3O5GA

Fk1 domain of fkbp51, crystal form i
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5gA00
2RUQA 3MDYB 3O5IA 3IHZA 4MSPA 3WH0A 4W9PA 1FKKA 4ODKA 1NMWA 4TW6A 2DG9A 1EQ3A 4C02B 3O5JA 4MGVA 3OOBA 1FKFA 2XPAA 1L1PA 1JNTA 3KACA 4DZ2A 2OFNA 4LAYA 2VCDA 1FKJA 5HTGA 4TYOA 2LJ4A 3NI6A 4U86A 2MLYA 5DIVA 2ZQSA 2M1IA 1FKRA 3JYJA 3LUOA 3JYMA 1D7JA 4U85A 3PA7A 3O5FA 4DRPA 4GIVA 1TCOC 1T11A 2LGOA 2PPOA 4QT3A 4TW7A 4DZ3A 5HW6A 1ROUA 4IQ2A 3O5QA 2PPPA 4FAPA 2F4EA 3RGCA 1N1AA 3TC5A 3EY6A 3I6CA 3UQBA 5HWBA 1FKHA 4ODNA 5DIUA 3VAWA 2K8IA 4NNRA 4DRHA 2PV2A 2KO7A 3KAHA 4IPXA 4DRIA 2ZR6A 4ITZA 3RFWA 4LAVA 2DG3A 3UI6A 2KGJA 4TW8A 1FKGA 2MLXA 1QPLA 2RURA 4QIBA 2Y78A 5GPGA 4LAWA 2ITKA 5J6EA 1KT0A 3KAGA 2KFWA 1PBKA 2AWGA 1EYMA 3CGNA 3KABA 5HKGA 1J4HA 1KT1A 1QZ2A 2Q5AA 5HWCA 2PPNA 3KZ7A 3B7XA 3O5EA 4GGQA 2RQSA 4DRKA 2DG4A 1FKIA 3UQAA 2ZR4A 3GPKA 4ODLA 5I98A 1W26A 1NSGA 1D6OA 3O5GA 3PRBA 4J4NA 4ODRA 1C9HA 1QPFA 4ODPA 3KAFA 1YW5A 2VN1A 2N87A 4O2TA 3UI4A 1FJDA 4U84A 2PV1A 2KI3A 3CGMA 1YATA 5HW8A 2MLZA 3O5MA 3UF8A 1P5QA 4W9OA 1FKDA 1JNSA 1BKFA 3KCEA 2XP4A 2XP3A 3O5RA 2XP6A 2ZR5A 1Q1CA 2F2DA 2F21A 2PV3A 4JFIA 1NMVA 3O5KA 2XP5A 1F40A 4DRQA 1ZK6A 4W9QA 2FKEA 4DT4A 1JVWA 5HW7A 1FD9A 2XPBA 3O5LA 1J4RA 2MNTA 2MPHA 3IKDA 4FN2A 5BXJA 1ZCNA 1J6YA 3UI5A 2D9FA 4J4OA 4DIPA 3H9RB 5D75A 3NTPA 1D7IA 3NRKA 1Q6HA 2MF9A 2LPVA 2ZQTA 4DROA 2ZQUA 3KAIA 4DRMA 4JYSA 3TCZA 1FKBA 2PBCA 2XP8A 1FKTA 2M2AA 1F8AB 3IK8A 1PINA 1U79A 1M5YA 2LKNA 4QT2A 4TX0A 1FKLA 2KE0A 4R0XA 1HXVA 2KR7A 4TNSA 3UQIA 3O5OA 5HT1A 1ROTA 4ODQA 4ODMA 2RSEA 3TDBA 3JXVA 4ODOA 2XP7A 2JZVA 3O5PA 5B8IC 3ODKA 1D7HA 4DRJA 4JFLA 2M08A 1R9HA 5DITA 2ZQVA 1BL4A 1Q6IA 2XP9A 4JFKA 4G2PA 1B6CA 3KADA 3PRDA 4N19A 2FAPA 4IQCA 2RUCA 4LAXA 5HUAA 1J4IA 1Q6UA 2UZ5A 3FAPA 3IKGA 4JFMA 1A7XA 4BF8A 4DRNA 3O5DA 4G50A 4JFJA 4DH0A 1FAPA 2IF4A 1FKSA 1Y0OA 2RUDA 2L2SA
chains in the Genus database with same CATH superfamily
2RUQA 3O5IA 3IHZA 3WH0A 1FKKA 4ODKA 4TW6A 3GTYX 3O5JA 4MGVA 2XPAA 1L1PA 2VCDA 2LJ4A 2MLYA 3ARPA 3PRAA 1E44A 3PA7A 3O5FA 3ARYA 4DRPA 1RD6A 4URIA 4DZ3A 2WM0A 1D2KA 3RGCA 3EY6A 3I6CA 3UQBA 1FKHA 1LG1A 2K8IA 4NNRA 3RM8A 2KO7A 2A3CA 4DRIA 1FFQA 3WQWA 2DG3A 4TW8A 2MLXA 1QPLA 4QIBA 1NWRA 1UR8A 2ITKA 1J4HA 2Q5AA 4DRKA 4MPKA 2RQSA 1VF8A 2DG4A 3UQAA 2ZR4A 1EDQA 1NH6A 2A3AA 1W1PA 3KAFA 4WKFA 4UDMA 3AS0A 2PV1A 2O92A 3CGMA 1YATA 5HW8A 1OWQA 3EIPA 2O9OA 3FY1A 2F21A 3CHCA 1FD9A 4FN2A 5BXJA 1LQ0A 5DO2A 1LG2A 4Q22A 1W9UA 2ETNA 2ZQUA 4JYSA 2PBCA 1GOIA 1FKTA 1F8AB 1PINA 1W1TA 1M5YA 2LKNA 1ITXA 4QT2A 4TX0A 4WKHA 2KE0A 3ARZA 4TNSA 4ODMA 3TDBA 2RSEA 2YBTA 1H0IA 4QZVB 3ODKA 3ARQA 4DRJA 4R5EA 4Z2JA 2XP9A 1Q6IA 4JFKA 3WD2A 3PRDA 1XHGA 4Q7NA 1HKJA 4IQCA 2RUCA 5HUAA 1J4IA 5DEZA 3O5DA 2YBUA 2RUDA 3MDYB 1CTNA 1NMWA 4WK9A 3QOKA 5GPRA 1FKFA 1HKKA 4Z2LA 1W1VA 2OFNA 4P8UA 1FKJA 4TYOA 4U86A 3JYMA 1D7JA 4P8WA 1T11A 1ROUA 4IQ2A 3O5QA 2PPPA 4FAPA 1HJVA 1N1AA 5DF0A 2WLZA 4ZPWR 5DIUA 1WAWA 2PV2A 3GU0A 3KAHA 1WNOA 2RURA 2DSWA 2DT2A 4WJXA 1KT0A 1ZBKA 1PBKA 1EYMA 3CGNA 3KABA 5HKGA 1LJYA 3WD3A 1GUVA 4ZPTR 1E6PA 2G8ZA 5HWCA 3B7XA 4Z2IA 1NWSA 4ML4A 5I98A 1W26A 1NSGA 3O5GA 2DT0A 4ODPA 1C9HA 1YW5A 2EULA 1ZL1A 2PN0A 4U84A 3CHFA 4P8VA 3O5MA 4W9OA 3KCEA 2XP3A 5GQBA 1Q1CA 4JFIA 2PV3A 1F40A 4DRQA 1ZK6A 5HW7A 1JVWA 1GRJA 3AQUA 1J6YA 4S3JA 3WL1A 5D75A 1Q6HA 2MF9A 1UR9A 1TFVA 4DROA 4DRMA 3TCZA 4MNKA 1FKBA 4DWSC 1FFRA 1FKLA 1H0GA 2A3EA 3O5OA 3ARTA 3ARRA 3CHDA 4IT6A 2XP7A 5B8IC 1ZBCA 3O5PA 4ZS6A 1D7HA 3W4RA 1R9HA 1BL4A 4G2PA 4ZPVR 2FAPA 1ZBVA 4JFMA 3B8SA 4DRNA 2WK2A 4G50A 4JFJA 4HBEA 1FKSA 2L2SA 4PTMA 2DG9A 1EQ3A 4XAKA 3OOBA 1JNTA 3RMEA 2FDMA 1W9VA 4DZ2A 4LAYA 3BMBA 1HJXA 5DIVA 2DSZA 2ZQSA 3JYJA 3LUOA 2G41A 1TCOC 2PPOA 3CHEA 4QT3A 3CH9A 5HW6A 4L3NA 3RM9A 4ODNA 3VAWA 1JNEA 4DRHA 4IPXA 2ZR6A 4ITZA 4LAVA 3UI6A 1X6NA 3FXYA 5GPGA 4LAWA 2AWGA 3B9EA 4WKAA 1KT1A 1QZ2A 4Z2HA 1SR0A 2F23A 2PPNA 3KZ7A 1HJWA 5HBFA 3GPKA 4ODLA 1D6OA 4ODRA 1LL6A 4NZCA 3AS2A 3WD4A 2N87A 3ALGA 3ARSA 2DSUA 1FJDA 1LL4A 3UF8A 1NWTA 4MTVA 2XP6A 1X6LA 1NMVA 2XP5A 3ARVA 4W9QA 2FKEA 2XPBA 1J4RA 2MPHA 3WIJA 1JCHB 3ALFA 3UI5A 2D9FA 3AS1A 3H9RB 5JH8A 3NTPA 3NRKA 2DSVA 1ZB5A 2LPVA 2ZQTA 3KAIA 3WL0A 1U79A 4S3KA 4R0XA 1HXVA 3B9DA 2KR7A 5HT1A 1ROTA 4ODQA 2B5UB 4AY1A 4ODOA 3WD1A 2OLHA 2ZQVA 1O6IA 3KADA 4N19A 4WIWA 2A3BA 2B31A 4MNLA 4W5UA 1A7XA 1Y0OA 3O5LA 3G6MA 4MSPA 4W9PA 4C02B 4MNMA 1EHNA 3CZ8A 3KACA 4DWSD 3AROA 2PI6A 5HTGA 3NI6A 3G6LA 2M1IA 1FKRA 4U85A 4GIVA 4Z2KA 2LGOA 4TW7A 2ESCA 4HARA 2DPEA 2F4EA 4DWSB 1NWUA 1IX5A 1W9PA 3TC5A 5HWBA 3BXWA 2DT1A 4KR0B 1OGGA 3ARUA 1E6RA 3RFWA 1ZU8A 2KGJA 1FKGA 2Y78A 5J6EA 3WKZA 3KAGA 2KFWA 3PR9A 3RM4A 3ARXA 1E15A 1JNDA 4L72B 3O5EA 4GGQA 1GPFA 1FKIA 4IT4A 2AOSA 4J4NA 3PRBA 1WB0A 1QPFA 4LGXA 3ARWA 2P4VA 2VN1A 4O2TA 3UI4A 1W1YA 2KI3A 2MLZA 1HKIA 1P5QA 1FKDA 1ZBWA 1JNSA 1BKFA 2XP4A 3O5RA 2ZR5A 4NSBA 2F2DA 1HKMA 3O5KA 1K9TA 2QF8A 4DT4A 1E6NA 2MNTA 3B9AA 3IKDA 1ZCNA 3AS3A 4J4OA 4DIPA 2IUZA 1E6ZA 1D7IA 1E9LA 4MAVA 1KFWA 2XP8A 2M2AA 3IK8A 1EIBA 4Z2GA 3UQIA 4KQZA 1SYTA 3JXVA 2JZVA 3OA5A 3WQVA 2DT3A 4JFLA 2M08A 5DITA 2WLYA 1B6CA 4MNJA 4DWSA 3WD0A 4LAXA 4P8XA 2UZ5A 1Q6UA 1XRVA 3FAPA 3IKGA 4BF8A 4HBOA 4DH0A 1FAPA 2IF4A 1LL7A 1OGBA
chains in the Genus database with same CATH topology
2RUQA 3O5IA 3IHZA 3WH0A 1FKKA 4ODKA 4TW6A 3O5JA 4MGVA 2XPAA 1L1PA 2VCDA 2LJ4A 2MLYA 3ARPA 3PRAA 3PA7A 3O5FA 3ARYA 4DRPA 1RD6A 4URIA 4DZ3A 2WM0A 1D2KA 3RGCA 3EY6A 3I6CA 3UQBA 1FKHA 1LG1A 2K8IA 4NNRA 3RM8A 2KO7A 2A3CA 4DRIA 1FFQA 3WQWA 2DG3A 4TW8A 2MLXA 1QPLA 4QIBA 1NWRA 1UR8A 2ITKA 1J4HA 2Q5AA 4DRKA 4MPKA 2RQSA 1VF8A 2DG4A 3UQAA 2ZR4A 1EDQA 1NH6A 2A3AA 1W1PA 3KAFA 4WKFA 3AS0A 2PV1A 2O92A 3CGMA 1YATA 5HW8A 1OWQA 2O9OA 3FY1A 2F21A 3CHCA 1FD9A 4FN2A 5BXJA 1LQ0A 5DO2A 1LG2A 4Q22A 1W9UA 2ZQUA 4JYSA 2PBCA 1GOIA 1FKTA 1F8AB 1PINA 1W1TA 1M5YA 2LKNA 1ITXA 4QT2A 4TX0A 4WKHA 2KE0A 3ARZA 4TNSA 4ODMA 3TDBA 2RSEA 2YBTA 1H0IA 4QZVB 3ODKA 3ARQA 4DRJA 4R5EA 4Z2JA 2XP9A 1Q6IA 4JFKA 3WD2A 3PRDA 1XHGA 4Q7NA 1HKJA 4IQCA 2RUCA 5HUAA 1J4IA 5DEZA 3O5DA 2YBUA 2RUDA 3MDYB 1CTNA 1NMWA 4WK9A 3QOKA 5GPRA 1FKFA 1HKKA 4Z2LA 1W1VA 2OFNA 4P8UA 1FKJA 4TYOA 4U86A 3JYMA 1D7JA 4P8WA 1T11A 1ROUA 4IQ2A 3O5QA 2PPPA 4FAPA 1HJVA 1N1AA 5DF0A 2WLZA 4ZPWR 5DIUA 1WAWA 2PV2A 3KAHA 1WNOA 2RURA 2DSWA 2DT2A 4WJXA 1KT0A 1ZBKA 1PBKA 1EYMA 3CGNA 3KABA 5HKGA 1LJYA 3WD3A 1GUVA 4ZPTR 1E6PA 2G8ZA 5HWCA 3B7XA 4Z2IA 1NWSA 4ML4A 5I98A 3O5GA 1NSGA 1W26A 2DT0A 4ODPA 1C9HA 1YW5A 1ZL1A 4U84A 3CHFA 4P8VA 3O5MA 4W9OA 3KCEA 2XP3A 5GQBA 1Q1CA 4JFIA 2PV3A 1F40A 4DRQA 1ZK6A 5HW7A 1JVWA 3AQUA 1J6YA 4S3JA 3WL1A 5D75A 1Q6HA 2MF9A 1UR9A 1TFVA 4DROA 4DRMA 3TCZA 4MNKA 1FKBA 4DWSC 1FFRA 1FKLA 1H0GA 2A3EA 3O5OA 3ARTA 3ARRA 3CHDA 4IT6A 2XP7A 5B8IC 1ZBCA 3O5PA 4ZS6A 1D7HA 3W4RA 1R9HA 1BL4A 4G2PA 4ZPVR 2FAPA 1ZBVA 4JFMA 3B8SA 4DRNA 2WK2A 4G50A 4JFJA 4HBEA 1FKSA 2L2SA 4PTMA 2DG9A 1EQ3A 4XAKA 3OOBA 1JNTA 3RMEA 2FDMA 1W9VA 4DZ2A 4LAYA 1HJXA 5DIVA 2DSZA 2ZQSA 3JYJA 3LUOA 2G41A 1TCOC 2PPOA 3CHEA 4QT3A 3CH9A 5HW6A 4L3NA 3RM9A 4ODNA 3VAWA 1JNEA 4DRHA 4IPXA 2ZR6A 4ITZA 4LAVA 3UI6A 1X6NA 3FXYA 5GPGA 4LAWA 2AWGA 3B9EA 4WKAA 1KT1A 1QZ2A 4Z2HA 1SR0A 2PPNA 3KZ7A 1HJWA 5HBFA 3GPKA 4ODLA 1D6OA 4ODRA 1LL6A 4NZCA 3AS2A 3WD4A 2N87A 3ALGA 3ARSA 2DSUA 1FJDA 1LL4A 3UF8A 1NWTA 4MTVA 2XP6A 1X6LA 1NMVA 2XP5A 3ARVA 4W9QA 2FKEA 2XPBA 1J4RA 2MPHA 3WIJA 3ALFA 3UI5A 2D9FA 3AS1A 3H9RB 5JH8A 3NTPA 3NRKA 2DSVA 1ZB5A 2LPVA 2ZQTA 3KAIA 3WL0A 1U79A 4S3KA 4R0XA 1HXVA 3B9DA 2KR7A 5HT1A 1ROTA 4ODQA 4AY1A 4ODOA 3WD1A 2OLHA 2ZQVA 1O6IA 3KADA 4N19A 4WIWA 2A3BA 2B31A 4MNLA 4W5UA 1A7XA 1Y0OA 3O5LA 3G6MA 4MSPA 4W9PA 4C02B 4MNMA 1EHNA 3CZ8A 3KACA 4DWSD 3AROA 2PI6A 5HTGA 3NI6A 3G6LA 2M1IA 1FKRA 4U85A 4GIVA 4Z2KA 2LGOA 4TW7A 2ESCA 4HARA 2DPEA 2F4EA 4DWSB 1NWUA 1IX5A 1W9PA 3TC5A 5HWBA 3BXWA 2DT1A 4KR0B 1OGGA 3ARUA 1E6RA 3RFWA 1ZU8A 2KGJA 1FKGA 2Y78A 5J6EA 3WKZA 3KAGA 2KFWA 3PR9A 3RM4A 3ARXA 1E15A 1JNDA 4L72B 3O5EA 4GGQA 1GPFA 1FKIA 4IT4A 2AOSA 4J4NA 3PRBA 1WB0A 1QPFA 4LGXA 3ARWA 2VN1A 4O2TA 3UI4A 1W1YA 2KI3A 2MLZA 1HKIA 1P5QA 1FKDA 1ZBWA 1JNSA 1BKFA 2XP4A 3O5RA 2ZR5A 4NSBA 2F2DA 1HKMA 3O5KA 1K9TA 2QF8A 4DT4A 1E6NA 2MNTA 3B9AA 3IKDA 1ZCNA 3AS3A 4J4OA 4DIPA 2IUZA 1E6ZA 1D7IA 1E9LA 4MAVA 1KFWA 2XP8A 2M2AA 3IK8A 1EIBA 4Z2GA 3UQIA 4KQZA 1SYTA 3JXVA 2JZVA 3OA5A 3WQVA 2DT3A 4JFLA 2M08A 5DITA 2WLYA 1B6CA 4MNJA 4DWSA 3WD0A 4LAXA 4P8XA 2UZ5A 1Q6UA 1XRVA 3FAPA 3IKGA 4BF8A 4HBOA 4DH0A 1FAPA 2IF4A 1LL7A 1OGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RUQ A;  3MDY B;  3O5I A;  3IHZ A;  4MSP A;  3WH0 A;  4W9P A;  1FKK A;  4ODK A;  1NMW A;  4TW6 A;  2DG9 A;  1EQ3 A;  4C02 B;  3O5J A;  4MGV A;  3OOB A;  1FKF A;  2XPA A;  1L1P A;  1JNT A;  3KAC A;  4DZ2 A;  2OFN A;  4LAY A;  2VCD A;  1FKJ A;  5HTG A;  4TYO A;  2LJ4 A;  3NI6 A;  4U86 A;  2MLY A;  5DIV A;  2ZQS A;  2M1I A;  1FKR A;  3JYJ A;  3LUO A;  3JYM A;  1D7J A;  4U85 A;  3PA7 A;  3O5F A;  4DRP A;  4GIV A;  1TCO C;  1T11 A;  2LGO A;  2PPO A;  4QT3 A;  4TW7 A;  4DZ3 A;  5HW6 A;  1ROU A;  4IQ2 A;  3O5Q A;  2PPP A;  4FAP A;  2F4E A;  3RGC A;  1N1A A;  3TC5 A;  3EY6 A;  3I6C A;  3UQB A;  5HWB A;  1FKH A;  4ODN A;  5DIU A;  3VAW A;  2K8I A;  4NNR A;  4DRH A;  2PV2 A;  2KO7 A;  3KAH A;  4IPX A;  4DRI A;  2ZR6 A;  4ITZ A;  3RFW A;  4LAV A;  2DG3 A;  3UI6 A;  2KGJ A;  4TW8 A;  1FKG A;  2MLX A;  1QPL A;  2RUR A;  4QIB A;  2Y78 A;  5GPG A;  4LAW A;  2ITK A;  5J6E A;  1KT0 A;  3KAG A;  2KFW A;  1PBK A;  2AWG A;  1EYM A;  3CGN A;  3KAB A;  5HKG A;  1J4H A;  1KT1 A;  1QZ2 A;  2Q5A A;  5HWC A;  2PPN A;  3KZ7 A;  3B7X A;  3O5E A;  4GGQ A;  2RQS A;  4DRK A;  2DG4 A;  1FKI A;  3UQA A;  2ZR4 A;  3GPK A;  4ODL A;  5I98 A;  1W26 A;  1NSG A;  1D6O A;  3O5G A;  3PRB A;  4J4N A;  4ODR A;  1C9H A;  1QPF A;  4ODP A;  3KAF A;  1YW5 A;  2VN1 A;  2N87 A;  4O2T A;  3UI4 A;  1FJD A;  4U84 A;  2PV1 A;  2KI3 A;  3CGM A;  1YAT A;  5HW8 A;  2MLZ A;  3O5M A;  3UF8 A;  1P5Q A;  4W9O A;  1FKD A;  1JNS A;  1BKF A;  3KCE A;  2XP4 A;  2XP3 A;  3O5R A;  2XP6 A;  2ZR5 A;  1Q1C A;  2F2D A;  2F21 A;  2PV3 A;  4JFI A;  1NMV A;  3O5K A;  2XP5 A;  1F40 A;  4DRQ A;  1ZK6 A;  4W9Q A;  2FKE A;  4DT4 A;  1JVW A;  5HW7 A;  1FD9 A;  2XPB A;  3O5L A;  1J4R A;  2MNT A;  2MPH A;  3IKD A;  4FN2 A;  5BXJ A;  1ZCN A;  1J6Y A;  3UI5 A;  2D9F A;  4J4O A;  4DIP A;  3H9R B;  5D75 A;  3NTP A;  1D7I A;  3NRK A;  1Q6H A;  2MF9 A;  2LPV A;  2ZQT A;  4DRO A;  2ZQU A;  3KAI A;  4DRM A;  4JYS A;  3TCZ A;  1FKB A;  2PBC A;  2XP8 A;  1FKT A;  2M2A A;  1F8A B;  3IK8 A;  1PIN A;  1U79 A;  1M5Y A;  2LKN A;  4QT2 A;  4TX0 A;  1FKL A;  2KE0 A;  4R0X A;  1HXV A;  2KR7 A;  4TNS A;  3UQI A;  3O5O A;  5HT1 A;  1ROT A;  4ODQ A;  4ODM A;  2RSE A;  3TDB A;  3JXV A;  4ODO A;  2XP7 A;  2JZV A;  3O5P A;  5B8I C;  3ODK A;  1D7H A;  4DRJ A;  4JFL A;  2M08 A;  1R9H A;  5DIT A;  2ZQV A;  1BL4 A;  1Q6I A;  2XP9 A;  4JFK A;  4G2P A;  1B6C A;  3KAD A;  3PRD A;  4N19 A;  2FAP A;  4IQC A;  2RUC A;  4LAX A;  5HUA A;  1J4I A;  1Q6U A;  2UZ5 A;  3FAP A;  3IKG A;  4JFM A;  1A7X A;  4BF8 A;  4DRN A;  3O5D A;  4G50 A;  4JFJ A;  4DH0 A;  1FAP A;  2IF4 A;  1FKS A;  1Y0O A;  2RUD A;  2L2S A; 
#chains in the Genus database with same CATH topology
 2RUQ A;  3O5I A;  3IHZ A;  3WH0 A;  1FKK A;  4ODK A;  4TW6 A;  3GTY X;  3O5J A;  4MGV A;  2XPA A;  1L1P A;  2VCD A;  2LJ4 A;  2MLY A;  3ARP A;  3PRA A;  1E44 A;  3PA7 A;  3O5F A;  3ARY A;  4DRP A;  1RD6 A;  4URI A;  4DZ3 A;  2WM0 A;  1D2K A;  3RGC A;  3EY6 A;  3I6C A;  3UQB A;  1FKH A;  1LG1 A;  2K8I A;  4NNR A;  3RM8 A;  2KO7 A;  2A3C A;  4DRI A;  1FFQ A;  3WQW A;  2DG3 A;  4TW8 A;  2MLX A;  1QPL A;  4QIB A;  1NWR A;  1UR8 A;  2ITK A;  1J4H A;  2Q5A A;  4DRK A;  4MPK A;  2RQS A;  1VF8 A;  2DG4 A;  3UQA A;  2ZR4 A;  1EDQ A;  1NH6 A;  2A3A A;  1W1P A;  3KAF A;  4WKF A;  4UDM A;  3AS0 A;  2PV1 A;  2O92 A;  3CGM A;  1YAT A;  5HW8 A;  1OWQ A;  3EIP A;  2O9O A;  3FY1 A;  2F21 A;  3CHC A;  1FD9 A;  4FN2 A;  5BXJ A;  1LQ0 A;  5DO2 A;  1LG2 A;  4Q22 A;  1W9U A;  2ETN A;  2ZQU A;  4JYS A;  2PBC A;  1GOI A;  1FKT A;  1F8A B;  1PIN A;  1W1T A;  1M5Y A;  2LKN A;  1ITX A;  4QT2 A;  4TX0 A;  4WKH A;  2KE0 A;  3ARZ A;  4TNS A;  4ODM A;  3TDB A;  2RSE A;  2YBT A;  1H0I A;  4QZV B;  3ODK A;  3ARQ A;  4DRJ A;  4R5E A;  4Z2J A;  2XP9 A;  1Q6I A;  4JFK A;  3WD2 A;  3PRD A;  1XHG A;  4Q7N A;  1HKJ A;  4IQC A;  2RUC A;  5HUA A;  1J4I A;  5DEZ A;  3O5D A;  2YBU A;  2RUD A;  3MDY B;  1CTN A;  1NMW A;  4WK9 A;  3QOK A;  5GPR A;  1FKF A;  1HKK A;  4Z2L A;  1W1V A;  2OFN A;  4P8U A;  1FKJ A;  4TYO A;  4U86 A;  3JYM A;  1D7J A;  4P8W A;  1T11 A;  1ROU A;  4IQ2 A;  3O5Q A;  2PPP A;  4FAP A;  1HJV A;  1N1A A;  5DF0 A;  2WLZ A;  4ZPW R;  5DIU A;  1WAW A;  2PV2 A;  3GU0 A;  3KAH A;  1WNO A;  2RUR A;  2DSW A;  2DT2 A;  4WJX A;  1KT0 A;  1ZBK A;  1PBK A;  1EYM A;  3CGN A;  3KAB A;  5HKG A;  1LJY A;  3WD3 A;  1GUV A;  4ZPT R;  1E6P A;  2G8Z A;  5HWC A;  3B7X A;  4Z2I A;  1NWS A;  4ML4 A;  5I98 A;  1W26 A;  1NSG A;  3O5G A;  2DT0 A;  4ODP A;  1C9H A;  1YW5 A;  2EUL A;  1ZL1 A;  2PN0 A;  4U84 A;  3CHF A;  4P8V A;  3O5M A;  4W9O A;  3KCE A;  2XP3 A;  5GQB A;  1Q1C A;  4JFI A;  2PV3 A;  1F40 A;  4DRQ A;  1ZK6 A;  5HW7 A;  1JVW A;  1GRJ A;  3AQU A;  1J6Y A;  4S3J A;  3WL1 A;  5D75 A;  1Q6H A;  2MF9 A;  1UR9 A;  1TFV A;  4DRO A;  4DRM A;  3TCZ A;  4MNK A;  1FKB A;  4DWS C;  1FFR A;  1FKL A;  1H0G A;  2A3E A;  3O5O A;  3ART A;  3ARR A;  3CHD A;  4IT6 A;  2XP7 A;  5B8I C;  1ZBC A;  3O5P A;  4ZS6 A;  1D7H A;  3W4R A;  1R9H A;  1BL4 A;  4G2P A;  4ZPV R;  2FAP A;  1ZBV A;  4JFM A;  3B8S A;  4DRN A;  2WK2 A;  4G50 A;  4JFJ A;  4HBE A;  1FKS A;  2L2S A;  4PTM A;  2DG9 A;  1EQ3 A;  4XAK A;  3OOB A;  1JNT A;  3RME A;  2FDM A;  1W9V A;  4DZ2 A;  4LAY A;  3BMB A;  1HJX A;  5DIV A;  2DSZ A;  2ZQS A;  3JYJ A;  3LUO A;  2G41 A;  1TCO C;  2PPO A;  3CHE A;  4QT3 A;  3CH9 A;  5HW6 A;  4L3N A;  3RM9 A;  4ODN A;  3VAW A;  1JNE A;  4DRH A;  4IPX A;  2ZR6 A;  4ITZ A;  4LAV A;  3UI6 A;  1X6N A;  3FXY A;  5GPG A;  4LAW A;  2AWG A;  3B9E A;  4WKA A;  1KT1 A;  1QZ2 A;  4Z2H A;  1SR0 A;  2F23 A;  2PPN A;  3KZ7 A;  1HJW A;  5HBF A;  3GPK A;  4ODL A;  1D6O A;  4ODR A;  1LL6 A;  4NZC A;  3AS2 A;  3WD4 A;  2N87 A;  3ALG A;  3ARS A;  2DSU A;  1FJD A;  1LL4 A;  3UF8 A;  1NWT A;  4MTV A;  2XP6 A;  1X6L A;  1NMV A;  2XP5 A;  3ARV A;  4W9Q A;  2FKE A;  2XPB A;  1J4R A;  2MPH A;  3WIJ A;  1JCH B;  3ALF A;  3UI5 A;  2D9F A;  3AS1 A;  3H9R B;  5JH8 A;  3NTP A;  3NRK A;  2DSV A;  1ZB5 A;  2LPV A;  2ZQT A;  3KAI A;  3WL0 A;  1U79 A;  4S3K A;  4R0X A;  1HXV A;  3B9D A;  2KR7 A;  5HT1 A;  1ROT A;  4ODQ A;  2B5U B;  4AY1 A;  4ODO A;  3WD1 A;  2OLH A;  2ZQV A;  1O6I A;  3KAD A;  4N19 A;  4WIW A;  2A3B A;  2B31 A;  4MNL A;  4W5U A;  1A7X A;  1Y0O A;  3O5L A;  3G6M A;  4MSP A;  4W9P A;  4C02 B;  4MNM A;  1EHN A;  3CZ8 A;  3KAC A;  4DWS D;  3ARO A;  2PI6 A;  5HTG A;  3NI6 A;  3G6L A;  2M1I A;  1FKR A;  4U85 A;  4GIV A;  4Z2K A;  2LGO A;  4TW7 A;  2ESC A;  4HAR A;  2DPE A;  2F4E A;  4DWS B;  1NWU A;  1IX5 A;  1W9P A;  3TC5 A;  5HWB A;  3BXW A;  2DT1 A;  4KR0 B;  1OGG A;  3ARU A;  1E6R A;  3RFW A;  1ZU8 A;  2KGJ A;  1FKG A;  2Y78 A;  5J6E A;  3WKZ A;  3KAG A;  2KFW A;  3PR9 A;  3RM4 A;  3ARX A;  1E15 A;  1JND A;  4L72 B;  3O5E A;  4GGQ A;  1GPF A;  1FKI A;  4IT4 A;  2AOS A;  4J4N A;  3PRB A;  1WB0 A;  1QPF A;  4LGX A;  3ARW A;  2P4V A;  2VN1 A;  4O2T A;  3UI4 A;  1W1Y A;  2KI3 A;  2MLZ A;  1HKI A;  1P5Q A;  1FKD A;  1ZBW A;  1JNS A;  1BKF A;  2XP4 A;  3O5R A;  2ZR5 A;  4NSB A;  2F2D A;  1HKM A;  3O5K A;  1K9T A;  2QF8 A;  4DT4 A;  1E6N A;  2MNT A;  3B9A A;  3IKD A;  1ZCN A;  3AS3 A;  4J4O A;  4DIP A;  2IUZ A;  1E6Z A;  1D7I A;  1E9L A;  4MAV A;  1KFW A;  2XP8 A;  2M2A A;  3IK8 A;  1EIB A;  4Z2G A;  3UQI A;  4KQZ A;  1SYT A;  3JXV A;  2JZV A;  3OA5 A;  3WQV A;  2DT3 A;  4JFL A;  2M08 A;  5DIT A;  2WLY A;  1B6C A;  4MNJ A;  4DWS A;  3WD0 A;  4LAX A;  4P8X A;  2UZ5 A;  1Q6U A;  1XRV A;  3FAP A;  3IKG A;  4BF8 A;  4HBO A;  4DH0 A;  1FAP A;  2IF4 A;  1LL7 A;  1OGB A; 
#chains in the Genus database with same CATH homology
 2RUQ A;  3O5I A;  3IHZ A;  3WH0 A;  1FKK A;  4ODK A;  4TW6 A;  3O5J A;  4MGV A;  2XPA A;  1L1P A;  2VCD A;  2LJ4 A;  2MLY A;  3ARP A;  3PRA A;  3PA7 A;  3O5F A;  3ARY A;  4DRP A;  1RD6 A;  4URI A;  4DZ3 A;  2WM0 A;  1D2K A;  3RGC A;  3EY6 A;  3I6C A;  3UQB A;  1FKH A;  1LG1 A;  2K8I A;  4NNR A;  3RM8 A;  2KO7 A;  2A3C A;  4DRI A;  1FFQ A;  3WQW A;  2DG3 A;  4TW8 A;  2MLX A;  1QPL A;  4QIB A;  1NWR A;  1UR8 A;  2ITK A;  1J4H A;  2Q5A A;  4DRK A;  4MPK A;  2RQS A;  1VF8 A;  2DG4 A;  3UQA A;  2ZR4 A;  1EDQ A;  1NH6 A;  2A3A A;  1W1P A;  3KAF A;  4WKF A;  3AS0 A;  2PV1 A;  2O92 A;  3CGM A;  1YAT A;  5HW8 A;  1OWQ A;  2O9O A;  3FY1 A;  2F21 A;  3CHC A;  1FD9 A;  4FN2 A;  5BXJ A;  1LQ0 A;  5DO2 A;  1LG2 A;  4Q22 A;  1W9U A;  2ZQU A;  4JYS A;  2PBC A;  1GOI A;  1FKT A;  1F8A B;  1PIN A;  1W1T A;  1M5Y A;  2LKN A;  1ITX A;  4QT2 A;  4TX0 A;  4WKH A;  2KE0 A;  3ARZ A;  4TNS A;  4ODM A;  3TDB A;  2RSE A;  2YBT A;  1H0I A;  4QZV B;  3ODK A;  3ARQ A;  4DRJ A;  4R5E A;  4Z2J A;  2XP9 A;  1Q6I A;  4JFK A;  3WD2 A;  3PRD A;  1XHG A;  4Q7N A;  1HKJ A;  4IQC A;  2RUC A;  5HUA A;  1J4I A;  5DEZ A;  3O5D A;  2YBU A;  2RUD A;  3MDY B;  1CTN A;  1NMW A;  4WK9 A;  3QOK A;  5GPR A;  1FKF A;  1HKK A;  4Z2L A;  1W1V A;  2OFN A;  4P8U A;  1FKJ A;  4TYO A;  4U86 A;  3JYM A;  1D7J A;  4P8W A;  1T11 A;  1ROU A;  4IQ2 A;  3O5Q A;  2PPP A;  4FAP A;  1HJV A;  1N1A A;  5DF0 A;  2WLZ A;  4ZPW R;  5DIU A;  1WAW A;  2PV2 A;  3KAH A;  1WNO A;  2RUR A;  2DSW A;  2DT2 A;  4WJX A;  1KT0 A;  1ZBK A;  1PBK A;  1EYM A;  3CGN A;  3KAB A;  5HKG A;  1LJY A;  3WD3 A;  1GUV A;  4ZPT R;  1E6P A;  2G8Z A;  5HWC A;  3B7X A;  4Z2I A;  1NWS A;  4ML4 A;  5I98 A;  3O5G A;  1NSG A;  1W26 A;  2DT0 A;  4ODP A;  1C9H A;  1YW5 A;  1ZL1 A;  4U84 A;  3CHF A;  4P8V A;  3O5M A;  4W9O A;  3KCE A;  2XP3 A;  5GQB A;  1Q1C A;  4JFI A;  2PV3 A;  1F40 A;  4DRQ A;  1ZK6 A;  5HW7 A;  1JVW A;  3AQU A;  1J6Y A;  4S3J A;  3WL1 A;  5D75 A;  1Q6H A;  2MF9 A;  1UR9 A;  1TFV A;  4DRO A;  4DRM A;  3TCZ A;  4MNK A;  1FKB A;  4DWS C;  1FFR A;  1FKL A;  1H0G A;  2A3E A;  3O5O A;  3ART A;  3ARR A;  3CHD A;  4IT6 A;  2XP7 A;  5B8I C;  1ZBC A;  3O5P A;  4ZS6 A;  1D7H A;  3W4R A;  1R9H A;  1BL4 A;  4G2P A;  4ZPV R;  2FAP A;  1ZBV A;  4JFM A;  3B8S A;  4DRN A;  2WK2 A;  4G50 A;  4JFJ A;  4HBE A;  1FKS A;  2L2S A;  4PTM A;  2DG9 A;  1EQ3 A;  4XAK A;  3OOB A;  1JNT A;  3RME A;  2FDM A;  1W9V A;  4DZ2 A;  4LAY A;  1HJX A;  5DIV A;  2DSZ A;  2ZQS A;  3JYJ A;  3LUO A;  2G41 A;  1TCO C;  2PPO A;  3CHE A;  4QT3 A;  3CH9 A;  5HW6 A;  4L3N A;  3RM9 A;  4ODN A;  3VAW A;  1JNE A;  4DRH A;  4IPX A;  2ZR6 A;  4ITZ A;  4LAV A;  3UI6 A;  1X6N A;  3FXY A;  5GPG A;  4LAW A;  2AWG A;  3B9E A;  4WKA A;  1KT1 A;  1QZ2 A;  4Z2H A;  1SR0 A;  2PPN A;  3KZ7 A;  1HJW A;  5HBF A;  3GPK A;  4ODL A;  1D6O A;  4ODR A;  1LL6 A;  4NZC A;  3AS2 A;  3WD4 A;  2N87 A;  3ALG A;  3ARS A;  2DSU A;  1FJD A;  1LL4 A;  3UF8 A;  1NWT A;  4MTV A;  2XP6 A;  1X6L A;  1NMV A;  2XP5 A;  3ARV A;  4W9Q A;  2FKE A;  2XPB A;  1J4R A;  2MPH A;  3WIJ A;  3ALF A;  3UI5 A;  2D9F A;  3AS1 A;  3H9R B;  5JH8 A;  3NTP A;  3NRK A;  2DSV A;  1ZB5 A;  2LPV A;  2ZQT A;  3KAI A;  3WL0 A;  1U79 A;  4S3K A;  4R0X A;  1HXV A;  3B9D A;  2KR7 A;  5HT1 A;  1ROT A;  4ODQ A;  4AY1 A;  4ODO A;  3WD1 A;  2OLH A;  2ZQV A;  1O6I A;  3KAD A;  4N19 A;  4WIW A;  2A3B A;  2B31 A;  4MNL A;  4W5U A;  1A7X A;  1Y0O A;  3O5L A;  3G6M A;  4MSP A;  4W9P A;  4C02 B;  4MNM A;  1EHN A;  3CZ8 A;  3KAC A;  4DWS D;  3ARO A;  2PI6 A;  5HTG A;  3NI6 A;  3G6L A;  2M1I A;  1FKR A;  4U85 A;  4GIV A;  4Z2K A;  2LGO A;  4TW7 A;  2ESC A;  4HAR A;  2DPE A;  2F4E A;  4DWS B;  1NWU A;  1IX5 A;  1W9P A;  3TC5 A;  5HWB A;  3BXW A;  2DT1 A;  4KR0 B;  1OGG A;  3ARU A;  1E6R A;  3RFW A;  1ZU8 A;  2KGJ A;  1FKG A;  2Y78 A;  5J6E A;  3WKZ A;  3KAG A;  2KFW A;  3PR9 A;  3RM4 A;  3ARX A;  1E15 A;  1JND A;  4L72 B;  3O5E A;  4GGQ A;  1GPF A;  1FKI A;  4IT4 A;  2AOS A;  4J4N A;  3PRB A;  1WB0 A;  1QPF A;  4LGX A;  3ARW A;  2VN1 A;  4O2T A;  3UI4 A;  1W1Y A;  2KI3 A;  2MLZ A;  1HKI A;  1P5Q A;  1FKD A;  1ZBW A;  1JNS A;  1BKF A;  2XP4 A;  3O5R A;  2ZR5 A;  4NSB A;  2F2D A;  1HKM A;  3O5K A;  1K9T A;  2QF8 A;  4DT4 A;  1E6N A;  2MNT A;  3B9A A;  3IKD A;  1ZCN A;  3AS3 A;  4J4O A;  4DIP A;  2IUZ A;  1E6Z A;  1D7I A;  1E9L A;  4MAV A;  1KFW A;  2XP8 A;  2M2A A;  3IK8 A;  1EIB A;  4Z2G A;  3UQI A;  4KQZ A;  1SYT A;  3JXV A;  2JZV A;  3OA5 A;  3WQV A;  2DT3 A;  4JFL A;  2M08 A;  5DIT A;  2WLY A;  1B6C A;  4MNJ A;  4DWS A;  3WD0 A;  4LAX A;  4P8X A;  2UZ5 A;  1Q6U A;  1XRV A;  3FAP A;  3IKG A;  4BF8 A;  4HBO A;  4DH0 A;  1FAP A;  2IF4 A;  1LL7 A;  1OGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...