3O5FA

Fk1 domain of fkbp51, crystal form vii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
b'TATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
molecule tags Isomerase
source organism Homo sapiens
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
total genus 34
structure length 125
sequence length 125
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5fA00
1FKKA 1PBKA 1Q1CA 4MGVA 2XP9A 4ODLA 1Y0OA 2IF4A 1FJDA 4ODRA 4FN2A 4DH0A 3PRDA 2XP4A 3IHZA 4DRPA 1ROUA 1J6YA 1HXVA 3TDBA 1FKTA 1F40A 3OOBA 3FAPA 4TW6A 3O5OA 3UI5A 2FKEA 1Q6UA 4GGQA 3UQBA 2XP6A 1FKHA 1B6CA 1NSGA 4JFJA 3UI4A 4LAWA 1JNSA 1Q6HA 1L1PA 2LJ4A 1EYMA 4W9QA 3JXVA 4ODNA 4QT2A 4TYOA 5HW7A 2LGOA 4ITZA 4C02B 3KAIA 1FKFA 1JVWA 3CGMA 1FKIA 2ZQUA 3ODKA 2JZVA 3KAFA 2K8IA 3PA7A 4JFMA 4ODOA 4TW8A 2F2DA 1JNTA 3RFWA 3JYJA 3UQIA 3KAHA 1QPFA 4W9OA 2KFWA 2MLZA 4U86A 4DRNA 2DG4A 1BKFA 5HTGA 3NTPA 1U79A 1A7XA 4U85A 1Q6IA 2PPNA 3O5MA 3NRKA 3VAWA 1FKSA 1EQ3A 4R0XA 4JFLA 3O5FA 4U84A 3KAGA 4DRIA 4ODMA 4DRJA 3O5GA 4DRHA 1QPLA 1FKJA 1PINA 2PBCA 4TX0A 1W26A 2PPPA 3O5KA 2PV1A 3CGNA 4JYSA 1J4IA 4FAPA 2VCDA 3KABA 4JFKA 4N19A 1KT1A 2PV3A 2FAPA 2RUCA 2ZQTA 1NMVA 3IKDA 5DITA 5HWBA 2F21A 1D6OA 4O2TA 3UI6A 1NMWA 1FKRA 4TNSA 2XPBA 4IQ2A 4J4NA 3JYMA 3TC5A 2KO7A 1BL4A 3H9RB 3O5EA 5BXJA 3IKGA 1N1AA 1FKDA 1FKLA 2MF9A 2MPHA 2D9FA 5D75A 3O5QA 1D7HA 3O5DA 1J4RA 2UZ5A 4G50A 2RSEA 3KCEA 1ROTA 1D7JA 3EY6A 3IK8A 4IPXA 3I6CA 4G2PA 1YW5A 2XP3A 1FKBA 3RGCA 3WH0A 5I98A 5HW6A 4LAYA 5HWCA 1TCOC 2N87A 3KADA 2LKNA 1FAPA 4W9PA 1C9HA 5HT1A 5J6EA 4GIVA 1KT0A 4DIPA 1R9HA 2RUQA 1D7IA 2RURA 4LAVA 4QIBA 2DG9A 1ZCNA 2OFNA 3MDYB 3O5PA 4IQCA 4DROA 2XP5A 2M1IA 5HW8A 1FD9A 2KR7A 1YATA 2Q5AA 3TCZA 4DZ2A 3UQAA 1J4HA 4DZ3A 3B7XA 2PPOA 4QT3A 4ODKA 3UF8A 2L2SA 1F8AB 2PV2A 3KACA 4ODPA 1T11A 2XPAA 3NI6A 3PRBA 4ODQA 4TW7A 4NNRA 2DG3A 3O5IA 2XP7A 2MNTA 2ZR4A 4MSPA 5B8IC 2MLYA 2ZQVA 3GPKA 2ZR6A 2AWGA 5DIVA 5GPGA 3O5RA 2XP8A 4DRMA 2M08A 1QZ2A 2MLXA 5HUAA 4J4OA 1P5QA 5DIUA 2KGJA 4DT4A 2RQSA 4BF8A 2RUDA 2M2AA 2LPVA 3LUOA 2ITKA 2ZQSA 3O5JA 4LAXA 1ZK6A 1FKGA 2VN1A 3O5LA 4JFIA 4DRKA 2KE0A 2Y78A 3KZ7A 2ZR5A 2F4EA 2KI3A 4DRQA 5HKGA 1M5YA
chains in the Genus database with same CATH superfamily
1Q1CA 2XP9A 2IF4A 1FJDA 4FN2A 3ARSA 2DSZA 3TDBA 1E6RA 3OOBA 1LG2A 4TW6A 3O5OA 3UI5A 2FKEA 3UQBA 1L1PA 2LJ4A 1EYMA 3JXVA 4ODNA 5HW7A 1SR0A 4ITZA 3KAIA 3ARWA 3ODKA 1FKIA 2K8IA 1JNTA 3RM9A 1QPFA 4U86A 1W1YA 3NTPA 2PPNA 4S3JA 4R0XA 4JFLA 3AS2A 4Z2GA 3KAGA 4DRJA 1NH6A 1W1VA 2PPPA 3O5KA 3CGNA 1UR8A 1ITXA 1J4IA 4JFKA 4N19A 3ARQA 4P8WA 2F21A 2A3CA 2G41A 3AS0A 1NMWA 4TNSA 2XPBA 4IQ2A 1ZB5A 1JNEA 1NWSA 5BXJA 1N1AA 1UR9A 1LL7A 1VF8A 3O5QA 2UZ5A 3WL0A 2RSEA 3KCEA 3EY6A 3GTYX 5HWCA 2N87A 5J6EA 5HT1A 5JH8A 3ARRA 1OGBA 4GIVA 1W1TA 1E6NA 3EIPA 3ARTA 4PTMA 1E9LA 4AY1A 2FDMA 2Q5AA 3TCZA 3CHDA 4WIWA 4ODKA 2DPEA 2PV2A 1T11A 4DWSB 4XAKA 2PN0A 2XP7A 2MNTA 4QZVB 3FXYA 5B8IC 2ZQVA 3GPKA 2ZR6A 2AWGA 1O6IA 5DIVA 3RM8A 2MLXA 3AROA 5HUAA 4J4OA 1P5QA 1HKJA 3FY1A 2EULA 1H0GA 3LUOA 3O5JA 1ZK6A 3ARPA 1H0IA 2KE0A 2Y78A 3BXWA 4DRQA 5HKGA 1M5YA 4MGVA 4DH0A 2DT3A 3PRDA 2A3BA 1ROUA 1FKTA 2DT2A 1ZU8A 4IT6A 1Q6UA 1B6CA 3ARZA 3UI4A 1Q6HA 4DWSA 3ALFA 1ZBCA 3WL1A 2AOSA 3PA7A 4ODOA 3BMBA 1XHGA 4S3KA 1RD6A 1LL4A 4W9OA 2MLZA 1ZBWA 1XRVA 1BKFA 1U79A 4U85A 1EQ3A 5DEZA 4ODMA 3O5GA 1KFWA 3G6LA 1W26A 3B9DA 3KABA 2RUCA 2FAPA 3G6MA 4Z2KA 1D6OA 3UI6A 3JYMA 2KO7A 1BL4A 3H9RB 3WIJA 3IKGA 4WKAA 1FKDA 5DO2A 2D9FA 2YBTA 5D75A 1W9PA 4ZS6A 1D7HA 3WD3A 1J4RA 1D7JA 1ZBKA 4IPXA 5I98A 2G8ZA 4WK9A 3B9EA 4Z2IA 2WK2A 3KADA 4W9PA 1IX5A 4MAVA 4DIPA 1GUVA 3CHCA 1D7IA 4TW8A 4Z2LA 1HJVA 4HBOA 1FFRA 2M1IA 3CHFA 1NWUA 4W5UA 2KR7A 1HKKA 4DZ2A 3B7XA 3KACA 2XPAA 4DWSC 2DG3A 1LQ0A 2XP8A 2M08A 3WD4A 2A3AA 3WD1A 2A3EA 4BF8A 1K9TA 2LPVA 1LJYA 3O5LA 1FKGA 4JFIA 3RM4A 1ZBVA 2PI6A 2YBUA 1FFQA 1FKKA 1PBKA 4ODLA 4NSBA 1Y0OA 4ODRA 1W1PA 3IHZA 4DRPA 1HXVA 1HJXA 3AS1A 3FAPA 3CH9A 4IT4A 3WQVA 1FKHA 4JFJA 4KR0B 4QT2A 2ESCA 4ZPVR 1GPFA 3CGMA 4JFMA 2ZQUA 2JZVA 4MNMA 1EIBA 4L72B 2F2DA 3RFWA 3JYJA 3UQIA 1D2KA 2KFWA 4DRNA 3PRAA 2OLHA 4URIA 1A7XA 1Q6IA 1FKSA 4UDMA 4MNLA 3O5FA 1E15A 4DRHA 1QPLA 1EDQA 1PINA 4TX0A 3ARXA 4MNKA 2PV1A 1E44A 1E6ZA 2PV3A 3IKDA 2DSUA 4MPKA 5HWBA 4J4NA 3ALGA 3O5EA 4L3NA 3PR9A 4G50A 3O5DA 3IK8A 2P4VA 1OWQA 3I6CA 1YW5A 3WH0A 3RGCA 4LAYA 2LKNA 1FAPA 4LAVA 2RUQA 2RURA 4W9QA 2DG9A 1ZCNA 1LG1A 3MDYB 4IQCA 5HW8A 1FD9A 5HBFA 1WAWA 4WKHA 1YATA 1CTNA 4DZ3A 1EHNA 4QT3A 2L2SA 1NWTA 3CHEA 2WM0A 4R5EA 3PRBA 4ODQA 3OA5A 2O92A 4NNRA 2O9OA 2ZR4A 1LL6A 4MSPA 2MLYA 3W4RA 4MTVA 1QZ2A 5DIUA 2KGJA 4WKFA 3WD2A 2RQSA 2DSVA 4ML4A 1HKMA 1ZL1A 2M2AA 3GU0A 4P8XA 4LAXA 2VN1A 4NZCA 2DT1A 1NWRA 1GOIA 2ZR5A 2F4EA 3RMEA 2XP4A 1WB0A 1J6YA 3AQUA 1F40A 5GQBA 1W9VA 2QF8A 4GGQA 2XP6A 1NSGA 5GPRA 4LAWA 1JNSA 4MNJA 4TYOA 1HKIA 2LGOA 5DF0A 4C02B 1FKFA 3KAFA 1TFVA 3ARYA 1E6PA 3CZ8A 3KAHA 4Z2HA 2DG4A 5HTGA 2F23A 1X6NA 2ETNA 3O5MA 3NRKA 3VAWA 4Q7NA 4Z2JA 4U84A 4DRIA 4HARA 1FKJA 2PBCA 3AS3A 4P8VA 1X6LA 4FAPA 4JYSA 2VCDA 4Q22A 1KT1A 5DITA 2ZQTA 1NMVA 4HBEA 2DT0A 4O2TA 3WKZA 1FKRA 3TC5A 1FKLA 2MF9A 2MPHA 4LGXA 3WD0A 1ROTA 4G2PA 2XP3A 1JCHB 1FKBA 1OGGA 2B31A 5HW6A 4ZPWR 1TCOC 1SYTA 1C9HA 1KT0A 1R9HA 1W9UA 4QIBA 2OFNA 3O5PA 3ARUA 4DROA 2XP5A 3ARVA 4DWSD 3UQAA 1J4HA 1WNOA 4ZPTR 2PPOA 3UF8A 2IUZA 1F8AB 4ODPA 3NI6A 4TW7A 3B9AA 3QOKA 1JNDA 3O5IA 1HJWA 5GPGA 3O5RA 4DRMA 4KQZA 1GRJA 4DT4A 2B5UB 3WQWA 2RUDA 2WLYA 2ITKA 2ZQSA 4WJXA 3B8SA 2DSWA 4DRKA 3KZ7A 2KI3A 1JVWA 2WLZA 4P8UA
chains in the Genus database with same CATH topology
1Q1CA 2XP9A 2IF4A 1FJDA 4FN2A 3ARSA 2DSZA 3TDBA 1E6RA 3OOBA 1LG2A 4TW6A 3O5OA 3UI5A 2FKEA 3UQBA 1L1PA 2LJ4A 1EYMA 3JXVA 4ODNA 5HW7A 1SR0A 4ITZA 3KAIA 3ARWA 3ODKA 1FKIA 2K8IA 1JNTA 3RM9A 1QPFA 4U86A 1W1YA 3NTPA 2PPNA 4S3JA 4R0XA 4JFLA 3AS2A 4Z2GA 3KAGA 4DRJA 1NH6A 1W1VA 2PPPA 3O5KA 3CGNA 1UR8A 1ITXA 1J4IA 4JFKA 4N19A 3ARQA 4P8WA 2F21A 2A3CA 2G41A 3AS0A 1NMWA 4TNSA 2XPBA 4IQ2A 1ZB5A 1JNEA 1NWSA 5BXJA 1N1AA 1UR9A 1LL7A 1VF8A 3O5QA 2UZ5A 3WL0A 2RSEA 3KCEA 3EY6A 5HWCA 2N87A 5J6EA 5HT1A 5JH8A 3ARRA 1OGBA 4GIVA 1W1TA 1E6NA 3ARTA 4PTMA 1E9LA 4AY1A 2FDMA 2Q5AA 3TCZA 3CHDA 4WIWA 4ODKA 2DPEA 2PV2A 1T11A 4DWSB 4XAKA 2XP7A 2MNTA 4QZVB 3FXYA 5B8IC 2ZQVA 3GPKA 2ZR6A 2AWGA 1O6IA 5DIVA 3RM8A 2MLXA 3AROA 5HUAA 4J4OA 1P5QA 1HKJA 3FY1A 1H0GA 3LUOA 3O5JA 1ZK6A 3ARPA 1H0IA 2KE0A 2Y78A 3BXWA 4DRQA 5HKGA 1M5YA 4MGVA 4DH0A 2DT3A 3PRDA 2A3BA 1ROUA 1FKTA 2DT2A 1ZU8A 4IT6A 1Q6UA 1B6CA 3ARZA 3UI4A 1Q6HA 4DWSA 3ALFA 1ZBCA 3WL1A 2AOSA 3PA7A 4ODOA 1XHGA 4S3KA 1RD6A 1LL4A 4W9OA 2MLZA 1ZBWA 1XRVA 1BKFA 1U79A 4U85A 1EQ3A 5DEZA 4ODMA 3O5GA 1KFWA 3G6LA 1W26A 3B9DA 3KABA 2RUCA 2FAPA 3G6MA 4Z2KA 1D6OA 3UI6A 3JYMA 2KO7A 1BL4A 3H9RB 3WIJA 3IKGA 4WKAA 1FKDA 5DO2A 2D9FA 2YBTA 5D75A 1W9PA 4ZS6A 1D7HA 3WD3A 1J4RA 1D7JA 1ZBKA 4IPXA 5I98A 2G8ZA 4WK9A 3B9EA 4Z2IA 2WK2A 3KADA 4W9PA 1IX5A 4MAVA 4DIPA 1GUVA 3CHCA 1D7IA 4TW8A 4Z2LA 1HJVA 1FFRA 2M1IA 3CHFA 4HBOA 1NWUA 4W5UA 2KR7A 1HKKA 4DZ2A 3B7XA 3KACA 2XPAA 4DWSC 2DG3A 1LQ0A 2XP8A 2M08A 3WD4A 2A3AA 3WD1A 2A3EA 4BF8A 1K9TA 2LPVA 1LJYA 3O5LA 1FKGA 4JFIA 3RM4A 1ZBVA 2PI6A 2YBUA 1FFQA 1FKKA 1PBKA 4ODLA 4NSBA 1Y0OA 4ODRA 1W1PA 3IHZA 4DRPA 1HXVA 1HJXA 3AS1A 3FAPA 3CH9A 4IT4A 3WQVA 1FKHA 4JFJA 4KR0B 4QT2A 2ESCA 4ZPVR 1GPFA 3CGMA 4JFMA 2ZQUA 2JZVA 4MNMA 1EIBA 4L72B 2F2DA 3RFWA 3JYJA 3UQIA 1D2KA 2KFWA 4DRNA 3PRAA 2OLHA 4URIA 1A7XA 1Q6IA 1FKSA 4MNLA 3O5FA 1E15A 4DRHA 1QPLA 1EDQA 1PINA 4TX0A 3ARXA 4MNKA 2PV1A 1E6ZA 2PV3A 3IKDA 2DSUA 4MPKA 5HWBA 4J4NA 3ALGA 3O5EA 4L3NA 3PR9A 4G50A 3O5DA 3IK8A 1OWQA 3I6CA 1YW5A 3WH0A 3RGCA 4LAYA 2LKNA 1FAPA 4LAVA 2RUQA 2RURA 4W9QA 2DG9A 1ZCNA 1LG1A 3MDYB 4IQCA 5HW8A 1FD9A 5HBFA 1WAWA 4WKHA 1YATA 1CTNA 4DZ3A 1EHNA 4QT3A 2L2SA 1NWTA 3CHEA 2WM0A 4R5EA 3PRBA 4ODQA 3OA5A 2O92A 4NNRA 2O9OA 2ZR4A 1LL6A 4MSPA 2MLYA 3W4RA 4MTVA 1QZ2A 5DIUA 2KGJA 4WKFA 3WD2A 2RQSA 2DSVA 4ML4A 1HKMA 1ZL1A 2M2AA 4P8XA 4LAXA 2VN1A 4NZCA 2DT1A 1NWRA 1GOIA 2ZR5A 2F4EA 3RMEA 2XP4A 1WB0A 1J6YA 3AQUA 1F40A 5GQBA 1W9VA 2QF8A 4GGQA 2XP6A 1NSGA 5GPRA 4LAWA 1JNSA 4MNJA 4TYOA 1HKIA 2LGOA 5DF0A 4C02B 1FKFA 3KAFA 1TFVA 3ARYA 1E6PA 3CZ8A 3KAHA 4Z2HA 2DG4A 5HTGA 1X6NA 3O5MA 3NRKA 3VAWA 4Q7NA 4Z2JA 4U84A 4DRIA 4HARA 1FKJA 2PBCA 3AS3A 4P8VA 1X6LA 4FAPA 4JYSA 2VCDA 4Q22A 1KT1A 5DITA 2ZQTA 1NMVA 4HBEA 2DT0A 4O2TA 3WKZA 1FKRA 3TC5A 1FKLA 2MF9A 2MPHA 4LGXA 3WD0A 1ROTA 4G2PA 2XP3A 1FKBA 1OGGA 2B31A 5HW6A 4ZPWR 1TCOC 1SYTA 1C9HA 1KT0A 1R9HA 1W9UA 4QIBA 2OFNA 3O5PA 3ARUA 4DROA 2XP5A 3ARVA 4DWSD 3UQAA 1J4HA 1WNOA 4ZPTR 2PPOA 3UF8A 2IUZA 1F8AB 4ODPA 3NI6A 4TW7A 3B9AA 3QOKA 1JNDA 3O5IA 1HJWA 5GPGA 3O5RA 4DRMA 4KQZA 4DT4A 3WQWA 2RUDA 2WLYA 2ITKA 2ZQSA 4WJXA 3B8SA 2DSWA 4DRKA 3KZ7A 2KI3A 1JVWA 2WLZA 4P8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKK A;  1PBK A;  1Q1C A;  4MGV A;  2XP9 A;  4ODL A;  1Y0O A;  2IF4 A;  1FJD A;  4ODR A;  4FN2 A;  4DH0 A;  3PRD A;  2XP4 A;  3IHZ A;  4DRP A;  1ROU A;  1J6Y A;  1HXV A;  3TDB A;  1FKT A;  1F40 A;  3OOB A;  3FAP A;  4TW6 A;  3O5O A;  3UI5 A;  2FKE A;  1Q6U A;  4GGQ A;  3UQB A;  2XP6 A;  1FKH A;  1B6C A;  1NSG A;  4JFJ A;  3UI4 A;  4LAW A;  1JNS A;  1Q6H A;  1L1P A;  2LJ4 A;  1EYM A;  4W9Q A;  3JXV A;  4ODN A;  4QT2 A;  4TYO A;  5HW7 A;  2LGO A;  4ITZ A;  4C02 B;  3KAI A;  1FKF A;  1JVW A;  3CGM A;  1FKI A;  2ZQU A;  3ODK A;  2JZV A;  3KAF A;  2K8I A;  3PA7 A;  4JFM A;  4ODO A;  4TW8 A;  2F2D A;  1JNT A;  3RFW A;  3JYJ A;  3UQI A;  3KAH A;  1QPF A;  4W9O A;  2KFW A;  2MLZ A;  4U86 A;  4DRN A;  2DG4 A;  1BKF A;  5HTG A;  3NTP A;  1U79 A;  1A7X A;  4U85 A;  1Q6I A;  2PPN A;  3O5M A;  3NRK A;  3VAW A;  1FKS A;  1EQ3 A;  4R0X A;  4JFL A;  3O5F A;  4U84 A;  3KAG A;  4DRI A;  4ODM A;  4DRJ A;  3O5G A;  4DRH A;  1QPL A;  1FKJ A;  1PIN A;  2PBC A;  4TX0 A;  1W26 A;  2PPP A;  3O5K A;  2PV1 A;  3CGN A;  4JYS A;  1J4I A;  4FAP A;  2VCD A;  3KAB A;  4JFK A;  4N19 A;  1KT1 A;  2PV3 A;  2FAP A;  2RUC A;  2ZQT A;  1NMV A;  3IKD A;  5DIT A;  5HWB A;  2F21 A;  1D6O A;  4O2T A;  3UI6 A;  1NMW A;  1FKR A;  4TNS A;  2XPB A;  4IQ2 A;  4J4N A;  3JYM A;  3TC5 A;  2KO7 A;  1BL4 A;  3H9R B;  3O5E A;  5BXJ A;  3IKG A;  1N1A A;  1FKD A;  1FKL A;  2MF9 A;  2MPH A;  2D9F A;  5D75 A;  3O5Q A;  1D7H A;  3O5D A;  1J4R A;  2UZ5 A;  4G50 A;  2RSE A;  3KCE A;  1ROT A;  1D7J A;  3EY6 A;  3IK8 A;  4IPX A;  3I6C A;  4G2P A;  1YW5 A;  2XP3 A;  1FKB A;  3RGC A;  3WH0 A;  5I98 A;  5HW6 A;  4LAY A;  5HWC A;  1TCO C;  2N87 A;  3KAD A;  2LKN A;  1FAP A;  4W9P A;  1C9H A;  5HT1 A;  5J6E A;  4GIV A;  1KT0 A;  4DIP A;  1R9H A;  2RUQ A;  1D7I A;  2RUR A;  4LAV A;  4QIB A;  2DG9 A;  1ZCN A;  2OFN A;  3MDY B;  3O5P A;  4IQC A;  4DRO A;  2XP5 A;  2M1I A;  5HW8 A;  1FD9 A;  2KR7 A;  1YAT A;  2Q5A A;  3TCZ A;  4DZ2 A;  3UQA A;  1J4H A;  4DZ3 A;  3B7X A;  2PPO A;  4QT3 A;  4ODK A;  3UF8 A;  2L2S A;  1F8A B;  2PV2 A;  3KAC A;  4ODP A;  1T11 A;  2XPA A;  3NI6 A;  3PRB A;  4ODQ A;  4TW7 A;  4NNR A;  2DG3 A;  3O5I A;  2XP7 A;  2MNT A;  2ZR4 A;  4MSP A;  5B8I C;  2MLY A;  2ZQV A;  3GPK A;  2ZR6 A;  2AWG A;  5DIV A;  5GPG A;  3O5R A;  2XP8 A;  4DRM A;  2M08 A;  1QZ2 A;  2MLX A;  5HUA A;  4J4O A;  1P5Q A;  5DIU A;  2KGJ A;  4DT4 A;  2RQS A;  4BF8 A;  2RUD A;  2M2A A;  2LPV A;  3LUO A;  2ITK A;  2ZQS A;  3O5J A;  4LAX A;  1ZK6 A;  1FKG A;  2VN1 A;  3O5L A;  4JFI A;  4DRK A;  2KE0 A;  2Y78 A;  3KZ7 A;  2ZR5 A;  2F4E A;  2KI3 A;  4DRQ A;  5HKG A;  1M5Y A; 
#chains in the Genus database with same CATH topology
 1Q1C A;  2XP9 A;  2IF4 A;  1FJD A;  4FN2 A;  3ARS A;  2DSZ A;  3TDB A;  1E6R A;  3OOB A;  1LG2 A;  4TW6 A;  3O5O A;  3UI5 A;  2FKE A;  3UQB A;  1L1P A;  2LJ4 A;  1EYM A;  3JXV A;  4ODN A;  5HW7 A;  1SR0 A;  4ITZ A;  3KAI A;  3ARW A;  3ODK A;  1FKI A;  2K8I A;  1JNT A;  3RM9 A;  1QPF A;  4U86 A;  1W1Y A;  3NTP A;  2PPN A;  4S3J A;  4R0X A;  4JFL A;  3AS2 A;  4Z2G A;  3KAG A;  4DRJ A;  1NH6 A;  1W1V A;  2PPP A;  3O5K A;  3CGN A;  1UR8 A;  1ITX A;  1J4I A;  4JFK A;  4N19 A;  3ARQ A;  4P8W A;  2F21 A;  2A3C A;  2G41 A;  3AS0 A;  1NMW A;  4TNS A;  2XPB A;  4IQ2 A;  1ZB5 A;  1JNE A;  1NWS A;  5BXJ A;  1N1A A;  1UR9 A;  1LL7 A;  1VF8 A;  3O5Q A;  2UZ5 A;  3WL0 A;  2RSE A;  3KCE A;  3EY6 A;  3GTY X;  5HWC A;  2N87 A;  5J6E A;  5HT1 A;  5JH8 A;  3ARR A;  1OGB A;  4GIV A;  1W1T A;  1E6N A;  3EIP A;  3ART A;  4PTM A;  1E9L A;  4AY1 A;  2FDM A;  2Q5A A;  3TCZ A;  3CHD A;  4WIW A;  4ODK A;  2DPE A;  2PV2 A;  1T11 A;  4DWS B;  4XAK A;  2PN0 A;  2XP7 A;  2MNT A;  4QZV B;  3FXY A;  5B8I C;  2ZQV A;  3GPK A;  2ZR6 A;  2AWG A;  1O6I A;  5DIV A;  3RM8 A;  2MLX A;  3ARO A;  5HUA A;  4J4O A;  1P5Q A;  1HKJ A;  3FY1 A;  2EUL A;  1H0G A;  3LUO A;  3O5J A;  1ZK6 A;  3ARP A;  1H0I A;  2KE0 A;  2Y78 A;  3BXW A;  4DRQ A;  5HKG A;  1M5Y A;  4MGV A;  4DH0 A;  2DT3 A;  3PRD A;  2A3B A;  1ROU A;  1FKT A;  2DT2 A;  1ZU8 A;  4IT6 A;  1Q6U A;  1B6C A;  3ARZ A;  3UI4 A;  1Q6H A;  4DWS A;  3ALF A;  1ZBC A;  3WL1 A;  2AOS A;  3PA7 A;  4ODO A;  3BMB A;  1XHG A;  4S3K A;  1RD6 A;  1LL4 A;  4W9O A;  2MLZ A;  1ZBW A;  1XRV A;  1BKF A;  1U79 A;  4U85 A;  1EQ3 A;  5DEZ A;  4ODM A;  3O5G A;  1KFW A;  3G6L A;  1W26 A;  3B9D A;  3KAB A;  2RUC A;  2FAP A;  3G6M A;  4Z2K A;  1D6O A;  3UI6 A;  3JYM A;  2KO7 A;  1BL4 A;  3H9R B;  3WIJ A;  3IKG A;  4WKA A;  1FKD A;  5DO2 A;  2D9F A;  2YBT A;  5D75 A;  1W9P A;  4ZS6 A;  1D7H A;  3WD3 A;  1J4R A;  1D7J A;  1ZBK A;  4IPX A;  5I98 A;  2G8Z A;  4WK9 A;  3B9E A;  4Z2I A;  2WK2 A;  3KAD A;  4W9P A;  1IX5 A;  4MAV A;  4DIP A;  1GUV A;  3CHC A;  1D7I A;  4TW8 A;  4Z2L A;  1HJV A;  4HBO A;  1FFR A;  2M1I A;  3CHF A;  1NWU A;  4W5U A;  2KR7 A;  1HKK A;  4DZ2 A;  3B7X A;  3KAC A;  2XPA A;  4DWS C;  2DG3 A;  1LQ0 A;  2XP8 A;  2M08 A;  3WD4 A;  2A3A A;  3WD1 A;  2A3E A;  4BF8 A;  1K9T A;  2LPV A;  1LJY A;  3O5L A;  1FKG A;  4JFI A;  3RM4 A;  1ZBV A;  2PI6 A;  2YBU A;  1FFQ A;  1FKK A;  1PBK A;  4ODL A;  4NSB A;  1Y0O A;  4ODR A;  1W1P A;  3IHZ A;  4DRP A;  1HXV A;  1HJX A;  3AS1 A;  3FAP A;  3CH9 A;  4IT4 A;  3WQV A;  1FKH A;  4JFJ A;  4KR0 B;  4QT2 A;  2ESC A;  4ZPV R;  1GPF A;  3CGM A;  4JFM A;  2ZQU A;  2JZV A;  4MNM A;  1EIB A;  4L72 B;  2F2D A;  3RFW A;  3JYJ A;  3UQI A;  1D2K A;  2KFW A;  4DRN A;  3PRA A;  2OLH A;  4URI A;  1A7X A;  1Q6I A;  1FKS A;  4UDM A;  4MNL A;  3O5F A;  1E15 A;  4DRH A;  1QPL A;  1EDQ A;  1PIN A;  4TX0 A;  3ARX A;  4MNK A;  2PV1 A;  1E44 A;  1E6Z A;  2PV3 A;  3IKD A;  2DSU A;  4MPK A;  5HWB A;  4J4N A;  3ALG A;  3O5E A;  4L3N A;  3PR9 A;  4G50 A;  3O5D A;  3IK8 A;  2P4V A;  1OWQ A;  3I6C A;  1YW5 A;  3WH0 A;  3RGC A;  4LAY A;  2LKN A;  1FAP A;  4LAV A;  2RUQ A;  2RUR A;  4W9Q A;  2DG9 A;  1ZCN A;  1LG1 A;  3MDY B;  4IQC A;  5HW8 A;  1FD9 A;  5HBF A;  1WAW A;  4WKH A;  1YAT A;  1CTN A;  4DZ3 A;  1EHN A;  4QT3 A;  2L2S A;  1NWT A;  3CHE A;  2WM0 A;  4R5E A;  3PRB A;  4ODQ A;  3OA5 A;  2O92 A;  4NNR A;  2O9O A;  2ZR4 A;  1LL6 A;  4MSP A;  2MLY A;  3W4R A;  4MTV A;  1QZ2 A;  5DIU A;  2KGJ A;  4WKF A;  3WD2 A;  2RQS A;  2DSV A;  4ML4 A;  1HKM A;  1ZL1 A;  2M2A A;  3GU0 A;  4P8X A;  4LAX A;  2VN1 A;  4NZC A;  2DT1 A;  1NWR A;  1GOI A;  2ZR5 A;  2F4E A;  3RME A;  2XP4 A;  1WB0 A;  1J6Y A;  3AQU A;  1F40 A;  5GQB A;  1W9V A;  2QF8 A;  4GGQ A;  2XP6 A;  1NSG A;  5GPR A;  4LAW A;  1JNS A;  4MNJ A;  4TYO A;  1HKI A;  2LGO A;  5DF0 A;  4C02 B;  1FKF A;  3KAF A;  1TFV A;  3ARY A;  1E6P A;  3CZ8 A;  3KAH A;  4Z2H A;  2DG4 A;  5HTG A;  2F23 A;  1X6N A;  2ETN A;  3O5M A;  3NRK A;  3VAW A;  4Q7N A;  4Z2J A;  4U84 A;  4DRI A;  4HAR A;  1FKJ A;  2PBC A;  3AS3 A;  4P8V A;  1X6L A;  4FAP A;  4JYS A;  2VCD A;  4Q22 A;  1KT1 A;  5DIT A;  2ZQT A;  1NMV A;  4HBE A;  2DT0 A;  4O2T A;  3WKZ A;  1FKR A;  3TC5 A;  1FKL A;  2MF9 A;  2MPH A;  4LGX A;  3WD0 A;  1ROT A;  4G2P A;  2XP3 A;  1JCH B;  1FKB A;  1OGG A;  2B31 A;  5HW6 A;  4ZPW R;  1TCO C;  1SYT A;  1C9H A;  1KT0 A;  1R9H A;  1W9U A;  4QIB A;  2OFN A;  3O5P A;  3ARU A;  4DRO A;  2XP5 A;  3ARV A;  4DWS D;  3UQA A;  1J4H A;  1WNO A;  4ZPT R;  2PPO A;  3UF8 A;  2IUZ A;  1F8A B;  4ODP A;  3NI6 A;  4TW7 A;  3B9A A;  3QOK A;  1JND A;  3O5I A;  1HJW A;  5GPG A;  3O5R A;  4DRM A;  4KQZ A;  1GRJ A;  4DT4 A;  2B5U B;  3WQW A;  2RUD A;  2WLY A;  2ITK A;  2ZQS A;  4WJX A;  3B8S A;  2DSW A;  4DRK A;  3KZ7 A;  2KI3 A;  1JVW A;  2WLZ A;  4P8U A; 
#chains in the Genus database with same CATH homology
 1Q1C A;  2XP9 A;  2IF4 A;  1FJD A;  4FN2 A;  3ARS A;  2DSZ A;  3TDB A;  1E6R A;  3OOB A;  1LG2 A;  4TW6 A;  3O5O A;  3UI5 A;  2FKE A;  3UQB A;  1L1P A;  2LJ4 A;  1EYM A;  3JXV A;  4ODN A;  5HW7 A;  1SR0 A;  4ITZ A;  3KAI A;  3ARW A;  3ODK A;  1FKI A;  2K8I A;  1JNT A;  3RM9 A;  1QPF A;  4U86 A;  1W1Y A;  3NTP A;  2PPN A;  4S3J A;  4R0X A;  4JFL A;  3AS2 A;  4Z2G A;  3KAG A;  4DRJ A;  1NH6 A;  1W1V A;  2PPP A;  3O5K A;  3CGN A;  1UR8 A;  1ITX A;  1J4I A;  4JFK A;  4N19 A;  3ARQ A;  4P8W A;  2F21 A;  2A3C A;  2G41 A;  3AS0 A;  1NMW A;  4TNS A;  2XPB A;  4IQ2 A;  1ZB5 A;  1JNE A;  1NWS A;  5BXJ A;  1N1A A;  1UR9 A;  1LL7 A;  1VF8 A;  3O5Q A;  2UZ5 A;  3WL0 A;  2RSE A;  3KCE A;  3EY6 A;  5HWC A;  2N87 A;  5J6E A;  5HT1 A;  5JH8 A;  3ARR A;  1OGB A;  4GIV A;  1W1T A;  1E6N A;  3ART A;  4PTM A;  1E9L A;  4AY1 A;  2FDM A;  2Q5A A;  3TCZ A;  3CHD A;  4WIW A;  4ODK A;  2DPE A;  2PV2 A;  1T11 A;  4DWS B;  4XAK A;  2XP7 A;  2MNT A;  4QZV B;  3FXY A;  5B8I C;  2ZQV A;  3GPK A;  2ZR6 A;  2AWG A;  1O6I A;  5DIV A;  3RM8 A;  2MLX A;  3ARO A;  5HUA A;  4J4O A;  1P5Q A;  1HKJ A;  3FY1 A;  1H0G A;  3LUO A;  3O5J A;  1ZK6 A;  3ARP A;  1H0I A;  2KE0 A;  2Y78 A;  3BXW A;  4DRQ A;  5HKG A;  1M5Y A;  4MGV A;  4DH0 A;  2DT3 A;  3PRD A;  2A3B A;  1ROU A;  1FKT A;  2DT2 A;  1ZU8 A;  4IT6 A;  1Q6U A;  1B6C A;  3ARZ A;  3UI4 A;  1Q6H A;  4DWS A;  3ALF A;  1ZBC A;  3WL1 A;  2AOS A;  3PA7 A;  4ODO A;  1XHG A;  4S3K A;  1RD6 A;  1LL4 A;  4W9O A;  2MLZ A;  1ZBW A;  1XRV A;  1BKF A;  1U79 A;  4U85 A;  1EQ3 A;  5DEZ A;  4ODM A;  3O5G A;  1KFW A;  3G6L A;  1W26 A;  3B9D A;  3KAB A;  2RUC A;  2FAP A;  3G6M A;  4Z2K A;  1D6O A;  3UI6 A;  3JYM A;  2KO7 A;  1BL4 A;  3H9R B;  3WIJ A;  3IKG A;  4WKA A;  1FKD A;  5DO2 A;  2D9F A;  2YBT A;  5D75 A;  1W9P A;  4ZS6 A;  1D7H A;  3WD3 A;  1J4R A;  1D7J A;  1ZBK A;  4IPX A;  5I98 A;  2G8Z A;  4WK9 A;  3B9E A;  4Z2I A;  2WK2 A;  3KAD A;  4W9P A;  1IX5 A;  4MAV A;  4DIP A;  1GUV A;  3CHC A;  1D7I A;  4TW8 A;  4Z2L A;  1HJV A;  1FFR A;  2M1I A;  3CHF A;  4HBO A;  1NWU A;  4W5U A;  2KR7 A;  1HKK A;  4DZ2 A;  3B7X A;  3KAC A;  2XPA A;  4DWS C;  2DG3 A;  1LQ0 A;  2XP8 A;  2M08 A;  3WD4 A;  2A3A A;  3WD1 A;  2A3E A;  4BF8 A;  1K9T A;  2LPV A;  1LJY A;  3O5L A;  1FKG A;  4JFI A;  3RM4 A;  1ZBV A;  2PI6 A;  2YBU A;  1FFQ A;  1FKK A;  1PBK A;  4ODL A;  4NSB A;  1Y0O A;  4ODR A;  1W1P A;  3IHZ A;  4DRP A;  1HXV A;  1HJX A;  3AS1 A;  3FAP A;  3CH9 A;  4IT4 A;  3WQV A;  1FKH A;  4JFJ A;  4KR0 B;  4QT2 A;  2ESC A;  4ZPV R;  1GPF A;  3CGM A;  4JFM A;  2ZQU A;  2JZV A;  4MNM A;  1EIB A;  4L72 B;  2F2D A;  3RFW A;  3JYJ A;  3UQI A;  1D2K A;  2KFW A;  4DRN A;  3PRA A;  2OLH A;  4URI A;  1A7X A;  1Q6I A;  1FKS A;  4MNL A;  3O5F A;  1E15 A;  4DRH A;  1QPL A;  1EDQ A;  1PIN A;  4TX0 A;  3ARX A;  4MNK A;  2PV1 A;  1E6Z A;  2PV3 A;  3IKD A;  2DSU A;  4MPK A;  5HWB A;  4J4N A;  3ALG A;  3O5E A;  4L3N A;  3PR9 A;  4G50 A;  3O5D A;  3IK8 A;  1OWQ A;  3I6C A;  1YW5 A;  3WH0 A;  3RGC A;  4LAY A;  2LKN A;  1FAP A;  4LAV A;  2RUQ A;  2RUR A;  4W9Q A;  2DG9 A;  1ZCN A;  1LG1 A;  3MDY B;  4IQC A;  5HW8 A;  1FD9 A;  5HBF A;  1WAW A;  4WKH A;  1YAT A;  1CTN A;  4DZ3 A;  1EHN A;  4QT3 A;  2L2S A;  1NWT A;  3CHE A;  2WM0 A;  4R5E A;  3PRB A;  4ODQ A;  3OA5 A;  2O92 A;  4NNR A;  2O9O A;  2ZR4 A;  1LL6 A;  4MSP A;  2MLY A;  3W4R A;  4MTV A;  1QZ2 A;  5DIU A;  2KGJ A;  4WKF A;  3WD2 A;  2RQS A;  2DSV A;  4ML4 A;  1HKM A;  1ZL1 A;  2M2A A;  4P8X A;  4LAX A;  2VN1 A;  4NZC A;  2DT1 A;  1NWR A;  1GOI A;  2ZR5 A;  2F4E A;  3RME A;  2XP4 A;  1WB0 A;  1J6Y A;  3AQU A;  1F40 A;  5GQB A;  1W9V A;  2QF8 A;  4GGQ A;  2XP6 A;  1NSG A;  5GPR A;  4LAW A;  1JNS A;  4MNJ A;  4TYO A;  1HKI A;  2LGO A;  5DF0 A;  4C02 B;  1FKF A;  3KAF A;  1TFV A;  3ARY A;  1E6P A;  3CZ8 A;  3KAH A;  4Z2H A;  2DG4 A;  5HTG A;  1X6N A;  3O5M A;  3NRK A;  3VAW A;  4Q7N A;  4Z2J A;  4U84 A;  4DRI A;  4HAR A;  1FKJ A;  2PBC A;  3AS3 A;  4P8V A;  1X6L A;  4FAP A;  4JYS A;  2VCD A;  4Q22 A;  1KT1 A;  5DIT A;  2ZQT A;  1NMV A;  4HBE A;  2DT0 A;  4O2T A;  3WKZ A;  1FKR A;  3TC5 A;  1FKL A;  2MF9 A;  2MPH A;  4LGX A;  3WD0 A;  1ROT A;  4G2P A;  2XP3 A;  1FKB A;  1OGG A;  2B31 A;  5HW6 A;  4ZPW R;  1TCO C;  1SYT A;  1C9H A;  1KT0 A;  1R9H A;  1W9U A;  4QIB A;  2OFN A;  3O5P A;  3ARU A;  4DRO A;  2XP5 A;  3ARV A;  4DWS D;  3UQA A;  1J4H A;  1WNO A;  4ZPT R;  2PPO A;  3UF8 A;  2IUZ A;  1F8A B;  4ODP A;  3NI6 A;  4TW7 A;  3B9A A;  3QOK A;  1JND A;  3O5I A;  1HJW A;  5GPG A;  3O5R A;  4DRM A;  4KQZ A;  4DT4 A;  3WQW A;  2RUD A;  2WLY A;  2ITK A;  2ZQS A;  4WJX A;  3B8S A;  2DSW A;  4DRK A;  3KZ7 A;  2KI3 A;  1JVW A;  2WLZ A;  4P8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...