5B8IC

Crystal structure of calcineurin a and calcineurin b in complex with fkbp12 and fk506 from coccidioides immitis rs
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
GVTKKILKEGNGVDKPVKGDDIVMNYRGCLYDSSKPSEHFMGRKFDSTEERGEFKTKIGIGVVIRGWDEAVLQMSLGEKSILTITDDYAYGARGFPGLIPPHATLVFEVELKGINSKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase
publication title Crystal structure of Calcineurin A and Calcineurin B in complex with FKBP12 and FK506 from Coccidioides immitis RS
rcsb
source organism Coccidioides immitis (strain rs)
molecule tags Hydrolase
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5b8iC00
1PINA 1EYMA 5BXJA 3PA7A 3CGNA 3FAPA 4JFLA 1D7IA 1QPFA 3KAHA 1ZK6A 3I6CA 4G2PA 1JNSA 3UQBA 4W9QA 4JFMA 4DT4A 2M2AA 1Q6HA 4ITZA 5HKGA 4DZ3A 4TX0A 5HUAA 1U79A 3UF8A 3GPKA 3O5KA 4ODLA 3O5DA 2KGJA 4QIBA 2DG9A 4LAYA 4TNSA 1C9HA 3O5QA 3VAWA 2FAPA 4DRNA 5J6EA 2DG3A 1NSGA 3O5PA 4QT3A 4ODRA 1J4HA 1FKIA 1FKTA 3KCEA 3UI6A 3TDBA 2RURA 4DRHA 1NMWA 1EQ3A 3KADA 2MLYA 2RUQA 3KZ7A 3ODKA 2KE0A 3O5FA 1L1PA 4ODOA 1D7JA 4IPXA 4ODQA 3IKDA 2RSEA 3UI4A 2M08A 2ZQUA 4GGQA 1Q6UA 4W9PA 4DRPA 2PPPA 1FKRA 3O5MA 4ODNA 1JNTA 3H9RB 3CGMA 3JYMA 3PRDA 1J6YA 1NMVA 4DZ2A 3KAIA 3TC5A 5I98A 2MLXA 5HWCA 2N87A 3O5RA 4LAXA 5HW8A 2LJ4A 2LKNA 2XP7A 4ODPA 1FD9A 4DH0A 2ITKA 4U84A 4DRIA 1YATA 2MPHA 3LUOA 2ZQTA 1F40A 2JZVA 3UQAA 2L2SA 4FN2A 3IKGA 3JYJA 2KO7A 3RGCA 5HWBA 2VCDA 4O2TA 4N19A 1FAPA 2XP5A 4J4NA 3O5OA 4FAPA 1J4RA 3NRKA 2F4EA 2IF4A 2PBCA 3KABA 4LAWA 1Y0OA 4U86A 5HW7A 1D6OA 2MNTA 1B6CA 3NI6A 4QT2A 5DIUA 5DITA 1FJDA 4TW7A 1J4IA 1W26A 1KT0A 4MGVA 2XP3A 2XP4A 1BKFA 4TW8A 5HW6A 2PPNA 1A7XA 4GIVA 1JVWA 3UQIA 2F2DA 2XP6A 3RFWA 2K8IA 4LAVA 2DG4A 3IK8A 2RUDA 3IHZA 4DIPA 2RQSA 1QZ2A 4G50A 2XP8A 2RUCA 3O5EA 3KAFA 2XPAA 5HT1A 3EY6A 2M1IA 2ZR4A 5D75A 5B8IC 2VN1A 2F21A 1KT1A 1P5QA 1N1AA 4ODKA 2LGOA 2KI3A 4JFKA 1ROTA 1ZCNA 4IQ2A 2PV2A 1FKBA 1TCOC 1FKGA 2LPVA 4MSPA 2MLZA 3MDYB 3O5LA 4DRKA 5HTGA 4C02B 4JFJA 1F8AB 2ZQVA 3KAGA 1QPLA 2PPOA 2XP9A 1R9HA 4JFIA 3JXVA 3PRBA 1FKSA 2Q5AA 3B7XA 1FKJA 4W9OA 4DRQA 5DIVA 1FKKA 2UZ5A 3UI5A 4BF8A 3WH0A 5GPGA 2FKEA 3NTPA 4TW6A 2KFWA 1D7HA 1T11A 1M5YA 2D9FA 1ROUA 2PV3A 2XPBA 4ODMA 4DRJA 2ZQSA 4TYOA 1Q1CA 3O5GA 2OFNA 1FKHA 3O5IA 1Q6IA 2ZR5A 4NNRA 2ZR6A 3OOBA 1BL4A 3O5JA 3TCZA 4DRMA 4U85A 3KACA 1PBKA 4JYSA 1FKDA 1HXVA 2MF9A 2Y78A 1FKFA 2AWGA 4J4OA 2PV1A 4R0XA 1YW5A 1FKLA 4IQCA 4DROA 2KR7A
chains in the Genus database with same CATH superfamily
1EYMA 1ZU8A 3CGNA 3FAPA 1D7IA 1D2KA 1H0GA 1NWRA 3WL1A 3UF8A 1NWTA 3ARPA 3RM4A 1NWSA 3WD2A 4PTMA 2DG9A 4LAYA 5GQBA 4DRNA 1OGBA 3ARQA 3UI6A 3TDBA 4IT4A 1NMWA 1EQ3A 3KADA 4XAKA 2RUQA 1O6IA 4ODOA 4L72B 3UI4A 4GGQA 3RM9A 2PPPA 1FKRA 3O5MA 1J6YA 1NMVA 1W1VA 2O9OA 4W5UA 4P8XA 3KAIA 5I98A 2N87A 5HW8A 2DT2A 4ODPA 4DH0A 1WNOA 3AQUA 1W1TA 1F40A 2L2SA 3RGCA 2KO7A 4O2TA 4MAVA 3RMEA 2XP5A 4J4NA 3NRKA 1Y0OA 1GRJA 1LG2A 5DIUA 2XP3A 1ZB5A 4TW8A 3CHCA 4GIVA 1XRVA 1RD6A 4MNLA 2F2DA 3RFWA 2YBUA 2RQSA 1X6LA 1ITXA 4G50A 2XP8A 4ZPTR 3PRAA 5HT1A 3EY6A 1UR9A 4WKFA 3FXYA 5B8IC 2VN1A 4ODKA 1E6NA 3CHFA 1EIBA 4Z2HA 1ZCNA 2PV2A 1FKBA 1FKGA 4S3JA 5DF0A 5HBFA 1X6NA 3MDYB 4Q22A 4JFJA 3KAGA 2XP9A 3ARUA 3B9AA 1OGGA 4JFIA 4W9OA 2O92A 1FKKA 2UZ5A 3AS3A 3WH0A 2FKEA 3ARRA 2D9FA 4DWSA 1ROUA 4DRJA 4ZPWR 3O5IA 3O5JA 3TCZA 3W4RA 2Y78A 1FKFA 4WJXA 4DROA 4QZVB 3G6MA 3ARSA 3PA7A 2PI6A 2F23A 1ZK6A 1ZBCA 3KAHA 4HBEA 3UQBA 1E15A 4W9QA 4JFMA 4DT4A 2DPEA 3B9EA 1Q6HA 5HKGA 1U79A 3O5KA 1FFRA 3CZ8A 1W9UA 4QIBA 1C9HA 3O5QA 2FAPA 1NSGA 4S3KA 1ZBWA 4WK9A 1FKTA 3G6LA 2RURA 3KZ7A 3CHDA 1HKJA 2KR7A 1GUVA 4IPXA 1FFQA 3WD4A 4W9PA 3OA5A 1JNTA 3CGMA 4Z2KA 3WKZA 3TC5A 3GU0A 2ITKA 2JZVA 3UQAA 2VCDA 1FAPA 4FAPA 2PN0A 2PBCA 3KABA 2OLHA 1LQ0A 2FDMA 2DSWA 1EDQA 2PPNA 4MNJA 1A7XA 3BXWA 2XP6A 2K8IA 2RUCA 4MNMA 1LG1A 2XPAA 1E6ZA 3KAFA 2M1IA 3ALFA 4MTVA 1E44A 4HARA 1N1AA 3EIPA 2EULA 2KI3A 1XHGA 4ZPVR 4MSPA 2DT1A 3FY1A 4DRKA 4MPKA 4MNKA 2G8ZA 3JXVA 3B7XA 1FKJA 2DSVA 3ARTA 3WD1A 4BF8A 4TW6A 1T11A 2ESCA 2PV3A 4ODMA 4ML4A 3O5GA 4DWSC 3AROA 2ZR5A 1BL4A 4KR0B 3WQVA 2A3AA 4DRMA 4JYSA 1HXVA 4P8UA 1GPFA 2PV1A 1OWQA 3CHEA 1YW5A 2WM0A 5BXJA 4JFLA 2DT0A 1JNSA 3ARXA 1SR0A 2M2AA 1VF8A 4DZ3A 5HUAA 3GPKA 4IT6A 4ODLA 3O5DA 4ZS6A 3AS2A 2KGJA 3B9DA 4Q7NA 3WL0A 1TFVA 3VAWA 1K9TA 1E9LA 5J6EA 3QOKA 3O5PA 4QT3A 4ODRA 1FKIA 4LGXA 2WK2A 2WLZA 2QF8A 4ODQA 3IKDA 2A3BA 2RSEA 2YBTA 5DEZA 3RM8A 4ODNA 3H9RB 2A3EA 1JCHB 3CH9A 4DWSD 5HWCA 4LAXA 4R5EA 2LKNA 1HJVA 1FD9A 1W9VA 4DRIA 2MPHA 1HKKA 3LUOA 2ZQTA 3IKGA 5HWBA 4N19A 1HJXA 3O5OA 4U86A 1CTNA 4P8WA 5HW7A 1FJDA 1B6CA 4QT2A 5DITA 4TW7A 1KT0A 4MGVA 3ARZA 1HJWA 4WIWA 3UQIA 1ZBVA 4LAVA 2DG4A 3IK8A 2RUDA 1KFWA 3O5EA 4WKAA 2A3CA 1H0IA 2F21A 1WB0A 2LGOA 4JFKA 1NWUA 1ROTA 1TCOC 2LPVA 3GTYX 2MLZA 5GPRA 5HTGA 4P8VA 2AOSA 1QPLA 2DT3A 4URIA 1SYTA 4Z2JA 5GPGA 2KFWA 1JNDA 1M5YA 4NZCA 2XPBA 2ZQSA 4TYOA 1HKIA 1Q1CA 1FKHA 1Q6IA 4NNRA 2ZR6A 4Z2LA 1W9PA 3KACA 2MF9A 4J4OA 4R0XA 3WD3A 3BMBA 1FKLA 1PINA 2ETNA 3AS1A 3WIJA 1QPFA 4G2PA 3I6CA 1E6PA 4L3NA 1UR8A 4ITZA 1GOIA 4TX0A 2DSUA 4TNSA 2DG3A 1J4HA 4AY1A 3KCEA 3PR9A 1EHNA 4DRHA 2MLYA 3ODKA 2B5UB 2KE0A 3O5FA 1L1PA 1D7JA 1WAWA 1E6RA 1LJYA 2M08A 2ZQUA 4DRPA 1Q6UA 1W1YA 1LL7A 3PRDA 3JYMA 3ARYA 4DZ2A 2DSZA 2B31A 2MLXA 3ARWA 3O5RA 3B8SA 4Z2GA 2LJ4A 2XP7A 1ZBKA 4U84A 1YATA 1IX5A 4FN2A 3JYJA 1NH6A 4UDMA 4HBOA 4WKHA 3AS0A 1J4RA 2F4EA 2IF4A 2IUZA 4LAWA 1D6OA 2MNTA 3NI6A 1J4IA 1W26A 2XP4A 1BKFA 1JVWA 1JNEA 2G41A 3IHZA 4DIPA 1QZ2A 1ZL1A 2ZR4A 5D75A 2WLYA 1KT1A 1P5QA 2P4VA 4NSBA 3WQWA 4KQZA 4IQ2A 1HKMA 3O5LA 4C02B 1F8AB 2ZQVA 2PPOA 1R9HA 5JH8A 3PRBA 1FKSA 2Q5AA 4DRQA 5DIVA 5DO2A 4Z2IA 3WD0A 3UI5A 3NTPA 3ARVA 1D7HA 1LL4A 4DWSB 2OFNA 1W1PA 3OOBA 4U85A 1LL6A 1PBKA 1FKDA 2AWGA 5HW6A 4IQCA 3ALGA
chains in the Genus database with same CATH topology
1EYMA 1ZU8A 3CGNA 3FAPA 1D7IA 1D2KA 1H0GA 1NWRA 3WL1A 3UF8A 1NWTA 3ARPA 3RM4A 1NWSA 3WD2A 4PTMA 2DG9A 4LAYA 5GQBA 4DRNA 1OGBA 3ARQA 3UI6A 3TDBA 4IT4A 1NMWA 1EQ3A 3KADA 4XAKA 2RUQA 1O6IA 4ODOA 4L72B 3UI4A 4GGQA 3RM9A 2PPPA 1FKRA 3O5MA 1J6YA 1NMVA 1W1VA 2O9OA 4W5UA 4P8XA 3KAIA 5I98A 2N87A 5HW8A 2DT2A 4ODPA 4DH0A 1WNOA 3AQUA 1W1TA 1F40A 2L2SA 3RGCA 2KO7A 4O2TA 4MAVA 3RMEA 2XP5A 4J4NA 3NRKA 1Y0OA 1LG2A 5DIUA 2XP3A 1ZB5A 4TW8A 3CHCA 4GIVA 1XRVA 1RD6A 4MNLA 2F2DA 3RFWA 2YBUA 2RQSA 1X6LA 1ITXA 4G50A 2XP8A 4ZPTR 3PRAA 5HT1A 3EY6A 1UR9A 4WKFA 3FXYA 5B8IC 2VN1A 4ODKA 1E6NA 3CHFA 1EIBA 4Z2HA 1ZCNA 2PV2A 1FKBA 1FKGA 4S3JA 5DF0A 5HBFA 1X6NA 3MDYB 4Q22A 4JFJA 3KAGA 2XP9A 3ARUA 3B9AA 1OGGA 4JFIA 4W9OA 2O92A 1FKKA 2UZ5A 3AS3A 3WH0A 2FKEA 3ARRA 2D9FA 4DWSA 1ROUA 4DRJA 4ZPWR 3O5IA 3O5JA 3TCZA 3W4RA 2Y78A 1FKFA 4WJXA 4DROA 4QZVB 3G6MA 3ARSA 3PA7A 2PI6A 3KAHA 1ZK6A 1ZBCA 4HBEA 3UQBA 1E15A 4W9QA 4JFMA 4DT4A 2DPEA 3B9EA 1Q6HA 5HKGA 1U79A 3O5KA 1FFRA 3CZ8A 1W9UA 4QIBA 1C9HA 3O5QA 2FAPA 1NSGA 4S3KA 1ZBWA 4WK9A 1FKTA 3G6LA 2RURA 3KZ7A 3CHDA 1HKJA 2KR7A 1GUVA 4IPXA 1FFQA 3WD4A 4W9PA 3OA5A 1JNTA 3CGMA 4Z2KA 3WKZA 3TC5A 2ITKA 2JZVA 3UQAA 2VCDA 1FAPA 4FAPA 2PBCA 3KABA 2OLHA 1LQ0A 2FDMA 2DSWA 1EDQA 2PPNA 4MNJA 1A7XA 3BXWA 2XP6A 2K8IA 2RUCA 4MNMA 1LG1A 2XPAA 1E6ZA 3KAFA 2M1IA 3ALFA 4MTVA 4HARA 1N1AA 2KI3A 1XHGA 4ZPVR 4MSPA 2DT1A 3FY1A 4DRKA 4MPKA 4MNKA 2G8ZA 3JXVA 3B7XA 1FKJA 2DSVA 3ARTA 3WD1A 4BF8A 4TW6A 1T11A 2ESCA 2PV3A 4ODMA 4ML4A 3O5GA 4DWSC 3AROA 2ZR5A 1BL4A 4KR0B 3WQVA 2A3AA 4DRMA 4JYSA 1HXVA 4P8UA 1GPFA 2PV1A 1OWQA 3CHEA 1YW5A 2WM0A 5BXJA 4JFLA 2DT0A 1JNSA 3ARXA 1SR0A 2M2AA 1VF8A 4DZ3A 5HUAA 3GPKA 4IT6A 4ODLA 3O5DA 4ZS6A 3AS2A 2KGJA 3B9DA 4Q7NA 3WL0A 1TFVA 3VAWA 1K9TA 1E9LA 5J6EA 3QOKA 3O5PA 4QT3A 4ODRA 1FKIA 4LGXA 2WK2A 2WLZA 2QF8A 4ODQA 3IKDA 2A3BA 2RSEA 2YBTA 5DEZA 3RM8A 4ODNA 3H9RB 2A3EA 3CH9A 4DWSD 5HWCA 4LAXA 4R5EA 2LKNA 1HJVA 1FD9A 1W9VA 4DRIA 2MPHA 1HKKA 3LUOA 2ZQTA 3IKGA 5HWBA 4N19A 1HJXA 3O5OA 4U86A 1CTNA 4P8WA 5HW7A 1FJDA 1B6CA 4QT2A 5DITA 4TW7A 1KT0A 4MGVA 3ARZA 1HJWA 4WIWA 3UQIA 1ZBVA 4LAVA 2DG4A 3IK8A 2RUDA 1KFWA 3O5EA 4WKAA 2A3CA 1H0IA 2F21A 1WB0A 2LGOA 4JFKA 1NWUA 1ROTA 1TCOC 2LPVA 2MLZA 5GPRA 5HTGA 4P8VA 2AOSA 1QPLA 2DT3A 4URIA 1SYTA 4Z2JA 5GPGA 2KFWA 1JNDA 1M5YA 4NZCA 2XPBA 2ZQSA 4TYOA 1HKIA 1Q1CA 1FKHA 1Q6IA 4NNRA 2ZR6A 4Z2LA 1W9PA 3KACA 2MF9A 4J4OA 4R0XA 3WD3A 1FKLA 1PINA 3AS1A 3WIJA 1QPFA 4G2PA 3I6CA 1E6PA 4L3NA 1UR8A 4ITZA 1GOIA 4TX0A 2DSUA 4TNSA 2DG3A 1J4HA 4AY1A 3KCEA 3PR9A 1EHNA 4DRHA 2MLYA 3ODKA 2KE0A 3O5FA 1L1PA 1D7JA 1WAWA 1E6RA 1LJYA 2M08A 2ZQUA 4DRPA 1Q6UA 1W1YA 1LL7A 3PRDA 3JYMA 3ARYA 4DZ2A 2DSZA 2B31A 2MLXA 3ARWA 3O5RA 3B8SA 4Z2GA 2LJ4A 2XP7A 1ZBKA 4U84A 1YATA 1IX5A 4FN2A 3JYJA 1NH6A 4HBOA 4WKHA 3AS0A 1J4RA 2F4EA 2IF4A 2IUZA 4LAWA 1D6OA 2MNTA 3NI6A 1J4IA 1W26A 2XP4A 1BKFA 1JVWA 1JNEA 2G41A 3IHZA 4DIPA 1QZ2A 1ZL1A 2ZR4A 5D75A 2WLYA 1KT1A 1P5QA 4NSBA 3WQWA 4KQZA 4IQ2A 1HKMA 3O5LA 4C02B 1F8AB 2ZQVA 2PPOA 1R9HA 5JH8A 3PRBA 1FKSA 2Q5AA 4DRQA 5DIVA 5DO2A 4Z2IA 3WD0A 3UI5A 3NTPA 3ARVA 1D7HA 1LL4A 4DWSB 2OFNA 1W1PA 3OOBA 4U85A 1LL6A 1PBKA 1FKDA 2AWGA 5HW6A 4IQCA 3ALGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIN A;  1EYM A;  5BXJ A;  3PA7 A;  3CGN A;  3FAP A;  4JFL A;  1D7I A;  1QPF A;  3KAH A;  1ZK6 A;  3I6C A;  4G2P A;  1JNS A;  3UQB A;  4W9Q A;  4JFM A;  4DT4 A;  2M2A A;  1Q6H A;  4ITZ A;  5HKG A;  4DZ3 A;  4TX0 A;  5HUA A;  1U79 A;  3UF8 A;  3GPK A;  3O5K A;  4ODL A;  3O5D A;  2KGJ A;  4QIB A;  2DG9 A;  4LAY A;  4TNS A;  1C9H A;  3O5Q A;  3VAW A;  2FAP A;  4DRN A;  5J6E A;  2DG3 A;  1NSG A;  3O5P A;  4QT3 A;  4ODR A;  1J4H A;  1FKI A;  1FKT A;  3KCE A;  3UI6 A;  3TDB A;  2RUR A;  4DRH A;  1NMW A;  1EQ3 A;  3KAD A;  2MLY A;  2RUQ A;  3KZ7 A;  3ODK A;  2KE0 A;  3O5F A;  1L1P A;  4ODO A;  1D7J A;  4IPX A;  4ODQ A;  3IKD A;  2RSE A;  3UI4 A;  2M08 A;  2ZQU A;  4GGQ A;  1Q6U A;  4W9P A;  4DRP A;  2PPP A;  1FKR A;  3O5M A;  4ODN A;  1JNT A;  3H9R B;  3CGM A;  3JYM A;  3PRD A;  1J6Y A;  1NMV A;  4DZ2 A;  3KAI A;  3TC5 A;  5I98 A;  2MLX A;  5HWC A;  2N87 A;  3O5R A;  4LAX A;  5HW8 A;  2LJ4 A;  2LKN A;  2XP7 A;  4ODP A;  1FD9 A;  4DH0 A;  2ITK A;  4U84 A;  4DRI A;  1YAT A;  2MPH A;  3LUO A;  2ZQT A;  1F40 A;  2JZV A;  3UQA A;  2L2S A;  4FN2 A;  3IKG A;  3JYJ A;  2KO7 A;  3RGC A;  5HWB A;  2VCD A;  4O2T A;  4N19 A;  1FAP A;  2XP5 A;  4J4N A;  3O5O A;  4FAP A;  1J4R A;  3NRK A;  2F4E A;  2IF4 A;  2PBC A;  3KAB A;  4LAW A;  1Y0O A;  4U86 A;  5HW7 A;  1D6O A;  2MNT A;  1B6C A;  3NI6 A;  4QT2 A;  5DIU A;  5DIT A;  1FJD A;  4TW7 A;  1J4I A;  1W26 A;  1KT0 A;  4MGV A;  2XP3 A;  2XP4 A;  1BKF A;  4TW8 A;  5HW6 A;  2PPN A;  1A7X A;  4GIV A;  1JVW A;  3UQI A;  2F2D A;  2XP6 A;  3RFW A;  2K8I A;  4LAV A;  2DG4 A;  3IK8 A;  2RUD A;  3IHZ A;  4DIP A;  2RQS A;  1QZ2 A;  4G50 A;  2XP8 A;  2RUC A;  3O5E A;  3KAF A;  2XPA A;  5HT1 A;  3EY6 A;  2M1I A;  2ZR4 A;  5D75 A;  5B8I C;  2VN1 A;  2F21 A;  1KT1 A;  1P5Q A;  1N1A A;  4ODK A;  2LGO A;  2KI3 A;  4JFK A;  1ROT A;  1ZCN A;  4IQ2 A;  2PV2 A;  1FKB A;  1TCO C;  1FKG A;  2LPV A;  4MSP A;  2MLZ A;  3MDY B;  3O5L A;  4DRK A;  5HTG A;  4C02 B;  4JFJ A;  1F8A B;  2ZQV A;  3KAG A;  1QPL A;  2PPO A;  2XP9 A;  1R9H A;  4JFI A;  3JXV A;  3PRB A;  1FKS A;  2Q5A A;  3B7X A;  1FKJ A;  4W9O A;  4DRQ A;  5DIV A;  1FKK A;  2UZ5 A;  3UI5 A;  4BF8 A;  3WH0 A;  5GPG A;  2FKE A;  3NTP A;  4TW6 A;  2KFW A;  1D7H A;  1T11 A;  1M5Y A;  2D9F A;  1ROU A;  2PV3 A;  2XPB A;  4ODM A;  4DRJ A;  2ZQS A;  4TYO A;  1Q1C A;  3O5G A;  2OFN A;  1FKH A;  3O5I A;  1Q6I A;  2ZR5 A;  4NNR A;  2ZR6 A;  3OOB A;  1BL4 A;  3O5J A;  3TCZ A;  4DRM A;  4U85 A;  3KAC A;  1PBK A;  4JYS A;  1FKD A;  1HXV A;  2MF9 A;  2Y78 A;  1FKF A;  2AWG A;  4J4O A;  2PV1 A;  4R0X A;  1YW5 A;  1FKL A;  4IQC A;  4DRO A;  2KR7 A; 
#chains in the Genus database with same CATH topology
 1EYM A;  1ZU8 A;  3CGN A;  3FAP A;  1D7I A;  1D2K A;  1H0G A;  1NWR A;  3WL1 A;  3UF8 A;  1NWT A;  3ARP A;  3RM4 A;  1NWS A;  3WD2 A;  4PTM A;  2DG9 A;  4LAY A;  5GQB A;  4DRN A;  1OGB A;  3ARQ A;  3UI6 A;  3TDB A;  4IT4 A;  1NMW A;  1EQ3 A;  3KAD A;  4XAK A;  2RUQ A;  1O6I A;  4ODO A;  4L72 B;  3UI4 A;  4GGQ A;  3RM9 A;  2PPP A;  1FKR A;  3O5M A;  1J6Y A;  1NMV A;  1W1V A;  2O9O A;  4W5U A;  4P8X A;  3KAI A;  5I98 A;  2N87 A;  5HW8 A;  2DT2 A;  4ODP A;  4DH0 A;  1WNO A;  3AQU A;  1W1T A;  1F40 A;  2L2S A;  3RGC A;  2KO7 A;  4O2T A;  4MAV A;  3RME A;  2XP5 A;  4J4N A;  3NRK A;  1Y0O A;  1GRJ A;  1LG2 A;  5DIU A;  2XP3 A;  1ZB5 A;  4TW8 A;  3CHC A;  4GIV A;  1XRV A;  1RD6 A;  4MNL A;  2F2D A;  3RFW A;  2YBU A;  2RQS A;  1X6L A;  1ITX A;  4G50 A;  2XP8 A;  4ZPT R;  3PRA A;  5HT1 A;  3EY6 A;  1UR9 A;  4WKF A;  3FXY A;  5B8I C;  2VN1 A;  4ODK A;  1E6N A;  3CHF A;  1EIB A;  4Z2H A;  1ZCN A;  2PV2 A;  1FKB A;  1FKG A;  4S3J A;  5DF0 A;  5HBF A;  1X6N A;  3MDY B;  4Q22 A;  4JFJ A;  3KAG A;  2XP9 A;  3ARU A;  3B9A A;  1OGG A;  4JFI A;  4W9O A;  2O92 A;  1FKK A;  2UZ5 A;  3AS3 A;  3WH0 A;  2FKE A;  3ARR A;  2D9F A;  4DWS A;  1ROU A;  4DRJ A;  4ZPW R;  3O5I A;  3O5J A;  3TCZ A;  3W4R A;  2Y78 A;  1FKF A;  4WJX A;  4DRO A;  4QZV B;  3G6M A;  3ARS A;  3PA7 A;  2PI6 A;  2F23 A;  1ZK6 A;  1ZBC A;  3KAH A;  4HBE A;  3UQB A;  1E15 A;  4W9Q A;  4JFM A;  4DT4 A;  2DPE A;  3B9E A;  1Q6H A;  5HKG A;  1U79 A;  3O5K A;  1FFR A;  3CZ8 A;  1W9U A;  4QIB A;  1C9H A;  3O5Q A;  2FAP A;  1NSG A;  4S3K A;  1ZBW A;  4WK9 A;  1FKT A;  3G6L A;  2RUR A;  3KZ7 A;  3CHD A;  1HKJ A;  2KR7 A;  1GUV A;  4IPX A;  1FFQ A;  3WD4 A;  4W9P A;  3OA5 A;  1JNT A;  3CGM A;  4Z2K A;  3WKZ A;  3TC5 A;  3GU0 A;  2ITK A;  2JZV A;  3UQA A;  2VCD A;  1FAP A;  4FAP A;  2PN0 A;  2PBC A;  3KAB A;  2OLH A;  1LQ0 A;  2FDM A;  2DSW A;  1EDQ A;  2PPN A;  4MNJ A;  1A7X A;  3BXW A;  2XP6 A;  2K8I A;  2RUC A;  4MNM A;  1LG1 A;  2XPA A;  1E6Z A;  3KAF A;  2M1I A;  3ALF A;  4MTV A;  1E44 A;  4HAR A;  1N1A A;  3EIP A;  2EUL A;  2KI3 A;  1XHG A;  4ZPV R;  4MSP A;  2DT1 A;  3FY1 A;  4DRK A;  4MPK A;  4MNK A;  2G8Z A;  3JXV A;  3B7X A;  1FKJ A;  2DSV A;  3ART A;  3WD1 A;  4BF8 A;  4TW6 A;  1T11 A;  2ESC A;  2PV3 A;  4ODM A;  4ML4 A;  3O5G A;  4DWS C;  3ARO A;  2ZR5 A;  1BL4 A;  4KR0 B;  3WQV A;  2A3A A;  4DRM A;  4JYS A;  1HXV A;  4P8U A;  1GPF A;  2PV1 A;  1OWQ A;  3CHE A;  1YW5 A;  2WM0 A;  5BXJ A;  4JFL A;  2DT0 A;  1JNS A;  3ARX A;  1SR0 A;  2M2A A;  1VF8 A;  4DZ3 A;  5HUA A;  3GPK A;  4IT6 A;  4ODL A;  3O5D A;  4ZS6 A;  3AS2 A;  2KGJ A;  3B9D A;  4Q7N A;  3WL0 A;  1TFV A;  3VAW A;  1K9T A;  1E9L A;  5J6E A;  3QOK A;  3O5P A;  4QT3 A;  4ODR A;  1FKI A;  4LGX A;  2WK2 A;  2WLZ A;  2QF8 A;  4ODQ A;  3IKD A;  2A3B A;  2RSE A;  2YBT A;  5DEZ A;  3RM8 A;  4ODN A;  3H9R B;  2A3E A;  1JCH B;  3CH9 A;  4DWS D;  5HWC A;  4LAX A;  4R5E A;  2LKN A;  1HJV A;  1FD9 A;  1W9V A;  4DRI A;  2MPH A;  1HKK A;  3LUO A;  2ZQT A;  3IKG A;  5HWB A;  4N19 A;  1HJX A;  3O5O A;  4U86 A;  1CTN A;  4P8W A;  5HW7 A;  1FJD A;  1B6C A;  4QT2 A;  5DIT A;  4TW7 A;  1KT0 A;  4MGV A;  3ARZ A;  1HJW A;  4WIW A;  3UQI A;  1ZBV A;  4LAV A;  2DG4 A;  3IK8 A;  2RUD A;  1KFW A;  3O5E A;  4WKA A;  2A3C A;  1H0I A;  2F21 A;  1WB0 A;  2LGO A;  4JFK A;  1NWU A;  1ROT A;  1TCO C;  2LPV A;  3GTY X;  2MLZ A;  5GPR A;  5HTG A;  4P8V A;  2AOS A;  1QPL A;  2DT3 A;  4URI A;  1SYT A;  4Z2J A;  5GPG A;  2KFW A;  1JND A;  1M5Y A;  4NZC A;  2XPB A;  2ZQS A;  4TYO A;  1HKI A;  1Q1C A;  1FKH A;  1Q6I A;  4NNR A;  2ZR6 A;  4Z2L A;  1W9P A;  3KAC A;  2MF9 A;  4J4O A;  4R0X A;  3WD3 A;  3BMB A;  1FKL A;  1PIN A;  2ETN A;  3AS1 A;  3WIJ A;  1QPF A;  4G2P A;  3I6C A;  1E6P A;  4L3N A;  1UR8 A;  4ITZ A;  1GOI A;  4TX0 A;  2DSU A;  4TNS A;  2DG3 A;  1J4H A;  4AY1 A;  3KCE A;  3PR9 A;  1EHN A;  4DRH A;  2MLY A;  3ODK A;  2B5U B;  2KE0 A;  3O5F A;  1L1P A;  1D7J A;  1WAW A;  1E6R A;  1LJY A;  2M08 A;  2ZQU A;  4DRP A;  1Q6U A;  1W1Y A;  1LL7 A;  3PRD A;  3JYM A;  3ARY A;  4DZ2 A;  2DSZ A;  2B31 A;  2MLX A;  3ARW A;  3O5R A;  3B8S A;  4Z2G A;  2LJ4 A;  2XP7 A;  1ZBK A;  4U84 A;  1YAT A;  1IX5 A;  4FN2 A;  3JYJ A;  1NH6 A;  4UDM A;  4HBO A;  4WKH A;  3AS0 A;  1J4R A;  2F4E A;  2IF4 A;  2IUZ A;  4LAW A;  1D6O A;  2MNT A;  3NI6 A;  1J4I A;  1W26 A;  2XP4 A;  1BKF A;  1JVW A;  1JNE A;  2G41 A;  3IHZ A;  4DIP A;  1QZ2 A;  1ZL1 A;  2ZR4 A;  5D75 A;  2WLY A;  1KT1 A;  1P5Q A;  2P4V A;  4NSB A;  3WQW A;  4KQZ A;  4IQ2 A;  1HKM A;  3O5L A;  4C02 B;  1F8A B;  2ZQV A;  2PPO A;  1R9H A;  5JH8 A;  3PRB A;  1FKS A;  2Q5A A;  4DRQ A;  5DIV A;  5DO2 A;  4Z2I A;  3WD0 A;  3UI5 A;  3NTP A;  3ARV A;  1D7H A;  1LL4 A;  4DWS B;  2OFN A;  1W1P A;  3OOB A;  4U85 A;  1LL6 A;  1PBK A;  1FKD A;  2AWG A;  5HW6 A;  4IQC A;  3ALG A; 
#chains in the Genus database with same CATH homology
 1EYM A;  1ZU8 A;  3CGN A;  3FAP A;  1D7I A;  1D2K A;  1H0G A;  1NWR A;  3WL1 A;  3UF8 A;  1NWT A;  3ARP A;  3RM4 A;  1NWS A;  3WD2 A;  4PTM A;  2DG9 A;  4LAY A;  5GQB A;  4DRN A;  1OGB A;  3ARQ A;  3UI6 A;  3TDB A;  4IT4 A;  1NMW A;  1EQ3 A;  3KAD A;  4XAK A;  2RUQ A;  1O6I A;  4ODO A;  4L72 B;  3UI4 A;  4GGQ A;  3RM9 A;  2PPP A;  1FKR A;  3O5M A;  1J6Y A;  1NMV A;  1W1V A;  2O9O A;  4W5U A;  4P8X A;  3KAI A;  5I98 A;  2N87 A;  5HW8 A;  2DT2 A;  4ODP A;  4DH0 A;  1WNO A;  3AQU A;  1W1T A;  1F40 A;  2L2S A;  3RGC A;  2KO7 A;  4O2T A;  4MAV A;  3RME A;  2XP5 A;  4J4N A;  3NRK A;  1Y0O A;  1LG2 A;  5DIU A;  2XP3 A;  1ZB5 A;  4TW8 A;  3CHC A;  4GIV A;  1XRV A;  1RD6 A;  4MNL A;  2F2D A;  3RFW A;  2YBU A;  2RQS A;  1X6L A;  1ITX A;  4G50 A;  2XP8 A;  4ZPT R;  3PRA A;  5HT1 A;  3EY6 A;  1UR9 A;  4WKF A;  3FXY A;  5B8I C;  2VN1 A;  4ODK A;  1E6N A;  3CHF A;  1EIB A;  4Z2H A;  1ZCN A;  2PV2 A;  1FKB A;  1FKG A;  4S3J A;  5DF0 A;  5HBF A;  1X6N A;  3MDY B;  4Q22 A;  4JFJ A;  3KAG A;  2XP9 A;  3ARU A;  3B9A A;  1OGG A;  4JFI A;  4W9O A;  2O92 A;  1FKK A;  2UZ5 A;  3AS3 A;  3WH0 A;  2FKE A;  3ARR A;  2D9F A;  4DWS A;  1ROU A;  4DRJ A;  4ZPW R;  3O5I A;  3O5J A;  3TCZ A;  3W4R A;  2Y78 A;  1FKF A;  4WJX A;  4DRO A;  4QZV B;  3G6M A;  3ARS A;  3PA7 A;  2PI6 A;  3KAH A;  1ZK6 A;  1ZBC A;  4HBE A;  3UQB A;  1E15 A;  4W9Q A;  4JFM A;  4DT4 A;  2DPE A;  3B9E A;  1Q6H A;  5HKG A;  1U79 A;  3O5K A;  1FFR A;  3CZ8 A;  1W9U A;  4QIB A;  1C9H A;  3O5Q A;  2FAP A;  1NSG A;  4S3K A;  1ZBW A;  4WK9 A;  1FKT A;  3G6L A;  2RUR A;  3KZ7 A;  3CHD A;  1HKJ A;  2KR7 A;  1GUV A;  4IPX A;  1FFQ A;  3WD4 A;  4W9P A;  3OA5 A;  1JNT A;  3CGM A;  4Z2K A;  3WKZ A;  3TC5 A;  2ITK A;  2JZV A;  3UQA A;  2VCD A;  1FAP A;  4FAP A;  2PBC A;  3KAB A;  2OLH A;  1LQ0 A;  2FDM A;  2DSW A;  1EDQ A;  2PPN A;  4MNJ A;  1A7X A;  3BXW A;  2XP6 A;  2K8I A;  2RUC A;  4MNM A;  1LG1 A;  2XPA A;  1E6Z A;  3KAF A;  2M1I A;  3ALF A;  4MTV A;  4HAR A;  1N1A A;  2KI3 A;  1XHG A;  4ZPV R;  4MSP A;  2DT1 A;  3FY1 A;  4DRK A;  4MPK A;  4MNK A;  2G8Z A;  3JXV A;  3B7X A;  1FKJ A;  2DSV A;  3ART A;  3WD1 A;  4BF8 A;  4TW6 A;  1T11 A;  2ESC A;  2PV3 A;  4ODM A;  4ML4 A;  3O5G A;  4DWS C;  3ARO A;  2ZR5 A;  1BL4 A;  4KR0 B;  3WQV A;  2A3A A;  4DRM A;  4JYS A;  1HXV A;  4P8U A;  1GPF A;  2PV1 A;  1OWQ A;  3CHE A;  1YW5 A;  2WM0 A;  5BXJ A;  4JFL A;  2DT0 A;  1JNS A;  3ARX A;  1SR0 A;  2M2A A;  1VF8 A;  4DZ3 A;  5HUA A;  3GPK A;  4IT6 A;  4ODL A;  3O5D A;  4ZS6 A;  3AS2 A;  2KGJ A;  3B9D A;  4Q7N A;  3WL0 A;  1TFV A;  3VAW A;  1K9T A;  1E9L A;  5J6E A;  3QOK A;  3O5P A;  4QT3 A;  4ODR A;  1FKI A;  4LGX A;  2WK2 A;  2WLZ A;  2QF8 A;  4ODQ A;  3IKD A;  2A3B A;  2RSE A;  2YBT A;  5DEZ A;  3RM8 A;  4ODN A;  3H9R B;  2A3E A;  3CH9 A;  4DWS D;  5HWC A;  4LAX A;  4R5E A;  2LKN A;  1HJV A;  1FD9 A;  1W9V A;  4DRI A;  2MPH A;  1HKK A;  3LUO A;  2ZQT A;  3IKG A;  5HWB A;  4N19 A;  1HJX A;  3O5O A;  4U86 A;  1CTN A;  4P8W A;  5HW7 A;  1FJD A;  1B6C A;  4QT2 A;  5DIT A;  4TW7 A;  1KT0 A;  4MGV A;  3ARZ A;  1HJW A;  4WIW A;  3UQI A;  1ZBV A;  4LAV A;  2DG4 A;  3IK8 A;  2RUD A;  1KFW A;  3O5E A;  4WKA A;  2A3C A;  1H0I A;  2F21 A;  1WB0 A;  2LGO A;  4JFK A;  1NWU A;  1ROT A;  1TCO C;  2LPV A;  2MLZ A;  5GPR A;  5HTG A;  4P8V A;  2AOS A;  1QPL A;  2DT3 A;  4URI A;  1SYT A;  4Z2J A;  5GPG A;  2KFW A;  1JND A;  1M5Y A;  4NZC A;  2XPB A;  2ZQS A;  4TYO A;  1HKI A;  1Q1C A;  1FKH A;  1Q6I A;  4NNR A;  2ZR6 A;  4Z2L A;  1W9P A;  3KAC A;  2MF9 A;  4J4O A;  4R0X A;  3WD3 A;  1FKL A;  1PIN A;  3AS1 A;  3WIJ A;  1QPF A;  4G2P A;  3I6C A;  1E6P A;  4L3N A;  1UR8 A;  4ITZ A;  1GOI A;  4TX0 A;  2DSU A;  4TNS A;  2DG3 A;  1J4H A;  4AY1 A;  3KCE A;  3PR9 A;  1EHN A;  4DRH A;  2MLY A;  3ODK A;  2KE0 A;  3O5F A;  1L1P A;  1D7J A;  1WAW A;  1E6R A;  1LJY A;  2M08 A;  2ZQU A;  4DRP A;  1Q6U A;  1W1Y A;  1LL7 A;  3PRD A;  3JYM A;  3ARY A;  4DZ2 A;  2DSZ A;  2B31 A;  2MLX A;  3ARW A;  3O5R A;  3B8S A;  4Z2G A;  2LJ4 A;  2XP7 A;  1ZBK A;  4U84 A;  1YAT A;  1IX5 A;  4FN2 A;  3JYJ A;  1NH6 A;  4HBO A;  4WKH A;  3AS0 A;  1J4R A;  2F4E A;  2IF4 A;  2IUZ A;  4LAW A;  1D6O A;  2MNT A;  3NI6 A;  1J4I A;  1W26 A;  2XP4 A;  1BKF A;  1JVW A;  1JNE A;  2G41 A;  3IHZ A;  4DIP A;  1QZ2 A;  1ZL1 A;  2ZR4 A;  5D75 A;  2WLY A;  1KT1 A;  1P5Q A;  4NSB A;  3WQW A;  4KQZ A;  4IQ2 A;  1HKM A;  3O5L A;  4C02 B;  1F8A B;  2ZQV A;  2PPO A;  1R9H A;  5JH8 A;  3PRB A;  1FKS A;  2Q5A A;  4DRQ A;  5DIV A;  5DO2 A;  4Z2I A;  3WD0 A;  3UI5 A;  3NTP A;  3ARV A;  1D7H A;  1LL4 A;  4DWS B;  2OFN A;  1W1P A;  3OOB A;  4U85 A;  1LL6 A;  1PBK A;  1FKD A;  2AWG A;  5HW6 A;  4IQC A;  3ALG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...