3O5FA

Fk1 domain of fkbp51, crystal form vii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
TATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 34
structure length 125
sequence length 125
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5fA00
3O5RA 3JYJA 2XP6A 1FKJA 2ZR6A 1W26A 1FKBA 1JNTA 2ZR4A 3KAFA 4MSPA 4W9PA 5DITA 4NNRA 1FKIA 4ODLA 1Q6IA 1Q1CA 1D6OA 3O5OA 4C02B 4TW7A 4FN2A 1PBKA 3VAWA 1F8AB 3O5JA 1FKDA 3IHZA 2XPAA 3CGMA 2VN1A 1J6YA 3KAIA 3KCEA 3NI6A 2PV1A 1D7IA 4LAYA 1KT1A 1A7XA 3O5QA 4ODMA 3RGCA 5HWBA 2L2SA 2LPVA 4ODOA 3UQIA 5I98A 1BL4A 3FAPA 4ITZA 4FAPA 1FD9A 2RUQA 3LUOA 4ODNA 4U86A 4JFJA 5BXJA 1JNSA 1F40A 2F21A 1FKTA 4JFLA 2ZQVA 2KO7A 1ZK6A 2RUCA 4DZ2A 1BKFA 2RSEA 3OOBA 4DRPA 1FKSA 3IKGA 3NTPA 5D75A 2MPHA 4GIVA 3UI5A 1D7HA 4QT2A 4J4NA 1FKRA 2DG3A 4JFIA 4ODPA 1D7JA 2K8IA 1R9HA 1T11A 1Y0OA 2MF9A 2KE0A 3O5IA 4IQ2A 1FKFA 1FKKA 4LAVA 4LAXA 4R0XA 4W9QA 2FKEA 1FKHA 1EYMA 3EY6A 3JYMA 3H9RB 2RUDA 1NMVA 4DRKA 1HXVA 4DRMA 1FAPA 4TX0A 3CGNA 5J6EA 3O5MA 1Q6UA 1B6CA 2XP4A 3O5EA 4GGQA 1FKGA 3NRKA 4DH0A 3KADA 2FAPA 3ODKA 4N19A 2N87A 2DG4A 2DG9A 1P5QA 1TCOC 1C9HA 1U79A 3O5LA 4LAWA 2KR7A 2MLZA 3UI6A 2Y78A 1KT0A 3RFWA 1QPFA 3UF8A 3KAHA 3UQAA 3O5PA 5HKGA 5B8IC 5HTGA 4ODKA 1M5YA 4MGVA 1QPLA 4TNSA 4U84A 4DRNA 5HUAA 1ZCNA 2M1IA 3UI4A 2VCDA 2AWGA 1N1AA 2MNTA 2RURA 3KAGA 3KACA 3O5DA 3PA7A 4ODRA 4TW6A 5HT1A 5HW6A 1Q6HA 5HW7A 1EQ3A 2XP7A 2XP9A 2ZQSA 3O5KA 4DRHA 4O2TA 3IKDA 2ZQTA 2ZQUA 2M2AA 1QZ2A 3IK8A 3KZ7A 3PRBA 1J4HA 1FKLA 4DZ3A 2XP8A 2PPPA 2PPOA 1YW5A 3KABA 1ROTA 2ITKA 2XP3A 3B7XA 2ZR5A 4J4OA 1JVWA 2LJ4A 2OFNA 4IPXA 5DIVA 4DROA 5GPGA 4JYSA 1NMWA 4U85A 5HW8A 3UQBA 2KGJA 2PV2A 2XP5A 4TYOA 2KI3A 3WH0A 1NSGA 2JZVA 2PBCA 4QT3A 4DRIA 1J4RA 1FJDA 3TC5A 4G2PA 2PV3A 1J4IA 2LGOA 3MDYB 3PRDA 4G50A 4W9OA 4TW8A 4IQCA 4DRQA 2XPBA 2RQSA 4DRJA 2IF4A 2LKNA 2KFWA 2MLXA 4BF8A 2F4EA 1YATA 3GPKA 3I6CA 3TDBA 2UZ5A 3JXVA 5DIUA 3TCZA 5HWCA 2Q5AA 1PINA 2MLYA 4DIPA 2D9FA 4DT4A 2PPNA 4ODQA 4JFKA 1L1PA 4JFMA 3O5FA 1ROUA 2F2DA 2M08A 3O5GA 4QIBA
chains in the Genus database with same CATH superfamily
1ZBWA 2WLZA 1FKJA 4W9PA 2WK2A 3AS0A 4S3JA 1JNEA 3O5OA 4FN2A 3BXWA 4MPKA 2XPAA 1J6YA 2PV1A 1EHNA 1KT1A 3RGCA 3FAPA 4FAPA 4U86A 2B31A 1WB0A 1F40A 3ALFA 2YBTA 2KO7A 1LQ0A 1ZK6A 2RUCA 2DSWA 3NTPA 4GIVA 2O9OA 4QT2A 1FKRA 2DG3A 1NWRA 4HARA 1Y0OA 1LL6A 4IQ2A 4LAXA 4R0XA 3RMEA 2FKEA 1EYMA 3EIPA 1LL7A 4DRMA 1HJWA 1Q6UA 2ESCA 2IUZA 1FKGA 1ZU8A 2DT1A 3KADA 1W1YA 2WM0A 1W9UA 2N87A 3CHEA 1C9HA 3O5LA 4LAWA 4LGXA 2A3CA 1QPFA 4WK9A 1UR9A 5HTGA 1W9VA 1M5YA 2F23A 3CHCA 3RM9A 3ARXA 2VCDA 4S3KA 2AWGA 1N1AA 2MNTA 3O5DA 4TW6A 3WQVA 3FY1A 1EQ3A 3AS2A 2AOSA 1JNDA 4IT6A 4O2TA 2M2AA 3GTYX 3WKZA 1H0GA 2ITKA 4J4OA 5DIVA 4DROA 5GPGA 4MTVA 2KI3A 4W5UA 1NSGA 4QT3A 1OGGA 3WD3A 1HJXA 1NH6A 4MNLA 3ARYA 4WKAA 1ZBKA 1FFQA 1J4IA 2PV3A 4G50A 4IQCA 4NSBA 3WQWA 2RQSA 5HBFA 2IF4A 2KFWA 2F4EA 3I6CA 3TDBA 4Z2GA 3JXVA 4DIPA 1WAWA 4KR0B 3FXYA 4JFKA 2F2DA 2XP6A 1JCHB 2ZR6A 2B5UB 1HKIA 5DITA 3ARSA 3AS1A 1FKIA 4ODLA 4Z2LA 1ZL1A 1Q6IA 4C02B 1PBKA 1F8AB 1FKDA 3IHZA 1SYTA 3NI6A 1E15A 4ODMA 5HWBA 3ARPA 2LPVA 4ODOA 1GRJA 1FD9A 4JFJA 2F21A 4DWSD 4JFLA 2ZQVA 3ARZA 4R5EA 3ARQA 1H0IA 4DZ2A 1BKFA 1D2KA 2RSEA 3OOBA 4DRPA 1FKSA 1W9PA 1SR0A 1D7HA 4PTMA 4ODPA 4ZPWR 1D7JA 1R9HA 3O5IA 3W4RA 1E44A 4HBOA 4P8WA 2PI6A 3EY6A 1XRVA 3H9RB 1NMVA 4DRKA 1HXVA 3ARUA 3CGNA 4DH0A 2ETNA 2DG4A 2DG9A 1TCOC 1U79A 2DSZA 2MLZA 3UI6A 3UF8A 5B8IC 4TNSA 1QPLA 3GU0A 4ZPVR 4Z2JA 1ZCNA 2M1IA 4ODRA 3OA5A 5HW6A 1Q6HA 2XP7A 2XP9A 4XAKA 3AS3A 3CHDA 2ZQTA 4Z2IA 1EDQA 3KZ7A 4DZ3A 1J4HA 2PPPA 2PPOA 1ROTA 2XP3A 3B7XA 2ZR5A 1NWTA 1JVWA 2OFNA 4IPXA 4UDMA 2KGJA 2PBCA 4MAVA 4DWSC 1LJYA 4G2PA 4Q7NA 4TW8A 1WNOA 4DRQA 2DSUA 2LKNA 4L72B 5DIUA 1HKJA 3TCZA 2MLYA 3ARTA 1ZB5A 3CHFA 3QOKA 2M08A 4ZS6A 3O5GA 4QIBA 1NWUA 1FKBA 1JNTA 1W26A 4QZVB 4NNRA 1GUVA 3WD0A 4Z2HA 2OLHA 3VAWA 3O5JA 1X6NA 3CGMA 2VN1A 1K9TA 3KCEA 3O5QA 2L2SA 4P8VA 4ITZA 3RM4A 1LG2A 5BXJA 1E6RA 4P8UA 1FFRA 3AROA 2DPEA 1UR8A 4AY1A 1E6NA 5D75A 3PRAA 4Q22A 4J4NA 4JFIA 5JH8A 3ALGA 2K8IA 1T11A 2KE0A 4W9QA 2P4VA 3JYMA 1FKHA 2RUDA 4TX0A 5J6EA 1IX5A 2XP4A 3O5EA 4GGQA 5GPRA 2A3EA 3G6MA 3ODKA 2G41A 4WKFA 2KR7A 1KT0A 1HJVA 1OWQA 3WD1A 1X6LA 3KAHA 3WIJA 5HKGA 1TFVA 5DO2A 2DT2A 5DEZA 4U84A 5HUAA 1GPFA 4WIWA 3KAGA 3PA7A 3KACA 5HW7A 4DRHA 1KFWA 4NZCA 2ZQUA 1QZ2A 1VF8A 3IK8A 2A3AA 3KABA 1YW5A 3WL0A 1L1PA 1ZBVA 3ARRA 5HW8A 2PV2A 1LG1A 4TYOA 3WD4A 3WD2A 4DRIA 4MNKA 2PN0A 2DT0A 4W9OA 5GQBA 1O6IA 3RM8A 4DRJA 4ZPTR 2MLXA 4BF8A 2DSVA 3BMBA 2UZ5A 4IT4A 1PINA 2D9FA 4DT4A 2PPNA 4KQZA 2O92A 3ARVA 4HBEA 1ITXA 1LL4A 1ROUA 3UQIA 3UI5A 1E6PA 3O5RA 3JYJA 2ZR4A 3KAFA 4MSPA 5DF0A 1W1VA 1Q1CA 1D6OA 4TW7A 1GOIA 3KAIA 3B8SA 3CH9A 4LAYA 1D7IA 1A7XA 5I98A 4ML4A 1BL4A 3LUOA 2RUQA 1JNSA 1EIBA 1FKTA 3B9EA 1XHGA 3IKGA 2MPHA 4WJXA 4L3NA 1HKKA 2DT3A 2MF9A 4LAVA 1FKFA 1FKKA 3B9AA 1FAPA 3CZ8A 3O5MA 1B6CA 1W1PA 2YBUA 3NRKA 2FAPA 4URIA 2QF8A 4N19A 1P5QA 2Y78A 3RFWA 3UQAA 1RD6A 3O5PA 3G6LA 4ODKA 4MGVA 4DRNA 4DWSB 3UI4A 2RURA 5HT1A 1OGBA 3PR9A 1NWSA 2ZQSA 3O5KA 4WKHA 3IKDA 4Z2KA 4DWSA 3PRBA 1FKLA 2XP8A 4MNJA 2LJ4A 1CTNA 4JYSA 1NMWA 1ZBCA 4U85A 3B9DA 3UQBA 2XP5A 2G8ZA 3WH0A 1W1TA 2JZVA 1E6ZA 1J4RA 1FJDA 3TC5A 2FDMA 1E9LA 3MDYB 3PRDA 2LGOA 2EULA 2A3BA 3AQUA 2WLYA 2XPBA 4MNMA 1HKMA 3GPKA 1YATA 3WL1A 4P8XA 5HWCA 2Q5AA 4ODQA 4JFMA 3ARWA 3O5FA 4ODNA
chains in the Genus database with same CATH topology
1ZBWA 2WLZA 1FKJA 4W9PA 2WK2A 3AS0A 4S3JA 1JNEA 3O5OA 4FN2A 3BXWA 4MPKA 2XPAA 1J6YA 2PV1A 1EHNA 1KT1A 3RGCA 3FAPA 4FAPA 4U86A 2B31A 1WB0A 1F40A 3ALFA 2YBTA 2KO7A 1LQ0A 1ZK6A 2RUCA 2DSWA 3NTPA 4GIVA 2O9OA 4QT2A 1FKRA 2DG3A 1NWRA 4HARA 1Y0OA 1LL6A 4IQ2A 4LAXA 4R0XA 3RMEA 2FKEA 1EYMA 1LL7A 4DRMA 1HJWA 1Q6UA 2ESCA 2IUZA 1FKGA 1ZU8A 2DT1A 3KADA 1W1YA 2WM0A 1W9UA 2N87A 3CHEA 1C9HA 3O5LA 4LAWA 4LGXA 2A3CA 1QPFA 4WK9A 1UR9A 5HTGA 1W9VA 1M5YA 3CHCA 3RM9A 3ARXA 2VCDA 4S3KA 2AWGA 1N1AA 2MNTA 3O5DA 4TW6A 3WQVA 3FY1A 1EQ3A 3AS2A 2AOSA 1JNDA 4IT6A 4O2TA 2M2AA 3WKZA 1H0GA 4J4OA 2ITKA 5DIVA 4DROA 5GPGA 4MTVA 2KI3A 4W5UA 1NSGA 4QT3A 1OGGA 3WD3A 1HJXA 1NH6A 4MNLA 3ARYA 4WKAA 1ZBKA 1FFQA 1J4IA 2PV3A 4G50A 4IQCA 4NSBA 3WQWA 2RQSA 5HBFA 2IF4A 2KFWA 2F4EA 3I6CA 3TDBA 4Z2GA 3JXVA 4DIPA 1WAWA 4KR0B 3FXYA 4JFKA 2F2DA 2XP6A 2ZR6A 1HKIA 5DITA 3ARSA 3AS1A 1FKIA 4ODLA 4Z2LA 1ZL1A 1Q6IA 4C02B 1PBKA 1F8AB 1FKDA 3IHZA 1SYTA 3NI6A 1E15A 4ODMA 5HWBA 3ARPA 2LPVA 4ODOA 1FD9A 4JFJA 2F21A 4DWSD 4JFLA 2ZQVA 3ARZA 4R5EA 3ARQA 1H0IA 4DZ2A 1BKFA 1D2KA 2RSEA 3OOBA 4DRPA 1FKSA 1W9PA 1SR0A 1D7HA 4PTMA 4ODPA 4ZPWR 1D7JA 1R9HA 3O5IA 3W4RA 4HBOA 4P8WA 2PI6A 3EY6A 1XRVA 3H9RB 1NMVA 4DRKA 1HXVA 3ARUA 3CGNA 4DH0A 2DG4A 2DG9A 1TCOC 1U79A 2DSZA 2MLZA 3UI6A 3UF8A 5B8IC 4TNSA 1QPLA 4ZPVR 4Z2JA 1ZCNA 2M1IA 4ODRA 3OA5A 5HW6A 1Q6HA 2XP7A 2XP9A 4XAKA 3AS3A 3CHDA 2ZQTA 4Z2IA 1EDQA 3KZ7A 4DZ3A 1J4HA 2PPPA 2PPOA 1ROTA 2XP3A 3B7XA 2ZR5A 1NWTA 1JVWA 2OFNA 4IPXA 2KGJA 2PBCA 4MAVA 4DWSC 1LJYA 4G2PA 4Q7NA 4TW8A 1WNOA 4DRQA 2DSUA 2LKNA 4L72B 5DIUA 1HKJA 3TCZA 2MLYA 3ARTA 1ZB5A 3CHFA 3QOKA 2M08A 4ZS6A 3O5GA 4QIBA 1NWUA 1FKBA 1JNTA 1W26A 4QZVB 4NNRA 1GUVA 3WD0A 4Z2HA 2OLHA 3VAWA 3O5JA 1X6NA 3CGMA 2VN1A 1K9TA 3KCEA 3O5QA 2L2SA 4P8VA 4ITZA 3RM4A 1LG2A 5BXJA 1E6RA 4P8UA 1FFRA 3AROA 2DPEA 1UR8A 4AY1A 1E6NA 5D75A 3PRAA 4Q22A 4J4NA 4JFIA 5JH8A 3ALGA 2K8IA 1T11A 2KE0A 4W9QA 3JYMA 1FKHA 2RUDA 4TX0A 5J6EA 1IX5A 2XP4A 3O5EA 4GGQA 5GPRA 2A3EA 3G6MA 3ODKA 2G41A 4WKFA 2KR7A 1KT0A 1HJVA 1OWQA 3WD1A 1X6LA 3KAHA 3WIJA 5HKGA 1TFVA 5DO2A 2DT2A 5DEZA 4U84A 5HUAA 1GPFA 4WIWA 3KAGA 3PA7A 3KACA 5HW7A 4DRHA 1KFWA 4NZCA 2ZQUA 1QZ2A 1VF8A 3IK8A 2A3AA 3KABA 1YW5A 3WL0A 1L1PA 1ZBVA 3ARRA 5HW8A 2PV2A 1LG1A 4TYOA 3WD4A 3WD2A 4DRIA 4MNKA 2DT0A 4W9OA 5GQBA 1O6IA 3RM8A 4DRJA 4ZPTR 2MLXA 4BF8A 2DSVA 2UZ5A 4IT4A 1PINA 2D9FA 4DT4A 2PPNA 4KQZA 2O92A 3ARVA 4HBEA 1ITXA 1LL4A 1ROUA 3UQIA 3UI5A 1E6PA 3O5RA 3JYJA 2ZR4A 3KAFA 4MSPA 5DF0A 1W1VA 1Q1CA 1D6OA 4TW7A 1GOIA 3KAIA 3B8SA 3CH9A 4LAYA 1D7IA 1A7XA 5I98A 4ML4A 1BL4A 3LUOA 2RUQA 1JNSA 1EIBA 1FKTA 3B9EA 1XHGA 3IKGA 2MPHA 4WJXA 4L3NA 1HKKA 2DT3A 2MF9A 4LAVA 1FKFA 1FKKA 3B9AA 1FAPA 3CZ8A 3O5MA 1B6CA 1W1PA 2YBUA 3NRKA 2FAPA 4URIA 2QF8A 4N19A 1P5QA 2Y78A 3RFWA 3UQAA 1RD6A 3O5PA 3G6LA 4ODKA 4MGVA 4DRNA 4DWSB 3UI4A 2RURA 5HT1A 1OGBA 3PR9A 1NWSA 2ZQSA 3O5KA 4WKHA 3IKDA 4Z2KA 4DWSA 3PRBA 1FKLA 2XP8A 4MNJA 2LJ4A 1CTNA 4JYSA 1NMWA 1ZBCA 4U85A 3B9DA 3UQBA 2XP5A 2G8ZA 3WH0A 1W1TA 2JZVA 1E6ZA 1J4RA 1FJDA 3TC5A 2FDMA 1E9LA 3MDYB 3PRDA 2LGOA 2A3BA 3AQUA 2WLYA 2XPBA 4MNMA 1HKMA 3GPKA 1YATA 3WL1A 4P8XA 5HWCA 2Q5AA 4ODQA 4JFMA 3ARWA 3O5FA 4ODNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5R A;  3JYJ A;  2XP6 A;  1FKJ A;  2ZR6 A;  1W26 A;  1FKB A;  1JNT A;  2ZR4 A;  3KAF A;  4MSP A;  4W9P A;  5DIT A;  4NNR A;  1FKI A;  4ODL A;  1Q6I A;  1Q1C A;  1D6O A;  3O5O A;  4C02 B;  4TW7 A;  4FN2 A;  1PBK A;  3VAW A;  1F8A B;  3O5J A;  1FKD A;  3IHZ A;  2XPA A;  3CGM A;  2VN1 A;  1J6Y A;  3KAI A;  3KCE A;  3NI6 A;  2PV1 A;  1D7I A;  4LAY A;  1KT1 A;  1A7X A;  3O5Q A;  4ODM A;  3RGC A;  5HWB A;  2L2S A;  2LPV A;  4ODO A;  3UQI A;  5I98 A;  1BL4 A;  3FAP A;  4ITZ A;  4FAP A;  1FD9 A;  2RUQ A;  3LUO A;  4ODN A;  4U86 A;  4JFJ A;  5BXJ A;  1JNS A;  1F40 A;  2F21 A;  1FKT A;  4JFL A;  2ZQV A;  2KO7 A;  1ZK6 A;  2RUC A;  4DZ2 A;  1BKF A;  2RSE A;  3OOB A;  4DRP A;  1FKS A;  3IKG A;  3NTP A;  5D75 A;  2MPH A;  4GIV A;  3UI5 A;  1D7H A;  4QT2 A;  4J4N A;  1FKR A;  2DG3 A;  4JFI A;  4ODP A;  1D7J A;  2K8I A;  1R9H A;  1T11 A;  1Y0O A;  2MF9 A;  2KE0 A;  3O5I A;  4IQ2 A;  1FKF A;  1FKK A;  4LAV A;  4LAX A;  4R0X A;  4W9Q A;  2FKE A;  1FKH A;  1EYM A;  3EY6 A;  3JYM A;  3H9R B;  2RUD A;  1NMV A;  4DRK A;  1HXV A;  4DRM A;  1FAP A;  4TX0 A;  3CGN A;  5J6E A;  3O5M A;  1Q6U A;  1B6C A;  2XP4 A;  3O5E A;  4GGQ A;  1FKG A;  3NRK A;  4DH0 A;  3KAD A;  2FAP A;  3ODK A;  4N19 A;  2N87 A;  2DG4 A;  2DG9 A;  1P5Q A;  1TCO C;  1C9H A;  1U79 A;  3O5L A;  4LAW A;  2KR7 A;  2MLZ A;  3UI6 A;  2Y78 A;  1KT0 A;  3RFW A;  1QPF A;  3UF8 A;  3KAH A;  3UQA A;  3O5P A;  5HKG A;  5B8I C;  5HTG A;  4ODK A;  1M5Y A;  4MGV A;  1QPL A;  4TNS A;  4U84 A;  4DRN A;  5HUA A;  1ZCN A;  2M1I A;  3UI4 A;  2VCD A;  2AWG A;  1N1A A;  2MNT A;  2RUR A;  3KAG A;  3KAC A;  3O5D A;  3PA7 A;  4ODR A;  4TW6 A;  5HT1 A;  5HW6 A;  1Q6H A;  5HW7 A;  1EQ3 A;  2XP7 A;  2XP9 A;  2ZQS A;  3O5K A;  4DRH A;  4O2T A;  3IKD A;  2ZQT A;  2ZQU A;  2M2A A;  1QZ2 A;  3IK8 A;  3KZ7 A;  3PRB A;  1J4H A;  1FKL A;  4DZ3 A;  2XP8 A;  2PPP A;  2PPO A;  1YW5 A;  3KAB A;  1ROT A;  2ITK A;  2XP3 A;  3B7X A;  2ZR5 A;  4J4O A;  1JVW A;  2LJ4 A;  2OFN A;  4IPX A;  5DIV A;  4DRO A;  5GPG A;  4JYS A;  1NMW A;  4U85 A;  5HW8 A;  3UQB A;  2KGJ A;  2PV2 A;  2XP5 A;  4TYO A;  2KI3 A;  3WH0 A;  1NSG A;  2JZV A;  2PBC A;  4QT3 A;  4DRI A;  1J4R A;  1FJD A;  3TC5 A;  4G2P A;  2PV3 A;  1J4I A;  2LGO A;  3MDY B;  3PRD A;  4G50 A;  4W9O A;  4TW8 A;  4IQC A;  4DRQ A;  2XPB A;  2RQS A;  4DRJ A;  2IF4 A;  2LKN A;  2KFW A;  2MLX A;  4BF8 A;  2F4E A;  1YAT A;  3GPK A;  3I6C A;  3TDB A;  2UZ5 A;  3JXV A;  5DIU A;  3TCZ A;  5HWC A;  2Q5A A;  1PIN A;  2MLY A;  4DIP A;  2D9F A;  4DT4 A;  2PPN A;  4ODQ A;  4JFK A;  1L1P A;  4JFM A;  3O5F A;  1ROU A;  2F2D A;  2M08 A;  3O5G A;  4QIB A; 
#chains in the Genus database with same CATH topology
 1ZBW A;  2WLZ A;  1FKJ A;  4W9P A;  2WK2 A;  3AS0 A;  4S3J A;  1JNE A;  3O5O A;  4FN2 A;  3BXW A;  4MPK A;  2XPA A;  1J6Y A;  2PV1 A;  1EHN A;  1KT1 A;  3RGC A;  3FAP A;  4FAP A;  4U86 A;  2B31 A;  1WB0 A;  1F40 A;  3ALF A;  2YBT A;  2KO7 A;  1LQ0 A;  1ZK6 A;  2RUC A;  2DSW A;  3NTP A;  4GIV A;  2O9O A;  4QT2 A;  1FKR A;  2DG3 A;  1NWR A;  4HAR A;  1Y0O A;  1LL6 A;  4IQ2 A;  4LAX A;  4R0X A;  3RME A;  2FKE A;  1EYM A;  3EIP A;  1LL7 A;  4DRM A;  1HJW A;  1Q6U A;  2ESC A;  2IUZ A;  1FKG A;  1ZU8 A;  2DT1 A;  3KAD A;  1W1Y A;  2WM0 A;  1W9U A;  2N87 A;  3CHE A;  1C9H A;  3O5L A;  4LAW A;  4LGX A;  2A3C A;  1QPF A;  4WK9 A;  1UR9 A;  5HTG A;  1W9V A;  1M5Y A;  2F23 A;  3CHC A;  3RM9 A;  3ARX A;  2VCD A;  4S3K A;  2AWG A;  1N1A A;  2MNT A;  3O5D A;  4TW6 A;  3WQV A;  3FY1 A;  1EQ3 A;  3AS2 A;  2AOS A;  1JND A;  4IT6 A;  4O2T A;  2M2A A;  3GTY X;  3WKZ A;  1H0G A;  2ITK A;  4J4O A;  5DIV A;  4DRO A;  5GPG A;  4MTV A;  2KI3 A;  4W5U A;  1NSG A;  4QT3 A;  1OGG A;  3WD3 A;  1HJX A;  1NH6 A;  4MNL A;  3ARY A;  4WKA A;  1ZBK A;  1FFQ A;  1J4I A;  2PV3 A;  4G50 A;  4IQC A;  4NSB A;  3WQW A;  2RQS A;  5HBF A;  2IF4 A;  2KFW A;  2F4E A;  3I6C A;  3TDB A;  4Z2G A;  3JXV A;  4DIP A;  1WAW A;  4KR0 B;  3FXY A;  4JFK A;  2F2D A;  2XP6 A;  1JCH B;  2ZR6 A;  2B5U B;  1HKI A;  5DIT A;  3ARS A;  3AS1 A;  1FKI A;  4ODL A;  4Z2L A;  1ZL1 A;  1Q6I A;  4C02 B;  1PBK A;  1F8A B;  1FKD A;  3IHZ A;  1SYT A;  3NI6 A;  1E15 A;  4ODM A;  5HWB A;  3ARP A;  2LPV A;  4ODO A;  1GRJ A;  1FD9 A;  4JFJ A;  2F21 A;  4DWS D;  4JFL A;  2ZQV A;  3ARZ A;  4R5E A;  3ARQ A;  1H0I A;  4DZ2 A;  1BKF A;  1D2K A;  2RSE A;  3OOB A;  4DRP A;  1FKS A;  1W9P A;  1SR0 A;  1D7H A;  4PTM A;  4ODP A;  4ZPW R;  1D7J A;  1R9H A;  3O5I A;  3W4R A;  1E44 A;  4HBO A;  4P8W A;  2PI6 A;  3EY6 A;  1XRV A;  3H9R B;  1NMV A;  4DRK A;  1HXV A;  3ARU A;  3CGN A;  4DH0 A;  2ETN A;  2DG4 A;  2DG9 A;  1TCO C;  1U79 A;  2DSZ A;  2MLZ A;  3UI6 A;  3UF8 A;  5B8I C;  4TNS A;  1QPL A;  3GU0 A;  4ZPV R;  4Z2J A;  1ZCN A;  2M1I A;  4ODR A;  3OA5 A;  5HW6 A;  1Q6H A;  2XP7 A;  2XP9 A;  4XAK A;  3AS3 A;  3CHD A;  2ZQT A;  4Z2I A;  1EDQ A;  3KZ7 A;  4DZ3 A;  1J4H A;  2PPP A;  2PPO A;  1ROT A;  2XP3 A;  3B7X A;  2ZR5 A;  1NWT A;  1JVW A;  2OFN A;  4IPX A;  4UDM A;  2KGJ A;  2PBC A;  4MAV A;  4DWS C;  1LJY A;  4G2P A;  4Q7N A;  4TW8 A;  1WNO A;  4DRQ A;  2DSU A;  2LKN A;  4L72 B;  5DIU A;  1HKJ A;  3TCZ A;  2MLY A;  3ART A;  1ZB5 A;  3CHF A;  3QOK A;  2M08 A;  4ZS6 A;  3O5G A;  4QIB A;  1NWU A;  1FKB A;  1JNT A;  1W26 A;  4QZV B;  4NNR A;  1GUV A;  3WD0 A;  4Z2H A;  2OLH A;  3VAW A;  3O5J A;  1X6N A;  3CGM A;  2VN1 A;  1K9T A;  3KCE A;  3O5Q A;  2L2S A;  4P8V A;  4ITZ A;  3RM4 A;  1LG2 A;  5BXJ A;  1E6R A;  4P8U A;  1FFR A;  3ARO A;  2DPE A;  1UR8 A;  4AY1 A;  1E6N A;  5D75 A;  3PRA A;  4Q22 A;  4J4N A;  4JFI A;  5JH8 A;  3ALG A;  2K8I A;  1T11 A;  2KE0 A;  4W9Q A;  2P4V A;  3JYM A;  1FKH A;  2RUD A;  4TX0 A;  5J6E A;  1IX5 A;  2XP4 A;  3O5E A;  4GGQ A;  5GPR A;  2A3E A;  3G6M A;  3ODK A;  2G41 A;  4WKF A;  2KR7 A;  1KT0 A;  1HJV A;  1OWQ A;  3WD1 A;  1X6L A;  3KAH A;  3WIJ A;  5HKG A;  1TFV A;  5DO2 A;  2DT2 A;  5DEZ A;  4U84 A;  5HUA A;  1GPF A;  4WIW A;  3KAG A;  3PA7 A;  3KAC A;  5HW7 A;  4DRH A;  1KFW A;  4NZC A;  2ZQU A;  1QZ2 A;  1VF8 A;  3IK8 A;  2A3A A;  3KAB A;  1YW5 A;  3WL0 A;  1L1P A;  1ZBV A;  3ARR A;  5HW8 A;  2PV2 A;  1LG1 A;  4TYO A;  3WD4 A;  3WD2 A;  4DRI A;  4MNK A;  2PN0 A;  2DT0 A;  4W9O A;  5GQB A;  1O6I A;  3RM8 A;  4DRJ A;  4ZPT R;  2MLX A;  4BF8 A;  2DSV A;  3BMB A;  2UZ5 A;  4IT4 A;  1PIN A;  2D9F A;  4DT4 A;  2PPN A;  4KQZ A;  2O92 A;  3ARV A;  4HBE A;  1ITX A;  1LL4 A;  1ROU A;  3UQI A;  3UI5 A;  1E6P A;  3O5R A;  3JYJ A;  2ZR4 A;  3KAF A;  4MSP A;  5DF0 A;  1W1V A;  1Q1C A;  1D6O A;  4TW7 A;  1GOI A;  3KAI A;  3B8S A;  3CH9 A;  4LAY A;  1D7I A;  1A7X A;  5I98 A;  4ML4 A;  1BL4 A;  3LUO A;  2RUQ A;  1JNS A;  1EIB A;  1FKT A;  3B9E A;  1XHG A;  3IKG A;  2MPH A;  4WJX A;  4L3N A;  1HKK A;  2DT3 A;  2MF9 A;  4LAV A;  1FKF A;  1FKK A;  3B9A A;  1FAP A;  3CZ8 A;  3O5M A;  1B6C A;  1W1P A;  2YBU A;  3NRK A;  2FAP A;  4URI A;  2QF8 A;  4N19 A;  1P5Q A;  2Y78 A;  3RFW A;  3UQA A;  1RD6 A;  3O5P A;  3G6L A;  4ODK A;  4MGV A;  4DRN A;  4DWS B;  3UI4 A;  2RUR A;  5HT1 A;  1OGB A;  3PR9 A;  1NWS A;  2ZQS A;  3O5K A;  4WKH A;  3IKD A;  4Z2K A;  4DWS A;  3PRB A;  1FKL A;  2XP8 A;  4MNJ A;  2LJ4 A;  1CTN A;  4JYS A;  1NMW A;  1ZBC A;  4U85 A;  3B9D A;  3UQB A;  2XP5 A;  2G8Z A;  3WH0 A;  1W1T A;  2JZV A;  1E6Z A;  1J4R A;  1FJD A;  3TC5 A;  2FDM A;  1E9L A;  3MDY B;  3PRD A;  2LGO A;  2EUL A;  2A3B A;  3AQU A;  2WLY A;  2XPB A;  4MNM A;  1HKM A;  3GPK A;  1YAT A;  3WL1 A;  4P8X A;  5HWC A;  2Q5A A;  4ODQ A;  4JFM A;  3ARW A;  3O5F A;  4ODN A; 
#chains in the Genus database with same CATH homology
 1ZBW A;  2WLZ A;  1FKJ A;  4W9P A;  2WK2 A;  3AS0 A;  4S3J A;  1JNE A;  3O5O A;  4FN2 A;  3BXW A;  4MPK A;  2XPA A;  1J6Y A;  2PV1 A;  1EHN A;  1KT1 A;  3RGC A;  3FAP A;  4FAP A;  4U86 A;  2B31 A;  1WB0 A;  1F40 A;  3ALF A;  2YBT A;  2KO7 A;  1LQ0 A;  1ZK6 A;  2RUC A;  2DSW A;  3NTP A;  4GIV A;  2O9O A;  4QT2 A;  1FKR A;  2DG3 A;  1NWR A;  4HAR A;  1Y0O A;  1LL6 A;  4IQ2 A;  4LAX A;  4R0X A;  3RME A;  2FKE A;  1EYM A;  1LL7 A;  4DRM A;  1HJW A;  1Q6U A;  2ESC A;  2IUZ A;  1FKG A;  1ZU8 A;  2DT1 A;  3KAD A;  1W1Y A;  2WM0 A;  1W9U A;  2N87 A;  3CHE A;  1C9H A;  3O5L A;  4LAW A;  4LGX A;  2A3C A;  1QPF A;  4WK9 A;  1UR9 A;  5HTG A;  1W9V A;  1M5Y A;  3CHC A;  3RM9 A;  3ARX A;  2VCD A;  4S3K A;  2AWG A;  1N1A A;  2MNT A;  3O5D A;  4TW6 A;  3WQV A;  3FY1 A;  1EQ3 A;  3AS2 A;  2AOS A;  1JND A;  4IT6 A;  4O2T A;  2M2A A;  3WKZ A;  1H0G A;  4J4O A;  2ITK A;  5DIV A;  4DRO A;  5GPG A;  4MTV A;  2KI3 A;  4W5U A;  1NSG A;  4QT3 A;  1OGG A;  3WD3 A;  1HJX A;  1NH6 A;  4MNL A;  3ARY A;  4WKA A;  1ZBK A;  1FFQ A;  1J4I A;  2PV3 A;  4G50 A;  4IQC A;  4NSB A;  3WQW A;  2RQS A;  5HBF A;  2IF4 A;  2KFW A;  2F4E A;  3I6C A;  3TDB A;  4Z2G A;  3JXV A;  4DIP A;  1WAW A;  4KR0 B;  3FXY A;  4JFK A;  2F2D A;  2XP6 A;  2ZR6 A;  1HKI A;  5DIT A;  3ARS A;  3AS1 A;  1FKI A;  4ODL A;  4Z2L A;  1ZL1 A;  1Q6I A;  4C02 B;  1PBK A;  1F8A B;  1FKD A;  3IHZ A;  1SYT A;  3NI6 A;  1E15 A;  4ODM A;  5HWB A;  3ARP A;  2LPV A;  4ODO A;  1FD9 A;  4JFJ A;  2F21 A;  4DWS D;  4JFL A;  2ZQV A;  3ARZ A;  4R5E A;  3ARQ A;  1H0I A;  4DZ2 A;  1BKF A;  1D2K A;  2RSE A;  3OOB A;  4DRP A;  1FKS A;  1W9P A;  1SR0 A;  1D7H A;  4PTM A;  4ODP A;  4ZPW R;  1D7J A;  1R9H A;  3O5I A;  3W4R A;  4HBO A;  4P8W A;  2PI6 A;  3EY6 A;  1XRV A;  3H9R B;  1NMV A;  4DRK A;  1HXV A;  3ARU A;  3CGN A;  4DH0 A;  2DG4 A;  2DG9 A;  1TCO C;  1U79 A;  2DSZ A;  2MLZ A;  3UI6 A;  3UF8 A;  5B8I C;  4TNS A;  1QPL A;  4ZPV R;  4Z2J A;  1ZCN A;  2M1I A;  4ODR A;  3OA5 A;  5HW6 A;  1Q6H A;  2XP7 A;  2XP9 A;  4XAK A;  3AS3 A;  3CHD A;  2ZQT A;  4Z2I A;  1EDQ A;  3KZ7 A;  4DZ3 A;  1J4H A;  2PPP A;  2PPO A;  1ROT A;  2XP3 A;  3B7X A;  2ZR5 A;  1NWT A;  1JVW A;  2OFN A;  4IPX A;  2KGJ A;  2PBC A;  4MAV A;  4DWS C;  1LJY A;  4G2P A;  4Q7N A;  4TW8 A;  1WNO A;  4DRQ A;  2DSU A;  2LKN A;  4L72 B;  5DIU A;  1HKJ A;  3TCZ A;  2MLY A;  3ART A;  1ZB5 A;  3CHF A;  3QOK A;  2M08 A;  4ZS6 A;  3O5G A;  4QIB A;  1NWU A;  1FKB A;  1JNT A;  1W26 A;  4QZV B;  4NNR A;  1GUV A;  3WD0 A;  4Z2H A;  2OLH A;  3VAW A;  3O5J A;  1X6N A;  3CGM A;  2VN1 A;  1K9T A;  3KCE A;  3O5Q A;  2L2S A;  4P8V A;  4ITZ A;  3RM4 A;  1LG2 A;  5BXJ A;  1E6R A;  4P8U A;  1FFR A;  3ARO A;  2DPE A;  1UR8 A;  4AY1 A;  1E6N A;  5D75 A;  3PRA A;  4Q22 A;  4J4N A;  4JFI A;  5JH8 A;  3ALG A;  2K8I A;  1T11 A;  2KE0 A;  4W9Q A;  3JYM A;  1FKH A;  2RUD A;  4TX0 A;  5J6E A;  1IX5 A;  2XP4 A;  3O5E A;  4GGQ A;  5GPR A;  2A3E A;  3G6M A;  3ODK A;  2G41 A;  4WKF A;  2KR7 A;  1KT0 A;  1HJV A;  1OWQ A;  3WD1 A;  1X6L A;  3KAH A;  3WIJ A;  5HKG A;  1TFV A;  5DO2 A;  2DT2 A;  5DEZ A;  4U84 A;  5HUA A;  1GPF A;  4WIW A;  3KAG A;  3PA7 A;  3KAC A;  5HW7 A;  4DRH A;  1KFW A;  4NZC A;  2ZQU A;  1QZ2 A;  1VF8 A;  3IK8 A;  2A3A A;  3KAB A;  1YW5 A;  3WL0 A;  1L1P A;  1ZBV A;  3ARR A;  5HW8 A;  2PV2 A;  1LG1 A;  4TYO A;  3WD4 A;  3WD2 A;  4DRI A;  4MNK A;  2DT0 A;  4W9O A;  5GQB A;  1O6I A;  3RM8 A;  4DRJ A;  4ZPT R;  2MLX A;  4BF8 A;  2DSV A;  2UZ5 A;  4IT4 A;  1PIN A;  2D9F A;  4DT4 A;  2PPN A;  4KQZ A;  2O92 A;  3ARV A;  4HBE A;  1ITX A;  1LL4 A;  1ROU A;  3UQI A;  3UI5 A;  1E6P A;  3O5R A;  3JYJ A;  2ZR4 A;  3KAF A;  4MSP A;  5DF0 A;  1W1V A;  1Q1C A;  1D6O A;  4TW7 A;  1GOI A;  3KAI A;  3B8S A;  3CH9 A;  4LAY A;  1D7I A;  1A7X A;  5I98 A;  4ML4 A;  1BL4 A;  3LUO A;  2RUQ A;  1JNS A;  1EIB A;  1FKT A;  3B9E A;  1XHG A;  3IKG A;  2MPH A;  4WJX A;  4L3N A;  1HKK A;  2DT3 A;  2MF9 A;  4LAV A;  1FKF A;  1FKK A;  3B9A A;  1FAP A;  3CZ8 A;  3O5M A;  1B6C A;  1W1P A;  2YBU A;  3NRK A;  2FAP A;  4URI A;  2QF8 A;  4N19 A;  1P5Q A;  2Y78 A;  3RFW A;  3UQA A;  1RD6 A;  3O5P A;  3G6L A;  4ODK A;  4MGV A;  4DRN A;  4DWS B;  3UI4 A;  2RUR A;  5HT1 A;  1OGB A;  3PR9 A;  1NWS A;  2ZQS A;  3O5K A;  4WKH A;  3IKD A;  4Z2K A;  4DWS A;  3PRB A;  1FKL A;  2XP8 A;  4MNJ A;  2LJ4 A;  1CTN A;  4JYS A;  1NMW A;  1ZBC A;  4U85 A;  3B9D A;  3UQB A;  2XP5 A;  2G8Z A;  3WH0 A;  1W1T A;  2JZV A;  1E6Z A;  1J4R A;  1FJD A;  3TC5 A;  2FDM A;  1E9L A;  3MDY B;  3PRD A;  2LGO A;  2A3B A;  3AQU A;  2WLY A;  2XPB A;  4MNM A;  1HKM A;  3GPK A;  1YAT A;  3WL1 A;  4P8X A;  5HWC A;  2Q5A A;  4ODQ A;  4JFM A;  3ARW A;  3O5F A;  4ODN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...