3O5FA

Fk1 domain of fkbp51, crystal form vii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
b'TATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 34
structure length 125
sequence length 125
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5fA00
1D7JA 2PBCA 2MPHA 2LPVA 3O5RA 4LAXA 2XP7A 5HKGA 1FJDA 3RFWA 4JFMA 1NMVA 2KO7A 4DIPA 5BXJA 3B7XA 3O5FA 2DG4A 4ODPA 1P5QA 2F2DA 3LUOA 4LAVA 1Q6IA 3TDBA 3KCEA 1JNTA 2F21A 4IQCA 1D7HA 1PINA 2XP3A 4TYOA 1FKFA 1ROUA 2KE0A 1R9HA 2XP6A 1A7XA 5HT1A 1NMWA 4DH0A 2RUDA 3PA7A 5HW8A 5HWBA 2PV1A 1FKJA 3IKGA 3KAFA 4DRKA 4ODNA 1U79A 4DZ3A 2Q5AA 4IPXA 1YW5A 4LAYA 1J4IA 4W9QA 3PRBA 1F40A 4U86A 3O5JA 1FKLA 1Q6HA 2PPPA 2ZR6A 3O5OA 4G2PA 5B8IC 2Y78A 4TW8A 1FKIA 4TW7A 4JYSA 4O2TA 2D9FA 4TX0A 4DRIA 2XP8A 4ODQA 1Q6UA 1L1PA 2LKNA 2L2SA 1F8AB 3EY6A 4N19A 5GPGA 3WH0A 2PPNA 2N87A 1J4HA 2PV3A 1ZK6A 3UQBA 4ODKA 3JYMA 2RUCA 1QZ2A 1ZCNA 1EYMA 1FKBA 3O5DA 2PPOA 3RGCA 3JYJA 1W26A 2RSEA 4ODMA 2ZQTA 1KT1A 1KT0A 5HTGA 2FKEA 2XPBA 2LJ4A 3FAPA 4ODOA 1C9HA 2ZQSA 2RUQA 3UI6A 3IK8A 3NRKA 1BKFA 2K8IA 3UF8A 4GIVA 3O5GA 4DZ2A 3UQAA 2M1IA 1M5YA 4DRNA 5D75A 4BF8A 2ZR4A 5HWCA 1FKRA 4QT2A 1JVWA 2F4EA 1FAPA 3KABA 3KADA 3H9RB 4G50A 4QT3A 1NSGA 5DIUA 4DROA 2UZ5A 1QPFA 3UQIA 1T11A 2LGOA 4LAWA 2ZQVA 1N1AA 2IF4A 4ITZA 2M2AA 4FN2A 4FAPA 3ODKA 4ODRA 2MLYA 4TW6A 2VN1A 5I98A 1PBKA 1Y0OA 3KZ7A 4DRJA 3O5LA 3TC5A 2KFWA 4W9OA 1D6OA 1B6CA 2KR7A 1FKKA 3O5IA 2PV2A 2ITKA 4JFIA 2DG9A 3O5KA 3JXVA 4JFJA 2ZQUA 4MSPA 4R0XA 5DIVA 3PRDA 4JFLA 4DRQA 2RURA 3CGNA 4MGVA 2MLXA 4W9PA 1TCOC 1EQ3A 1FKHA 4QIBA 4U84A 4DRPA 3IKDA 4J4OA 3NI6A 3GPKA 5HW7A 2XPAA 1QPLA 3OOBA 2JZVA 1J4RA 2DG3A 1YATA 2FAPA 3MDYB 5HW6A 1J6YA 1JNSA 1FKGA 1FKTA 2KI3A 3O5QA 4JFKA 2AWGA 3KAGA 3CGMA 3IHZA 1HXVA 2M08A 4DRHA 1BL4A 2RQSA 4ODLA 5DITA 5HUAA 1FKDA 1D7IA 3KAHA 4J4NA 4IQ2A 2KGJA 4DT4A 3KACA 3O5PA 3O5MA 4U85A 4NNRA 2MNTA 2XP9A 3UI4A 3UI5A 4GGQA 3TCZA 2XP5A 5J6EA 3NTPA 3O5EA 2OFNA 1Q1CA 1FKSA 1FD9A 3I6CA 2MLZA 4TNSA 1ROTA 4C02B 2MF9A 2ZR5A 4DRMA 2VCDA 3KAIA 3VAWA 2XP4A
chains in the Genus database with same CATH superfamily
2PBCA 4L3NA 4MNKA 3ARVA 4DIPA 4DWSA 2F2DA 4LAVA 5DEZA 4IQCA 2F21A 3ARWA 1ZU8A 1ROUA 2XP6A 1A7XA 4HBOA 5HW8A 4WKFA 3KAFA 2O9OA 4ODNA 3CH9A 4IPXA 3BMBA 1ZL1A 5DF0A 1FFQA 1F40A 1GPFA 3ARPA 4U86A 1W9VA 1HXVA 4G2PA 1FKIA 4O2TA 1W1TA 1X6LA 1Q6UA 4MTVA 2LKNA 4Q22A 1ZK6A 4ODKA 1QZ2A 3RGCA 2EULA 3CHFA 4WIWA 4L72B 3NRKA 1ZBCA 3UF8A 4GIVA 4DZ2A 1HJXA 1ZBWA 5DO2A 1FKRA 4DWSC 1JVWA 1RD6A 1FAPA 2F4EA 4G50A 4QT3A 1NSGA 2LGOA 2ZQVA 4ITZA 1X6NA 1LQ0A 1GOIA 4MNJA 2DSVA 1K9TA 4ODRA 1D2KA 2VN1A 5I98A 1WAWA 3O5LA 3CHEA 2WK2A 3O5KA 1SR0A 3GTYX 2RURA 3CGNA 4QIBA 4DRPA 4J4OA 3NI6A 5HW7A 4P8XA 1J4RA 1J6YA 2AWGA 3KAGA 3RM4A 1FKDA 1LL6A 2KGJA 4DT4A 3G6MA 3UI4A 1EHNA 4GGQA 4ZPWR 3WQVA 1Q1CA 2G8ZA 1OGGA 1VF8A 4TNSA 1ROTA 4DRMA 3KAIA 3IKDA 2LPVA 3O5RA 2ESCA 5HKGA 1FJDA 4JFMA 2AOSA 2DG4A 3LUOA 1Q6IA 1JNTA 2XP3A 3WL0A 5GPRA 5HT1A 1NMWA 3PA7A 3IKGA 4DRKA 1U79A 1W9PA 2Q5AA 1HJVA 4W9QA 2YBUA 3PRBA 1Q6HA 2DPEA 4WKHA 4Z2KA 2DT3A 1NWUA 4TW7A 1L1PA 2L2SA 1F8AB 3EY6A 4N19A 2PPNA 3WD2A 3QOKA 2B31A 1ZCNA 3CHCA 3JYJA 1W26A 2DT1A 1KT0A 1O6IA 1HKJA 4P8WA 3FAPA 2O92A 4HARA 3AS2A 3WD1A 1E15A 1C9HA 3UI6A 1SYTA 1BKFA 1OGBA 1M5YA 4DRNA 5HWCA 4QT2A 3KADA 4HBEA 3UQIA 4LAWA 1W1PA 2IF4A 5GQBA 2M2AA 4FAPA 3ODKA 1HKMA 3AS0A 4WJXA 3TC5A 3OA5A 4MNMA 1B6CA 2KR7A 3O5IA 2PV2A 4MSPA 2DG9A 1CTNA 4Z2IA 2ZQUA 3PRDA 4JFLA 4S3KA 1WNOA 1LJYA 4MGVA 1TCOC 3BXWA 3ARXA 3GPKA 2XPAA 1NWRA 3O5QA 3WQWA 3G6LA 3KAHA 3B9DA 4IQ2A 3O5PA 4NNRA 2XP9A 3UI5A 3ARUA 5J6EA 2A3AA 3PRAA 3NTPA 4QZVB 3I6CA 1H0IA 3AS3A 1HKIA 2MF9A 2ZR5A 3ARRA 1D7JA 2MPHA 3FY1A 2XP7A 3RFWA 1NMVA 4DWSD 3B7XA 3RMEA 4S3JA 4LGXA 2DT0A 1XHGA 4TYOA 1FKFA 1GUVA 1LG2A 2KE0A 5HBFA 4MNLA 2RUDA 4DZ3A 4LAYA 1YW5A 1J4IA 2IUZA 1FFRA 1EDQA 2PPPA 1W9UA 5BXJA 2Y78A 4TW8A 1W1YA 4TX0A 2D9FA 3B9AA 5GPGA 1HJWA 2N87A 1J4HA 3UQBA 1UR9A 3B9EA 4Z2HA 3GU0A 2DSZA 1EYMA 1H0GA 2ETNA 2RSEA 3CZ8A 2ZQTA 1KT1A 2PI6A 5HTGA 2XPBA 2LJ4A 1LG1A 4ZPTR 2RUQA 3CHDA 4Q7NA 3O5GA 1W1VA 5D75A 4XAKA 4AY1A 3KABA 3H9RB 5DIUA 4DROA 1T11A 1N1AA 1E6PA 3WIJA 4FN2A 2OLHA 2B5UB 2MLYA 3WL1A 1PBKA 4DRJA 2KFWA 1D6OA 1UR8A 3AS1A 2ITKA 1GRJA 1NWTA 4JFJA 4MAVA 1ITXA 1JNDA 4IT6A 3ARSA 4DRQA 1EQ3A 1QPLA 3OOBA 3ARTA 1YATA 3WD4A 5HW6A 3AQUA 1FKGA 1FKTA 4URIA 2KI3A 4W5UA 4ZS6A 1LL7A 3ALFA 3IHZA 4DRHA 2RQSA 5HUAA 1D7IA 1TFVA 4WK9A 3KACA 3O5MA 3W4RA 2P4VA 3O5EA 2OFNA 1EIBA 4C02B 4R5EA 2VCDA 3VAWA 2XP4A 4Z2JA 4LAXA 2A3CA 2KO7A 3O5FA 4ODPA 1P5QA 3TDBA 3KCEA 1D7HA 1PINA 1R9HA 4DH0A 5HWBA 2PV1A 1FKJA 3PR9A 1IX5A 3FXYA 4P8VA 1E44A 3ALGA 3O5JA 1FKLA 2ZR6A 3O5OA 2WLZA 5B8IC 4JYSA 1E6NA 4DRIA 4IT4A 2XP8A 4ODQA 1ZB5A 3WH0A 3B8SA 2PV3A 3JYMA 2RUCA 3RM9A 3O5DA 1FKBA 4ZPVR 2PPOA 4Z2GA 2FDMA 1E9LA 4ODMA 1E6RA 2FKEA 3RM8A 1HKKA 4ODOA 1XRVA 2G41A 2YBTA 2ZQSA 3AROA 3IK8A 2K8IA 1NWSA 4KR0B 5JH8A 3UQAA 2M1IA 4BF8A 2ZR4A 2F23A 3WD0A 4KQZA 3ARZA 1ZBVA 2UZ5A 1QPFA 4DWSB 2DSWA 4Z2LA 4UDMA 1KFWA 1WB0A 4TW6A 2A3BA 1Y0OA 3KZ7A 2PN0A 3WD3A 4W9OA 2WLYA 1FKKA 2QF8A 4JFIA 2DT2A 3JXVA 4R0XA 5DIVA 2MLXA 4W9PA 1FKHA 4U84A 4NSBA 4WKAA 3ARYA 2A3EA 1LL4A 2DG3A 2JZVA 3MDYB 2FAPA 4MPKA 1JNSA 3WKZA 4ML4A 2DSUA 4JFKA 3CGMA 2M08A 3ARQA 1BL4A 4ODLA 5DITA 1JCHB 4J4NA 4U85A 1OWQA 1ZBKA 1E6ZA 2MNTA 3TCZA 2XP5A 4NZCA 4PTMA 3EIPA 1FKSA 1FD9A 2WM0A 1NH6A 2MLZA 1JNEA 4P8UA
chains in the Genus database with same CATH topology
2PBCA 4L3NA 4MNKA 3ARVA 4DIPA 4DWSA 2F2DA 4LAVA 5DEZA 4IQCA 2F21A 3ARWA 1ZU8A 1ROUA 2XP6A 1A7XA 4HBOA 5HW8A 4WKFA 3KAFA 2O9OA 4ODNA 3CH9A 4IPXA 1ZL1A 5DF0A 1FFQA 1F40A 1GPFA 3ARPA 4U86A 1W9VA 1HXVA 4G2PA 1FKIA 4O2TA 1W1TA 1X6LA 1Q6UA 4MTVA 2LKNA 4Q22A 1ZK6A 4ODKA 1QZ2A 3RGCA 3CHFA 4WIWA 4L72B 3NRKA 1ZBCA 3UF8A 4GIVA 4DZ2A 1HJXA 1ZBWA 5DO2A 1FKRA 4DWSC 1JVWA 1RD6A 1FAPA 2F4EA 4G50A 4QT3A 1NSGA 2LGOA 2ZQVA 4ITZA 1X6NA 1LQ0A 1GOIA 4MNJA 2DSVA 1K9TA 4ODRA 1D2KA 2VN1A 5I98A 1WAWA 3O5LA 3CHEA 2WK2A 3O5KA 1SR0A 2RURA 3CGNA 4QIBA 4DRPA 4J4OA 3NI6A 5HW7A 4P8XA 1J4RA 1J6YA 2AWGA 3KAGA 3RM4A 1FKDA 1LL6A 2KGJA 4DT4A 3G6MA 3UI4A 1EHNA 4GGQA 4ZPWR 3WQVA 1Q1CA 2G8ZA 1OGGA 1VF8A 4TNSA 1ROTA 4DRMA 3KAIA 3IKDA 2LPVA 3O5RA 2ESCA 5HKGA 1FJDA 4JFMA 2AOSA 2DG4A 3LUOA 1Q6IA 1JNTA 2XP3A 3WL0A 5GPRA 5HT1A 1NMWA 3PA7A 3IKGA 4DRKA 1U79A 1W9PA 2Q5AA 1HJVA 4W9QA 2YBUA 3PRBA 1Q6HA 2DPEA 4WKHA 4Z2KA 2DT3A 1NWUA 4TW7A 1L1PA 2L2SA 1F8AB 3EY6A 4N19A 2PPNA 3WD2A 3QOKA 2B31A 1ZCNA 3CHCA 3JYJA 1W26A 2DT1A 1KT0A 1O6IA 1HKJA 4P8WA 3FAPA 2O92A 4HARA 3AS2A 3WD1A 1E15A 1C9HA 3UI6A 1SYTA 1BKFA 1OGBA 1M5YA 4DRNA 5HWCA 4QT2A 3KADA 4HBEA 3UQIA 4LAWA 1W1PA 2IF4A 5GQBA 2M2AA 4FAPA 3ODKA 1HKMA 3AS0A 4WJXA 3TC5A 3OA5A 4MNMA 1B6CA 2KR7A 3O5IA 2PV2A 4MSPA 2DG9A 1CTNA 4Z2IA 2ZQUA 3PRDA 4JFLA 4S3KA 1WNOA 1LJYA 4MGVA 1TCOC 3BXWA 3ARXA 3GPKA 2XPAA 1NWRA 3O5QA 3WQWA 3G6LA 3KAHA 3B9DA 4IQ2A 3O5PA 4NNRA 2XP9A 3UI5A 3ARUA 5J6EA 2A3AA 3PRAA 3NTPA 4QZVB 3I6CA 1H0IA 3AS3A 1HKIA 2MF9A 2ZR5A 3ARRA 1D7JA 2MPHA 3FY1A 2XP7A 3RFWA 1NMVA 4DWSD 3B7XA 3RMEA 4S3JA 4LGXA 2DT0A 1XHGA 4TYOA 1FKFA 1GUVA 1LG2A 2KE0A 5HBFA 4MNLA 2RUDA 4DZ3A 4LAYA 1YW5A 1J4IA 2IUZA 1FFRA 1EDQA 2PPPA 1W9UA 5BXJA 2Y78A 4TW8A 1W1YA 4TX0A 2D9FA 3B9AA 5GPGA 1HJWA 2N87A 1J4HA 3UQBA 1UR9A 3B9EA 4Z2HA 2DSZA 1EYMA 1H0GA 2RSEA 3CZ8A 2ZQTA 1KT1A 2PI6A 5HTGA 2XPBA 2LJ4A 1LG1A 4ZPTR 2RUQA 3CHDA 4Q7NA 3O5GA 1W1VA 5D75A 4XAKA 4AY1A 3KABA 3H9RB 5DIUA 4DROA 1T11A 1N1AA 1E6PA 3WIJA 4FN2A 2OLHA 2MLYA 3WL1A 1PBKA 4DRJA 2KFWA 1D6OA 1UR8A 3AS1A 2ITKA 4JFJA 1NWTA 4MAVA 1ITXA 1JNDA 4IT6A 3ARSA 4DRQA 1EQ3A 1QPLA 3OOBA 3ARTA 1YATA 3WD4A 5HW6A 3AQUA 1FKGA 1FKTA 4URIA 2KI3A 4W5UA 4ZS6A 1LL7A 3ALFA 3IHZA 4DRHA 2RQSA 5HUAA 1D7IA 1TFVA 4WK9A 3KACA 3O5MA 3W4RA 3O5EA 2OFNA 1EIBA 4C02B 4R5EA 2VCDA 3VAWA 2XP4A 4Z2JA 4LAXA 2A3CA 2KO7A 3O5FA 4ODPA 1P5QA 3TDBA 3KCEA 1D7HA 1PINA 1R9HA 4DH0A 5HWBA 2PV1A 1FKJA 3PR9A 1IX5A 3FXYA 4P8VA 3ALGA 3O5JA 1FKLA 2ZR6A 3O5OA 2WLZA 5B8IC 4JYSA 1E6NA 4DRIA 4IT4A 2XP8A 4ODQA 1ZB5A 3WH0A 3B8SA 2PV3A 3JYMA 2RUCA 3RM9A 3O5DA 1FKBA 4ZPVR 2PPOA 4Z2GA 2FDMA 1E9LA 4ODMA 1E6RA 2FKEA 3RM8A 1HKKA 4ODOA 1XRVA 2G41A 2YBTA 2ZQSA 3AROA 3IK8A 2K8IA 1NWSA 4KR0B 5JH8A 3UQAA 2M1IA 4BF8A 2ZR4A 3WD0A 4KQZA 3ARZA 1ZBVA 2UZ5A 1QPFA 4DWSB 2DSWA 4Z2LA 1KFWA 1WB0A 4TW6A 2A3BA 1Y0OA 3KZ7A 3WD3A 4W9OA 2WLYA 1FKKA 2QF8A 4JFIA 2DT2A 3JXVA 4R0XA 5DIVA 2MLXA 4W9PA 1FKHA 4U84A 4NSBA 4WKAA 3ARYA 2A3EA 1LL4A 2DG3A 2JZVA 3MDYB 2FAPA 4MPKA 1JNSA 3WKZA 4ML4A 2DSUA 4JFKA 3CGMA 2M08A 3ARQA 1BL4A 4ODLA 5DITA 4J4NA 4U85A 1OWQA 1ZBKA 1E6ZA 2MNTA 3TCZA 2XP5A 4NZCA 4PTMA 1FKSA 1FD9A 2WM0A 1NH6A 2MLZA 1JNEA 4P8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7J A;  2PBC A;  2MPH A;  2LPV A;  3O5R A;  4LAX A;  2XP7 A;  5HKG A;  1FJD A;  3RFW A;  4JFM A;  1NMV A;  2KO7 A;  4DIP A;  5BXJ A;  3B7X A;  3O5F A;  2DG4 A;  4ODP A;  1P5Q A;  2F2D A;  3LUO A;  4LAV A;  1Q6I A;  3TDB A;  3KCE A;  1JNT A;  2F21 A;  4IQC A;  1D7H A;  1PIN A;  2XP3 A;  4TYO A;  1FKF A;  1ROU A;  2KE0 A;  1R9H A;  2XP6 A;  1A7X A;  5HT1 A;  1NMW A;  4DH0 A;  2RUD A;  3PA7 A;  5HW8 A;  5HWB A;  2PV1 A;  1FKJ A;  3IKG A;  3KAF A;  4DRK A;  4ODN A;  1U79 A;  4DZ3 A;  2Q5A A;  4IPX A;  1YW5 A;  4LAY A;  1J4I A;  4W9Q A;  3PRB A;  1F40 A;  4U86 A;  3O5J A;  1FKL A;  1Q6H A;  2PPP A;  2ZR6 A;  3O5O A;  4G2P A;  5B8I C;  2Y78 A;  4TW8 A;  1FKI A;  4TW7 A;  4JYS A;  4O2T A;  2D9F A;  4TX0 A;  4DRI A;  2XP8 A;  4ODQ A;  1Q6U A;  1L1P A;  2LKN A;  2L2S A;  1F8A B;  3EY6 A;  4N19 A;  5GPG A;  3WH0 A;  2PPN A;  2N87 A;  1J4H A;  2PV3 A;  1ZK6 A;  3UQB A;  4ODK A;  3JYM A;  2RUC A;  1QZ2 A;  1ZCN A;  1EYM A;  1FKB A;  3O5D A;  2PPO A;  3RGC A;  3JYJ A;  1W26 A;  2RSE A;  4ODM A;  2ZQT A;  1KT1 A;  1KT0 A;  5HTG A;  2FKE A;  2XPB A;  2LJ4 A;  3FAP A;  4ODO A;  1C9H A;  2ZQS A;  2RUQ A;  3UI6 A;  3IK8 A;  3NRK A;  1BKF A;  2K8I A;  3UF8 A;  4GIV A;  3O5G A;  4DZ2 A;  3UQA A;  2M1I A;  1M5Y A;  4DRN A;  5D75 A;  4BF8 A;  2ZR4 A;  5HWC A;  1FKR A;  4QT2 A;  1JVW A;  2F4E A;  1FAP A;  3KAB A;  3KAD A;  3H9R B;  4G50 A;  4QT3 A;  1NSG A;  5DIU A;  4DRO A;  2UZ5 A;  1QPF A;  3UQI A;  1T11 A;  2LGO A;  4LAW A;  2ZQV A;  1N1A A;  2IF4 A;  4ITZ A;  2M2A A;  4FN2 A;  4FAP A;  3ODK A;  4ODR A;  2MLY A;  4TW6 A;  2VN1 A;  5I98 A;  1PBK A;  1Y0O A;  3KZ7 A;  4DRJ A;  3O5L A;  3TC5 A;  2KFW A;  4W9O A;  1D6O A;  1B6C A;  2KR7 A;  1FKK A;  3O5I A;  2PV2 A;  2ITK A;  4JFI A;  2DG9 A;  3O5K A;  3JXV A;  4JFJ A;  2ZQU A;  4MSP A;  4R0X A;  5DIV A;  3PRD A;  4JFL A;  4DRQ A;  2RUR A;  3CGN A;  4MGV A;  2MLX A;  4W9P A;  1TCO C;  1EQ3 A;  1FKH A;  4QIB A;  4U84 A;  4DRP A;  3IKD A;  4J4O A;  3NI6 A;  3GPK A;  5HW7 A;  2XPA A;  1QPL A;  3OOB A;  2JZV A;  1J4R A;  2DG3 A;  1YAT A;  2FAP A;  3MDY B;  5HW6 A;  1J6Y A;  1JNS A;  1FKG A;  1FKT A;  2KI3 A;  3O5Q A;  4JFK A;  2AWG A;  3KAG A;  3CGM A;  3IHZ A;  1HXV A;  2M08 A;  4DRH A;  1BL4 A;  2RQS A;  4ODL A;  5DIT A;  5HUA A;  1FKD A;  1D7I A;  3KAH A;  4J4N A;  4IQ2 A;  2KGJ A;  4DT4 A;  3KAC A;  3O5P A;  3O5M A;  4U85 A;  4NNR A;  2MNT A;  2XP9 A;  3UI4 A;  3UI5 A;  4GGQ A;  3TCZ A;  2XP5 A;  5J6E A;  3NTP A;  3O5E A;  2OFN A;  1Q1C A;  1FKS A;  1FD9 A;  3I6C A;  2MLZ A;  4TNS A;  1ROT A;  4C02 B;  2MF9 A;  2ZR5 A;  4DRM A;  2VCD A;  3KAI A;  3VAW A;  2XP4 A; 
#chains in the Genus database with same CATH topology
 2PBC A;  4L3N A;  4MNK A;  3ARV A;  4DIP A;  4DWS A;  2F2D A;  4LAV A;  5DEZ A;  4IQC A;  2F21 A;  3ARW A;  1ZU8 A;  1ROU A;  2XP6 A;  1A7X A;  4HBO A;  5HW8 A;  4WKF A;  3KAF A;  2O9O A;  4ODN A;  3CH9 A;  4IPX A;  3BMB A;  1ZL1 A;  5DF0 A;  1FFQ A;  1F40 A;  1GPF A;  3ARP A;  4U86 A;  1W9V A;  1HXV A;  4G2P A;  1FKI A;  4O2T A;  1W1T A;  1X6L A;  1Q6U A;  4MTV A;  2LKN A;  4Q22 A;  1ZK6 A;  4ODK A;  1QZ2 A;  3RGC A;  2EUL A;  3CHF A;  4WIW A;  4L72 B;  3NRK A;  1ZBC A;  3UF8 A;  4GIV A;  4DZ2 A;  1HJX A;  1ZBW A;  5DO2 A;  1FKR A;  4DWS C;  1JVW A;  1RD6 A;  1FAP A;  2F4E A;  4G50 A;  4QT3 A;  1NSG A;  2LGO A;  2ZQV A;  4ITZ A;  1X6N A;  1LQ0 A;  1GOI A;  4MNJ A;  2DSV A;  1K9T A;  4ODR A;  1D2K A;  2VN1 A;  5I98 A;  1WAW A;  3O5L A;  3CHE A;  2WK2 A;  3O5K A;  1SR0 A;  3GTY X;  2RUR A;  3CGN A;  4QIB A;  4DRP A;  4J4O A;  3NI6 A;  5HW7 A;  4P8X A;  1J4R A;  1J6Y A;  2AWG A;  3KAG A;  3RM4 A;  1FKD A;  1LL6 A;  2KGJ A;  4DT4 A;  3G6M A;  3UI4 A;  1EHN A;  4GGQ A;  4ZPW R;  3WQV A;  1Q1C A;  2G8Z A;  1OGG A;  1VF8 A;  4TNS A;  1ROT A;  4DRM A;  3KAI A;  3IKD A;  2LPV A;  3O5R A;  2ESC A;  5HKG A;  1FJD A;  4JFM A;  2AOS A;  2DG4 A;  3LUO A;  1Q6I A;  1JNT A;  2XP3 A;  3WL0 A;  5GPR A;  5HT1 A;  1NMW A;  3PA7 A;  3IKG A;  4DRK A;  1U79 A;  1W9P A;  2Q5A A;  1HJV A;  4W9Q A;  2YBU A;  3PRB A;  1Q6H A;  2DPE A;  4WKH A;  4Z2K A;  2DT3 A;  1NWU A;  4TW7 A;  1L1P A;  2L2S A;  1F8A B;  3EY6 A;  4N19 A;  2PPN A;  3WD2 A;  3QOK A;  2B31 A;  1ZCN A;  3CHC A;  3JYJ A;  1W26 A;  2DT1 A;  1KT0 A;  1O6I A;  1HKJ A;  4P8W A;  3FAP A;  2O92 A;  4HAR A;  3AS2 A;  3WD1 A;  1E15 A;  1C9H A;  3UI6 A;  1SYT A;  1BKF A;  1OGB A;  1M5Y A;  4DRN A;  5HWC A;  4QT2 A;  3KAD A;  4HBE A;  3UQI A;  4LAW A;  1W1P A;  2IF4 A;  5GQB A;  2M2A A;  4FAP A;  3ODK A;  1HKM A;  3AS0 A;  4WJX A;  3TC5 A;  3OA5 A;  4MNM A;  1B6C A;  2KR7 A;  3O5I A;  2PV2 A;  4MSP A;  2DG9 A;  1CTN A;  4Z2I A;  2ZQU A;  3PRD A;  4JFL A;  4S3K A;  1WNO A;  1LJY A;  4MGV A;  1TCO C;  3BXW A;  3ARX A;  3GPK A;  2XPA A;  1NWR A;  3O5Q A;  3WQW A;  3G6L A;  3KAH A;  3B9D A;  4IQ2 A;  3O5P A;  4NNR A;  2XP9 A;  3UI5 A;  3ARU A;  5J6E A;  2A3A A;  3PRA A;  3NTP A;  4QZV B;  3I6C A;  1H0I A;  3AS3 A;  1HKI A;  2MF9 A;  2ZR5 A;  3ARR A;  1D7J A;  2MPH A;  3FY1 A;  2XP7 A;  3RFW A;  1NMV A;  4DWS D;  3B7X A;  3RME A;  4S3J A;  4LGX A;  2DT0 A;  1XHG A;  4TYO A;  1FKF A;  1GUV A;  1LG2 A;  2KE0 A;  5HBF A;  4MNL A;  2RUD A;  4DZ3 A;  4LAY A;  1YW5 A;  1J4I A;  2IUZ A;  1FFR A;  1EDQ A;  2PPP A;  1W9U A;  5BXJ A;  2Y78 A;  4TW8 A;  1W1Y A;  4TX0 A;  2D9F A;  3B9A A;  5GPG A;  1HJW A;  2N87 A;  1J4H A;  3UQB A;  1UR9 A;  3B9E A;  4Z2H A;  3GU0 A;  2DSZ A;  1EYM A;  1H0G A;  2ETN A;  2RSE A;  3CZ8 A;  2ZQT A;  1KT1 A;  2PI6 A;  5HTG A;  2XPB A;  2LJ4 A;  1LG1 A;  4ZPT R;  2RUQ A;  3CHD A;  4Q7N A;  3O5G A;  1W1V A;  5D75 A;  4XAK A;  4AY1 A;  3KAB A;  3H9R B;  5DIU A;  4DRO A;  1T11 A;  1N1A A;  1E6P A;  3WIJ A;  4FN2 A;  2OLH A;  2B5U B;  2MLY A;  3WL1 A;  1PBK A;  4DRJ A;  2KFW A;  1D6O A;  1UR8 A;  3AS1 A;  2ITK A;  1GRJ A;  1NWT A;  4JFJ A;  4MAV A;  1ITX A;  1JND A;  4IT6 A;  3ARS A;  4DRQ A;  1EQ3 A;  1QPL A;  3OOB A;  3ART A;  1YAT A;  3WD4 A;  5HW6 A;  3AQU A;  1FKG A;  1FKT A;  4URI A;  2KI3 A;  4W5U A;  4ZS6 A;  1LL7 A;  3ALF A;  3IHZ A;  4DRH A;  2RQS A;  5HUA A;  1D7I A;  1TFV A;  4WK9 A;  3KAC A;  3O5M A;  3W4R A;  2P4V A;  3O5E A;  2OFN A;  1EIB A;  4C02 B;  4R5E A;  2VCD A;  3VAW A;  2XP4 A;  4Z2J A;  4LAX A;  2A3C A;  2KO7 A;  3O5F A;  4ODP A;  1P5Q A;  3TDB A;  3KCE A;  1D7H A;  1PIN A;  1R9H A;  4DH0 A;  5HWB A;  2PV1 A;  1FKJ A;  3PR9 A;  1IX5 A;  3FXY A;  4P8V A;  1E44 A;  3ALG A;  3O5J A;  1FKL A;  2ZR6 A;  3O5O A;  2WLZ A;  5B8I C;  4JYS A;  1E6N A;  4DRI A;  4IT4 A;  2XP8 A;  4ODQ A;  1ZB5 A;  3WH0 A;  3B8S A;  2PV3 A;  3JYM A;  2RUC A;  3RM9 A;  3O5D A;  1FKB A;  4ZPV R;  2PPO A;  4Z2G A;  2FDM A;  1E9L A;  4ODM A;  1E6R A;  2FKE A;  3RM8 A;  1HKK A;  4ODO A;  1XRV A;  2G41 A;  2YBT A;  2ZQS A;  3ARO A;  3IK8 A;  2K8I A;  1NWS A;  4KR0 B;  5JH8 A;  3UQA A;  2M1I A;  4BF8 A;  2ZR4 A;  2F23 A;  3WD0 A;  4KQZ A;  3ARZ A;  1ZBV A;  2UZ5 A;  1QPF A;  4DWS B;  2DSW A;  4Z2L A;  4UDM A;  1KFW A;  1WB0 A;  4TW6 A;  2A3B A;  1Y0O A;  3KZ7 A;  2PN0 A;  3WD3 A;  4W9O A;  2WLY A;  1FKK A;  2QF8 A;  4JFI A;  2DT2 A;  3JXV A;  4R0X A;  5DIV A;  2MLX A;  4W9P A;  1FKH A;  4U84 A;  4NSB A;  4WKA A;  3ARY A;  2A3E A;  1LL4 A;  2DG3 A;  2JZV A;  3MDY B;  2FAP A;  4MPK A;  1JNS A;  3WKZ A;  4ML4 A;  2DSU A;  4JFK A;  3CGM A;  2M08 A;  3ARQ A;  1BL4 A;  4ODL A;  5DIT A;  1JCH B;  4J4N A;  4U85 A;  1OWQ A;  1ZBK A;  1E6Z A;  2MNT A;  3TCZ A;  2XP5 A;  4NZC A;  4PTM A;  3EIP A;  1FKS A;  1FD9 A;  2WM0 A;  1NH6 A;  2MLZ A;  1JNE A;  4P8U A; 
#chains in the Genus database with same CATH homology
 2PBC A;  4L3N A;  4MNK A;  3ARV A;  4DIP A;  4DWS A;  2F2D A;  4LAV A;  5DEZ A;  4IQC A;  2F21 A;  3ARW A;  1ZU8 A;  1ROU A;  2XP6 A;  1A7X A;  4HBO A;  5HW8 A;  4WKF A;  3KAF A;  2O9O A;  4ODN A;  3CH9 A;  4IPX A;  1ZL1 A;  5DF0 A;  1FFQ A;  1F40 A;  1GPF A;  3ARP A;  4U86 A;  1W9V A;  1HXV A;  4G2P A;  1FKI A;  4O2T A;  1W1T A;  1X6L A;  1Q6U A;  4MTV A;  2LKN A;  4Q22 A;  1ZK6 A;  4ODK A;  1QZ2 A;  3RGC A;  3CHF A;  4WIW A;  4L72 B;  3NRK A;  1ZBC A;  3UF8 A;  4GIV A;  4DZ2 A;  1HJX A;  1ZBW A;  5DO2 A;  1FKR A;  4DWS C;  1JVW A;  1RD6 A;  1FAP A;  2F4E A;  4G50 A;  4QT3 A;  1NSG A;  2LGO A;  2ZQV A;  4ITZ A;  1X6N A;  1LQ0 A;  1GOI A;  4MNJ A;  2DSV A;  1K9T A;  4ODR A;  1D2K A;  2VN1 A;  5I98 A;  1WAW A;  3O5L A;  3CHE A;  2WK2 A;  3O5K A;  1SR0 A;  2RUR A;  3CGN A;  4QIB A;  4DRP A;  4J4O A;  3NI6 A;  5HW7 A;  4P8X A;  1J4R A;  1J6Y A;  2AWG A;  3KAG A;  3RM4 A;  1FKD A;  1LL6 A;  2KGJ A;  4DT4 A;  3G6M A;  3UI4 A;  1EHN A;  4GGQ A;  4ZPW R;  3WQV A;  1Q1C A;  2G8Z A;  1OGG A;  1VF8 A;  4TNS A;  1ROT A;  4DRM A;  3KAI A;  3IKD A;  2LPV A;  3O5R A;  2ESC A;  5HKG A;  1FJD A;  4JFM A;  2AOS A;  2DG4 A;  3LUO A;  1Q6I A;  1JNT A;  2XP3 A;  3WL0 A;  5GPR A;  5HT1 A;  1NMW A;  3PA7 A;  3IKG A;  4DRK A;  1U79 A;  1W9P A;  2Q5A A;  1HJV A;  4W9Q A;  2YBU A;  3PRB A;  1Q6H A;  2DPE A;  4WKH A;  4Z2K A;  2DT3 A;  1NWU A;  4TW7 A;  1L1P A;  2L2S A;  1F8A B;  3EY6 A;  4N19 A;  2PPN A;  3WD2 A;  3QOK A;  2B31 A;  1ZCN A;  3CHC A;  3JYJ A;  1W26 A;  2DT1 A;  1KT0 A;  1O6I A;  1HKJ A;  4P8W A;  3FAP A;  2O92 A;  4HAR A;  3AS2 A;  3WD1 A;  1E15 A;  1C9H A;  3UI6 A;  1SYT A;  1BKF A;  1OGB A;  1M5Y A;  4DRN A;  5HWC A;  4QT2 A;  3KAD A;  4HBE A;  3UQI A;  4LAW A;  1W1P A;  2IF4 A;  5GQB A;  2M2A A;  4FAP A;  3ODK A;  1HKM A;  3AS0 A;  4WJX A;  3TC5 A;  3OA5 A;  4MNM A;  1B6C A;  2KR7 A;  3O5I A;  2PV2 A;  4MSP A;  2DG9 A;  1CTN A;  4Z2I A;  2ZQU A;  3PRD A;  4JFL A;  4S3K A;  1WNO A;  1LJY A;  4MGV A;  1TCO C;  3BXW A;  3ARX A;  3GPK A;  2XPA A;  1NWR A;  3O5Q A;  3WQW A;  3G6L A;  3KAH A;  3B9D A;  4IQ2 A;  3O5P A;  4NNR A;  2XP9 A;  3UI5 A;  3ARU A;  5J6E A;  2A3A A;  3PRA A;  3NTP A;  4QZV B;  3I6C A;  1H0I A;  3AS3 A;  1HKI A;  2MF9 A;  2ZR5 A;  3ARR A;  1D7J A;  2MPH A;  3FY1 A;  2XP7 A;  3RFW A;  1NMV A;  4DWS D;  3B7X A;  3RME A;  4S3J A;  4LGX A;  2DT0 A;  1XHG A;  4TYO A;  1FKF A;  1GUV A;  1LG2 A;  2KE0 A;  5HBF A;  4MNL A;  2RUD A;  4DZ3 A;  4LAY A;  1YW5 A;  1J4I A;  2IUZ A;  1FFR A;  1EDQ A;  2PPP A;  1W9U A;  5BXJ A;  2Y78 A;  4TW8 A;  1W1Y A;  4TX0 A;  2D9F A;  3B9A A;  5GPG A;  1HJW A;  2N87 A;  1J4H A;  3UQB A;  1UR9 A;  3B9E A;  4Z2H A;  2DSZ A;  1EYM A;  1H0G A;  2RSE A;  3CZ8 A;  2ZQT A;  1KT1 A;  2PI6 A;  5HTG A;  2XPB A;  2LJ4 A;  1LG1 A;  4ZPT R;  2RUQ A;  3CHD A;  4Q7N A;  3O5G A;  1W1V A;  5D75 A;  4XAK A;  4AY1 A;  3KAB A;  3H9R B;  5DIU A;  4DRO A;  1T11 A;  1N1A A;  1E6P A;  3WIJ A;  4FN2 A;  2OLH A;  2MLY A;  3WL1 A;  1PBK A;  4DRJ A;  2KFW A;  1D6O A;  1UR8 A;  3AS1 A;  2ITK A;  4JFJ A;  1NWT A;  4MAV A;  1ITX A;  1JND A;  4IT6 A;  3ARS A;  4DRQ A;  1EQ3 A;  1QPL A;  3OOB A;  3ART A;  1YAT A;  3WD4 A;  5HW6 A;  3AQU A;  1FKG A;  1FKT A;  4URI A;  2KI3 A;  4W5U A;  4ZS6 A;  1LL7 A;  3ALF A;  3IHZ A;  4DRH A;  2RQS A;  5HUA A;  1D7I A;  1TFV A;  4WK9 A;  3KAC A;  3O5M A;  3W4R A;  3O5E A;  2OFN A;  1EIB A;  4C02 B;  4R5E A;  2VCD A;  3VAW A;  2XP4 A;  4Z2J A;  4LAX A;  2A3C A;  2KO7 A;  3O5F A;  4ODP A;  1P5Q A;  3TDB A;  3KCE A;  1D7H A;  1PIN A;  1R9H A;  4DH0 A;  5HWB A;  2PV1 A;  1FKJ A;  3PR9 A;  1IX5 A;  3FXY A;  4P8V A;  3ALG A;  3O5J A;  1FKL A;  2ZR6 A;  3O5O A;  2WLZ A;  5B8I C;  4JYS A;  1E6N A;  4DRI A;  4IT4 A;  2XP8 A;  4ODQ A;  1ZB5 A;  3WH0 A;  3B8S A;  2PV3 A;  3JYM A;  2RUC A;  3RM9 A;  3O5D A;  1FKB A;  4ZPV R;  2PPO A;  4Z2G A;  2FDM A;  1E9L A;  4ODM A;  1E6R A;  2FKE A;  3RM8 A;  1HKK A;  4ODO A;  1XRV A;  2G41 A;  2YBT A;  2ZQS A;  3ARO A;  3IK8 A;  2K8I A;  1NWS A;  4KR0 B;  5JH8 A;  3UQA A;  2M1I A;  4BF8 A;  2ZR4 A;  3WD0 A;  4KQZ A;  3ARZ A;  1ZBV A;  2UZ5 A;  1QPF A;  4DWS B;  2DSW A;  4Z2L A;  1KFW A;  1WB0 A;  4TW6 A;  2A3B A;  1Y0O A;  3KZ7 A;  3WD3 A;  4W9O A;  2WLY A;  1FKK A;  2QF8 A;  4JFI A;  2DT2 A;  3JXV A;  4R0X A;  5DIV A;  2MLX A;  4W9P A;  1FKH A;  4U84 A;  4NSB A;  4WKA A;  3ARY A;  2A3E A;  1LL4 A;  2DG3 A;  2JZV A;  3MDY B;  2FAP A;  4MPK A;  1JNS A;  3WKZ A;  4ML4 A;  2DSU A;  4JFK A;  3CGM A;  2M08 A;  3ARQ A;  1BL4 A;  4ODL A;  5DIT A;  4J4N A;  4U85 A;  1OWQ A;  1ZBK A;  1E6Z A;  2MNT A;  3TCZ A;  2XP5 A;  4NZC A;  4PTM A;  1FKS A;  1FD9 A;  2WM0 A;  1NH6 A;  2MLZ A;  1JNE A;  4P8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...