A 2OFNA 2KI3A 2RURA 1FKBA 2MLXA
chains in the Genus database with same CATH superfamily
3NI6A 4DRNA 4TW6A 2ZR6A 1LQ0A 5D75A 4KR0B 2ESCA 1OGBA 3ARYA 4TW7A 3WD3A 2KE0A 2PPNA 2B31A 1KT1A 3ARUA 4JFJA 1NWRA 4U84A 2VCDA 5HW7A 4PTMA 1ZBKA 3PR9A 1LL4A 1SR0A 1WNOA 1FKIA 1EHNA 3O5JA 2M08A 3O5FA 5GQBA 3WD2A 1EDQA 3QOKA 1W1YA 4Z2IA 2PV2A 2DT1A 3IKGA 1Y0OA 1ROTA 1ZCNA 3CHEA 3KCEA 4P8UA 3ARXA 5HWCA 1KT0A 3WD4A 3AS1A 2P4VA 4R5EA 4TYOA 2A3CA 1W9UA 4MNLA 4LAWA 1PINA 4ODNA 3FY1A 1GRJA 1E6PA 1JNDA 3ODKA 3B8SA 4DRHA 1FKRA 1EQ3A 2AWGA 1C9HA 3JYMA 2MPHA 1JNEA 3UQIA 3CGNA 2KO7A 2A3AA 3FXYA 3H9RB 3B9DA 2XP4A 1D7JA 2OLHA 5JH8A 4ODRA 1M5YA 4DRJA 1X6NA 1E9LA 1FKGA 3O5PA 1NMVA 2DG3A 4Z2HA 3LUOA 3RGCA 3GU0A 1LL7A 2N87A 5HBFA 3IK8A 3JYJA 4QZVB 3O5QA 3EIPA 2XP6A 1JCHB 1ZBWA 2D9FA 1XHGA 4DZ2A 1H0GA 2YBUA 3WH0A 4LGXA 3ARZA 1N1AA 4L72B 1ZBCA 3O5OA 3FAPA 2PPOA 1HKIA 1FFRA 2KFWA 3ALGA 1W1VA 1GOIA 3NTPA 1QZ2A 4QT3A 4XAKA 1J4IA 1FFQA 4MNJA 1B6CA 5DIVA 3WQWA 3O5RA 4J4NA 4W9QA 4W5UA 3ARVA 4FN2A 4C02B 3O5IA 1W9VA 3O5EA 1NWSA 4DROA 3KADA 2PBCA 1D7IA 1J6YA 4FAPA 1YATA 1PBKA 3IKDA 3AQUA 4ZPWR 1P5QA 5HW8A 2ZR5A 1GUVA 1LG2A 1J4HA 3ARWA 5HUAA 1NWTA 4Z2LA 5DEZA 3RMEA 4IQCA 3PRBA 3TCZA 2A3EA 2O9OA 4WKAA 4HBEA 4ODKA 2M1IA 4DRIA 1ZK6A 4ODPA 1HKKA 3B7XA 1U79A 3AS3A 4GIVA 3BXWA 5HKGA 2FKEA 1HJXA 4TW8A 3VAWA 5I98A 3WL1A 2MLYA 4ODOA 5BXJA 2FAPA 4DRMA 4U85A 1E44A 2MLZA 4DWSC 4ODMA 3ARSA 1UR9A 4WKHA 1W26A 1JVWA 3G6LA 4S3JA 1F8AB 1JNSA 3UF8A 2LJ4A 1NWUA 3ARTA 3GPKA 4ZPTR 1LG1A 4IT6A 4ODLA 2F4EA 2RSEA 1QPFA 2K8IA 2VN1A 4S3KA 3RM8A 1FKDA 4Z2KA 2LKNA 3CHDA 3PRDA 4MPKA 4WKFA 1D7HA 1FKJA 5DIUA 1Q6HA 3B9EA 3ARQA 4LAXA 1HKMA 2QF8A 2A3BA 2PI6A 1FKFA 2MF9A 4GGQA 4TNSA 3WQVA 2OFNA 1GPFA 2XP5A 2MLXA 1HJVA 1OWQA 4BF8A 1BL4A 4LAYA 2DSWA 3AROA 2L2SA 3WKZA 4Z2JA 4DWSB 4NSBA 3KAHA 3CH9A 4WK9A 4ZS6A 1FKLA 1QPLA 2XP7A 4DWSA 4MTVA 3UQBA 3CZ8A 3OA5A 1T11A 2LPVA 4U86A 4DIPA 4MGVA 1Q6IA 2DT0A 2Y78A 3O5MA 4KQZA 2MNTA 4MNMA 3WIJA 4P8WA 1A7XA 1F40A 2WM0A 1Q1CA 1W1TA 3ALFA 2F2DA 3W4RA 2DSUA 3UQAA 4HARA 5DO2A 2F23A 4LAVA 3BMBA 4IQ2A 1SYTA 4DH0A 2M2AA 4Q7NA 2LGOA 3G6MA 4ODQA 4QIBA 2B5UB 3AS0A 2RURA 3PA7A 5HTGA 4DRPA 1FJDA 4P8VA 3O5DA 3EY6A 1ZBVA 2XPAA 1E15A 1VF8A 4MAVA 4P8XA 2G8ZA 4JYSA 2DT3A 1XRVA 1W1PA 1HXVA 2DPEA 1EIBA 4L3NA 4MNKA 1WB0A 3MDYB 1HKJA 3CHFA 2ZR4A 1CTNA 1TCOC 2G41A 4WIWA 4Q22A 2RUQA 3KZ7A 2DSZA 2AOSA 3RM4A 1D2KA 3TDBA 3KACA 3ARPA 2YBTA 2EULA 1ZU8A 2FDMA 3O5KA 2ZQSA 4UDMA 4TX0A 1IX5A 4ML4A 1O6IA 1ROUA 2KI3A 3ARRA 3RFWA 3WD1A 1FAPA 3RM9A 2WLZA 3CHCA 1ZB5A 2PV3A 2XP8A 1E6ZA 4WJXA 1FKSA 2ZQTA 2RUCA 1EYMA 2F21A 4JFLA 2DSVA 2XPBA 3UI5A 4DWSD 2IF4A 1K9TA 3I6CA 4ZPVR 1X6LA 1TFVA 1E6NA 1H0IA 3KABA 1R9HA 3CGMA 4JFMA 2UZ5A 1ITXA 3KAGA 3TC5A 2WK2A 2JZVA 2PN0A 3WD0A 1RD6A 2ITKA 3IHZA 2RQSA 1FKTA 5GPRA 5HT1A 3JXVA 3KAIA 4N19A 5HW6A 4Z2GA 4MSPA 4G50A 3OOBA 1NMWA 3AS2A 1WAWA 2IUZA 5DF0A 4JFKA 4URIA 1FKHA 4DZ3A 1LJYA 2WLYA 4W9PA 2RUDA 4ITZA 1NSGA 1D6OA 3GTYX 4W9OA 1E6RA 3B9AA 1Q6UA 4J4OA 2XP3A 1UR8A 3WL0A 5DITA 1FD9A 2DG4A 1NH6A 2KGJA 5J6EA 1KFWA 1J4RA 5GPGA 2ZQUA 3NRKA 1HJWA 1BKFA 2ZQVA 4NNRA 4O2TA 2XP9A 4NZCA 3PRAA 5HWBA 4AY1A 2DT2A 5B8IC 1YW5A 1ZL1A 2KR7A 1L1PA 4QT2A 2PV1A 4IT4A 3UI6A 2O92A 2ETNA 2Q5AA 3O5GA 4DRQA 4DT4A 1OGGA 2PPPA 3KAFA 1JNTA 2DG9A 4HBOA 4JFIA 4R0XA 4DRKA 4IPXA 3UI4A 4G2PA 1LL6A 1FKKA 3O5LA 1W9PA 1FKBA
chains in the Genus database with same CATH topology
3NI6A 4DRNA 4TW6A 2ZR6A 1LQ0A 5D75A 4KR0B 2ESCA 1OGBA 3ARYA 4TW7A 3WD3A 2KE0A 2PPNA 2B31A 1KT1A 3ARUA 4JFJA 1NWRA 4U84A 2VCDA 5HW7A 4PTMA 1ZBKA 3PR9A 1LL4A 1SR0A 1WNOA 1FKIA 1EHNA 3O5JA 2M08A 3O5FA 5GQBA 3WD2A 1EDQA 3QOKA 1W1YA 4Z2IA 2PV2A 2DT1A 3IKGA 1Y0OA 1ROTA 1ZCNA 3CHEA 3KCEA 4P8UA 3ARXA 5HWCA 1KT0A 3WD4A 3AS1A 4R5EA 4TYOA 2A3CA 1W9UA 4MNLA 4LAWA 1PINA 4ODNA 3FY1A 1E6PA 1JNDA 3ODKA 3B8SA 4DRHA 1FKRA 1EQ3A 2AWGA 1C9HA 3JYMA 2MPHA 1JNEA 3UQIA 3CGNA 2KO7A 2A3AA 3FXYA 3H9RB 3B9DA 2XP4A 1D7JA 2OLHA 5JH8A 4ODRA 1M5YA 4DRJA 1X6NA 1E9LA 1FKGA 3O5PA 1NMVA 2DG3A 4Z2HA 3LUOA 3RGCA 1LL7A 2N87A 5HBFA 3IK8A 3JYJA 4QZVB 3O5QA 2XP6A 1ZBWA 2D9FA 1XHGA 4DZ2A 1H0GA 2YBUA 3WH0A 4LGXA 3ARZA 1N1AA 4L72B 1ZBCA 3O5OA 3FAPA 2PPOA 1HKIA 1FFRA 2KFWA 3ALGA 1W1VA 1GOIA 3NTPA 1QZ2A 4QT3A 4XAKA 1J4IA 1FFQA 4MNJA 1B6CA 5DIVA 3WQWA 3O5RA 4J4NA 4W9QA 4W5UA 3ARVA 4FN2A 4C02B 3O5IA 1W9VA 3O5EA 1NWSA 4DROA 3KADA 2PBCA 1D7IA 1J6YA 4FAPA 1YATA 1PBKA 3IKDA 3AQUA 4ZPWR 1P5QA 5HW8A 2ZR5A 1GUVA 1LG2A 1J4HA 3ARWA 5HUAA 1NWTA 4Z2LA 5DEZA 3RMEA 4IQCA 3PRBA 3TCZA 2A3EA 2O9OA 4WKAA 4HBEA 4ODKA 2M1IA 4DRIA 1ZK6A 4ODPA 1HKKA 3B7XA 1U79A 3AS3A 4GIVA 3BXWA 5HKGA 2FKEA 1HJXA 4TW8A 3VAWA 5I98A 3WL1A 2MLYA 4ODOA 5BXJA 2FAPA 4DRMA 4U85A 2MLZA 4DWSC 4ODMA 3ARSA 1UR9A 4WKHA 1W26A 1JVWA 3G6LA 4S3JA 1F8AB 1JNSA 3UF8A 2LJ4A 1NWUA 3ARTA 3GPKA 4ZPTR 1LG1A 4IT6A 4ODLA 2F4EA 2RSEA 1QPFA 2K8IA 2VN1A 4S3KA 3RM8A 1FKDA 4Z2KA 2LKNA 3CHDA 3PRDA 4MPKA 4WKFA 1D7HA 1FKJA 5DIUA 1Q6HA 3B9EA 3ARQA 4LAXA 1HKMA 2QF8A 2A3BA 2PI6A 1FKFA 2MF9A 4GGQA 4TNSA 3WQVA 2OFNA 1GPFA 2XP5A 2MLXA 1HJVA 1OWQA 4BF8A 1BL4A 4LAYA 2DSWA 3AROA 2L2SA 3WKZA 4Z2JA 4DWSB 4NSBA 3KAHA 3CH9A 4WK9A 4ZS6A 1FKLA 1QPLA 2XP7A 4DWSA 4MTVA 3UQBA 3CZ8A 3OA5A 1T11A 2LPVA 4U86A 4DIPA 4MGVA 1Q6IA 2DT0A 2Y78A 3O5MA 4KQZA 2MNTA 4MNMA 3WIJA 4P8WA 1A7XA 1F40A 2WM0A 1Q1CA 1W1TA 3ALFA 2F2DA 3W4RA 2DSUA 3UQAA 4HARA 5DO2A 4LAVA 4IQ2A 1SYTA 4DH0A 2M2AA 4Q7NA 2LGOA 3G6MA 4ODQA 4QIBA 3AS0A 2RURA 3PA7A 5HTGA 4DRPA 1FJDA 4P8VA 3O5DA 3EY6A 1ZBVA 2XPAA 1E15A 1VF8A 4MAVA 4P8XA 2G8ZA 4JYSA 2DT3A 1XRVA 1W1PA 1HXVA 2DPEA 1EIBA 4L3NA 4MNKA 1WB0A 3MDYB 1HKJA 3CHFA 2ZR4A 1CTNA 1TCOC 2G41A 4WIWA 4Q22A 2RUQA 3KZ7A 2DSZA 2AOSA 3RM4A 1D2KA 3TDBA 3KACA 3ARPA 2YBTA 1ZU8A 2FDMA 3O5KA 2ZQSA 4TX0A 1IX5A 4ML4A 1O6IA 1ROUA 2KI3A 3ARRA 3RFWA 3WD1A 1FAPA 3RM9A 2WLZA 3CHCA 1ZB5A 2PV3A 2XP8A 1E6ZA 4WJXA 1FKSA 2ZQTA 2RUCA 1EYMA 2F21A 4JFLA 2DSVA 2XPBA 3UI5A 4DWSD 2IF4A 1K9TA 3I6CA 4ZPVR 1X6LA 1TFVA 1E6NA 1H0IA 3KABA 1R9HA 3CGMA 4JFMA 2UZ5A 1ITXA 3KAGA 3TC5A 2WK2A 2JZVA 3WD0A 1RD6A 2ITKA 3IHZA 2RQSA 1FKTA 5GPRA 5HT1A 3JXVA 3KAIA 4N19A 5HW6A 4Z2GA 4MSPA 4G50A 3OOBA 1NMWA 3AS2A 1WAWA 2IUZA 5DF0A 4JFKA 4URIA 1FKHA 4DZ3A 1LJYA 2WLYA 4W9PA 2RUDA 4ITZA 1NSGA 1D6OA 4W9OA 1E6RA 3B9AA 4J4OA 1Q6UA 2XP3A 1UR8A 3WL0A 5DITA 1FD9A 2DG4A 1NH6A 2KGJA 5J6EA 1KFWA 1J4RA 5GPGA 2ZQUA 3NRKA 1HJWA 1BKFA 2ZQVA 4NNRA 4O2TA 2XP9A 4NZCA 3PRAA 5HWBA 4AY1A 2DT2A 5B8IC 1YW5A 1ZL1A 2KR7A 1L1PA 4QT2A 4IT4A 2PV1A 3UI6A 2O92A 2Q5AA 3O5GA 4DRQA 4DT4A 1OGGA 2PPPA 3KAFA 1JNTA 2DG9A 4HBOA 4JFIA 4R0XA 4DRKA 4IPXA 3UI4A 4G2PA 1LL6A 1FKKA 3O5LA 1W9PA 1FKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WH0 A;  3NI6 A;  4BF8 A;  4DRN A;  1BL4 A;  4LAY A;  4TW6 A;  2ZR6 A;  3RFW A;  1N1A A;  3O5O A;  3FAP A;  2XP5 A;  1FAP A;  5D75 A;  2L2S A;  2PPO A;  2KFW A;  2PV3 A;  2XP8 A;  3NTP A;  4TW7 A;  1FKS A;  3KAH A;  2ZQT A;  1FKL A;  1QZ2 A;  2RUC A;  4QT3 A;  1EYM A;  2KE0 A;  1J4I A;  1QPL A;  2XP7 A;  2F21 A;  4JFL A;  2XPB A;  3UQB A;  2PPN A;  3UI5 A;  4JFJ A;  1KT1 A;  1B6C A;  5DIV A;  4U84 A;  2VCD A;  2IF4 A;  3O5R A;  4J4N A;  5HW7 A;  3I6C A;  4W9Q A;  1T11 A;  2LPV A;  4U86 A;  3KAB A;  1R9H A;  3CGM A;  4DIP A;  4JFM A;  4MGV A;  1Q6I A;  2UZ5 A;  4FN2 A;  4C02 B;  3KAG A;  2Y78 A;  3O5I A;  3TC5 A;  1FKI A;  3O5M A;  3O5E A;  3O5J A;  2M08 A;  4DRO A;  3KAD A;  2JZV A;  2PBC A;  1D7I A;  3O5F A;  2MNT A;  1J6Y A;  2ITK A;  3IHZ A;  4FAP A;  1A7X A;  1F40 A;  1YAT A;  2RQS A;  1PBK A;  3IKD A;  1FKT A;  2PV2 A;  5HT1 A;  1Q1C A;  3JXV A;  3IKG A;  3KAI A;  4N19 A;  5HW6 A;  1Y0O A;  1ROT A;  1P5Q A;  1ZCN A;  2F2D A;  4MSP A;  2ZR5 A;  3KCE A;  3OOB A;  4G50 A;  5HW8 A;  3UQA A;  1NMW A;  1J4H A;  5HUA A;  5HWC A;  3O5L A;  4LAV A;  1KT0 A;  4JFK A;  4IQC A;  4IQ2 A;  3PRB A;  4TYO A;  1FKH A;  4DH0 A;  4DZ3 A;  2M2A A;  3TCZ A;  4W9P A;  2RUD A;  4ODK A;  2M1I A;  4ITZ A;  1NSG A;  2LGO A;  4LAW A;  4DRI A;  1ZK6 A;  4ODP A;  4ODQ A;  4QIB A;  1PIN A;  4ODN A;  1D6O A;  3B7X A;  1U79 A;  4W9O A;  3PA7 A;  4GIV A;  1Q6U A;  4J4O A;  5HTG A;  2XP3 A;  5HKG A;  2FKE A;  3ODK A;  4TW8 A;  3VAW A;  4DRP A;  5I98 A;  1FJD A;  4DRH A;  3O5D A;  1FKR A;  2MLY A;  4ODO A;  1EQ3 A;  3EY6 A;  2AWG A;  1C9H A;  5DIT A;  1FD9 A;  2DG4 A;  2KGJ A;  2XPA A;  5BXJ A;  5J6E A;  3JYM A;  2MPH A;  1J4R A;  5GPG A;  2FAP A;  2ZQU A;  3NRK A;  4JYS A;  4DRM A;  4U85 A;  1BKF A;  2MLZ A;  2ZQV A;  3UQI A;  4NNR A;  3CGN A;  2KO7 A;  4ODM A;  4O2T A;  2XP9 A;  1HXV A;  1W26 A;  5HWB A;  1JVW A;  3H9R B;  1JNS A;  1F8A B;  5B8I C;  1YW5 A;  3UF8 A;  2XP4 A;  3MDY B;  1D7J A;  2KR7 A;  2LJ4 A;  1L1P A;  4ODR A;  1M5Y A;  2ZR4 A;  3GPK A;  4QT2 A;  4DRJ A;  2PV1 A;  3UI6 A;  2Q5A A;  3O5G A;  2F4E A;  4ODL A;  1TCO C;  4DRQ A;  2RSE A;  1QPF A;  2K8I A;  4DT4 A;  2RUQ A;  1FKG A;  2PPP A;  2VN1 A;  1NMV A;  3KAF A;  3KZ7 A;  1FKD A;  2DG3 A;  3O5P A;  2LKN A;  3LUO A;  3PRD A;  3RGC A;  1D7H A;  1FKJ A;  1JNT A;  1Q6H A;  2DG9 A;  2N87 A;  5DIU A;  3TDB A;  3IK8 A;  3KAC A;  4JFI A;  3JYJ A;  4R0X A;  4LAX A;  3O5Q A;  4DRK A;  3O5K A;  4IPX A;  3UI4 A;  2ZQS A;  1FKF A;  2MF9 A;  4G2P A;  4GGQ A;  4TX0 A;  2XP6 A;  4TNS A;  1FKK A;  2D9F A;  1ROU A;  4DZ2 A;  2OFN A;  2KI3 A;  2RUR A;  1FKB A;  2MLX A; 
#chains in the Genus database with same CATH topology
 3NI6 A;  4DRN A;  4TW6 A;  2ZR6 A;  1LQ0 A;  5D75 A;  4KR0 B;  2ESC A;  1OGB A;  3ARY A;  4TW7 A;  3WD3 A;  2KE0 A;  2PPN A;  2B31 A;  1KT1 A;  3ARU A;  4JFJ A;  1NWR A;  4U84 A;  2VCD A;  5HW7 A;  4PTM A;  1ZBK A;  3PR9 A;  1LL4 A;  1SR0 A;  1WNO A;  1FKI A;  1EHN A;  3O5J A;  2M08 A;  3O5F A;  5GQB A;  3WD2 A;  1EDQ A;  3QOK A;  1W1Y A;  4Z2I A;  2PV2 A;  2DT1 A;  3IKG A;  1Y0O A;  1ROT A;  1ZCN A;  3CHE A;  3KCE A;  4P8U A;  3ARX A;  5HWC A;  1KT0 A;  3WD4 A;  3AS1 A;  2P4V A;  4R5E A;  4TYO A;  2A3C A;  1W9U A;  4MNL A;  4LAW A;  1PIN A;  4ODN A;  3FY1 A;  1GRJ A;  1E6P A;  1JND A;  3ODK A;  3B8S A;  4DRH A;  1FKR A;  1EQ3 A;  2AWG A;  1C9H A;  3JYM A;  2MPH A;  1JNE A;  3UQI A;  3CGN A;  2KO7 A;  2A3A A;  3FXY A;  3H9R B;  3B9D A;  2XP4 A;  1D7J A;  2OLH A;  5JH8 A;  4ODR A;  1M5Y A;  4DRJ A;  1X6N A;  1E9L A;  1FKG A;  3O5P A;  1NMV A;  2DG3 A;  4Z2H A;  3LUO A;  3RGC A;  3GU0 A;  1LL7 A;  2N87 A;  5HBF A;  3IK8 A;  3JYJ A;  4QZV B;  3O5Q A;  3EIP A;  2XP6 A;  1JCH B;  1ZBW A;  2D9F A;  1XHG A;  4DZ2 A;  1H0G A;  2YBU A;  3WH0 A;  4LGX A;  3ARZ A;  1N1A A;  4L72 B;  1ZBC A;  3O5O A;  3FAP A;  2PPO A;  1HKI A;  1FFR A;  2KFW A;  3ALG A;  1W1V A;  1GOI A;  3NTP A;  1QZ2 A;  4QT3 A;  4XAK A;  1J4I A;  1FFQ A;  4MNJ A;  1B6C A;  5DIV A;  3WQW A;  3O5R A;  4J4N A;  4W9Q A;  4W5U A;  3ARV A;  4FN2 A;  4C02 B;  3O5I A;  1W9V A;  3O5E A;  1NWS A;  4DRO A;  3KAD A;  2PBC A;  1D7I A;  1J6Y A;  4FAP A;  1YAT A;  1PBK A;  3IKD A;  3AQU A;  4ZPW R;  1P5Q A;  5HW8 A;  2ZR5 A;  1GUV A;  1LG2 A;  1J4H A;  3ARW A;  5HUA A;  1NWT A;  4Z2L A;  5DEZ A;  3RME A;  4IQC A;  3PRB A;  3TCZ A;  2A3E A;  2O9O A;  4WKA A;  4HBE A;  4ODK A;  2M1I A;  4DRI A;  1ZK6 A;  4ODP A;  1HKK A;  3B7X A;  1U79 A;  3AS3 A;  4GIV A;  3BXW A;  5HKG A;  2FKE A;  1HJX A;  4TW8 A;  3VAW A;  5I98 A;  3WL1 A;  2MLY A;  4ODO A;  5BXJ A;  2FAP A;  4DRM A;  4U85 A;  1E44 A;  2MLZ A;  4DWS C;  4ODM A;  3ARS A;  1UR9 A;  4WKH A;  1W26 A;  1JVW A;  3G6L A;  4S3J A;  1F8A B;  1JNS A;  3UF8 A;  2LJ4 A;  1NWU A;  3ART A;  3GPK A;  4ZPT R;  1LG1 A;  4IT6 A;  4ODL A;  2F4E A;  2RSE A;  1QPF A;  2K8I A;  2VN1 A;  4S3K A;  3RM8 A;  1FKD A;  4Z2K A;  2LKN A;  3CHD A;  3PRD A;  4MPK A;  4WKF A;  1D7H A;  1FKJ A;  5DIU A;  1Q6H A;  3B9E A;  3ARQ A;  4LAX A;  1HKM A;  2QF8 A;  2A3B A;  2PI6 A;  1FKF A;  2MF9 A;  4GGQ A;  4TNS A;  3WQV A;  2OFN A;  1GPF A;  2XP5 A;  2MLX A;  1HJV A;  1OWQ A;  4BF8 A;  1BL4 A;  4LAY A;  2DSW A;  3ARO A;  2L2S A;  3WKZ A;  4Z2J A;  4DWS B;  4NSB A;  3KAH A;  3CH9 A;  4WK9 A;  4ZS6 A;  1FKL A;  1QPL A;  2XP7 A;  4DWS A;  4MTV A;  3UQB A;  3CZ8 A;  3OA5 A;  1T11 A;  2LPV A;  4U86 A;  4DIP A;  4MGV A;  1Q6I A;  2DT0 A;  2Y78 A;  3O5M A;  4KQZ A;  2MNT A;  4MNM A;  3WIJ A;  4P8W A;  1A7X A;  1F40 A;  2WM0 A;  1Q1C A;  1W1T A;  3ALF A;  2F2D A;  3W4R A;  2DSU A;  3UQA A;  4HAR A;  5DO2 A;  2F23 A;  4LAV A;  3BMB A;  4IQ2 A;  1SYT A;  4DH0 A;  2M2A A;  4Q7N A;  2LGO A;  3G6M A;  4ODQ A;  4QIB A;  2B5U B;  3AS0 A;  2RUR A;  3PA7 A;  5HTG A;  4DRP A;  1FJD A;  4P8V A;  3O5D A;  3EY6 A;  1ZBV A;  2XPA A;  1E15 A;  1VF8 A;  4MAV A;  4P8X A;  2G8Z A;  4JYS A;  2DT3 A;  1XRV A;  1W1P A;  1HXV A;  2DPE A;  1EIB A;  4L3N A;  4MNK A;  1WB0 A;  3MDY B;  1HKJ A;  3CHF A;  2ZR4 A;  1CTN A;  1TCO C;  2G41 A;  4WIW A;  4Q22 A;  2RUQ A;  3KZ7 A;  2DSZ A;  2AOS A;  3RM4 A;  1D2K A;  3TDB A;  3KAC A;  3ARP A;  2YBT A;  2EUL A;  1ZU8 A;  2FDM A;  3O5K A;  2ZQS A;  4UDM A;  4TX0 A;  1IX5 A;  4ML4 A;  1O6I A;  1ROU A;  2KI3 A;  3ARR A;  3RFW A;  3WD1 A;  1FAP A;  3RM9 A;  2WLZ A;  3CHC A;  1ZB5 A;  2PV3 A;  2XP8 A;  1E6Z A;  4WJX A;  1FKS A;  2ZQT A;  2RUC A;  1EYM A;  2F21 A;  4JFL A;  2DSV A;  2XPB A;  3UI5 A;  4DWS D;  2IF4 A;  1K9T A;  3I6C A;  4ZPV R;  1X6L A;  1TFV A;  1E6N A;  1H0I A;  3KAB A;  1R9H A;  3CGM A;  4JFM A;  2UZ5 A;  1ITX A;  3KAG A;  3TC5 A;  2WK2 A;  2JZV A;  2PN0 A;  3WD0 A;  1RD6 A;  2ITK A;  3IHZ A;  2RQS A;  1FKT A;  5GPR A;  5HT1 A;  3JXV A;  3KAI A;  4N19 A;  5HW6 A;  4Z2G A;  4MSP A;  4G50 A;  3OOB A;  1NMW A;  3AS2 A;  1WAW A;  2IUZ A;  5DF0 A;  4JFK A;  4URI A;  1FKH A;  4DZ3 A;  1LJY A;  2WLY A;  4W9P A;  2RUD A;  4ITZ A;  1NSG A;  1D6O A;  3GTY X;  4W9O A;  1E6R A;  3B9A A;  1Q6U A;  4J4O A;  2XP3 A;  1UR8 A;  3WL0 A;  5DIT A;  1FD9 A;  2DG4 A;  1NH6 A;  2KGJ A;  5J6E A;  1KFW A;  1J4R A;  5GPG A;  2ZQU A;  3NRK A;  1HJW A;  1BKF A;  2ZQV A;  4NNR A;  4O2T A;  2XP9 A;  4NZC A;  3PRA A;  5HWB A;  4AY1 A;  2DT2 A;  5B8I C;  1YW5 A;  1ZL1 A;  2KR7 A;  1L1P A;  4QT2 A;  2PV1 A;  4IT4 A;  3UI6 A;  2O92 A;  2ETN A;  2Q5A A;  3O5G A;  4DRQ A;  4DT4 A;  1OGG A;  2PPP A;  3KAF A;  1JNT A;  2DG9 A;  4HBO A;  4JFI A;  4R0X A;  4DRK A;  4IPX A;  3UI4 A;  4G2P A;  1LL6 A;  1FKK A;  3O5L A;  1W9P A;  1FKB A; 
#chains in the Genus database with same CATH homology
 3NI6 A;  4DRN A;  4TW6 A;  2ZR6 A;  1LQ0 A;  5D75 A;  4KR0 B;  2ESC A;  1OGB A;  3ARY A;  4TW7 A;  3WD3 A;  2KE0 A;  2PPN A;  2B31 A;  1KT1 A;  3ARU A;  4JFJ A;  1NWR A;  4U84 A;  2VCD A;  5HW7 A;  4PTM A;  1ZBK A;  3PR9 A;  1LL4 A;  1SR0 A;  1WNO A;  1FKI A;  1EHN A;  3O5J A;  2M08 A;  3O5F A;  5GQB A;  3WD2 A;  1EDQ A;  3QOK A;  1W1Y A;  4Z2I A;  2PV2 A;  2DT1 A;  3IKG A;  1Y0O A;  1ROT A;  1ZCN A;  3CHE A;  3KCE A;  4P8U A;  3ARX A;  5HWC A;  1KT0 A;  3WD4 A;  3AS1 A;  4R5E A;  4TYO A;  2A3C A;  1W9U A;  4MNL A;  4LAW A;  1PIN A;  4ODN A;  3FY1 A;  1E6P A;  1JND A;  3ODK A;  3B8S A;  4DRH A;  1FKR A;  1EQ3 A;  2AWG A;  1C9H A;  3JYM A;  2MPH A;  1JNE A;  3UQI A;  3CGN A;  2KO7 A;  2A3A A;  3FXY A;  3H9R B;  3B9D A;  2XP4 A;  1D7J A;  2OLH A;  5JH8 A;  4ODR A;  1M5Y A;  4DRJ A;  1X6N A;  1E9L A;  1FKG A;  3O5P A;  1NMV A;  2DG3 A;  4Z2H A;  3LUO A;  3RGC A;  1LL7 A;  2N87 A;  5HBF A;  3IK8 A;  3JYJ A;  4QZV B;  3O5Q A;  2XP6 A;  1ZBW A;  2D9F A;  1XHG A;  4DZ2 A;  1H0G A;  2YBU A;  3WH0 A;  4LGX A;  3ARZ A;  1N1A A;  4L72 B;  1ZBC A;  3O5O A;  3FAP A;  2PPO A;  1HKI A;  1FFR A;  2KFW A;  3ALG A;  1W1V A;  1GOI A;  3NTP A;  1QZ2 A;  4QT3 A;  4XAK A;  1J4I A;  1FFQ A;  4MNJ A;  1B6C A;  5DIV A;  3WQW A;  3O5R A;  4J4N A;  4W9Q A;  4W5U A;  3ARV A;  4FN2 A;  4C02 B;  3O5I A;  1W9V A;  3O5E A;  1NWS A;  4DRO A;  3KAD A;  2PBC A;  1D7I A;  1J6Y A;  4FAP A;  1YAT A;  1PBK A;  3IKD A;  3AQU A;  4ZPW R;  1P5Q A;  5HW8 A;  2ZR5 A;  1GUV A;  1LG2 A;  1J4H A;  3ARW A;  5HUA A;  1NWT A;  4Z2L A;  5DEZ A;  3RME A;  4IQC A;  3PRB A;  3TCZ A;  2A3E A;  2O9O A;  4WKA A;  4HBE A;  4ODK A;  2M1I A;  4DRI A;  1ZK6 A;  4ODP A;  1HKK A;  3B7X A;  1U79 A;  3AS3 A;  4GIV A;  3BXW A;  5HKG A;  2FKE A;  1HJX A;  4TW8 A;  3VAW A;  5I98 A;  3WL1 A;  2MLY A;  4ODO A;  5BXJ A;  2FAP A;  4DRM A;  4U85 A;  2MLZ A;  4DWS C;  4ODM A;  3ARS A;  1UR9 A;  4WKH A;  1W26 A;  1JVW A;  3G6L A;  4S3J A;  1F8A B;  1JNS A;  3UF8 A;  2LJ4 A;  1NWU A;  3ART A;  3GPK A;  4ZPT R;  1LG1 A;  4IT6 A;  4ODL A;  2F4E A;  2RSE A;  1QPF A;  2K8I A;  2VN1 A;  4S3K A;  3RM8 A;  1FKD A;  4Z2K A;  2LKN A;  3CHD A;  3PRD A;  4MPK A;  4WKF A;  1D7H A;  1FKJ A;  5DIU A;  1Q6H A;  3B9E A;  3ARQ A;  4LAX A;  1HKM A;  2QF8 A;  2A3B A;  2PI6 A;  1FKF A;  2MF9 A;  4GGQ A;  4TNS A;  3WQV A;  2OFN A;  1GPF A;  2XP5 A;  2MLX A;  1HJV A;  1OWQ A;  4BF8 A;  1BL4 A;  4LAY A;  2DSW A;  3ARO A;  2L2S A;  3WKZ A;  4Z2J A;  4DWS B;  4NSB A;  3KAH A;  3CH9 A;  4WK9 A;  4ZS6 A;  1FKL A;  1QPL A;  2XP7 A;  4DWS A;  4MTV A;  3UQB A;  3CZ8 A;  3OA5 A;  1T11 A;  2LPV A;  4U86 A;  4DIP A;  4MGV A;  1Q6I A;  2DT0 A;  2Y78 A;  3O5M A;  4KQZ A;  2MNT A;  4MNM A;  3WIJ A;  4P8W A;  1A7X A;  1F40 A;  2WM0 A;  1Q1C A;  1W1T A;  3ALF A;  2F2D A;  3W4R A;  2DSU A;  3UQA A;  4HAR A;  5DO2 A;  4LAV A;  4IQ2 A;  1SYT A;  4DH0 A;  2M2A A;  4Q7N A;  2LGO A;  3G6M A;  4ODQ A;  4QIB A;  3AS0 A;  2RUR A;  3PA7 A;  5HTG A;  4DRP A;  1FJD A;  4P8V A;  3O5D A;  3EY6 A;  1ZBV A;  2XPA A;  1E15 A;  1VF8 A;  4MAV A;  4P8X A;  2G8Z A;  4JYS A;  2DT3 A;  1XRV A;  1W1P A;  1HXV A;  2DPE A;  1EIB A;  4L3N A;  4MNK A;  1WB0 A;  3MDY B;  1HKJ A;  3CHF A;  2ZR4 A;  1CTN A;  1TCO C;  2G41 A;  4WIW A;  4Q22 A;  2RUQ A;  3KZ7 A;  2DSZ A;  2AOS A;  3RM4 A;  1D2K A;  3TDB A;  3KAC A;  3ARP A;  2YBT A;  1ZU8 A;  2FDM A;  3O5K A;  2ZQS A;  4TX0 A;  1IX5 A;  4ML4 A;  1O6I A;  1ROU A;  2KI3 A;  3ARR A;  3RFW A;  3WD1 A;  1FAP A;  3RM9 A;  2WLZ A;  3CHC A;  1ZB5 A;  2PV3 A;  2XP8 A;  1E6Z A;  4WJX A;  1FKS A;  2ZQT A;  2RUC A;  1EYM A;  2F21 A;  4JFL A;  2DSV A;  2XPB A;  3UI5 A;  4DWS D;  2IF4 A;  1K9T A;  3I6C A;  4ZPV R;  1X6L A;  1TFV A;  1E6N A;  1H0I A;  3KAB A;  1R9H A;  3CGM A;  4JFM A;  2UZ5 A;  1ITX A;  3KAG A;  3TC5 A;  2WK2 A;  2JZV A;  3WD0 A;  1RD6 A;  2ITK A;  3IHZ A;  2RQS A;  1FKT A;  5GPR A;  5HT1 A;  3JXV A;  3KAI A;  4N19 A;  5HW6 A;  4Z2G A;  4MSP A;  4G50 A;  3OOB A;  1NMW A;  3AS2 A;  1WAW A;  2IUZ A;  5DF0 A;  4JFK A;  4URI A;  1FKH A;  4DZ3 A;  1LJY A;  2WLY A;  4W9P A;  2RUD A;  4ITZ A;  1NSG A;  1D6O A;  4W9O A;  1E6R A;  3B9A A;  4J4O A;  1Q6U A;  2XP3 A;  1UR8 A;  3WL0 A;  5DIT A;  1FD9 A;  2DG4 A;  1NH6 A;  2KGJ A;  5J6E A;  1KFW A;  1J4R A;  5GPG A;  2ZQU A;  3NRK A;  1HJW A;  1BKF A;  2ZQV A;  4NNR A;  4O2T A;  2XP9 A;  4NZC A;  3PRA A;  5HWB A;  4AY1 A;  2DT2 A;  5B8I C;  1YW5 A;  1ZL1 A;  2KR7 A;  1L1P A;  4QT2 A;  4IT4 A;  2PV1 A;  3UI6 A;  2O92 A;  2Q5A A;  3O5G A;  4DRQ A;  4DT4 A;  1OGG A;  2PPP A;  3KAF A;  1JNT A;  2DG9 A;  4HBO A;  4JFI A;  4R0X A;  4DRK A;  4IPX A;  3UI4 A;  4G2P A;  1LL6 A;  1FKK A;  3O5L A;  1W9P A;  1FKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...