1FD9A

Crystal structure of the macrophage infectivity potentiator protein (mip) a major virulence factor from legionella pneumophila
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
204
structure length
204
Chain Sequence
TDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MACROPHAGE INFECTIVITY POTENTIATOR PROTEIN)
publication title Crystal structure of Mip, a prolylisomerase from Legionella pneumophila
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Isomerase
total genus 64
structure length 204
sequence length 204
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1fd9A02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fd9A01
1ROTA 4W9PA 5GPGA 4DIPA 3RGCA 2KE0A 1BKFA 1QPFA 4DT4A 3RFWA 3ODKA 4ODLA 2RSEA 4DRMA 2PPPA 2DG3A 2F4EA 3CGNA 4ODMA 3WH0A 4ITZA 1YATA 4DRIA 4N19A 4W9QA 5HW6A 2MNTA 2XP6A 1FKLA 1YW5A 2PBCA 4JYSA 3O5DA 4U84A 1FKKA 1ZCNA 3O5OA 1D7HA 1Q1CA 3VAWA 3UF8A 1J6YA 4TX0A 4TW6A 3JYJA 1Q6IA 4IQCA 3UI4A 3O5RA 1J4IA 4U86A 2VCDA 5HUAA 4TYOA 4MSPA 4ODKA 4QIBA 1FKDA 1U79A 2XP9A 4QT3A 3NTPA 2DG4A 2AWGA 1F8AB 1FKHA 2MF9A 5DIVA 4DRHA 1FKFA 1B6CA 4ODOA 4JFLA 2M2AA 3JXVA 3NI6A 5BXJA 5D75A 2L2SA 2IF4A 3MDYB 1BL4A 2RURA 3O5PA 3KADA 3O5MA 1J4RA 3PRBA 1JNSA 4BF8A 1J4HA 3EY6A 1PINA 1M5YA 5HW8A 1FKGA 1QZ2A 1PBKA 4W9OA 3FAPA 2XP4A 3I6CA 3UQBA 2KR7A 2XPBA 4FAPA 3O5FA 4JFJA 3H9RB 5HTGA 4DRPA 2D9FA 4ODPA 1A7XA 2N87A 3TDBA 1NMWA 1EQ3A 2PV2A 1D6OA 4G50A 1FKBA 5HWBA 3KABA 4C02B 2RUQA 2XP3A 2PPOA 4DRJA 4ODNA 2XP5A 4JFIA 1L1PA 4DRKA 4FN2A 2LGOA 3KCEA 2ZR6A 3IKGA 4JFMA 2RUDA 4QT2A 4DRQA 5J6EA 3OOBA 2MLXA 1EYMA 1FKIA 4DH0A 2Y78A 3UQIA 4DRNA 1JNTA 4IPXA 2MPHA 2ZQUA 4TNSA 3LUOA 5HT1A 5B8IC 3O5GA 5HKGA 3O5QA 2K8IA 1C9HA 1D7IA 2KGJA 3B7XA 1FKJA 4LAXA 2ZR4A 3O5LA 3GPKA 2ZQSA 4ODQA 3UQAA 3B09A 3UI6A 1ROUA 1F40A 2KI3A 4LAWA 1KT1A 4LAVA 3NRKA 1FJDA 1FD9A 1Y0OA 4MGVA 2ZQTA 2FAPA 1JVWA 2F21A 3KAGA 5DITA 3CGMA 2LPVA 1QPLA 4JFKA 4DROA 1W26A 4DZ2A 2JZVA 2KO7A 2XP8A 3UI5A 1Q6HA 2M08A 3TC5A 1HXVA 1R9HA 4NNRA 3IKDA 3O5KA 1D7JA 2LJ4A 4J4OA 3PA7A 2UZ5A 1N1AA 3PRDA 2LKNA 1NMVA 2PV3A 4DZ3A 3TCZA 2ITKA 2XP7A 4J4NA 1KT0A 4TW7A 3KACA 4R0XA 2F2DA 2PPNA 3KAFA 3O5JA 3IHZA 4LAYA 2ZR5A 3KAHA 3KAIA 4TW8A 2MLZA 2KFWA 4GIVA 1FKRA 4IQ2A 3KZ7A 2FKEA 2XPAA 1FKTA 3O5IA 1FAPA 1FKSA 2RQSA 2Q5AA 4O2TA 5DIUA 2DG9A 1P5QA 1NSGA 2VN1A 1TCOC 4U85A 4GGQA 2OFNA 2RUCA 2ZQVA 1T11A 5I98A 4ODRA 1Q6UA 5HW7A 2MLYA 1ZK6A 3O5EA 2PV1A 5HWCA 4G2PA 3JYMA 3IK8A 2M1IA
chains in the Genus database with same CATH superfamily
1VEWA 4X66O 5EBLC 5C8YB 3SDLA 4O2AA 1FFRA 4DV0B 3RMEA 4PDRA 1YDXA 1VQ5V 4TV8A 2X0LA 2F23A 4QE9A 4PA4A 4WBNB 1FKLA 3OMAB 4DR7O 3VAWA 4ZHQA 1N32O 3DSQA 3E8BA 3U11A 3CE2A 4Q7NA 3O5RA 2QM8A 3SYPA 4X20B 5LYJA 1F8AB 1FKHA 2WA4A 5LOVB 4MTOA 3AEIA 3NI6A 2HVKC 2IF4A 3FYIB 1U96A 2IJKA 1S5JA 1NJIW 2AZ0A 4B3MO 5JVDB 1I5XA 1VARA 4L8JA 2GV9A 4O2BB 1Y74A 3CHFA 4UV9A 3P30A 1AJQA 2QKAA 2UXDO 2RUQA 1ZB5A 4ODNA 2B1IA 4JI3O 4JV5B 1AR1B 4FN2A 1K34A 5B3SB 1XNRO 4LF7O 4LF5O 3PN1A 3ZHSA 3AK1A 4WKFA 2PI5A 4QE7A 2FMLA 3OEHG 3RYHA 3AK3A 3JD3A 2PZSA 1HR0O 1Y66A 4WFGA 3RYFA 1RM1B 1LNQA 1EN5A 1LJYA 1EBOA 3CP1A 4ODQA 1GOIA 3E8FA 3G67A 3NRKA 1FD9A 2JJ1G 2KB1A 3E89A 1OJHA 4GKJB 2N74A 4DROA 4DUYO 1ENVA 3E86A 5IWAB 1R1BA 4GX5A 2XP8A 1XILA 1EHNA 4WCEV 5A2QN 1VQPV 2JS5A 3IGAC 3WD3A 4W4LA 3OTOB 2VS0A 1XBLA 2E5LO 1ORQC 3KAFA 3O5JA 2DWDC 2ZE7A 3IHZA 5LGTA 3X2QC 1Z2GA 1B6QA 5E1AC 3G6EV 1FKTA 2PY5A 2RJZA 1Q86W 5EIBC 2VQEB 2ZQVA 1T11A 5I98A 5B1AC 4B08A 4FLZA 1VQOV 1VQMV 1BGYH 3J81N 2UU9B 3ZMVA 3I56V 4DT4A 3S3WA 3ODKA 1HJWA 3G4SV 2HJDA 3AG3B 5LMNB 5KX5A 4YIOA 1NQTA 3K5NA 4JI8B 1XL6A 2ZE6A 4F4LA 1GN3A 1UFIA 1WLEA 4FLVA 3UO2A 2ADQB 5D5QA 1AJNA 2BTQB 4DWSA 3CZ8A 1J6YA 3UI4A 3ABMB 1BL8A 2VCDA 3JARA 3ARZA 4JTCB 2IJJA 4EB6A 1MSDA 2IM9A 3ARRA 4X1YA 1M56C 4KUMA 4OX9B 2ZDIA 1FFTB 5HFMA 3JAMN 1WPBA 3O5MA 1GRJA 4WFFA 3WB2A 1J4HA 3PRBA 1FKGA 1PBKA 2B5UA 4B3RB 2DSWA 4OPAA 4MAVA 3CB2A 1M57B 4CH4A 3P32A 4ASUG 4YY3O 3HKBA 4MSWC 3FY1A 1P49A 5LGNA 1WNSA 4LH7A 2CDYA 3EXAA 4DRQA 1CP9A 2E75B 5C8YA 2P67A 5GONB 2Y78A 4B7EA 4DV6B 2P90A 3E22A 4JAUA 2EILC 4TWKA 3AG2C 1DTOA 4WBNA 4J41A 3AG7A 4JGSA 4X65O 2Q67A 3ZRWA 3AG4C 4G2KA 3MDSA 3GB7C 2ESCA 4DZ2A 2KO7A 3TC5A 2DYSC 5DECA 5KHGA 1XHZA 1D5AA 1FXVA 3UKMA 1F7YA 3AROA 3FB8C 1PL4A 2XAJA 1VQKV 2ZR5A 4LF9B 4LFBO 1ZSPA 4CH5A 1LL7A 1AI7A 5CA3A 2Y69B 1UPGA 3K5OA 2DG9A 1TVKB 5DEZA 1P4RA 3AG1B 1S3JA 1JJ2U 1HWYA 4MVSA 3OM3B 4TV9A 5B5EZ 1I7FA 2V7QG 5KMGB 2M7WA 3LUTB 2IJHA 4MTFA 1HNXO 4AQYB 5CBFA 1H2NA 3ZN0A 5BY1A 1QNMA 3ZRSA 2CK3G 1FXKA 4N21A 1Q1CA 1OGGA 1K9MW 3HPLC 3T1YO 4IHJB 4JI7B 1NWUA 5CB4A 1RFYA 3HB3B 4X1IA 3NTPA 4RWUA 1VF5B 1FJGO 4MNKA 3OTFA 5D75A 1H8HG 2WK2A 3IJ4A 3AK2A 1GKFA 3CRAA 2X6CA 3K04A 4I9QA 4JI2O 3RYIB 2C2AA 1W1TA 4QGPA 3H9RB 4DW0A 4DRPA 3H1IH 4WKHA 1EQ3A 4UCRA 1URFA 2Q69A 1HKJA 4DRKA 3KCEA 1HDJA 3T2MA 3ZHVA 2A3EA 4X64O 1Y76B 4DV3O 2WLYA 3VQVA 4PTMA 1X6LA 1C9HA 4LAXA 5IYDO 5GQBA 3LSQA 2MK3A 3FD9A 2QTSA 4BAYA 3LDEA 3H1KH 4U7NA 1NTKH 4AI8A 2Q73A 2QKCA 4MVZA 2ZQTA 1PD3A 1KECA 5JWPA 2E76B 5BZBA 5L3BA 1R3KC 4WK9A 1EN4A 3SJBC 3ZMTA 1M5IA 1Q8IA 3C3TA 2A9HA 2UZ5A 2F43G 1BSMA 3KACA 1ZLZA 1V55B 2F66C 3CCSV 3FFQA 4YHHO 3B40A 3J80N 1FAPA 3TJTA 4LFAB 3LNMB 1OCRC 5CBGA 4ODRA 2QWNB 1TUEB 1NBMG 3O5EA 5HBFA 1YXBA 1NWSA 5IJ9B 5GONA 2VWKA 3EIPA 4ODLA 3L74H 2UXBO 4KHPO 2GSMB 4RUFA 4YJ2A 4DV4B 1N36B 4JI1O 4QIWF 2BE3A 3QVNA 4JTAB 3B8MA 1NI8A 3O5OA 1NKDA 1PKXA 3TCUA 4TX0A 4Z2JA 3CEIA 4IYHA 4MVMA 3CCLV 2ZM6O 4H44B 2HP8A 3HKEB 2WPDG 3UM7A 3GU0A 1I0HA 4KP4A 4MVUA 4O4JB 2Z5UA 1IDSA 1FFXB 2P4VA 3ML0A 5LXTB 2L2SA 4E2LA 4JI0O 2RURA 4BF8A 1EZVH 1CTNA 3I6CA 4H13B 1EN6A 1GTOA 2ITCC 4FAPA 1Y6XA 2DT3A 1KMIZ 1JR9A 1K5SA 4ZPTR 4X62O 4P2ZA 1PM9A 2LJ2A 5HWBA 4JAAA 3MD0A 2ZR6A 1H2MA 4MVQA 1H0IA 1PV0A 2DT0A 4U3JB 2DT2A 2K8IA 4DR5O 4FZ0A 3E2EA 3LNNA 3F5WC 1F40A 2ZINA 1XNQO 1JA8A 4IHJA 2PN0A 2YBTA 1KU9A 4MPKA 1MMMA 2P06A 5B66Z 3IKDA 3BPZA 1XMQB 4NXNO 1NMVA 1LG2A 3ZS8C 4O2AB 1N33O 2LP7A 3FB7C 2IU0A 2NR5A 3JD0A 4CS2A 5C93A 2YIBD 3O5IA 2DSZA 3D8CA 4ZHQB 1IZ3A 3STZC 1Q6UA 1OWQA 2MLYA 1ZK6A 4URIA 1SETA 2YIAA 1SA0B 3DXRB 3K79A 2HKOA 2F93B 5GPGA 5LYJB 2HG5C 1GN6A 1YJ9V 2F4VB 1GUVA 4DRMA 4LP8A 4BR6A 2UUAB 4LCUC 2WM0A 1ZL1A 3ABLB 3PR9A 1LUVA 2MNTA 4K0KO 4LGXA 3ZHQA 1GM8A 2HJFC 2JIZG 4GKKB 4IT6A 1Y74B 2UUBO 2OLHA 4TW6A 1Q6IA 1XL4A 4DR6B 2A3BA 5LMUB 2DT1A 2MF9A 5DM6V 4O4LA 2DE0X 3DC5A 3P3NA 4MVRA 4Z2HA 3RYHB 1SZXA 1WJZA 2KSDA 3W7XA 4UB8Z 3RT3C 3ASOB 1GAXA 1YVWA 3LSSA 3ZEDA 4JI4B 3ZHTA 1GPFA 1XHGA 3K9AA 3TDBA 3D3QA 1QHTA 1SQBH 1I94O 1YITV 2OTLV 2QEXV 3WD0A 1MZEA 1D2DA 1OCZC 4CZZA 5IJ9A 4Z2IA 4DV5B 3H1HH 1I08A 1FKIA 2DW4A 2LW7A 3B9EA 1K4DC 3ZX6A 5DF0A 3ARUA 2HLDG 4YJ3A 3ASNB 1YTFD 3ZN1A 2ZR4A 2HEPA 4RUEA 4PELA 1PPJH 1ROUA 1A32A 4DV7B 4AY1A 1SQGA 3L72H 3K5MA 3CGMA 2LPVA 1J95A 4WJXA 1W59A 1KP2A 2LGQA 3HKEA 4XBFA 1ZTEA 4MS2A 4NNRA 3UO3A 4O4JA 1ROPA 3PA7A 3CRMA 1FFXA 2Q5ZA 3RWRD 5LXTA 2VQFO 1YEWA 2XNDG 5JH7A 4TW7A 5KX5B 1YTFB 3SGIA 4P8VA 2EIMC 1QLNA 2MLZA 2KFWA 4IQ2A 5JCOA 5HFLA 2OCCC 5CN0A 1N34O 2Q5AA 2VN1A 2PTMA 4GGQA 2OFNA 2RUCA 3K08A 2K9PA 5EK0A 5L3CA 2OCHA 3JARB 4DR3O 4OGQB 4RQFA 3H1JH 4UCOA 1SC5B 2YEVA 5B1BB 1QVFU 4U3JA 4FM0A 3G71V 2DG3A 1UR8A 4NB5A 4DUZB 4NYKA 1X6NA 3SYOA 2A79B 4GLXA 3FAVA 2CTWA 2B5UB 1JNDA 3JD1A 2ZXWC 4I55A 3UQ8A 4PHZA 4L72B 4QT3A 1MABG 4H0LB 1J5EO 1WAZA 4Q22A 3CCUV 2FB5A 2M2AA 3JXVA 4JYYA 4LF4O 3CSXA 4JYBA 3OD4A 3E22B 3ABUA 2R9RB 5HTGA 1E44A 4XDLA 3ZRWB 3BHPA 1S5HC 1B04A 1SA0A 3DXRA 5J6EA 1O9HA 4I0XA 5D5PA 1Q81W 3BA9A 2L6LA 4FZ1A 1R3IC 1M93A 2LFRA 3ZHRA 3CYOA 1PNKA 2XAGA 4ICGA 3CRCA 2DSUA 3E8GA 3Q4HA 2AZ2A 4Q20A 1E9LA 4KL1A 1BT8A 1N0NA 5IYBO 2P7TC 4GX0A 2Q68A 3UI6A 4ZKIA 2YIBA 2P6JA 3FKSG 3K0DA 4UCTA 5L3FA 4DV6O 5EC2C 2YICA 1QPLA 4TV9B 1O9GA 1AROP 4LNUB 3ABKB 1JOYA 5JJJB 2YC0A 2EULA 4ZI7A 4EEQA 1Y67A 1K73W 2OT5A 1FXKB 1XREA 4B3TB 4S3JA 1JMKC 1SS3A 3N27A 1D2KA 1P84F 5KAFZ 3IC7A 4GUNA 2JRIA 1OCOC 5CB4B 4LF8O 4X1IB 3BVOA 5LGUA 1IBLO 4PA9A 1H38A 4P8UA 1LL4A 3OA5A 4B3SB 1V54C 4LFCB 1YATA 4DR4O 4TUYB 5BR8O 5LP6B 3K59A 3IFXA 4D7TA 1WB0A 2A3QA 4CC6A 3RM8A 2FTKA 4DW1A 1PP9H 2YDEA 1IURA 3CCMV 5HUAA 2QR4A 3HR0A 4P8XA 3ZCCA 3JAKA 2AWGA 3JD2A 2X6BA 3SR2C 1ZBKA 1K7DA 2IH1C 2Q6AA 3KCXA 5DEDA 3APQA 1T5EA 4MNLA 5CA1B 3UQBA 2XPBA 4ODPA 1JX9A 1GN4A 1EM1A 3CXHF 5CMUA 4NXMB 1FKBA 3WD1A 1HNWB 5JQGA 4DRJA 2EJRA 3THOA 3OOBA 3JD4A 4DK0A 1JNTA 4K8ZA 2MPHA 1W0JG 2MW2B 2Y0IA 3KG2A 4IGGA 4NTWA 4UUJC 2ZQUA 5HKGA 5KA6A 4NVPA 4JI6B 1XMOB 3B09A 4AILC 3CRRA 4DV2O 5EZYA 3SPIA 4JPRA 1KQSU 1IBMO 4X66B 5IYZA 4MGVA 4DR1B 1G6UA 4DK1A 3HKDA 1ZX3A 3FYEB 3SYQA 2GHYA 4H37A 2G8ZA 2O9OA 2R9AA 1U97A 1Q82W 3SPHA 2CAZC 2PV3A 4HARA 4DR7B 1JFFA 4ZPWR 1N32B 3B9AA 4YJ2B 4PI2A 1IX9A 2ZIOA 4TQDA 3CHCA 3STLC 5J2UA 4JTDB 5IDJA 4JYAB 4DR2O 2Z3YA 3K58A 3WL1A 3OEEG 1SERA 1YSCA 4X1KB 4B3MB 3CH9A 4DIPA 3DGEA 1K4CC 2DQ0A 2YBUA 3BABA 4F6RA 2CTRA 1S72V 3WH0A 2ATKC 4K3AA 5IJ0A 5IY5C 4I5SA 2UXDB 4FLWA 3B9DA 3A0BZ 1H8EG 4JI3B 2ZD9A 4CC5A 3I55V 1XNRB 4LF7B 1JJOA 4LF5B 4IIJA 4FLYA 4HBEA 4NTXA 4A5UB 5LBQA 1J4IA 1HR0B 3AQUA 4ODKA 1FKDA 5GW7A 3JYCA 3JSLA 1FKFA 3DTUB 4LNUA 1NTMH 1E1QG 5BXJA 4D7SA 1BL4A 3K5LA 3T1CA 4DUYB 1M5YA 2XP4A 4C7UA 3OUSA 2W0XA 1XRVA 2ETNA 4U3FH 1FFQA 2ZR2A 1BQZA 1LR1A 1ZAUA 3MHHC 1Q90D 1GMGA 3TXQA 1MSWD 5EBMC 3GVMA 2E5LB 4QT2A 2LFSA 2KG7B 4DH0A 1AI6A 3JAWB 1L1PA 1VF6A 1VP7A 2XTAA 2EJ7A 4TUYA 5FL7G 3O5LA 5LP6A 1EFRG 1SR0A 1MA1A 1KUQA 1FJDA 1R6TA 2B9ZA 3ZRXA 1TA8A 3QF7A 4JFKA 2A06H 3CD6V 2WSSG 2YI9A 3CMAV 2M08A 4FPPA 4R5EA 1H2KA 2Q7GA 2WLMA 3JALB 5FNVB 3NXSA 1RP3B 2LO1A 4DZ3A 3U10A 3KZIZ 1AB3A 4CH6A 4H33A 2QGNA 1OGBA 5CBHA 5CA1A 5EIBD 4JI5O 4RQEA 3P3PA 4L87A 2ZE5A 3DC6A 4FVMA 2B1GA 3OE7G 4J7JA 3OFNG 3B4SA 1OHHG 3IK8A 3WL0A 1BMFG 4O4LB 1I5YA 3CMEV 3X2QB 4YY3B 4MNJA 1RSOB 3OAAG 2XUMA 1S0VA 1VQLV 2F4VO 2PBCA 3ASNC 4JYSA 3ALFA 2QWOB 5B1AB 1RD6A 5EC1C 1OCCC 1BQ0A 4U86A 2ITDC 1AR5A 3ZRVA 3RVZA 4Q6GA 4MNMA 2RMKB 2DG4A 3QO8A 4GYCB 4TSFG 1W9UA 3T1HO 3S3XA 2BSKA 4X65B 4W5UA 3F7VC 4Z2LA 5FPRA 2HHHO 4YJ3B 2UUCO 3BMBA 1SZTA 2JK5C 2EIKC 4W9OA 5KHKA 5LL6Y 2XHBA 1NU1H 1A7XA 2N87A 4FLUA 1NR1A 1D6OA 1RPRA 4Z1MG 1KB9F 4HAMA 3N2GA 4DWSC 5B1OA 4R8CA 4X1KA 1M56B 3JCUZ 4LFBB 1O6IA 4UVCA 4FK5C 4TNSA 5HT1A 3LUOA 4R50A 3O5QA 2RN9A 1GM7A 1E1RG 5JH7B 2EIJB 1P7GA 1E6RA 2ZDIC 1BHAA 2ZT9B 4WF9V 2EX3A 4Z1VA 2CE4A 1YF2A 1HNXB 3JCZA 1KFWA 3RVYA 3K57A 1EZJA 4WFEA 1KYOF 2UXCO 1IBKO 2DYRC 4UFZA 3A8TA 1SQPH 4HBNA 3WG7B 1QLEB 1HNZO 2WLIB 2EILB 3AG2B 2YEVB 3AS2A 2Q0AA 1KT0A 4S3KA 4DV1O 4EFBA 3T1YB 3GTYX 2F1MA 3AG4B 1JQ0A 2CGNA 1WNOA 2ZNIA 1AP5A 4GIVA 2NLJC 4QPKA 1TUBA 3FAVB 5LHHA 3QO7A 1MG1A 2E74B 1FJGB 1P7BA 2EZPA 3O65A 5HW7A 4I55B 1FXHA 3D36C 3HKCB 1YCIA 2RQ6A 4JZ2A 1YJWV 3SJAC 2KE0A 4JI2B 2WWWA 2KG7A 5JJEB 3JAWA 1IXBA 5L3GA 4I50B 3CHDA 1BZKA 4O4HB 4L3NA 1R3JC 2A3AA 1QCEA 4QZVB 4U84A 3E8HA 4HBOA 1ITXA 4LF6O 2DMXA 4TT3G 1W1YA 1WA8B 4X64B 2RDCA 4DV3B 3G80A 4MW3A 1YI2V 1G1XB 3OR6C 2EZOA 3JALA 4TOIA 1K97A 5FNVA 1WAWA 4I0XB 1B6CA 4ODOA 4JFLA 1KKCA 5B3SC 4NSBA 3O5PA 2ZR3A 1Z5WA 3Q4HB 4J9ZB 1K9TA 1M4UA 1TGOA 1RM1C 1IVSA 4X9QA 4G28B 3I5DA 4DV0O 5BMVA 4UVAA 2PF4E 3VOUA 2FKXA 4G50A 2OWOA 2O57A 4N23A 2XP3A 2QSAA 4GX1A 2GUZA 2XP5A 5B1NA 4JFMA 2RUDA 4CBCA 2BOCC 3JASA 3CCEV 4FFBA 4ZI7B 2YXYA 1X4TA 1RSOA 3FB5C 2R70A 4KXRA 3ARTA 2BOBC 2ZQSA 1H2LA 1XEQA 3JATB 2RNBA 1TAEA 2P4KA 4FMTA 2PYJA 2AXTZ 2LGWA 1H0GA 1LUWA 4NZCA 5DITA 1OV9A 2UXBB 4KHPB 3T4ZA 3APOA 3ARXA 3CX5F 2QWPB 4QJFB 4JI1B 4PDLA 4OPHA 3MAQA 3WU2Z 1D7JA 2LJ4A 1FPOA 3W4RA 3U0ZA 2ITKA 3G6MA 4JV5O 2GDSA 2ZM6B 3KAIA 3AG3C 2WLNA 2QJ1A 3SPCA 2FKEA 1OZ0A 4O2TA 4UCVA 4EKWA 3C90A 3CCJV 4JI0B 2ODMA 3ZMSA 3ABMC 3GWOA 1ROTA 5LA6A 3JAKB 1PNMA 3CPWU 5IT9N 4GKJO 2RSEA 5TISZ 5IWAO 4X62B 4ITZA 4PA6A 5DN6G 3N2KB 1OCRB 2BTOA 2Q9LA 1NWTA 1ZCNA 1PL0A 4J80A 3OMNB 4B3SO 3CJHA 3OTOO 3UF8A 3H01A 1Q43A 2Y0PA 3JYJA 5KLVH 1M57C 3EFFK 5GTHZ 2WLZA 5JQGB 4DR5B 3ARWA 3B8SA 2WLIA 1XNQB 2VQEO 3O9OA 1JNSA 4J42A 1VF8A 4KQZA 2IH3C 2UU9O 1DLBA 1XUQA 4Z2GA 3O5FA 5EZYB 5LMNO 5IYZB 1G4YB 4NXNB 3TETA 4JI8O 4C02B 3W7TA 1N33B 2PPOA 1LL6A 2XASA 4JFIA 5JJNB 3HKCA 3IKGA 3HKDB 1YIJV 1VQ8V 4XAKA 3LDCA 4MW8A 4UVBA 1AI5A 4I9WA 2Y4UA 1EYMA 5DO2A 1VMGA 1THZA 2G41A 3UQIA 1AR4A 2JEUA 1JFFB 4I50A 3B7XA 3ETEA 1WP8A 4O4HA 1M1KW 1FKAO 2JVDA 4J11A 5J2UB 2KI3A 3BFRA 2JGDA 4MTXA 4OX9O 4WFHA 1QVGU 1WA8A 2Y48A 1H2GA 1HKKA 3WFVA 5H2FZ 1FS0G 4BIZA 2HFEC 2Y69C 3SJCC 4B3RO 1XHXA 2LQTA 1WPXA 1Q7YW 5K1XA 3AG1C 3WKZA 4DR1O 4K0KB 3O5KA 4J4OA 1DGSA 2JEXA 2P5OA 3RGBA 3OMIB 3OT7A 2UUBB 1K33A 4F6RB 2WLLA 1Z5VA 5IJ0B 1BCCH 2UXXA 1E6NA 3WQWA 4TW8A 3LDDA 3KZ7A 2XPAA 5ITZA 1FKSA 1DF4A 2KKWA 3KKYA 3CC7V 4X88A 3AS0A 4IIJB 5J2TB 2QM4A 3J7AU 2A3CA 4JYAO 5HWCA 2YXHA 4JASA 4LWSB 3JYMA 2M1IA 3VQWA 4ML4A 1COWG 1ZBCA 3ZMUA 3RFWA 2PPPA 2F4EA 4DRXA 1W9VA 1WN7A 1I94B 1E6PA 1YHQV 3G6LA 3JATA 1FKKA 2QKSA 4FJCC 1GO3F 1SQFA 2ZQMA 2PGGA 3WB0A 2DN9A 1D5NA 4WKAA 2YIDA 4LF9O 3CC4V 4I4TB 3ZHUA 4KFMA 1V9PA 1JCHB 2GTAA 1HKMA 1L8DA 2AHYA 1NVPD 3KADA 3BXWA 5HW8A 1QZ2A 2HR3A 1VQ6V 2B31A 2YXLA 2KR7A 2QWQB 4AQYO 4JFJA 2Y4TA 1E6ZA 2D9FA 2KQXA 4UDMA 1NMWA 1QR9A 4K8XA 2PV2A 4K35A 3KABA 2R9IA 3M99B 2VQFB 1NWRA 5IE9A 3BRCA 3VQXA 3L70H 3OGCC 2Q7EA 5H6RA 4U7OA 4FM2A 5EYPA 4IT5A 5B8IC 1NR7A 1SF9A 2DQ3A 1N34B 4JI7O 1EIBA 4HYOA 2ZE8A 1D7IA 2E3CA 1NVPB 3L71H 3N2KA 4ZBMA 4DR3B 3JSNA 1PNLA 1V55C 3ARQA 2QF8A 3D3IA 3OW2U 4ZOLA 1OCZB 4EFEA 3ETDA 2DWEC 4DXWA 1S5LZ 1NTZH 1X59A 3KCYA 2ZIMA 1HJXA 3QOKA 2PYLA 2A0LA 3WB1A 1FYJA 1DF5A 1FAFA 1ZWIC 3BEHA 2D2CB 5F2VO 1J5EB 3L9DA 4D6TH 5DIUA 1KC8W 4LF4B 2CH7A 4G2PA 1BE3H 3K06A 4W9PA 2QTOA 2BCCH 4FIPC 1BKFA 5EBWC 2DOSA 2EINB 4NR1A 2BSKB 3CGNA 2EIMB 5J9PC 1SRYA 4DRIA 2OCCB 4J10A 2XP6A 2EIJC 4ZPVR 5KHHA 3PJSK 3RBZA 1D7HA 4FM1A 5H5NA 1K5QA 5JCOC 3N2GB 2H8PC 1SESA 4J7KA 2X7RB 4NTYA 5DIVA 2WLHA 4LFAO 3RYCB 1QR8A 3WG7C 3BY6A 1QLEC 3C3SA 3R65A 3IAYA 4Z2KA 5BXZA 3EY6A 3A2FA 1PINA 1W1PA 1YZBA 1XQ8A 2ZXWB 3F5TA 1R6KA 3D36A 1CXZB 1LQ0A 5J2TA 2XAFA 4DV4O 1N36O 4X20A 2GBOA 3CHXA 1ZBVA 1WP7A 1LG1A 2ADPA 2IJIA 4LWSA 1KBHA 2JS3A 3ETGA 5LOVA 4UCSA 2AGAA 3CRQA 4IPXA 1F4MA 1M9NA 5JVDA 2PUSA 4MT8A 3GPKA 1SKVA 4O2BA 3UQAA 1ZBWA 4LF8B 1L0NH 1TUBB 4IT4A 1IBLB 2FAPA 3SPGA 3M8AA 1W26A 4MTVA 1NS1A 3H1LH 4DR4B 5BR8B 4PD4F 4I4TA 2VWJA 3WD2A 1JCHA 3SPJA 4O4IB 1VIBA 3FB6C 2H94A 3G6BA 1IXMA 4MVOA 5KHJA 3TCZA 1DK1A 4J4NA 4CS3A 2FL4A 2X6AA 3ABLC 2AW9A 1YJNV 5GPRA 2W0FC 1TCOC 4X89A 1EDQA 4J9YB 2PV1A 1SYTA 3ARVA 2WLJA 1TFVA 5K1PA 2IW5A 1Q5OA 3L73H 3AS3A 1GH6A 4J7ZA 1ZL8B 4JAVA 3RN4A 4LH6A 5AG2A 2W6JG 3CXCU 1E15A 4W9QA 5HW6A 4BW9A 4IYIA 1AI4A 2IUZA 4IL6Z 1XMQO 1UR9A 4QNHB 1XDCA 2PI4A 5BMVB 1OCOB 3ASOC 1KP3A 3WQVA 2XOKG 4MSPA 1JPXA 4P9OA 2GUZB 4QIBA 4CS4A 2XP9A 2G38A 4BW5A 1K3EA 3B77A 1HKIA 4DRHA 1NH2D 3F7YC 3UT5B 4DV2B 1V54B 2O92A 1IBMB 1HP8A 2QWRB 4PA7A 2OYQA 3MDYB 3PRAA 2N04A 3JASB 4FFBB 4LBEC 2F95B 2WA3A 1L1FA 1JVMA 5KHIA 4FFKA 2BTQA 2L35A 5L3DA 4OXSA 4UXNA 5IYCO 2UUAO 1S77D 4KR0B 4TQFA 3TXSA 1ZUQA 2ZKOA 1BS3A 4X8AA 2LGOA 4GKKO 2WAMA 1NH2B 4DR2B 1VF7A 2Q0OC 4DR6O 3K03A 4JZGA 4DRNA 4AHCA 5GTIZ 5LMUO 2YSUB 4HNAB 2KGJA 4GCZA 1B3QA 4GT1A 4YXWG 4BIUA 2H3OA 4LAWA 3NR7A 3R66A 4E4EA 4WIWA 1JVWA 2F21A 1S76D 3ICXA 2QA4V 3RW0A 3QG5A 4GZRB 1VQ9V 1Q6HA 4YIPA 1QQCA 2JGUA 3RYCA 2QE7G 4JI4O 5LA6B 1AVMA 1N1AA 2LKNA 3W7UA 3PRDA 3E35A 4JF3A 3QTCA 4RAIA 2IBZH 1F51A 5B1BC 3AS1A 1R6NA 4CH3A 1R73A 2YS8A 4DV5O 1FKRA 1L0LH 1XOUA 3B8NA 3SYCA 1N0JA 1P5QA 4U85A 3CJHB 1NZ6A 1GK9A 1QBZA 1F23A 3K3WA 4XDJA 2FYUH 4DV7O 1CPYA 3FX7A 3RGCA 3ZIAG 2DPEA 1QPFA 3WIJA 2VRZA 4ODMA 1SQXH 1YW5A 3EVKA 3W7SA 2FDMA 5A9GA 1TVKA 2QDOA 2K1EA 4ABMA 4FLXA 3TGUH 4DYLA 4HZ3A 4G27B 5KMGA 4TYOA 3T4DA 2DYSB 5CA0B 1U79A 1N8RW 3CC2V 3L75H 4O4IA 5IY5B 3SJQC 3OGIB 2P22C 1SQQH 3H9VA 3RFRA 1K8AW 5LHIA 1HJVA 2YUAA 2OIEA 2IU3A 3RM9A 1B06A 3ETQA 2JGDB 3LSUA 1QU7A 2NN4A 2JDIG 4DUZO 2OIGA 1AJPA 4UV8A 3K0GA 2N05A 2DJVA 2UXNA 4Z2WA 4JI5B 3MHSC 3GWKC 1F4NA 2Q7HA 1W0KG 3O5GA 1ZL8A 4TV8B 1FKJA 3ABKC 1CEZA 4R6ZA 1HW7A 2WLLB 3VBBA 2ZCEA 5H6QA 3RYIA 4LAVA 4ZS6A 2GTSA 1Y0OA 5ITZB 3KAGA 4LC1A 1FXKC 2CUGA 2R72A 3UI5A 4LR3A 1VQ4V 3ZJZA 1R9HA 4W4KA 3UT5A 1Y76A 1WB7A 1Q3EA 3BCCH 3CS5A 2Q4PA 4YHHB 4FLTA 3CCVV 1H2SB 3OR7C 2YI8A 3ZMZA 2M6YA 4WFBV 4DRXB 2F2DA 4RO2A 1VF6C 3KAHA 3K9SA 5JH8A 1MOFA 4PJ0Z 2CTPA 1RPOA 4PI0A 2CTQA 3QO5A 2DSVA 5LP6C 3T1HB 2RQSA 1UJWB 3CCRV 1ZU8A 4PV1B 1AILA 2HHHB 2Z0AA 2UUCB 4PDVA 4UCUA 2Q8VA 2CGOA 2HVJC 2OTJV 4BWAA 4HNAA 4P8WA 3ARPA 3RYFB 4N19A 3EHBB 1R3LC 4B7KA 3O5DA 1GM9A 3BAAA 2XT9A 3A0HZ 5KA5A 2AHZA 4IQCA 5L3EA 2PI6A 2LW1A 3OUFA 1NH6A 3E83A 2NNUA 4DO2A 5FLXN 1XI1A 4QPJA 5KAIZ 2D3OW 4B3TO 3ALGA 3ARYA 1Y4MA 5EYPB 3ABTA 1AP6A 3SYAA 4P30A 4UB6Z 1KD1W 1N4CA 1J4RA 2UXCB 2ARHA 1IBKB 3TK1A 1VQNV 1MNGA 3FAPA 1OCCB 1W2BU 1BHBA 4MTGA 4DWSD 1HNZB 2XAHA 2RCVA 1WB8A 3QNEA 3CCQV 4LFCO 4NKGB 4ZOLB 4DV1B 1GN2A 2ILMA 2WLKA 4XDKA 3RM4A 2MLXA 4BIOA 4ZIBA 3WD4A 4R7CA 3CHEA 2EIKB 1JNEA 5KUKA 1G8MA 1KKDA 2AOSA 2EINC 1NT2B 1US6A 2XAQA 5FPOA 1VQ7V 1KT1A 3ARSA 3W7WA 4DWSB 5E79Z 4GX2A 3ZBHA 2JZVA 2EBOA 5CA0A 4I7ZB 2CH7B 2V4DA 1HXVA 3B2EE 4EB6B 3FXYA 5KUMA 4X1YB 1MZFA 4JYCA 4NXMO 3CWBH 4WFAV 1HNWO 1K92A 4LF6B 2XP7A 4PA3A 4F6EA 3BA8A 5LHGA 2QM7A 4R0XA 3UCSC 1W9PA 2PPNA 4LAYA 5H9CA 1M90W 3VQYA 2ZNJA 1SQVH 4PDMA 3A0RA 1IX5A 4P9PA 2W6IG 2V1DA 1NSGA 1W1VA 2DYRB 4JI6O 1XMOO 3IC9A 3HKBB 3M7MX 2JJ2G 1E79G 2A7WA
chains in the Genus database with same CATH topology
4W9PA 5GPGA 3WL0A 1BKFA 1GUVA 4DRMA 1FFRA 2WM0A 1ZL1A 3CGNA 3RMEA 4MNJA 3PR9A 4DRIA 2MNTA 2XP6A 1FKLA 2PBCA 4LGXA 4JYSA 3ALFA 4ZPVR 1D7HA 4IT6A 3VAWA 1RD6A 2OLHA 4TW6A 1Q6IA 4Q7NA 2A3BA 3O5RA 4U86A 2DT1A 4MNMA 2DG4A 1F8AB 1FKHA 2MF9A 5DIVA 1W9UA 3NI6A 4Z2HA 2IF4A 4W5UA 4Z2KA 4Z2LA 3EY6A 1PINA 1W1PA 4W9OA 3CHFA 1A7XA 1GPFA 2N87A 1XHGA 3TDBA 1LQ0A 1D6OA 2RUQA 4DWSC 1ZB5A 1ZBVA 4ODNA 3WD0A 1LG1A 4FN2A 4Z2IA 4WKFA 1FKIA 1O6IA 3B9EA 4IPXA 4TNSA 5HT1A 3LUOA 5DF0A 3O5QA 3ARUA 1LJYA 2ZR4A 3GPKA 1E6RA 4ODQA 3UQAA 1GOIA 1ROUA 1ZBWA 4AY1A 3NRKA 1FD9A 4IT4A 2FAPA 1KFWA 3CGMA 2LPVA 4DROA 1W26A 4MTVA 2XP8A 4WJXA 1EHNA 4NNRA 3WD2A 3PA7A 3WD3A 3AS2A 3TCZA 4J4NA 1KT0A 4S3KA 4TW7A 3KAFA 3O5JA 3IHZA 4P8VA 1WNOA 2MLZA 2KFWA 4GIVA 4IQ2A 1FKTA 5GPRA 2Q5AA 2VN1A 1TCOC 4GGQA 2OFNA 2RUCA 2ZQVA 1T11A 5I98A 1EDQA 5HW7A 2PV1A 1SYTA 3ARVA 1TFVA 2KE0A 4DT4A 3AS3A 1HJWA 3ODKA 2DG3A 3CHDA 1UR8A 4L3NA 1E15A 2A3AA 4W9QA 1X6NA 4QZVB 5HW6A 4U84A 2IUZA 4HBOA 1UR9A 1JNDA 4DWSA 1ITXA 3CZ8A 1J6YA 1W1YA 3UI4A 3WQVA 2VCDA 4MSPA 3ARZA 4QIBA 2XP9A 4L72B 4QT3A 3ARRA 1HKIA 4Q22A 1WAWA 4DRHA 1B6CA 4ODOA 4JFLA 2M2AA 2O92A 3JXVA 4NSBA 3MDYB 3PRAA 3O5PA 3O5MA 3PRBA 1J4HA 1K9TA 1FKGA 1PBKA 2DSWA 4MAVA 5HTGA 4KR0B 4G50A 2XP3A 3FY1A 2XP5A 2LGOA 4JFMA 5J6EA 2RUDA 4DRQA 2Y78A 4DRNA 2DSUA 2KGJA 1E9LA 3ARTA 2ZQSA 3UI6A 4LAWA 4WIWA 1JVWA 2F21A 1H0GA 5DITA 4NZCA 1QPLA 2ESCA 4DZ2A 3ARXA 2KO7A 1Q6HA 3TC5A 1D7JA 2LJ4A 1N1AA 3PRDA 2LKNA 3W4RA 3AROA 2ITKA 3G6MA 3AS1A 2ZR5A 3KAIA 1FKRA 1LL7A 2FKEA 4S3JA 4O2TA 2DG9A 1P5QA 4U85A 1D2KA 5DEZA 1ROTA 3RGCA 2DPEA 1QPFA 3WIJA 4P8UA 2RSEA 1LL4A 3OA5A 4ODMA 4ITZA 1YATA 1YW5A 1NWTA 1ZCNA 1WB0A 1Q1CA 2FDMA 1OGGA 3RM8A 3UF8A 3JYJA 1NWUA 5HUAA 2WLZA 4TYOA 1U79A 4P8XA 3NTPA 3ARWA 2AWGA 3B8SA 1ZBKA 4MNKA 5D75A 2WK2A 4MNLA 1JNSA 1VF8A 1HJVA 4KQZA 3UQBA 2XPBA 4Z2GA 3O5FA 1W1TA 3RM9A 3H9RB 4DRPA 4ODPA 4WKHA 1EQ3A 1FKBA 3WD1A 4C02B 2PPOA 1HKJA 1LL6A 4DRJA 4JFIA 4DRKA 3KCEA 3IKGA 4XAKA 3OOBA 1EYMA 2A3EA 5DO2A 2G41A 3UQIA 1JNTA 2WLYA 2MPHA 2ZQUA 4PTMA 1X6LA 5HKGA 3O5GA 3B7XA 1C9HA 4LAXA 1FKJA 5GQBA 3B09A 2KI3A 4LAVA 4ZS6A 1Y0OA 4MGVA 2ZQTA 3KAGA 1HKKA 3UI5A 4WK9A 1R9HA 3WKZA 2O9OA 2G8ZA 3O5KA 4J4OA 2UZ5A 2PV3A 4HARA 4ZPWR 3B9AA 3KACA 2F2DA 3CHCA 1E6NA 3KAHA 4TW8A 3WQWA 5JH8A 3KZ7A 2XPAA 2DSVA 1FAPA 1FKSA 2RQSA 3AS0A 2A3CA 4ODRA 3WL1A 1ZU8A 3O5EA 5HWCA 3JYMA 5HBFA 2M1IA 3CH9A 1NWSA 4DIPA 4ML4A 1ZBCA 3RFWA 2YBUA 4ODLA 2PPPA 2F4EA 3WH0A 4P8WA 3ARPA 1W9VA 3B9DA 4N19A 1E6PA 3G6LA 3O5DA 1FKKA 3O5OA 4HBEA 4TX0A 4Z2JA 4IQCA 1J4IA 2PI6A 4WKAA 3AQUA 4ODKA 1FKDA 1NH6A 1FKFA 3ALGA 3ARYA 5BXJA 1HKMA 2L2SA 1BL4A 2RURA 3KADA 1J4RA 4BF8A 3BXWA 1M5YA 5HW8A 1QZ2A 1CTNA 2XP4A 2B31A 3FAPA 3I6CA 2KR7A 4FAPA 1XRVA 4JFJA 2DT3A 4DWSD 1FFQA 1E6ZA 2D9FA 1NMWA 4ZPTR 2PV2A 5HWBA 3KABA 1NWRA 2ZR6A 4QT2A 1H0IA 3RM4A 2MLXA 3WD4A 4DH0A 3CHEA 1L1PA 2DT0A 5B8IC 1EIBA 1JNEA 2DT2A 2K8IA 1D7IA 2AOSA 3O5LA 1SR0A 1F40A 1KT1A 3ARSA 1FJDA 3ARQA 4DWSB 2QF8A 4JFKA 2YBTA 2JZVA 4MPKA 2M08A 4R5EA 1HXVA 1HJXA 3IKDA 3FXYA 1NMVA 1LG2A 4DZ3A 2XP7A 3QOKA 4R0XA 1OGBA 1W9PA 2PPNA 4LAYA 1IX5A 3O5IA 2DSZA 5DIUA 1NSGA 1W1VA 1Q6UA 1OWQA 2MLYA 1ZK6A 4URIA 4G2PA 3IK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROT A;  4W9P A;  5GPG A;  4DIP A;  3RGC A;  2KE0 A;  1BKF A;  1QPF A;  4DT4 A;  3RFW A;  3ODK A;  4ODL A;  2RSE A;  4DRM A;  2PPP A;  2DG3 A;  2F4E A;  3CGN A;  4ODM A;  3WH0 A;  4ITZ A;  1YAT A;  4DRI A;  4N19 A;  4W9Q A;  5HW6 A;  2MNT A;  2XP6 A;  1FKL A;  1YW5 A;  2PBC A;  4JYS A;  3O5D A;  4U84 A;  1FKK A;  1ZCN A;  3O5O A;  1D7H A;  1Q1C A;  3VAW A;  3UF8 A;  1J6Y A;  4TX0 A;  4TW6 A;  3JYJ A;  1Q6I A;  4IQC A;  3UI4 A;  3O5R A;  1J4I A;  4U86 A;  2VCD A;  5HUA A;  4TYO A;  4MSP A;  4ODK A;  4QIB A;  1FKD A;  1U79 A;  2XP9 A;  4QT3 A;  3NTP A;  2DG4 A;  2AWG A;  1F8A B;  1FKH A;  2MF9 A;  5DIV A;  4DRH A;  1FKF A;  1B6C A;  4ODO A;  4JFL A;  2M2A A;  3JXV A;  3NI6 A;  5BXJ A;  5D75 A;  2L2S A;  2IF4 A;  3MDY B;  1BL4 A;  2RUR A;  3O5P A;  3KAD A;  3O5M A;  1J4R A;  3PRB A;  1JNS A;  4BF8 A;  1J4H A;  3EY6 A;  1PIN A;  1M5Y A;  5HW8 A;  1FKG A;  1QZ2 A;  1PBK A;  4W9O A;  3FAP A;  2XP4 A;  3I6C A;  3UQB A;  2KR7 A;  2XPB A;  4FAP A;  3O5F A;  4JFJ A;  3H9R B;  5HTG A;  4DRP A;  2D9F A;  4ODP A;  1A7X A;  2N87 A;  3TDB A;  1NMW A;  1EQ3 A;  2PV2 A;  1D6O A;  4G50 A;  1FKB A;  5HWB A;  3KAB A;  4C02 B;  2RUQ A;  2XP3 A;  2PPO A;  4DRJ A;  4ODN A;  2XP5 A;  4JFI A;  1L1P A;  4DRK A;  4FN2 A;  2LGO A;  3KCE A;  2ZR6 A;  3IKG A;  4JFM A;  2RUD A;  4QT2 A;  4DRQ A;  5J6E A;  3OOB A;  2MLX A;  1EYM A;  1FKI A;  4DH0 A;  2Y78 A;  3UQI A;  4DRN A;  1JNT A;  4IPX A;  2MPH A;  2ZQU A;  4TNS A;  3LUO A;  5HT1 A;  5B8I C;  3O5G A;  5HKG A;  3O5Q A;  2K8I A;  1C9H A;  1D7I A;  2KGJ A;  3B7X A;  1FKJ A;  4LAX A;  2ZR4 A;  3O5L A;  3GPK A;  2ZQS A;  4ODQ A;  3UQA A;  3B09 A;  3UI6 A;  1ROU A;  1F40 A;  2KI3 A;  4LAW A;  1KT1 A;  4LAV A;  3NRK A;  1FJD A;  1FD9 A;  1Y0O A;  4MGV A;  2ZQT A;  2FAP A;  1JVW A;  2F21 A;  3KAG A;  5DIT A;  3CGM A;  2LPV A;  1QPL A;  4JFK A;  4DRO A;  1W26 A;  4DZ2 A;  2JZV A;  2KO7 A;  2XP8 A;  3UI5 A;  1Q6H A;  2M08 A;  3TC5 A;  1HXV A;  1R9H A;  4NNR A;  3IKD A;  3O5K A;  1D7J A;  2LJ4 A;  4J4O A;  3PA7 A;  2UZ5 A;  1N1A A;  3PRD A;  2LKN A;  1NMV A;  2PV3 A;  4DZ3 A;  3TCZ A;  2ITK A;  2XP7 A;  4J4N A;  1KT0 A;  4TW7 A;  3KAC A;  4R0X A;  2F2D A;  2PPN A;  3KAF A;  3O5J A;  3IHZ A;  4LAY A;  2ZR5 A;  3KAH A;  3KAI A;  4TW8 A;  2MLZ A;  2KFW A;  4GIV A;  1FKR A;  4IQ2 A;  3KZ7 A;  2FKE A;  2XPA A;  1FKT A;  3O5I A;  1FAP A;  1FKS A;  2RQS A;  2Q5A A;  4O2T A;  5DIU A;  2DG9 A;  1P5Q A;  1NSG A;  2VN1 A;  1TCO C;  4U85 A;  4GGQ A;  2OFN A;  2RUC A;  2ZQV A;  1T11 A;  5I98 A;  4ODR A;  1Q6U A;  5HW7 A;  2MLY A;  1ZK6 A;  3O5E A;  2PV1 A;  5HWC A;  4G2P A;  3JYM A;  3IK8 A;  2M1I A; 
#chains in the Genus database with same CATH topology
 1VEW A;  4X66 O;  5EBL C;  5C8Y B;  3SDL A;  4O2A A;  1FFR A;  4DV0 B;  3RME A;  4PDR A;  1YDX A;  1VQ5 V;  4TV8 A;  2X0L A;  2F23 A;  4QE9 A;  4PA4 A;  4WBN B;  1FKL A;  3OMA B;  4DR7 O;  3VAW A;  4ZHQ A;  1N32 O;  3DSQ A;  3E8B A;  3U11 A;  3CE2 A;  4Q7N A;  3O5R A;  2QM8 A;  3SYP A;  4X20 B;  5LYJ A;  1F8A B;  1FKH A;  2WA4 A;  5LOV B;  4MTO A;  3AEI A;  3NI6 A;  2HVK C;  2IF4 A;  3FYI B;  1U96 A;  2IJK A;  1S5J A;  1NJI W;  2AZ0 A;  4B3M O;  5JVD B;  1I5X A;  1VAR A;  4L8J A;  2GV9 A;  4O2B B;  1Y74 A;  3CHF A;  4UV9 A;  3P30 A;  1AJQ A;  2QKA A;  2UXD O;  2RUQ A;  1ZB5 A;  4ODN A;  2B1I A;  4JI3 O;  4JV5 B;  1AR1 B;  4FN2 A;  1K34 A;  5B3S B;  1XNR O;  4LF7 O;  4LF5 O;  3PN1 A;  3ZHS A;  3AK1 A;  4WKF A;  2PI5 A;  4QE7 A;  2FML A;  3OEH G;  3RYH A;  3AK3 A;  3JD3 A;  2PZS A;  1HR0 O;  1Y66 A;  4WFG A;  3RYF A;  1RM1 B;  1LNQ A;  1EN5 A;  1LJY A;  1EBO A;  3CP1 A;  4ODQ A;  1GOI A;  3E8F A;  3G67 A;  3NRK A;  1FD9 A;  2JJ1 G;  2KB1 A;  3E89 A;  1OJH A;  4GKJ B;  2N74 A;  4DRO A;  4DUY O;  1ENV A;  3E86 A;  5IWA B;  1R1B A;  4GX5 A;  2XP8 A;  1XIL A;  1EHN A;  4WCE V;  5A2Q N;  1VQP V;  2JS5 A;  3IGA C;  3WD3 A;  4W4L A;  3OTO B;  2VS0 A;  1XBL A;  2E5L O;  1ORQ C;  3KAF A;  3O5J A;  2DWD C;  2ZE7 A;  3IHZ A;  5LGT A;  3X2Q C;  1Z2G A;  1B6Q A;  5E1A C;  3G6E V;  1FKT A;  2PY5 A;  2RJZ A;  1Q86 W;  5EIB C;  2VQE B;  2ZQV A;  1T11 A;  5I98 A;  5B1A C;  4B08 A;  4FLZ A;  1VQO V;  1VQM V;  1BGY H;  3J81 N;  2UU9 B;  3ZMV A;  3I56 V;  4DT4 A;  3S3W A;  3ODK A;  1HJW A;  3G4S V;  2HJD A;  3AG3 B;  5LMN B;  5KX5 A;  4YIO A;  1NQT A;  3K5N A;  4JI8 B;  1XL6 A;  2ZE6 A;  4F4L A;  1GN3 A;  1UFI A;  1WLE A;  4FLV A;  3UO2 A;  2ADQ B;  5D5Q A;  1AJN A;  2BTQ B;  4DWS A;  3CZ8 A;  1J6Y A;  3UI4 A;  3ABM B;  1BL8 A;  2VCD A;  3JAR A;  3ARZ A;  4JTC B;  2IJJ A;  4EB6 A;  1MSD A;  2IM9 A;  3ARR A;  4X1Y A;  1M56 C;  4KUM A;  4OX9 B;  2ZDI A;  1FFT B;  5HFM A;  3JAM N;  1WPB A;  3O5M A;  1GRJ A;  4WFF A;  3WB2 A;  1J4H A;  3PRB A;  1FKG A;  1PBK A;  2B5U A;  4B3R B;  2DSW A;  4OPA A;  4MAV A;  3CB2 A;  1M57 B;  4CH4 A;  3P32 A;  4ASU G;  4YY3 O;  3HKB A;  4MSW C;  3FY1 A;  1P49 A;  5LGN A;  1WNS A;  4LH7 A;  2CDY A;  3EXA A;  4DRQ A;  1CP9 A;  2E75 B;  5C8Y A;  2P67 A;  5GON B;  2Y78 A;  4B7E A;  4DV6 B;  2P90 A;  3E22 A;  4JAU A;  2EIL C;  4TWK A;  3AG2 C;  1DTO A;  4WBN A;  4J41 A;  3AG7 A;  4JGS A;  4X65 O;  2Q67 A;  3ZRW A;  3AG4 C;  4G2K A;  3MDS A;  3GB7 C;  2ESC A;  4DZ2 A;  2KO7 A;  3TC5 A;  2DYS C;  5DEC A;  5KHG A;  1XHZ A;  1D5A A;  1FXV A;  3UKM A;  1F7Y A;  3ARO A;  3FB8 C;  1PL4 A;  2XAJ A;  1VQK V;  2ZR5 A;  4LF9 B;  4LFB O;  1ZSP A;  4CH5 A;  1LL7 A;  1AI7 A;  5CA3 A;  2Y69 B;  1UPG A;  3K5O A;  2DG9 A;  1TVK B;  5DEZ A;  1P4R A;  3AG1 B;  1S3J A;  1JJ2 U;  1HWY A;  4MVS A;  3OM3 B;  4TV9 A;  5B5E Z;  1I7F A;  2V7Q G;  5KMG B;  2M7W A;  3LUT B;  2IJH A;  4MTF A;  1HNX O;  4AQY B;  5CBF A;  1H2N A;  3ZN0 A;  5BY1 A;  1QNM A;  3ZRS A;  2CK3 G;  1FXK A;  4N21 A;  1Q1C A;  1OGG A;  1K9M W;  3HPL C;  3T1Y O;  4IHJ B;  4JI7 B;  1NWU A;  5CB4 A;  1RFY A;  3HB3 B;  4X1I A;  3NTP A;  4RWU A;  1VF5 B;  1FJG O;  4MNK A;  3OTF A;  5D75 A;  1H8H G;  2WK2 A;  3IJ4 A;  3AK2 A;  1GKF A;  3CRA A;  2X6C A;  3K04 A;  4I9Q A;  4JI2 O;  3RYI B;  2C2A A;  1W1T A;  4QGP A;  3H9R B;  4DW0 A;  4DRP A;  3H1I H;  4WKH A;  1EQ3 A;  4UCR A;  1URF A;  2Q69 A;  1HKJ A;  4DRK A;  3KCE A;  1HDJ A;  3T2M A;  3ZHV A;  2A3E A;  4X64 O;  1Y76 B;  4DV3 O;  2WLY A;  3VQV A;  4PTM A;  1X6L A;  1C9H A;  4LAX A;  5IYD O;  5GQB A;  3LSQ A;  2MK3 A;  3FD9 A;  2QTS A;  4BAY A;  3LDE A;  3H1K H;  4U7N A;  1NTK H;  4AI8 A;  2Q73 A;  2QKC A;  4MVZ A;  2ZQT A;  1PD3 A;  1KEC A;  5JWP A;  2E76 B;  5BZB A;  5L3B A;  1R3K C;  4WK9 A;  1EN4 A;  3SJB C;  3ZMT A;  1M5I A;  1Q8I A;  3C3T A;  2A9H A;  2UZ5 A;  2F43 G;  1BSM A;  3KAC A;  1ZLZ A;  1V55 B;  2F66 C;  3CCS V;  3FFQ A;  4YHH O;  3B40 A;  3J80 N;  1FAP A;  3TJT A;  4LFA B;  3LNM B;  1OCR C;  5CBG A;  4ODR A;  2QWN B;  1TUE B;  1NBM G;  3O5E A;  5HBF A;  1YXB A;  1NWS A;  5IJ9 B;  5GON A;  2VWK A;  3EIP A;  4ODL A;  3L74 H;  2UXB O;  4KHP O;  2GSM B;  4RUF A;  4YJ2 A;  4DV4 B;  1N36 B;  4JI1 O;  4QIW F;  2BE3 A;  3QVN A;  4JTA B;  3B8M A;  1NI8 A;  3O5O A;  1NKD A;  1PKX A;  3TCU A;  4TX0 A;  4Z2J A;  3CEI A;  4IYH A;  4MVM A;  3CCL V;  2ZM6 O;  4H44 B;  2HP8 A;  3HKE B;  2WPD G;  3UM7 A;  3GU0 A;  1I0H A;  4KP4 A;  4MVU A;  4O4J B;  2Z5U A;  1IDS A;  1FFX B;  2P4V A;  3ML0 A;  5LXT B;  2L2S A;  4E2L A;  4JI0 O;  2RUR A;  4BF8 A;  1EZV H;  1CTN A;  3I6C A;  4H13 B;  1EN6 A;  1GTO A;  2ITC C;  4FAP A;  1Y6X A;  2DT3 A;  1KMI Z;  1JR9 A;  1K5S A;  4ZPT R;  4X62 O;  4P2Z A;  1PM9 A;  2LJ2 A;  5HWB A;  4JAA A;  3MD0 A;  2ZR6 A;  1H2M A;  4MVQ A;  1H0I A;  1PV0 A;  2DT0 A;  4U3J B;  2DT2 A;  2K8I A;  4DR5 O;  4FZ0 A;  3E2E A;  3LNN A;  3F5W C;  1F40 A;  2ZIN A;  1XNQ O;  1JA8 A;  4IHJ A;  2PN0 A;  2YBT A;  1KU9 A;  4MPK A;  1MMM A;  2P06 A;  5B66 Z;  3IKD A;  3BPZ A;  1XMQ B;  4NXN O;  1NMV A;  1LG2 A;  3ZS8 C;  4O2A B;  1N33 O;  2LP7 A;  3FB7 C;  2IU0 A;  2NR5 A;  3JD0 A;  4CS2 A;  5C93 A;  2YIB D;  3O5I A;  2DSZ A;  3D8C A;  4ZHQ B;  1IZ3 A;  3STZ C;  1Q6U A;  1OWQ A;  2MLY A;  1ZK6 A;  4URI A;  1SET A;  2YIA A;  1SA0 B;  3DXR B;  3K79 A;  2HKO A;  2F93 B;  5GPG A;  5LYJ B;  2HG5 C;  1GN6 A;  1YJ9 V;  2F4V B;  1GUV A;  4DRM A;  4LP8 A;  4BR6 A;  2UUA B;  4LCU C;  2WM0 A;  1ZL1 A;  3ABL B;  3PR9 A;  1LUV A;  2MNT A;  4K0K O;  4LGX A;  3ZHQ A;  1GM8 A;  2HJF C;  2JIZ G;  4GKK B;  4IT6 A;  1Y74 B;  2UUB O;  2OLH A;  4TW6 A;  1Q6I A;  1XL4 A;  4DR6 B;  2A3B A;  5LMU B;  2DT1 A;  2MF9 A;  5DM6 V;  4O4L A;  2DE0 X;  3DC5 A;  3P3N A;  4MVR A;  4Z2H A;  3RYH B;  1SZX A;  1WJZ A;  2KSD A;  3W7X A;  4UB8 Z;  3RT3 C;  3ASO B;  1GAX A;  1YVW A;  3LSS A;  3ZED A;  4JI4 B;  3ZHT A;  1GPF A;  1XHG A;  3K9A A;  3TDB A;  3D3Q A;  1QHT A;  1SQB H;  1I94 O;  1YIT V;  2OTL V;  2QEX V;  3WD0 A;  1MZE A;  1D2D A;  1OCZ C;  4CZZ A;  5IJ9 A;  4Z2I A;  4DV5 B;  3H1H H;  1I08 A;  1FKI A;  2DW4 A;  2LW7 A;  3B9E A;  1K4D C;  3ZX6 A;  5DF0 A;  3ARU A;  2HLD G;  4YJ3 A;  3ASN B;  1YTF D;  3ZN1 A;  2ZR4 A;  2HEP A;  4RUE A;  4PEL A;  1PPJ H;  1ROU A;  1A32 A;  4DV7 B;  4AY1 A;  1SQG A;  3L72 H;  3K5M A;  3CGM A;  2LPV A;  1J95 A;  4WJX A;  1W59 A;  1KP2 A;  2LGQ A;  3HKE A;  4XBF A;  1ZTE A;  4MS2 A;  4NNR A;  3UO3 A;  4O4J A;  1ROP A;  3PA7 A;  3CRM A;  1FFX A;  2Q5Z A;  3RWR D;  5LXT A;  2VQF O;  1YEW A;  2XND G;  5JH7 A;  4TW7 A;  5KX5 B;  1YTF B;  3SGI A;  4P8V A;  2EIM C;  1QLN A;  2MLZ A;  2KFW A;  4IQ2 A;  5JCO A;  5HFL A;  2OCC C;  5CN0 A;  1N34 O;  2Q5A A;  2VN1 A;  2PTM A;  4GGQ A;  2OFN A;  2RUC A;  3K08 A;  2K9P A;  5EK0 A;  5L3C A;  2OCH A;  3JAR B;  4DR3 O;  4OGQ B;  4RQF A;  3H1J H;  4UCO A;  1SC5 B;  2YEV A;  5B1B B;  1QVF U;  4U3J A;  4FM0 A;  3G71 V;  2DG3 A;  1UR8 A;  4NB5 A;  4DUZ B;  4NYK A;  1X6N A;  3SYO A;  2A79 B;  4GLX A;  3FAV A;  2CTW A;  2B5U B;  1JND A;  3JD1 A;  2ZXW C;  4I55 A;  3UQ8 A;  4PHZ A;  4L72 B;  4QT3 A;  1MAB G;  4H0L B;  1J5E O;  1WAZ A;  4Q22 A;  3CCU V;  2FB5 A;  2M2A A;  3JXV A;  4JYY A;  4LF4 O;  3CSX A;  4JYB A;  3OD4 A;  3E22 B;  3ABU A;  2R9R B;  5HTG A;  1E44 A;  4XDL A;  3ZRW B;  3BHP A;  1S5H C;  1B04 A;  1SA0 A;  3DXR A;  5J6E A;  1O9H A;  4I0X A;  5D5P A;  1Q81 W;  3BA9 A;  2L6L A;  4FZ1 A;  1R3I C;  1M93 A;  2LFR A;  3ZHR A;  3CYO A;  1PNK A;  2XAG A;  4ICG A;  3CRC A;  2DSU A;  3E8G A;  3Q4H A;  2AZ2 A;  4Q20 A;  1E9L A;  4KL1 A;  1BT8 A;  1N0N A;  5IYB O;  2P7T C;  4GX0 A;  2Q68 A;  3UI6 A;  4ZKI A;  2YIB A;  2P6J A;  3FKS G;  3K0D A;  4UCT A;  5L3F A;  4DV6 O;  5EC2 C;  2YIC A;  1QPL A;  4TV9 B;  1O9G A;  1ARO P;  4LNU B;  3ABK B;  1JOY A;  5JJJ B;  2YC0 A;  2EUL A;  4ZI7 A;  4EEQ A;  1Y67 A;  1K73 W;  2OT5 A;  1FXK B;  1XRE A;  4B3T B;  4S3J A;  1JMK C;  1SS3 A;  3N27 A;  1D2K A;  1P84 F;  5KAF Z;  3IC7 A;  4GUN A;  2JRI A;  1OCO C;  5CB4 B;  4LF8 O;  4X1I B;  3BVO A;  5LGU A;  1IBL O;  4PA9 A;  1H38 A;  4P8U A;  1LL4 A;  3OA5 A;  4B3S B;  1V54 C;  4LFC B;  1YAT A;  4DR4 O;  4TUY B;  5BR8 O;  5LP6 B;  3K59 A;  3IFX A;  4D7T A;  1WB0 A;  2A3Q A;  4CC6 A;  3RM8 A;  2FTK A;  4DW1 A;  1PP9 H;  2YDE A;  1IUR A;  3CCM V;  5HUA A;  2QR4 A;  3HR0 A;  4P8X A;  3ZCC A;  3JAK A;  2AWG A;  3JD2 A;  2X6B A;  3SR2 C;  1ZBK A;  1K7D A;  2IH1 C;  2Q6A A;  3KCX A;  5DED A;  3APQ A;  1T5E A;  4MNL A;  5CA1 B;  3UQB A;  2XPB A;  4ODP A;  1JX9 A;  1GN4 A;  1EM1 A;  3CXH F;  5CMU A;  4NXM B;  1FKB A;  3WD1 A;  1HNW B;  5JQG A;  4DRJ A;  2EJR A;  3THO A;  3OOB A;  3JD4 A;  4DK0 A;  1JNT A;  4K8Z A;  2MPH A;  1W0J G;  2MW2 B;  2Y0I A;  3KG2 A;  4IGG A;  4NTW A;  4UUJ C;  2ZQU A;  5HKG A;  5KA6 A;  4NVP A;  4JI6 B;  1XMO B;  3B09 A;  4AIL C;  3CRR A;  4DV2 O;  5EZY A;  3SPI A;  4JPR A;  1KQS U;  1IBM O;  4X66 B;  5IYZ A;  4MGV A;  4DR1 B;  1G6U A;  4DK1 A;  3HKD A;  1ZX3 A;  3FYE B;  3SYQ A;  2GHY A;  4H37 A;  2G8Z A;  2O9O A;  2R9A A;  1U97 A;  1Q82 W;  3SPH A;  2CAZ C;  2PV3 A;  4HAR A;  4DR7 B;  1JFF A;  4ZPW R;  1N32 B;  3B9A A;  4YJ2 B;  4PI2 A;  1IX9 A;  2ZIO A;  4TQD A;  3CHC A;  3STL C;  5J2U A;  4JTD B;  5IDJ A;  4JYA B;  4DR2 O;  2Z3Y A;  3K58 A;  3WL1 A;  3OEE G;  1SER A;  1YSC A;  4X1K B;  4B3M B;  3CH9 A;  4DIP A;  3DGE A;  1K4C C;  2DQ0 A;  2YBU A;  3BAB A;  4F6R A;  2CTR A;  1S72 V;  3WH0 A;  2ATK C;  4K3A A;  5IJ0 A;  5IY5 C;  4I5S A;  2UXD B;  4FLW A;  3B9D A;  3A0B Z;  1H8E G;  4JI3 B;  2ZD9 A;  4CC5 A;  3I55 V;  1XNR B;  4LF7 B;  1JJO A;  4LF5 B;  4IIJ A;  4FLY A;  4HBE A;  4NTX A;  4A5U B;  5LBQ A;  1J4I A;  1HR0 B;  3AQU A;  4ODK A;  1FKD A;  5GW7 A;  3JYC A;  3JSL A;  1FKF A;  3DTU B;  4LNU A;  1NTM H;  1E1Q G;  5BXJ A;  4D7S A;  1BL4 A;  3K5L A;  3T1C A;  4DUY B;  1M5Y A;  2XP4 A;  4C7U A;  3OUS A;  2W0X A;  1XRV A;  2ETN A;  4U3F H;  1FFQ A;  2ZR2 A;  1BQZ A;  1LR1 A;  1ZAU A;  3MHH C;  1Q90 D;  1GMG A;  3TXQ A;  1MSW D;  5EBM C;  3GVM A;  2E5L B;  4QT2 A;  2LFS A;  2KG7 B;  4DH0 A;  1AI6 A;  3JAW B;  1L1P A;  1VF6 A;  1VP7 A;  2XTA A;  2EJ7 A;  4TUY A;  5FL7 G;  3O5L A;  5LP6 A;  1EFR G;  1SR0 A;  1MA1 A;  1KUQ A;  1FJD A;  1R6T A;  2B9Z A;  3ZRX A;  1TA8 A;  3QF7 A;  4JFK A;  2A06 H;  3CD6 V;  2WSS G;  2YI9 A;  3CMA V;  2M08 A;  4FPP A;  4R5E A;  1H2K A;  2Q7G A;  2WLM A;  3JAL B;  5FNV B;  3NXS A;  1RP3 B;  2LO1 A;  4DZ3 A;  3U10 A;  3KZI Z;  1AB3 A;  4CH6 A;  4H33 A;  2QGN A;  1OGB A;  5CBH A;  5CA1 A;  5EIB D;  4JI5 O;  4RQE A;  3P3P A;  4L87 A;  2ZE5 A;  3DC6 A;  4FVM A;  2B1G A;  3OE7 G;  4J7J A;  3OFN G;  3B4S A;  1OHH G;  3IK8 A;  3WL0 A;  1BMF G;  4O4L B;  1I5Y A;  3CME V;  3X2Q B;  4YY3 B;  4MNJ A;  1RSO B;  3OAA G;  2XUM A;  1S0V A;  1VQL V;  2F4V O;  2PBC A;  3ASN C;  4JYS A;  3ALF A;  2QWO B;  5B1A B;  1RD6 A;  5EC1 C;  1OCC C;  1BQ0 A;  4U86 A;  2ITD C;  1AR5 A;  3ZRV A;  3RVZ A;  4Q6G A;  4MNM A;  2RMK B;  2DG4 A;  3QO8 A;  4GYC B;  4TSF G;  1W9U A;  3T1H O;  3S3X A;  2BSK A;  4X65 B;  4W5U A;  3F7V C;  4Z2L A;  5FPR A;  2HHH O;  4YJ3 B;  2UUC O;  3BMB A;  1SZT A;  2JK5 C;  2EIK C;  4W9O A;  5KHK A;  5LL6 Y;  2XHB A;  1NU1 H;  1A7X A;  2N87 A;  4FLU A;  1NR1 A;  1D6O A;  1RPR A;  4Z1M G;  1KB9 F;  4HAM A;  3N2G A;  4DWS C;  5B1O A;  4R8C A;  4X1K A;  1M56 B;  3JCU Z;  4LFB B;  1O6I A;  4UVC A;  4FK5 C;  4TNS A;  5HT1 A;  3LUO A;  4R50 A;  3O5Q A;  2RN9 A;  1GM7 A;  1E1R G;  5JH7 B;  2EIJ B;  1P7G A;  1E6R A;  2ZDI C;  1BHA A;  2ZT9 B;  4WF9 V;  2EX3 A;  4Z1V A;  2CE4 A;  1YF2 A;  1HNX B;  3JCZ A;  1KFW A;  3RVY A;  3K57 A;  1EZJ A;  4WFE A;  1KYO F;  2UXC O;  1IBK O;  2DYR C;  4UFZ A;  3A8T A;  1SQP H;  4HBN A;  3WG7 B;  1QLE B;  1HNZ O;  2WLI B;  2EIL B;  3AG2 B;  2YEV B;  3AS2 A;  2Q0A A;  1KT0 A;  4S3K A;  4DV1 O;  4EFB A;  3T1Y B;  3GTY X;  2F1M A;  3AG4 B;  1JQ0 A;  2CGN A;  1WNO A;  2ZNI A;  1AP5 A;  4GIV A;  2NLJ C;  4QPK A;  1TUB A;  3FAV B;  5LHH A;  3QO7 A;  1MG1 A;  2E74 B;  1FJG B;  1P7B A;  2EZP A;  3O65 A;  5HW7 A;  4I55 B;  1FXH A;  3D36 C;  3HKC B;  1YCI A;  2RQ6 A;  4JZ2 A;  1YJW V;  3SJA C;  2KE0 A;  4JI2 B;  2WWW A;  2KG7 A;  5JJE B;  3JAW A;  1IXB A;  5L3G A;  4I50 B;  3CHD A;  1BZK A;  4O4H B;  4L3N A;  1R3J C;  2A3A A;  1QCE A;  4QZV B;  4U84 A;  3E8H A;  4HBO A;  1ITX A;  4LF6 O;  2DMX A;  4TT3 G;  1W1Y A;  1WA8 B;  4X64 B;  2RDC A;  4DV3 B;  3G80 A;  4MW3 A;  1YI2 V;  1G1X B;  3OR6 C;  2EZO A;  3JAL A;  4TOI A;  1K97 A;  5FNV A;  1WAW A;  4I0X B;  1B6C A;  4ODO A;  4JFL A;  1KKC A;  5B3S C;  4NSB A;  3O5P A;  2ZR3 A;  1Z5W A;  3Q4H B;  4J9Z B;  1K9T A;  1M4U A;  1TGO A;  1RM1 C;  1IVS A;  4X9Q A;  4G28 B;  3I5D A;  4DV0 O;  5BMV A;  4UVA A;  2PF4 E;  3VOU A;  2FKX A;  4G50 A;  2OWO A;  2O57 A;  4N23 A;  2XP3 A;  2QSA A;  4GX1 A;  2GUZ A;  2XP5 A;  5B1N A;  4JFM A;  2RUD A;  4CBC A;  2BOC C;  3JAS A;  3CCE V;  4FFB A;  4ZI7 B;  2YXY A;  1X4T A;  1RSO A;  3FB5 C;  2R70 A;  4KXR A;  3ART A;  2BOB C;  2ZQS A;  1H2L A;  1XEQ A;  3JAT B;  2RNB A;  1TAE A;  2P4K A;  4FMT A;  2PYJ A;  2AXT Z;  2LGW A;  1H0G A;  1LUW A;  4NZC A;  5DIT A;  1OV9 A;  2UXB B;  4KHP B;  3T4Z A;  3APO A;  3ARX A;  3CX5 F;  2QWP B;  4QJF B;  4JI1 B;  4PDL A;  4OPH A;  3MAQ A;  3WU2 Z;  1D7J A;  2LJ4 A;  1FPO A;  3W4R A;  3U0Z A;  2ITK A;  3G6M A;  4JV5 O;  2GDS A;  2ZM6 B;  3KAI A;  3AG3 C;  2WLN A;  2QJ1 A;  3SPC A;  2FKE A;  1OZ0 A;  4O2T A;  4UCV A;  4EKW A;  3C90 A;  3CCJ V;  4JI0 B;  2ODM A;  3ZMS A;  3ABM C;  3GWO A;  1ROT A;  5LA6 A;  3JAK B;  1PNM A;  3CPW U;  5IT9 N;  4GKJ O;  2RSE A;  5TIS Z;  5IWA O;  4X62 B;  4ITZ A;  4PA6 A;  5DN6 G;  3N2K B;  1OCR B;  2BTO A;  2Q9L A;  1NWT A;  1ZCN A;  1PL0 A;  4J80 A;  3OMN B;  4B3S O;  3CJH A;  3OTO O;  3UF8 A;  3H01 A;  1Q43 A;  2Y0P A;  3JYJ A;  5KLV H;  1M57 C;  3EFF K;  5GTH Z;  2WLZ A;  5JQG B;  4DR5 B;  3ARW A;  3B8S A;  2WLI A;  1XNQ B;  2VQE O;  3O9O A;  1JNS A;  4J42 A;  1VF8 A;  4KQZ A;  2IH3 C;  2UU9 O;  1DLB A;  1XUQ A;  4Z2G A;  3O5F A;  5EZY B;  5LMN O;  5IYZ B;  1G4Y B;  4NXN B;  3TET A;  4JI8 O;  4C02 B;  3W7T A;  1N33 B;  2PPO A;  1LL6 A;  2XAS A;  4JFI A;  5JJN B;  3HKC A;  3IKG A;  3HKD B;  1YIJ V;  1VQ8 V;  4XAK A;  3LDC A;  4MW8 A;  4UVB A;  1AI5 A;  4I9W A;  2Y4U A;  1EYM A;  5DO2 A;  1VMG A;  1THZ A;  2G41 A;  3UQI A;  1AR4 A;  2JEU A;  1JFF B;  4I50 A;  3B7X A;  3ETE A;  1WP8 A;  4O4H A;  1M1K W;  1FKA O;  2JVD A;  4J11 A;  5J2U B;  2KI3 A;  3BFR A;  2JGD A;  4MTX A;  4OX9 O;  4WFH A;  1QVG U;  1WA8 A;  2Y48 A;  1H2G A;  1HKK A;  3WFV A;  5H2F Z;  1FS0 G;  4BIZ A;  2HFE C;  2Y69 C;  3SJC C;  4B3R O;  1XHX A;  2LQT A;  1WPX A;  1Q7Y W;  5K1X A;  3AG1 C;  3WKZ A;  4DR1 O;  4K0K B;  3O5K A;  4J4O A;  1DGS A;  2JEX A;  2P5O A;  3RGB A;  3OMI B;  3OT7 A;  2UUB B;  1K33 A;  4F6R B;  2WLL A;  1Z5V A;  5IJ0 B;  1BCC H;  2UXX A;  1E6N A;  3WQW A;  4TW8 A;  3LDD A;  3KZ7 A;  2XPA A;  5ITZ A;  1FKS A;  1DF4 A;  2KKW A;  3KKY A;  3CC7 V;  4X88 A;  3AS0 A;  4IIJ B;  5J2T B;  2QM4 A;  3J7A U;  2A3C A;  4JYA O;  5HWC A;  2YXH A;  4JAS A;  4LWS B;  3JYM A;  2M1I A;  3VQW A;  4ML4 A;  1COW G;  1ZBC A;  3ZMU A;  3RFW A;  2PPP A;  2F4E A;  4DRX A;  1W9V A;  1WN7 A;  1I94 B;  1E6P A;  1YHQ V;  3G6L A;  3JAT A;  1FKK A;  2QKS A;  4FJC C;  1GO3 F;  1SQF A;  2ZQM A;  2PGG A;  3WB0 A;  2DN9 A;  1D5N A;  4WKA A;  2YID A;  4LF9 O;  3CC4 V;  4I4T B;  3ZHU A;  4KFM A;  1V9P A;  1JCH B;  2GTA A;  1HKM A;  1L8D A;  2AHY A;  1NVP D;  3KAD A;  3BXW A;  5HW8 A;  1QZ2 A;  2HR3 A;  1VQ6 V;  2B31 A;  2YXL A;  2KR7 A;  2QWQ B;  4AQY O;  4JFJ A;  2Y4T A;  1E6Z A;  2D9F A;  2KQX A;  4UDM A;  1NMW A;  1QR9 A;  4K8X A;  2PV2 A;  4K35 A;  3KAB A;  2R9I A;  3M99 B;  2VQF B;  1NWR A;  5IE9 A;  3BRC A;  3VQX A;  3L70 H;  3OGC C;  2Q7E A;  5H6R A;  4U7O A;  4FM2 A;  5EYP A;  4IT5 A;  5B8I C;  1NR7 A;  1SF9 A;  2DQ3 A;  1N34 B;  4JI7 O;  1EIB A;  4HYO A;  2ZE8 A;  1D7I A;  2E3C A;  1NVP B;  3L71 H;  3N2K A;  4ZBM A;  4DR3 B;  3JSN A;  1PNL A;  1V55 C;  3ARQ A;  2QF8 A;  3D3I A;  3OW2 U;  4ZOL A;  1OCZ B;  4EFE A;  3ETD A;  2DWE C;  4DXW A;  1S5L Z;  1NTZ H;  1X59 A;  3KCY A;  2ZIM A;  1HJX A;  3QOK A;  2PYL A;  2A0L A;  3WB1 A;  1FYJ A;  1DF5 A;  1FAF A;  1ZWI C;  3BEH A;  2D2C B;  5F2V O;  1J5E B;  3L9D A;  4D6T H;  5DIU A;  1KC8 W;  4LF4 B;  2CH7 A;  4G2P A;  1BE3 H;  3K06 A;  4W9P A;  2QTO A;  2BCC H;  4FIP C;  1BKF A;  5EBW C;  2DOS A;  2EIN B;  4NR1 A;  2BSK B;  3CGN A;  2EIM B;  5J9P C;  1SRY A;  4DRI A;  2OCC B;  4J10 A;  2XP6 A;  2EIJ C;  4ZPV R;  5KHH A;  3PJS K;  3RBZ A;  1D7H A;  4FM1 A;  5H5N A;  1K5Q A;  5JCO C;  3N2G B;  2H8P C;  1SES A;  4J7K A;  2X7R B;  4NTY A;  5DIV A;  2WLH A;  4LFA O;  3RYC B;  1QR8 A;  3WG7 C;  3BY6 A;  1QLE C;  3C3S A;  3R65 A;  3IAY A;  4Z2K A;  5BXZ A;  3EY6 A;  3A2F A;  1PIN A;  1W1P A;  1YZB A;  1XQ8 A;  2ZXW B;  3F5T A;  1R6K A;  3D36 A;  1CXZ B;  1LQ0 A;  5J2T A;  2XAF A;  4DV4 O;  1N36 O;  4X20 A;  2GBO A;  3CHX A;  1ZBV A;  1WP7 A;  1LG1 A;  2ADP A;  2IJI A;  4LWS A;  1KBH A;  2JS3 A;  3ETG A;  5LOV A;  4UCS A;  2AGA A;  3CRQ A;  4IPX A;  1F4M A;  1M9N A;  5JVD A;  2PUS A;  4MT8 A;  3GPK A;  1SKV A;  4O2B A;  3UQA A;  1ZBW A;  4LF8 B;  1L0N H;  1TUB B;  4IT4 A;  1IBL B;  2FAP A;  3SPG A;  3M8A A;  1W26 A;  4MTV A;  1NS1 A;  3H1L H;  4DR4 B;  5BR8 B;  4PD4 F;  4I4T A;  2VWJ A;  3WD2 A;  1JCH A;  3SPJ A;  4O4I B;  1VIB A;  3FB6 C;  2H94 A;  3G6B A;  1IXM A;  4MVO A;  5KHJ A;  3TCZ A;  1DK1 A;  4J4N A;  4CS3 A;  2FL4 A;  2X6A A;  3ABL C;  2AW9 A;  1YJN V;  5GPR A;  2W0F C;  1TCO C;  4X89 A;  1EDQ A;  4J9Y B;  2PV1 A;  1SYT A;  3ARV A;  2WLJ A;  1TFV A;  5K1P A;  2IW5 A;  1Q5O A;  3L73 H;  3AS3 A;  1GH6 A;  4J7Z A;  1ZL8 B;  4JAV A;  3RN4 A;  4LH6 A;  5AG2 A;  2W6J G;  3CXC U;  1E15 A;  4W9Q A;  5HW6 A;  4BW9 A;  4IYI A;  1AI4 A;  2IUZ A;  4IL6 Z;  1XMQ O;  1UR9 A;  4QNH B;  1XDC A;  2PI4 A;  5BMV B;  1OCO B;  3ASO C;  1KP3 A;  3WQV A;  2XOK G;  4MSP A;  1JPX A;  4P9O A;  2GUZ B;  4QIB A;  4CS4 A;  2XP9 A;  2G38 A;  4BW5 A;  1K3E A;  3B77 A;  1HKI A;  4DRH A;  1NH2 D;  3F7Y C;  3UT5 B;  4DV2 B;  1V54 B;  2O92 A;  1IBM B;  1HP8 A;  2QWR B;  4PA7 A;  2OYQ A;  3MDY B;  3PRA A;  2N04 A;  3JAS B;  4FFB B;  4LBE C;  2F95 B;  2WA3 A;  1L1F A;  1JVM A;  5KHI A;  4FFK A;  2BTQ A;  2L35 A;  5L3D A;  4OXS A;  4UXN A;  5IYC O;  2UUA O;  1S77 D;  4KR0 B;  4TQF A;  3TXS A;  1ZUQ A;  2ZKO A;  1BS3 A;  4X8A A;  2LGO A;  4GKK O;  2WAM A;  1NH2 B;  4DR2 B;  1VF7 A;  2Q0O C;  4DR6 O;  3K03 A;  4JZG A;  4DRN A;  4AHC A;  5GTI Z;  5LMU O;  2YSU B;  4HNA B;  2KGJ A;  4GCZ A;  1B3Q A;  4GT1 A;  4YXW G;  4BIU A;  2H3O A;  4LAW A;  3NR7 A;  3R66 A;  4E4E A;  4WIW A;  1JVW A;  2F21 A;  1S76 D;  3ICX A;  2QA4 V;  3RW0 A;  3QG5 A;  4GZR B;  1VQ9 V;  1Q6H A;  4YIP A;  1QQC A;  2JGU A;  3RYC A;  2QE7 G;  4JI4 O;  5LA6 B;  1AVM A;  1N1A A;  2LKN A;  3W7U A;  3PRD A;  3E35 A;  4JF3 A;  3QTC A;  4RAI A;  2IBZ H;  1F51 A;  5B1B C;  3AS1 A;  1R6N A;  4CH3 A;  1R73 A;  2YS8 A;  4DV5 O;  1FKR A;  1L0L H;  1XOU A;  3B8N A;  3SYC A;  1N0J A;  1P5Q A;  4U85 A;  3CJH B;  1NZ6 A;  1GK9 A;  1QBZ A;  1F23 A;  3K3W A;  4XDJ A;  2FYU H;  4DV7 O;  1CPY A;  3FX7 A;  3RGC A;  3ZIA G;  2DPE A;  1QPF A;  3WIJ A;  2VRZ A;  4ODM A;  1SQX H;  1YW5 A;  3EVK A;  3W7S A;  2FDM A;  5A9G A;  1TVK A;  2QDO A;  2K1E A;  4ABM A;  4FLX A;  3TGU H;  4DYL A;  4HZ3 A;  4G27 B;  5KMG A;  4TYO A;  3T4D A;  2DYS B;  5CA0 B;  1U79 A;  1N8R W;  3CC2 V;  3L75 H;  4O4I A;  5IY5 B;  3SJQ C;  3OGI B;  2P22 C;  1SQQ H;  3H9V A;  3RFR A;  1K8A W;  5LHI A;  1HJV A;  2YUA A;  2OIE A;  2IU3 A;  3RM9 A;  1B06 A;  3ETQ A;  2JGD B;  3LSU A;  1QU7 A;  2NN4 A;  2JDI G;  4DUZ O;  2OIG A;  1AJP A;  4UV8 A;  3K0G A;  2N05 A;  2DJV A;  2UXN A;  4Z2W A;  4JI5 B;  3MHS C;  3GWK C;  1F4N A;  2Q7H A;  1W0K G;  3O5G A;  1ZL8 A;  4TV8 B;  1FKJ A;  3ABK C;  1CEZ A;  4R6Z A;  1HW7 A;  2WLL B;  3VBB A;  2ZCE A;  5H6Q A;  3RYI A;  4LAV A;  4ZS6 A;  2GTS A;  1Y0O A;  5ITZ B;  3KAG A;  4LC1 A;  1FXK C;  2CUG A;  2R72 A;  3UI5 A;  4LR3 A;  1VQ4 V;  3ZJZ A;  1R9H A;  4W4K A;  3UT5 A;  1Y76 A;  1WB7 A;  1Q3E A;  3BCC H;  3CS5 A;  2Q4P A;  4YHH B;  4FLT A;  3CCV V;  1H2S B;  3OR7 C;  2YI8 A;  3ZMZ A;  2M6Y A;  4WFB V;  4DRX B;  2F2D A;  4RO2 A;  1VF6 C;  3KAH A;  3K9S A;  5JH8 A;  1MOF A;  4PJ0 Z;  2CTP A;  1RPO A;  4PI0 A;  2CTQ A;  3QO5 A;  2DSV A;  5LP6 C;  3T1H B;  2RQS A;  1UJW B;  3CCR V;  1ZU8 A;  4PV1 B;  1AIL A;  2HHH B;  2Z0A A;  2UUC B;  4PDV A;  4UCU A;  2Q8V A;  2CGO A;  2HVJ C;  2OTJ V;  4BWA A;  4HNA A;  4P8W A;  3ARP A;  3RYF B;  4N19 A;  3EHB B;  1R3L C;  4B7K A;  3O5D A;  1GM9 A;  3BAA A;  2XT9 A;  3A0H Z;  5KA5 A;  2AHZ A;  4IQC A;  5L3E A;  2PI6 A;  2LW1 A;  3OUF A;  1NH6 A;  3E83 A;  2NNU A;  4DO2 A;  5FLX N;  1XI1 A;  4QPJ A;  5KAI Z;  2D3O W;  4B3T O;  3ALG A;  3ARY A;  1Y4M A;  5EYP B;  3ABT A;  1AP6 A;  3SYA A;  4P30 A;  4UB6 Z;  1KD1 W;  1N4C A;  1J4R A;  2UXC B;  2ARH A;  1IBK B;  3TK1 A;  1VQN V;  1MNG A;  3FAP A;  1OCC B;  1W2B U;  1BHB A;  4MTG A;  4DWS D;  1HNZ B;  2XAH A;  2RCV A;  1WB8 A;  3QNE A;  3CCQ V;  4LFC O;  4NKG B;  4ZOL B;  4DV1 B;  1GN2 A;  2ILM A;  2WLK A;  4XDK A;  3RM4 A;  2MLX A;  4BIO A;  4ZIB A;  3WD4 A;  4R7C A;  3CHE A;  2EIK B;  1JNE A;  5KUK A;  1G8M A;  1KKD A;  2AOS A;  2EIN C;  1NT2 B;  1US6 A;  2XAQ A;  5FPO A;  1VQ7 V;  1KT1 A;  3ARS A;  3W7W A;  4DWS B;  5E79 Z;  4GX2 A;  3ZBH A;  2JZV A;  2EBO A;  5CA0 A;  4I7Z B;  2CH7 B;  2V4D A;  1HXV A;  3B2E E;  4EB6 B;  3FXY A;  5KUM A;  4X1Y B;  1MZF A;  4JYC A;  4NXM O;  3CWB H;  4WFA V;  1HNW O;  1K92 A;  4LF6 B;  2XP7 A;  4PA3 A;  4F6E A;  3BA8 A;  5LHG A;  2QM7 A;  4R0X A;  3UCS C;  1W9P A;  2PPN A;  4LAY A;  5H9C A;  1M90 W;  3VQY A;  2ZNJ A;  1SQV H;  4PDM A;  3A0R A;  1IX5 A;  4P9P A;  2W6I G;  2V1D A;  1NSG A;  1W1V A;  2DYR B;  4JI6 O;  1XMO O;  3IC9 A;  3HKB B;  3M7M X;  2JJ2 G;  1E79 G;  2A7W A; 
#chains in the Genus database with same CATH homology
 4W9P A;  5GPG A;  3WL0 A;  1BKF A;  1GUV A;  4DRM A;  1FFR A;  2WM0 A;  1ZL1 A;  3CGN A;  3RME A;  4MNJ A;  3PR9 A;  4DRI A;  2MNT A;  2XP6 A;  1FKL A;  2PBC A;  4LGX A;  4JYS A;  3ALF A;  4ZPV R;  1D7H A;  4IT6 A;  3VAW A;  1RD6 A;  2OLH A;  4TW6 A;  1Q6I A;  4Q7N A;  2A3B A;  3O5R A;  4U86 A;  2DT1 A;  4MNM A;  2DG4 A;  1F8A B;  1FKH A;  2MF9 A;  5DIV A;  1W9U A;  3NI6 A;  4Z2H A;  2IF4 A;  4W5U A;  4Z2K A;  4Z2L A;  3EY6 A;  1PIN A;  1W1P A;  4W9O A;  3CHF A;  1A7X A;  1GPF A;  2N87 A;  1XHG A;  3TDB A;  1LQ0 A;  1D6O A;  2RUQ A;  4DWS C;  1ZB5 A;  1ZBV A;  4ODN A;  3WD0 A;  1LG1 A;  4FN2 A;  4Z2I A;  4WKF A;  1FKI A;  1O6I A;  3B9E A;  4IPX A;  4TNS A;  5HT1 A;  3LUO A;  5DF0 A;  3O5Q A;  3ARU A;  1LJY A;  2ZR4 A;  3GPK A;  1E6R A;  4ODQ A;  3UQA A;  1GOI A;  1ROU A;  1ZBW A;  4AY1 A;  3NRK A;  1FD9 A;  4IT4 A;  2FAP A;  1KFW A;  3CGM A;  2LPV A;  4DRO A;  1W26 A;  4MTV A;  2XP8 A;  4WJX A;  1EHN A;  4NNR A;  3WD2 A;  3PA7 A;  3WD3 A;  3AS2 A;  3TCZ A;  4J4N A;  1KT0 A;  4S3K A;  4TW7 A;  3KAF A;  3O5J A;  3IHZ A;  4P8V A;  1WNO A;  2MLZ A;  2KFW A;  4GIV A;  4IQ2 A;  1FKT A;  5GPR A;  2Q5A A;  2VN1 A;  1TCO C;  4GGQ A;  2OFN A;  2RUC A;  2ZQV A;  1T11 A;  5I98 A;  1EDQ A;  5HW7 A;  2PV1 A;  1SYT A;  3ARV A;  1TFV A;  2KE0 A;  4DT4 A;  3AS3 A;  1HJW A;  3ODK A;  2DG3 A;  3CHD A;  1UR8 A;  4L3N A;  1E15 A;  2A3A A;  4W9Q A;  1X6N A;  4QZV B;  5HW6 A;  4U84 A;  2IUZ A;  4HBO A;  1UR9 A;  1JND A;  4DWS A;  1ITX A;  3CZ8 A;  1J6Y A;  1W1Y A;  3UI4 A;  3WQV A;  2VCD A;  4MSP A;  3ARZ A;  4QIB A;  2XP9 A;  4L72 B;  4QT3 A;  3ARR A;  1HKI A;  4Q22 A;  1WAW A;  4DRH A;  1B6C A;  4ODO A;  4JFL A;  2M2A A;  2O92 A;  3JXV A;  4NSB A;  3MDY B;  3PRA A;  3O5P A;  3O5M A;  3PRB A;  1J4H A;  1K9T A;  1FKG A;  1PBK A;  2DSW A;  4MAV A;  5HTG A;  4KR0 B;  4G50 A;  2XP3 A;  3FY1 A;  2XP5 A;  2LGO A;  4JFM A;  5J6E A;  2RUD A;  4DRQ A;  2Y78 A;  4DRN A;  2DSU A;  2KGJ A;  1E9L A;  3ART A;  2ZQS A;  3UI6 A;  4LAW A;  4WIW A;  1JVW A;  2F21 A;  1H0G A;  5DIT A;  4NZC A;  1QPL A;  2ESC A;  4DZ2 A;  3ARX A;  2KO7 A;  1Q6H A;  3TC5 A;  1D7J A;  2LJ4 A;  1N1A A;  3PRD A;  2LKN A;  3W4R A;  3ARO A;  2ITK A;  3G6M A;  3AS1 A;  2ZR5 A;  3KAI A;  1FKR A;  1LL7 A;  2FKE A;  4S3J A;  4O2T A;  2DG9 A;  1P5Q A;  4U85 A;  1D2K A;  5DEZ A;  1ROT A;  3RGC A;  2DPE A;  1QPF A;  3WIJ A;  4P8U A;  2RSE A;  1LL4 A;  3OA5 A;  4ODM A;  4ITZ A;  1YAT A;  1YW5 A;  1NWT A;  1ZCN A;  1WB0 A;  1Q1C A;  2FDM A;  1OGG A;  3RM8 A;  3UF8 A;  3JYJ A;  1NWU A;  5HUA A;  2WLZ A;  4TYO A;  1U79 A;  4P8X A;  3NTP A;  3ARW A;  2AWG A;  3B8S A;  1ZBK A;  4MNK A;  5D75 A;  2WK2 A;  4MNL A;  1JNS A;  1VF8 A;  1HJV A;  4KQZ A;  3UQB A;  2XPB A;  4Z2G A;  3O5F A;  1W1T A;  3RM9 A;  3H9R B;  4DRP A;  4ODP A;  4WKH A;  1EQ3 A;  1FKB A;  3WD1 A;  4C02 B;  2PPO A;  1HKJ A;  1LL6 A;  4DRJ A;  4JFI A;  4DRK A;  3KCE A;  3IKG A;  4XAK A;  3OOB A;  1EYM A;  2A3E A;  5DO2 A;  2G41 A;  3UQI A;  1JNT A;  2WLY A;  2MPH A;  2ZQU A;  4PTM A;  1X6L A;  5HKG A;  3O5G A;  3B7X A;  1C9H A;  4LAX A;  1FKJ A;  5GQB A;  3B09 A;  2KI3 A;  4LAV A;  4ZS6 A;  1Y0O A;  4MGV A;  2ZQT A;  3KAG A;  1HKK A;  3UI5 A;  4WK9 A;  1R9H A;  3WKZ A;  2O9O A;  2G8Z A;  3O5K A;  4J4O A;  2UZ5 A;  2PV3 A;  4HAR A;  4ZPW R;  3B9A A;  3KAC A;  2F2D A;  3CHC A;  1E6N A;  3KAH A;  4TW8 A;  3WQW A;  5JH8 A;  3KZ7 A;  2XPA A;  2DSV A;  1FAP A;  1FKS A;  2RQS A;  3AS0 A;  2A3C A;  4ODR A;  3WL1 A;  1ZU8 A;  3O5E A;  5HWC A;  3JYM A;  5HBF A;  2M1I A;  3CH9 A;  1NWS A;  4DIP A;  4ML4 A;  1ZBC A;  3RFW A;  2YBU A;  4ODL A;  2PPP A;  2F4E A;  3WH0 A;  4P8W A;  3ARP A;  1W9V A;  3B9D A;  4N19 A;  1E6P A;  3G6L A;  3O5D A;  1FKK A;  3O5O A;  4HBE A;  4TX0 A;  4Z2J A;  4IQC A;  1J4I A;  2PI6 A;  4WKA A;  3AQU A;  4ODK A;  1FKD A;  1NH6 A;  1FKF A;  3ALG A;  3ARY A;  5BXJ A;  1HKM A;  2L2S A;  1BL4 A;  2RUR A;  3KAD A;  1J4R A;  4BF8 A;  3BXW A;  1M5Y A;  5HW8 A;  1QZ2 A;  1CTN A;  2XP4 A;  2B31 A;  3FAP A;  3I6C A;  2KR7 A;  4FAP A;  1XRV A;  4JFJ A;  2DT3 A;  4DWS D;  1FFQ A;  1E6Z A;  2D9F A;  1NMW A;  4ZPT R;  2PV2 A;  5HWB A;  3KAB A;  1NWR A;  2ZR6 A;  4QT2 A;  1H0I A;  3RM4 A;  2MLX A;  3WD4 A;  4DH0 A;  3CHE A;  1L1P A;  2DT0 A;  5B8I C;  1EIB A;  1JNE A;  2DT2 A;  2K8I A;  1D7I A;  2AOS A;  3O5L A;  1SR0 A;  1F40 A;  1KT1 A;  3ARS A;  1FJD A;  3ARQ A;  4DWS B;  2QF8 A;  4JFK A;  2YBT A;  2JZV A;  4MPK A;  2M08 A;  4R5E A;  1HXV A;  1HJX A;  3IKD A;  3FXY A;  1NMV A;  1LG2 A;  4DZ3 A;  2XP7 A;  3QOK A;  4R0X A;  1OGB A;  1W9P A;  2PPN A;  4LAY A;  1IX5 A;  3O5I A;  2DSZ A;  5DIU A;  1NSG A;  1W1V A;  1Q6U A;  1OWQ A;  2MLY A;  1ZK6 A;  4URI A;  4G2P A;  3IK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...