5B8IC

Crystal structure of calcineurin a and calcineurin b in complex with fkbp12 and fk506 from coccidioides immitis rs
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
GVTKKILKEGNGVDKPVKGDDIVMNYRGCLYDSSKPSEHFMGRKFDSTEERGEFKTKIGIGVVIRGWDEAVLQMSLGEKSILTITDDYAYGARGFPGLIPPHATLVFEVELKGINSKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase
publication title Crystal structure of Calcineurin A and Calcineurin B in complex with FKBP12 and FK506 from Coccidioides immitis RS
rcsb
source organism Coccidioides immitis (strain rs)
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5b8iC00
3RFWA 5HWBA 4J4OA 4O2TA 3UQBA 1F40A 4IQCA 2MNTA 4R0XA 2N87A 3PRBA 1FKBA 2IF4A 4ODNA 3O5MA 1ZK6A 2JZVA 2PPNA 2VN1A 3NTPA 2PV1A 4TX0A 2KR7A 4DRIA 2LGOA 1FD9A 3KAHA 4NNRA 2PV2A 4ODPA 1D7JA 4W9QA 2MLYA 4TYOA 4U86A 3FAPA 4IPXA 5HW8A 2PBCA 1HXVA 2KI3A 4DRPA 4QT3A 4JFMA 1J6YA 1EQ3A 5HW6A 1PBKA 2KGJA 1PINA 5J6EA 1FKLA 5HKGA 1ROTA 4J4NA 4FAPA 3JXVA 1NSGA 2ZQSA 1B6CA 4DIPA 3UQAA 4G50A 1KT0A 3EY6A 1FKDA 3I6CA 2DG4A 2XP7A 3IK8A 3KACA 2D9FA 3MDYB 2RQSA 1F8AB 2ZR4A 1Y0OA 1BL4A 2F2DA 2ZQVA 2MPHA 3OOBA 4ODRA 3LUOA 3KCEA 3NI6A 1QZ2A 3GPKA 1D7HA 2M1IA 1R9HA 5D75A 2FAPA 3WH0A 2XP6A 5B8IC 2M2AA 1EYMA 1Q6HA 3RGCA 1N1AA 1J4IA 4MGVA 4IQ2A 2KO7A 4GIVA 4ODLA 5HWCA 2RUDA 5HTGA 4TW8A 4LAWA 4TW6A 2UZ5A 3KAGA 2ZR5A 1YATA 4JFIA 1FKHA 4DZ3A 1U79A 2VCDA 5HUAA 2DG3A 1ZCNA 4JFJA 4N19A 3PRDA 3O5RA 2XP5A 1D6OA 1FKGA 4GGQA 3O5FA 3TC5A 1D7IA 2ZQTA 4DRKA 3TDBA 5GPGA 1J4HA 3H9RB 4DRNA 2XP4A 3UF8A 5DIVA 2KFWA 1NMWA 3UI6A 2L2SA 4U84A 3UI5A 1FKKA 1ROUA 2M08A 2PV3A 1JVWA 1BKFA 2MLZA 3IKDA 1Q1CA 3O5EA 3PA7A 2LPVA 2XP9A 2ZQUA 2MF9A 4W9OA 3O5IA 3O5OA 3O5JA 5HT1A 4DROA 4DT4A 2Q5AA 2ITKA 2RSEA 4DH0A 2RUCA 3O5PA 1P5QA 3KABA 3O5QA 1QPFA 1FJDA 3JYMA 1L1PA 4FN2A 5I98A 2PPOA 4QT2A 1JNSA 3KAIA 4LAXA 3CGNA 4G2PA 4JYSA 2Y78A 3TCZA 2KE0A 1KT1A 1FAPA 2MLXA 4ODOA 4ODMA 4W9PA 1FKSA 1YW5A 3IKGA 2AWGA 4DRQA 3ODKA 4JFLA 1NMVA 3JYJA 2XP8A 1TCOC 4QIBA 3UQIA 4DRJA 1FKTA 5BXJA 4DRHA 4TNSA 2RURA 1T11A 3KAFA 3O5GA 4ODQA 4LAYA 3KZ7A 4C02B 3UI4A 5HW7A 4ODKA 5DIUA 1JNTA 4LAVA 2RUQA 1J4RA 4DZ2A 5DITA 1FKFA 1FKIA 3O5KA 2FKEA 2F21A 1Q6UA 4U85A 1W26A 2K8IA 1A7XA 3B7XA 3O5DA 1Q6IA 2ZR6A 2LKNA 2XP3A 3CGMA 4ITZA 3NRKA 3VAWA 4JFKA 2OFNA 2XPAA 1QPLA 2F4EA 3KADA 1M5YA 1FKJA 2DG9A 2LJ4A 2PPPA 4DRMA 3O5LA 2XPBA 4TW7A 1C9HA 4MSPA 3IHZA 1FKRA 4BF8A
chains in the Genus database with same CATH superfamily
4P8XA 3O5MA 1W1VA 1ZK6A 3NTPA 2PV1A 3QOKA 1FD9A 2PV2A 1D7JA 3B9DA 2B31A 4TYOA 1GOIA 1TFVA 4IPXA 1HXVA 4DWSC 2KI3A 4DRPA 4QT3A 4JFMA 4AY1A 4URIA 1PBKA 4Q7NA 2KGJA 5DO2A 4FAPA 3JXVA 1NSGA 2ZQSA 4DIPA 3OA5A 2OLHA 3ALFA 1OWQA 3OOBA 3LUOA 1QZ2A 3GPKA 4DWSD 1R9HA 1D2KA 3WH0A 5B8IC 3WKZA 3CHFA 3RMEA 4MGVA 2KO7A 4TW8A 4LAWA 2A3AA 3KAGA 1FKHA 2DG3A 1GUVA 1ZCNA 3AS2A 3O5RA 3PRDA 4WK9A 4ZPWR 3ARSA 3WD4A 1D7IA 1NWSA 3TDBA 1J4HA 5GPRA 3WD2A 1E6NA 3UI6A 3O5EA 1JVWA 4ITZA 3B8SA 3PA7A 2LPVA 3O5IA 3O5OA 3O5JA 4WKAA 3GU0A 2Q5AA 1E6PA 3KABA 1X6NA 2O9OA 1L1PA 4QT2A 3G6LA 1JNEA 4G2PA 1FAPA 1GRJA 4ODOA 4W9PA 4Z2HA 1HKKA 1KFWA 1NMVA 3GTYX 3JYJA 2XP8A 1TCOC 4ODQA 4C02B 1WNOA 1W9PA 1FKIA 4DWSB 2FKEA 4MNJA 1A7XA 2DPEA 2LKNA 2XP3A 3ARXA 3NRKA 3PR9A 3WQWA 3O5LA 4TW7A 1C9HA 4MSPA 1UR8A 1FKRA 5HWBA 4NSBA 2MNTA 4R0XA 3PRBA 1FKBA 2IF4A 4ODNA 1EIBA 2PI6A 4W5UA 2WM0A 4DRIA 2LGOA 2DSUA 3KAHA 4W9QA 2MLYA 3G6MA 2WLZA 5HW6A 4WKHA 1PINA 1FKLA 3EY6A 1F8AB 2ZQVA 1H0IA 3KCEA 1E6RA 2EULA 1EYMA 1Q6HA 4Z2IA 3RGCA 3CHDA 5GQBA 4IQ2A 2DT2A 4WKFA 4ODLA 5HWCA 5HTGA 2UZ5A 4KQZA 4DZ3A 1UR9A 1U79A 5HUAA 4JFJA 1NWUA 4N19A 4GGQA 1E6ZA 1NWRA 3ARYA 3WL1A 4MNLA 4DRNA 4HARA 4U84A 2DT3A 3UI5A 1HKJA 2M08A 2DSVA 2XP9A 2MF9A 1ZB5A 1ZBCA 4DH0A 3FXYA 1P5QA 5I98A 2PPOA 1W1PA 1JNSA 4S3KA 4JYSA 2Y78A 1KT1A 2MLXA 1FFQA 4QZVB 1FKSA 1YW5A 4DRQA 1WAWA 4Q22A 4JFLA 4QIBA 5BXJA 1LQ0A 4DRHA 1FFRA 3UI4A 5HW7A 4ODKA 3B9AA 5DIUA 4LAVA 3ARZA 4DWSA 2RUQA 4IT6A 1FKFA 3WD1A 2F21A 3B7XA 1Q6IA 3BMBA 3AS0A 1M5YA 2PPPA 2XPBA 3WQVA 1OGBA 3UQBA 1F40A 4IQCA 3PRAA 2N87A 4L72B 3CHCA 2DT0A 2JZVA 2VN1A 1H0GA 3RM4A 2KR7A 3AROA 1EHNA 4ODPA 1NH6A 1ZL1A 5HBFA 2DT1A 2YBTA 3ARWA 3ALGA 1LL4A 5J6EA 5HKGA 1ROTA 2WLYA 4J4NA 3ARQA 4HBOA 3UQAA 4G50A 1W9UA 4MNKA 1FKDA 2A3BA 2FDMA 2XP7A 3KACA 2RQSA 4WJXA 1HJXA 2DSWA 1Y0OA 3WL0A 4ODRA 2MPHA 3NI6A 2M1IA 5D75A 2FAPA 2XP6A 5DF0A 3RM8A 2DSZA 1J4IA 1OGGA 4GIVA 3CHEA 2RUDA 4TW6A 1E9LA 1LG2A 4UDMA 2AOSA 1W1YA 2ZR5A 1YATA 3ARPA 3WD3A 4LGXA 1D6OA 1FKGA 3O5FA 2ZQTA 1W1TA 5GPGA 3H9RB 2XP4A 3ARVA 4Z2KA 1NMWA 2QF8A 1WB0A 2WK2A 4ZPVR 1FKKA 1ROUA 3IKDA 2PV3A 4W9OA 1Q1CA 2ESCA 1ZU8A 4DT4A 1CTNA 1HJWA 2ITKA 2A3EA 2RSEA 2RUCA 1FJDA 3JYMA 2PN0A 3KAIA 3CGNA 4PTMA 4KR0B 2KE0A 1JCHB 2G41A 4ODMA 3IKGA 3ODKA 4MTVA 3UQIA 1FKTA 1LG1A 1EDQA 4TNSA 2RURA 1T11A 3KAFA 3O5GA 1ZBWA 1K9TA 1SR0A 1RD6A 4ZPTR 4Z2LA 1Q6UA 1ITXA 1E15A 2K8IA 4WIWA 3O5DA 2ZR6A 3CGMA 5JH8A 3VAWA 3KADA 1QPLA 2DG9A 3IHZA 3RFWA 4J4OA 4O2TA 4MAVA 1HKIA 3ARRA 2PPNA 4TX0A 5DEZA 4ML4A 4NNRA 2B5UB 4U86A 3FAPA 3RM9A 5HW8A 2PBCA 1J6YA 1XRVA 3WD0A 1EQ3A 1LJYA 1JNDA 1B6CA 4L3NA 4ZS6A 1KT0A 3AS3A 3I6CA 2DG4A 3IK8A 2D9FA 3MDYB 4MPKA 1ZBVA 2F23A 2ZR4A 1BL4A 2F2DA 1HKMA 1E44A 1VF8A 2ETNA 3AQUA 1LL7A 3FY1A 1D7HA 2M2AA 1N1AA 2P4VA 3ARUA 4IT4A 4JFIA 3W4RA 2VCDA 4S3JA 2G8ZA 4DRJA 2XP5A 4XAKA 3EIPA 3TC5A 1LL6A 4P8VA 4Z2JA 1GPFA 3UF8A 5DIVA 2KFWA 4P8WA 2L2SA 3CH9A 3BXWA 4MNMA 4DRKA 1BKFA 2MLZA 2ZQUA 5HT1A 4DROA 1IX5A 3O5PA 4NZCA 3WIJA 3B9EA 3O5QA 1QPFA 1X6LA 2YBUA 1O6IA 1ZBKA 4FN2A 1W9VA 4LAXA 4R5EA 3ARTA 4HBEA 3TCZA 2A3CA 2AWGA 1NWTA 2O92A 3CZ8A 1SYTA 1XHGA 4LAYA 3KZ7A 3AS1A 1JNTA 1J4RA 4DZ2A 5DITA 3O5KA 4U85A 1W26A 4Z2GA 1HJVA 4JFKA 2OFNA 2XPAA 4DRMA 2F4EA 2IUZA 2LJ4A 1FKJA 4P8UA 4BF8A
chains in the Genus database with same CATH topology
4P8XA 3O5MA 1W1VA 1ZK6A 3NTPA 2PV1A 3QOKA 1FD9A 2PV2A 1D7JA 3B9DA 2B31A 4TYOA 1GOIA 1TFVA 4IPXA 1HXVA 4DWSC 2KI3A 4DRPA 4QT3A 4JFMA 4AY1A 4URIA 1PBKA 4Q7NA 2KGJA 5DO2A 4FAPA 3JXVA 1NSGA 2ZQSA 4DIPA 3OA5A 2OLHA 3ALFA 1OWQA 3OOBA 3LUOA 1QZ2A 3GPKA 4DWSD 1R9HA 1D2KA 3WH0A 5B8IC 3WKZA 3CHFA 3RMEA 4MGVA 2KO7A 4TW8A 4LAWA 2A3AA 3KAGA 1FKHA 2DG3A 1GUVA 1ZCNA 3AS2A 3O5RA 3PRDA 4WK9A 4ZPWR 3ARSA 3WD4A 1D7IA 1NWSA 3TDBA 1J4HA 5GPRA 3WD2A 1E6NA 3UI6A 3O5EA 1JVWA 4ITZA 3B8SA 3PA7A 2LPVA 3O5IA 3O5OA 3O5JA 4WKAA 2Q5AA 1E6PA 3KABA 1X6NA 2O9OA 1L1PA 4QT2A 3G6LA 1JNEA 4G2PA 1FAPA 4ODOA 4W9PA 4Z2HA 1HKKA 1KFWA 1NMVA 3JYJA 2XP8A 1TCOC 4ODQA 4C02B 1WNOA 1W9PA 1FKIA 4DWSB 2FKEA 4MNJA 1A7XA 2DPEA 2LKNA 2XP3A 3ARXA 3NRKA 3PR9A 3WQWA 3O5LA 4TW7A 1C9HA 4MSPA 1UR8A 1FKRA 5HWBA 4NSBA 2MNTA 4R0XA 3PRBA 1FKBA 2IF4A 4ODNA 1EIBA 2PI6A 4W5UA 2WM0A 4DRIA 2LGOA 2DSUA 3KAHA 4W9QA 2MLYA 3G6MA 2WLZA 5HW6A 4WKHA 1PINA 1FKLA 3EY6A 1F8AB 2ZQVA 1H0IA 3KCEA 1E6RA 1EYMA 1Q6HA 4Z2IA 3RGCA 3CHDA 5GQBA 4IQ2A 2DT2A 4WKFA 4ODLA 5HWCA 5HTGA 2UZ5A 4KQZA 4DZ3A 1UR9A 1U79A 5HUAA 4JFJA 1NWUA 4N19A 4GGQA 1E6ZA 1NWRA 3ARYA 3WL1A 4MNLA 4DRNA 4HARA 4U84A 2DT3A 3UI5A 1HKJA 2M08A 2DSVA 2XP9A 2MF9A 1ZB5A 1ZBCA 4DH0A 3FXYA 1P5QA 5I98A 2PPOA 1W1PA 1JNSA 4S3KA 4JYSA 2Y78A 1KT1A 2MLXA 1FFQA 4QZVB 1FKSA 1YW5A 4DRQA 1WAWA 4Q22A 4JFLA 4QIBA 5BXJA 1LQ0A 4DRHA 1FFRA 3UI4A 5HW7A 4ODKA 3B9AA 5DIUA 4LAVA 3ARZA 4DWSA 2RUQA 4IT6A 1FKFA 3WD1A 2F21A 3B7XA 1Q6IA 3AS0A 1M5YA 2PPPA 2XPBA 3WQVA 1OGBA 3UQBA 1F40A 4IQCA 3PRAA 2N87A 4L72B 3CHCA 2DT0A 2JZVA 2VN1A 1H0GA 3RM4A 2KR7A 3AROA 1EHNA 4ODPA 1NH6A 1ZL1A 5HBFA 2DT1A 2YBTA 3ARWA 3ALGA 1LL4A 5J6EA 5HKGA 1ROTA 2WLYA 4J4NA 3ARQA 4HBOA 3UQAA 4G50A 1W9UA 4MNKA 1FKDA 2A3BA 2FDMA 2XP7A 3KACA 2RQSA 4WJXA 1HJXA 2DSWA 1Y0OA 3WL0A 4ODRA 2MPHA 3NI6A 2M1IA 5D75A 2FAPA 2XP6A 5DF0A 3RM8A 2DSZA 1J4IA 1OGGA 4GIVA 3CHEA 2RUDA 4TW6A 1E9LA 1LG2A 2AOSA 1W1YA 2ZR5A 1YATA 3ARPA 3WD3A 4LGXA 1D6OA 1FKGA 3O5FA 2ZQTA 1W1TA 5GPGA 3H9RB 2XP4A 3ARVA 4Z2KA 1NMWA 2QF8A 1WB0A 2WK2A 4ZPVR 1FKKA 1ROUA 3IKDA 2PV3A 4W9OA 1Q1CA 2ESCA 1ZU8A 4DT4A 1CTNA 1HJWA 2ITKA 2A3EA 2RSEA 2RUCA 1FJDA 3JYMA 3KAIA 3CGNA 4PTMA 4KR0B 2KE0A 2G41A 4ODMA 3IKGA 3ODKA 4MTVA 3UQIA 1FKTA 1LG1A 1EDQA 4TNSA 2RURA 1T11A 3KAFA 3O5GA 1ZBWA 1K9TA 1SR0A 1RD6A 4ZPTR 4Z2LA 1Q6UA 1ITXA 1E15A 2K8IA 4WIWA 3O5DA 2ZR6A 3CGMA 5JH8A 3VAWA 3KADA 1QPLA 2DG9A 3IHZA 3RFWA 4J4OA 4O2TA 4MAVA 1HKIA 3ARRA 2PPNA 4TX0A 5DEZA 4ML4A 4NNRA 4U86A 3FAPA 3RM9A 5HW8A 2PBCA 1J6YA 1XRVA 3WD0A 1EQ3A 1LJYA 1JNDA 1B6CA 4L3NA 4ZS6A 1KT0A 3AS3A 3I6CA 2DG4A 3IK8A 2D9FA 3MDYB 4MPKA 1ZBVA 2ZR4A 1BL4A 2F2DA 1HKMA 1VF8A 3AQUA 1LL7A 3FY1A 1D7HA 2M2AA 1N1AA 3ARUA 4IT4A 4JFIA 3W4RA 2VCDA 4S3JA 2G8ZA 4DRJA 2XP5A 4XAKA 3TC5A 1LL6A 4P8VA 4Z2JA 1GPFA 3UF8A 5DIVA 2KFWA 4P8WA 2L2SA 3CH9A 3BXWA 4MNMA 4DRKA 1BKFA 2MLZA 2ZQUA 5HT1A 4DROA 1IX5A 3O5PA 4NZCA 3WIJA 3B9EA 3O5QA 1QPFA 1X6LA 2YBUA 1O6IA 1ZBKA 4FN2A 1W9VA 4LAXA 4R5EA 3ARTA 4HBEA 3TCZA 2A3CA 2AWGA 1NWTA 2O92A 3CZ8A 1SYTA 1XHGA 4LAYA 3KZ7A 3AS1A 1JNTA 1J4RA 4DZ2A 5DITA 3O5KA 4U85A 1W26A 4Z2GA 1HJVA 4JFKA 2OFNA 2XPAA 4DRMA 2F4EA 2IUZA 2LJ4A 1FKJA 4P8UA 4BF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RFW A;  5HWB A;  4J4O A;  4O2T A;  3UQB A;  1F40 A;  4IQC A;  2MNT A;  4R0X A;  2N87 A;  3PRB A;  1FKB A;  2IF4 A;  4ODN A;  3O5M A;  1ZK6 A;  2JZV A;  2PPN A;  2VN1 A;  3NTP A;  2PV1 A;  4TX0 A;  2KR7 A;  4DRI A;  2LGO A;  1FD9 A;  3KAH A;  4NNR A;  2PV2 A;  4ODP A;  1D7J A;  4W9Q A;  2MLY A;  4TYO A;  4U86 A;  3FAP A;  4IPX A;  5HW8 A;  2PBC A;  1HXV A;  2KI3 A;  4DRP A;  4QT3 A;  4JFM A;  1J6Y A;  1EQ3 A;  5HW6 A;  1PBK A;  2KGJ A;  1PIN A;  5J6E A;  1FKL A;  5HKG A;  1ROT A;  4J4N A;  4FAP A;  3JXV A;  1NSG A;  2ZQS A;  1B6C A;  4DIP A;  3UQA A;  4G50 A;  1KT0 A;  3EY6 A;  1FKD A;  3I6C A;  2DG4 A;  2XP7 A;  3IK8 A;  3KAC A;  2D9F A;  3MDY B;  2RQS A;  1F8A B;  2ZR4 A;  1Y0O A;  1BL4 A;  2F2D A;  2ZQV A;  2MPH A;  3OOB A;  4ODR A;  3LUO A;  3KCE A;  3NI6 A;  1QZ2 A;  3GPK A;  1D7H A;  2M1I A;  1R9H A;  5D75 A;  2FAP A;  3WH0 A;  2XP6 A;  5B8I C;  2M2A A;  1EYM A;  1Q6H A;  3RGC A;  1N1A A;  1J4I A;  4MGV A;  4IQ2 A;  2KO7 A;  4GIV A;  4ODL A;  5HWC A;  2RUD A;  5HTG A;  4TW8 A;  4LAW A;  4TW6 A;  2UZ5 A;  3KAG A;  2ZR5 A;  1YAT A;  4JFI A;  1FKH A;  4DZ3 A;  1U79 A;  2VCD A;  5HUA A;  2DG3 A;  1ZCN A;  4JFJ A;  4N19 A;  3PRD A;  3O5R A;  2XP5 A;  1D6O A;  1FKG A;  4GGQ A;  3O5F A;  3TC5 A;  1D7I A;  2ZQT A;  4DRK A;  3TDB A;  5GPG A;  1J4H A;  3H9R B;  4DRN A;  2XP4 A;  3UF8 A;  5DIV A;  2KFW A;  1NMW A;  3UI6 A;  2L2S A;  4U84 A;  3UI5 A;  1FKK A;  1ROU A;  2M08 A;  2PV3 A;  1JVW A;  1BKF A;  2MLZ A;  3IKD A;  1Q1C A;  3O5E A;  3PA7 A;  2LPV A;  2XP9 A;  2ZQU A;  2MF9 A;  4W9O A;  3O5I A;  3O5O A;  3O5J A;  5HT1 A;  4DRO A;  4DT4 A;  2Q5A A;  2ITK A;  2RSE A;  4DH0 A;  2RUC A;  3O5P A;  1P5Q A;  3KAB A;  3O5Q A;  1QPF A;  1FJD A;  3JYM A;  1L1P A;  4FN2 A;  5I98 A;  2PPO A;  4QT2 A;  1JNS A;  3KAI A;  4LAX A;  3CGN A;  4G2P A;  4JYS A;  2Y78 A;  3TCZ A;  2KE0 A;  1KT1 A;  1FAP A;  2MLX A;  4ODO A;  4ODM A;  4W9P A;  1FKS A;  1YW5 A;  3IKG A;  2AWG A;  4DRQ A;  3ODK A;  4JFL A;  1NMV A;  3JYJ A;  2XP8 A;  1TCO C;  4QIB A;  3UQI A;  4DRJ A;  1FKT A;  5BXJ A;  4DRH A;  4TNS A;  2RUR A;  1T11 A;  3KAF A;  3O5G A;  4ODQ A;  4LAY A;  3KZ7 A;  4C02 B;  3UI4 A;  5HW7 A;  4ODK A;  5DIU A;  1JNT A;  4LAV A;  2RUQ A;  1J4R A;  4DZ2 A;  5DIT A;  1FKF A;  1FKI A;  3O5K A;  2FKE A;  2F21 A;  1Q6U A;  4U85 A;  1W26 A;  2K8I A;  1A7X A;  3B7X A;  3O5D A;  1Q6I A;  2ZR6 A;  2LKN A;  2XP3 A;  3CGM A;  4ITZ A;  3NRK A;  3VAW A;  4JFK A;  2OFN A;  2XPA A;  1QPL A;  2F4E A;  3KAD A;  1M5Y A;  1FKJ A;  2DG9 A;  2LJ4 A;  2PPP A;  4DRM A;  3O5L A;  2XPB A;  4TW7 A;  1C9H A;  4MSP A;  3IHZ A;  1FKR A;  4BF8 A; 
#chains in the Genus database with same CATH topology
 4P8X A;  3O5M A;  1W1V A;  1ZK6 A;  3NTP A;  2PV1 A;  3QOK A;  1FD9 A;  2PV2 A;  1D7J A;  3B9D A;  2B31 A;  4TYO A;  1GOI A;  1TFV A;  4IPX A;  1HXV A;  4DWS C;  2KI3 A;  4DRP A;  4QT3 A;  4JFM A;  4AY1 A;  4URI A;  1PBK A;  4Q7N A;  2KGJ A;  5DO2 A;  4FAP A;  3JXV A;  1NSG A;  2ZQS A;  4DIP A;  3OA5 A;  2OLH A;  3ALF A;  1OWQ A;  3OOB A;  3LUO A;  1QZ2 A;  3GPK A;  4DWS D;  1R9H A;  1D2K A;  3WH0 A;  5B8I C;  3WKZ A;  3CHF A;  3RME A;  4MGV A;  2KO7 A;  4TW8 A;  4LAW A;  2A3A A;  3KAG A;  1FKH A;  2DG3 A;  1GUV A;  1ZCN A;  3AS2 A;  3O5R A;  3PRD A;  4WK9 A;  4ZPW R;  3ARS A;  3WD4 A;  1D7I A;  1NWS A;  3TDB A;  1J4H A;  5GPR A;  3WD2 A;  1E6N A;  3UI6 A;  3O5E A;  1JVW A;  4ITZ A;  3B8S A;  3PA7 A;  2LPV A;  3O5I A;  3O5O A;  3O5J A;  4WKA A;  3GU0 A;  2Q5A A;  1E6P A;  3KAB A;  1X6N A;  2O9O A;  1L1P A;  4QT2 A;  3G6L A;  1JNE A;  4G2P A;  1FAP A;  1GRJ A;  4ODO A;  4W9P A;  4Z2H A;  1HKK A;  1KFW A;  1NMV A;  3GTY X;  3JYJ A;  2XP8 A;  1TCO C;  4ODQ A;  4C02 B;  1WNO A;  1W9P A;  1FKI A;  4DWS B;  2FKE A;  4MNJ A;  1A7X A;  2DPE A;  2LKN A;  2XP3 A;  3ARX A;  3NRK A;  3PR9 A;  3WQW A;  3O5L A;  4TW7 A;  1C9H A;  4MSP A;  1UR8 A;  1FKR A;  5HWB A;  4NSB A;  2MNT A;  4R0X A;  3PRB A;  1FKB A;  2IF4 A;  4ODN A;  1EIB A;  2PI6 A;  4W5U A;  2WM0 A;  4DRI A;  2LGO A;  2DSU A;  3KAH A;  4W9Q A;  2MLY A;  3G6M A;  2WLZ A;  5HW6 A;  4WKH A;  1PIN A;  1FKL A;  3EY6 A;  1F8A B;  2ZQV A;  1H0I A;  3KCE A;  1E6R A;  2EUL A;  1EYM A;  1Q6H A;  4Z2I A;  3RGC A;  3CHD A;  5GQB A;  4IQ2 A;  2DT2 A;  4WKF A;  4ODL A;  5HWC A;  5HTG A;  2UZ5 A;  4KQZ A;  4DZ3 A;  1UR9 A;  1U79 A;  5HUA A;  4JFJ A;  1NWU A;  4N19 A;  4GGQ A;  1E6Z A;  1NWR A;  3ARY A;  3WL1 A;  4MNL A;  4DRN A;  4HAR A;  4U84 A;  2DT3 A;  3UI5 A;  1HKJ A;  2M08 A;  2DSV A;  2XP9 A;  2MF9 A;  1ZB5 A;  1ZBC A;  4DH0 A;  3FXY A;  1P5Q A;  5I98 A;  2PPO A;  1W1P A;  1JNS A;  4S3K A;  4JYS A;  2Y78 A;  1KT1 A;  2MLX A;  1FFQ A;  4QZV B;  1FKS A;  1YW5 A;  4DRQ A;  1WAW A;  4Q22 A;  4JFL A;  4QIB A;  5BXJ A;  1LQ0 A;  4DRH A;  1FFR A;  3UI4 A;  5HW7 A;  4ODK A;  3B9A A;  5DIU A;  4LAV A;  3ARZ A;  4DWS A;  2RUQ A;  4IT6 A;  1FKF A;  3WD1 A;  2F21 A;  3B7X A;  1Q6I A;  3BMB A;  3AS0 A;  1M5Y A;  2PPP A;  2XPB A;  3WQV A;  1OGB A;  3UQB A;  1F40 A;  4IQC A;  3PRA A;  2N87 A;  4L72 B;  3CHC A;  2DT0 A;  2JZV A;  2VN1 A;  1H0G A;  3RM4 A;  2KR7 A;  3ARO A;  1EHN A;  4ODP A;  1NH6 A;  1ZL1 A;  5HBF A;  2DT1 A;  2YBT A;  3ARW A;  3ALG A;  1LL4 A;  5J6E A;  5HKG A;  1ROT A;  2WLY A;  4J4N A;  3ARQ A;  4HBO A;  3UQA A;  4G50 A;  1W9U A;  4MNK A;  1FKD A;  2A3B A;  2FDM A;  2XP7 A;  3KAC A;  2RQS A;  4WJX A;  1HJX A;  2DSW A;  1Y0O A;  3WL0 A;  4ODR A;  2MPH A;  3NI6 A;  2M1I A;  5D75 A;  2FAP A;  2XP6 A;  5DF0 A;  3RM8 A;  2DSZ A;  1J4I A;  1OGG A;  4GIV A;  3CHE A;  2RUD A;  4TW6 A;  1E9L A;  1LG2 A;  4UDM A;  2AOS A;  1W1Y A;  2ZR5 A;  1YAT A;  3ARP A;  3WD3 A;  4LGX A;  1D6O A;  1FKG A;  3O5F A;  2ZQT A;  1W1T A;  5GPG A;  3H9R B;  2XP4 A;  3ARV A;  4Z2K A;  1NMW A;  2QF8 A;  1WB0 A;  2WK2 A;  4ZPV R;  1FKK A;  1ROU A;  3IKD A;  2PV3 A;  4W9O A;  1Q1C A;  2ESC A;  1ZU8 A;  4DT4 A;  1CTN A;  1HJW A;  2ITK A;  2A3E A;  2RSE A;  2RUC A;  1FJD A;  3JYM A;  2PN0 A;  3KAI A;  3CGN A;  4PTM A;  4KR0 B;  2KE0 A;  1JCH B;  2G41 A;  4ODM A;  3IKG A;  3ODK A;  4MTV A;  3UQI A;  1FKT A;  1LG1 A;  1EDQ A;  4TNS A;  2RUR A;  1T11 A;  3KAF A;  3O5G A;  1ZBW A;  1K9T A;  1SR0 A;  1RD6 A;  4ZPT R;  4Z2L A;  1Q6U A;  1ITX A;  1E15 A;  2K8I A;  4WIW A;  3O5D A;  2ZR6 A;  3CGM A;  5JH8 A;  3VAW A;  3KAD A;  1QPL A;  2DG9 A;  3IHZ A;  3RFW A;  4J4O A;  4O2T A;  4MAV A;  1HKI A;  3ARR A;  2PPN A;  4TX0 A;  5DEZ A;  4ML4 A;  4NNR A;  2B5U B;  4U86 A;  3FAP A;  3RM9 A;  5HW8 A;  2PBC A;  1J6Y A;  1XRV A;  3WD0 A;  1EQ3 A;  1LJY A;  1JND A;  1B6C A;  4L3N A;  4ZS6 A;  1KT0 A;  3AS3 A;  3I6C A;  2DG4 A;  3IK8 A;  2D9F A;  3MDY B;  4MPK A;  1ZBV A;  2F23 A;  2ZR4 A;  1BL4 A;  2F2D A;  1HKM A;  1E44 A;  1VF8 A;  2ETN A;  3AQU A;  1LL7 A;  3FY1 A;  1D7H A;  2M2A A;  1N1A A;  2P4V A;  3ARU A;  4IT4 A;  4JFI A;  3W4R A;  2VCD A;  4S3J A;  2G8Z A;  4DRJ A;  2XP5 A;  4XAK A;  3EIP A;  3TC5 A;  1LL6 A;  4P8V A;  4Z2J A;  1GPF A;  3UF8 A;  5DIV A;  2KFW A;  4P8W A;  2L2S A;  3CH9 A;  3BXW A;  4MNM A;  4DRK A;  1BKF A;  2MLZ A;  2ZQU A;  5HT1 A;  4DRO A;  1IX5 A;  3O5P A;  4NZC A;  3WIJ A;  3B9E A;  3O5Q A;  1QPF A;  1X6L A;  2YBU A;  1O6I A;  1ZBK A;  4FN2 A;  1W9V A;  4LAX A;  4R5E A;  3ART A;  4HBE A;  3TCZ A;  2A3C A;  2AWG A;  1NWT A;  2O92 A;  3CZ8 A;  1SYT A;  1XHG A;  4LAY A;  3KZ7 A;  3AS1 A;  1JNT A;  1J4R A;  4DZ2 A;  5DIT A;  3O5K A;  4U85 A;  1W26 A;  4Z2G A;  1HJV A;  4JFK A;  2OFN A;  2XPA A;  4DRM A;  2F4E A;  2IUZ A;  2LJ4 A;  1FKJ A;  4P8U A;  4BF8 A; 
#chains in the Genus database with same CATH homology
 4P8X A;  3O5M A;  1W1V A;  1ZK6 A;  3NTP A;  2PV1 A;  3QOK A;  1FD9 A;  2PV2 A;  1D7J A;  3B9D A;  2B31 A;  4TYO A;  1GOI A;  1TFV A;  4IPX A;  1HXV A;  4DWS C;  2KI3 A;  4DRP A;  4QT3 A;  4JFM A;  4AY1 A;  4URI A;  1PBK A;  4Q7N A;  2KGJ A;  5DO2 A;  4FAP A;  3JXV A;  1NSG A;  2ZQS A;  4DIP A;  3OA5 A;  2OLH A;  3ALF A;  1OWQ A;  3OOB A;  3LUO A;  1QZ2 A;  3GPK A;  4DWS D;  1R9H A;  1D2K A;  3WH0 A;  5B8I C;  3WKZ A;  3CHF A;  3RME A;  4MGV A;  2KO7 A;  4TW8 A;  4LAW A;  2A3A A;  3KAG A;  1FKH A;  2DG3 A;  1GUV A;  1ZCN A;  3AS2 A;  3O5R A;  3PRD A;  4WK9 A;  4ZPW R;  3ARS A;  3WD4 A;  1D7I A;  1NWS A;  3TDB A;  1J4H A;  5GPR A;  3WD2 A;  1E6N A;  3UI6 A;  3O5E A;  1JVW A;  4ITZ A;  3B8S A;  3PA7 A;  2LPV A;  3O5I A;  3O5O A;  3O5J A;  4WKA A;  2Q5A A;  1E6P A;  3KAB A;  1X6N A;  2O9O A;  1L1P A;  4QT2 A;  3G6L A;  1JNE A;  4G2P A;  1FAP A;  4ODO A;  4W9P A;  4Z2H A;  1HKK A;  1KFW A;  1NMV A;  3JYJ A;  2XP8 A;  1TCO C;  4ODQ A;  4C02 B;  1WNO A;  1W9P A;  1FKI A;  4DWS B;  2FKE A;  4MNJ A;  1A7X A;  2DPE A;  2LKN A;  2XP3 A;  3ARX A;  3NRK A;  3PR9 A;  3WQW A;  3O5L A;  4TW7 A;  1C9H A;  4MSP A;  1UR8 A;  1FKR A;  5HWB A;  4NSB A;  2MNT A;  4R0X A;  3PRB A;  1FKB A;  2IF4 A;  4ODN A;  1EIB A;  2PI6 A;  4W5U A;  2WM0 A;  4DRI A;  2LGO A;  2DSU A;  3KAH A;  4W9Q A;  2MLY A;  3G6M A;  2WLZ A;  5HW6 A;  4WKH A;  1PIN A;  1FKL A;  3EY6 A;  1F8A B;  2ZQV A;  1H0I A;  3KCE A;  1E6R A;  1EYM A;  1Q6H A;  4Z2I A;  3RGC A;  3CHD A;  5GQB A;  4IQ2 A;  2DT2 A;  4WKF A;  4ODL A;  5HWC A;  5HTG A;  2UZ5 A;  4KQZ A;  4DZ3 A;  1UR9 A;  1U79 A;  5HUA A;  4JFJ A;  1NWU A;  4N19 A;  4GGQ A;  1E6Z A;  1NWR A;  3ARY A;  3WL1 A;  4MNL A;  4DRN A;  4HAR A;  4U84 A;  2DT3 A;  3UI5 A;  1HKJ A;  2M08 A;  2DSV A;  2XP9 A;  2MF9 A;  1ZB5 A;  1ZBC A;  4DH0 A;  3FXY A;  1P5Q A;  5I98 A;  2PPO A;  1W1P A;  1JNS A;  4S3K A;  4JYS A;  2Y78 A;  1KT1 A;  2MLX A;  1FFQ A;  4QZV B;  1FKS A;  1YW5 A;  4DRQ A;  1WAW A;  4Q22 A;  4JFL A;  4QIB A;  5BXJ A;  1LQ0 A;  4DRH A;  1FFR A;  3UI4 A;  5HW7 A;  4ODK A;  3B9A A;  5DIU A;  4LAV A;  3ARZ A;  4DWS A;  2RUQ A;  4IT6 A;  1FKF A;  3WD1 A;  2F21 A;  3B7X A;  1Q6I A;  3AS0 A;  1M5Y A;  2PPP A;  2XPB A;  3WQV A;  1OGB A;  3UQB A;  1F40 A;  4IQC A;  3PRA A;  2N87 A;  4L72 B;  3CHC A;  2DT0 A;  2JZV A;  2VN1 A;  1H0G A;  3RM4 A;  2KR7 A;  3ARO A;  1EHN A;  4ODP A;  1NH6 A;  1ZL1 A;  5HBF A;  2DT1 A;  2YBT A;  3ARW A;  3ALG A;  1LL4 A;  5J6E A;  5HKG A;  1ROT A;  2WLY A;  4J4N A;  3ARQ A;  4HBO A;  3UQA A;  4G50 A;  1W9U A;  4MNK A;  1FKD A;  2A3B A;  2FDM A;  2XP7 A;  3KAC A;  2RQS A;  4WJX A;  1HJX A;  2DSW A;  1Y0O A;  3WL0 A;  4ODR A;  2MPH A;  3NI6 A;  2M1I A;  5D75 A;  2FAP A;  2XP6 A;  5DF0 A;  3RM8 A;  2DSZ A;  1J4I A;  1OGG A;  4GIV A;  3CHE A;  2RUD A;  4TW6 A;  1E9L A;  1LG2 A;  2AOS A;  1W1Y A;  2ZR5 A;  1YAT A;  3ARP A;  3WD3 A;  4LGX A;  1D6O A;  1FKG A;  3O5F A;  2ZQT A;  1W1T A;  5GPG A;  3H9R B;  2XP4 A;  3ARV A;  4Z2K A;  1NMW A;  2QF8 A;  1WB0 A;  2WK2 A;  4ZPV R;  1FKK A;  1ROU A;  3IKD A;  2PV3 A;  4W9O A;  1Q1C A;  2ESC A;  1ZU8 A;  4DT4 A;  1CTN A;  1HJW A;  2ITK A;  2A3E A;  2RSE A;  2RUC A;  1FJD A;  3JYM A;  3KAI A;  3CGN A;  4PTM A;  4KR0 B;  2KE0 A;  2G41 A;  4ODM A;  3IKG A;  3ODK A;  4MTV A;  3UQI A;  1FKT A;  1LG1 A;  1EDQ A;  4TNS A;  2RUR A;  1T11 A;  3KAF A;  3O5G A;  1ZBW A;  1K9T A;  1SR0 A;  1RD6 A;  4ZPT R;  4Z2L A;  1Q6U A;  1ITX A;  1E15 A;  2K8I A;  4WIW A;  3O5D A;  2ZR6 A;  3CGM A;  5JH8 A;  3VAW A;  3KAD A;  1QPL A;  2DG9 A;  3IHZ A;  3RFW A;  4J4O A;  4O2T A;  4MAV A;  1HKI A;  3ARR A;  2PPN A;  4TX0 A;  5DEZ A;  4ML4 A;  4NNR A;  4U86 A;  3FAP A;  3RM9 A;  5HW8 A;  2PBC A;  1J6Y A;  1XRV A;  3WD0 A;  1EQ3 A;  1LJY A;  1JND A;  1B6C A;  4L3N A;  4ZS6 A;  1KT0 A;  3AS3 A;  3I6C A;  2DG4 A;  3IK8 A;  2D9F A;  3MDY B;  4MPK A;  1ZBV A;  2ZR4 A;  1BL4 A;  2F2D A;  1HKM A;  1VF8 A;  3AQU A;  1LL7 A;  3FY1 A;  1D7H A;  2M2A A;  1N1A A;  3ARU A;  4IT4 A;  4JFI A;  3W4R A;  2VCD A;  4S3J A;  2G8Z A;  4DRJ A;  2XP5 A;  4XAK A;  3TC5 A;  1LL6 A;  4P8V A;  4Z2J A;  1GPF A;  3UF8 A;  5DIV A;  2KFW A;  4P8W A;  2L2S A;  3CH9 A;  3BXW A;  4MNM A;  4DRK A;  1BKF A;  2MLZ A;  2ZQU A;  5HT1 A;  4DRO A;  1IX5 A;  3O5P A;  4NZC A;  3WIJ A;  3B9E A;  3O5Q A;  1QPF A;  1X6L A;  2YBU A;  1O6I A;  1ZBK A;  4FN2 A;  1W9V A;  4LAX A;  4R5E A;  3ART A;  4HBE A;  3TCZ A;  2A3C A;  2AWG A;  1NWT A;  2O92 A;  3CZ8 A;  1SYT A;  1XHG A;  4LAY A;  3KZ7 A;  3AS1 A;  1JNT A;  1J4R A;  4DZ2 A;  5DIT A;  3O5K A;  4U85 A;  1W26 A;  4Z2G A;  1HJV A;  4JFK A;  2OFN A;  2XPA A;  4DRM A;  2F4E A;  2IUZ A;  2LJ4 A;  1FKJ A;  4P8U A;  4BF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...