5B8IC

Crystal structure of calcineurin a and calcineurin b in complex with fkbp12 and fk506 from coccidioides immitis rs
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
b'GVTKKILKEGNGVDKPVKGDDIVMNYRGCLYDSSKPSEHFMGRKFDSTEERGEFKTKIGIGVVIRGWDEAVLQMSLGEKSILTITDDYAYGARGFPGLIPPHATLVFEVELKGINSKRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase
publication title Crystal structure of Calcineurin A and Calcineurin B in complex with FKBP12 and FK506 from Coccidioides immitis RS
rcsb
source organism Coccidioides immitis (strain rs)
molecule tags Hydrolase
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5b8iC00
1FJDA 1Q6UA 4TW6A 3UI4A 3MDYB 4NNRA 1FD9A 4QT2A 3TDBA 4ITZA 1P5QA 2F21A 2MLYA 1T11A 3WH0A 4QT3A 1JNTA 4FN2A 2KO7A 2DG3A 3KAIA 1D7IA 2DG4A 2PBCA 1NMVA 1FKJA 2MNTA 2XP6A 4DRIA 1FKBA 1U79A 1Y0OA 3IKGA 4GGQA 2RQSA 2F2DA 5B8IC 4ODKA 2MF9A 1D7JA 2XP3A 3KADA 4W9PA 4N19A 1D6OA 4ODMA 2UZ5A 4DROA 2M2AA 2ZQSA 3NRKA 4TNSA 4JFLA 4IQCA 5DIVA 5I98A 2ZR4A 3ODKA 4ODLA 3B7XA 4DRHA 2DG9A 3KACA 1J4RA 4DZ3A 2MLXA 4JYSA 1BKFA 2M08A 3VAWA 1QPLA 2PV1A 3UI5A 1Q6HA 2M1IA 1L1PA 3IHZA 3IK8A 5HKGA 5HW7A 3CGMA 1FKKA 2PPOA 2XP5A 2XP7A 1ZCNA 2ZR6A 2KI3A 4IPXA 4DRKA 5BXJA 3KAFA 2MLZA 1NSGA 2ZR5A 4JFIA 1BL4A 1F40A 1NMWA 1JNSA 1A7XA 4O2TA 2RUCA 2RSEA 2XP9A 2Y78A 3O5EA 4DRMA 3GPKA 4FAPA 1YATA 2IF4A 4ODNA 3JXVA 4TW8A 1J4IA 1ROUA 2FAPA 2FKEA 2K8IA 2KGJA 3O5LA 3I6CA 4BF8A 4DRQA 3RGCA 4MSPA 3O5OA 2PV2A 4ODPA 1PBKA 3KAGA 1EYMA 2LPVA 4TW7A 5DITA 1KT0A 2PV3A 2AWGA 4QIBA 4JFMA 1ZK6A 1FKDA 2ZQTA 2ITKA 3KCEA 3O5DA 1FKGA 4W9QA 5D75A 3UI6A 3UQBA 4LAWA 4IQ2A 2D9FA 4J4NA 5HUAA 2XPBA 5HW6A 3O5RA 2KE0A 1N1AA 3JYJA 3NI6A 3OOBA 4ODOA 3UF8A 3O5PA 1B6CA 3KZ7A 4DZ2A 4LAVA 3O5QA 4ODQA 2XP4A 1FKHA 2RUDA 4C02B 3IKDA 4DIPA 3O5JA 4G2PA 1KT1A 4DT4A 5HWCA 1D7HA 1FKSA 4JFJA 3O5FA 1TCOC 4DRJA 1J4HA 1HXVA 3O5GA 3JYMA 1C9HA 2L2SA 5GPGA 4ODRA 1FKFA 3EY6A 4U86A 3PRDA 1QPFA 4R0XA 1J6YA 2JZVA 4DH0A 2VN1A 3KABA 3O5KA 5HW8A 5J6EA 1FKTA 3CGNA 2RURA 4TX0A 3KAHA 1PINA 2KFWA 3TCZA 2PPNA 3O5MA 1EQ3A 3FAPA 2PPPA 2ZQUA 4J4OA 1F8AB 3H9RB 1FAPA 1R9HA 5HT1A 5HWBA 3UQAA 2XP8A 2MPHA 2LKNA 1QZ2A 1FKLA 3O5IA 1Q1CA 3NTPA 2LGOA 4TYOA 4U84A 2KR7A 1YW5A 2F4EA 4MGVA 3PRBA 1M5YA 2Q5AA 3LUOA 1ROTA 4JFKA 1W26A 2RUQA 2XPAA 4GIVA 5DIUA 1FKRA 2OFNA 3PA7A 1JVWA 1Q6IA 2VCDA 2LJ4A 2ZQVA 3TC5A 3UQIA 1FKIA 4U85A 5HTGA 4DRNA 4G50A 3RFWA 4LAYA 4DRPA 4W9OA 2N87A 4LAXA
chains in the Genus database with same CATH superfamily
1FJDA 1Q6UA 3MDYB 4IT4A 3TDBA 1CTNA 1JNEA 4ITZA 3AS0A 2DG3A 3KAIA 3QOKA 3CHCA 3EIPA 1FKJA 2WLYA 4DRIA 3ARXA 4WKHA 3CHFA 3IKGA 2MF9A 4ZPVR 1D7JA 4N19A 2DT2A 4IQCA 4ODLA 3B7XA 1LQ0A 1E6RA 2MLXA 1BKFA 2M08A 3FXYA 4HBEA 2PV1A 2XP5A 1LG2A 1VF8A 4IPXA 3WIJA 1F40A 4JFIA 1NMWA 2RSEA 1ZL1A 1ROUA 2FAPA 4Z2KA 2KGJA 4BF8A 3RGCA 3O5OA 1PBKA 3KAGA 1EYMA 2LPVA 3BXWA 4WKFA 4MTVA 4QIBA 1FKDA 3WQVA 4DWSA 4Z2JA 5HW6A 3O5RA 1OGGA 3OOBA 4ODOA 1B6CA 2PN0A 4DZ2A 3O5QA 4ODQA 1LL4A 3ARUA 1HKMA 4C02B 1W9VA 2A3EA 1KT1A 4MNJA 4DT4A 3O5FA 4L3NA 4DRJA 4UDMA 5GPGA 1J6YA 1H0GA 4DH0A 5HW8A 3O5KA 2DT0A 5J6EA 3KAHA 2KFWA 2DSUA 2DSZA 3O5MA 1ZBVA 2G41A 1WB0A 4MNMA 1TFVA 1FAPA 1R9HA 2DT1A 1EIBA 5DEZA 4MPKA 1QZ2A 1FKLA 3NTPA 2KR7A 4MGVA 3WD4A 5DIUA 2XPAA 1FKRA 2OFNA 3PA7A 4WK9A 4NZCA 5HTGA 3RFWA 4DRPA 2PI6A 3ARZA 3UI4A 1FD9A 2MLYA 1T11A 3ARSA 4QT3A 4L72B 2YBTA 2XP6A 3ARPA 1GPFA 5B8IC 4ODKA 2EULA 2XP3A 1O6IA 4ODMA 4R5EA 2M2AA 3NRKA 4TNSA 1ZBWA 1HJXA 4DZ3A 1NWRA 3VAWA 1QPLA 2M1IA 3IHZA 3CH9A 2AOSA 5HKGA 5BXJA 2KI3A 4DRKA 4DWSD 1ZBKA 3KAFA 1JNSA 2ZR5A 1BL4A 4P8UA 2IUZA 3ARYA 1NWTA 3O5EA 4DWSB 4ODNA 3AS3A 1J4IA 2K8IA 3O5LA 4DRQA 1EHNA 2WLZA 4WKAA 1ZK6A 3KCEA 4WIWA 4W9QA 5D75A 3WD0A 2D9FA 2XPBA 2B5UB 5DF0A 2WM0A 3NI6A 3AQUA 4WJXA 4LAVA 1W9PA 3ARQA 2RUDA 4DIPA 4G2PA 5HWCA 1D7HA 1ITXA 1FKSA 1TCOC 1J4HA 1HXVA 3WQWA 3JYMA 3WL0A 2OLHA 3EY6A 3PRDA 3WD1A 1JCHB 4TX0A 2P4VA 1NH6A 3FAPA 5HT1A 3UQAA 2MPHA 1YW5A 2F4EA 3GU0A 3PRBA 2RUQA 4GIVA 4AY1A 1X6NA 2VCDA 1KFWA 3UQIA 1FKIA 4P8VA 3ARRA 2DSWA 4ZS6A 4LAXA 1EQ3A 1IX5A 4QT2A 1LL7A 4Q22A 1P5QA 2F21A 3FY1A 3WH0A 4W5UA 3B9DA 4FN2A 2KO7A 1HKKA 2DG4A 2PBCA 4Z2LA 1NMVA 1H0IA 1GUVA 2MNTA 4ZPTR 1FKBA 1U79A 1Y0OA 4GGQA 4Z2HA 2RQSA 2DPEA 3KADA 4PTMA 2UZ5A 4DROA 1HKJA 5DIVA 5I98A 1SR0A 4DRHA 2DG9A 2QF8A 4S3JA 1W9UA 2B31A 3RM9A 4ML4A 2A3AA 3RMEA 5HW7A 2PPOA 2ZR6A 2XP7A 1ZCNA 1D2KA 1A7XA 2RUCA 2Y78A 3CHEA 4FAPA 4DRMA 1JNDA 3GPKA 3JXVA 2WK2A 4TW8A 5GPRA 2O9OA 4URIA 2A3CA 4ODPA 4TW7A 4JFMA 2ESCA 2ZQTA 2ITKA 4MNKA 1GOIA 3O5DA 3UI6A 3UQBA 4J4NA 5HUAA 3UF8A 2O92A 3KZ7A 2DT3A 3O5PA 4QZVB 3GTYX 2XP4A 1OGBA 3O5JA 3WKZA 4JFJA 4XAKA 3WD3A 1C9HA 2L2SA 4LGXA 1E9LA 1QPFA 4R0XA 1GRJA 2JZVA 1WAWA 2RURA 1E6NA 1PINA 3TCZA 3ARTA 2FDMA 1HKIA 4J4OA 3H9RB 5HWBA 4P8WA 2XP8A 1XHGA 2LKNA 1W1YA 1Q1CA 1NWUA 1M5YA 2Q5AA 3LUOA 1ROTA 4JFKA 4KR0B 3RM8A 1JVWA 2LJ4A 4MNLA 3TC5A 1UR8A 4U85A 4DRNA 4G50A 1OWQA 4W9OA 3AROA 1ZU8A 3PR9A 4TW6A 2DSVA 4NNRA 3ARVA 5DO2A 1LL6A 1E15A 1K9TA 3BMBA 1JNTA 3ARWA 1D7IA 4S3KA 3CZ8A 4HARA 1SYTA 2F2DA 1FFQA 2ETNA 4W9PA 1D6OA 2YBUA 2ZQSA 3AS2A 4JFLA 3G6MA 5GQBA 1NWSA 2ZR4A 3ODKA 3KACA 1J4RA 1LJYA 3W4RA 1UR9A 4JYSA 3B9AA 1HJVA 4P8XA 3UI5A 1Q6HA 1L1PA 3IK8A 1W1PA 3CGMA 1FKKA 3PRAA 3G6LA 2MLZA 1NSGA 3B9EA 4O2TA 2XP9A 4Q7NA 1YATA 2IF4A 1ZBCA 2FKEA 4IT6A 3I6CA 3CHDA 4MSPA 1WNOA 2PV2A 5DITA 1KT0A 2PV3A 2AWGA 1ZB5A 4KQZA 2F23A 1FKGA 1EDQA 1HJWA 4LAWA 4IQ2A 1W1VA 1X6LA 2KE0A 1N1AA 3JYJA 3OA5A 1FKHA 2G8ZA 3IKDA 4MAVA 1RD6A 3WD2A 5HBFA 1E6PA 4NSBA 3O5GA 3ALFA 4ODRA 1FKFA 4Z2IA 4U86A 1E6ZA 2VN1A 3KABA 4DWSC 2A3BA 1FKTA 3CGNA 1E44A 1FFRA 3RM4A 2PPNA 1W1TA 5JH8A 2PPPA 2ZQUA 3B8SA 1XRVA 1F8AB 4Z2GA 4HBOA 3O5IA 2LGOA 3ALGA 4TYOA 4U84A 1W26A 3WL1A 1Q6IA 2ZQVA 1LG1A 4ZPWR 4LAYA 3AS1A 2N87A
chains in the Genus database with same CATH topology
1FJDA 1Q6UA 3MDYB 4IT4A 3TDBA 1CTNA 1JNEA 4ITZA 3AS0A 2DG3A 3KAIA 3QOKA 3CHCA 1FKJA 2WLYA 4DRIA 3ARXA 4WKHA 3CHFA 3IKGA 2MF9A 4ZPVR 1D7JA 4N19A 2DT2A 4IQCA 4ODLA 3B7XA 1LQ0A 1E6RA 2MLXA 1BKFA 2M08A 3FXYA 4HBEA 2PV1A 2XP5A 1LG2A 1VF8A 4IPXA 3WIJA 1F40A 4JFIA 1NMWA 2RSEA 1ZL1A 1ROUA 2FAPA 4Z2KA 2KGJA 4BF8A 3RGCA 3O5OA 1PBKA 3KAGA 1EYMA 2LPVA 3BXWA 4WKFA 4MTVA 4QIBA 1FKDA 3WQVA 4DWSA 4Z2JA 5HW6A 3O5RA 1OGGA 3OOBA 4ODOA 1B6CA 4DZ2A 3O5QA 4ODQA 1LL4A 3ARUA 1HKMA 4C02B 1W9VA 2A3EA 1KT1A 4MNJA 4DT4A 3O5FA 4L3NA 4DRJA 5GPGA 1J6YA 1H0GA 4DH0A 5HW8A 3O5KA 2DT0A 5J6EA 3KAHA 2KFWA 2DSUA 2DSZA 3O5MA 1ZBVA 2G41A 1WB0A 4MNMA 1TFVA 1FAPA 1R9HA 2DT1A 1EIBA 5DEZA 4MPKA 1QZ2A 1FKLA 3NTPA 2KR7A 4MGVA 3WD4A 5DIUA 2XPAA 1FKRA 2OFNA 3PA7A 4WK9A 4NZCA 5HTGA 3RFWA 4DRPA 2PI6A 3ARZA 3UI4A 1FD9A 2MLYA 1T11A 3ARSA 4QT3A 4L72B 2YBTA 2XP6A 3ARPA 1GPFA 5B8IC 4ODKA 2XP3A 1O6IA 4ODMA 4R5EA 2M2AA 3NRKA 4TNSA 1ZBWA 1HJXA 4DZ3A 1NWRA 3VAWA 1QPLA 2M1IA 3IHZA 3CH9A 2AOSA 5HKGA 5BXJA 2KI3A 4DRKA 4DWSD 1ZBKA 3KAFA 1JNSA 2ZR5A 1BL4A 4P8UA 2IUZA 3ARYA 1NWTA 3O5EA 4DWSB 4ODNA 3AS3A 1J4IA 2K8IA 3O5LA 4DRQA 1EHNA 2WLZA 4WKAA 1ZK6A 3KCEA 4WIWA 4W9QA 5D75A 3WD0A 2D9FA 2XPBA 5DF0A 2WM0A 3NI6A 3AQUA 4WJXA 4LAVA 1W9PA 3ARQA 2RUDA 4DIPA 4G2PA 5HWCA 1D7HA 1ITXA 1FKSA 1TCOC 1J4HA 1HXVA 3WQWA 3JYMA 3WL0A 2OLHA 3EY6A 3PRDA 3WD1A 4TX0A 1NH6A 3FAPA 5HT1A 3UQAA 2MPHA 1YW5A 2F4EA 3PRBA 2RUQA 4GIVA 4AY1A 1X6NA 2VCDA 1KFWA 3UQIA 1FKIA 4P8VA 3ARRA 2DSWA 4ZS6A 4LAXA 1EQ3A 1IX5A 4QT2A 1LL7A 4Q22A 1P5QA 2F21A 3FY1A 3WH0A 4W5UA 3B9DA 4FN2A 2KO7A 1HKKA 2DG4A 2PBCA 4Z2LA 1NMVA 1H0IA 1GUVA 2MNTA 4ZPTR 1FKBA 1U79A 1Y0OA 4GGQA 4Z2HA 2RQSA 2DPEA 3KADA 4PTMA 2UZ5A 4DROA 1HKJA 5DIVA 5I98A 1SR0A 4DRHA 2DG9A 2QF8A 4S3JA 1W9UA 2B31A 3RM9A 4ML4A 2A3AA 3RMEA 5HW7A 2PPOA 2ZR6A 2XP7A 1ZCNA 1D2KA 1A7XA 2RUCA 2Y78A 3CHEA 4FAPA 4DRMA 1JNDA 3GPKA 3JXVA 2WK2A 4TW8A 5GPRA 2O9OA 4URIA 2A3CA 4ODPA 4TW7A 4JFMA 2ESCA 2ZQTA 2ITKA 4MNKA 1GOIA 3O5DA 3UI6A 3UQBA 4J4NA 5HUAA 3UF8A 2O92A 3KZ7A 2DT3A 3O5PA 4QZVB 2XP4A 1OGBA 3O5JA 3WKZA 4JFJA 4XAKA 3WD3A 1C9HA 2L2SA 4LGXA 1E9LA 1QPFA 4R0XA 2JZVA 1WAWA 2RURA 1E6NA 1PINA 3TCZA 3ARTA 2FDMA 1HKIA 4J4OA 3H9RB 5HWBA 4P8WA 2XP8A 1XHGA 2LKNA 1W1YA 1Q1CA 1NWUA 1M5YA 2Q5AA 3LUOA 1ROTA 4JFKA 4KR0B 3RM8A 1JVWA 2LJ4A 4MNLA 3TC5A 1UR8A 4U85A 4DRNA 4G50A 1OWQA 4W9OA 3AROA 1ZU8A 3PR9A 4TW6A 2DSVA 4NNRA 3ARVA 5DO2A 1LL6A 1E15A 1K9TA 1JNTA 3ARWA 1D7IA 4S3KA 3CZ8A 4HARA 1SYTA 2F2DA 1FFQA 4W9PA 1D6OA 2YBUA 2ZQSA 3AS2A 4JFLA 3G6MA 5GQBA 1NWSA 2ZR4A 3ODKA 3KACA 1J4RA 1LJYA 3W4RA 1UR9A 4JYSA 3B9AA 1HJVA 4P8XA 3UI5A 1Q6HA 1L1PA 3IK8A 1W1PA 3CGMA 1FKKA 3PRAA 3G6LA 2MLZA 1NSGA 3B9EA 4O2TA 2XP9A 4Q7NA 1YATA 2IF4A 1ZBCA 2FKEA 4IT6A 3I6CA 3CHDA 4MSPA 1WNOA 2PV2A 5DITA 1KT0A 2PV3A 2AWGA 1ZB5A 4KQZA 1FKGA 1EDQA 1HJWA 4LAWA 4IQ2A 1W1VA 1X6LA 2KE0A 1N1AA 3JYJA 3OA5A 1FKHA 2G8ZA 3IKDA 4MAVA 1RD6A 3WD2A 5HBFA 1E6PA 4NSBA 3O5GA 3ALFA 4ODRA 1FKFA 4Z2IA 4U86A 1E6ZA 2VN1A 3KABA 4DWSC 2A3BA 1FKTA 3CGNA 1FFRA 3RM4A 2PPNA 1W1TA 5JH8A 2PPPA 2ZQUA 3B8SA 1XRVA 1F8AB 4Z2GA 4HBOA 3O5IA 2LGOA 3ALGA 4TYOA 4U84A 1W26A 3WL1A 1Q6IA 2ZQVA 1LG1A 4ZPWR 4LAYA 3AS1A 2N87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJD A;  1Q6U A;  4TW6 A;  3UI4 A;  3MDY B;  4NNR A;  1FD9 A;  4QT2 A;  3TDB A;  4ITZ A;  1P5Q A;  2F21 A;  2MLY A;  1T11 A;  3WH0 A;  4QT3 A;  1JNT A;  4FN2 A;  2KO7 A;  2DG3 A;  3KAI A;  1D7I A;  2DG4 A;  2PBC A;  1NMV A;  1FKJ A;  2MNT A;  2XP6 A;  4DRI A;  1FKB A;  1U79 A;  1Y0O A;  3IKG A;  4GGQ A;  2RQS A;  2F2D A;  5B8I C;  4ODK A;  2MF9 A;  1D7J A;  2XP3 A;  3KAD A;  4W9P A;  4N19 A;  1D6O A;  4ODM A;  2UZ5 A;  4DRO A;  2M2A A;  2ZQS A;  3NRK A;  4TNS A;  4JFL A;  4IQC A;  5DIV A;  5I98 A;  2ZR4 A;  3ODK A;  4ODL A;  3B7X A;  4DRH A;  2DG9 A;  3KAC A;  1J4R A;  4DZ3 A;  2MLX A;  4JYS A;  1BKF A;  2M08 A;  3VAW A;  1QPL A;  2PV1 A;  3UI5 A;  1Q6H A;  2M1I A;  1L1P A;  3IHZ A;  3IK8 A;  5HKG A;  5HW7 A;  3CGM A;  1FKK A;  2PPO A;  2XP5 A;  2XP7 A;  1ZCN A;  2ZR6 A;  2KI3 A;  4IPX A;  4DRK A;  5BXJ A;  3KAF A;  2MLZ A;  1NSG A;  2ZR5 A;  4JFI A;  1BL4 A;  1F40 A;  1NMW A;  1JNS A;  1A7X A;  4O2T A;  2RUC A;  2RSE A;  2XP9 A;  2Y78 A;  3O5E A;  4DRM A;  3GPK A;  4FAP A;  1YAT A;  2IF4 A;  4ODN A;  3JXV A;  4TW8 A;  1J4I A;  1ROU A;  2FAP A;  2FKE A;  2K8I A;  2KGJ A;  3O5L A;  3I6C A;  4BF8 A;  4DRQ A;  3RGC A;  4MSP A;  3O5O A;  2PV2 A;  4ODP A;  1PBK A;  3KAG A;  1EYM A;  2LPV A;  4TW7 A;  5DIT A;  1KT0 A;  2PV3 A;  2AWG A;  4QIB A;  4JFM A;  1ZK6 A;  1FKD A;  2ZQT A;  2ITK A;  3KCE A;  3O5D A;  1FKG A;  4W9Q A;  5D75 A;  3UI6 A;  3UQB A;  4LAW A;  4IQ2 A;  2D9F A;  4J4N A;  5HUA A;  2XPB A;  5HW6 A;  3O5R A;  2KE0 A;  1N1A A;  3JYJ A;  3NI6 A;  3OOB A;  4ODO A;  3UF8 A;  3O5P A;  1B6C A;  3KZ7 A;  4DZ2 A;  4LAV A;  3O5Q A;  4ODQ A;  2XP4 A;  1FKH A;  2RUD A;  4C02 B;  3IKD A;  4DIP A;  3O5J A;  4G2P A;  1KT1 A;  4DT4 A;  5HWC A;  1D7H A;  1FKS A;  4JFJ A;  3O5F A;  1TCO C;  4DRJ A;  1J4H A;  1HXV A;  3O5G A;  3JYM A;  1C9H A;  2L2S A;  5GPG A;  4ODR A;  1FKF A;  3EY6 A;  4U86 A;  3PRD A;  1QPF A;  4R0X A;  1J6Y A;  2JZV A;  4DH0 A;  2VN1 A;  3KAB A;  3O5K A;  5HW8 A;  5J6E A;  1FKT A;  3CGN A;  2RUR A;  4TX0 A;  3KAH A;  1PIN A;  2KFW A;  3TCZ A;  2PPN A;  3O5M A;  1EQ3 A;  3FAP A;  2PPP A;  2ZQU A;  4J4O A;  1F8A B;  3H9R B;  1FAP A;  1R9H A;  5HT1 A;  5HWB A;  3UQA A;  2XP8 A;  2MPH A;  2LKN A;  1QZ2 A;  1FKL A;  3O5I A;  1Q1C A;  3NTP A;  2LGO A;  4TYO A;  4U84 A;  2KR7 A;  1YW5 A;  2F4E A;  4MGV A;  3PRB A;  1M5Y A;  2Q5A A;  3LUO A;  1ROT A;  4JFK A;  1W26 A;  2RUQ A;  2XPA A;  4GIV A;  5DIU A;  1FKR A;  2OFN A;  3PA7 A;  1JVW A;  1Q6I A;  2VCD A;  2LJ4 A;  2ZQV A;  3TC5 A;  3UQI A;  1FKI A;  4U85 A;  5HTG A;  4DRN A;  4G50 A;  3RFW A;  4LAY A;  4DRP A;  4W9O A;  2N87 A;  4LAX A; 
#chains in the Genus database with same CATH topology
 1FJD A;  1Q6U A;  3MDY B;  4IT4 A;  3TDB A;  1CTN A;  1JNE A;  4ITZ A;  3AS0 A;  2DG3 A;  3KAI A;  3QOK A;  3CHC A;  3EIP A;  1FKJ A;  2WLY A;  4DRI A;  3ARX A;  4WKH A;  3CHF A;  3IKG A;  2MF9 A;  4ZPV R;  1D7J A;  4N19 A;  2DT2 A;  4IQC A;  4ODL A;  3B7X A;  1LQ0 A;  1E6R A;  2MLX A;  1BKF A;  2M08 A;  3FXY A;  4HBE A;  2PV1 A;  2XP5 A;  1LG2 A;  1VF8 A;  4IPX A;  3WIJ A;  1F40 A;  4JFI A;  1NMW A;  2RSE A;  1ZL1 A;  1ROU A;  2FAP A;  4Z2K A;  2KGJ A;  4BF8 A;  3RGC A;  3O5O A;  1PBK A;  3KAG A;  1EYM A;  2LPV A;  3BXW A;  4WKF A;  4MTV A;  4QIB A;  1FKD A;  3WQV A;  4DWS A;  4Z2J A;  5HW6 A;  3O5R A;  1OGG A;  3OOB A;  4ODO A;  1B6C A;  2PN0 A;  4DZ2 A;  3O5Q A;  4ODQ A;  1LL4 A;  3ARU A;  1HKM A;  4C02 B;  1W9V A;  2A3E A;  1KT1 A;  4MNJ A;  4DT4 A;  3O5F A;  4L3N A;  4DRJ A;  4UDM A;  5GPG A;  1J6Y A;  1H0G A;  4DH0 A;  5HW8 A;  3O5K A;  2DT0 A;  5J6E A;  3KAH A;  2KFW A;  2DSU A;  2DSZ A;  3O5M A;  1ZBV A;  2G41 A;  1WB0 A;  4MNM A;  1TFV A;  1FAP A;  1R9H A;  2DT1 A;  1EIB A;  5DEZ A;  4MPK A;  1QZ2 A;  1FKL A;  3NTP A;  2KR7 A;  4MGV A;  3WD4 A;  5DIU A;  2XPA A;  1FKR A;  2OFN A;  3PA7 A;  4WK9 A;  4NZC A;  5HTG A;  3RFW A;  4DRP A;  2PI6 A;  3ARZ A;  3UI4 A;  1FD9 A;  2MLY A;  1T11 A;  3ARS A;  4QT3 A;  4L72 B;  2YBT A;  2XP6 A;  3ARP A;  1GPF A;  5B8I C;  4ODK A;  2EUL A;  2XP3 A;  1O6I A;  4ODM A;  4R5E A;  2M2A A;  3NRK A;  4TNS A;  1ZBW A;  1HJX A;  4DZ3 A;  1NWR A;  3VAW A;  1QPL A;  2M1I A;  3IHZ A;  3CH9 A;  2AOS A;  5HKG A;  5BXJ A;  2KI3 A;  4DRK A;  4DWS D;  1ZBK A;  3KAF A;  1JNS A;  2ZR5 A;  1BL4 A;  4P8U A;  2IUZ A;  3ARY A;  1NWT A;  3O5E A;  4DWS B;  4ODN A;  3AS3 A;  1J4I A;  2K8I A;  3O5L A;  4DRQ A;  1EHN A;  2WLZ A;  4WKA A;  1ZK6 A;  3KCE A;  4WIW A;  4W9Q A;  5D75 A;  3WD0 A;  2D9F A;  2XPB A;  2B5U B;  5DF0 A;  2WM0 A;  3NI6 A;  3AQU A;  4WJX A;  4LAV A;  1W9P A;  3ARQ A;  2RUD A;  4DIP A;  4G2P A;  5HWC A;  1D7H A;  1ITX A;  1FKS A;  1TCO C;  1J4H A;  1HXV A;  3WQW A;  3JYM A;  3WL0 A;  2OLH A;  3EY6 A;  3PRD A;  3WD1 A;  1JCH B;  4TX0 A;  2P4V A;  1NH6 A;  3FAP A;  5HT1 A;  3UQA A;  2MPH A;  1YW5 A;  2F4E A;  3GU0 A;  3PRB A;  2RUQ A;  4GIV A;  4AY1 A;  1X6N A;  2VCD A;  1KFW A;  3UQI A;  1FKI A;  4P8V A;  3ARR A;  2DSW A;  4ZS6 A;  4LAX A;  1EQ3 A;  1IX5 A;  4QT2 A;  1LL7 A;  4Q22 A;  1P5Q A;  2F21 A;  3FY1 A;  3WH0 A;  4W5U A;  3B9D A;  4FN2 A;  2KO7 A;  1HKK A;  2DG4 A;  2PBC A;  4Z2L A;  1NMV A;  1H0I A;  1GUV A;  2MNT A;  4ZPT R;  1FKB A;  1U79 A;  1Y0O A;  4GGQ A;  4Z2H A;  2RQS A;  2DPE A;  3KAD A;  4PTM A;  2UZ5 A;  4DRO A;  1HKJ A;  5DIV A;  5I98 A;  1SR0 A;  4DRH A;  2DG9 A;  2QF8 A;  4S3J A;  1W9U A;  2B31 A;  3RM9 A;  4ML4 A;  2A3A A;  3RME A;  5HW7 A;  2PPO A;  2ZR6 A;  2XP7 A;  1ZCN A;  1D2K A;  1A7X A;  2RUC A;  2Y78 A;  3CHE A;  4FAP A;  4DRM A;  1JND A;  3GPK A;  3JXV A;  2WK2 A;  4TW8 A;  5GPR A;  2O9O A;  4URI A;  2A3C A;  4ODP A;  4TW7 A;  4JFM A;  2ESC A;  2ZQT A;  2ITK A;  4MNK A;  1GOI A;  3O5D A;  3UI6 A;  3UQB A;  4J4N A;  5HUA A;  3UF8 A;  2O92 A;  3KZ7 A;  2DT3 A;  3O5P A;  4QZV B;  3GTY X;  2XP4 A;  1OGB A;  3O5J A;  3WKZ A;  4JFJ A;  4XAK A;  3WD3 A;  1C9H A;  2L2S A;  4LGX A;  1E9L A;  1QPF A;  4R0X A;  1GRJ A;  2JZV A;  1WAW A;  2RUR A;  1E6N A;  1PIN A;  3TCZ A;  3ART A;  2FDM A;  1HKI A;  4J4O A;  3H9R B;  5HWB A;  4P8W A;  2XP8 A;  1XHG A;  2LKN A;  1W1Y A;  1Q1C A;  1NWU A;  1M5Y A;  2Q5A A;  3LUO A;  1ROT A;  4JFK A;  4KR0 B;  3RM8 A;  1JVW A;  2LJ4 A;  4MNL A;  3TC5 A;  1UR8 A;  4U85 A;  4DRN A;  4G50 A;  1OWQ A;  4W9O A;  3ARO A;  1ZU8 A;  3PR9 A;  4TW6 A;  2DSV A;  4NNR A;  3ARV A;  5DO2 A;  1LL6 A;  1E15 A;  1K9T A;  3BMB A;  1JNT A;  3ARW A;  1D7I A;  4S3K A;  3CZ8 A;  4HAR A;  1SYT A;  2F2D A;  1FFQ A;  2ETN A;  4W9P A;  1D6O A;  2YBU A;  2ZQS A;  3AS2 A;  4JFL A;  3G6M A;  5GQB A;  1NWS A;  2ZR4 A;  3ODK A;  3KAC A;  1J4R A;  1LJY A;  3W4R A;  1UR9 A;  4JYS A;  3B9A A;  1HJV A;  4P8X A;  3UI5 A;  1Q6H A;  1L1P A;  3IK8 A;  1W1P A;  3CGM A;  1FKK A;  3PRA A;  3G6L A;  2MLZ A;  1NSG A;  3B9E A;  4O2T A;  2XP9 A;  4Q7N A;  1YAT A;  2IF4 A;  1ZBC A;  2FKE A;  4IT6 A;  3I6C A;  3CHD A;  4MSP A;  1WNO A;  2PV2 A;  5DIT A;  1KT0 A;  2PV3 A;  2AWG A;  1ZB5 A;  4KQZ A;  2F23 A;  1FKG A;  1EDQ A;  1HJW A;  4LAW A;  4IQ2 A;  1W1V A;  1X6L A;  2KE0 A;  1N1A A;  3JYJ A;  3OA5 A;  1FKH A;  2G8Z A;  3IKD A;  4MAV A;  1RD6 A;  3WD2 A;  5HBF A;  1E6P A;  4NSB A;  3O5G A;  3ALF A;  4ODR A;  1FKF A;  4Z2I A;  4U86 A;  1E6Z A;  2VN1 A;  3KAB A;  4DWS C;  2A3B A;  1FKT A;  3CGN A;  1E44 A;  1FFR A;  3RM4 A;  2PPN A;  1W1T A;  5JH8 A;  2PPP A;  2ZQU A;  3B8S A;  1XRV A;  1F8A B;  4Z2G A;  4HBO A;  3O5I A;  2LGO A;  3ALG A;  4TYO A;  4U84 A;  1W26 A;  3WL1 A;  1Q6I A;  2ZQV A;  1LG1 A;  4ZPW R;  4LAY A;  3AS1 A;  2N87 A; 
#chains in the Genus database with same CATH homology
 1FJD A;  1Q6U A;  3MDY B;  4IT4 A;  3TDB A;  1CTN A;  1JNE A;  4ITZ A;  3AS0 A;  2DG3 A;  3KAI A;  3QOK A;  3CHC A;  1FKJ A;  2WLY A;  4DRI A;  3ARX A;  4WKH A;  3CHF A;  3IKG A;  2MF9 A;  4ZPV R;  1D7J A;  4N19 A;  2DT2 A;  4IQC A;  4ODL A;  3B7X A;  1LQ0 A;  1E6R A;  2MLX A;  1BKF A;  2M08 A;  3FXY A;  4HBE A;  2PV1 A;  2XP5 A;  1LG2 A;  1VF8 A;  4IPX A;  3WIJ A;  1F40 A;  4JFI A;  1NMW A;  2RSE A;  1ZL1 A;  1ROU A;  2FAP A;  4Z2K A;  2KGJ A;  4BF8 A;  3RGC A;  3O5O A;  1PBK A;  3KAG A;  1EYM A;  2LPV A;  3BXW A;  4WKF A;  4MTV A;  4QIB A;  1FKD A;  3WQV A;  4DWS A;  4Z2J A;  5HW6 A;  3O5R A;  1OGG A;  3OOB A;  4ODO A;  1B6C A;  4DZ2 A;  3O5Q A;  4ODQ A;  1LL4 A;  3ARU A;  1HKM A;  4C02 B;  1W9V A;  2A3E A;  1KT1 A;  4MNJ A;  4DT4 A;  3O5F A;  4L3N A;  4DRJ A;  5GPG A;  1J6Y A;  1H0G A;  4DH0 A;  5HW8 A;  3O5K A;  2DT0 A;  5J6E A;  3KAH A;  2KFW A;  2DSU A;  2DSZ A;  3O5M A;  1ZBV A;  2G41 A;  1WB0 A;  4MNM A;  1TFV A;  1FAP A;  1R9H A;  2DT1 A;  1EIB A;  5DEZ A;  4MPK A;  1QZ2 A;  1FKL A;  3NTP A;  2KR7 A;  4MGV A;  3WD4 A;  5DIU A;  2XPA A;  1FKR A;  2OFN A;  3PA7 A;  4WK9 A;  4NZC A;  5HTG A;  3RFW A;  4DRP A;  2PI6 A;  3ARZ A;  3UI4 A;  1FD9 A;  2MLY A;  1T11 A;  3ARS A;  4QT3 A;  4L72 B;  2YBT A;  2XP6 A;  3ARP A;  1GPF A;  5B8I C;  4ODK A;  2XP3 A;  1O6I A;  4ODM A;  4R5E A;  2M2A A;  3NRK A;  4TNS A;  1ZBW A;  1HJX A;  4DZ3 A;  1NWR A;  3VAW A;  1QPL A;  2M1I A;  3IHZ A;  3CH9 A;  2AOS A;  5HKG A;  5BXJ A;  2KI3 A;  4DRK A;  4DWS D;  1ZBK A;  3KAF A;  1JNS A;  2ZR5 A;  1BL4 A;  4P8U A;  2IUZ A;  3ARY A;  1NWT A;  3O5E A;  4DWS B;  4ODN A;  3AS3 A;  1J4I A;  2K8I A;  3O5L A;  4DRQ A;  1EHN A;  2WLZ A;  4WKA A;  1ZK6 A;  3KCE A;  4WIW A;  4W9Q A;  5D75 A;  3WD0 A;  2D9F A;  2XPB A;  5DF0 A;  2WM0 A;  3NI6 A;  3AQU A;  4WJX A;  4LAV A;  1W9P A;  3ARQ A;  2RUD A;  4DIP A;  4G2P A;  5HWC A;  1D7H A;  1ITX A;  1FKS A;  1TCO C;  1J4H A;  1HXV A;  3WQW A;  3JYM A;  3WL0 A;  2OLH A;  3EY6 A;  3PRD A;  3WD1 A;  4TX0 A;  1NH6 A;  3FAP A;  5HT1 A;  3UQA A;  2MPH A;  1YW5 A;  2F4E A;  3PRB A;  2RUQ A;  4GIV A;  4AY1 A;  1X6N A;  2VCD A;  1KFW A;  3UQI A;  1FKI A;  4P8V A;  3ARR A;  2DSW A;  4ZS6 A;  4LAX A;  1EQ3 A;  1IX5 A;  4QT2 A;  1LL7 A;  4Q22 A;  1P5Q A;  2F21 A;  3FY1 A;  3WH0 A;  4W5U A;  3B9D A;  4FN2 A;  2KO7 A;  1HKK A;  2DG4 A;  2PBC A;  4Z2L A;  1NMV A;  1H0I A;  1GUV A;  2MNT A;  4ZPT R;  1FKB A;  1U79 A;  1Y0O A;  4GGQ A;  4Z2H A;  2RQS A;  2DPE A;  3KAD A;  4PTM A;  2UZ5 A;  4DRO A;  1HKJ A;  5DIV A;  5I98 A;  1SR0 A;  4DRH A;  2DG9 A;  2QF8 A;  4S3J A;  1W9U A;  2B31 A;  3RM9 A;  4ML4 A;  2A3A A;  3RME A;  5HW7 A;  2PPO A;  2ZR6 A;  2XP7 A;  1ZCN A;  1D2K A;  1A7X A;  2RUC A;  2Y78 A;  3CHE A;  4FAP A;  4DRM A;  1JND A;  3GPK A;  3JXV A;  2WK2 A;  4TW8 A;  5GPR A;  2O9O A;  4URI A;  2A3C A;  4ODP A;  4TW7 A;  4JFM A;  2ESC A;  2ZQT A;  2ITK A;  4MNK A;  1GOI A;  3O5D A;  3UI6 A;  3UQB A;  4J4N A;  5HUA A;  3UF8 A;  2O92 A;  3KZ7 A;  2DT3 A;  3O5P A;  4QZV B;  2XP4 A;  1OGB A;  3O5J A;  3WKZ A;  4JFJ A;  4XAK A;  3WD3 A;  1C9H A;  2L2S A;  4LGX A;  1E9L A;  1QPF A;  4R0X A;  2JZV A;  1WAW A;  2RUR A;  1E6N A;  1PIN A;  3TCZ A;  3ART A;  2FDM A;  1HKI A;  4J4O A;  3H9R B;  5HWB A;  4P8W A;  2XP8 A;  1XHG A;  2LKN A;  1W1Y A;  1Q1C A;  1NWU A;  1M5Y A;  2Q5A A;  3LUO A;  1ROT A;  4JFK A;  4KR0 B;  3RM8 A;  1JVW A;  2LJ4 A;  4MNL A;  3TC5 A;  1UR8 A;  4U85 A;  4DRN A;  4G50 A;  1OWQ A;  4W9O A;  3ARO A;  1ZU8 A;  3PR9 A;  4TW6 A;  2DSV A;  4NNR A;  3ARV A;  5DO2 A;  1LL6 A;  1E15 A;  1K9T A;  1JNT A;  3ARW A;  1D7I A;  4S3K A;  3CZ8 A;  4HAR A;  1SYT A;  2F2D A;  1FFQ A;  4W9P A;  1D6O A;  2YBU A;  2ZQS A;  3AS2 A;  4JFL A;  3G6M A;  5GQB A;  1NWS A;  2ZR4 A;  3ODK A;  3KAC A;  1J4R A;  1LJY A;  3W4R A;  1UR9 A;  4JYS A;  3B9A A;  1HJV A;  4P8X A;  3UI5 A;  1Q6H A;  1L1P A;  3IK8 A;  1W1P A;  3CGM A;  1FKK A;  3PRA A;  3G6L A;  2MLZ A;  1NSG A;  3B9E A;  4O2T A;  2XP9 A;  4Q7N A;  1YAT A;  2IF4 A;  1ZBC A;  2FKE A;  4IT6 A;  3I6C A;  3CHD A;  4MSP A;  1WNO A;  2PV2 A;  5DIT A;  1KT0 A;  2PV3 A;  2AWG A;  1ZB5 A;  4KQZ A;  1FKG A;  1EDQ A;  1HJW A;  4LAW A;  4IQ2 A;  1W1V A;  1X6L A;  2KE0 A;  1N1A A;  3JYJ A;  3OA5 A;  1FKH A;  2G8Z A;  3IKD A;  4MAV A;  1RD6 A;  3WD2 A;  5HBF A;  1E6P A;  4NSB A;  3O5G A;  3ALF A;  4ODR A;  1FKF A;  4Z2I A;  4U86 A;  1E6Z A;  2VN1 A;  3KAB A;  4DWS C;  2A3B A;  1FKT A;  3CGN A;  1FFR A;  3RM4 A;  2PPN A;  1W1T A;  5JH8 A;  2PPP A;  2ZQU A;  3B8S A;  1XRV A;  1F8A B;  4Z2G A;  4HBO A;  3O5I A;  2LGO A;  3ALG A;  4TYO A;  4U84 A;  1W26 A;  3WL1 A;  1Q6I A;  2ZQV A;  1LG1 A;  4ZPW R;  4LAY A;  3AS1 A;  2N87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...