3O5GA

Fk1 domain of fkbp51, crystal form i
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5gA00
2ZQSA 3LUOA 2PV3A 2LJ4A 1FD9A 4QT2A 2VCDA 5HKGA 1ROUA 2RURA 3I6CA 4DRJA 4N19A 3UQIA 1Q6HA 1F8AB 5D75A 3UI6A 1BKFA 2ZQVA 3UQAA 2DG9A 2MNTA 2XPAA 3IKGA 3KZ7A 1PINA 1ZCNA 1ZK6A 4TW7A 4U86A 1KT0A 3FAPA 4NNRA 3NRKA 3RGCA 3KAIA 3IK8A 2PBCA 5HWCA 3CGNA 4DIPA 4TNSA 1HXVA 1ROTA 4JFKA 2RSEA 2L2SA 2ZR4A 2KI3A 4DRNA 1JNSA 2PV2A 1FKSA 1QZ2A 1B6CA 2D9FA 2F4EA 4IQ2A 2MLYA 2XP9A 3VAWA 1EYMA 3PRBA 5DIVA 5BXJA 3UQBA 3O5QA 3NI6A 2XP3A 3B7XA 2RUDA 3O5KA 3JXVA 4J4OA 1L1PA 1TCOC 2K8IA 3O5PA 5HW6A 3O5RA 3UI5A 2KR7A 2XP4A 1C9HA 2PPOA 1FAPA 4JYSA 4IQCA 4W9PA 4LAYA 1W26A 4GIVA 5HW7A 3O5DA 4ODPA 2JZVA 4DRPA 3O5IA 4IPXA 1D7IA 3O5FA 1FKIA 5HT1A 3H9RB 5DITA 3O5MA 4DH0A 2F2DA 2ZR5A 2KFWA 1NMWA 4U85A 1Q6IA 4DRKA 2M2AA 3NTPA 1J4HA 2DG4A 1BL4A 2VN1A 2FKEA 2ZQTA 2XP8A 1D6OA 4G2PA 4ODKA 3KAGA 4ITZA 1Q1CA 4JFJA 3UF8A 4DRIA 4ODQA 2XPBA 1NMVA 1FKHA 2MLXA 3KAFA 3KAHA 2XP7A 5B8IC 1FKJA 2KO7A 4TW8A 4R0XA 1D7JA 1N1AA 3IHZA 1U79A 5J6EA 3TDBA 2Y78A 3ODKA 4G50A 1J6YA 1EQ3A 3MDYB 1NSGA 4MSPA 1M5YA 4DRMA 1FKFA 3PA7A 2RQSA 4QT3A 2PPNA 4LAXA 5HW8A 3CGMA 2M1IA 2OFNA 2ZQUA 5HWBA 1J4IA 1YW5A 1KT1A 4FAPA 3KADA 1JVWA 1FKDA 4DROA 1R9HA 2FAPA 3JYMA 3KACA 2MLZA 1FJDA 4TX0A 4ODLA 4JFIA 2LPVA 4ODNA 4DT4A 2DG3A 3KCEA 4FN2A 3O5GA 1Y0OA 3O5LA 2M08A 1FKBA 1FKTA 2MF9A 4DZ2A 3EY6A 3OOBA 3GPKA 2LKNA 2PPPA 2F21A 4LAVA 4U84A 1FKRA 4JFLA 2Q5AA 3TCZA 2ZR6A 4W9QA 5HTGA 2AWGA 3O5EA 1PBKA 4BF8A 2RUCA 2XP6A 3PRDA 4W9OA 4DRHA 4LAWA 3RFWA 3WH0A 2XP5A 4DZ3A 1A7XA 2IF4A 2MPHA 4J4NA 1FKLA 3O5JA 4ODOA 1T11A 2PV1A 5GPGA 1FKKA 1JNTA 1YATA 4JFMA 3UI4A 4DRQA 2RUQA 5HUAA 1J4RA 2KE0A 2UZ5A 4O2TA 2LGOA 1QPLA 2N87A 3KABA 4ODMA 4MGVA 3TC5A 2KGJA 3IKDA 4GGQA 4QIBA 4C02B 5DIUA 1P5QA 1QPFA 2ITKA 5I98A 1D7HA 1FKGA 4TW6A 4ODRA 1Q6UA 3O5OA 4TYOA 3JYJA 1F40A
chains in the Genus database with same CATH superfamily
2PV3A 1X6NA 3UI6A 1F8AB 1XRVA 2ZQVA 3UQAA 2DG9A 3ARVA 1PINA 3WD1A 1KT0A 3FAPA 3RGCA 4DIPA 4TNSA 1ROTA 2WLYA 4JFKA 2L2SA 2DSVA 1QZ2A 3GTYX 2MLYA 3UQBA 3O5QA 2RUDA 3O5KA 3JXVA 4ML4A 1FFRA 1L1PA 3O5RA 3CHFA 3UI5A 3W4RA 2P4VA 1FAPA 3ARWA 1KFWA 1W26A 1JNDA 4P8UA 4L3NA 3O5IA 1D7IA 3O5FA 4DH0A 1IX5A 3H9RB 2ZR5A 2KFWA 1Q6IA 2YBTA 2ZQTA 2FKEA 4ZPTR 4DRIA 1UR8A 1NMVA 4DWSA 2KO7A 1FFQA 1D7JA 5J6EA 4HARA 2B5UB 1NSGA 4Z2GA 2A3BA 4DRMA 3PA7A 2RQSA 1E6ZA 2ZQUA 4MNKA 3ARTA 1JVWA 3KACA 4P8WA 2G8ZA 4TX0A 1HKIA 5DEZA 4MNMA 3O5LA 1W9UA 4DZ2A 4ZPWR 1W1YA 3PRAA 1FKRA 3WD0A 4IT6A 4AY1A 3TCZA 4L72B 4Q7NA 2PI6A 4LAWA 3WH0A 1A7XA 2IF4A 3GU0A 4J4NA 1FKLA 2PV1A 1ZBVA 1E6RA 3WKZA 1J4RA 4ODMA 3OA5A 4MGVA 2KGJA 4Z2LA 3CH9A 2DSZA 5DIUA 1O6IA 1QPFA 2ITKA 5I98A 4ODRA 3O5OA 1ZBWA 1F40A 3B9DA 3LUOA 1FD9A 1NWRA 3ALGA 4N19A 3CZ8A 1Q6HA 2XPAA 3KAIA 3AS0A 1NWTA 4Z2KA 2PBCA 1SR0A 1OGBA 2ZR4A 3PR9A 1JNSA 1FKSA 1B6CA 2F4EA 2EULA 2DT1A 4DWSD 1E6NA 2K8IA 2XP4A 3CHEA 1C9HA 2PPOA 4LAYA 3FXYA 1EDQA 2JZVA 4DRPA 4IPXA 1RD6A 5DITA 2DG4A 1BL4A 1EHNA 2XP8A 3ARRA 3WD2A 4WKAA 4S3KA 3RM8A 3WD3A 5B8IC 3G6MA 4NSBA 4R0XA 3WIJA 3IHZA 3TDBA 3WL1A 2Y78A 4G50A 1J6YA 1EQ3A 4MSPA 1M5YA 1FKFA 2PPNA 4LAXA 1W9VA 2OFNA 1J4IA 2WK2A 1KT1A 1ZL1A 4FAPA 1FKDA 4DROA 1R9HA 2FAPA 3JYMA 2MLZA 2F23A 1FJDA 2DG3A 2IUZA 2FDMA 1Y0OA 2MF9A 3EY6A 3G6LA 2LKNA 1JCHB 4JFLA 2QF8A 2ZR6A 4MNLA 4W9QA 3O5EA 5HTGA 1PBKA 4BF8A 1WAWA 4DRHA 1SYTA 3CHDA 3WQWA 3WL0A 2MPHA 4ODOA 3O5JA 4MTVA 1VF8A 4JFMA 1TFVA 2KE0A 2OLHA 3TC5A 3AS3A 2WM0A 4QIBA 3ARPA 4KQZA 1CTNA 3BMBA 1LL4A 1LL7A 4QT2A 4WKHA 5HKGA 2RURA 4DRJA 1K9TA 3B8SA 3UQIA 4QZVB 5D75A 1BKFA 3KZ7A 1ZK6A 1ZCNA 3NRKA 5DO2A 3IK8A 5HWCA 3CGNA 3AS2A 2PV2A 2D9FA 2XP9A 3VAWA 2WLZA 1EYMA 3PRBA 5BXJA 1D2KA 2XP3A 4J4OA 1TCOC 1X6LA 3O5PA 5GQBA 5HW6A 1GUVA 1H0GA 4WJXA 4JYSA 4W9PA 5HW7A 4ODPA 1E15A 1W1VA 3ALFA 1ZU8A 1E9LA 1ZBCA 1GRJA 2ETNA 3WQVA 2DT0A 1NMWA 1HKKA 2DT2A 2M2AA 1E44A 3NTPA 4ODKA 3EIPA 3KAGA 4ITZA 1Q1CA 4XAKA 2MLXA 3KAFA 2AOSA 3KAHA 2XP7A 1FKJA 2A3EA 3ARQA 1HKJA 4TW8A 1N1AA 4IT4A 1U79A 3ODKA 1HJVA 3MDYB 4QT3A 4MPKA 2M1IA 5HWBA 2A3CA 4JFIA 2LPVA 4Z2HA 4ODNA 3KCEA 1FKBA 4MAVA 1HKMA 1WNOA 3OOBA 2PPPA 2F21A 4U84A 4URIA 2B31A 2AWGA 2RUCA 3PRDA 4W9OA 2PN0A 4P8VA 1E6PA 2XP5A 1H0IA 4UDMA 1T11A 5GPGA 4WK9A 1JNTA 4HBOA 2RUQA 3QOKA 4O2TA 2LGOA 1QPLA 3KABA 4NZCA 4KR0B 1LJYA 4GGQA 3ARYA 2ESCA 1FKGA 4TYOA 2ZQSA 3ARSA 2LJ4A 2VCDA 1LG2A 1ROUA 3I6CA 1XHGA 2MNTA 3IKGA 1LL6A 4TW7A 4U86A 4LGXA 4NNRA 4MNJA 1HXVA 2RSEA 1HJXA 1NH6A 1W1PA 2KI3A 3AROA 4DRNA 4IQ2A 1WB0A 4HBEA 5DIVA 3B9AA 3NI6A 3B7XA 4Q22A 1HJWA 2KR7A 4Z2JA 4WIWA 1NWUA 2A3AA 4IQCA 4GIVA 3O5DA 4Z2IA 5HT1A 3RM9A 1FKIA 3O5MA 3ARUA 2DSUA 2F2DA 4U85A 4DRKA 3AS1A 1J4HA 4S3JA 2VN1A 4G2PA 1D6OA 4JFJA 3UF8A 1JNEA 1ITXA 2XPBA 3ARZA 4ODQA 2O92A 1FKHA 5HBFA 3RM4A 1NWSA 2DSWA 4ZS6A 4DWSB 1GPFA 4DWSC 1LG1A 2DPEA 1W1TA 3ARXA 5HW8A 3AQUA 4WKFA 3CGMA 3RMEA 3CHCA 1YW5A 5JH8A 3KADA 1OGGA 1ZBKA 4ODLA 4DT4A 4FN2A 3O5GA 2M08A 1FKTA 3GPKA 4LAVA 4ZPVR 2Q5AA 4R5EA 3B9EA 3WD4A 4P8XA 1OWQA 2XP6A 1EIBA 2YBUA 1LQ0A 1W9PA 2G41A 3RFWA 4DZ3A 5DF0A 1FKKA 1YATA 3UI4A 4DRQA 5HUAA 2UZ5A 4W5UA 2N87A 5GPRA 2DT3A 3IKDA 4C02B 2O9OA 4PTMA 1ZB5A 1P5QA 1UR9A 1GOIA 3BXWA 1D7HA 3FY1A 4TW6A 1Q6UA 3JYJA
chains in the Genus database with same CATH topology
2PV3A 1X6NA 3UI6A 1F8AB 1XRVA 2ZQVA 3UQAA 2DG9A 3ARVA 1PINA 3WD1A 1KT0A 3FAPA 3RGCA 4DIPA 4TNSA 1ROTA 2WLYA 4JFKA 2L2SA 2DSVA 1QZ2A 2MLYA 3UQBA 3O5QA 2RUDA 3O5KA 3JXVA 4ML4A 1FFRA 1L1PA 3O5RA 3CHFA 3UI5A 3W4RA 1FAPA 3ARWA 1KFWA 1W26A 1JNDA 4P8UA 4L3NA 3O5IA 1D7IA 3O5FA 4DH0A 1IX5A 3H9RB 2ZR5A 2KFWA 1Q6IA 2YBTA 2ZQTA 2FKEA 4ZPTR 4DRIA 1UR8A 1NMVA 4DWSA 2KO7A 1FFQA 1D7JA 5J6EA 4HARA 4Z2GA 1NSGA 2A3BA 4DRMA 3PA7A 2RQSA 1E6ZA 2ZQUA 4MNKA 3ARTA 1JVWA 3KACA 4P8WA 2G8ZA 4TX0A 1HKIA 5DEZA 4MNMA 3O5LA 1W9UA 4DZ2A 4ZPWR 1W1YA 3PRAA 1FKRA 3WD0A 4IT6A 4AY1A 3TCZA 4L72B 4Q7NA 2PI6A 4LAWA 3WH0A 1A7XA 2IF4A 4J4NA 1FKLA 2PV1A 1ZBVA 1E6RA 3WKZA 1J4RA 4ODMA 3OA5A 4MGVA 2KGJA 4Z2LA 3CH9A 2DSZA 5DIUA 1O6IA 1QPFA 2ITKA 5I98A 4ODRA 3O5OA 1ZBWA 1F40A 3B9DA 3LUOA 1FD9A 1NWRA 3ALGA 4N19A 3CZ8A 1Q6HA 2XPAA 3KAIA 3AS0A 1NWTA 4Z2KA 2PBCA 1SR0A 1OGBA 2ZR4A 3PR9A 1JNSA 1FKSA 1B6CA 2F4EA 2DT1A 4DWSD 1E6NA 2K8IA 2XP4A 3CHEA 1C9HA 2PPOA 4LAYA 3FXYA 1EDQA 2JZVA 4DRPA 4IPXA 1RD6A 5DITA 2DG4A 1BL4A 1EHNA 2XP8A 3ARRA 3WD2A 4WKAA 4S3KA 3RM8A 3WD3A 5B8IC 3G6MA 4NSBA 4R0XA 3WIJA 3IHZA 3TDBA 3WL1A 2Y78A 4G50A 1J6YA 1EQ3A 4MSPA 1M5YA 1FKFA 2PPNA 4LAXA 1W9VA 2OFNA 1J4IA 2WK2A 1KT1A 1ZL1A 4FAPA 1FKDA 4DROA 1R9HA 2FAPA 3JYMA 2MLZA 1FJDA 2DG3A 2IUZA 2FDMA 1Y0OA 2MF9A 3EY6A 3G6LA 2LKNA 4JFLA 2QF8A 2ZR6A 4MNLA 4W9QA 3O5EA 5HTGA 1PBKA 4BF8A 1WAWA 4DRHA 1SYTA 3CHDA 3WQWA 3WL0A 2MPHA 4ODOA 3O5JA 4MTVA 1VF8A 4JFMA 1TFVA 2KE0A 2OLHA 3TC5A 3AS3A 2WM0A 4QIBA 3ARPA 4KQZA 1CTNA 1LL4A 1LL7A 4QT2A 4WKHA 5HKGA 2RURA 4DRJA 1K9TA 3B8SA 3UQIA 4QZVB 5D75A 1BKFA 3KZ7A 1ZK6A 1ZCNA 3NRKA 5DO2A 3IK8A 5HWCA 3CGNA 3AS2A 2PV2A 2D9FA 2XP9A 3VAWA 2WLZA 1EYMA 3PRBA 5BXJA 1D2KA 2XP3A 4J4OA 1TCOC 1X6LA 3O5PA 5GQBA 5HW6A 1GUVA 1H0GA 4WJXA 4JYSA 4W9PA 5HW7A 4ODPA 1E15A 1W1VA 3ALFA 1ZU8A 1E9LA 1ZBCA 3WQVA 2DT0A 1NMWA 1HKKA 2DT2A 2M2AA 3NTPA 4ODKA 3KAGA 4ITZA 1Q1CA 4XAKA 2MLXA 3KAFA 2AOSA 3KAHA 2XP7A 1FKJA 2A3EA 3ARQA 1HKJA 4TW8A 1N1AA 4IT4A 1U79A 3ODKA 1HJVA 3MDYB 4QT3A 4MPKA 2M1IA 5HWBA 2A3CA 4JFIA 2LPVA 4Z2HA 4ODNA 3KCEA 1FKBA 4MAVA 1HKMA 1WNOA 3OOBA 2PPPA 2F21A 4U84A 4URIA 2B31A 2AWGA 2RUCA 3PRDA 4W9OA 4P8VA 1E6PA 2XP5A 1H0IA 1T11A 5GPGA 4WK9A 1JNTA 4HBOA 2RUQA 3QOKA 4O2TA 2LGOA 1QPLA 3KABA 4NZCA 4KR0B 1LJYA 4GGQA 3ARYA 2ESCA 1FKGA 4TYOA 2ZQSA 3ARSA 2LJ4A 2VCDA 1LG2A 1ROUA 3I6CA 1XHGA 2MNTA 3IKGA 1LL6A 4TW7A 4U86A 4LGXA 4NNRA 4MNJA 1HXVA 2RSEA 1HJXA 1NH6A 1W1PA 2KI3A 3AROA 4DRNA 4IQ2A 1WB0A 4HBEA 5DIVA 3B9AA 3NI6A 3B7XA 4Q22A 1HJWA 2KR7A 4Z2JA 4WIWA 1NWUA 2A3AA 4IQCA 4GIVA 3O5DA 4Z2IA 5HT1A 3RM9A 1FKIA 3O5MA 3ARUA 2DSUA 2F2DA 4U85A 4DRKA 3AS1A 1J4HA 4S3JA 2VN1A 4G2PA 1D6OA 4JFJA 3UF8A 1JNEA 1ITXA 2XPBA 3ARZA 4ODQA 2O92A 1FKHA 5HBFA 3RM4A 1NWSA 2DSWA 4ZS6A 4DWSB 1GPFA 4DWSC 1LG1A 2DPEA 1W1TA 3ARXA 5HW8A 3AQUA 4WKFA 3CGMA 3RMEA 3CHCA 1YW5A 5JH8A 3KADA 1OGGA 1ZBKA 4ODLA 4DT4A 4FN2A 3O5GA 2M08A 1FKTA 3GPKA 4LAVA 4ZPVR 2Q5AA 4R5EA 3B9EA 3WD4A 4P8XA 1OWQA 2XP6A 1EIBA 2YBUA 1LQ0A 1W9PA 2G41A 3RFWA 4DZ3A 5DF0A 1FKKA 1YATA 3UI4A 4DRQA 5HUAA 2UZ5A 4W5UA 2N87A 5GPRA 2DT3A 3IKDA 4C02B 2O9OA 4PTMA 1ZB5A 1P5QA 1UR9A 1GOIA 3BXWA 1D7HA 3FY1A 4TW6A 1Q6UA 3JYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQS A;  3LUO A;  2PV3 A;  2LJ4 A;  1FD9 A;  4QT2 A;  2VCD A;  5HKG A;  1ROU A;  2RUR A;  3I6C A;  4DRJ A;  4N19 A;  3UQI A;  1Q6H A;  1F8A B;  5D75 A;  3UI6 A;  1BKF A;  2ZQV A;  3UQA A;  2DG9 A;  2MNT A;  2XPA A;  3IKG A;  3KZ7 A;  1PIN A;  1ZCN A;  1ZK6 A;  4TW7 A;  4U86 A;  1KT0 A;  3FAP A;  4NNR A;  3NRK A;  3RGC A;  3KAI A;  3IK8 A;  2PBC A;  5HWC A;  3CGN A;  4DIP A;  4TNS A;  1HXV A;  1ROT A;  4JFK A;  2RSE A;  2L2S A;  2ZR4 A;  2KI3 A;  4DRN A;  1JNS A;  2PV2 A;  1FKS A;  1QZ2 A;  1B6C A;  2D9F A;  2F4E A;  4IQ2 A;  2MLY A;  2XP9 A;  3VAW A;  1EYM A;  3PRB A;  5DIV A;  5BXJ A;  3UQB A;  3O5Q A;  3NI6 A;  2XP3 A;  3B7X A;  2RUD A;  3O5K A;  3JXV A;  4J4O A;  1L1P A;  1TCO C;  2K8I A;  3O5P A;  5HW6 A;  3O5R A;  3UI5 A;  2KR7 A;  2XP4 A;  1C9H A;  2PPO A;  1FAP A;  4JYS A;  4IQC A;  4W9P A;  4LAY A;  1W26 A;  4GIV A;  5HW7 A;  3O5D A;  4ODP A;  2JZV A;  4DRP A;  3O5I A;  4IPX A;  1D7I A;  3O5F A;  1FKI A;  5HT1 A;  3H9R B;  5DIT A;  3O5M A;  4DH0 A;  2F2D A;  2ZR5 A;  2KFW A;  1NMW A;  4U85 A;  1Q6I A;  4DRK A;  2M2A A;  3NTP A;  1J4H A;  2DG4 A;  1BL4 A;  2VN1 A;  2FKE A;  2ZQT A;  2XP8 A;  1D6O A;  4G2P A;  4ODK A;  3KAG A;  4ITZ A;  1Q1C A;  4JFJ A;  3UF8 A;  4DRI A;  4ODQ A;  2XPB A;  1NMV A;  1FKH A;  2MLX A;  3KAF A;  3KAH A;  2XP7 A;  5B8I C;  1FKJ A;  2KO7 A;  4TW8 A;  4R0X A;  1D7J A;  1N1A A;  3IHZ A;  1U79 A;  5J6E A;  3TDB A;  2Y78 A;  3ODK A;  4G50 A;  1J6Y A;  1EQ3 A;  3MDY B;  1NSG A;  4MSP A;  1M5Y A;  4DRM A;  1FKF A;  3PA7 A;  2RQS A;  4QT3 A;  2PPN A;  4LAX A;  5HW8 A;  3CGM A;  2M1I A;  2OFN A;  2ZQU A;  5HWB A;  1J4I A;  1YW5 A;  1KT1 A;  4FAP A;  3KAD A;  1JVW A;  1FKD A;  4DRO A;  1R9H A;  2FAP A;  3JYM A;  3KAC A;  2MLZ A;  1FJD A;  4TX0 A;  4ODL A;  4JFI A;  2LPV A;  4ODN A;  4DT4 A;  2DG3 A;  3KCE A;  4FN2 A;  3O5G A;  1Y0O A;  3O5L A;  2M08 A;  1FKB A;  1FKT A;  2MF9 A;  4DZ2 A;  3EY6 A;  3OOB A;  3GPK A;  2LKN A;  2PPP A;  2F21 A;  4LAV A;  4U84 A;  1FKR A;  4JFL A;  2Q5A A;  3TCZ A;  2ZR6 A;  4W9Q A;  5HTG A;  2AWG A;  3O5E A;  1PBK A;  4BF8 A;  2RUC A;  2XP6 A;  3PRD A;  4W9O A;  4DRH A;  4LAW A;  3RFW A;  3WH0 A;  2XP5 A;  4DZ3 A;  1A7X A;  2IF4 A;  2MPH A;  4J4N A;  1FKL A;  3O5J A;  4ODO A;  1T11 A;  2PV1 A;  5GPG A;  1FKK A;  1JNT A;  1YAT A;  4JFM A;  3UI4 A;  4DRQ A;  2RUQ A;  5HUA A;  1J4R A;  2KE0 A;  2UZ5 A;  4O2T A;  2LGO A;  1QPL A;  2N87 A;  3KAB A;  4ODM A;  4MGV A;  3TC5 A;  2KGJ A;  3IKD A;  4GGQ A;  4QIB A;  4C02 B;  5DIU A;  1P5Q A;  1QPF A;  2ITK A;  5I98 A;  1D7H A;  1FKG A;  4TW6 A;  4ODR A;  1Q6U A;  3O5O A;  4TYO A;  3JYJ A;  1F40 A; 
#chains in the Genus database with same CATH topology
 2PV3 A;  1X6N A;  3UI6 A;  1F8A B;  1XRV A;  2ZQV A;  3UQA A;  2DG9 A;  3ARV A;  1PIN A;  3WD1 A;  1KT0 A;  3FAP A;  3RGC A;  4DIP A;  4TNS A;  1ROT A;  2WLY A;  4JFK A;  2L2S A;  2DSV A;  1QZ2 A;  3GTY X;  2MLY A;  3UQB A;  3O5Q A;  2RUD A;  3O5K A;  3JXV A;  4ML4 A;  1FFR A;  1L1P A;  3O5R A;  3CHF A;  3UI5 A;  3W4R A;  2P4V A;  1FAP A;  3ARW A;  1KFW A;  1W26 A;  1JND A;  4P8U A;  4L3N A;  3O5I A;  1D7I A;  3O5F A;  4DH0 A;  1IX5 A;  3H9R B;  2ZR5 A;  2KFW A;  1Q6I A;  2YBT A;  2ZQT A;  2FKE A;  4ZPT R;  4DRI A;  1UR8 A;  1NMV A;  4DWS A;  2KO7 A;  1FFQ A;  1D7J A;  5J6E A;  4HAR A;  2B5U B;  1NSG A;  4Z2G A;  2A3B A;  4DRM A;  3PA7 A;  2RQS A;  1E6Z A;  2ZQU A;  4MNK A;  3ART A;  1JVW A;  3KAC A;  4P8W A;  2G8Z A;  4TX0 A;  1HKI A;  5DEZ A;  4MNM A;  3O5L A;  1W9U A;  4DZ2 A;  4ZPW R;  1W1Y A;  3PRA A;  1FKR A;  3WD0 A;  4IT6 A;  4AY1 A;  3TCZ A;  4L72 B;  4Q7N A;  2PI6 A;  4LAW A;  3WH0 A;  1A7X A;  2IF4 A;  3GU0 A;  4J4N A;  1FKL A;  2PV1 A;  1ZBV A;  1E6R A;  3WKZ A;  1J4R A;  4ODM A;  3OA5 A;  4MGV A;  2KGJ A;  4Z2L A;  3CH9 A;  2DSZ A;  5DIU A;  1O6I A;  1QPF A;  2ITK A;  5I98 A;  4ODR A;  3O5O A;  1ZBW A;  1F40 A;  3B9D A;  3LUO A;  1FD9 A;  1NWR A;  3ALG A;  4N19 A;  3CZ8 A;  1Q6H A;  2XPA A;  3KAI A;  3AS0 A;  1NWT A;  4Z2K A;  2PBC A;  1SR0 A;  1OGB A;  2ZR4 A;  3PR9 A;  1JNS A;  1FKS A;  1B6C A;  2F4E A;  2EUL A;  2DT1 A;  4DWS D;  1E6N A;  2K8I A;  2XP4 A;  3CHE A;  1C9H A;  2PPO A;  4LAY A;  3FXY A;  1EDQ A;  2JZV A;  4DRP A;  4IPX A;  1RD6 A;  5DIT A;  2DG4 A;  1BL4 A;  1EHN A;  2XP8 A;  3ARR A;  3WD2 A;  4WKA A;  4S3K A;  3RM8 A;  3WD3 A;  5B8I C;  3G6M A;  4NSB A;  4R0X A;  3WIJ A;  3IHZ A;  3TDB A;  3WL1 A;  2Y78 A;  4G50 A;  1J6Y A;  1EQ3 A;  4MSP A;  1M5Y A;  1FKF A;  2PPN A;  4LAX A;  1W9V A;  2OFN A;  1J4I A;  2WK2 A;  1KT1 A;  1ZL1 A;  4FAP A;  1FKD A;  4DRO A;  1R9H A;  2FAP A;  3JYM A;  2MLZ A;  2F23 A;  1FJD A;  2DG3 A;  2IUZ A;  2FDM A;  1Y0O A;  2MF9 A;  3EY6 A;  3G6L A;  2LKN A;  1JCH B;  4JFL A;  2QF8 A;  2ZR6 A;  4MNL A;  4W9Q A;  3O5E A;  5HTG A;  1PBK A;  4BF8 A;  1WAW A;  4DRH A;  1SYT A;  3CHD A;  3WQW A;  3WL0 A;  2MPH A;  4ODO A;  3O5J A;  4MTV A;  1VF8 A;  4JFM A;  1TFV A;  2KE0 A;  2OLH A;  3TC5 A;  3AS3 A;  2WM0 A;  4QIB A;  3ARP A;  4KQZ A;  1CTN A;  3BMB A;  1LL4 A;  1LL7 A;  4QT2 A;  4WKH A;  5HKG A;  2RUR A;  4DRJ A;  1K9T A;  3B8S A;  3UQI A;  4QZV B;  5D75 A;  1BKF A;  3KZ7 A;  1ZK6 A;  1ZCN A;  3NRK A;  5DO2 A;  3IK8 A;  5HWC A;  3CGN A;  3AS2 A;  2PV2 A;  2D9F A;  2XP9 A;  3VAW A;  2WLZ A;  1EYM A;  3PRB A;  5BXJ A;  1D2K A;  2XP3 A;  4J4O A;  1TCO C;  1X6L A;  3O5P A;  5GQB A;  5HW6 A;  1GUV A;  1H0G A;  4WJX A;  4JYS A;  4W9P A;  5HW7 A;  4ODP A;  1E15 A;  1W1V A;  3ALF A;  1ZU8 A;  1E9L A;  1ZBC A;  1GRJ A;  2ETN A;  3WQV A;  2DT0 A;  1NMW A;  1HKK A;  2DT2 A;  2M2A A;  1E44 A;  3NTP A;  4ODK A;  3EIP A;  3KAG A;  4ITZ A;  1Q1C A;  4XAK A;  2MLX A;  3KAF A;  2AOS A;  3KAH A;  2XP7 A;  1FKJ A;  2A3E A;  3ARQ A;  1HKJ A;  4TW8 A;  1N1A A;  4IT4 A;  1U79 A;  3ODK A;  1HJV A;  3MDY B;  4QT3 A;  4MPK A;  2M1I A;  5HWB A;  2A3C A;  4JFI A;  2LPV A;  4Z2H A;  4ODN A;  3KCE A;  1FKB A;  4MAV A;  1HKM A;  1WNO A;  3OOB A;  2PPP A;  2F21 A;  4U84 A;  4URI A;  2B31 A;  2AWG A;  2RUC A;  3PRD A;  4W9O A;  2PN0 A;  4P8V A;  1E6P A;  2XP5 A;  1H0I A;  4UDM A;  1T11 A;  5GPG A;  4WK9 A;  1JNT A;  4HBO A;  2RUQ A;  3QOK A;  4O2T A;  2LGO A;  1QPL A;  3KAB A;  4NZC A;  4KR0 B;  1LJY A;  4GGQ A;  3ARY A;  2ESC A;  1FKG A;  4TYO A;  2ZQS A;  3ARS A;  2LJ4 A;  2VCD A;  1LG2 A;  1ROU A;  3I6C A;  1XHG A;  2MNT A;  3IKG A;  1LL6 A;  4TW7 A;  4U86 A;  4LGX A;  4NNR A;  4MNJ A;  1HXV A;  2RSE A;  1HJX A;  1NH6 A;  1W1P A;  2KI3 A;  3ARO A;  4DRN A;  4IQ2 A;  1WB0 A;  4HBE A;  5DIV A;  3B9A A;  3NI6 A;  3B7X A;  4Q22 A;  1HJW A;  2KR7 A;  4Z2J A;  4WIW A;  1NWU A;  2A3A A;  4IQC A;  4GIV A;  3O5D A;  4Z2I A;  5HT1 A;  3RM9 A;  1FKI A;  3O5M A;  3ARU A;  2DSU A;  2F2D A;  4U85 A;  4DRK A;  3AS1 A;  1J4H A;  4S3J A;  2VN1 A;  4G2P A;  1D6O A;  4JFJ A;  3UF8 A;  1JNE A;  1ITX A;  2XPB A;  3ARZ A;  4ODQ A;  2O92 A;  1FKH A;  5HBF A;  3RM4 A;  1NWS A;  2DSW A;  4ZS6 A;  4DWS B;  1GPF A;  4DWS C;  1LG1 A;  2DPE A;  1W1T A;  3ARX A;  5HW8 A;  3AQU A;  4WKF A;  3CGM A;  3RME A;  3CHC A;  1YW5 A;  5JH8 A;  3KAD A;  1OGG A;  1ZBK A;  4ODL A;  4DT4 A;  4FN2 A;  3O5G A;  2M08 A;  1FKT A;  3GPK A;  4LAV A;  4ZPV R;  2Q5A A;  4R5E A;  3B9E A;  3WD4 A;  4P8X A;  1OWQ A;  2XP6 A;  1EIB A;  2YBU A;  1LQ0 A;  1W9P A;  2G41 A;  3RFW A;  4DZ3 A;  5DF0 A;  1FKK A;  1YAT A;  3UI4 A;  4DRQ A;  5HUA A;  2UZ5 A;  4W5U A;  2N87 A;  5GPR A;  2DT3 A;  3IKD A;  4C02 B;  2O9O A;  4PTM A;  1ZB5 A;  1P5Q A;  1UR9 A;  1GOI A;  3BXW A;  1D7H A;  3FY1 A;  4TW6 A;  1Q6U A;  3JYJ A; 
#chains in the Genus database with same CATH homology
 2PV3 A;  1X6N A;  3UI6 A;  1F8A B;  1XRV A;  2ZQV A;  3UQA A;  2DG9 A;  3ARV A;  1PIN A;  3WD1 A;  1KT0 A;  3FAP A;  3RGC A;  4DIP A;  4TNS A;  1ROT A;  2WLY A;  4JFK A;  2L2S A;  2DSV A;  1QZ2 A;  2MLY A;  3UQB A;  3O5Q A;  2RUD A;  3O5K A;  3JXV A;  4ML4 A;  1FFR A;  1L1P A;  3O5R A;  3CHF A;  3UI5 A;  3W4R A;  1FAP A;  3ARW A;  1KFW A;  1W26 A;  1JND A;  4P8U A;  4L3N A;  3O5I A;  1D7I A;  3O5F A;  4DH0 A;  1IX5 A;  3H9R B;  2ZR5 A;  2KFW A;  1Q6I A;  2YBT A;  2ZQT A;  2FKE A;  4ZPT R;  4DRI A;  1UR8 A;  1NMV A;  4DWS A;  2KO7 A;  1FFQ A;  1D7J A;  5J6E A;  4HAR A;  4Z2G A;  1NSG A;  2A3B A;  4DRM A;  3PA7 A;  2RQS A;  1E6Z A;  2ZQU A;  4MNK A;  3ART A;  1JVW A;  3KAC A;  4P8W A;  2G8Z A;  4TX0 A;  1HKI A;  5DEZ A;  4MNM A;  3O5L A;  1W9U A;  4DZ2 A;  4ZPW R;  1W1Y A;  3PRA A;  1FKR A;  3WD0 A;  4IT6 A;  4AY1 A;  3TCZ A;  4L72 B;  4Q7N A;  2PI6 A;  4LAW A;  3WH0 A;  1A7X A;  2IF4 A;  4J4N A;  1FKL A;  2PV1 A;  1ZBV A;  1E6R A;  3WKZ A;  1J4R A;  4ODM A;  3OA5 A;  4MGV A;  2KGJ A;  4Z2L A;  3CH9 A;  2DSZ A;  5DIU A;  1O6I A;  1QPF A;  2ITK A;  5I98 A;  4ODR A;  3O5O A;  1ZBW A;  1F40 A;  3B9D A;  3LUO A;  1FD9 A;  1NWR A;  3ALG A;  4N19 A;  3CZ8 A;  1Q6H A;  2XPA A;  3KAI A;  3AS0 A;  1NWT A;  4Z2K A;  2PBC A;  1SR0 A;  1OGB A;  2ZR4 A;  3PR9 A;  1JNS A;  1FKS A;  1B6C A;  2F4E A;  2DT1 A;  4DWS D;  1E6N A;  2K8I A;  2XP4 A;  3CHE A;  1C9H A;  2PPO A;  4LAY A;  3FXY A;  1EDQ A;  2JZV A;  4DRP A;  4IPX A;  1RD6 A;  5DIT A;  2DG4 A;  1BL4 A;  1EHN A;  2XP8 A;  3ARR A;  3WD2 A;  4WKA A;  4S3K A;  3RM8 A;  3WD3 A;  5B8I C;  3G6M A;  4NSB A;  4R0X A;  3WIJ A;  3IHZ A;  3TDB A;  3WL1 A;  2Y78 A;  4G50 A;  1J6Y A;  1EQ3 A;  4MSP A;  1M5Y A;  1FKF A;  2PPN A;  4LAX A;  1W9V A;  2OFN A;  1J4I A;  2WK2 A;  1KT1 A;  1ZL1 A;  4FAP A;  1FKD A;  4DRO A;  1R9H A;  2FAP A;  3JYM A;  2MLZ A;  1FJD A;  2DG3 A;  2IUZ A;  2FDM A;  1Y0O A;  2MF9 A;  3EY6 A;  3G6L A;  2LKN A;  4JFL A;  2QF8 A;  2ZR6 A;  4MNL A;  4W9Q A;  3O5E A;  5HTG A;  1PBK A;  4BF8 A;  1WAW A;  4DRH A;  1SYT A;  3CHD A;  3WQW A;  3WL0 A;  2MPH A;  4ODO A;  3O5J A;  4MTV A;  1VF8 A;  4JFM A;  1TFV A;  2KE0 A;  2OLH A;  3TC5 A;  3AS3 A;  2WM0 A;  4QIB A;  3ARP A;  4KQZ A;  1CTN A;  1LL4 A;  1LL7 A;  4QT2 A;  4WKH A;  5HKG A;  2RUR A;  4DRJ A;  1K9T A;  3B8S A;  3UQI A;  4QZV B;  5D75 A;  1BKF A;  3KZ7 A;  1ZK6 A;  1ZCN A;  3NRK A;  5DO2 A;  3IK8 A;  5HWC A;  3CGN A;  3AS2 A;  2PV2 A;  2D9F A;  2XP9 A;  3VAW A;  2WLZ A;  1EYM A;  3PRB A;  5BXJ A;  1D2K A;  2XP3 A;  4J4O A;  1TCO C;  1X6L A;  3O5P A;  5GQB A;  5HW6 A;  1GUV A;  1H0G A;  4WJX A;  4JYS A;  4W9P A;  5HW7 A;  4ODP A;  1E15 A;  1W1V A;  3ALF A;  1ZU8 A;  1E9L A;  1ZBC A;  3WQV A;  2DT0 A;  1NMW A;  1HKK A;  2DT2 A;  2M2A A;  3NTP A;  4ODK A;  3KAG A;  4ITZ A;  1Q1C A;  4XAK A;  2MLX A;  3KAF A;  2AOS A;  3KAH A;  2XP7 A;  1FKJ A;  2A3E A;  3ARQ A;  1HKJ A;  4TW8 A;  1N1A A;  4IT4 A;  1U79 A;  3ODK A;  1HJV A;  3MDY B;  4QT3 A;  4MPK A;  2M1I A;  5HWB A;  2A3C A;  4JFI A;  2LPV A;  4Z2H A;  4ODN A;  3KCE A;  1FKB A;  4MAV A;  1HKM A;  1WNO A;  3OOB A;  2PPP A;  2F21 A;  4U84 A;  4URI A;  2B31 A;  2AWG A;  2RUC A;  3PRD A;  4W9O A;  4P8V A;  1E6P A;  2XP5 A;  1H0I A;  1T11 A;  5GPG A;  4WK9 A;  1JNT A;  4HBO A;  2RUQ A;  3QOK A;  4O2T A;  2LGO A;  1QPL A;  3KAB A;  4NZC A;  4KR0 B;  1LJY A;  4GGQ A;  3ARY A;  2ESC A;  1FKG A;  4TYO A;  2ZQS A;  3ARS A;  2LJ4 A;  2VCD A;  1LG2 A;  1ROU A;  3I6C A;  1XHG A;  2MNT A;  3IKG A;  1LL6 A;  4TW7 A;  4U86 A;  4LGX A;  4NNR A;  4MNJ A;  1HXV A;  2RSE A;  1HJX A;  1NH6 A;  1W1P A;  2KI3 A;  3ARO A;  4DRN A;  4IQ2 A;  1WB0 A;  4HBE A;  5DIV A;  3B9A A;  3NI6 A;  3B7X A;  4Q22 A;  1HJW A;  2KR7 A;  4Z2J A;  4WIW A;  1NWU A;  2A3A A;  4IQC A;  4GIV A;  3O5D A;  4Z2I A;  5HT1 A;  3RM9 A;  1FKI A;  3O5M A;  3ARU A;  2DSU A;  2F2D A;  4U85 A;  4DRK A;  3AS1 A;  1J4H A;  4S3J A;  2VN1 A;  4G2P A;  1D6O A;  4JFJ A;  3UF8 A;  1JNE A;  1ITX A;  2XPB A;  3ARZ A;  4ODQ A;  2O92 A;  1FKH A;  5HBF A;  3RM4 A;  1NWS A;  2DSW A;  4ZS6 A;  4DWS B;  1GPF A;  4DWS C;  1LG1 A;  2DPE A;  1W1T A;  3ARX A;  5HW8 A;  3AQU A;  4WKF A;  3CGM A;  3RME A;  3CHC A;  1YW5 A;  5JH8 A;  3KAD A;  1OGG A;  1ZBK A;  4ODL A;  4DT4 A;  4FN2 A;  3O5G A;  2M08 A;  1FKT A;  3GPK A;  4LAV A;  4ZPV R;  2Q5A A;  4R5E A;  3B9E A;  3WD4 A;  4P8X A;  1OWQ A;  2XP6 A;  1EIB A;  2YBU A;  1LQ0 A;  1W9P A;  2G41 A;  3RFW A;  4DZ3 A;  5DF0 A;  1FKK A;  1YAT A;  3UI4 A;  4DRQ A;  5HUA A;  2UZ5 A;  4W5U A;  2N87 A;  5GPR A;  2DT3 A;  3IKD A;  4C02 B;  2O9O A;  4PTM A;  1ZB5 A;  1P5Q A;  1UR9 A;  1GOI A;  3BXW A;  1D7H A;  3FY1 A;  4TW6 A;  1Q6U A;  3JYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...