3O5FA

Fk1 domain of fkbp51, crystal form vii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
TATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 34
structure length 125
sequence length 125
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5fA00
4G50A 3H9RB 4JFIA 1C9HA 3JYJA 5DIVA 5HUAA 1KT0A 4TW6A 2XP7A 3O5RA 1BKFA 2Q5AA 4N19A 3UF8A 3VAWA 3KADA 1J4IA 4DRPA 4FN2A 1NMWA 4TNSA 1U79A 1PBKA 1QPLA 2DG3A 2MPHA 4W9OA 2LGOA 3O5OA 4GGQA 4W9PA 1FKLA 1FKIA 4DROA 4DRHA 4R0XA 1QPFA 3O5GA 4ODMA 4IQCA 4JFMA 4U86A 1W26A 3KZ7A 2DG9A 4J4NA 4QT3A 4JFLA 1FKBA 1ZCNA 2XPBA 4IQ2A 3UQIA 1FKRA 1D7IA 1Y0OA 1FKTA 4TX0A 2MLZA 2IF4A 3IHZA 5HT1A 2JZVA 3RFWA 4DRQA 4DRNA 1Q6HA 2XP8A 2F21A 2FAPA 4J4OA 2K8IA 4C02B 3TCZA 5B8IC 3O5IA 3NTPA 1FJDA 2XP9A 4DZ3A 2F2DA 2UZ5A 5DITA 2PPNA 2RQSA 3KAGA 1F8AB 2RUDA 2RUCA 2F4EA 3CGNA 5HWCA 1P5QA 3O5KA 3O5FA 2XP5A 4W9QA 4ITZA 2KE0A 4DZ2A 1D6OA 3WH0A 3CGMA 5HTGA 3O5MA 3ODKA 4NNRA 1YATA 3NRKA 3UI5A 3O5LA 2LJ4A 1R9HA 2OFNA 4FAPA 4MGVA 2MLYA 4U84A 4ODQA 3LUOA 1KT1A 3OOBA 2XPAA 4DH0A 5I98A 2PPPA 2DG4A 1FAPA 2RSEA 3UQAA 5J6EA 2PV3A 1JNSA 4JFJA 1FKGA 3UI6A 2XP3A 2ZR6A 4ODPA 3O5EA 1ROTA 4ODLA 1FKDA 3KAFA 2XP4A 3KACA 2AWGA 4IPXA 2LKNA 3KABA 1M5YA 3EY6A 1FKKA 3IK8A 1Q1CA 1EQ3A 3O5DA 2ZQSA 2D9FA 4TYOA 4BF8A 3I6CA 3KCEA 4LAVA 4LAYA 2ZR5A 3JYMA 2M1IA 3UQBA 4QIBA 4DRIA 3JXVA 2Y78A 5HKGA 4G2PA 4O2TA 4LAWA 1ZK6A 2M08A 4LAXA 4ODKA 3RGCA 1FKSA 2XP6A 5HW6A 2VN1A 4QT2A 3O5JA 1Q6IA 3TDBA 1YW5A 1T11A 2RURA 2RUQA 1F40A 1ROUA 4DIPA 1Q6UA 2PBCA 4DRJA 3PRDA 3PA7A 3TC5A 3GPKA 1L1PA 1FD9A 2PV2A 5DIUA 5HW7A 3NI6A 2KO7A 3KAHA 4ODRA 4DT4A 1BL4A 2FKEA 4JYSA 1NMVA 4TW7A 2MF9A 2KI3A 1JVWA 1J4RA 3O5PA 5BXJA 1N1AA 1FKHA 1A7XA 5HW8A 5HWBA 2ZQVA 2PPOA 2KGJA 3MDYB 3B7XA 1FKJA 2MNTA 2LPVA 4MSPA 1FKFA 1B6CA 2L2SA 3IKDA 1D7HA 3KAIA 1NSGA 2ZQUA 2PV1A 5D75A 5GPGA 1HXVA 1J4HA 2ZR4A 1TCOC 3O5QA 2ITKA 1D7JA 4TW8A 2N87A 4DRKA 2VCDA 2M2AA 4ODOA 1EYMA 2ZQTA 2KFWA 3FAPA 1QZ2A 1JNTA 2MLXA 2KR7A 1PINA 3IKGA 4GIVA 3PRBA 4U85A 1J6YA 4ODNA 4JFKA 3UI4A 4DRMA
chains in the Genus database with same CATH superfamily
3H9RB 4ZS6A 4JFIA 1C9HA 2DSUA 3EIPA 1KFWA 3ARYA 1ITXA 4NSBA 4FN2A 2MPHA 4W9OA 3ARSA 2LGOA 2PN0A 2A3EA 4W9PA 4DRHA 4DROA 4U86A 3KZ7A 2OLHA 1LL4A 4QT3A 4QZVB 3CHCA 1E6NA 4TX0A 4ZPWR 4PTMA 2IF4A 5HT1A 3RFWA 4DRQA 3ARQA 3RM4A 2F21A 4C02B 2K8IA 3WIJA 1XRVA 1WAWA 1EIBA 2RUCA 3CGNA 5HWCA 4Z2LA 4W9QA 4DZ2A 3WH0A 1YATA 3O5LA 2LJ4A 1ZBKA 3LUOA 1OGGA 4DH0A 1FAPA 1FKGA 1SYTA 1XHGA 4ODLA 1FKDA 3CHDA 3KABA 3EY6A 3IK8A 4WKFA 2ZQSA 3AROA 4TYOA 3I6CA 1NWRA 1LG1A 3CHFA 3WQVA 3FY1A 4ODKA 2M08A 1HJXA 3TDBA 4QT2A 1LL6A 1ROUA 1X6LA 2O92A 4NZCA 4Z2GA 3GPKA 4MNLA 1NWUA 3NI6A 1X6NA 4AY1A 4ODRA 4JYSA 2DSVA 1ZB5A 1ZU8A 4Q7NA 1NWTA 3B7XA 1FKFA 3IKDA 2G41A 4Z2HA 3O5QA 2WLYA 2G8ZA 1EYMA 2ZQTA 1QZ2A 1JNTA 1GPFA 1PINA 4GIVA 3PRBA 3BXWA 1J6YA 1O6IA 4ODNA 3UI4A 4DRMA 4G50A 4DRNA 1W9VA 1WNOA 3W4RA 3JYJA 5DIVA 3ARRA 3B9EA 2YBTA 2YBUA 1W1TA 4TW6A 2XP7A 4ML4A 1BKFA 3KADA 3GU0A 4DRPA 1ZBCA 1U79A 4ZPTR 2QF8A 4JFMA 4UDMA 2DG9A 4P8VA 1FFRA 3ARWA 3AQUA 1FJDA 4DZ3A 2B31A 2F2DA 2RQSA 2F4EA 3O5FA 3WQWA 4MPKA 5HTGA 3O5MA 2A3CA 4WK9A 2OFNA 3AS1A 1H0GA 1KT1A 2RSEA 3UQAA 1W1PA 5J6EA 1JNSA 4R5EA 2ZR6A 1E6ZA 4P8WA 3KACA 2LKNA 1EQ3A 2ZR5A 1E9LA 4P8UA 2M1IA 4IT6A 4QIBA 3RM9A 4DRIA 3ARVA 5HW6A 4DWSA 2RUQA 1E44A 2PBCA 3CHEA 4MNKA 3TC5A 4Z2JA 4DWSD 3ALFA 1FD9A 2PV2A 5DIUA 3WKZA 1LL7A 1HKJA 4Q22A 2A3BA 1BL4A 2FKEA 4MAVA 5DO2A 2MF9A 1JVWA 3ARZA 5BXJA 1FKHA 1A7XA 5HW8A 2ZQVA 2KGJA 2LPVA 4DWSC 1B6CA 4S3JA 1D7HA 1NSGA 1HXVA 2FDMA 3CH9A 4DRKA 4ODOA 1GUVA 4L72B 2DSWA 2KR7A 3IKGA 4MTVA 2P4VA 3ARTA 4WIWA 4DWSB 3WD0A 2ETNA 5DF0A 1FFQA 2WK2A 3G6MA 5HUAA 3O5RA 2Q5AA 3UF8A 3VAWA 5HBFA 2AOSA 4HARA 4TNSA 1PBKA 2DPEA 3O5OA 4GGQA 1FKLA 4R0XA 1QPFA 4IQCA 1W26A 1HJVA 4JFLA 1FKBA 1ZCNA 2XPBA 1JNEA 1D7IA 1Y0OA 3WD4A 1OGBA 2MLZA 3IHZA 2F23A 2JZVA 1Q6HA 2FAPA 3O5IA 3NTPA 2XP9A 2UZ5A 2PPNA 2XP5A 1NH6A 2KE0A 4ITZA 1D6OA 3AS3A 3AS0A 1HJWA 4MGVA 2MLYA 3BMBA 3OOBA 2XPAA 2DT1A 5I98A 2PPPA 3WD3A 3B9AA 3UI6A 4WKAA 4WJXA 3WD2A 3KAFA 1M5YA 1FKKA 1Q1CA 1TFVA 4U85A 2D9FA 4BF8A 3KCEA 4LAVA 1ZBVA 4LGXA 3JYMA 4Z2IA 3UQBA 3JXVA 5HKGA 1FKSA 2XP6A 1F40A 1Q6IA 1YW5A 2RURA 2ESCA 2O9OA 3G6LA 2A3AA 4Z2KA 4DIPA 3PRDA 3PA7A 5HW7A 2KO7A 1HKIA 1W1VA 4DT4A 4TW7A 1EHNA 1LQ0A 1J4RA 2IUZA 1N1AA 5GQBA 5HWBA 2PI6A 2PPOA 1FKJA 3GTYX 4MSPA 2L2SA 5D75A 2ZQUA 2PV1A 5GPGA 3FXYA 1J4HA 1HKKA 1ZL1A 4TW8A 3B8SA 2N87A 2VCDA 1ZBWA 2KFWA 3FAPA 2MLXA 2DT2A 2B5UB 1UR9A 3ARXA 1KT0A 4MNJA 1HKMA 5GPRA 1W1YA 4N19A 1E6RA 2WM0A 1J4IA 1NMWA 1QPLA 2DG3A 1NWSA 1CTNA 1FKIA 3PRAA 3O5GA 4ODMA 2DSZA 4S3KA 1RD6A 4J4NA 3QOKA 4IQ2A 3UQIA 1JNDA 1FKTA 3ARPA 1E6PA 2XP8A 4P8XA 4J4OA 5B8IC 3TCZA 1GOIA 1E15A 5DITA 3KAGA 1IX5A 1F8AB 2RUDA 1H0IA 1P5QA 3O5KA 5JH8A 1JCHB 3CGMA 3ODKA 4NNRA 3NRKA 3UI5A 4IT4A 4XAKA 1R9HA 4KQZA 4FAPA 2DT0A 4U84A 4ODQA 2DG4A 2PV3A 2DT3A 4JFJA 3OA5A 2XP3A 4ODPA 3O5EA 1UR8A 1ROTA 1W9UA 2XP4A 2AWGA 4IPXA 3O5DA 3WD1A 4L3NA 1K9TA 3B9DA 4HBEA 4LAYA 1VF8A 1WB0A 2Y78A 4ZPVR 4G2PA 4O2TA 4LAWA 1ZK6A 4LAXA 3RGCA 2VN1A 3O5JA 1T11A 1LG2A 1Q6UA 3PR9A 4DRJA 1L1PA 3AS2A 1EDQA 3KAHA 1LJYA 1NMVA 3RMEA 3RM8A 2KI3A 4W5UA 1GRJA 3O5PA 4URIA 3WL1A 1W9PA 3MDYB 2MNTA 2WLZA 1FKRA 3KAIA 1SR0A 4WKHA 3ARUA 5DEZA 3CZ8A 2ZR4A 1D2KA 1TCOC 2ITKA 1D7JA 2M2AA 4KR0B 4MNMA 1OWQA 3ALGA 3WL0A 2EULA 4HBOA 4JFKA
chains in the Genus database with same CATH topology
3H9RB 4ZS6A 4JFIA 1C9HA 2DSUA 1KFWA 3ARYA 1ITXA 4NSBA 4FN2A 2MPHA 4W9OA 3ARSA 2LGOA 2A3EA 4W9PA 4DRHA 4DROA 4U86A 3KZ7A 2OLHA 1LL4A 4QT3A 4QZVB 3CHCA 1E6NA 4TX0A 4ZPWR 4PTMA 2IF4A 5HT1A 3RFWA 4DRQA 3ARQA 3RM4A 2F21A 4C02B 2K8IA 3WIJA 1XRVA 1WAWA 1EIBA 2RUCA 3CGNA 5HWCA 4Z2LA 4W9QA 4DZ2A 3WH0A 1YATA 3O5LA 2LJ4A 1ZBKA 3LUOA 1OGGA 4DH0A 1FAPA 1FKGA 1SYTA 1XHGA 4ODLA 1FKDA 3CHDA 3KABA 3EY6A 3IK8A 4WKFA 2ZQSA 3AROA 4TYOA 3I6CA 1NWRA 1LG1A 3CHFA 3WQVA 3FY1A 4ODKA 2M08A 1HJXA 3TDBA 4QT2A 1LL6A 1ROUA 1X6LA 2O92A 4NZCA 4Z2GA 3GPKA 4MNLA 1NWUA 3NI6A 1X6NA 4AY1A 4ODRA 4JYSA 2DSVA 1ZB5A 1ZU8A 4Q7NA 1NWTA 3B7XA 1FKFA 3IKDA 2G41A 4Z2HA 3O5QA 2WLYA 2G8ZA 1EYMA 2ZQTA 1QZ2A 1JNTA 1GPFA 1PINA 4GIVA 3PRBA 3BXWA 1J6YA 1O6IA 4ODNA 3UI4A 4DRMA 4G50A 4DRNA 1W9VA 1WNOA 3W4RA 3JYJA 5DIVA 3ARRA 3B9EA 2YBTA 2YBUA 1W1TA 4TW6A 2XP7A 4ML4A 1BKFA 3KADA 4DRPA 1ZBCA 1U79A 4ZPTR 2QF8A 4JFMA 2DG9A 4P8VA 1FFRA 3ARWA 3AQUA 1FJDA 4DZ3A 2B31A 2F2DA 2RQSA 2F4EA 3O5FA 3WQWA 4MPKA 5HTGA 3O5MA 2A3CA 4WK9A 2OFNA 3AS1A 1H0GA 1KT1A 2RSEA 3UQAA 1W1PA 5J6EA 1JNSA 4R5EA 2ZR6A 1E6ZA 4P8WA 3KACA 2LKNA 1EQ3A 2ZR5A 1E9LA 4P8UA 2M1IA 4IT6A 4QIBA 3RM9A 4DRIA 3ARVA 5HW6A 4DWSA 2RUQA 2PBCA 3CHEA 4MNKA 3TC5A 4Z2JA 4DWSD 3ALFA 1FD9A 2PV2A 5DIUA 3WKZA 1LL7A 1HKJA 4Q22A 2A3BA 1BL4A 2FKEA 4MAVA 5DO2A 2MF9A 1JVWA 3ARZA 5BXJA 1FKHA 1A7XA 5HW8A 2ZQVA 2KGJA 2LPVA 4DWSC 1B6CA 4S3JA 1D7HA 1NSGA 1HXVA 2FDMA 3CH9A 4DRKA 4ODOA 1GUVA 4L72B 2DSWA 2KR7A 3IKGA 4MTVA 4WIWA 3ARTA 4DWSB 3WD0A 5DF0A 1FFQA 2WK2A 3G6MA 5HUAA 3O5RA 2Q5AA 3UF8A 3VAWA 5HBFA 2AOSA 4HARA 4TNSA 1PBKA 2DPEA 3O5OA 4GGQA 1FKLA 4R0XA 1QPFA 4IQCA 1W26A 1HJVA 4JFLA 1FKBA 1ZCNA 2XPBA 1JNEA 1D7IA 1Y0OA 3WD4A 1OGBA 2MLZA 3IHZA 2JZVA 1Q6HA 2FAPA 3O5IA 3NTPA 2XP9A 2UZ5A 2PPNA 2XP5A 1NH6A 2KE0A 4ITZA 1D6OA 3AS3A 3AS0A 1HJWA 4MGVA 2MLYA 3OOBA 2XPAA 2DT1A 5I98A 2PPPA 3WD3A 3B9AA 3UI6A 4WKAA 4WJXA 3WD2A 3KAFA 1M5YA 1FKKA 1Q1CA 1TFVA 2D9FA 4BF8A 3KCEA 4LAVA 1ZBVA 4LGXA 3JYMA 4Z2IA 3UQBA 3JXVA 5HKGA 1FKSA 2XP6A 1F40A 1Q6IA 1YW5A 2RURA 2ESCA 2O9OA 3G6LA 2A3AA 4Z2KA 4DIPA 3PRDA 3PA7A 5HW7A 2KO7A 1HKIA 1W1VA 4DT4A 4TW7A 1EHNA 1LQ0A 1J4RA 2IUZA 1N1AA 5GQBA 5HWBA 2PI6A 2PPOA 1FKJA 4MSPA 2L2SA 5D75A 2ZQUA 2PV1A 5GPGA 3FXYA 1J4HA 1HKKA 1ZL1A 4TW8A 3B8SA 2N87A 2VCDA 1ZBWA 2KFWA 3FAPA 2MLXA 2DT2A 1UR9A 3ARXA 1KT0A 4MNJA 1HKMA 5GPRA 1W1YA 4N19A 1E6RA 2WM0A 1J4IA 1NMWA 1QPLA 2DG3A 1NWSA 1CTNA 1FKIA 3PRAA 3O5GA 4ODMA 2DSZA 4S3KA 1RD6A 4J4NA 3QOKA 4IQ2A 3UQIA 1JNDA 1FKTA 3ARPA 1E6PA 2XP8A 4P8XA 4J4OA 5B8IC 3TCZA 1GOIA 1E15A 5DITA 3KAGA 1IX5A 1F8AB 2RUDA 1H0IA 1P5QA 3O5KA 5JH8A 3CGMA 3ODKA 4NNRA 3NRKA 3UI5A 4IT4A 4XAKA 1R9HA 4KQZA 4FAPA 2DT0A 4U84A 4ODQA 2DG4A 2PV3A 2DT3A 4JFJA 3OA5A 2XP3A 4ODPA 3O5EA 1UR8A 1ROTA 1W9UA 2XP4A 2AWGA 4IPXA 3O5DA 3WD1A 4L3NA 1K9TA 3B9DA 4HBEA 4LAYA 1VF8A 1WB0A 2Y78A 4ZPVR 4G2PA 4O2TA 4LAWA 1ZK6A 4LAXA 3RGCA 2VN1A 3O5JA 1T11A 1LG2A 1Q6UA 3PR9A 4DRJA 1L1PA 3AS2A 1EDQA 3KAHA 1LJYA 1NMVA 3RMEA 3RM8A 2KI3A 4W5UA 3O5PA 4URIA 3WL1A 1W9PA 3MDYB 2MNTA 2WLZA 1FKRA 3KAIA 1SR0A 4WKHA 3ARUA 5DEZA 3CZ8A 2ZR4A 1D2KA 1TCOC 2ITKA 1D7JA 2M2AA 4KR0B 4MNMA 1OWQA 3ALGA 3WL0A 4U85A 4HBOA 4JFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G50 A;  3H9R B;  4JFI A;  1C9H A;  3JYJ A;  5DIV A;  5HUA A;  1KT0 A;  4TW6 A;  2XP7 A;  3O5R A;  1BKF A;  2Q5A A;  4N19 A;  3UF8 A;  3VAW A;  3KAD A;  1J4I A;  4DRP A;  4FN2 A;  1NMW A;  4TNS A;  1U79 A;  1PBK A;  1QPL A;  2DG3 A;  2MPH A;  4W9O A;  2LGO A;  3O5O A;  4GGQ A;  4W9P A;  1FKL A;  1FKI A;  4DRO A;  4DRH A;  4R0X A;  1QPF A;  3O5G A;  4ODM A;  4IQC A;  4JFM A;  4U86 A;  1W26 A;  3KZ7 A;  2DG9 A;  4J4N A;  4QT3 A;  4JFL A;  1FKB A;  1ZCN A;  2XPB A;  4IQ2 A;  3UQI A;  1FKR A;  1D7I A;  1Y0O A;  1FKT A;  4TX0 A;  2MLZ A;  2IF4 A;  3IHZ A;  5HT1 A;  2JZV A;  3RFW A;  4DRQ A;  4DRN A;  1Q6H A;  2XP8 A;  2F21 A;  2FAP A;  4J4O A;  2K8I A;  4C02 B;  3TCZ A;  5B8I C;  3O5I A;  3NTP A;  1FJD A;  2XP9 A;  4DZ3 A;  2F2D A;  2UZ5 A;  5DIT A;  2PPN A;  2RQS A;  3KAG A;  1F8A B;  2RUD A;  2RUC A;  2F4E A;  3CGN A;  5HWC A;  1P5Q A;  3O5K A;  3O5F A;  2XP5 A;  4W9Q A;  4ITZ A;  2KE0 A;  4DZ2 A;  1D6O A;  3WH0 A;  3CGM A;  5HTG A;  3O5M A;  3ODK A;  4NNR A;  1YAT A;  3NRK A;  3UI5 A;  3O5L A;  2LJ4 A;  1R9H A;  2OFN A;  4FAP A;  4MGV A;  2MLY A;  4U84 A;  4ODQ A;  3LUO A;  1KT1 A;  3OOB A;  2XPA A;  4DH0 A;  5I98 A;  2PPP A;  2DG4 A;  1FAP A;  2RSE A;  3UQA A;  5J6E A;  2PV3 A;  1JNS A;  4JFJ A;  1FKG A;  3UI6 A;  2XP3 A;  2ZR6 A;  4ODP A;  3O5E A;  1ROT A;  4ODL A;  1FKD A;  3KAF A;  2XP4 A;  3KAC A;  2AWG A;  4IPX A;  2LKN A;  3KAB A;  1M5Y A;  3EY6 A;  1FKK A;  3IK8 A;  1Q1C A;  1EQ3 A;  3O5D A;  2ZQS A;  2D9F A;  4TYO A;  4BF8 A;  3I6C A;  3KCE A;  4LAV A;  4LAY A;  2ZR5 A;  3JYM A;  2M1I A;  3UQB A;  4QIB A;  4DRI A;  3JXV A;  2Y78 A;  5HKG A;  4G2P A;  4O2T A;  4LAW A;  1ZK6 A;  2M08 A;  4LAX A;  4ODK A;  3RGC A;  1FKS A;  2XP6 A;  5HW6 A;  2VN1 A;  4QT2 A;  3O5J A;  1Q6I A;  3TDB A;  1YW5 A;  1T11 A;  2RUR A;  2RUQ A;  1F40 A;  1ROU A;  4DIP A;  1Q6U A;  2PBC A;  4DRJ A;  3PRD A;  3PA7 A;  3TC5 A;  3GPK A;  1L1P A;  1FD9 A;  2PV2 A;  5DIU A;  5HW7 A;  3NI6 A;  2KO7 A;  3KAH A;  4ODR A;  4DT4 A;  1BL4 A;  2FKE A;  4JYS A;  1NMV A;  4TW7 A;  2MF9 A;  2KI3 A;  1JVW A;  1J4R A;  3O5P A;  5BXJ A;  1N1A A;  1FKH A;  1A7X A;  5HW8 A;  5HWB A;  2ZQV A;  2PPO A;  2KGJ A;  3MDY B;  3B7X A;  1FKJ A;  2MNT A;  2LPV A;  4MSP A;  1FKF A;  1B6C A;  2L2S A;  3IKD A;  1D7H A;  3KAI A;  1NSG A;  2ZQU A;  2PV1 A;  5D75 A;  5GPG A;  1HXV A;  1J4H A;  2ZR4 A;  1TCO C;  3O5Q A;  2ITK A;  1D7J A;  4TW8 A;  2N87 A;  4DRK A;  2VCD A;  2M2A A;  4ODO A;  1EYM A;  2ZQT A;  2KFW A;  3FAP A;  1QZ2 A;  1JNT A;  2MLX A;  2KR7 A;  1PIN A;  3IKG A;  4GIV A;  3PRB A;  4U85 A;  1J6Y A;  4ODN A;  4JFK A;  3UI4 A;  4DRM A; 
#chains in the Genus database with same CATH topology
 3H9R B;  4ZS6 A;  4JFI A;  1C9H A;  2DSU A;  3EIP A;  1KFW A;  3ARY A;  1ITX A;  4NSB A;  4FN2 A;  2MPH A;  4W9O A;  3ARS A;  2LGO A;  2PN0 A;  2A3E A;  4W9P A;  4DRH A;  4DRO A;  4U86 A;  3KZ7 A;  2OLH A;  1LL4 A;  4QT3 A;  4QZV B;  3CHC A;  1E6N A;  4TX0 A;  4ZPW R;  4PTM A;  2IF4 A;  5HT1 A;  3RFW A;  4DRQ A;  3ARQ A;  3RM4 A;  2F21 A;  4C02 B;  2K8I A;  3WIJ A;  1XRV A;  1WAW A;  1EIB A;  2RUC A;  3CGN A;  5HWC A;  4Z2L A;  4W9Q A;  4DZ2 A;  3WH0 A;  1YAT A;  3O5L A;  2LJ4 A;  1ZBK A;  3LUO A;  1OGG A;  4DH0 A;  1FAP A;  1FKG A;  1SYT A;  1XHG A;  4ODL A;  1FKD A;  3CHD A;  3KAB A;  3EY6 A;  3IK8 A;  4WKF A;  2ZQS A;  3ARO A;  4TYO A;  3I6C A;  1NWR A;  1LG1 A;  3CHF A;  3WQV A;  3FY1 A;  4ODK A;  2M08 A;  1HJX A;  3TDB A;  4QT2 A;  1LL6 A;  1ROU A;  1X6L A;  2O92 A;  4NZC A;  4Z2G A;  3GPK A;  4MNL A;  1NWU A;  3NI6 A;  1X6N A;  4AY1 A;  4ODR A;  4JYS A;  2DSV A;  1ZB5 A;  1ZU8 A;  4Q7N A;  1NWT A;  3B7X A;  1FKF A;  3IKD A;  2G41 A;  4Z2H A;  3O5Q A;  2WLY A;  2G8Z A;  1EYM A;  2ZQT A;  1QZ2 A;  1JNT A;  1GPF A;  1PIN A;  4GIV A;  3PRB A;  3BXW A;  1J6Y A;  1O6I A;  4ODN A;  3UI4 A;  4DRM A;  4G50 A;  4DRN A;  1W9V A;  1WNO A;  3W4R A;  3JYJ A;  5DIV A;  3ARR A;  3B9E A;  2YBT A;  2YBU A;  1W1T A;  4TW6 A;  2XP7 A;  4ML4 A;  1BKF A;  3KAD A;  3GU0 A;  4DRP A;  1ZBC A;  1U79 A;  4ZPT R;  2QF8 A;  4JFM A;  4UDM A;  2DG9 A;  4P8V A;  1FFR A;  3ARW A;  3AQU A;  1FJD A;  4DZ3 A;  2B31 A;  2F2D A;  2RQS A;  2F4E A;  3O5F A;  3WQW A;  4MPK A;  5HTG A;  3O5M A;  2A3C A;  4WK9 A;  2OFN A;  3AS1 A;  1H0G A;  1KT1 A;  2RSE A;  3UQA A;  1W1P A;  5J6E A;  1JNS A;  4R5E A;  2ZR6 A;  1E6Z A;  4P8W A;  3KAC A;  2LKN A;  1EQ3 A;  2ZR5 A;  1E9L A;  4P8U A;  2M1I A;  4IT6 A;  4QIB A;  3RM9 A;  4DRI A;  3ARV A;  5HW6 A;  4DWS A;  2RUQ A;  1E44 A;  2PBC A;  3CHE A;  4MNK A;  3TC5 A;  4Z2J A;  4DWS D;  3ALF A;  1FD9 A;  2PV2 A;  5DIU A;  3WKZ A;  1LL7 A;  1HKJ A;  4Q22 A;  2A3B A;  1BL4 A;  2FKE A;  4MAV A;  5DO2 A;  2MF9 A;  1JVW A;  3ARZ A;  5BXJ A;  1FKH A;  1A7X A;  5HW8 A;  2ZQV A;  2KGJ A;  2LPV A;  4DWS C;  1B6C A;  4S3J A;  1D7H A;  1NSG A;  1HXV A;  2FDM A;  3CH9 A;  4DRK A;  4ODO A;  1GUV A;  4L72 B;  2DSW A;  2KR7 A;  3IKG A;  4MTV A;  2P4V A;  3ART A;  4WIW A;  4DWS B;  3WD0 A;  2ETN A;  5DF0 A;  1FFQ A;  2WK2 A;  3G6M A;  5HUA A;  3O5R A;  2Q5A A;  3UF8 A;  3VAW A;  5HBF A;  2AOS A;  4HAR A;  4TNS A;  1PBK A;  2DPE A;  3O5O A;  4GGQ A;  1FKL A;  4R0X A;  1QPF A;  4IQC A;  1W26 A;  1HJV A;  4JFL A;  1FKB A;  1ZCN A;  2XPB A;  1JNE A;  1D7I A;  1Y0O A;  3WD4 A;  1OGB A;  2MLZ A;  3IHZ A;  2F23 A;  2JZV A;  1Q6H A;  2FAP A;  3O5I A;  3NTP A;  2XP9 A;  2UZ5 A;  2PPN A;  2XP5 A;  1NH6 A;  2KE0 A;  4ITZ A;  1D6O A;  3AS3 A;  3AS0 A;  1HJW A;  4MGV A;  2MLY A;  3BMB A;  3OOB A;  2XPA A;  2DT1 A;  5I98 A;  2PPP A;  3WD3 A;  3B9A A;  3UI6 A;  4WKA A;  4WJX A;  3WD2 A;  3KAF A;  1M5Y A;  1FKK A;  1Q1C A;  1TFV A;  4U85 A;  2D9F A;  4BF8 A;  3KCE A;  4LAV A;  1ZBV A;  4LGX A;  3JYM A;  4Z2I A;  3UQB A;  3JXV A;  5HKG A;  1FKS A;  2XP6 A;  1F40 A;  1Q6I A;  1YW5 A;  2RUR A;  2ESC A;  2O9O A;  3G6L A;  2A3A A;  4Z2K A;  4DIP A;  3PRD A;  3PA7 A;  5HW7 A;  2KO7 A;  1HKI A;  1W1V A;  4DT4 A;  4TW7 A;  1EHN A;  1LQ0 A;  1J4R A;  2IUZ A;  1N1A A;  5GQB A;  5HWB A;  2PI6 A;  2PPO A;  1FKJ A;  3GTY X;  4MSP A;  2L2S A;  5D75 A;  2ZQU A;  2PV1 A;  5GPG A;  3FXY A;  1J4H A;  1HKK A;  1ZL1 A;  4TW8 A;  3B8S A;  2N87 A;  2VCD A;  1ZBW A;  2KFW A;  3FAP A;  2MLX A;  2DT2 A;  2B5U B;  1UR9 A;  3ARX A;  1KT0 A;  4MNJ A;  1HKM A;  5GPR A;  1W1Y A;  4N19 A;  1E6R A;  2WM0 A;  1J4I A;  1NMW A;  1QPL A;  2DG3 A;  1NWS A;  1CTN A;  1FKI A;  3PRA A;  3O5G A;  4ODM A;  2DSZ A;  4S3K A;  1RD6 A;  4J4N A;  3QOK A;  4IQ2 A;  3UQI A;  1JND A;  1FKT A;  3ARP A;  1E6P A;  2XP8 A;  4P8X A;  4J4O A;  5B8I C;  3TCZ A;  1GOI A;  1E15 A;  5DIT A;  3KAG A;  1IX5 A;  1F8A B;  2RUD A;  1H0I A;  1P5Q A;  3O5K A;  5JH8 A;  1JCH B;  3CGM A;  3ODK A;  4NNR A;  3NRK A;  3UI5 A;  4IT4 A;  4XAK A;  1R9H A;  4KQZ A;  4FAP A;  2DT0 A;  4U84 A;  4ODQ A;  2DG4 A;  2PV3 A;  2DT3 A;  4JFJ A;  3OA5 A;  2XP3 A;  4ODP A;  3O5E A;  1UR8 A;  1ROT A;  1W9U A;  2XP4 A;  2AWG A;  4IPX A;  3O5D A;  3WD1 A;  4L3N A;  1K9T A;  3B9D A;  4HBE A;  4LAY A;  1VF8 A;  1WB0 A;  2Y78 A;  4ZPV R;  4G2P A;  4O2T A;  4LAW A;  1ZK6 A;  4LAX A;  3RGC A;  2VN1 A;  3O5J A;  1T11 A;  1LG2 A;  1Q6U A;  3PR9 A;  4DRJ A;  1L1P A;  3AS2 A;  1EDQ A;  3KAH A;  1LJY A;  1NMV A;  3RME A;  3RM8 A;  2KI3 A;  4W5U A;  1GRJ A;  3O5P A;  4URI A;  3WL1 A;  1W9P A;  3MDY B;  2MNT A;  2WLZ A;  1FKR A;  3KAI A;  1SR0 A;  4WKH A;  3ARU A;  5DEZ A;  3CZ8 A;  2ZR4 A;  1D2K A;  1TCO C;  2ITK A;  1D7J A;  2M2A A;  4KR0 B;  4MNM A;  1OWQ A;  3ALG A;  3WL0 A;  2EUL A;  4HBO A;  4JFK A; 
#chains in the Genus database with same CATH homology
 3H9R B;  4ZS6 A;  4JFI A;  1C9H A;  2DSU A;  1KFW A;  3ARY A;  1ITX A;  4NSB A;  4FN2 A;  2MPH A;  4W9O A;  3ARS A;  2LGO A;  2A3E A;  4W9P A;  4DRH A;  4DRO A;  4U86 A;  3KZ7 A;  2OLH A;  1LL4 A;  4QT3 A;  4QZV B;  3CHC A;  1E6N A;  4TX0 A;  4ZPW R;  4PTM A;  2IF4 A;  5HT1 A;  3RFW A;  4DRQ A;  3ARQ A;  3RM4 A;  2F21 A;  4C02 B;  2K8I A;  3WIJ A;  1XRV A;  1WAW A;  1EIB A;  2RUC A;  3CGN A;  5HWC A;  4Z2L A;  4W9Q A;  4DZ2 A;  3WH0 A;  1YAT A;  3O5L A;  2LJ4 A;  1ZBK A;  3LUO A;  1OGG A;  4DH0 A;  1FAP A;  1FKG A;  1SYT A;  1XHG A;  4ODL A;  1FKD A;  3CHD A;  3KAB A;  3EY6 A;  3IK8 A;  4WKF A;  2ZQS A;  3ARO A;  4TYO A;  3I6C A;  1NWR A;  1LG1 A;  3CHF A;  3WQV A;  3FY1 A;  4ODK A;  2M08 A;  1HJX A;  3TDB A;  4QT2 A;  1LL6 A;  1ROU A;  1X6L A;  2O92 A;  4NZC A;  4Z2G A;  3GPK A;  4MNL A;  1NWU A;  3NI6 A;  1X6N A;  4AY1 A;  4ODR A;  4JYS A;  2DSV A;  1ZB5 A;  1ZU8 A;  4Q7N A;  1NWT A;  3B7X A;  1FKF A;  3IKD A;  2G41 A;  4Z2H A;  3O5Q A;  2WLY A;  2G8Z A;  1EYM A;  2ZQT A;  1QZ2 A;  1JNT A;  1GPF A;  1PIN A;  4GIV A;  3PRB A;  3BXW A;  1J6Y A;  1O6I A;  4ODN A;  3UI4 A;  4DRM A;  4G50 A;  4DRN A;  1W9V A;  1WNO A;  3W4R A;  3JYJ A;  5DIV A;  3ARR A;  3B9E A;  2YBT A;  2YBU A;  1W1T A;  4TW6 A;  2XP7 A;  4ML4 A;  1BKF A;  3KAD A;  4DRP A;  1ZBC A;  1U79 A;  4ZPT R;  2QF8 A;  4JFM A;  2DG9 A;  4P8V A;  1FFR A;  3ARW A;  3AQU A;  1FJD A;  4DZ3 A;  2B31 A;  2F2D A;  2RQS A;  2F4E A;  3O5F A;  3WQW A;  4MPK A;  5HTG A;  3O5M A;  2A3C A;  4WK9 A;  2OFN A;  3AS1 A;  1H0G A;  1KT1 A;  2RSE A;  3UQA A;  1W1P A;  5J6E A;  1JNS A;  4R5E A;  2ZR6 A;  1E6Z A;  4P8W A;  3KAC A;  2LKN A;  1EQ3 A;  2ZR5 A;  1E9L A;  4P8U A;  2M1I A;  4IT6 A;  4QIB A;  3RM9 A;  4DRI A;  3ARV A;  5HW6 A;  4DWS A;  2RUQ A;  2PBC A;  3CHE A;  4MNK A;  3TC5 A;  4Z2J A;  4DWS D;  3ALF A;  1FD9 A;  2PV2 A;  5DIU A;  3WKZ A;  1LL7 A;  1HKJ A;  4Q22 A;  2A3B A;  1BL4 A;  2FKE A;  4MAV A;  5DO2 A;  2MF9 A;  1JVW A;  3ARZ A;  5BXJ A;  1FKH A;  1A7X A;  5HW8 A;  2ZQV A;  2KGJ A;  2LPV A;  4DWS C;  1B6C A;  4S3J A;  1D7H A;  1NSG A;  1HXV A;  2FDM A;  3CH9 A;  4DRK A;  4ODO A;  1GUV A;  4L72 B;  2DSW A;  2KR7 A;  3IKG A;  4MTV A;  4WIW A;  3ART A;  4DWS B;  3WD0 A;  5DF0 A;  1FFQ A;  2WK2 A;  3G6M A;  5HUA A;  3O5R A;  2Q5A A;  3UF8 A;  3VAW A;  5HBF A;  2AOS A;  4HAR A;  4TNS A;  1PBK A;  2DPE A;  3O5O A;  4GGQ A;  1FKL A;  4R0X A;  1QPF A;  4IQC A;  1W26 A;  1HJV A;  4JFL A;  1FKB A;  1ZCN A;  2XPB A;  1JNE A;  1D7I A;  1Y0O A;  3WD4 A;  1OGB A;  2MLZ A;  3IHZ A;  2JZV A;  1Q6H A;  2FAP A;  3O5I A;  3NTP A;  2XP9 A;  2UZ5 A;  2PPN A;  2XP5 A;  1NH6 A;  2KE0 A;  4ITZ A;  1D6O A;  3AS3 A;  3AS0 A;  1HJW A;  4MGV A;  2MLY A;  3OOB A;  2XPA A;  2DT1 A;  5I98 A;  2PPP A;  3WD3 A;  3B9A A;  3UI6 A;  4WKA A;  4WJX A;  3WD2 A;  3KAF A;  1M5Y A;  1FKK A;  1Q1C A;  1TFV A;  2D9F A;  4BF8 A;  3KCE A;  4LAV A;  1ZBV A;  4LGX A;  3JYM A;  4Z2I A;  3UQB A;  3JXV A;  5HKG A;  1FKS A;  2XP6 A;  1F40 A;  1Q6I A;  1YW5 A;  2RUR A;  2ESC A;  2O9O A;  3G6L A;  2A3A A;  4Z2K A;  4DIP A;  3PRD A;  3PA7 A;  5HW7 A;  2KO7 A;  1HKI A;  1W1V A;  4DT4 A;  4TW7 A;  1EHN A;  1LQ0 A;  1J4R A;  2IUZ A;  1N1A A;  5GQB A;  5HWB A;  2PI6 A;  2PPO A;  1FKJ A;  4MSP A;  2L2S A;  5D75 A;  2ZQU A;  2PV1 A;  5GPG A;  3FXY A;  1J4H A;  1HKK A;  1ZL1 A;  4TW8 A;  3B8S A;  2N87 A;  2VCD A;  1ZBW A;  2KFW A;  3FAP A;  2MLX A;  2DT2 A;  1UR9 A;  3ARX A;  1KT0 A;  4MNJ A;  1HKM A;  5GPR A;  1W1Y A;  4N19 A;  1E6R A;  2WM0 A;  1J4I A;  1NMW A;  1QPL A;  2DG3 A;  1NWS A;  1CTN A;  1FKI A;  3PRA A;  3O5G A;  4ODM A;  2DSZ A;  4S3K A;  1RD6 A;  4J4N A;  3QOK A;  4IQ2 A;  3UQI A;  1JND A;  1FKT A;  3ARP A;  1E6P A;  2XP8 A;  4P8X A;  4J4O A;  5B8I C;  3TCZ A;  1GOI A;  1E15 A;  5DIT A;  3KAG A;  1IX5 A;  1F8A B;  2RUD A;  1H0I A;  1P5Q A;  3O5K A;  5JH8 A;  3CGM A;  3ODK A;  4NNR A;  3NRK A;  3UI5 A;  4IT4 A;  4XAK A;  1R9H A;  4KQZ A;  4FAP A;  2DT0 A;  4U84 A;  4ODQ A;  2DG4 A;  2PV3 A;  2DT3 A;  4JFJ A;  3OA5 A;  2XP3 A;  4ODP A;  3O5E A;  1UR8 A;  1ROT A;  1W9U A;  2XP4 A;  2AWG A;  4IPX A;  3O5D A;  3WD1 A;  4L3N A;  1K9T A;  3B9D A;  4HBE A;  4LAY A;  1VF8 A;  1WB0 A;  2Y78 A;  4ZPV R;  4G2P A;  4O2T A;  4LAW A;  1ZK6 A;  4LAX A;  3RGC A;  2VN1 A;  3O5J A;  1T11 A;  1LG2 A;  1Q6U A;  3PR9 A;  4DRJ A;  1L1P A;  3AS2 A;  1EDQ A;  3KAH A;  1LJY A;  1NMV A;  3RME A;  3RM8 A;  2KI3 A;  4W5U A;  3O5P A;  4URI A;  3WL1 A;  1W9P A;  3MDY B;  2MNT A;  2WLZ A;  1FKR A;  3KAI A;  1SR0 A;  4WKH A;  3ARU A;  5DEZ A;  3CZ8 A;  2ZR4 A;  1D2K A;  1TCO C;  2ITK A;  1D7J A;  2M2A A;  4KR0 B;  4MNM A;  1OWQ A;  3ALG A;  3WL0 A;  4U85 A;  4HBO A;  4JFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...