3O5FA

Fk1 domain of fkbp51, crystal form vii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
TATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 125
sequence length 125
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5fA00
1FKRA 4ODNA 3O5MA 3O5LA 3O5IA 4J4NA 3FAPA 2XP6A 2MLYA 3IKGA 2PBCA 3LUOA 2FKEA 4MGVA 4JFIA 2XP5A 4IQ2A 1FKFA 4DRPA 3CGMA 2LPVA 3UQAA 3O5RA 4C02B 5HWBA 1L1PA 4DRHA 5HW8A 2Q5AA 4GGQA 4DH0A 2ZR4A 3KAFA 4ODMA 4R0XA 1QPLA 1ZK6A 2XP9A 2M08A 2M1IA 2RUDA 3KAHA 1NMVA 4N19A 1FKIA 3H9RB 3KAIA 1PINA 5HWCA 3KABA 4ITZA 1Q6UA 4DIPA 1D6OA 2RUQA 3JYJA 3NTPA 2ZQSA 1J4IA 3NRKA 4TW6A 2MLXA 1F8AB 1KT0A 3O5GA 3O5QA 1EYMA 2ITKA 1FKTA 2M2AA 2XPBA 2N87A 3IHZA 3PRBA 4O2TA 3UI5A 3O5KA 4ODOA 2LGOA 4TYOA 3O5PA 4JFJA 1F40A 2XP3A 4TNSA 2MF9A 1J4RA 1FKHA 2JZVA 4JFLA 4DRQA 1KT1A 4NNRA 3PA7A 2ZQVA 3KACA 1D7IA 2ZR6A 1J4HA 5HT1A 1JNSA 4ODQA 1Q6HA 2RURA 3UI6A 3TCZA 2XP4A 2DG4A 1FKDA 1Y0OA 3CGNA 1YATA 2ZQUA 2PV3A 4DRJA 5D75A 1BKFA 5GPGA 2PV1A 4LAXA 4W9QA 2PPPA 2FAPA 4DRNA 2F2DA 3O5JA 5B8IC 4G2PA 4DZ2A 4DZ3A 5HW7A 1YW5A 2PPOA 2UZ5A 1ROTA 2KI3A 2DG3A 3KAGA 1D7HA 3NI6A 3O5FA 5I98A 1FKJA 4W9OA 4QT3A 1T11A 1QPFA 1FKKA 4LAVA 2MLZA 2F4EA 5HW6A 1FJDA 2KR7A 2KFWA 1ROUA 4ODKA 2Y78A 3WH0A 2XPAA 4DT4A 2OFNA 2LJ4A 3ODKA 1NSGA 2IF4A 4FN2A 4IPXA 4QT2A 1B6CA 4IQCA 1M5YA 3RFWA 3UF8A 3UQIA 4DRKA 5HKGA 2VCDA 5J6EA 2ZR5A 5DITA 4ODLA 5HTGA 4QIBA 3VAWA 1W26A 3B7XA 1JVWA 2F21A 3TDBA 5HUAA 4U84A 2D9FA 3I6CA 3O5OA 1EQ3A 2KE0A 1TCOC 2ZQTA 4U85A 3MDYB 1J6YA 1FKLA 3JXVA 4ODRA 1HXVA 2KGJA 1FD9A 4FAPA 3TC5A 3UI4A 2MPHA 4U86A 2PV2A 1QZ2A 4J4OA 2RQSA 5DIVA 4DRMA 1ZCNA 4TW8A 4DROA 1PBKA 3KCEA 4BF8A 1FAPA 2PPNA 3RGCA 3EY6A 1P5QA 3GPKA 4G50A 2RSEA 3KADA 4LAWA 2DG9A 2KO7A 4ODPA 3KZ7A 4TW7A 2K8IA 1BL4A 4GIVA 4JFMA 5BXJA 2MNTA 4JYSA 1FKGA 1NMWA 4W9PA 4DRIA 1FKSA 1C9HA 2AWGA 2LKNA 3UQBA 2XP7A 3JYMA 4JFKA 1JNTA 1N1AA 4LAYA 4TX0A 1R9HA 1D7JA 3O5EA 1A7XA 1U79A 3IK8A 4MSPA 2XP8A 1Q1CA 3OOBA 1Q6IA 3IKDA 1FKBA 2L2SA 5DIUA 3PRDA 3O5DA 2RUCA 2VN1A
chains in the Genus database with same CATH superfamily
1XRVA 4NZCA 4J4NA 3IKGA 2PBCA 4MGVA 1FKFA 3O5RA 1L1PA 2ETNA 4WJXA 4DH0A 1QPLA 4NSBA 2AOSA 4N19A 1FKIA 3KAIA 3JYJA 1LL6A 2ZQSA 1WNOA 4TW6A 1F8AB 1E44A 3ARYA 1KT0A 1EYMA 3IHZA 1FKTA 1ITXA 2M2AA 2O9OA 4O2TA 1NH6A 3GU0A 2XP3A 3BMBA 4JFLA 4NNRA 2WLYA 2ZQVA 3WKZA 1Q6HA 2DG4A 4IT4A 2PV1A 2B5UB 3RM9A 1UR8A 4LAXA 4W9QA 2FAPA 4KR0B 3O5JA 4DZ2A 4AY1A 1NWSA 1E6PA 2QF8A 1HJXA 1D7HA 4DWSB 4Z2LA 4W9OA 3CHEA 4PTMA 1T11A 3QOKA 3RM8A 5HW6A 2MLZA 2F4EA 2G41A 2KR7A 4DT4A 2XPAA 3UF8A 4IPXA 3RFWA 1B6CA 4IQCA 5HKGA 5DITA 2DSVA 3FXYA 4MNJA 1VF8A 3AS0A 5HUAA 3O5OA 1CTNA 1IX5A 1TCOC 2ZQTA 3MDYB 1J6YA 3B8SA 3JXVA 1HXVA 3TC5A 2PV2A 3BXWA 4R5EA 4HARA 1O6IA 4DRHA 4TW7A 2KO7A 3KZ7A 1H0GA 4GIVA 5BXJA 4W9PA 2DSWA 3B9DA 3RM4A 2LKNA 1SR0A 1N1AA 3FY1A 4P8UA 1OWQA 4DWSA 1A7XA 1U79A 3CZ8A 3PRDA 3AS1A 3O5MA 4L3NA 3O5IA 2DSZA 1ZL1A 3LUOA 2FKEA 1NWTA 1W9VA 4WIWA 2XP5A 3CGMA 3UQAA 5HWBA 3CHDA 1E6ZA 2ZR4A 4ODMA 4R0XA 4ZPWR 2M1IA 2RUDA 4XAKA 3H9RB 4DWSC 1ZBCA 5HWCA 2A3EA 1W1VA 1D6OA 3NTPA 3WIJA 4L72B 1JNDA 3O5QA 2EULA 2XPBA 2N87A 3GTYX 3UI5A 4JFJA 1HJVA 2DT2A 2IUZA 2DSUA 4MNKA 1KT1A 3PA7A 4Q22A 1J4HA 1JNSA 4ODQA 2RURA 3CHFA 2XP4A 1FKDA 1Y0OA 3CGNA 2ZQUA 1LQ0A 4MNMA 5D75A 5GPGA 3ALFA 2A3BA 2PPPA 2F2DA 2P4VA 4G2PA 4DZ3A 1YW5A 2PPOA 3ARZA 1ROTA 2WM0A 5I98A 1FKJA 4MNLA 4ZPTR 4LAVA 4QZVB 3ARSA 2OFNA 3ALGA 4DWSD 1NSGA 3W4RA 1X6LA 2VCDA 2ZR5A 4WKAA 4QIBA 3ARVA 1W26A 1JVWA 2B31A 2D9FA 1EDQA 4Z2JA 1FD9A 4FAPA 1OGGA 4U86A 1NWRA 5DIVA 1W9PA 2FDMA 1W1PA 3KCEA 4BF8A 4URIA 3GPKA 1OGBA 2RSEA 3KADA 3EIPA 4Q7NA 1ZBVA 1FKGA 3UQBA 2XP7A 3JYMA 3PR9A 4JFKA 1D7JA 4HBEA 1LL7A 3O5DA 4ZS6A 3FAPA 2MLYA 2G8ZA 4P8WA 3B9EA 1GOIA 1WAWA 4JFIA 1EIBA 4IQ2A 2LPVA 4C02B 2WK2A 2Q5AA 4GGQA 3WD1A 1ZK6A 2XP9A 2M08A 4S3JA 1NMVA 1PINA 1RD6A 2OLHA 1XHGA 3KABA 1Q6UA 4DIPA 2RUQA 2PI6A 2ITKA 3ARPA 5DF0A 3O5KA 1F40A 2LGOA 2A3AA 1J4RA 1FKHA 5HBFA 3CHCA 1GUVA 4WKHA 3WD3A 3KACA 1W9UA 2PV3A 1E15A 1BKFA 3AQUA 2O92A 4Z2HA 1KFWA 4DRNA 3WD2A 5B8IC 1W1TA 1HKKA 5HW7A 2UZ5A 1D2KA 3G6MA 2DG3A 3NI6A 2DT0A 1WB0A 4WKFA 1FJDA 2KFWA 4MAVA 4FN2A 2IF4A 4QT2A 3WD4A 1M5YA 4ODLA 3VAWA 3B7XA 3TDBA 3WL0A 4IT6A 3I6CA 4LGXA 1ZB5A 1E9LA 1HKMA 4W5UA 3UI4A 2MPHA 1LG1A 3OA5A 4DRMA 1QZ2A 4J4OA 2RQSA 1ZCNA 1HJWA 4HBOA 4DROA 1TFVA 1FAPA 3RGCA 3EY6A 4ODPA 4LAWA 2DG9A 2K8IA 4P8VA 2YBUA 4Z2IA 4JYSA 3WQVA 1K9TA 1NMWA 4DRIA 1C9HA 2AWGA 1JNTA 4LAYA 1GPFA 1R9HA 3AS2A 1Q1CA 3OOBA 2DPEA 5DIUA 1FKBA 1JCHB 1FFRA 4QT3A 1UR9A 2VN1A 1FKRA 4ODNA 3O5LA 3G6LA 5DO2A 2XP6A 1W1YA 3ARWA 1ZBWA 4DRPA 1H0IA 4S3KA 4MTVA 2ESCA 3ARQA 5HW8A 5GQBA 3WQWA 3KAFA 3KAHA 1JNEA 4ITZA 1LL4A 1J4IA 3NRKA 1ZBKA 2MLXA 3O5GA 1E6RA 4ODRA 3PRBA 1HKJA 4P8XA 3ARUA 4ODOA 1NWUA 4TYOA 3O5PA 3AROA 4TNSA 2MF9A 2JZVA 1E6NA 4DRQA 1D7IA 2ZR6A 5HT1A 3UI6A 2YBTA 3TCZA 1FFQA 1YATA 4DRJA 2DT1A 1ZU8A 1LG2A 1HKIA 4ML4A 2KI3A 3KAGA 4ZPVR 3O5FA 4Z2KA 3RMEA 1QPFA 1FKKA 1ROUA 4ODKA 2Y78A 3WH0A 2LJ4A 3ODKA 2PN0A 2WLZA 3UQIA 3AS3A 4DRKA 5J6EA 4WK9A 3CH9A 3ARXA 5HTGA 4KQZA 3ARTA 3WL1A 2F21A 4U84A 1SYTA 3ARRA 1EQ3A 2KE0A 4U85A 3WD0A 1FKLA 2KGJA 5JH8A 5DEZA 2DT3A 4TW8A 1PBKA 3B9AA 2PPNA 1P5QA 4G50A 4UDMA 5GPRA 1X6NA 1BL4A 3PRAA 4JFMA 2MNTA 4Z2GA 1FKSA 4MPKA 4TX0A 2A3CA 3O5EA 1EHNA 1GRJA 1LJYA 3IK8A 4MSPA 2XP8A 1Q6IA 2F23A 3IKDA 2L2SA 2RUCA
chains in the Genus database with same CATH topology
1XRVA 4NZCA 4J4NA 3IKGA 2PBCA 4MGVA 1FKFA 3O5RA 1L1PA 4WJXA 4DH0A 1QPLA 4NSBA 2AOSA 4N19A 1FKIA 3KAIA 3JYJA 1LL6A 2ZQSA 1WNOA 4TW6A 1F8AB 3ARYA 1KT0A 1EYMA 3IHZA 1FKTA 1ITXA 2M2AA 2O9OA 4O2TA 1NH6A 2XP3A 4JFLA 4NNRA 2WLYA 2ZQVA 3WKZA 1Q6HA 2DG4A 4IT4A 2PV1A 3RM9A 1UR8A 4LAXA 4W9QA 2FAPA 4KR0B 3O5JA 4DZ2A 4AY1A 1NWSA 1E6PA 2QF8A 1HJXA 1D7HA 4DWSB 4Z2LA 4W9OA 3CHEA 4PTMA 1T11A 3QOKA 3RM8A 5HW6A 2MLZA 2F4EA 2G41A 2KR7A 4DT4A 2XPAA 3UF8A 4IPXA 3RFWA 1B6CA 4IQCA 5HKGA 5DITA 2DSVA 3FXYA 4MNJA 1VF8A 3AS0A 5HUAA 3O5OA 1CTNA 1IX5A 1TCOC 2ZQTA 3MDYB 1J6YA 3B8SA 3JXVA 1HXVA 3TC5A 2PV2A 3BXWA 4R5EA 4HARA 1O6IA 4DRHA 4TW7A 2KO7A 3KZ7A 1H0GA 4GIVA 5BXJA 4W9PA 2DSWA 3B9DA 3RM4A 2LKNA 1SR0A 1N1AA 3FY1A 4P8UA 1OWQA 4DWSA 1A7XA 1U79A 3CZ8A 3PRDA 3AS1A 3O5MA 4L3NA 3O5IA 2DSZA 1ZL1A 3LUOA 2FKEA 1NWTA 1W9VA 4WIWA 2XP5A 3CGMA 3UQAA 5HWBA 3CHDA 1E6ZA 2ZR4A 4ODMA 4R0XA 4ZPWR 2M1IA 2RUDA 4XAKA 3H9RB 4DWSC 1ZBCA 5HWCA 2A3EA 1W1VA 1D6OA 3NTPA 3WIJA 4L72B 1JNDA 3O5QA 2XPBA 2N87A 3UI5A 4JFJA 1HJVA 2DT2A 2IUZA 2DSUA 4MNKA 1KT1A 3PA7A 4Q22A 1J4HA 1JNSA 4ODQA 2RURA 3CHFA 2XP4A 1FKDA 1Y0OA 3CGNA 2ZQUA 1LQ0A 4MNMA 5D75A 5GPGA 3ALFA 2A3BA 2PPPA 2F2DA 4G2PA 4DZ3A 1YW5A 2PPOA 3ARZA 1ROTA 2WM0A 5I98A 1FKJA 4MNLA 4ZPTR 4LAVA 4QZVB 3ARSA 2OFNA 3ALGA 4DWSD 1NSGA 3W4RA 1X6LA 2VCDA 2ZR5A 4WKAA 4QIBA 3ARVA 1W26A 1JVWA 2B31A 2D9FA 1EDQA 4Z2JA 1FD9A 4FAPA 1OGGA 4U86A 1NWRA 5DIVA 1W9PA 2FDMA 1W1PA 3KCEA 4BF8A 4URIA 3GPKA 1OGBA 2RSEA 3KADA 4Q7NA 1ZBVA 1FKGA 3UQBA 2XP7A 3JYMA 3PR9A 4JFKA 1D7JA 4HBEA 1LL7A 3O5DA 4ZS6A 3FAPA 2MLYA 2G8ZA 4P8WA 3B9EA 1GOIA 1WAWA 4JFIA 1EIBA 4IQ2A 2LPVA 4C02B 2WK2A 2Q5AA 4GGQA 3WD1A 1ZK6A 2XP9A 2M08A 4S3JA 1NMVA 1PINA 1RD6A 2OLHA 1XHGA 3KABA 1Q6UA 4DIPA 2RUQA 2PI6A 2ITKA 3ARPA 5DF0A 3O5KA 1F40A 2LGOA 2A3AA 1J4RA 1FKHA 5HBFA 3CHCA 1GUVA 4WKHA 3WD3A 3KACA 1W9UA 2PV3A 1E15A 1BKFA 3AQUA 2O92A 4Z2HA 1KFWA 4DRNA 3WD2A 5B8IC 1W1TA 1HKKA 5HW7A 2UZ5A 1D2KA 3G6MA 2DG3A 3NI6A 2DT0A 1WB0A 4WKFA 1FJDA 2KFWA 4MAVA 4FN2A 2IF4A 4QT2A 3WD4A 1M5YA 4ODLA 3VAWA 3B7XA 3TDBA 3WL0A 4IT6A 3I6CA 4LGXA 1ZB5A 1E9LA 1HKMA 4W5UA 3UI4A 2MPHA 1LG1A 3OA5A 4DRMA 1QZ2A 4J4OA 2RQSA 1ZCNA 1HJWA 4HBOA 4DROA 1TFVA 1FAPA 3RGCA 3EY6A 4ODPA 4LAWA 2DG9A 2K8IA 4P8VA 2YBUA 4Z2IA 4JYSA 3WQVA 1K9TA 1NMWA 4DRIA 1C9HA 2AWGA 1JNTA 4LAYA 1GPFA 1R9HA 3AS2A 1Q1CA 3OOBA 2DPEA 5DIUA 1FKBA 1FFRA 4QT3A 1UR9A 2VN1A 1FKRA 4ODNA 3O5LA 3G6LA 5DO2A 2XP6A 1W1YA 3ARWA 1ZBWA 4DRPA 1H0IA 4S3KA 4MTVA 2ESCA 3ARQA 5HW8A 5GQBA 3WQWA 3KAFA 3KAHA 1JNEA 4ITZA 1LL4A 1J4IA 3NRKA 1ZBKA 2MLXA 3O5GA 1E6RA 4ODRA 3PRBA 1HKJA 4P8XA 3ARUA 4ODOA 1NWUA 4TYOA 3O5PA 3AROA 4TNSA 2MF9A 2JZVA 1E6NA 4DRQA 1D7IA 2ZR6A 5HT1A 3UI6A 2YBTA 3TCZA 1FFQA 1YATA 4DRJA 2DT1A 1ZU8A 1HKIA 1LG2A 4ML4A 2KI3A 3KAGA 4ZPVR 3O5FA 4Z2KA 3RMEA 1QPFA 1FKKA 1ROUA 4ODKA 2Y78A 3WH0A 2LJ4A 3ODKA 2WLZA 3UQIA 3AS3A 4DRKA 5J6EA 4WK9A 3CH9A 3ARXA 5HTGA 4KQZA 3ARTA 3WL1A 2F21A 4U84A 1SYTA 3ARRA 1EQ3A 2KE0A 4U85A 3WD0A 1FKLA 2KGJA 5JH8A 5DEZA 2DT3A 4TW8A 1PBKA 3B9AA 2PPNA 1P5QA 4G50A 5GPRA 1X6NA 1BL4A 3PRAA 4JFMA 2MNTA 4Z2GA 1FKSA 4MPKA 4TX0A 2A3CA 3O5EA 1EHNA 1LJYA 3IK8A 4MSPA 2XP8A 1Q6IA 3IKDA 2L2SA 2RUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKR A;  4ODN A;  3O5M A;  3O5L A;  3O5I A;  4J4N A;  3FAP A;  2XP6 A;  2MLY A;  3IKG A;  2PBC A;  3LUO A;  2FKE A;  4MGV A;  4JFI A;  2XP5 A;  4IQ2 A;  1FKF A;  4DRP A;  3CGM A;  2LPV A;  3UQA A;  3O5R A;  4C02 B;  5HWB A;  1L1P A;  4DRH A;  5HW8 A;  2Q5A A;  4GGQ A;  4DH0 A;  2ZR4 A;  3KAF A;  4ODM A;  4R0X A;  1QPL A;  1ZK6 A;  2XP9 A;  2M08 A;  2M1I A;  2RUD A;  3KAH A;  1NMV A;  4N19 A;  1FKI A;  3H9R B;  3KAI A;  1PIN A;  5HWC A;  3KAB A;  4ITZ A;  1Q6U A;  4DIP A;  1D6O A;  2RUQ A;  3JYJ A;  3NTP A;  2ZQS A;  1J4I A;  3NRK A;  4TW6 A;  2MLX A;  1F8A B;  1KT0 A;  3O5G A;  3O5Q A;  1EYM A;  2ITK A;  1FKT A;  2M2A A;  2XPB A;  2N87 A;  3IHZ A;  3PRB A;  4O2T A;  3UI5 A;  3O5K A;  4ODO A;  2LGO A;  4TYO A;  3O5P A;  4JFJ A;  1F40 A;  2XP3 A;  4TNS A;  2MF9 A;  1J4R A;  1FKH A;  2JZV A;  4JFL A;  4DRQ A;  1KT1 A;  4NNR A;  3PA7 A;  2ZQV A;  3KAC A;  1D7I A;  2ZR6 A;  1J4H A;  5HT1 A;  1JNS A;  4ODQ A;  1Q6H A;  2RUR A;  3UI6 A;  3TCZ A;  2XP4 A;  2DG4 A;  1FKD A;  1Y0O A;  3CGN A;  1YAT A;  2ZQU A;  2PV3 A;  4DRJ A;  5D75 A;  1BKF A;  5GPG A;  2PV1 A;  4LAX A;  4W9Q A;  2PPP A;  2FAP A;  4DRN A;  2F2D A;  3O5J A;  5B8I C;  4G2P A;  4DZ2 A;  4DZ3 A;  5HW7 A;  1YW5 A;  2PPO A;  2UZ5 A;  1ROT A;  2KI3 A;  2DG3 A;  3KAG A;  1D7H A;  3NI6 A;  3O5F A;  5I98 A;  1FKJ A;  4W9O A;  4QT3 A;  1T11 A;  1QPF A;  1FKK A;  4LAV A;  2MLZ A;  2F4E A;  5HW6 A;  1FJD A;  2KR7 A;  2KFW A;  1ROU A;  4ODK A;  2Y78 A;  3WH0 A;  2XPA A;  4DT4 A;  2OFN A;  2LJ4 A;  3ODK A;  1NSG A;  2IF4 A;  4FN2 A;  4IPX A;  4QT2 A;  1B6C A;  4IQC A;  1M5Y A;  3RFW A;  3UF8 A;  3UQI A;  4DRK A;  5HKG A;  2VCD A;  5J6E A;  2ZR5 A;  5DIT A;  4ODL A;  5HTG A;  4QIB A;  3VAW A;  1W26 A;  3B7X A;  1JVW A;  2F21 A;  3TDB A;  5HUA A;  4U84 A;  2D9F A;  3I6C A;  3O5O A;  1EQ3 A;  2KE0 A;  1TCO C;  2ZQT A;  4U85 A;  3MDY B;  1J6Y A;  1FKL A;  3JXV A;  4ODR A;  1HXV A;  2KGJ A;  1FD9 A;  4FAP A;  3TC5 A;  3UI4 A;  2MPH A;  4U86 A;  2PV2 A;  1QZ2 A;  4J4O A;  2RQS A;  5DIV A;  4DRM A;  1ZCN A;  4TW8 A;  4DRO A;  1PBK A;  3KCE A;  4BF8 A;  1FAP A;  2PPN A;  3RGC A;  3EY6 A;  1P5Q A;  3GPK A;  4G50 A;  2RSE A;  3KAD A;  4LAW A;  2DG9 A;  2KO7 A;  4ODP A;  3KZ7 A;  4TW7 A;  2K8I A;  1BL4 A;  4GIV A;  4JFM A;  5BXJ A;  2MNT A;  4JYS A;  1FKG A;  1NMW A;  4W9P A;  4DRI A;  1FKS A;  1C9H A;  2AWG A;  2LKN A;  3UQB A;  2XP7 A;  3JYM A;  4JFK A;  1JNT A;  1N1A A;  4LAY A;  4TX0 A;  1R9H A;  1D7J A;  3O5E A;  1A7X A;  1U79 A;  3IK8 A;  4MSP A;  2XP8 A;  1Q1C A;  3OOB A;  1Q6I A;  3IKD A;  1FKB A;  2L2S A;  5DIU A;  3PRD A;  3O5D A;  2RUC A;  2VN1 A; 
#chains in the Genus database with same CATH topology
 1XRV A;  4NZC A;  4J4N A;  3IKG A;  2PBC A;  4MGV A;  1FKF A;  3O5R A;  1L1P A;  2ETN A;  4WJX A;  4DH0 A;  1QPL A;  4NSB A;  2AOS A;  4N19 A;  1FKI A;  3KAI A;  3JYJ A;  1LL6 A;  2ZQS A;  1WNO A;  4TW6 A;  1F8A B;  1E44 A;  3ARY A;  1KT0 A;  1EYM A;  3IHZ A;  1FKT A;  1ITX A;  2M2A A;  2O9O A;  4O2T A;  1NH6 A;  3GU0 A;  2XP3 A;  3BMB A;  4JFL A;  4NNR A;  2WLY A;  2ZQV A;  3WKZ A;  1Q6H A;  2DG4 A;  4IT4 A;  2PV1 A;  2B5U B;  3RM9 A;  1UR8 A;  4LAX A;  4W9Q A;  2FAP A;  4KR0 B;  3O5J A;  4DZ2 A;  4AY1 A;  1NWS A;  1E6P A;  2QF8 A;  1HJX A;  1D7H A;  4DWS B;  4Z2L A;  4W9O A;  3CHE A;  4PTM A;  1T11 A;  3QOK A;  3RM8 A;  5HW6 A;  2MLZ A;  2F4E A;  2G41 A;  2KR7 A;  4DT4 A;  2XPA A;  3UF8 A;  4IPX A;  3RFW A;  1B6C A;  4IQC A;  5HKG A;  5DIT A;  2DSV A;  3FXY A;  4MNJ A;  1VF8 A;  3AS0 A;  5HUA A;  3O5O A;  1CTN A;  1IX5 A;  1TCO C;  2ZQT A;  3MDY B;  1J6Y A;  3B8S A;  3JXV A;  1HXV A;  3TC5 A;  2PV2 A;  3BXW A;  4R5E A;  4HAR A;  1O6I A;  4DRH A;  4TW7 A;  2KO7 A;  3KZ7 A;  1H0G A;  4GIV A;  5BXJ A;  4W9P A;  2DSW A;  3B9D A;  3RM4 A;  2LKN A;  1SR0 A;  1N1A A;  3FY1 A;  4P8U A;  1OWQ A;  4DWS A;  1A7X A;  1U79 A;  3CZ8 A;  3PRD A;  3AS1 A;  3O5M A;  4L3N A;  3O5I A;  2DSZ A;  1ZL1 A;  3LUO A;  2FKE A;  1NWT A;  1W9V A;  4WIW A;  2XP5 A;  3CGM A;  3UQA A;  5HWB A;  3CHD A;  1E6Z A;  2ZR4 A;  4ODM A;  4R0X A;  4ZPW R;  2M1I A;  2RUD A;  4XAK A;  3H9R B;  4DWS C;  1ZBC A;  5HWC A;  2A3E A;  1W1V A;  1D6O A;  3NTP A;  3WIJ A;  4L72 B;  1JND A;  3O5Q A;  2EUL A;  2XPB A;  2N87 A;  3GTY X;  3UI5 A;  4JFJ A;  1HJV A;  2DT2 A;  2IUZ A;  2DSU A;  4MNK A;  1KT1 A;  3PA7 A;  4Q22 A;  1J4H A;  1JNS A;  4ODQ A;  2RUR A;  3CHF A;  2XP4 A;  1FKD A;  1Y0O A;  3CGN A;  2ZQU A;  1LQ0 A;  4MNM A;  5D75 A;  5GPG A;  3ALF A;  2A3B A;  2PPP A;  2F2D A;  2P4V A;  4G2P A;  4DZ3 A;  1YW5 A;  2PPO A;  3ARZ A;  1ROT A;  2WM0 A;  5I98 A;  1FKJ A;  4MNL A;  4ZPT R;  4LAV A;  4QZV B;  3ARS A;  2OFN A;  3ALG A;  4DWS D;  1NSG A;  3W4R A;  1X6L A;  2VCD A;  2ZR5 A;  4WKA A;  4QIB A;  3ARV A;  1W26 A;  1JVW A;  2B31 A;  2D9F A;  1EDQ A;  4Z2J A;  1FD9 A;  4FAP A;  1OGG A;  4U86 A;  1NWR A;  5DIV A;  1W9P A;  2FDM A;  1W1P A;  3KCE A;  4BF8 A;  4URI A;  3GPK A;  1OGB A;  2RSE A;  3KAD A;  3EIP A;  4Q7N A;  1ZBV A;  1FKG A;  3UQB A;  2XP7 A;  3JYM A;  3PR9 A;  4JFK A;  1D7J A;  4HBE A;  1LL7 A;  3O5D A;  4ZS6 A;  3FAP A;  2MLY A;  2G8Z A;  4P8W A;  3B9E A;  1GOI A;  1WAW A;  4JFI A;  1EIB A;  4IQ2 A;  2LPV A;  4C02 B;  2WK2 A;  2Q5A A;  4GGQ A;  3WD1 A;  1ZK6 A;  2XP9 A;  2M08 A;  4S3J A;  1NMV A;  1PIN A;  1RD6 A;  2OLH A;  1XHG A;  3KAB A;  1Q6U A;  4DIP A;  2RUQ A;  2PI6 A;  2ITK A;  3ARP A;  5DF0 A;  3O5K A;  1F40 A;  2LGO A;  2A3A A;  1J4R A;  1FKH A;  5HBF A;  3CHC A;  1GUV A;  4WKH A;  3WD3 A;  3KAC A;  1W9U A;  2PV3 A;  1E15 A;  1BKF A;  3AQU A;  2O92 A;  4Z2H A;  1KFW A;  4DRN A;  3WD2 A;  5B8I C;  1W1T A;  1HKK A;  5HW7 A;  2UZ5 A;  1D2K A;  3G6M A;  2DG3 A;  3NI6 A;  2DT0 A;  1WB0 A;  4WKF A;  1FJD A;  2KFW A;  4MAV A;  4FN2 A;  2IF4 A;  4QT2 A;  3WD4 A;  1M5Y A;  4ODL A;  3VAW A;  3B7X A;  3TDB A;  3WL0 A;  4IT6 A;  3I6C A;  4LGX A;  1ZB5 A;  1E9L A;  1HKM A;  4W5U A;  3UI4 A;  2MPH A;  1LG1 A;  3OA5 A;  4DRM A;  1QZ2 A;  4J4O A;  2RQS A;  1ZCN A;  1HJW A;  4HBO A;  4DRO A;  1TFV A;  1FAP A;  3RGC A;  3EY6 A;  4ODP A;  4LAW A;  2DG9 A;  2K8I A;  4P8V A;  2YBU A;  4Z2I A;  4JYS A;  3WQV A;  1K9T A;  1NMW A;  4DRI A;  1C9H A;  2AWG A;  1JNT A;  4LAY A;  1GPF A;  1R9H A;  3AS2 A;  1Q1C A;  3OOB A;  2DPE A;  5DIU A;  1FKB A;  1JCH B;  1FFR A;  4QT3 A;  1UR9 A;  2VN1 A;  1FKR A;  4ODN A;  3O5L A;  3G6L A;  5DO2 A;  2XP6 A;  1W1Y A;  3ARW A;  1ZBW A;  4DRP A;  1H0I A;  4S3K A;  4MTV A;  2ESC A;  3ARQ A;  5HW8 A;  5GQB A;  3WQW A;  3KAF A;  3KAH A;  1JNE A;  4ITZ A;  1LL4 A;  1J4I A;  3NRK A;  1ZBK A;  2MLX A;  3O5G A;  1E6R A;  4ODR A;  3PRB A;  1HKJ A;  4P8X A;  3ARU A;  4ODO A;  1NWU A;  4TYO A;  3O5P A;  3ARO A;  4TNS A;  2MF9 A;  2JZV A;  1E6N A;  4DRQ A;  1D7I A;  2ZR6 A;  5HT1 A;  3UI6 A;  2YBT A;  3TCZ A;  1FFQ A;  1YAT A;  4DRJ A;  2DT1 A;  1ZU8 A;  1LG2 A;  1HKI A;  4ML4 A;  2KI3 A;  3KAG A;  4ZPV R;  3O5F A;  4Z2K A;  3RME A;  1QPF A;  1FKK A;  1ROU A;  4ODK A;  2Y78 A;  3WH0 A;  2LJ4 A;  3ODK A;  2PN0 A;  2WLZ A;  3UQI A;  3AS3 A;  4DRK A;  5J6E A;  4WK9 A;  3CH9 A;  3ARX A;  5HTG A;  4KQZ A;  3ART A;  3WL1 A;  2F21 A;  4U84 A;  1SYT A;  3ARR A;  1EQ3 A;  2KE0 A;  4U85 A;  3WD0 A;  1FKL A;  2KGJ A;  5JH8 A;  5DEZ A;  2DT3 A;  4TW8 A;  1PBK A;  3B9A A;  2PPN A;  1P5Q A;  4G50 A;  4UDM A;  5GPR A;  1X6N A;  1BL4 A;  3PRA A;  4JFM A;  2MNT A;  4Z2G A;  1FKS A;  4MPK A;  4TX0 A;  2A3C A;  3O5E A;  1EHN A;  1GRJ A;  1LJY A;  3IK8 A;  4MSP A;  2XP8 A;  1Q6I A;  2F23 A;  3IKD A;  2L2S A;  2RUC A; 
#chains in the Genus database with same CATH homology
 1XRV A;  4NZC A;  4J4N A;  3IKG A;  2PBC A;  4MGV A;  1FKF A;  3O5R A;  1L1P A;  4WJX A;  4DH0 A;  1QPL A;  4NSB A;  2AOS A;  4N19 A;  1FKI A;  3KAI A;  3JYJ A;  1LL6 A;  2ZQS A;  1WNO A;  4TW6 A;  1F8A B;  3ARY A;  1KT0 A;  1EYM A;  3IHZ A;  1FKT A;  1ITX A;  2M2A A;  2O9O A;  4O2T A;  1NH6 A;  2XP3 A;  4JFL A;  4NNR A;  2WLY A;  2ZQV A;  3WKZ A;  1Q6H A;  2DG4 A;  4IT4 A;  2PV1 A;  3RM9 A;  1UR8 A;  4LAX A;  4W9Q A;  2FAP A;  4KR0 B;  3O5J A;  4DZ2 A;  4AY1 A;  1NWS A;  1E6P A;  2QF8 A;  1HJX A;  1D7H A;  4DWS B;  4Z2L A;  4W9O A;  3CHE A;  4PTM A;  1T11 A;  3QOK A;  3RM8 A;  5HW6 A;  2MLZ A;  2F4E A;  2G41 A;  2KR7 A;  4DT4 A;  2XPA A;  3UF8 A;  4IPX A;  3RFW A;  1B6C A;  4IQC A;  5HKG A;  5DIT A;  2DSV A;  3FXY A;  4MNJ A;  1VF8 A;  3AS0 A;  5HUA A;  3O5O A;  1CTN A;  1IX5 A;  1TCO C;  2ZQT A;  3MDY B;  1J6Y A;  3B8S A;  3JXV A;  1HXV A;  3TC5 A;  2PV2 A;  3BXW A;  4R5E A;  4HAR A;  1O6I A;  4DRH A;  4TW7 A;  2KO7 A;  3KZ7 A;  1H0G A;  4GIV A;  5BXJ A;  4W9P A;  2DSW A;  3B9D A;  3RM4 A;  2LKN A;  1SR0 A;  1N1A A;  3FY1 A;  4P8U A;  1OWQ A;  4DWS A;  1A7X A;  1U79 A;  3CZ8 A;  3PRD A;  3AS1 A;  3O5M A;  4L3N A;  3O5I A;  2DSZ A;  1ZL1 A;  3LUO A;  2FKE A;  1NWT A;  1W9V A;  4WIW A;  2XP5 A;  3CGM A;  3UQA A;  5HWB A;  3CHD A;  1E6Z A;  2ZR4 A;  4ODM A;  4R0X A;  4ZPW R;  2M1I A;  2RUD A;  4XAK A;  3H9R B;  4DWS C;  1ZBC A;  5HWC A;  2A3E A;  1W1V A;  1D6O A;  3NTP A;  3WIJ A;  4L72 B;  1JND A;  3O5Q A;  2XPB A;  2N87 A;  3UI5 A;  4JFJ A;  1HJV A;  2DT2 A;  2IUZ A;  2DSU A;  4MNK A;  1KT1 A;  3PA7 A;  4Q22 A;  1J4H A;  1JNS A;  4ODQ A;  2RUR A;  3CHF A;  2XP4 A;  1FKD A;  1Y0O A;  3CGN A;  2ZQU A;  1LQ0 A;  4MNM A;  5D75 A;  5GPG A;  3ALF A;  2A3B A;  2PPP A;  2F2D A;  4G2P A;  4DZ3 A;  1YW5 A;  2PPO A;  3ARZ A;  1ROT A;  2WM0 A;  5I98 A;  1FKJ A;  4MNL A;  4ZPT R;  4LAV A;  4QZV B;  3ARS A;  2OFN A;  3ALG A;  4DWS D;  1NSG A;  3W4R A;  1X6L A;  2VCD A;  2ZR5 A;  4WKA A;  4QIB A;  3ARV A;  1W26 A;  1JVW A;  2B31 A;  2D9F A;  1EDQ A;  4Z2J A;  1FD9 A;  4FAP A;  1OGG A;  4U86 A;  1NWR A;  5DIV A;  1W9P A;  2FDM A;  1W1P A;  3KCE A;  4BF8 A;  4URI A;  3GPK A;  1OGB A;  2RSE A;  3KAD A;  4Q7N A;  1ZBV A;  1FKG A;  3UQB A;  2XP7 A;  3JYM A;  3PR9 A;  4JFK A;  1D7J A;  4HBE A;  1LL7 A;  3O5D A;  4ZS6 A;  3FAP A;  2MLY A;  2G8Z A;  4P8W A;  3B9E A;  1GOI A;  1WAW A;  4JFI A;  1EIB A;  4IQ2 A;  2LPV A;  4C02 B;  2WK2 A;  2Q5A A;  4GGQ A;  3WD1 A;  1ZK6 A;  2XP9 A;  2M08 A;  4S3J A;  1NMV A;  1PIN A;  1RD6 A;  2OLH A;  1XHG A;  3KAB A;  1Q6U A;  4DIP A;  2RUQ A;  2PI6 A;  2ITK A;  3ARP A;  5DF0 A;  3O5K A;  1F40 A;  2LGO A;  2A3A A;  1J4R A;  1FKH A;  5HBF A;  3CHC A;  1GUV A;  4WKH A;  3WD3 A;  3KAC A;  1W9U A;  2PV3 A;  1E15 A;  1BKF A;  3AQU A;  2O92 A;  4Z2H A;  1KFW A;  4DRN A;  3WD2 A;  5B8I C;  1W1T A;  1HKK A;  5HW7 A;  2UZ5 A;  1D2K A;  3G6M A;  2DG3 A;  3NI6 A;  2DT0 A;  1WB0 A;  4WKF A;  1FJD A;  2KFW A;  4MAV A;  4FN2 A;  2IF4 A;  4QT2 A;  3WD4 A;  1M5Y A;  4ODL A;  3VAW A;  3B7X A;  3TDB A;  3WL0 A;  4IT6 A;  3I6C A;  4LGX A;  1ZB5 A;  1E9L A;  1HKM A;  4W5U A;  3UI4 A;  2MPH A;  1LG1 A;  3OA5 A;  4DRM A;  1QZ2 A;  4J4O A;  2RQS A;  1ZCN A;  1HJW A;  4HBO A;  4DRO A;  1TFV A;  1FAP A;  3RGC A;  3EY6 A;  4ODP A;  4LAW A;  2DG9 A;  2K8I A;  4P8V A;  2YBU A;  4Z2I A;  4JYS A;  3WQV A;  1K9T A;  1NMW A;  4DRI A;  1C9H A;  2AWG A;  1JNT A;  4LAY A;  1GPF A;  1R9H A;  3AS2 A;  1Q1C A;  3OOB A;  2DPE A;  5DIU A;  1FKB A;  1FFR A;  4QT3 A;  1UR9 A;  2VN1 A;  1FKR A;  4ODN A;  3O5L A;  3G6L A;  5DO2 A;  2XP6 A;  1W1Y A;  3ARW A;  1ZBW A;  4DRP A;  1H0I A;  4S3K A;  4MTV A;  2ESC A;  3ARQ A;  5HW8 A;  5GQB A;  3WQW A;  3KAF A;  3KAH A;  1JNE A;  4ITZ A;  1LL4 A;  1J4I A;  3NRK A;  1ZBK A;  2MLX A;  3O5G A;  1E6R A;  4ODR A;  3PRB A;  1HKJ A;  4P8X A;  3ARU A;  4ODO A;  1NWU A;  4TYO A;  3O5P A;  3ARO A;  4TNS A;  2MF9 A;  2JZV A;  1E6N A;  4DRQ A;  1D7I A;  2ZR6 A;  5HT1 A;  3UI6 A;  2YBT A;  3TCZ A;  1FFQ A;  1YAT A;  4DRJ A;  2DT1 A;  1ZU8 A;  1HKI A;  1LG2 A;  4ML4 A;  2KI3 A;  3KAG A;  4ZPV R;  3O5F A;  4Z2K A;  3RME A;  1QPF A;  1FKK A;  1ROU A;  4ODK A;  2Y78 A;  3WH0 A;  2LJ4 A;  3ODK A;  2WLZ A;  3UQI A;  3AS3 A;  4DRK A;  5J6E A;  4WK9 A;  3CH9 A;  3ARX A;  5HTG A;  4KQZ A;  3ART A;  3WL1 A;  2F21 A;  4U84 A;  1SYT A;  3ARR A;  1EQ3 A;  2KE0 A;  4U85 A;  3WD0 A;  1FKL A;  2KGJ A;  5JH8 A;  5DEZ A;  2DT3 A;  4TW8 A;  1PBK A;  3B9A A;  2PPN A;  1P5Q A;  4G50 A;  5GPR A;  1X6N A;  1BL4 A;  3PRA A;  4JFM A;  2MNT A;  4Z2G A;  1FKS A;  4MPK A;  4TX0 A;  2A3C A;  3O5E A;  1EHN A;  1LJY A;  3IK8 A;  4MSP A;  2XP8 A;  1Q6I A;  3IKD A;  2L2S A;  2RUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...