1FD9A

Crystal structure of the macrophage infectivity potentiator protein (mip) a major virulence factor from legionella pneumophila
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
204
structure length
204
Chain Sequence
TDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MACROPHAGE INFECTIVITY POTENTIATOR PROTEIN)
publication title Crystal structure of Mip, a prolylisomerase from Legionella pneumophila
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Isomerase
total genus 64
structure length 204
sequence length 204
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1fd9A02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fd9A01
4ITZA 4DRNA 1NMVA 1P5QA 4U84A 4DROA 4G50A 4R0XA 3O5IA 2XP7A 2KFWA 4FN2A 1FKIA 2MPHA 3CGMA 3GPKA 3KACA 4ODPA 1ROTA 1F40A 3B09A 3RGCA 4LAYA 3O5FA 3KCEA 4TW6A 3KAFA 1Q6HA 3O5PA 3KZ7A 2PV1A 2KR7A 3IHZA 4IQ2A 1J6YA 1NMWA 1U79A 2F4EA 2K8IA 1FD9A 3KAHA 1FKBA 4JFJA 4QIBA 4TW8A 2XP6A 3O5EA 4DZ2A 1FKRA 3CGNA 4W9QA 3PA7A 4TW7A 5HT1A 1QPLA 1J4RA 1W26A 3NRKA 4DRPA 5HTGA 1HXVA 2D9FA 2ZQTA 4DRKA 2F2DA 2XP9A 1Q6UA 5HKGA 2LJ4A 4JFIA 2OFNA 4GGQA 4JYSA 4J4NA 4DRHA 1FKDA 1KT0A 1ZCNA 1QZ2A 3JYMA 5DIVA 2RURA 1PBKA 3I6CA 2RUCA 3KAIA 3UQAA 2MNTA 2PBCA 2PV3A 2XPBA 3TCZA 1D6OA 3O5GA 1N1AA 1YATA 3O5DA 1F8AB 2MF9A 3IK8A 4ODLA 4DRQA 5B8IC 2ZQVA 4IQCA 3WH0A 2Y78A 5J6EA 1A7XA 2PPPA 2XP3A 2XP4A 2ZR4A 4QT3A 1FKJA 1D7HA 4NNRA 1FKKA 1Q1CA 1Q6IA 2VN1A 4N19A 4DT4A 1BKFA 2PPOA 1FKFA 4MGVA 4G2PA 5HW6A 1J4IA 2L2SA 1FJDA 4U85A 3MDYB 4ODOA 4DIPA 1QPFA 4FAPA 2M1IA 2DG9A 3KAGA 5BXJA 5HUAA 4DRMA 2XPAA 5D75A 2XP8A 3O5LA 3PRBA 3OOBA 4JFMA 2PV2A 4LAXA 4ODKA 2MLXA 1ROUA 2DG3A 1TCOC 4ODNA 4J4OA 4TNSA 2MLYA 2FKEA 2ITKA 3O5RA 1KT1A 2FAPA 2ZR6A 5GPGA 4DZ3A 1JNSA 4TX0A 1Y0OA 4BF8A 3UQIA 3UI4A 1PINA 3B7XA 5DITA 2UZ5A 2KGJA 3EY6A 1EYMA 3JXVA 4ODRA 1J4HA 2IF4A 2XP5A 4JFLA 3LUOA 4ODQA 1ZK6A 3UQBA 5HW7A 4MSPA 1FKSA 4LAWA 2M2AA 2RUDA 2LPVA 3O5KA 3KABA 4GIVA 2LKNA 3IKDA 1FKTA 5HW8A 2N87A 1M5YA 4IPXA 4W9PA 3JYJA 3FAPA 1JNTA 1FKHA 1YW5A 4U86A 2MLZA 2KE0A 4C02B 3O5MA 3ODKA 4O2TA 3O5QA 1BL4A 3UI6A 1JVWA 5DIUA 4DRJA 4W9OA 3RFWA 1FKGA 3TDBA 1FAPA 2JZVA 2M08A 1FKLA 2ZQSA 4JFKA 3NTPA 2ZQUA 1L1PA 5I98A 1D7JA 3H9RB 1B6CA 1T11A 2RUQA 3IKGA 2RQSA 3O5OA 4TYOA 5HWCA 3UF8A 3UI5A 3KADA 2AWGA 2Q5AA 3NI6A 4DH0A 2DG4A 4LAVA 3PRDA 1D7IA 2PPNA 3O5JA 1NSGA 4DRIA 2KI3A 3VAWA 3TC5A 2LGOA 2KO7A 2RSEA 2ZR5A 2F21A 5HWBA 2VCDA 4ODMA 4QT2A 1C9HA 1R9HA 1EQ3A
chains in the Genus database with same CATH superfamily
4JYAB 5JJNB 3FB7C 2OCCB 4NTWA 4W5UA 1K3EA 2WLKA 1SETA 2XP7A 2DN9A 3HKDA 3CCUV 2XAQA 5AG2A 5B3SB 2CH7B 3KAFA 4DV4B 1HKIA 1JA8A 4TW8A 4F6EA 3KAHA 3GU0A 3K57A 4TWKA 3N2GA 3OTFA 5LP6A 3PA7A 1BQ0A 1RD6A 1VF7A 3JYCA 3ABMC 3E22A 2ITCC 4MTOA 2HVJC 1VQLV 2F2DA 1OCZC 2P4KA 1KFWA 1JMKC 4G28B 2JVDA 1QR8A 2H8PC 2JDIG 2ZXWC 3ETQA 1NU1H 4CZZA 1D6OA 1VMGA 2MF9A 3WH0A 3F7VC 5IYCO 5CMUA 2V7QG 1I08A 2ZR2A 5LXTB 1GKFA 1LUVA 1SESA 2GSMB 4DV0B 4WFGA 1VQNV 4DT4A 1FAFA 2PYJA 1N0NA 1QPFA 1JOYA 2VQFO 2LGWA 3E2EA 5DEDA 4XBFA 4DR7O 1GRJA 4O4LA 2AZ2A 5GQBA 2E75B 1FFXA 3CRCA 3DGEA 3AG4B 5ITZB 3UQIA 5JJJB 1PINA 1KQSU 5IJ0A 1H0GA 4DO2A 1Q81W 3JSLA 4LP8A 3GB7C 4JFLA 1ZL1A 3W4RA 3HKEB 3E35A 1IBKO 3GTYX 2BSKA 4O4HA 2A0LA 1H2GA 4H13B 3RWRD 1E44A 3F7YC 3TDBA 3M8AA 4B3SB 2D3OW 3FX7A 2CUGA 3O5OA 5IYZA 1SRYA 3C3SA 2XAJA 1XMQB 1SS3A 3IJ4A 1QNMA 1SQPH 4DUZO 1PNKA 4B7EA 2DOSA 5L3EA 4ZI7B 5C8YA 4X62O 3Q4HB 5B1BB 2VCDA 4GZRB 3CCVV 4ABMA 1N36O 4JI6O 1W9VA 1NMVA 2Q0OC 3GWKC 2GBOA 5GPRA 4CC5A 1R6TA 4FM0A 4U7OA 1KECA 3PJSK 1V9PA 5HFLA 3O5IA 4ODPA 2IJIA 1SQGA 3B09A 1VQ9V 3RGCA 1XBLA 2Y48A 3HKCB 1D2KA 1MA1A 1AP5A 1BT8A 1XILA 3ARZA 2AXTZ 1YVWA 1TUEB 3LNMB 5CA0A 1H38A 3FY1A 3LDDA 1BSMA 1NBMG 1Z5VA 5DECA 1Y76A 4C7UA 2MW2B 1H2MA 1KKCA 4LH7A 1WN7A 1XL4A 1MZFA 1RSOA 4MGVA 3BRCA 1TVKA 5HUAA 4DRMA 4FVMA 3HKBB 4PDRA 2QDOA 2MLXA 2Q69A 2UUCO 1KT1A 2ZR6A 3OGIB 2Q0AA 1H2LA 1JNEA 1YHQV 2A06H 3B7XA 4UVAA 5GONA 4PDMA 1EHNA 2KGJA 2ZE6A 3CEIA 4I50B 1UFIA 4B3MO 4HBOA 4X89A 2YDEA 2QWRB 3CMAV 3JALA 3SJCC 1QLEB 3OEEG 3QG5A 2VQFB 2A7WA 3CXHF 4JI8O 5CA1A 3K0GA 3S3XA 4DR7B 1FKHA 2MLZA 4P9OA 2YIBA 1JVWA 3B77A 1GUVA 1OCRC 3RFWA 3ICXA 1I94O 2RQ6A 4Z1VA 5I98A 2DSVA 1BL8A 4JGSA 4J41A 5KA6A 1S5JA 4MTFA 5HBFA 4MVMA 1F51A 1M57B 1Z2GA 2CTRA 4JZGA 1IBKB 4ZKIA 2LGOA 3ARXA 5HWBA 1SQBH 1ZAUA 1F7YA 3L71H 2GTAA 1AR4A 3E83A 1YCIA 3M7MX 4R0XA 3WD3A 5JCOA 4FN2A 4K0KO 3CGMA 1GH6A 4LAYA 5KMGA 2KG7B 1HKMA 4DUZB 4IQ2A 4X64O 2Q68A 1U79A 3WIJA 5C93A 4W9QA 4X62B 4JTDB 1H2KA 1SYTA 2EX3A 2DE0X 4FJCC 3CHDA 1SA0B 4JI6B 1N36B 1HXVA 4J11A 1VQ8V 3OMNB 1EZJA 2XP9A 2WA4A 1ZLZA 1AB3A 1BCCH 3CRMA 2ESCA 1FKDA 4CH3A 1ZSPA 3N27A 3CD6V 1WAWA 2PI6A 3AK3A 2PUSA 3W7UA 3SPGA 3K79A 4IQCA 2Y78A 1K34A 4TQFA 1YZBA 3BPZA 4FLWA 2FB5A 1FKKA 4MTVA 5KX5B 3S3WA 2YBTA 4E4EA 1VF6C 1AI4A 3CPWU 4ZPTR 3AG7A 2ZDIA 1SQXH 2QGNA 2ZINA 4Q7NA 3OAAG 3O5LA 4DR4O 2XASA 1PNMA 1LR1A 3CX5F 3RYCB 2A3EA 2MLYA 1P7BA 4P8WA 3GVMA 4S3KA 4Z2IA 4R5EA 4Z2HA 2A79B 3UQBA 4LF5O 1TAEA 1SZTA 4LAWA 2WLHA 1N4CA 1JQ0A 1IXBA 4GIVA 1S0VA 4MNLA 3OFNG 1XUQA 5K1XA 3ARUA 2UUCB 3BHPA 4QJFB 3FYIB 1PD3A 3BXWA 4IGGA 2YIBD 2RUQA 4JAVA 4H44B 2ZQMA 4W4KA 3TJTA 2Q5AA 1QR9A 1J5EB 4U3FH 4B3MB 2CE4A 1U97A 1L0LH 3UKMA 5KHHA 4R6ZA 2YIDA 4JI8B 1NZ6A 2XHBA 1W1YA 2QM8A 1S5LZ 1C9HA 1QVGU 4AHCA 1JVMA 4EB6A 4DV3O 3ABKB 1M4UA 1FXVA 4LFAO 2VQEO 3ARTA 3W7SA 3BFRA 5EC2C 2YC0A 1FKAO 1FYJA 1FKBA 2XTAA 2CGOA 5KHGA 3VBBA 4FFBA 1W26A 2D9FA 2LFRA 4MVUA 1WNOA 4K0KB 4YJ3A 1R6KA 1QZ2A 1N0JA 1XNQO 4GYCB 2QF8A 1BE3H 4NB5A 3I6CA 5IWAO 3QNEA 4PTMA 4X64B 3OD4A 2G41A 5LBQA 5KHIA 2OCCC 3IFXA 3B9EA 3DXRB 4I9QA 3SJBC 1L0NH 2GUZA 4X20B 3CCMV 1NT2B 5B3SC 5J2TA 1LQ0A 1EN4A 3UT5B 4FM1A 3B9AA 1QCEA 3FFQA 4NR1A 2FTKA 4LWSA 4DIPA 4TV8A 3MD0A 2LFSA 4TV9A 2PGGA 3PRBA 1SR0A 2PZSA 4FMTA 3L72H 4ODNA 3E8FA 4LF8O 5EK0A 5GPGA 3E8BA 3AG2B 4YJ2B 1SQQH 4RAIA 4LFBO 3UI4A 4J42A 3KZIZ 3EY6A 4ODRA 1DGSA 1FS0G 2Q8VA 3W7WA 2M2AA 1P4RA 4X1YA 3KABA 2LKNA 5HW8A 2WPDG 2WLIB 5IJ9B 4DR4B 4DW0A 4W9PA 1JJOA 4MW3A 4UVCA 5DIUA 4DRJA 3RYHB 5JQGA 4NXNO 1T11A 5CBFA 5HFMA 4WBNA 3CJHB 4LAVA 4LF5B 2Z3YA 3JAKB 4I7ZB 1NSGA 4NSBA 3WU2Z 3AG4C 5CB4A 2HEPA 1CPYA 3RVYA 1UR9A 2F21A 2JJ1G 4FK5C 3CWBH 3OA5A 3AK2A 1MMMA 1AROP 4DZ3A 1R9HA 2P22C 5B1NA 1JPXA 3JD1A 5LYJA 4G50A 1K33A 1K97A 4JAAA 4UCSA 3O5FA 3RYFB 4ZS6A 1ORQC 2D2CB 4IYIA 4UDMA 1J6YA 4MPKA 3KCXA 4DZ2A 3ZHQA 4DRXB 2QTSA 3CE2A 2OWOA 4QGPA 2HHHO 2DT1A 2QM7A 2W0FC 4DRKA 1WB0A 4DV3B 1RPOA 1MG1A 2A3QA 4TSFG 5A2QN 4JFIA 4JAUA 2OFNA 1AJQA 4Z2LA 4LFAB 2VQEB 5A9GA 5B1BC 5DM6V 3AS1A 1E6RA 2W6JG 4UCOA 1N1AA 2BTQB 2QJ1A 1F8AB 4JYCA 3D8CA 1XL6A 5B66Z 4OXSA 4NNRA 2ZM6O 2Q67A 4FLYA 3DTUB 2EBOA 3H9VA 2B9ZA 1VQKV 4TQDA 3CCLV 1AI5A 2X6AA 2DQ3A 2WA3A 4HZ3A 4G27B 5GTHZ 5B1AB 1XNQB 2XT9A 4WK9A 4LBEC 5IWAB 3APQA 4PI2A 4O2AB 3EXAA 2IU3A 3WFVA 3VQVA 4HARA 1IX5A 3KKYA 2WLNA 4DW1A 1J4HA 2HG5C 4ZHQB 4ODQA 1GN2A 4GX2A 1NWRA 1FXKB 1XEQA 2F93B 3QO7A 3SYOA 4KXRA 1FXHA 2IM9A 2KE0A 1WNSA 1W0KG 2Y0IA 1R3KC 4LF8B 4DWSA 2XOKG 4JFKA 4PD4F 3SYCA 3IKGA 4Z2KA 2IJHA 4LFBB 4H0LB 3ARSA 2QWQB 3P3PA 4CH5A 4I0XA 1HKKA 3TXQA 2ZR3A 3BVOA 2JEUA 3P3NA 2EJ7A 5BMVB 4NKGB 4BW9A 4BAYA 1HJVA 4EFBA 2DWEC 3STLC 1P7GA 5JH7B 1QLEC 5GTIZ 1GTOA 1Y4MA 1W1TA 2VS0A 2ARHA 1AILA 3ZN1A 1EN6A 3G6BA 1K8AW 2X6BA 3HPLC 4UCRA 1NJIW 3GWOA 1Y6XA 2F4EA 1H8EG 5EIBD 3HKDB 2UXNA 4MAVA 1J4RA 2Q9LA 2YEVA 4FZ0A 4PI0A 4RUFA 1M57C 3B2EE 4MTXA 1BZKA 3ARQA 3E86A 3N2GB 5HKGA 5LP6B 2HJFC 2GDSA 4DRHA 3E22B 1R6NA 2MNTA 4X1IB 3JD3A 1WP7A 4IL6Z 3IGAC 1BHAA 5JVDA 3E8GA 2PN0A 3WD0A 3ABLB 4JYYA 4HNAA 3CHFA 4ZPWR 2HHHB 3RW0A 1OHHG 3QF7A 5IYBO 1Z5WA 4FAPA 2O9OA 4RWUA 1N32O 1LL4A 1JNDA 3THOA 2QE7G 1KUQA 5J2UA 3FB8C 2HR3A 5F2VO 1TA8A 2ZM6B 1VQ4V 3OMAB 3CSXA 4IT5A 4O4LB 3VQYA 1FFXB 3CC2V 5DF0A 4B7KA 4RQFA 2YI8A 1TFVA 5IJ0B 2EINB 1JNTA 4U86A 2DYRC 4O2TA 5H6RA 3AS3A 1S76D 2BSKB 4QNHB 4O4HB 3I55V 1GN3A 1VQ6V 4TYOA 3UO2A 1G4YB 3JASA 3UF8A 2QR4A 1NWUA 4DYLA 5J9PC 1IURA 1W59A 3O5JA 2EILB 2ADPA 2XUMA 3T1CA 5LGUA 2MK3A 1B06A 5IYZB 4ZPVR 4ODMA 4QT2A 1XMOO 1W1PA 4ITZA 2KKWA 2PTMA 4FLVA 1BS3A 5C8YB 1URFA 4W4LA 2B5UA 1OWQA 1F23A 1MNGA 2KFWA 3GPKA 2WWWA 1BQZA 4WCEV 3D3IA 1Y74A 4LNUA 3MDSA 1NMWA 3JAWA 4JFJA 3BA9A 4FLUA 2DJVA 1XREA 3CRQA 3B40A 4TW7A 1M56B 5EYPA 4URIA 4GX5A 5JJEB 1LL7A 4I4TA 2QWNB 3ABUA 1K7DA 3ASOB 2IW5A 5H2FZ 3OR7C 2R72A 1PBKA 3PRAA 2RUCA 4TUYA 5CA0B 1HP8A 2PV3A 2XPBA 4AI8A 3O5DA 3A0BZ 1S3JA 3ZHSA 3ZIAG 3ABKC 2XP3A 4J80A 2ZIMA 4QT3A 2E74B 1D7HA 3OUFA 5LMNO 4UUJC 1BKFA 3RN4A 2HVKC 1Y76B 2R9RB 1K5SA 4G2PA 1FJDA 3F5TA 3ZN0A 2B31A 4UCTA 3SYAA 3STZC 3WL0A 2DG9A 5LHHA 2F1MA 2YICA 4O4JA 2OYQA 1RSOB 1TCOC 2CTPA 1YDXA 3SDLA 2ADQB 1TVKB 3IAYA 4P8XA 4BF8A 1TGOA 1G8MA 1PPJH 3IC9A 1DF4A 1QBZA 3VQXA 2IF4A 5FNVA 1FKSA 1GN6A 3H1HH 4PA9A 3G71V 4F6RA 4JF3A 5BXZA 5KHKA 4UVBA 5GONB 1OV9A 3K04A 1N32B 4D6TH 3H1JH 4P2ZA 5LOVA 1RP3B 5IE9A 3A0HZ 1VQ5V 4W9OA 3JALB 3OGCC 1AP6A 2LW7A 3OM3B 1NTMH 1FFTB 2WLLA 2Y4UA 3OT7A 5EBMC 2EIJC 5CA1B 3L9DA 2AOSA 2PI4A 2P90A 2DG4A 3ALFA 4DV1B 5E1AC 4LF4O 4O2BA 1J5EO 4GKJO 4IHJA 3AG2C 5H5NA 2K9PA 4YIPA 2JJ2G 4EFEA 1EQ3A 4OPAA 5BY1A 2E3CA 2YSUB 4CS2A 1PP9H 5BZBA 1M1KW 3QO5A 5CBGA 1ROTA 3JD2A 3WL1A 2BOBC 1LNQA 3B4SA 1Q5OA 4TW6A 3ZJZA 3ETDA 3B8SA 4AILC 4L72B 4J9ZB 4JI4O 1KU9A 4YY3O 4DUYO 4QIBA 2WSSG 2XP6A 1Q7YW 2WLZA 1BHBA 3O5EA 2P06A 5KMGB 3ZMTA 4WFEA 4HYOA 2N05A 5EBLC 1XMOB 1O9GA 3JCUZ 4NTYA 4IT6A 4MNMA 2YI9A 3EVKA 1IBMO 4J9YB 4DR1O 5EIBC 3AROA 2FL4A 1K4DC 2GTSA 1ZCNA 2IUZA 3ARPA 1MZEA 3SPHA 2PPPA 3APOA 3TXSA 1YSCA 2YXHA 4FFKA 1M9NA 4J7ZA 4UCVA 1G1XB 3AS2A 2DSUA 2FMLA 2L2SA 5EZYA 1R3IC 4I55A 4YXWG 4WFHA 2M1IA 3EFFK 1OCOB 2LW1A 4K3AA 2XP8A 4RQEA 3WG7B 1NR1A 1Q43A 2DG3A 4U7NA 1NWSA 2KSDA 1YIJV 2ITKA 1ZUQA 1SQVH 2QEXV 1NVPB 2A9HA 3OEHG 5LMNB 1QQCA 3JXVA 2ITDC 2XP5A 2YXLA 1Q90D 1SKVA 4K8XA 2X7RB 2ODMA 2YS8A 1VQMV 1M5YA 2XAHA 3FAPA 1YW5A 2Q4PA 3AG3B 3M99B 1BL4A 4FM2A 3UQ8A 1UR8A 4PA3A 4EEQA 1AJNA 1WLEA 4U3JA 3WB2A 5HWCA 5B1AC 2CGNA 3NI6A 3ZRWA 2OT5A 3JAMN 2QA4V 4FLTA 4XDKA 5KHJA 5DEZA 3VAWA 2CAZC 4J7JA 2ZR5A 2DT2A 1DF5A 3F5WC 3LUTB 4DK0A 1Q8IA 1ZBWA 1FXKC 1FKIA 3KCEA 3FAVB 1VIBA 2M7WA 2UUAO 4EB6B 4WIWA 1IVSA 4LF4B 1NR7A 4GKJB 1N34O 3WQVA 5KAIZ 3MHSC 1H2NA 4DRPA 2JGDA 5LL6Y 2VRZA 1WAZA 3D36C 3CCRV 4FFBB 2RURA 4JI3O 3RM8A 1IX9A 5CN0A 3LSUA 3K58A 4JI4B 4YY3B 4DUYB 4DRQA 4YJ3B 1A7XA 3OTOO 1I5YA 2W6IG 2F4VO 2UXCO 4BR6A 5DO2A 3CP1A 4X66O 1IBMB 4DR1B 2GUZB 5H9CA 1P49A 4G2KA 1VEWA 5D75A 2KQXA 2B1GA 5FPOA 5J2TB 4ODKA 1CP9A 4MVRA 1OGBA 4LWSB 3JARA 1P84F 4TV8B 3UM7A 1GM9A 2WM0A 1ZL8A 4TV9B 2F43G 5LP6C 3QVNA 2WLMA 3SR2C 1HR0O 5CBHA 4H37A 3K9AA 3WD1A 2HJDA 1ZB5A 1IBLB 3ABLC 1FKTA 4IPXA 3G6EV 2DSZA 4C02B 1D5NA 1ZBVA 1JCHA 2BOCC 3O5MA 3ZS8C 3ODKA 2AHZA 4WF9V 4X1YB 1FKLA 2CTWA 3ZHTA 4MVQA 1NVPD 3ETEA 4IT4A 3OR6C 3PRDA 5JQGB 1RFYA 2RDCA 2DT3A 1ITXA 4WBNB 1XNRO 3RM4A 4QZVB 1KP2A 4HBNA 2L35A 4LGXA 1SF9A 2Y4TA 5CB4B 1AJPA 2Z5UA 2Q7HA 4JI5O 4JI7O 2R9IA 1JJ2U 2EINC 1KD1W 1Q6HA 3BMBA 3CRRA 5LYJB 4WKHA 3DSQA 1FD9A 2QTOA 4P30A 2YXYA 5EBWC 4GX0A 1OCRB 1XQ8A 3X2QB 1X6LA 2O92A 2EILC 3LNNA 1VQPV 5L3FA 1VF5B 1B6QA 1R3LC 1L1FA 2FKXA 2DPEA 3UQAA 2UUAB 2JS3A 3DC6A 2JS5A 2ZQVA 1X59A 4DXWA 3RVZA 5B5EZ 1N34B 2XP4A 3FB5C 1AI7A 4MVZA 1Q6IA 2V4DA 1COWG 3FYEB 5KUMA 1XI1A 1D2DA 2DSWA 4ASUG 3CC4V 1FJGO 3K0DA 1S77D 1K9TA 1ZWIC 3K5MA 4JZ2A 5BXJA 2EULA 4DK1A 3ZRXA 4L3NA 2CK3G 2Q73A 1J95A 4JI3B 1M56C 1EFRG 4FPPA 1Y66A 4JTAB 1GOIA 3FXYA 4DV5B 5BR8O 3O5RA 2FAPA 4QIWF 3RMEA 4MVSA 5E79Z 1W1VA 1KC8W 3CHEA 3CZ8A 3ASOC 3OTOB 2F4VB 5DITA 2UXCB 5L3CA 4X66B 2HLDG 4CS3A 1NTKH 2ZE8A 4N23A 3ZHVA 1E1QG 3CH9A 4LCUC 2OIGA 4FLXA 3WD4A 5LA6A 4S3JA 4XAKA 3H1LH 3CCJV 4DR6O 2L6LA 5LHIA 4O4IA 2ZQUA 1GMGA 2EZOA 3ZMZA 3BAAA 1YTFB 1SQFA 4LC1A 2HKOA 1HR0B 1EN5A 4DWSB 2DMXA 2H94A 5B1OA 2LQTA 4GKKO 4KUMA 4NYKA 3ZHRA 1EDQA 2XAFA 4I0XB 3RYIA 2AZ0A 3RM9A 1ZU8A 4QE7A 4KR0B 1VF6A 3ARYA 3QO8A 4YHHO 5IYDO 1SERA 1GN4A 4IYHA 4TNSA 2MPHA 1PV0A 3KACA 4YIOA 2RN9A 1RPRA 3TCUA 4PELA 2WLYA 4GCZA 4Q6GA 3ASNB 4LF6B 1KBHA 1YJ9V 5IDJA 1EIBA 3CGNA 1XNRB 3W7XA 3T2MA 3U0ZA 1HNZO 4MTGA 4K8ZA 2LO1A 3ETGA 4A5UB 3OMIB 2LJ4A 4ZOLA 2PYLA 3CCEV 4JI5B 4JI7B 2YEVB 3NXSA 1GK9A 2ATKC 4MW8A 2BE3A 2OCHA 2G8ZA 2Y69B 3RBZA 4ODLA 4Z2JA 5J6EA 1TUBA 4JI2O 2C2AA 3LSSA 4N19A 1MABG 2Y0PA 4X1KA 1FKFA 3MDYB 5JVDB 1YJWV 3PR9A 4Z2GA 1KB9F 5JCOC 4HNAB 4UXNA 1S5HC 1PM9A 1NH6A 1E9LA 2X0LA 1VARA 1RM1B 2R70A 4DR2O 4QPKA 3WKZA 5L3BA 5LGTA 1W9PA 1JFFA 1PL0A 5J2UB 1WA8A 1F4MA 1X6NA 4CH6A 4HAMA 1FJGB 3AK1A 1WP8A 3O5KA 1LG2A 4AY1A 3N2KA 3ZEDA 3O9OA 3AQUA 3JATA 4BW5A 4ZBMA 3JYJA 4IIJA 4RUEA 4WFBV 4KHPO 5BR8B 2JGUA 5GW7A 4WFFA 5H6QA 3NTPA 4ICGA 1OCOC 3ZHUA 3WG7C 4FZ1A 2Z0AA 4KL1A 4LF7O 5LHGA 2ZDIC 3JASB 1H8HG 4DV1O 2RSEA 3FB6C 5KA5A 4X1IA 1DTOA 3B9DA 2CH7A 4DRNA 2DYSB 3ZMVA 4JV5B 4DR6B 1HKJA 4X65O 4UV8A 1V54B 1GAXA 3UO3A 4FLZA 2ZT9B 1YTFD 3L74H 2EZPA 1PKXA 3AG3C 1K9MW 3O5PA 1SC5B 4JYBA 4DWSD 4LFCO 3IHZA 2B5UB 1G6UA 4CBCA 1E79G 1YF2A 4GKKB 4NTXA 4F4LA 3K5LA 2A3CA 3OUSA 1Y74B 2PY5A 4LNUB 3K03A 4H33A 1NKDA 3JAWB 4YHHB 3FD9A 4GGQA 4E2LA 4J4NA 5LXTA 1AI6A 1B3QA 5EYPB 1CXZB 3LDCA 1L8DA 2JK5C 4I4TB 1OZ0A 4CH4A 1YATA 3P32A 3L70H 2EIMB 1EZVH 4X9QA 4MSWC 4TUYB 5IY5B 2H3OA 1HNZB 2VN1A 2JEXA 3SYQA 4U85A 3K3WA 1LG1A 3SJQC 3TETA 3KAGA 4UFZA 5ITZA 3OOBA 4LAXA 4GX1A 2E76B 3ZRVA 4XDLA 1WJZA 1FPOA 3ZMUA 2FKEA 3FKSG 1JNSA 3HKEA 4O4JB 2V1DA 3SYPA 4OX9O 1QLNA 2ZE5A 2N74A 2P67A 4TT3G 4JI2B 2O57A 4LR3A 2LP7A 4DR5O 4AQYO 1K5QA 2F95B 1ZK6A 3SPIA 2LGQA 4EKWA 2RUDA 1KP3A 2LPVA 3RGBA 3A2FA 1HWYA 1VQOV 2P4VA 2ZE7A 5FNVB 4F6RB 4WFAV 4DR2B 1FKGA 1FAPA 2WLJA 4X88A 4ZI7A 3MHHC 3Q4HA 2F66C 5LOVB 3D3QA 3KADA 1N33B 3G67A 4R7CA 2PPNA 2WLLB 1UJWB 3IC7A 3QOKA 2M6YA 4OGQB 3O65A 4KHPB 1M5IA 2ILMA 3HKCA 4O2BB 1NWTA 2Q5ZA 3H1KH 4IHJB 3AEIA 4WJXA 2RMKB 3CXCU 1U96A 2F23A 3ZMSA 1WB8A 4LF7B 4ML4A 2QM4A 3ZRSA 1HJXA 1SZXA 3AG1B 3HR0A 5CA3A 1FKRA 1Q86W 3G6LA 3JD4A 1E1RG 2QKSA 2FDMA 4KP4A 1QPLA 1LUWA 3CS5A 2ZD9A 3ARVA 1OJHA 4X65B 5DIVA 4JASA 3JYMA 3A0RA 3SPCA 2UXDO 2IJKA 4LFCB 5B8IC 1A32A 4K35A 2EIKB 4BWAA 3HKBA 2RJZA 5HW6A 1J4IA 3K5NA 4QE9A 5KLVH 3SGIA 1KKDA 1OCCB 1IDSA 2UUBO 2WK2A 4JFMA 4RO2A 1R1BA 1FFRA 3HB3B 1CEZA 1ROUA 5EZYB 4TOIA 4J4OA 4I55B 2GHYA 3X2QC 1HJWA 3WD2A 4I50A 3K06A 1V55B 1M93A 4DV2O 1GPFA 5L3GA 4MNKA 4J10A 1HNWO 3EIPA 2UZ5A 1EYMA 3P30A 3T1HO 4JI0O 4I9WA 2N04A 3K08A 5KAFZ 3VOUA 1YI2V 1YITV 1O9HA 3BEHA 3T4DA 1VP7A 2HFEC 1IBLO 1R73A 2IJJA 1Q82W 1KYOF 4DV7O 2NNUA 1NI8A 4OX9B 2DWDC 1S72V 2RQSA 4JTCB 4J7KA 3QTCA 3U11A 1XDCA 3ABMB 4AQYB 3G80A 4DR5B 2ZNJA 5EC1C 3L73H 1OCZB 2VWKA 4U3JB 3ABTA 1O6IA 3RFRA 1D5AA 3SJAC 3CB2A 1AR5A 3ZRWB 2ZXWB 2KG7A 1NS1A 4U84A 2LJ2A 3E89A 3ZX6A 1Q3EA 4DV6O 3JCZA 2UXBO 5JH8A 2K1EA 4NZCA 2CTQA 1CTNA 1SA0A 3BABA 3KZ7A 1E6ZA 5LMUO 4LF9O 5FPRA 5JWPA 2DYRB 1GO3F 5HT1A 1XHXA 1I0HA 2EJRA 4DWSC 4Z1MG 2UU9O 2ZQTA 2HP8A 1QVFU 4NXMO 1KT0A 2JGDB 1AVMA 3R66A 5KX5A 1US6A 3J81N 3O5GA 5DN6G 3IK8A 1PL4A 5IT9N 3I5DA 4GUNA 2ZR4A 1GM7A 1Q1CA 3BY6A 3CHCA 5K1PA 4UCUA 4JI1O 3ASNC 1K4CC 3RYCA 2JIZG 1JX9A 2XPAA 1WPBA 2G38A 4PDVA 3K5OA 4PA6A 2PV2A 2UXDB 3ML0A 2DW4A 4DV5O 4CC6A 4P8VA 3JARB 3LUOA 5L3DA 2E5LO 3C90A 4MSPA 1ZL8B 2OTJV 2Y69C 2PI5A 2OLHA 1JR9A 3T4ZA 1E15A 4B3TO 3FAVA 2UUBB 1QHTA 4MNJA 4PHZA 3UI6A 1I94B 3W7TA 2JZVA 3R65A 1VF8A 4DV2B 2AGAA 4BIZA 1HNWB 1AR1B 1JCHB 2IH3C 5KUKA 1FFQA 3UI5A 3U10A 1GM8A 1RM1C 1X4TA 2R9AA 4GT1A 3T1HB 4JI0B 2GV9A 1IXMA 3MAQA 1HNXO 2A3AA 4WKFA 4XDJA 2ZIOA 2KO7A 1KMIZ 2Q7EA 3ARRA 2BCCH 4DV7B 1P5QA 2RCVA 4UB6Z 1F40A 1E6NA 2BTOA 2IBZH 3TGUH 2ZKOA 2W0XA 4R50A 4DR3O 3J80N 2NR5A 1OGGA 2K8IA 1DLBA 4Z2WA 4LF6O 2ZNIA 4GLXA 1ZBKA 1ZBCA 3L75H 1XOUA 3UCSC 3NRKA 5HTGA 3NR7A 4BIUA 4D7SA 2YIAA 2QKCA 2EIJB 2XNDG 4L87A 2IU0A 1UPGA 4UV9A 3JSNA 4JYSA 3DXRA 4DV6B 2UXBB 4X20A 3KAIA 2QWOB 2PBCA 1LL6A 4I5SA 2DYSC 3UT5A 2X6CA 5LMUB 4LF9B 3ZCCA 1V54C 4KFMA 3PN1A 1XRVA 1I7FA 5FL7G 3EHBB 1DK1A 2UU9B 4NVPA 1T5EA 2NN4A 1K92A 4PA4A 3T1YO 4R8CA 4QPJA 5D5PA 4YJ2A 4NXMB 3LDEA 2FYUH 5LGNA 1WB7A 1EM1A 1MSWD 1HW7A 4KQZA 1NTZH 3DC5A 3JD0A 3J7AU 1L1PA 1H2SB 1NH2B 2QKAA 1HDJA 3CCQV 1XHZA 1W9UA 2Q6AA 1B04A 2WLIA 4D7TA 5IJ9A 3WB0A 3VQWA 2NLJC 4JI1B 5HW7A 4LH6A 1ZX3A 3RYHA 3IKDA 2EIMC 1M90W 4B08A 4B3RO 5IY5C 3CJHA 3O5QA 4JYAO 4PJ0Z 4WKAA 2M08A 2ZQSA 1I5XA 4FIPC 3JAKA 2AHYA 5LA6B 1B6CA 3WQWA 3K9SA 1W2BU 2ZCEA 4N21A 4OPHA 2VWJA 4DV4O 3B8MA 1MSDA 1D7IA 2E5LB 4O4IB 4DRIA 2KI3A 4BIOA 4B3TB 3TK1A 5TISZ 3BA8A 2UXXA 2DQ0A 3RYFA 2QWPB 1BGYH 1ROPA 1E6PA 4DROA 3ZBHA 3G6MA 4JV5O 4MVOA 3RYIB 3H1IH 4DRXA 1N8RW 2B1IA 2XAGA 4HBEA 1XHGA 1IZ3A 2PV1A 2KR7A 1BMFG 3A8TA 3K59A 1HNXB 1EBOA 2RNBA 3BCCH 2A3BA 1R3JC 4MS2A 3I56V 4DV0O 2WAMA 3B8NA 3ARWA 1NQTA 1ENVA 1Q6UA 2BTQA 2YUAA 1YEWA 4ZIBA 3WB1A 2DT0A 2CDYA 4Q20A 4JPRA 4DR3B 3G4SV 3TCZA 1MOFA 1W0JG 4ZOLB 3H01A 3OE7G 4CS4A 3CC7V 1FKJA 2OIEA 4P8UA 2QSAA 4PA7A 3CHXA 4L8JA 2P7TC 2PPOA 1WPXA 1YXBA 4ODOA 1H0IA 4O2AA 2OTLV 1TUBB 3AG1C 3ALGA 3OW2U 4UB8Z 2ETNA 3AS0A 4X1KB 4P9PA 4X8AA 1YJNV 1THZA 4ZHQA 5D5QA 2P6JA 4B3SO 4TX0A 1Y0OA 4Q22A 1ZTEA 1FXKA 3C3TA 1XMQO 2AW9A 1F4NA 4MT8A 3CYOA 2Q7GA 1JFFB 3T1YB 2N87A 4PDLA 1K73W 1WA8B 2EIKC 3CCSV 2KB1A 2YBUA 4NXNB 3N2KB 3SPJA 3JATB 1Y67A 3D36A 1NH2D 1D7JA 3H9RB 1OCCC 3LSQA 5FLXN 2PF4E 4IIJB 4PV1B 3E8HA 2AWGA 2JRIA 5BMVA 2P5OA 4DH0A 1VQ7V 1LJYA 3KCYA 2IH1C 3CMEV 3KG2A 1N33O 1V55C 3CRAA 3TC5A 5JH7A 1QU7A 3RT3C 4B3RB 1PNLA
chains in the Genus database with same CATH topology
1NWTA 4W5UA 1ZBWA 4G50A 4WJXA 2XP7A 1FKIA 3O5FA 3KCEA 4ZS6A 3KAFA 1HKIA 4ML4A 4WIWA 1HJXA 1J6YA 4TW8A 3KAHA 4MPKA 1FKRA 3G6LA 4DZ2A 2FDMA 3PA7A 3WQVA 1QPLA 2DT1A 4DRPA 1RD6A 4DRKA 1WB0A 2F2DA 3ARVA 4JFIA 2OFNA 4Z2LA 1KFWA 5DIVA 3JYMA 3AS1A 1E6RA 2RURA 3RM8A 1D6OA 1N1AA 1F8AB 2MF9A 4DRQA 5B8IC 3WH0A 1A7XA 4NNRA 4DT4A 5DO2A 5HW6A 1J4IA 1QPFA 5D75A 2WK2A 4JFMA 1FFRA 4ODKA 1ROUA 4WK9A 1OGBA 4J4OA 1HJWA 3WD2A 5GQBA 2WM0A 1GPFA 4HARA 4MNKA 3UQIA 1PINA 1IX5A 1H0GA 2UZ5A 1EYMA 1J4HA 4JFLA 3W4RA 1ZL1A 4ODQA 3WD1A 1ZB5A 1NWRA 1FKTA 4IPXA 2DSZA 4C02B 1ZBVA 2KE0A 3O5MA 3ODKA 4DWSA 3TDBA 4JFKA 1FKLA 3IKGA 4Z2KA 2RQSA 3O5OA 3ARSA 1HKKA 4IT4A 3PRDA 2DT3A 1ITXA 1O6IA 3RM4A 4QZVB 2VCDA 1W9VA 4LGXA 1HJVA 1NMVA 4U84A 5GPRA 3O5IA 4ODPA 1W1TA 3B09A 3RGCA 5JH8A 4NZCA 1D2KA 1Q6HA 1CTNA 3KZ7A 1E6ZA 4WKHA 2F4EA 1FD9A 3ARZA 5HT1A 4MAVA 1J4RA 1X6LA 2O92A 4DWSC 2ZQTA 3ARQA 3FY1A 5HKGA 4DRHA 1KT0A 2DPEA 3UQAA 2MNTA 3O5GA 3IK8A 2ZQVA 3WD0A 2XP4A 2ZR4A 3CHFA 1Q1CA 1Q6IA 3CHCA 4ZPWR 2DSWA 4MGVA 4FAPA 1K9TA 5BXJA 2O9OA 4DRMA 2XPAA 5HUAA 1LL4A 2PV2A 4L3NA 1JNDA 2MLXA 3FXYA 1GOIA 3O5RA 1KT1A 2FAPA 2ZR6A 3RMEA 1W1VA 3CHEA 3CZ8A 1JNEA 3B7XA 4P8VA 5DITA 1EHNA 2KGJA 4HBOA 3LUOA 4MSPA 5DF0A 2OLHA 1TFVA 1E15A 3CH9A 3WD4A 4S3JA 4U86A 1JNTA 1FKHA 4XAKA 2MLZA 4MNJA 4O2TA 3UI6A 1JVWA 1GUVA 3AS3A 3RFWA 2JZVA 2ZQUA 1VF8A 5I98A 2DSVA 4TYOA 3UF8A 1NWUA 1FFQA 3UI5A 5HBFA 4DWSB 3O5JA 2A3AA 4WKFA 4ZPVR 2LGOA 2KO7A 3ARXA 1EDQA 5HWBA 4ODMA 4QT2A 1W1PA 3ARRA 4ITZA 3RM9A 1ZU8A 4KR0B 1P5QA 3ARYA 1OWQA 4R0XA 3WD3A 4FN2A 4TNSA 2KFWA 1F40A 2MPHA 3CGMA 1E6NA 3GPKA 3KACA 4LAYA 2WLYA 1HKMA 4IQ2A 1NMWA 1OGGA 1U79A 2K8IA 4JFJA 3WIJA 1EIBA 3CGNA 4W9QA 1ZBKA 1SYTA 1ZBCA 4TW7A 3CHDA 3NRKA 5HTGA 1HXVA 4URIA 2XP9A 1LL7A 2LJ4A 4JYSA 2ESCA 1FKDA 3KAIA 1PBKA 3PRAA 2RUCA 1WAWA 2PI6A 2PBCA 1LL6A 2PV3A 2XPBA 3O5DA 2G8ZA 4ODLA 4Z2JA 5J6EA 4IQCA 2Y78A 2XP3A 4QT3A 1D7HA 1FKKA 4MTVA 1XRVA 4N19A 1BKFA 2YBTA 1FKFA 4G2PA 1FJDA 3MDYB 4ZPTR 4Z2GA 3PR9A 2B31A 3WL0A 2DG9A 4Q7NA 1NH6A 3O5LA 1E9LA 1TCOC 4KQZA 2A3EA 2MLYA 1L1PA 3WKZA 4P8WA 4P8XA 4BF8A 1W9UA 4S3KA 1W9PA 4Z2IA 4R5EA 2IF4A 4Z2HA 1X6NA 3UQBA 5HW7A 1FKSA 4LAWA 3O5KA 1LG2A 4GIVA 4AY1A 3IKDA 3AQUA 4MNLA 3JYJA 3ARUA 3O5QA 4W9OA 4WKAA 2M08A 2ZQSA 3NTPA 3BXWA 1B6CA 2RUQA 3WQWA 2AOSA 2Q5AA 2DG4A 3ALFA 1D7IA 4DRIA 2KI3A 2RSEA 1W1YA 3B9DA 1C9HA 1EQ3A 4DRNA 1E6PA 4DROA 1HKJA 3G6MA 1ROTA 3ARTA 3WL1A 4TW6A 3B8SA 4HBEA 3O5PA 1XHGA 4L72B 4DWSD 2PV1A 2KR7A 3IHZA 1FKBA 4QIBA 2XP6A 3O5EA 2WLZA 2A3BA 2A3CA 1W26A 3ARWA 2D9FA 4IT6A 4MNMA 1Q6UA 3AROA 1WNOA 4GGQA 4J4NA 1ZCNA 1QZ2A 2DT0A 2QF8A 3I6CA 2IUZA 4PTMA 3TCZA 2G41A 1YATA 3ARPA 3B9EA 2PPPA 1FKJA 4P8UA 2VN1A 1LQ0A 3AS2A 2PPOA 2DSUA 3B9AA 2L2SA 4U85A 4ODOA 1H0IA 1LG1A 3ALGA 4DIPA 2M1IA 3KAGA 2XP8A 3AS0A 3PRBA 3OOBA 1SR0A 4LAXA 2DG3A 1NWSA 4ODNA 2FKEA 2ITKA 5GPGA 1JNSA 4TX0A 1Y0OA 4Q22A 3UI4A 3EY6A 3JXVA 4ODRA 2XP5A 1ZK6A 2M2AA 2RUDA 2LPVA 3KABA 2LKNA 5HW8A 2N87A 1M5YA 4W9PA 3FAPA 1YW5A 1BL4A 2YBUA 5DIUA 4DRJA 1UR8A 1FKGA 1FAPA 1D7JA 3H9RB 1T11A 5HWCA 3KADA 2AWGA 3NI6A 4DH0A 4LAVA 1LJYA 2PPNA 1NSGA 3QOKA 5DEZA 3VAWA 3TC5A 4NSBA 2ZR5A 1UR9A 2DT2A 2F21A 3OA5A 4DZ3A 1R9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ITZ A;  4DRN A;  1NMV A;  1P5Q A;  4U84 A;  4DRO A;  4G50 A;  4R0X A;  3O5I A;  2XP7 A;  2KFW A;  4FN2 A;  1FKI A;  2MPH A;  3CGM A;  3GPK A;  3KAC A;  4ODP A;  1ROT A;  1F40 A;  3B09 A;  3RGC A;  4LAY A;  3O5F A;  3KCE A;  4TW6 A;  3KAF A;  1Q6H A;  3O5P A;  3KZ7 A;  2PV1 A;  2KR7 A;  3IHZ A;  4IQ2 A;  1J6Y A;  1NMW A;  1U79 A;  2F4E A;  2K8I A;  1FD9 A;  3KAH A;  1FKB A;  4JFJ A;  4QIB A;  4TW8 A;  2XP6 A;  3O5E A;  4DZ2 A;  1FKR A;  3CGN A;  4W9Q A;  3PA7 A;  4TW7 A;  5HT1 A;  1QPL A;  1J4R A;  1W26 A;  3NRK A;  4DRP A;  5HTG A;  1HXV A;  2D9F A;  2ZQT A;  4DRK A;  2F2D A;  2XP9 A;  1Q6U A;  5HKG A;  2LJ4 A;  4JFI A;  2OFN A;  4GGQ A;  4JYS A;  4J4N A;  4DRH A;  1FKD A;  1KT0 A;  1ZCN A;  1QZ2 A;  3JYM A;  5DIV A;  2RUR A;  1PBK A;  3I6C A;  2RUC A;  3KAI A;  3UQA A;  2MNT A;  2PBC A;  2PV3 A;  2XPB A;  3TCZ A;  1D6O A;  3O5G A;  1N1A A;  1YAT A;  3O5D A;  1F8A B;  2MF9 A;  3IK8 A;  4ODL A;  4DRQ A;  5B8I C;  2ZQV A;  4IQC A;  3WH0 A;  2Y78 A;  5J6E A;  1A7X A;  2PPP A;  2XP3 A;  2XP4 A;  2ZR4 A;  4QT3 A;  1FKJ A;  1D7H A;  4NNR A;  1FKK A;  1Q1C A;  1Q6I A;  2VN1 A;  4N19 A;  4DT4 A;  1BKF A;  2PPO A;  1FKF A;  4MGV A;  4G2P A;  5HW6 A;  1J4I A;  2L2S A;  1FJD A;  4U85 A;  3MDY B;  4ODO A;  4DIP A;  1QPF A;  4FAP A;  2M1I A;  2DG9 A;  3KAG A;  5BXJ A;  5HUA A;  4DRM A;  2XPA A;  5D75 A;  2XP8 A;  3O5L A;  3PRB A;  3OOB A;  4JFM A;  2PV2 A;  4LAX A;  4ODK A;  2MLX A;  1ROU A;  2DG3 A;  1TCO C;  4ODN A;  4J4O A;  4TNS A;  2MLY A;  2FKE A;  2ITK A;  3O5R A;  1KT1 A;  2FAP A;  2ZR6 A;  5GPG A;  4DZ3 A;  1JNS A;  4TX0 A;  1Y0O A;  4BF8 A;  3UQI A;  3UI4 A;  1PIN A;  3B7X A;  5DIT A;  2UZ5 A;  2KGJ A;  3EY6 A;  1EYM A;  3JXV A;  4ODR A;  1J4H A;  2IF4 A;  2XP5 A;  4JFL A;  3LUO A;  4ODQ A;  1ZK6 A;  3UQB A;  5HW7 A;  4MSP A;  1FKS A;  4LAW A;  2M2A A;  2RUD A;  2LPV A;  3O5K A;  3KAB A;  4GIV A;  2LKN A;  3IKD A;  1FKT A;  5HW8 A;  2N87 A;  1M5Y A;  4IPX A;  4W9P A;  3JYJ A;  3FAP A;  1JNT A;  1FKH A;  1YW5 A;  4U86 A;  2MLZ A;  2KE0 A;  4C02 B;  3O5M A;  3ODK A;  4O2T A;  3O5Q A;  1BL4 A;  3UI6 A;  1JVW A;  5DIU A;  4DRJ A;  4W9O A;  3RFW A;  1FKG A;  3TDB A;  1FAP A;  2JZV A;  2M08 A;  1FKL A;  2ZQS A;  4JFK A;  3NTP A;  2ZQU A;  1L1P A;  5I98 A;  1D7J A;  3H9R B;  1B6C A;  1T11 A;  2RUQ A;  3IKG A;  2RQS A;  3O5O A;  4TYO A;  5HWC A;  3UF8 A;  3UI5 A;  3KAD A;  2AWG A;  2Q5A A;  3NI6 A;  4DH0 A;  2DG4 A;  4LAV A;  3PRD A;  1D7I A;  2PPN A;  3O5J A;  1NSG A;  4DRI A;  2KI3 A;  3VAW A;  3TC5 A;  2LGO A;  2KO7 A;  2RSE A;  2ZR5 A;  2F21 A;  5HWB A;  2VCD A;  4ODM A;  4QT2 A;  1C9H A;  1R9H A;  1EQ3 A; 
#chains in the Genus database with same CATH topology
 4JYA B;  5JJN B;  3FB7 C;  2OCC B;  4NTW A;  4W5U A;  1K3E A;  2WLK A;  1SET A;  2XP7 A;  2DN9 A;  3HKD A;  3CCU V;  2XAQ A;  5AG2 A;  5B3S B;  2CH7 B;  3KAF A;  4DV4 B;  1HKI A;  1JA8 A;  4TW8 A;  4F6E A;  3KAH A;  3GU0 A;  3K57 A;  4TWK A;  3N2G A;  3OTF A;  5LP6 A;  3PA7 A;  1BQ0 A;  1RD6 A;  1VF7 A;  3JYC A;  3ABM C;  3E22 A;  2ITC C;  4MTO A;  2HVJ C;  1VQL V;  2F2D A;  1OCZ C;  2P4K A;  1KFW A;  1JMK C;  4G28 B;  2JVD A;  1QR8 A;  2H8P C;  2JDI G;  2ZXW C;  3ETQ A;  1NU1 H;  4CZZ A;  1D6O A;  1VMG A;  2MF9 A;  3WH0 A;  3F7V C;  5IYC O;  5CMU A;  2V7Q G;  1I08 A;  2ZR2 A;  5LXT B;  1GKF A;  1LUV A;  1SES A;  2GSM B;  4DV0 B;  4WFG A;  1VQN V;  4DT4 A;  1FAF A;  2PYJ A;  1N0N A;  1QPF A;  1JOY A;  2VQF O;  2LGW A;  3E2E A;  5DED A;  4XBF A;  4DR7 O;  1GRJ A;  4O4L A;  2AZ2 A;  5GQB A;  2E75 B;  1FFX A;  3CRC A;  3DGE A;  3AG4 B;  5ITZ B;  3UQI A;  5JJJ B;  1PIN A;  1KQS U;  5IJ0 A;  1H0G A;  4DO2 A;  1Q81 W;  3JSL A;  4LP8 A;  3GB7 C;  4JFL A;  1ZL1 A;  3W4R A;  3HKE B;  3E35 A;  1IBK O;  3GTY X;  2BSK A;  4O4H A;  2A0L A;  1H2G A;  4H13 B;  3RWR D;  1E44 A;  3F7Y C;  3TDB A;  3M8A A;  4B3S B;  2D3O W;  3FX7 A;  2CUG A;  3O5O A;  5IYZ A;  1SRY A;  3C3S A;  2XAJ A;  1XMQ B;  1SS3 A;  3IJ4 A;  1QNM A;  1SQP H;  4DUZ O;  1PNK A;  4B7E A;  2DOS A;  5L3E A;  4ZI7 B;  5C8Y A;  4X62 O;  3Q4H B;  5B1B B;  2VCD A;  4GZR B;  3CCV V;  4ABM A;  1N36 O;  4JI6 O;  1W9V A;  1NMV A;  2Q0O C;  3GWK C;  2GBO A;  5GPR A;  4CC5 A;  1R6T A;  4FM0 A;  4U7O A;  1KEC A;  3PJS K;  1V9P A;  5HFL A;  3O5I A;  4ODP A;  2IJI A;  1SQG A;  3B09 A;  1VQ9 V;  3RGC A;  1XBL A;  2Y48 A;  3HKC B;  1D2K A;  1MA1 A;  1AP5 A;  1BT8 A;  1XIL A;  3ARZ A;  2AXT Z;  1YVW A;  1TUE B;  3LNM B;  5CA0 A;  1H38 A;  3FY1 A;  3LDD A;  1BSM A;  1NBM G;  1Z5V A;  5DEC A;  1Y76 A;  4C7U A;  2MW2 B;  1H2M A;  1KKC A;  4LH7 A;  1WN7 A;  1XL4 A;  1MZF A;  1RSO A;  4MGV A;  3BRC A;  1TVK A;  5HUA A;  4DRM A;  4FVM A;  3HKB B;  4PDR A;  2QDO A;  2MLX A;  2Q69 A;  2UUC O;  1KT1 A;  2ZR6 A;  3OGI B;  2Q0A A;  1H2L A;  1JNE A;  1YHQ V;  2A06 H;  3B7X A;  4UVA A;  5GON A;  4PDM A;  1EHN A;  2KGJ A;  2ZE6 A;  3CEI A;  4I50 B;  1UFI A;  4B3M O;  4HBO A;  4X89 A;  2YDE A;  2QWR B;  3CMA V;  3JAL A;  3SJC C;  1QLE B;  3OEE G;  3QG5 A;  2VQF B;  2A7W A;  3CXH F;  4JI8 O;  5CA1 A;  3K0G A;  3S3X A;  4DR7 B;  1FKH A;  2MLZ A;  4P9O A;  2YIB A;  1JVW A;  3B77 A;  1GUV A;  1OCR C;  3RFW A;  3ICX A;  1I94 O;  2RQ6 A;  4Z1V A;  5I98 A;  2DSV A;  1BL8 A;  4JGS A;  4J41 A;  5KA6 A;  1S5J A;  4MTF A;  5HBF A;  4MVM A;  1F51 A;  1M57 B;  1Z2G A;  2CTR A;  4JZG A;  1IBK B;  4ZKI A;  2LGO A;  3ARX A;  5HWB A;  1SQB H;  1ZAU A;  1F7Y A;  3L71 H;  2GTA A;  1AR4 A;  3E83 A;  1YCI A;  3M7M X;  4R0X A;  3WD3 A;  5JCO A;  4FN2 A;  4K0K O;  3CGM A;  1GH6 A;  4LAY A;  5KMG A;  2KG7 B;  1HKM A;  4DUZ B;  4IQ2 A;  4X64 O;  2Q68 A;  1U79 A;  3WIJ A;  5C93 A;  4W9Q A;  4X62 B;  4JTD B;  1H2K A;  1SYT A;  2EX3 A;  2DE0 X;  4FJC C;  3CHD A;  1SA0 B;  4JI6 B;  1N36 B;  1HXV A;  4J11 A;  1VQ8 V;  3OMN B;  1EZJ A;  2XP9 A;  2WA4 A;  1ZLZ A;  1AB3 A;  1BCC H;  3CRM A;  2ESC A;  1FKD A;  4CH3 A;  1ZSP A;  3N27 A;  3CD6 V;  1WAW A;  2PI6 A;  3AK3 A;  2PUS A;  3W7U A;  3SPG A;  3K79 A;  4IQC A;  2Y78 A;  1K34 A;  4TQF A;  1YZB A;  3BPZ A;  4FLW A;  2FB5 A;  1FKK A;  4MTV A;  5KX5 B;  3S3W A;  2YBT A;  4E4E A;  1VF6 C;  1AI4 A;  3CPW U;  4ZPT R;  3AG7 A;  2ZDI A;  1SQX H;  2QGN A;  2ZIN A;  4Q7N A;  3OAA G;  3O5L A;  4DR4 O;  2XAS A;  1PNM A;  1LR1 A;  3CX5 F;  3RYC B;  2A3E A;  2MLY A;  1P7B A;  4P8W A;  3GVM A;  4S3K A;  4Z2I A;  4R5E A;  4Z2H A;  2A79 B;  3UQB A;  4LF5 O;  1TAE A;  1SZT A;  4LAW A;  2WLH A;  1N4C A;  1JQ0 A;  1IXB A;  4GIV A;  1S0V A;  4MNL A;  3OFN G;  1XUQ A;  5K1X A;  3ARU A;  2UUC B;  3BHP A;  4QJF B;  3FYI B;  1PD3 A;  3BXW A;  4IGG A;  2YIB D;  2RUQ A;  4JAV A;  4H44 B;  2ZQM A;  4W4K A;  3TJT A;  2Q5A A;  1QR9 A;  1J5E B;  4U3F H;  4B3M B;  2CE4 A;  1U97 A;  1L0L H;  3UKM A;  5KHH A;  4R6Z A;  2YID A;  4JI8 B;  1NZ6 A;  2XHB A;  1W1Y A;  2QM8 A;  1S5L Z;  1C9H A;  1QVG U;  4AHC A;  1JVM A;  4EB6 A;  4DV3 O;  3ABK B;  1M4U A;  1FXV A;  4LFA O;  2VQE O;  3ART A;  3W7S A;  3BFR A;  5EC2 C;  2YC0 A;  1FKA O;  1FYJ A;  1FKB A;  2XTA A;  2CGO A;  5KHG A;  3VBB A;  4FFB A;  1W26 A;  2D9F A;  2LFR A;  4MVU A;  1WNO A;  4K0K B;  4YJ3 A;  1R6K A;  1QZ2 A;  1N0J A;  1XNQ O;  4GYC B;  2QF8 A;  1BE3 H;  4NB5 A;  3I6C A;  5IWA O;  3QNE A;  4PTM A;  4X64 B;  3OD4 A;  2G41 A;  5LBQ A;  5KHI A;  2OCC C;  3IFX A;  3B9E A;  3DXR B;  4I9Q A;  3SJB C;  1L0N H;  2GUZ A;  4X20 B;  3CCM V;  1NT2 B;  5B3S C;  5J2T A;  1LQ0 A;  1EN4 A;  3UT5 B;  4FM1 A;  3B9A A;  1QCE A;  3FFQ A;  4NR1 A;  2FTK A;  4LWS A;  4DIP A;  4TV8 A;  3MD0 A;  2LFS A;  4TV9 A;  2PGG A;  3PRB A;  1SR0 A;  2PZS A;  4FMT A;  3L72 H;  4ODN A;  3E8F A;  4LF8 O;  5EK0 A;  5GPG A;  3E8B A;  3AG2 B;  4YJ2 B;  1SQQ H;  4RAI A;  4LFB O;  3UI4 A;  4J42 A;  3KZI Z;  3EY6 A;  4ODR A;  1DGS A;  1FS0 G;  2Q8V A;  3W7W A;  2M2A A;  1P4R A;  4X1Y A;  3KAB A;  2LKN A;  5HW8 A;  2WPD G;  2WLI B;  5IJ9 B;  4DR4 B;  4DW0 A;  4W9P A;  1JJO A;  4MW3 A;  4UVC A;  5DIU A;  4DRJ A;  3RYH B;  5JQG A;  4NXN O;  1T11 A;  5CBF A;  5HFM A;  4WBN A;  3CJH B;  4LAV A;  4LF5 B;  2Z3Y A;  3JAK B;  4I7Z B;  1NSG A;  4NSB A;  3WU2 Z;  3AG4 C;  5CB4 A;  2HEP A;  1CPY A;  3RVY A;  1UR9 A;  2F21 A;  2JJ1 G;  4FK5 C;  3CWB H;  3OA5 A;  3AK2 A;  1MMM A;  1ARO P;  4DZ3 A;  1R9H A;  2P22 C;  5B1N A;  1JPX A;  3JD1 A;  5LYJ A;  4G50 A;  1K33 A;  1K97 A;  4JAA A;  4UCS A;  3O5F A;  3RYF B;  4ZS6 A;  1ORQ C;  2D2C B;  4IYI A;  4UDM A;  1J6Y A;  4MPK A;  3KCX A;  4DZ2 A;  3ZHQ A;  4DRX B;  2QTS A;  3CE2 A;  2OWO A;  4QGP A;  2HHH O;  2DT1 A;  2QM7 A;  2W0F C;  4DRK A;  1WB0 A;  4DV3 B;  1RPO A;  1MG1 A;  2A3Q A;  4TSF G;  5A2Q N;  4JFI A;  4JAU A;  2OFN A;  1AJQ A;  4Z2L A;  4LFA B;  2VQE B;  5A9G A;  5B1B C;  5DM6 V;  3AS1 A;  1E6R A;  2W6J G;  4UCO A;  1N1A A;  2BTQ B;  2QJ1 A;  1F8A B;  4JYC A;  3D8C A;  1XL6 A;  5B66 Z;  4OXS A;  4NNR A;  2ZM6 O;  2Q67 A;  4FLY A;  3DTU B;  2EBO A;  3H9V A;  2B9Z A;  1VQK V;  4TQD A;  3CCL V;  1AI5 A;  2X6A A;  2DQ3 A;  2WA3 A;  4HZ3 A;  4G27 B;  5GTH Z;  5B1A B;  1XNQ B;  2XT9 A;  4WK9 A;  4LBE C;  5IWA B;  3APQ A;  4PI2 A;  4O2A B;  3EXA A;  2IU3 A;  3WFV A;  3VQV A;  4HAR A;  1IX5 A;  3KKY A;  2WLN A;  4DW1 A;  1J4H A;  2HG5 C;  4ZHQ B;  4ODQ A;  1GN2 A;  4GX2 A;  1NWR A;  1FXK B;  1XEQ A;  2F93 B;  3QO7 A;  3SYO A;  4KXR A;  1FXH A;  2IM9 A;  2KE0 A;  1WNS A;  1W0K G;  2Y0I A;  1R3K C;  4LF8 B;  4DWS A;  2XOK G;  4JFK A;  4PD4 F;  3SYC A;  3IKG A;  4Z2K A;  2IJH A;  4LFB B;  4H0L B;  3ARS A;  2QWQ B;  3P3P A;  4CH5 A;  4I0X A;  1HKK A;  3TXQ A;  2ZR3 A;  3BVO A;  2JEU A;  3P3N A;  2EJ7 A;  5BMV B;  4NKG B;  4BW9 A;  4BAY A;  1HJV A;  4EFB A;  2DWE C;  3STL C;  1P7G A;  5JH7 B;  1QLE C;  5GTI Z;  1GTO A;  1Y4M A;  1W1T A;  2VS0 A;  2ARH A;  1AIL A;  3ZN1 A;  1EN6 A;  3G6B A;  1K8A W;  2X6B A;  3HPL C;  4UCR A;  1NJI W;  3GWO A;  1Y6X A;  2F4E A;  1H8E G;  5EIB D;  3HKD B;  2UXN A;  4MAV A;  1J4R A;  2Q9L A;  2YEV A;  4FZ0 A;  4PI0 A;  4RUF A;  1M57 C;  3B2E E;  4MTX A;  1BZK A;  3ARQ A;  3E86 A;  3N2G B;  5HKG A;  5LP6 B;  2HJF C;  2GDS A;  4DRH A;  3E22 B;  1R6N A;  2MNT A;  4X1I B;  3JD3 A;  1WP7 A;  4IL6 Z;  3IGA C;  1BHA A;  5JVD A;  3E8G A;  2PN0 A;  3WD0 A;  3ABL B;  4JYY A;  4HNA A;  3CHF A;  4ZPW R;  2HHH B;  3RW0 A;  1OHH G;  3QF7 A;  5IYB O;  1Z5W A;  4FAP A;  2O9O A;  4RWU A;  1N32 O;  1LL4 A;  1JND A;  3THO A;  2QE7 G;  1KUQ A;  5J2U A;  3FB8 C;  2HR3 A;  5F2V O;  1TA8 A;  2ZM6 B;  1VQ4 V;  3OMA B;  3CSX A;  4IT5 A;  4O4L B;  3VQY A;  1FFX B;  3CC2 V;  5DF0 A;  4B7K A;  4RQF A;  2YI8 A;  1TFV A;  5IJ0 B;  2EIN B;  1JNT A;  4U86 A;  2DYR C;  4O2T A;  5H6R A;  3AS3 A;  1S76 D;  2BSK B;  4QNH B;  4O4H B;  3I55 V;  1GN3 A;  1VQ6 V;  4TYO A;  3UO2 A;  1G4Y B;  3JAS A;  3UF8 A;  2QR4 A;  1NWU A;  4DYL A;  5J9P C;  1IUR A;  1W59 A;  3O5J A;  2EIL B;  2ADP A;  2XUM A;  3T1C A;  5LGU A;  2MK3 A;  1B06 A;  5IYZ B;  4ZPV R;  4ODM A;  4QT2 A;  1XMO O;  1W1P A;  4ITZ A;  2KKW A;  2PTM A;  4FLV A;  1BS3 A;  5C8Y B;  1URF A;  4W4L A;  2B5U A;  1OWQ A;  1F23 A;  1MNG A;  2KFW A;  3GPK A;  2WWW A;  1BQZ A;  4WCE V;  3D3I A;  1Y74 A;  4LNU A;  3MDS A;  1NMW A;  3JAW A;  4JFJ A;  3BA9 A;  4FLU A;  2DJV A;  1XRE A;  3CRQ A;  3B40 A;  4TW7 A;  1M56 B;  5EYP A;  4URI A;  4GX5 A;  5JJE B;  1LL7 A;  4I4T A;  2QWN B;  3ABU A;  1K7D A;  3ASO B;  2IW5 A;  5H2F Z;  3OR7 C;  2R72 A;  1PBK A;  3PRA A;  2RUC A;  4TUY A;  5CA0 B;  1HP8 A;  2PV3 A;  2XPB A;  4AI8 A;  3O5D A;  3A0B Z;  1S3J A;  3ZHS A;  3ZIA G;  3ABK C;  2XP3 A;  4J80 A;  2ZIM A;  4QT3 A;  2E74 B;  1D7H A;  3OUF A;  5LMN O;  4UUJ C;  1BKF A;  3RN4 A;  2HVK C;  1Y76 B;  2R9R B;  1K5S A;  4G2P A;  1FJD A;  3F5T A;  3ZN0 A;  2B31 A;  4UCT A;  3SYA A;  3STZ C;  3WL0 A;  2DG9 A;  5LHH A;  2F1M A;  2YIC A;  4O4J A;  2OYQ A;  1RSO B;  1TCO C;  2CTP A;  1YDX A;  3SDL A;  2ADQ B;  1TVK B;  3IAY A;  4P8X A;  4BF8 A;  1TGO A;  1G8M A;  1PPJ H;  3IC9 A;  1DF4 A;  1QBZ A;  3VQX A;  2IF4 A;  5FNV A;  1FKS A;  1GN6 A;  3H1H H;  4PA9 A;  3G71 V;  4F6R A;  4JF3 A;  5BXZ A;  5KHK A;  4UVB A;  5GON B;  1OV9 A;  3K04 A;  1N32 B;  4D6T H;  3H1J H;  4P2Z A;  5LOV A;  1RP3 B;  5IE9 A;  3A0H Z;  1VQ5 V;  4W9O A;  3JAL B;  3OGC C;  1AP6 A;  2LW7 A;  3OM3 B;  1NTM H;  1FFT B;  2WLL A;  2Y4U A;  3OT7 A;  5EBM C;  2EIJ C;  5CA1 B;  3L9D A;  2AOS A;  2PI4 A;  2P90 A;  2DG4 A;  3ALF A;  4DV1 B;  5E1A C;  4LF4 O;  4O2B A;  1J5E O;  4GKJ O;  4IHJ A;  3AG2 C;  5H5N A;  2K9P A;  4YIP A;  2JJ2 G;  4EFE A;  1EQ3 A;  4OPA A;  5BY1 A;  2E3C A;  2YSU B;  4CS2 A;  1PP9 H;  5BZB A;  1M1K W;  3QO5 A;  5CBG A;  1ROT A;  3JD2 A;  3WL1 A;  2BOB C;  1LNQ A;  3B4S A;  1Q5O A;  4TW6 A;  3ZJZ A;  3ETD A;  3B8S A;  4AIL C;  4L72 B;  4J9Z B;  4JI4 O;  1KU9 A;  4YY3 O;  4DUY O;  4QIB A;  2WSS G;  2XP6 A;  1Q7Y W;  2WLZ A;  1BHB A;  3O5E A;  2P06 A;  5KMG B;  3ZMT A;  4WFE A;  4HYO A;  2N05 A;  5EBL C;  1XMO B;  1O9G A;  3JCU Z;  4NTY A;  4IT6 A;  4MNM A;  2YI9 A;  3EVK A;  1IBM O;  4J9Y B;  4DR1 O;  5EIB C;  3ARO A;  2FL4 A;  1K4D C;  2GTS A;  1ZCN A;  2IUZ A;  3ARP A;  1MZE A;  3SPH A;  2PPP A;  3APO A;  3TXS A;  1YSC A;  2YXH A;  4FFK A;  1M9N A;  4J7Z A;  4UCV A;  1G1X B;  3AS2 A;  2DSU A;  2FML A;  2L2S A;  5EZY A;  1R3I C;  4I55 A;  4YXW G;  4WFH A;  2M1I A;  3EFF K;  1OCO B;  2LW1 A;  4K3A A;  2XP8 A;  4RQE A;  3WG7 B;  1NR1 A;  1Q43 A;  2DG3 A;  4U7N A;  1NWS A;  2KSD A;  1YIJ V;  2ITK A;  1ZUQ A;  1SQV H;  2QEX V;  1NVP B;  2A9H A;  3OEH G;  5LMN B;  1QQC A;  3JXV A;  2ITD C;  2XP5 A;  2YXL A;  1Q90 D;  1SKV A;  4K8X A;  2X7R B;  2ODM A;  2YS8 A;  1VQM V;  1M5Y A;  2XAH A;  3FAP A;  1YW5 A;  2Q4P A;  3AG3 B;  3M99 B;  1BL4 A;  4FM2 A;  3UQ8 A;  1UR8 A;  4PA3 A;  4EEQ A;  1AJN A;  1WLE A;  4U3J A;  3WB2 A;  5HWC A;  5B1A C;  2CGN A;  3NI6 A;  3ZRW A;  2OT5 A;  3JAM N;  2QA4 V;  4FLT A;  4XDK A;  5KHJ A;  5DEZ A;  3VAW A;  2CAZ C;  4J7J A;  2ZR5 A;  2DT2 A;  1DF5 A;  3F5W C;  3LUT B;  4DK0 A;  1Q8I A;  1ZBW A;  1FXK C;  1FKI A;  3KCE A;  3FAV B;  1VIB A;  2M7W A;  2UUA O;  4EB6 B;  4WIW A;  1IVS A;  4LF4 B;  1NR7 A;  4GKJ B;  1N34 O;  3WQV A;  5KAI Z;  3MHS C;  1H2N A;  4DRP A;  2JGD A;  5LL6 Y;  2VRZ A;  1WAZ A;  3D36 C;  3CCR V;  4FFB B;  2RUR A;  4JI3 O;  3RM8 A;  1IX9 A;  5CN0 A;  3LSU A;  3K58 A;  4JI4 B;  4YY3 B;  4DUY B;  4DRQ A;  4YJ3 B;  1A7X A;  3OTO O;  1I5Y A;  2W6I G;  2F4V O;  2UXC O;  4BR6 A;  5DO2 A;  3CP1 A;  4X66 O;  1IBM B;  4DR1 B;  2GUZ B;  5H9C A;  1P49 A;  4G2K A;  1VEW A;  5D75 A;  2KQX A;  2B1G A;  5FPO A;  5J2T B;  4ODK A;  1CP9 A;  4MVR A;  1OGB A;  4LWS B;  3JAR A;  1P84 F;  4TV8 B;  3UM7 A;  1GM9 A;  2WM0 A;  1ZL8 A;  4TV9 B;  2F43 G;  5LP6 C;  3QVN A;  2WLM A;  3SR2 C;  1HR0 O;  5CBH A;  4H37 A;  3K9A A;  3WD1 A;  2HJD A;  1ZB5 A;  1IBL B;  3ABL C;  1FKT A;  4IPX A;  3G6E V;  2DSZ A;  4C02 B;  1D5N A;  1ZBV A;  1JCH A;  2BOC C;  3O5M A;  3ZS8 C;  3ODK A;  2AHZ A;  4WF9 V;  4X1Y B;  1FKL A;  2CTW A;  3ZHT A;  4MVQ A;  1NVP D;  3ETE A;  4IT4 A;  3OR6 C;  3PRD A;  5JQG B;  1RFY A;  2RDC A;  2DT3 A;  1ITX A;  4WBN B;  1XNR O;  3RM4 A;  4QZV B;  1KP2 A;  4HBN A;  2L35 A;  4LGX A;  1SF9 A;  2Y4T A;  5CB4 B;  1AJP A;  2Z5U A;  2Q7H A;  4JI5 O;  4JI7 O;  2R9I A;  1JJ2 U;  2EIN C;  1KD1 W;  1Q6H A;  3BMB A;  3CRR A;  5LYJ B;  4WKH A;  3DSQ A;  1FD9 A;  2QTO A;  4P30 A;  2YXY A;  5EBW C;  4GX0 A;  1OCR B;  1XQ8 A;  3X2Q B;  1X6L A;  2O92 A;  2EIL C;  3LNN A;  1VQP V;  5L3F A;  1VF5 B;  1B6Q A;  1R3L C;  1L1F A;  2FKX A;  2DPE A;  3UQA A;  2UUA B;  2JS3 A;  3DC6 A;  2JS5 A;  2ZQV A;  1X59 A;  4DXW A;  3RVZ A;  5B5E Z;  1N34 B;  2XP4 A;  3FB5 C;  1AI7 A;  4MVZ A;  1Q6I A;  2V4D A;  1COW G;  3FYE B;  5KUM A;  1XI1 A;  1D2D A;  2DSW A;  4ASU G;  3CC4 V;  1FJG O;  3K0D A;  1S77 D;  1K9T A;  1ZWI C;  3K5M A;  4JZ2 A;  5BXJ A;  2EUL A;  4DK1 A;  3ZRX A;  4L3N A;  2CK3 G;  2Q73 A;  1J95 A;  4JI3 B;  1M56 C;  1EFR G;  4FPP A;  1Y66 A;  4JTA B;  1GOI A;  3FXY A;  4DV5 B;  5BR8 O;  3O5R A;  2FAP A;  4QIW F;  3RME A;  4MVS A;  5E79 Z;  1W1V A;  1KC8 W;  3CHE A;  3CZ8 A;  3ASO C;  3OTO B;  2F4V B;  5DIT A;  2UXC B;  5L3C A;  4X66 B;  2HLD G;  4CS3 A;  1NTK H;  2ZE8 A;  4N23 A;  3ZHV A;  1E1Q G;  3CH9 A;  4LCU C;  2OIG A;  4FLX A;  3WD4 A;  5LA6 A;  4S3J A;  4XAK A;  3H1L H;  3CCJ V;  4DR6 O;  2L6L A;  5LHI A;  4O4I A;  2ZQU A;  1GMG A;  2EZO A;  3ZMZ A;  3BAA A;  1YTF B;  1SQF A;  4LC1 A;  2HKO A;  1HR0 B;  1EN5 A;  4DWS B;  2DMX A;  2H94 A;  5B1O A;  2LQT A;  4GKK O;  4KUM A;  4NYK A;  3ZHR A;  1EDQ A;  2XAF A;  4I0X B;  3RYI A;  2AZ0 A;  3RM9 A;  1ZU8 A;  4QE7 A;  4KR0 B;  1VF6 A;  3ARY A;  3QO8 A;  4YHH O;  5IYD O;  1SER A;  1GN4 A;  4IYH A;  4TNS A;  2MPH A;  1PV0 A;  3KAC A;  4YIO A;  2RN9 A;  1RPR A;  3TCU A;  4PEL A;  2WLY A;  4GCZ A;  4Q6G A;  3ASN B;  4LF6 B;  1KBH A;  1YJ9 V;  5IDJ A;  1EIB A;  3CGN A;  1XNR B;  3W7X A;  3T2M A;  3U0Z A;  1HNZ O;  4MTG A;  4K8Z A;  2LO1 A;  3ETG A;  4A5U B;  3OMI B;  2LJ4 A;  4ZOL A;  2PYL A;  3CCE V;  4JI5 B;  4JI7 B;  2YEV B;  3NXS A;  1GK9 A;  2ATK C;  4MW8 A;  2BE3 A;  2OCH A;  2G8Z A;  2Y69 B;  3RBZ A;  4ODL A;  4Z2J A;  5J6E A;  1TUB A;  4JI2 O;  2C2A A;  3LSS A;  4N19 A;  1MAB G;  2Y0P A;  4X1K A;  1FKF A;  3MDY B;  5JVD B;  1YJW V;  3PR9 A;  4Z2G A;  1KB9 F;  5JCO C;  4HNA B;  4UXN A;  1S5H C;  1PM9 A;  1NH6 A;  1E9L A;  2X0L A;  1VAR A;  1RM1 B;  2R70 A;  4DR2 O;  4QPK A;  3WKZ A;  5L3B A;  5LGT A;  1W9P A;  1JFF A;  1PL0 A;  5J2U B;  1WA8 A;  1F4M A;  1X6N A;  4CH6 A;  4HAM A;  1FJG B;  3AK1 A;  1WP8 A;  3O5K A;  1LG2 A;  4AY1 A;  3N2K A;  3ZED A;  3O9O A;  3AQU A;  3JAT A;  4BW5 A;  4ZBM A;  3JYJ A;  4IIJ A;  4RUE A;  4WFB V;  4KHP O;  5BR8 B;  2JGU A;  5GW7 A;  4WFF A;  5H6Q A;  3NTP A;  4ICG A;  1OCO C;  3ZHU A;  3WG7 C;  4FZ1 A;  2Z0A A;  4KL1 A;  4LF7 O;  5LHG A;  2ZDI C;  3JAS B;  1H8H G;  4DV1 O;  2RSE A;  3FB6 C;  5KA5 A;  4X1I A;  1DTO A;  3B9D A;  2CH7 A;  4DRN A;  2DYS B;  3ZMV A;  4JV5 B;  4DR6 B;  1HKJ A;  4X65 O;  4UV8 A;  1V54 B;  1GAX A;  3UO3 A;  4FLZ A;  2ZT9 B;  1YTF D;  3L74 H;  2EZP A;  1PKX A;  3AG3 C;  1K9M W;  3O5P A;  1SC5 B;  4JYB A;  4DWS D;  4LFC O;  3IHZ A;  2B5U B;  1G6U A;  4CBC A;  1E79 G;  1YF2 A;  4GKK B;  4NTX A;  4F4L A;  3K5L A;  2A3C A;  3OUS A;  1Y74 B;  2PY5 A;  4LNU B;  3K03 A;  4H33 A;  1NKD A;  3JAW B;  4YHH B;  3FD9 A;  4GGQ A;  4E2L A;  4J4N A;  5LXT A;  1AI6 A;  1B3Q A;  5EYP B;  1CXZ B;  3LDC A;  1L8D A;  2JK5 C;  4I4T B;  1OZ0 A;  4CH4 A;  1YAT A;  3P32 A;  3L70 H;  2EIM B;  1EZV H;  4X9Q A;  4MSW C;  4TUY B;  5IY5 B;  2H3O A;  1HNZ B;  2VN1 A;  2JEX A;  3SYQ A;  4U85 A;  3K3W A;  1LG1 A;  3SJQ C;  3TET A;  3KAG A;  4UFZ A;  5ITZ A;  3OOB A;  4LAX A;  4GX1 A;  2E76 B;  3ZRV A;  4XDL A;  1WJZ A;  1FPO A;  3ZMU A;  2FKE A;  3FKS G;  1JNS A;  3HKE A;  4O4J B;  2V1D A;  3SYP A;  4OX9 O;  1QLN A;  2ZE5 A;  2N74 A;  2P67 A;  4TT3 G;  4JI2 B;  2O57 A;  4LR3 A;  2LP7 A;  4DR5 O;  4AQY O;  1K5Q A;  2F95 B;  1ZK6 A;  3SPI A;  2LGQ A;  4EKW A;  2RUD A;  1KP3 A;  2LPV A;  3RGB A;  3A2F A;  1HWY A;  1VQO V;  2P4V A;  2ZE7 A;  5FNV B;  4F6R B;  4WFA V;  4DR2 B;  1FKG A;  1FAP A;  2WLJ A;  4X88 A;  4ZI7 A;  3MHH C;  3Q4H A;  2F66 C;  5LOV B;  3D3Q A;  3KAD A;  1N33 B;  3G67 A;  4R7C A;  2PPN A;  2WLL B;  1UJW B;  3IC7 A;  3QOK A;  2M6Y A;  4OGQ B;  3O65 A;  4KHP B;  1M5I A;  2ILM A;  3HKC A;  4O2B B;  1NWT A;  2Q5Z A;  3H1K H;  4IHJ B;  3AEI A;  4WJX A;  2RMK B;  3CXC U;  1U96 A;  2F23 A;  3ZMS A;  1WB8 A;  4LF7 B;  4ML4 A;  2QM4 A;  3ZRS A;  1HJX A;  1SZX A;  3AG1 B;  3HR0 A;  5CA3 A;  1FKR A;  1Q86 W;  3G6L A;  3JD4 A;  1E1R G;  2QKS A;  2FDM A;  4KP4 A;  1QPL A;  1LUW A;  3CS5 A;  2ZD9 A;  3ARV A;  1OJH A;  4X65 B;  5DIV A;  4JAS A;  3JYM A;  3A0R A;  3SPC A;  2UXD O;  2IJK A;  4LFC B;  5B8I C;  1A32 A;  4K35 A;  2EIK B;  4BWA A;  3HKB A;  2RJZ A;  5HW6 A;  1J4I A;  3K5N A;  4QE9 A;  5KLV H;  3SGI A;  1KKD A;  1OCC B;  1IDS A;  2UUB O;  2WK2 A;  4JFM A;  4RO2 A;  1R1B A;  1FFR A;  3HB3 B;  1CEZ A;  1ROU A;  5EZY B;  4TOI A;  4J4O A;  4I55 B;  2GHY A;  3X2Q C;  1HJW A;  3WD2 A;  4I50 A;  3K06 A;  1V55 B;  1M93 A;  4DV2 O;  1GPF A;  5L3G A;  4MNK A;  4J10 A;  1HNW O;  3EIP A;  2UZ5 A;  1EYM A;  3P30 A;  3T1H O;  4JI0 O;  4I9W A;  2N04 A;  3K08 A;  5KAF Z;  3VOU A;  1YI2 V;  1YIT V;  1O9H A;  3BEH A;  3T4D A;  1VP7 A;  2HFE C;  1IBL O;  1R73 A;  2IJJ A;  1Q82 W;  1KYO F;  4DV7 O;  2NNU A;  1NI8 A;  4OX9 B;  2DWD C;  1S72 V;  2RQS A;  4JTC B;  4J7K A;  3QTC A;  3U11 A;  1XDC A;  3ABM B;  4AQY B;  3G80 A;  4DR5 B;  2ZNJ A;  5EC1 C;  3L73 H;  1OCZ B;  2VWK A;  4U3J B;  3ABT A;  1O6I A;  3RFR A;  1D5A A;  3SJA C;  3CB2 A;  1AR5 A;  3ZRW B;  2ZXW B;  2KG7 A;  1NS1 A;  4U84 A;  2LJ2 A;  3E89 A;  3ZX6 A;  1Q3E A;  4DV6 O;  3JCZ A;  2UXB O;  5JH8 A;  2K1E A;  4NZC A;  2CTQ A;  1CTN A;  1SA0 A;  3BAB A;  3KZ7 A;  1E6Z A;  5LMU O;  4LF9 O;  5FPR A;  5JWP A;  2DYR B;  1GO3 F;  5HT1 A;  1XHX A;  1I0H A;  2EJR A;  4DWS C;  4Z1M G;  2UU9 O;  2ZQT A;  2HP8 A;  1QVF U;  4NXM O;  1KT0 A;  2JGD B;  1AVM A;  3R66 A;  5KX5 A;  1US6 A;  3J81 N;  3O5G A;  5DN6 G;  3IK8 A;  1PL4 A;  5IT9 N;  3I5D A;  4GUN A;  2ZR4 A;  1GM7 A;  1Q1C A;  3BY6 A;  3CHC A;  5K1P A;  4UCU A;  4JI1 O;  3ASN C;  1K4C C;  3RYC A;  2JIZ G;  1JX9 A;  2XPA A;  1WPB A;  2G38 A;  4PDV A;  3K5O A;  4PA6 A;  2PV2 A;  2UXD B;  3ML0 A;  2DW4 A;  4DV5 O;  4CC6 A;  4P8V A;  3JAR B;  3LUO A;  5L3D A;  2E5L O;  3C90 A;  4MSP A;  1ZL8 B;  2OTJ V;  2Y69 C;  2PI5 A;  2OLH A;  1JR9 A;  3T4Z A;  1E15 A;  4B3T O;  3FAV A;  2UUB B;  1QHT A;  4MNJ A;  4PHZ A;  3UI6 A;  1I94 B;  3W7T A;  2JZV A;  3R65 A;  1VF8 A;  4DV2 B;  2AGA A;  4BIZ A;  1HNW B;  1AR1 B;  1JCH B;  2IH3 C;  5KUK A;  1FFQ A;  3UI5 A;  3U10 A;  1GM8 A;  1RM1 C;  1X4T A;  2R9A A;  4GT1 A;  3T1H B;  4JI0 B;  2GV9 A;  1IXM A;  3MAQ A;  1HNX O;  2A3A A;  4WKF A;  4XDJ A;  2ZIO A;  2KO7 A;  1KMI Z;  2Q7E A;  3ARR A;  2BCC H;  4DV7 B;  1P5Q A;  2RCV A;  4UB6 Z;  1F40 A;  1E6N A;  2BTO A;  2IBZ H;  3TGU H;  2ZKO A;  2W0X A;  4R50 A;  4DR3 O;  3J80 N;  2NR5 A;  1OGG A;  2K8I A;  1DLB A;  4Z2W A;  4LF6 O;  2ZNI A;  4GLX A;  1ZBK A;  1ZBC A;  3L75 H;  1XOU A;  3UCS C;  3NRK A;  5HTG A;  3NR7 A;  4BIU A;  4D7S A;  2YIA A;  2QKC A;  2EIJ B;  2XND G;  4L87 A;  2IU0 A;  1UPG A;  4UV9 A;  3JSN A;  4JYS A;  3DXR A;  4DV6 B;  2UXB B;  4X20 A;  3KAI A;  2QWO B;  2PBC A;  1LL6 A;  4I5S A;  2DYS C;  3UT5 A;  2X6C A;  5LMU B;  4LF9 B;  3ZCC A;  1V54 C;  4KFM A;  3PN1 A;  1XRV A;  1I7F A;  5FL7 G;  3EHB B;  1DK1 A;  2UU9 B;  4NVP A;  1T5E A;  2NN4 A;  1K92 A;  4PA4 A;  3T1Y O;  4R8C A;  4QPJ A;  5D5P A;  4YJ2 A;  4NXM B;  3LDE A;  2FYU H;  5LGN A;  1WB7 A;  1EM1 A;  1MSW D;  1HW7 A;  4KQZ A;  1NTZ H;  3DC5 A;  3JD0 A;  3J7A U;  1L1P A;  1H2S B;  1NH2 B;  2QKA A;  1HDJ A;  3CCQ V;  1XHZ A;  1W9U A;  2Q6A A;  1B04 A;  2WLI A;  4D7T A;  5IJ9 A;  3WB0 A;  3VQW A;  2NLJ C;  4JI1 B;  5HW7 A;  4LH6 A;  1ZX3 A;  3RYH A;  3IKD A;  2EIM C;  1M90 W;  4B08 A;  4B3R O;  5IY5 C;  3CJH A;  3O5Q A;  4JYA O;  4PJ0 Z;  4WKA A;  2M08 A;  2ZQS A;  1I5X A;  4FIP C;  3JAK A;  2AHY A;  5LA6 B;  1B6C A;  3WQW A;  3K9S A;  1W2B U;  2ZCE A;  4N21 A;  4OPH A;  2VWJ A;  4DV4 O;  3B8M A;  1MSD A;  1D7I A;  2E5L B;  4O4I B;  4DRI A;  2KI3 A;  4BIO A;  4B3T B;  3TK1 A;  5TIS Z;  3BA8 A;  2UXX A;  2DQ0 A;  3RYF A;  2QWP B;  1BGY H;  1ROP A;  1E6P A;  4DRO A;  3ZBH A;  3G6M A;  4JV5 O;  4MVO A;  3RYI B;  3H1I H;  4DRX A;  1N8R W;  2B1I A;  2XAG A;  4HBE A;  1XHG A;  1IZ3 A;  2PV1 A;  2KR7 A;  1BMF G;  3A8T A;  3K59 A;  1HNX B;  1EBO A;  2RNB A;  3BCC H;  2A3B A;  1R3J C;  4MS2 A;  3I56 V;  4DV0 O;  2WAM A;  3B8N A;  3ARW A;  1NQT A;  1ENV A;  1Q6U A;  2BTQ A;  2YUA A;  1YEW A;  4ZIB A;  3WB1 A;  2DT0 A;  2CDY A;  4Q20 A;  4JPR A;  4DR3 B;  3G4S V;  3TCZ A;  1MOF A;  1W0J G;  4ZOL B;  3H01 A;  3OE7 G;  4CS4 A;  3CC7 V;  1FKJ A;  2OIE A;  4P8U A;  2QSA A;  4PA7 A;  3CHX A;  4L8J A;  2P7T C;  2PPO A;  1WPX A;  1YXB A;  4ODO A;  1H0I A;  4O2A A;  2OTL V;  1TUB B;  3AG1 C;  3ALG A;  3OW2 U;  4UB8 Z;  2ETN A;  3AS0 A;  4X1K B;  4P9P A;  4X8A A;  1YJN V;  1THZ A;  4ZHQ A;  5D5Q A;  2P6J A;  4B3S O;  4TX0 A;  1Y0O A;  4Q22 A;  1ZTE A;  1FXK A;  3C3T A;  1XMQ O;  2AW9 A;  1F4N A;  4MT8 A;  3CYO A;  2Q7G A;  1JFF B;  3T1Y B;  2N87 A;  4PDL A;  1K73 W;  1WA8 B;  2EIK C;  3CCS V;  2KB1 A;  2YBU A;  4NXN B;  3N2K B;  3SPJ A;  3JAT B;  1Y67 A;  3D36 A;  1NH2 D;  1D7J A;  3H9R B;  1OCC C;  3LSQ A;  5FLX N;  2PF4 E;  4IIJ B;  4PV1 B;  3E8H A;  2AWG A;  2JRI A;  5BMV A;  2P5O A;  4DH0 A;  1VQ7 V;  1LJY A;  3KCY A;  2IH1 C;  3CME V;  3KG2 A;  1N33 O;  1V55 C;  3CRA A;  3TC5 A;  5JH7 A;  1QU7 A;  3RT3 C;  4B3R B;  1PNL A; 
#chains in the Genus database with same CATH homology
 1NWT A;  4W5U A;  1ZBW A;  4G50 A;  4WJX A;  2XP7 A;  1FKI A;  3O5F A;  3KCE A;  4ZS6 A;  3KAF A;  1HKI A;  4ML4 A;  4WIW A;  1HJX A;  1J6Y A;  4TW8 A;  3KAH A;  4MPK A;  1FKR A;  3G6L A;  4DZ2 A;  2FDM A;  3PA7 A;  3WQV A;  1QPL A;  2DT1 A;  4DRP A;  1RD6 A;  4DRK A;  1WB0 A;  2F2D A;  3ARV A;  4JFI A;  2OFN A;  4Z2L A;  1KFW A;  5DIV A;  3JYM A;  3AS1 A;  1E6R A;  2RUR A;  3RM8 A;  1D6O A;  1N1A A;  1F8A B;  2MF9 A;  4DRQ A;  5B8I C;  3WH0 A;  1A7X A;  4NNR A;  4DT4 A;  5DO2 A;  5HW6 A;  1J4I A;  1QPF A;  5D75 A;  2WK2 A;  4JFM A;  1FFR A;  4ODK A;  1ROU A;  4WK9 A;  1OGB A;  4J4O A;  1HJW A;  3WD2 A;  5GQB A;  2WM0 A;  1GPF A;  4HAR A;  4MNK A;  3UQI A;  1PIN A;  1IX5 A;  1H0G A;  2UZ5 A;  1EYM A;  1J4H A;  4JFL A;  3W4R A;  1ZL1 A;  4ODQ A;  3WD1 A;  1ZB5 A;  1NWR A;  1FKT A;  4IPX A;  2DSZ A;  4C02 B;  1ZBV A;  2KE0 A;  3O5M A;  3ODK A;  4DWS A;  3TDB A;  4JFK A;  1FKL A;  3IKG A;  4Z2K A;  2RQS A;  3O5O A;  3ARS A;  1HKK A;  4IT4 A;  3PRD A;  2DT3 A;  1ITX A;  1O6I A;  3RM4 A;  4QZV B;  2VCD A;  1W9V A;  4LGX A;  1HJV A;  1NMV A;  4U84 A;  5GPR A;  3O5I A;  4ODP A;  1W1T A;  3B09 A;  3RGC A;  5JH8 A;  4NZC A;  1D2K A;  1Q6H A;  1CTN A;  3KZ7 A;  1E6Z A;  4WKH A;  2F4E A;  1FD9 A;  3ARZ A;  5HT1 A;  4MAV A;  1J4R A;  1X6L A;  2O92 A;  4DWS C;  2ZQT A;  3ARQ A;  3FY1 A;  5HKG A;  4DRH A;  1KT0 A;  2DPE A;  3UQA A;  2MNT A;  3O5G A;  3IK8 A;  2ZQV A;  3WD0 A;  2XP4 A;  2ZR4 A;  3CHF A;  1Q1C A;  1Q6I A;  3CHC A;  4ZPW R;  2DSW A;  4MGV A;  4FAP A;  1K9T A;  5BXJ A;  2O9O A;  4DRM A;  2XPA A;  5HUA A;  1LL4 A;  2PV2 A;  4L3N A;  1JND A;  2MLX A;  3FXY A;  1GOI A;  3O5R A;  1KT1 A;  2FAP A;  2ZR6 A;  3RME A;  1W1V A;  3CHE A;  3CZ8 A;  1JNE A;  3B7X A;  4P8V A;  5DIT A;  1EHN A;  2KGJ A;  4HBO A;  3LUO A;  4MSP A;  5DF0 A;  2OLH A;  1TFV A;  1E15 A;  3CH9 A;  3WD4 A;  4S3J A;  4U86 A;  1JNT A;  1FKH A;  4XAK A;  2MLZ A;  4MNJ A;  4O2T A;  3UI6 A;  1JVW A;  1GUV A;  3AS3 A;  3RFW A;  2JZV A;  2ZQU A;  1VF8 A;  5I98 A;  2DSV A;  4TYO A;  3UF8 A;  1NWU A;  1FFQ A;  3UI5 A;  5HBF A;  4DWS B;  3O5J A;  2A3A A;  4WKF A;  4ZPV R;  2LGO A;  2KO7 A;  3ARX A;  1EDQ A;  5HWB A;  4ODM A;  4QT2 A;  1W1P A;  3ARR A;  4ITZ A;  3RM9 A;  1ZU8 A;  4KR0 B;  1P5Q A;  3ARY A;  1OWQ A;  4R0X A;  3WD3 A;  4FN2 A;  4TNS A;  2KFW A;  1F40 A;  2MPH A;  3CGM A;  1E6N A;  3GPK A;  3KAC A;  4LAY A;  2WLY A;  1HKM A;  4IQ2 A;  1NMW A;  1OGG A;  1U79 A;  2K8I A;  4JFJ A;  3WIJ A;  1EIB A;  3CGN A;  4W9Q A;  1ZBK A;  1SYT A;  1ZBC A;  4TW7 A;  3CHD A;  3NRK A;  5HTG A;  1HXV A;  4URI A;  2XP9 A;  1LL7 A;  2LJ4 A;  4JYS A;  2ESC A;  1FKD A;  3KAI A;  1PBK A;  3PRA A;  2RUC A;  1WAW A;  2PI6 A;  2PBC A;  1LL6 A;  2PV3 A;  2XPB A;  3O5D A;  2G8Z A;  4ODL A;  4Z2J A;  5J6E A;  4IQC A;  2Y78 A;  2XP3 A;  4QT3 A;  1D7H A;  1FKK A;  4MTV A;  1XRV A;  4N19 A;  1BKF A;  2YBT A;  1FKF A;  4G2P A;  1FJD A;  3MDY B;  4ZPT R;  4Z2G A;  3PR9 A;  2B31 A;  3WL0 A;  2DG9 A;  4Q7N A;  1NH6 A;  3O5L A;  1E9L A;  1TCO C;  4KQZ A;  2A3E A;  2MLY A;  1L1P A;  3WKZ A;  4P8W A;  4P8X A;  4BF8 A;  1W9U A;  4S3K A;  1W9P A;  4Z2I A;  4R5E A;  2IF4 A;  4Z2H A;  1X6N A;  3UQB A;  5HW7 A;  1FKS A;  4LAW A;  3O5K A;  1LG2 A;  4GIV A;  4AY1 A;  3IKD A;  3AQU A;  4MNL A;  3JYJ A;  3ARU A;  3O5Q A;  4W9O A;  4WKA A;  2M08 A;  2ZQS A;  3NTP A;  3BXW A;  1B6C A;  2RUQ A;  3WQW A;  2AOS A;  2Q5A A;  2DG4 A;  3ALF A;  1D7I A;  4DRI A;  2KI3 A;  2RSE A;  1W1Y A;  3B9D A;  1C9H A;  1EQ3 A;  4DRN A;  1E6P A;  4DRO A;  1HKJ A;  3G6M A;  1ROT A;  3ART A;  3WL1 A;  4TW6 A;  3B8S A;  4HBE A;  3O5P A;  1XHG A;  4L72 B;  4DWS D;  2PV1 A;  2KR7 A;  3IHZ A;  1FKB A;  4QIB A;  2XP6 A;  3O5E A;  2WLZ A;  2A3B A;  2A3C A;  1W26 A;  3ARW A;  2D9F A;  4IT6 A;  4MNM A;  1Q6U A;  3ARO A;  1WNO A;  4GGQ A;  4J4N A;  1ZCN A;  1QZ2 A;  2DT0 A;  2QF8 A;  3I6C A;  2IUZ A;  4PTM A;  3TCZ A;  2G41 A;  1YAT A;  3ARP A;  3B9E A;  2PPP A;  1FKJ A;  4P8U A;  2VN1 A;  1LQ0 A;  3AS2 A;  2PPO A;  2DSU A;  3B9A A;  2L2S A;  4U85 A;  4ODO A;  1H0I A;  1LG1 A;  3ALG A;  4DIP A;  2M1I A;  3KAG A;  2XP8 A;  3AS0 A;  3PRB A;  3OOB A;  1SR0 A;  4LAX A;  2DG3 A;  1NWS A;  4ODN A;  2FKE A;  2ITK A;  5GPG A;  1JNS A;  4TX0 A;  1Y0O A;  4Q22 A;  3UI4 A;  3EY6 A;  3JXV A;  4ODR A;  2XP5 A;  1ZK6 A;  2M2A A;  2RUD A;  2LPV A;  3KAB A;  2LKN A;  5HW8 A;  2N87 A;  1M5Y A;  4W9P A;  3FAP A;  1YW5 A;  1BL4 A;  2YBU A;  5DIU A;  4DRJ A;  1UR8 A;  1FKG A;  1FAP A;  1D7J A;  3H9R B;  1T11 A;  5HWC A;  3KAD A;  2AWG A;  3NI6 A;  4DH0 A;  4LAV A;  1LJY A;  2PPN A;  1NSG A;  3QOK A;  5DEZ A;  3VAW A;  3TC5 A;  4NSB A;  2ZR5 A;  1UR9 A;  2DT2 A;  2F21 A;  3OA5 A;  4DZ3 A;  1R9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...