5B8IC

Crystal structure of calcineurin a and calcineurin b in complex with fkbp12 and fk506 from coccidioides immitis rs
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
GVTKKILKEGNGVDKPVKGDDIVMNYRGCLYDSSKPSEHFMGRKFDSTEERGEFKTKIGIGVVIRGWDEAVLQMSLGEKSILTITDDYAYGARGFPGLIPPHATLVFEVELKGINSKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Calcineurin A and Calcineurin B in complex with FKBP12 and FK506 from Coccidioides immitis RS
rcsb
source organism Coccidioides immitis (strain rs)
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5b8iC00
4N19A 1YW5A 4QIBA 4DZ2A 3NTPA 5HWBA 3JYJA 3UI6A 2ITKA 2M2AA 3IKGA 1Q6HA 4FN2A 1JNSA 3O5GA 4DT4A 4IQ2A 1C9HA 4ITZA 1D7HA 1J4IA 1HXVA 4TW6A 3NRKA 4DZ3A 2MLXA 2PPOA 1T11A 2XP7A 3KADA 2RUCA 4LAVA 5DITA 4C02B 4ODOA 4DRQA 4JFKA 1KT1A 2IF4A 4DRPA 2F21A 4LAYA 4DRIA 3RFWA 3KAGA 1FKRA 1FKIA 2XP9A 3TC5A 2ZR5A 4U84A 3O5JA 3MDYB 1FKJA 2LGOA 2L2SA 4ODKA 5HKGA 2KO7A 4DRNA 2KR7A 2DG3A 4NNRA 3KZ7A 1Y0OA 3UQAA 1FKGA 4ODLA 5HUAA 2XPBA 3TDBA 1PINA 2N87A 1BL4A 4DRHA 2RUQA 2DG9A 2MNTA 3UQIA 2VN1A 2UZ5A 2KFWA 1KT0A 2DG4A 3JXVA 1Q6IA 1Q6UA 4JFMA 3JYMA 2PV1A 4DH0A 2ZQVA 2RUDA 1FD9A 2Y78A 4W9QA 1EQ3A 2XP8A 3KACA 4TNSA 1D7JA 3IHZA 4JFLA 4JYSA 3CGMA 3LUOA 1L1PA 1J6YA 2XP3A 2AWGA 3UQBA 1QPFA 2RQSA 1ZCNA 4JFIA 2M08A 2D9FA 5HTGA 1P5QA 5I98A 1ROTA 3ODKA 1F40A 4DIPA 1FKFA 3PRBA 3IKDA 4U86A 4TX0A 1JVWA 4G50A 4TW8A 5HW7A 4MSPA 1W26A 2LPVA 2ZQSA 2ZQUA 4LAXA 2FAPA 4DRJA 3KABA 2FKEA 5B8IC 2PBCA 2RSEA 2KI3A 3TCZA 1NMVA 4QT2A 3FAPA 1JNTA 1ROUA 1QZ2A 3B7XA 3I6CA 2Q5AA 3O5DA 4DRKA 3CGNA 1EYMA 4ODMA 2MLZA 2XP4A 3NI6A 4W9PA 1M5YA 2M1IA 5D75A 1J4RA 4J4OA 3UI5A 1FKBA 3KAFA 1U79A 1ZK6A 2RURA 2XP5A 5HT1A 5HW6A 4QT3A 1FKHA 2PPNA 3O5FA 2PPPA 5HWCA 1FJDA 3UI4A 4R0XA 4TYOA 2F2DA 2PV2A 4GGQA 3VAWA 3O5MA 4LAWA 4DRMA 1FAPA 3GPKA 3PA7A 3KAHA 3WH0A 3O5EA 4IPXA 2KE0A 2MF9A 3O5KA 3O5OA 5GPGA 4BF8A 1D7IA 4DROA 2LKNA 4ODNA 1FKSA 1F8AB 1FKLA 2OFNA 1NSGA 1R9HA 1D6OA 1A7XA 1Q1CA 3O5IA 1YATA 2ZR6A 3PRDA 3UF8A 1BKFA 3OOBA 4GIVA 1N1AA 2K8IA 1FKKA 2MLYA 1NMWA 2KGJA 1QPLA 3O5RA 2VCDA 4O2TA 4W9OA 3O5QA 4ODPA 3RGCA 4IQCA 1FKDA 2MPHA 2XP6A 4U85A 2ZQTA 3O5LA 2JZVA 4ODQA 5DIUA 2XPAA 2ZR4A 1PBKA 5DIVA 3IK8A 2F4EA 5HW8A 3EY6A 1J4HA 3H9RB 4MGVA 2PV3A 4G2PA 4FAPA 5BXJA 3KAIA 3O5PA 4JFJA 4J4NA 1TCOC 4TW7A 3KCEA 2LJ4A 4ODRA 5J6EA 1FKTA 1B6CA
chains in the Genus database with same CATH superfamily
4QIBA 3ARQA 1ZBCA 3BMBA 2M2AA 1NWUA 3O5GA 4IQ2A 1C9HA 1J4IA 1HXVA 2DSUA 3KADA 4MAVA 4Z2LA 5DITA 1KT1A 2F21A 4LAYA 4DRIA 3KAGA 1FKRA 2XP9A 2ZR5A 3MDYB 4MNLA 4ODKA 3ARTA 3WD3A 2KO7A 1LJYA 4UDMA 1E6PA 2DSWA 1GOIA 3FXYA 4S3KA 2MNTA 3UQIA 1WAWA 3JXVA 2DPEA 3WL1A 5DEZA 4W9QA 4R5EA 4ML4A 2F23A 3LUOA 1L1PA 1IX5A 2AOSA 1NH6A 3WD4A 5I98A 1CTNA 4KR0B 1ZBKA 3ODKA 3PRBA 4TX0A 1JVWA 4MSPA 2A3CA 2LPVA 2ETNA 2RSEA 3FY1A 1ZB5A 4QT2A 3ARSA 1JNTA 3I6CA 2PN0A 3AS2A 4DRKA 3WQWA 1EYMA 4ZS6A 3ARRA 3RMEA 1FKBA 3CHEA 3OA5A 5HW6A 1FKHA 4DWSA 4Q7NA 3UI4A 2PV2A 1ZBWA 3PA7A 4DWSB 3KAHA 3WH0A 4DRNA 3GTYX 3O5KA 3O5OA 4URIA 4ODNA 1F8AB 1SR0A 4ZPTR 3WQVA 4P8WA 4LGXA 2ZR6A 1LL4A 4MNJA 1NMWA 1ZL1A 3ARUA 2ESCA 4MPKA 3O5QA 4AY1A 4WKHA 3O5LA 4ODQA 1HKIA 1GRJA 2XPAA 2ZR4A 1PBKA 3IK8A 5DF0A 4DWSD 5HW8A 3EY6A 1EHNA 3KAIA 4JFJA 4MNMA 4J4NA 4ODRA 3VAWA 1LL6A 3NTPA 5HWBA 1O6IA 2ITKA 1Q6HA 4WIWA 1UR9A 3RM9A 3B9AA 3AQUA 2DSVA 2XP7A 4XAKA 4C02B 4JFKA 4DRPA 4IT6A 2FDMA 1XRVA 4HARA 3GU0A 3TC5A 1XHGA 2IUZA 3B9DA 2QF8A 2LGOA 1EDQA 4QZVB 4NNRA 1Y0OA 2DT2A 5HUAA 4DRHA 2DG9A 2VN1A 1K9TA 2DG4A 2DSZA 1Q6UA 1RD6A 1FD9A 3CH9A 4L72B 1J6YA 1W1TA 1OWQA 4P8XA 1ZCNA 4NZCA 1HKMA 1P5QA 1ROTA 1FKFA 1W9VA 3IKDA 4Z2HA 4TW8A 3AS3A 3W4RA 1FFQA 2P4VA 1W9UA 4LAXA 2FAPA 4DRJA 2KI3A 3TCZA 1W1YA 3AROA 3CHCA 2B5UB 1ROUA 1QZ2A 1NWTA 4W9PA 2MLZA 2XP4A 3NI6A 1M5YA 1J4RA 1E9LA 1ZK6A 4P8VA 2PPNA 1HJVA 4R0XA 4P8UA 2F2DA 3O5MA 5GQBA 5JH8A 3ALGA 3O5EA 4BF8A 3CHDA 1D7IA 1X6NA 2A3EA 2OFNA 1NSGA 1R9HA 1Q1CA 1YATA 3PRDA 3UF8A 1LG2A 1BKFA 4HBEA 1N1AA 2K8IA 1H0GA 4O2TA 4W9OA 4ODPA 3CHFA 3PRAA 4IQCA 2WM0A 4U85A 2ZQTA 3WL0A 4Q22A 4MTVA 1OGBA 3ARZA 3H9RB 4MGVA 5BXJA 3KCEA 1F40A 3ARPA 1B6CA 1GUVA 4N19A 4S3JA 2DT1A 3JYJA 3UI6A 3IKGA 4FN2A 1JNSA 2O9OA 3B9EA 1W1VA 4DT4A 4ITZA 1LL7A 4TW6A 3NRKA 3ARXA 4DZ3A 2MLXA 4LAVA 4DRQA 2IF4A 1ZU8A 1GPFA 1HKJA 4U84A 3O5JA 1FKJA 2DG3A 2WLYA 3AS1A 2XPBA 1NWSA 2RUQA 2UZ5A 2KFWA 1KT0A 3BXWA 1JNEA 1Q6IA 3JYMA 2PV1A 2ZQVA 4WJXA 3RM8A 2RUDA 1EQ3A 2XP8A 3KACA 4TNSA 1D7JA 3IHZA 4JFLA 2XP3A 2AWGA 1LG1A 3CZ8A 5DO2A 2RQSA 4JFIA 2PI6A 4Z2JA 2D9FA 5HBFA 1JNDA 1W26A 3KABA 5B8IC 2PBCA 2DT0A 1E15A 3FAPA 1E6NA 3B7XA 3WKZA 3CGNA 4IT4A 5D75A 1VF8A 3UI5A 1WNOA 3KAFA 1U79A 1E44A 2RURA 2XP5A 4Z2IA 4QT3A 4GGQA 4KQZA 4DRMA 2KE0A 1HKKA 3WD0A 4DROA 1FKSA 1H0IA 3ALFA 3ARVA 3B8SA 4GIVA 1LQ0A 3O5RA 1HJXA 3QOKA 2MPHA 2XP6A 2YBUA 2JZVA 5DIUA 4HBOA 4NSBA 2OLHA 4Z2KA 4FAPA 1SYTA 2PV3A 4G2PA 4W5UA 3ARWA 3O5PA 2LJ4A 5J6EA 1YW5A 4DZ2A 4Z2GA 2WK2A 1D7HA 2PPOA 1T11A 2RUCA 2A3BA 1E6RA 4ODOA 3RFWA 1FKIA 1UR8A 5HKGA 2L2SA 2A3AA 2KR7A 3KZ7A 3UQAA 1E6ZA 1FKGA 4ODLA 1FFRA 4WK9A 1PINA 2N87A 3TDBA 1BL4A 1W1PA 4WKFA 2G8ZA 1OGGA 4JFMA 4DH0A 2Y78A 4L3NA 1JCHB 4JYSA 3CGMA 3RM4A 2YBTA 3UQBA 1QPFA 3G6MA 2M08A 5HTGA 3WIJA 4DIPA 2EULA 4U86A 1W9PA 4G50A 4PTMA 1NWRA 5HW7A 2ZQSA 2ZQUA 5GPRA 2FKEA 1ITXA 2WLZA 1NMVA 1D2KA 4DWSC 1ZBVA 3G6LA 1KFWA 2G41A 3WD1A 3O5DA 2Q5AA 1HJWA 4ODMA 2M1IA 4MNKA 3AS0A 4J4OA 5HT1A 3PR9A 3O5FA 5HWCA 2PPPA 1FJDA 4TYOA 2DT3A 3ARYA 4LAWA 1FAPA 3GPKA 3WD2A 4IPXA 2MF9A 5GPGA 2LKNA 1FKLA 1EIBA 1D6OA 1A7XA 3O5IA 3OOBA 1FKKA 2MLYA 2KGJA 2O92A 1QPLA 2B31A 2VCDA 1TFVA 3RGCA 3EIPA 1FKDA 5DIVA 2F4EA 4ZPWR 1X6LA 4ZPVR 1J4HA 1WB0A 1TCOC 4TW7A 1FKTA 4WKAA
chains in the Genus database with same CATH topology
4QIBA 3ARQA 1ZBCA 2M2AA 1NWUA 3O5GA 4IQ2A 1C9HA 1J4IA 1HXVA 2DSUA 3KADA 4MAVA 4Z2LA 5DITA 1KT1A 2F21A 4LAYA 4DRIA 3KAGA 1FKRA 2XP9A 2ZR5A 3MDYB 4MNLA 4ODKA 3ARTA 3WD3A 2KO7A 1LJYA 1E6PA 2DSWA 1GOIA 3FXYA 4S3KA 2MNTA 3UQIA 1WAWA 3JXVA 2DPEA 3WL1A 5DEZA 4W9QA 4R5EA 4ML4A 3LUOA 1L1PA 1IX5A 2AOSA 1NH6A 3WD4A 5I98A 1CTNA 4KR0B 1ZBKA 3ODKA 3PRBA 4TX0A 1JVWA 4MSPA 2A3CA 2LPVA 2RSEA 3FY1A 1ZB5A 4QT2A 3ARSA 1JNTA 3I6CA 3AS2A 4DRKA 3WQWA 1EYMA 4ZS6A 3ARRA 3RMEA 1FKBA 3CHEA 3OA5A 5HW6A 1FKHA 4DWSA 4Q7NA 3UI4A 2PV2A 1ZBWA 3PA7A 4DWSB 3KAHA 3WH0A 4DRNA 3O5KA 3O5OA 4URIA 4ODNA 1F8AB 1SR0A 4ZPTR 3WQVA 4P8WA 4LGXA 2ZR6A 1LL4A 4MNJA 1NMWA 1ZL1A 3ARUA 2ESCA 4MPKA 3O5QA 4AY1A 4WKHA 3O5LA 4ODQA 1HKIA 2XPAA 2ZR4A 1PBKA 3IK8A 5DF0A 4DWSD 5HW8A 3EY6A 1EHNA 3KAIA 4JFJA 4MNMA 4J4NA 4ODRA 3VAWA 1LL6A 3NTPA 5HWBA 1O6IA 2ITKA 1Q6HA 4WIWA 1UR9A 3RM9A 3B9AA 3AQUA 2DSVA 2XP7A 4XAKA 4C02B 4JFKA 4DRPA 4IT6A 2FDMA 1XRVA 4HARA 3TC5A 1XHGA 2IUZA 3B9DA 2QF8A 2LGOA 1EDQA 4QZVB 4NNRA 1Y0OA 2DT2A 5HUAA 4DRHA 2DG9A 2VN1A 1K9TA 2DG4A 2DSZA 1Q6UA 1RD6A 1FD9A 3CH9A 4L72B 1J6YA 1W1TA 1OWQA 4P8XA 1ZCNA 4NZCA 1HKMA 1P5QA 1ROTA 1FKFA 1W9VA 3IKDA 4Z2HA 4TW8A 3AS3A 3W4RA 1FFQA 1W9UA 4LAXA 2FAPA 4DRJA 2KI3A 3TCZA 1W1YA 3AROA 3CHCA 1ROUA 1QZ2A 1NWTA 4W9PA 2MLZA 2XP4A 3NI6A 1M5YA 1J4RA 1E9LA 1ZK6A 4P8VA 2PPNA 1HJVA 4R0XA 4P8UA 2F2DA 3O5MA 5GQBA 5JH8A 3ALGA 3O5EA 4BF8A 3CHDA 1D7IA 1X6NA 2A3EA 2OFNA 1NSGA 1R9HA 1Q1CA 1YATA 3PRDA 3UF8A 1LG2A 1BKFA 4HBEA 1N1AA 2K8IA 1H0GA 4O2TA 4W9OA 4ODPA 3CHFA 3PRAA 4IQCA 2WM0A 4U85A 2ZQTA 3WL0A 4Q22A 4MTVA 1OGBA 3ARZA 3H9RB 4MGVA 5BXJA 3KCEA 1F40A 3ARPA 1B6CA 1GUVA 4N19A 4S3JA 2DT1A 3JYJA 3UI6A 3IKGA 4FN2A 1JNSA 2O9OA 3B9EA 1W1VA 4DT4A 4ITZA 1LL7A 4TW6A 3NRKA 3ARXA 4DZ3A 2MLXA 4LAVA 4DRQA 2IF4A 1ZU8A 1GPFA 1HKJA 4U84A 3O5JA 1FKJA 2DG3A 2WLYA 3AS1A 2XPBA 1NWSA 2RUQA 2UZ5A 2KFWA 1KT0A 3BXWA 1JNEA 1Q6IA 3JYMA 2PV1A 2ZQVA 4WJXA 3RM8A 2RUDA 1EQ3A 2XP8A 3KACA 4TNSA 1D7JA 3IHZA 4JFLA 2XP3A 2AWGA 1LG1A 3CZ8A 5DO2A 2RQSA 4JFIA 2PI6A 4Z2JA 2D9FA 5HBFA 1JNDA 1W26A 3KABA 5B8IC 2PBCA 2DT0A 1E15A 3FAPA 1E6NA 3B7XA 3WKZA 3CGNA 4IT4A 5D75A 1VF8A 3UI5A 1WNOA 3KAFA 1U79A 2RURA 2XP5A 4Z2IA 4QT3A 4GGQA 4KQZA 4DRMA 2KE0A 1HKKA 3WD0A 4DROA 1FKSA 1H0IA 3ALFA 3ARVA 3B8SA 4GIVA 1LQ0A 3O5RA 1HJXA 3QOKA 2MPHA 2XP6A 2YBUA 2JZVA 5DIUA 4HBOA 4NSBA 2OLHA 4Z2KA 4FAPA 1SYTA 2PV3A 4G2PA 4W5UA 3ARWA 3O5PA 2LJ4A 5J6EA 1YW5A 4DZ2A 4Z2GA 2WK2A 1D7HA 2PPOA 1T11A 2RUCA 2A3BA 1E6RA 4ODOA 3RFWA 1FKIA 1UR8A 5HKGA 2L2SA 2A3AA 2KR7A 3KZ7A 3UQAA 1E6ZA 1FKGA 4ODLA 1FFRA 4WK9A 1PINA 2N87A 3TDBA 1BL4A 1W1PA 4WKFA 2G8ZA 1OGGA 4JFMA 4DH0A 2Y78A 4L3NA 4JYSA 3CGMA 3RM4A 2YBTA 3UQBA 1QPFA 3G6MA 2M08A 5HTGA 3WIJA 4DIPA 4U86A 1W9PA 4G50A 4PTMA 1NWRA 5HW7A 2ZQSA 2ZQUA 5GPRA 2FKEA 1ITXA 2WLZA 1NMVA 1D2KA 4DWSC 1ZBVA 3G6LA 1KFWA 2G41A 3WD1A 3O5DA 2Q5AA 1HJWA 4ODMA 2M1IA 4MNKA 3AS0A 4J4OA 5HT1A 3PR9A 3O5FA 5HWCA 2PPPA 1FJDA 4TYOA 2DT3A 3ARYA 4LAWA 1FAPA 3GPKA 3WD2A 4IPXA 2MF9A 5GPGA 2LKNA 1FKLA 1EIBA 1D6OA 1A7XA 3O5IA 3OOBA 1FKKA 2MLYA 2KGJA 2O92A 1QPLA 2B31A 2VCDA 1TFVA 3RGCA 1FKDA 5DIVA 2F4EA 4ZPWR 1X6LA 4ZPVR 1J4HA 1WB0A 1TCOC 4TW7A 1FKTA 4WKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N19 A;  1YW5 A;  4QIB A;  4DZ2 A;  3NTP A;  5HWB A;  3JYJ A;  3UI6 A;  2ITK A;  2M2A A;  3IKG A;  1Q6H A;  4FN2 A;  1JNS A;  3O5G A;  4DT4 A;  4IQ2 A;  1C9H A;  4ITZ A;  1D7H A;  1J4I A;  1HXV A;  4TW6 A;  3NRK A;  4DZ3 A;  2MLX A;  2PPO A;  1T11 A;  2XP7 A;  3KAD A;  2RUC A;  4LAV A;  5DIT A;  4C02 B;  4ODO A;  4DRQ A;  4JFK A;  1KT1 A;  2IF4 A;  4DRP A;  2F21 A;  4LAY A;  4DRI A;  3RFW A;  3KAG A;  1FKR A;  1FKI A;  2XP9 A;  3TC5 A;  2ZR5 A;  4U84 A;  3O5J A;  3MDY B;  1FKJ A;  2LGO A;  2L2S A;  4ODK A;  5HKG A;  2KO7 A;  4DRN A;  2KR7 A;  2DG3 A;  4NNR A;  3KZ7 A;  1Y0O A;  3UQA A;  1FKG A;  4ODL A;  5HUA A;  2XPB A;  3TDB A;  1PIN A;  2N87 A;  1BL4 A;  4DRH A;  2RUQ A;  2DG9 A;  2MNT A;  3UQI A;  2VN1 A;  2UZ5 A;  2KFW A;  1KT0 A;  2DG4 A;  3JXV A;  1Q6I A;  1Q6U A;  4JFM A;  3JYM A;  2PV1 A;  4DH0 A;  2ZQV A;  2RUD A;  1FD9 A;  2Y78 A;  4W9Q A;  1EQ3 A;  2XP8 A;  3KAC A;  4TNS A;  1D7J A;  3IHZ A;  4JFL A;  4JYS A;  3CGM A;  3LUO A;  1L1P A;  1J6Y A;  2XP3 A;  2AWG A;  3UQB A;  1QPF A;  2RQS A;  1ZCN A;  4JFI A;  2M08 A;  2D9F A;  5HTG A;  1P5Q A;  5I98 A;  1ROT A;  3ODK A;  1F40 A;  4DIP A;  1FKF A;  3PRB A;  3IKD A;  4U86 A;  4TX0 A;  1JVW A;  4G50 A;  4TW8 A;  5HW7 A;  4MSP A;  1W26 A;  2LPV A;  2ZQS A;  2ZQU A;  4LAX A;  2FAP A;  4DRJ A;  3KAB A;  2FKE A;  5B8I C;  2PBC A;  2RSE A;  2KI3 A;  3TCZ A;  1NMV A;  4QT2 A;  3FAP A;  1JNT A;  1ROU A;  1QZ2 A;  3B7X A;  3I6C A;  2Q5A A;  3O5D A;  4DRK A;  3CGN A;  1EYM A;  4ODM A;  2MLZ A;  2XP4 A;  3NI6 A;  4W9P A;  1M5Y A;  2M1I A;  5D75 A;  1J4R A;  4J4O A;  3UI5 A;  1FKB A;  3KAF A;  1U79 A;  1ZK6 A;  2RUR A;  2XP5 A;  5HT1 A;  5HW6 A;  4QT3 A;  1FKH A;  2PPN A;  3O5F A;  2PPP A;  5HWC A;  1FJD A;  3UI4 A;  4R0X A;  4TYO A;  2F2D A;  2PV2 A;  4GGQ A;  3VAW A;  3O5M A;  4LAW A;  4DRM A;  1FAP A;  3GPK A;  3PA7 A;  3KAH A;  3WH0 A;  3O5E A;  4IPX A;  2KE0 A;  2MF9 A;  3O5K A;  3O5O A;  5GPG A;  4BF8 A;  1D7I A;  4DRO A;  2LKN A;  4ODN A;  1FKS A;  1F8A B;  1FKL A;  2OFN A;  1NSG A;  1R9H A;  1D6O A;  1A7X A;  1Q1C A;  3O5I A;  1YAT A;  2ZR6 A;  3PRD A;  3UF8 A;  1BKF A;  3OOB A;  4GIV A;  1N1A A;  2K8I A;  1FKK A;  2MLY A;  1NMW A;  2KGJ A;  1QPL A;  3O5R A;  2VCD A;  4O2T A;  4W9O A;  3O5Q A;  4ODP A;  3RGC A;  4IQC A;  1FKD A;  2MPH A;  2XP6 A;  4U85 A;  2ZQT A;  3O5L A;  2JZV A;  4ODQ A;  5DIU A;  2XPA A;  2ZR4 A;  1PBK A;  5DIV A;  3IK8 A;  2F4E A;  5HW8 A;  3EY6 A;  1J4H A;  3H9R B;  4MGV A;  2PV3 A;  4G2P A;  4FAP A;  5BXJ A;  3KAI A;  3O5P A;  4JFJ A;  4J4N A;  1TCO C;  4TW7 A;  3KCE A;  2LJ4 A;  4ODR A;  5J6E A;  1FKT A;  1B6C A; 
#chains in the Genus database with same CATH topology
 4QIB A;  3ARQ A;  1ZBC A;  3BMB A;  2M2A A;  1NWU A;  3O5G A;  4IQ2 A;  1C9H A;  1J4I A;  1HXV A;  2DSU A;  3KAD A;  4MAV A;  4Z2L A;  5DIT A;  1KT1 A;  2F21 A;  4LAY A;  4DRI A;  3KAG A;  1FKR A;  2XP9 A;  2ZR5 A;  3MDY B;  4MNL A;  4ODK A;  3ART A;  3WD3 A;  2KO7 A;  1LJY A;  4UDM A;  1E6P A;  2DSW A;  1GOI A;  3FXY A;  4S3K A;  2MNT A;  3UQI A;  1WAW A;  3JXV A;  2DPE A;  3WL1 A;  5DEZ A;  4W9Q A;  4R5E A;  4ML4 A;  2F23 A;  3LUO A;  1L1P A;  1IX5 A;  2AOS A;  1NH6 A;  3WD4 A;  5I98 A;  1CTN A;  4KR0 B;  1ZBK A;  3ODK A;  3PRB A;  4TX0 A;  1JVW A;  4MSP A;  2A3C A;  2LPV A;  2ETN A;  2RSE A;  3FY1 A;  1ZB5 A;  4QT2 A;  3ARS A;  1JNT A;  3I6C A;  2PN0 A;  3AS2 A;  4DRK A;  3WQW A;  1EYM A;  4ZS6 A;  3ARR A;  3RME A;  1FKB A;  3CHE A;  3OA5 A;  5HW6 A;  1FKH A;  4DWS A;  4Q7N A;  3UI4 A;  2PV2 A;  1ZBW A;  3PA7 A;  4DWS B;  3KAH A;  3WH0 A;  4DRN A;  3GTY X;  3O5K A;  3O5O A;  4URI A;  4ODN A;  1F8A B;  1SR0 A;  4ZPT R;  3WQV A;  4P8W A;  4LGX A;  2ZR6 A;  1LL4 A;  4MNJ A;  1NMW A;  1ZL1 A;  3ARU A;  2ESC A;  4MPK A;  3O5Q A;  4AY1 A;  4WKH A;  3O5L A;  4ODQ A;  1HKI A;  1GRJ A;  2XPA A;  2ZR4 A;  1PBK A;  3IK8 A;  5DF0 A;  4DWS D;  5HW8 A;  3EY6 A;  1EHN A;  3KAI A;  4JFJ A;  4MNM A;  4J4N A;  4ODR A;  3VAW A;  1LL6 A;  3NTP A;  5HWB A;  1O6I A;  2ITK A;  1Q6H A;  4WIW A;  1UR9 A;  3RM9 A;  3B9A A;  3AQU A;  2DSV A;  2XP7 A;  4XAK A;  4C02 B;  4JFK A;  4DRP A;  4IT6 A;  2FDM A;  1XRV A;  4HAR A;  3GU0 A;  3TC5 A;  1XHG A;  2IUZ A;  3B9D A;  2QF8 A;  2LGO A;  1EDQ A;  4QZV B;  4NNR A;  1Y0O A;  2DT2 A;  5HUA A;  4DRH A;  2DG9 A;  2VN1 A;  1K9T A;  2DG4 A;  2DSZ A;  1Q6U A;  1RD6 A;  1FD9 A;  3CH9 A;  4L72 B;  1J6Y A;  1W1T A;  1OWQ A;  4P8X A;  1ZCN A;  4NZC A;  1HKM A;  1P5Q A;  1ROT A;  1FKF A;  1W9V A;  3IKD A;  4Z2H A;  4TW8 A;  3AS3 A;  3W4R A;  1FFQ A;  2P4V A;  1W9U A;  4LAX A;  2FAP A;  4DRJ A;  2KI3 A;  3TCZ A;  1W1Y A;  3ARO A;  3CHC A;  2B5U B;  1ROU A;  1QZ2 A;  1NWT A;  4W9P A;  2MLZ A;  2XP4 A;  3NI6 A;  1M5Y A;  1J4R A;  1E9L A;  1ZK6 A;  4P8V A;  2PPN A;  1HJV A;  4R0X A;  4P8U A;  2F2D A;  3O5M A;  5GQB A;  5JH8 A;  3ALG A;  3O5E A;  4BF8 A;  3CHD A;  1D7I A;  1X6N A;  2A3E A;  2OFN A;  1NSG A;  1R9H A;  1Q1C A;  1YAT A;  3PRD A;  3UF8 A;  1LG2 A;  1BKF A;  4HBE A;  1N1A A;  2K8I A;  1H0G A;  4O2T A;  4W9O A;  4ODP A;  3CHF A;  3PRA A;  4IQC A;  2WM0 A;  4U85 A;  2ZQT A;  3WL0 A;  4Q22 A;  4MTV A;  1OGB A;  3ARZ A;  3H9R B;  4MGV A;  5BXJ A;  3KCE A;  1F40 A;  3ARP A;  1B6C A;  1GUV A;  4N19 A;  4S3J A;  2DT1 A;  3JYJ A;  3UI6 A;  3IKG A;  4FN2 A;  1JNS A;  2O9O A;  3B9E A;  1W1V A;  4DT4 A;  4ITZ A;  1LL7 A;  4TW6 A;  3NRK A;  3ARX A;  4DZ3 A;  2MLX A;  4LAV A;  4DRQ A;  2IF4 A;  1ZU8 A;  1GPF A;  1HKJ A;  4U84 A;  3O5J A;  1FKJ A;  2DG3 A;  2WLY A;  3AS1 A;  2XPB A;  1NWS A;  2RUQ A;  2UZ5 A;  2KFW A;  1KT0 A;  3BXW A;  1JNE A;  1Q6I A;  3JYM A;  2PV1 A;  2ZQV A;  4WJX A;  3RM8 A;  2RUD A;  1EQ3 A;  2XP8 A;  3KAC A;  4TNS A;  1D7J A;  3IHZ A;  4JFL A;  2XP3 A;  2AWG A;  1LG1 A;  3CZ8 A;  5DO2 A;  2RQS A;  4JFI A;  2PI6 A;  4Z2J A;  2D9F A;  5HBF A;  1JND A;  1W26 A;  3KAB A;  5B8I C;  2PBC A;  2DT0 A;  1E15 A;  3FAP A;  1E6N A;  3B7X A;  3WKZ A;  3CGN A;  4IT4 A;  5D75 A;  1VF8 A;  3UI5 A;  1WNO A;  3KAF A;  1U79 A;  1E44 A;  2RUR A;  2XP5 A;  4Z2I A;  4QT3 A;  4GGQ A;  4KQZ A;  4DRM A;  2KE0 A;  1HKK A;  3WD0 A;  4DRO A;  1FKS A;  1H0I A;  3ALF A;  3ARV A;  3B8S A;  4GIV A;  1LQ0 A;  3O5R A;  1HJX A;  3QOK A;  2MPH A;  2XP6 A;  2YBU A;  2JZV A;  5DIU A;  4HBO A;  4NSB A;  2OLH A;  4Z2K A;  4FAP A;  1SYT A;  2PV3 A;  4G2P A;  4W5U A;  3ARW A;  3O5P A;  2LJ4 A;  5J6E A;  1YW5 A;  4DZ2 A;  4Z2G A;  2WK2 A;  1D7H A;  2PPO A;  1T11 A;  2RUC A;  2A3B A;  1E6R A;  4ODO A;  3RFW A;  1FKI A;  1UR8 A;  5HKG A;  2L2S A;  2A3A A;  2KR7 A;  3KZ7 A;  3UQA A;  1E6Z A;  1FKG A;  4ODL A;  1FFR A;  4WK9 A;  1PIN A;  2N87 A;  3TDB A;  1BL4 A;  1W1P A;  4WKF A;  2G8Z A;  1OGG A;  4JFM A;  4DH0 A;  2Y78 A;  4L3N A;  1JCH B;  4JYS A;  3CGM A;  3RM4 A;  2YBT A;  3UQB A;  1QPF A;  3G6M A;  2M08 A;  5HTG A;  3WIJ A;  4DIP A;  2EUL A;  4U86 A;  1W9P A;  4G50 A;  4PTM A;  1NWR A;  5HW7 A;  2ZQS A;  2ZQU A;  5GPR A;  2FKE A;  1ITX A;  2WLZ A;  1NMV A;  1D2K A;  4DWS C;  1ZBV A;  3G6L A;  1KFW A;  2G41 A;  3WD1 A;  3O5D A;  2Q5A A;  1HJW A;  4ODM A;  2M1I A;  4MNK A;  3AS0 A;  4J4O A;  5HT1 A;  3PR9 A;  3O5F A;  5HWC A;  2PPP A;  1FJD A;  4TYO A;  2DT3 A;  3ARY A;  4LAW A;  1FAP A;  3GPK A;  3WD2 A;  4IPX A;  2MF9 A;  5GPG A;  2LKN A;  1FKL A;  1EIB A;  1D6O A;  1A7X A;  3O5I A;  3OOB A;  1FKK A;  2MLY A;  2KGJ A;  2O92 A;  1QPL A;  2B31 A;  2VCD A;  1TFV A;  3RGC A;  3EIP A;  1FKD A;  5DIV A;  2F4E A;  4ZPW R;  1X6L A;  4ZPV R;  1J4H A;  1WB0 A;  1TCO C;  4TW7 A;  1FKT A;  4WKA A; 
#chains in the Genus database with same CATH homology
 4QIB A;  3ARQ A;  1ZBC A;  2M2A A;  1NWU A;  3O5G A;  4IQ2 A;  1C9H A;  1J4I A;  1HXV A;  2DSU A;  3KAD A;  4MAV A;  4Z2L A;  5DIT A;  1KT1 A;  2F21 A;  4LAY A;  4DRI A;  3KAG A;  1FKR A;  2XP9 A;  2ZR5 A;  3MDY B;  4MNL A;  4ODK A;  3ART A;  3WD3 A;  2KO7 A;  1LJY A;  1E6P A;  2DSW A;  1GOI A;  3FXY A;  4S3K A;  2MNT A;  3UQI A;  1WAW A;  3JXV A;  2DPE A;  3WL1 A;  5DEZ A;  4W9Q A;  4R5E A;  4ML4 A;  3LUO A;  1L1P A;  1IX5 A;  2AOS A;  1NH6 A;  3WD4 A;  5I98 A;  1CTN A;  4KR0 B;  1ZBK A;  3ODK A;  3PRB A;  4TX0 A;  1JVW A;  4MSP A;  2A3C A;  2LPV A;  2RSE A;  3FY1 A;  1ZB5 A;  4QT2 A;  3ARS A;  1JNT A;  3I6C A;  3AS2 A;  4DRK A;  3WQW A;  1EYM A;  4ZS6 A;  3ARR A;  3RME A;  1FKB A;  3CHE A;  3OA5 A;  5HW6 A;  1FKH A;  4DWS A;  4Q7N A;  3UI4 A;  2PV2 A;  1ZBW A;  3PA7 A;  4DWS B;  3KAH A;  3WH0 A;  4DRN A;  3O5K A;  3O5O A;  4URI A;  4ODN A;  1F8A B;  1SR0 A;  4ZPT R;  3WQV A;  4P8W A;  4LGX A;  2ZR6 A;  1LL4 A;  4MNJ A;  1NMW A;  1ZL1 A;  3ARU A;  2ESC A;  4MPK A;  3O5Q A;  4AY1 A;  4WKH A;  3O5L A;  4ODQ A;  1HKI A;  2XPA A;  2ZR4 A;  1PBK A;  3IK8 A;  5DF0 A;  4DWS D;  5HW8 A;  3EY6 A;  1EHN A;  3KAI A;  4JFJ A;  4MNM A;  4J4N A;  4ODR A;  3VAW A;  1LL6 A;  3NTP A;  5HWB A;  1O6I A;  2ITK A;  1Q6H A;  4WIW A;  1UR9 A;  3RM9 A;  3B9A A;  3AQU A;  2DSV A;  2XP7 A;  4XAK A;  4C02 B;  4JFK A;  4DRP A;  4IT6 A;  2FDM A;  1XRV A;  4HAR A;  3TC5 A;  1XHG A;  2IUZ A;  3B9D A;  2QF8 A;  2LGO A;  1EDQ A;  4QZV B;  4NNR A;  1Y0O A;  2DT2 A;  5HUA A;  4DRH A;  2DG9 A;  2VN1 A;  1K9T A;  2DG4 A;  2DSZ A;  1Q6U A;  1RD6 A;  1FD9 A;  3CH9 A;  4L72 B;  1J6Y A;  1W1T A;  1OWQ A;  4P8X A;  1ZCN A;  4NZC A;  1HKM A;  1P5Q A;  1ROT A;  1FKF A;  1W9V A;  3IKD A;  4Z2H A;  4TW8 A;  3AS3 A;  3W4R A;  1FFQ A;  1W9U A;  4LAX A;  2FAP A;  4DRJ A;  2KI3 A;  3TCZ A;  1W1Y A;  3ARO A;  3CHC A;  1ROU A;  1QZ2 A;  1NWT A;  4W9P A;  2MLZ A;  2XP4 A;  3NI6 A;  1M5Y A;  1J4R A;  1E9L A;  1ZK6 A;  4P8V A;  2PPN A;  1HJV A;  4R0X A;  4P8U A;  2F2D A;  3O5M A;  5GQB A;  5JH8 A;  3ALG A;  3O5E A;  4BF8 A;  3CHD A;  1D7I A;  1X6N A;  2A3E A;  2OFN A;  1NSG A;  1R9H A;  1Q1C A;  1YAT A;  3PRD A;  3UF8 A;  1LG2 A;  1BKF A;  4HBE A;  1N1A A;  2K8I A;  1H0G A;  4O2T A;  4W9O A;  4ODP A;  3CHF A;  3PRA A;  4IQC A;  2WM0 A;  4U85 A;  2ZQT A;  3WL0 A;  4Q22 A;  4MTV A;  1OGB A;  3ARZ A;  3H9R B;  4MGV A;  5BXJ A;  3KCE A;  1F40 A;  3ARP A;  1B6C A;  1GUV A;  4N19 A;  4S3J A;  2DT1 A;  3JYJ A;  3UI6 A;  3IKG A;  4FN2 A;  1JNS A;  2O9O A;  3B9E A;  1W1V A;  4DT4 A;  4ITZ A;  1LL7 A;  4TW6 A;  3NRK A;  3ARX A;  4DZ3 A;  2MLX A;  4LAV A;  4DRQ A;  2IF4 A;  1ZU8 A;  1GPF A;  1HKJ A;  4U84 A;  3O5J A;  1FKJ A;  2DG3 A;  2WLY A;  3AS1 A;  2XPB A;  1NWS A;  2RUQ A;  2UZ5 A;  2KFW A;  1KT0 A;  3BXW A;  1JNE A;  1Q6I A;  3JYM A;  2PV1 A;  2ZQV A;  4WJX A;  3RM8 A;  2RUD A;  1EQ3 A;  2XP8 A;  3KAC A;  4TNS A;  1D7J A;  3IHZ A;  4JFL A;  2XP3 A;  2AWG A;  1LG1 A;  3CZ8 A;  5DO2 A;  2RQS A;  4JFI A;  2PI6 A;  4Z2J A;  2D9F A;  5HBF A;  1JND A;  1W26 A;  3KAB A;  5B8I C;  2PBC A;  2DT0 A;  1E15 A;  3FAP A;  1E6N A;  3B7X A;  3WKZ A;  3CGN A;  4IT4 A;  5D75 A;  1VF8 A;  3UI5 A;  1WNO A;  3KAF A;  1U79 A;  2RUR A;  2XP5 A;  4Z2I A;  4QT3 A;  4GGQ A;  4KQZ A;  4DRM A;  2KE0 A;  1HKK A;  3WD0 A;  4DRO A;  1FKS A;  1H0I A;  3ALF A;  3ARV A;  3B8S A;  4GIV A;  1LQ0 A;  3O5R A;  1HJX A;  3QOK A;  2MPH A;  2XP6 A;  2YBU A;  2JZV A;  5DIU A;  4HBO A;  4NSB A;  2OLH A;  4Z2K A;  4FAP A;  1SYT A;  2PV3 A;  4G2P A;  4W5U A;  3ARW A;  3O5P A;  2LJ4 A;  5J6E A;  1YW5 A;  4DZ2 A;  4Z2G A;  2WK2 A;  1D7H A;  2PPO A;  1T11 A;  2RUC A;  2A3B A;  1E6R A;  4ODO A;  3RFW A;  1FKI A;  1UR8 A;  5HKG A;  2L2S A;  2A3A A;  2KR7 A;  3KZ7 A;  3UQA A;  1E6Z A;  1FKG A;  4ODL A;  1FFR A;  4WK9 A;  1PIN A;  2N87 A;  3TDB A;  1BL4 A;  1W1P A;  4WKF A;  2G8Z A;  1OGG A;  4JFM A;  4DH0 A;  2Y78 A;  4L3N A;  4JYS A;  3CGM A;  3RM4 A;  2YBT A;  3UQB A;  1QPF A;  3G6M A;  2M08 A;  5HTG A;  3WIJ A;  4DIP A;  4U86 A;  1W9P A;  4G50 A;  4PTM A;  1NWR A;  5HW7 A;  2ZQS A;  2ZQU A;  5GPR A;  2FKE A;  1ITX A;  2WLZ A;  1NMV A;  1D2K A;  4DWS C;  1ZBV A;  3G6L A;  1KFW A;  2G41 A;  3WD1 A;  3O5D A;  2Q5A A;  1HJW A;  4ODM A;  2M1I A;  4MNK A;  3AS0 A;  4J4O A;  5HT1 A;  3PR9 A;  3O5F A;  5HWC A;  2PPP A;  1FJD A;  4TYO A;  2DT3 A;  3ARY A;  4LAW A;  1FAP A;  3GPK A;  3WD2 A;  4IPX A;  2MF9 A;  5GPG A;  2LKN A;  1FKL A;  1EIB A;  1D6O A;  1A7X A;  3O5I A;  3OOB A;  1FKK A;  2MLY A;  2KGJ A;  2O92 A;  1QPL A;  2B31 A;  2VCD A;  1TFV A;  3RGC A;  1FKD A;  5DIV A;  2F4E A;  4ZPW R;  1X6L A;  4ZPV R;  1J4H A;  1WB0 A;  1TCO C;  4TW7 A;  1FKT A;  4WKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...