1FD9A

Crystal structure of the macrophage infectivity potentiator protein (mip) a major virulence factor from legionella pneumophila
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
204
structure length
204
Chain Sequence
TDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PROTEIN (MACROPHAGE INFECTIVITY POTENTIATOR PROTEIN)
publication title Crystal structure of Mip, a prolylisomerase from Legionella pneumophila
pubmed doi rcsb
source organism Legionella pneumophila
total genus 64
structure length 204
sequence length 204
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1fd9A02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fd9A01
3UQIA 2RUQA 1FKFA 3KACA 2DG4A 3LUOA 1FKIA 4U84A 5GPGA 3UI4A 5HW8A 1P5QA 3KADA 2ZQTA 3B09A 2M1IA 4TW6A 1F8AB 1FKDA 5HWCA 2M08A 3RGCA 1PBKA 1TCOC 2PV3A 2VN1A 2MNTA 2M2AA 2Y78A 3KABA 2XP5A 2DG3A 4LAYA 4DRPA 2LPVA 2RURA 4W9QA 1EYMA 1NMWA 2KI3A 4TX0A 2MLXA 3TDBA 4ODRA 4TW7A 4C02B 4GIVA 4DRMA 1D7IA 2MLZA 2XP6A 3IK8A 3B7XA 1NMVA 1FJDA 2F2DA 4DRNA 2FAPA 1D6OA 4JFIA 1Q1CA 3O5PA 4DRJA 3O5QA 1YW5A 2F4EA 4LAWA 1C9HA 5HTGA 4JFKA 4FAPA 2RSEA 4NNRA 3NI6A 1U79A 2PV2A 4ODLA 2AWGA 3TC5A 4DZ3A 5HWBA 1YATA 3O5DA 3JYJA 1ROTA 4FN2A 2KGJA 3IHZA 1J6YA 1EQ3A 1A7XA 4DRHA 3WH0A 3PRDA 1FKTA 1JNTA 2F21A 2Q5AA 3JYMA 2XP7A 4JYSA 4QT3A 2UZ5A 3EY6A 1PINA 1FD9A 2PPOA 1J4RA 4R0XA 2VCDA 4U85A 4DRIA 3KAGA 5HUAA 2PPNA 5DIUA 5B8IC 4IQ2A 3UQAA 1FKRA 3O5LA 2MF9A 2ZQUA 4MGVA 4TYOA 3NTPA 4DRQA 3O5FA 3O5GA 3O5KA 3OOBA 1HXVA 2MLYA 1BL4A 1KT1A 4QIBA 4DRKA 4LAXA 2MPHA 4DIPA 1KT0A 4G2PA 5I98A 1FKLA 2KFWA 2PBCA 3O5MA 1D7HA 3RFWA 2XPBA 1L1PA 1FKBA 4G50A 4J4OA 4IPXA 1QPFA 4ODKA 1M5YA 4IQCA 4TNSA 1B6CA 5BXJA 4ODPA 1JVWA 2XP9A 5HW6A 3GPKA 4U86A 4J4NA 2D9FA 1JNSA 1Q6UA 2IF4A 4DZ2A 3O5IA 1FKSA 1NSGA 3O5EA 5DIVA 2KE0A 2RUDA 1FKJA 2OFNA 4JFMA 2LGOA 1FKKA 1FAPA 2LJ4A 3O5OA 1BKFA 1R9HA 1W26A 2JZVA 2LKNA 2ZQSA 2ZR6A 1Q6HA 2ZQVA 4O2TA 4DROA 5DITA 2RUCA 4W9OA 3KAFA 1ZCNA 2XPAA 2N87A 3H9RB 4DH0A 1QZ2A 4ODOA 2PV1A 2RQSA 3ODKA 3VAWA 3FAPA 1D7JA 2ZR4A 1J4IA 2K8IA 3I6CA 3TCZA 4ODQA 3UI5A 2KO7A 2L2SA 3MDYB 3IKDA 3IKGA 1ROUA 4ITZA 2XP8A 4JFJA 5HKGA 2KR7A 2DG9A 3KAHA 3PA7A 2ZR5A 3CGMA 3PRBA 4JFLA 3NRKA 1FKHA 1QPLA 1FKGA 3O5RA 3JXVA 1ZK6A 4MSPA 3KCEA 3UQBA 3UI6A 5D75A 3O5JA 4W9PA 5HT1A 3UF8A 5HW7A 2PPPA 3CGNA 1F40A 2XP3A 5J6EA 4GGQA 4BF8A 1Y0OA 4TW8A 4DT4A 4N19A 2XP4A 3KZ7A 4ODMA 1Q6IA 2FKEA 4ODNA 1J4HA 3KAIA 4QT2A 1T11A 4LAVA 1N1AA 2ITKA
chains in the Genus database with same CATH superfamily
1QU7A 4MVSA 3MHHC 3A8TA 5KX5B 3KADA 5LGUA 5A9GA 1R6KA 4LF4O 4I0XB 4FM1A 4WFFA 5IYDO 4ZI7B 1HKIA 3ARTA 3WG7C 2YEVA 3JAWB 4X1YA 2D3OW 4ODRA 4DRMA 4B08A 1XOUA 2F2DA 4GKJB 3AG4C 1L0LH 3CMEV 3T1HO 1YF2A 4DV7O 4LNUB 1UR8A 1QQCA 1N36O 2UUCO 3JYJA 5CBFA 5DN6G 1FXKB 2F21A 4OX9B 4UVCA 2VQEO 3FYIB 1E6RA 2P4VA 2QEXV 1H2LA 3EXAA 3U0ZA 1Q3EA 3FB8C 2DSVA 1XMOB 4O4IB 1D7HA 3RFWA 3ARUA 1IVSA 1WB0A 3RBZA 4UCUA 3CRQA 3H01A 1JVWA 5HW6A 5C8YA 2DYRB 4YIPA 2D9FA 3F7YC 3VQYA 3LDCA 1PNLA 4Z1VA 2RQ6A 1JX9A 1HNWB 4DYLA 1VF5B 1WAZA 4IIJB 5KHHA 1KP3A 3I56V 3EFFK 1U97A 2ZR6A 2HFEC 4O2TA 2Q7EA 4YJ3B 1W1VA 2B5UB 1QZ2A 2LW7A 1W0JG 4JAVA 1TVKB 2YBTA 2WPDG 4MVUA 4ITZA 4O2AB 1PKXA 1ZL8A 2VRZA 4K0KB 4GZRB 4JGSA 1YJNV 1E1QG 5K1XA 4JI7O 1KKDA 1VQMV 5EBMC 2W6IG 1GTOA 1OCRB 1H2KA 2FTKA 4N19A 1IX5A 1NVPD 2QWOB 4EB6B 2Q6AA 3VQVA 4WCEV 2HKOA 4JV5B 2DYSB 2KSDA 4MNJA 3QOKA 2ESCA 1M1KW 3KACA 3BA8A 1P5QA 3L75H 2ZQTA 3B09A 3FAVB 3FYEB 2LQTA 1FJGO 1E44A 3UM7A 1RPRA 1WNOA 4MNKA 1W2BU 1Z5VA 1VQKV 1BCCH 2KI3A 4HBNA 2CTQA 5BMVB 4O2BB 3B7XA 3KZIZ 1W9PA 2LFRA 3CEIA 2QM7A 1Q1CA 1QR8A 2V4DA 1FFRA 4ODLA 2UXDO 4GKKO 3RVZA 2HVKC 3ZS8C 3GVMA 3G71V 2Q5AA 5CA0A 1HNZO 4K8XA 5GQBA 3N2GB 5FLXN 4PA3A 3TK1A 4DRIA 4JI3B 2OCCC 1P49A 3H9VA 1IBKB 1FPOA 3E8BA 1Z2GA 5LMUO 3OEHG 5H6RA 5LBQA 1WA8B 3EIPA 3SYAA 1IX9A 4IPXA 1R73A 1JCHB 3ZCCA 1XDCA 4DWSA 3RYCB 4GLXA 4LF9O 1V54B 1JNSA 3CMAV 3QF7A 3RYFB 5IJ9B 2W0FC 5KMGA 2ZR3A 3FD9A 2DMXA 4OPHA 4QPJA 4GX2A 4E4EA 2QWPB 2FL4A 4JI1B 5DM6V 5E1AC 3ZRWB 3H1HH 2BTQA 4U3FH 1H8EG 3RYIB 2ZE8A 2EIKC 1BGYH 3S3WA 3PA7A 2EINC 3P3PA 5CB4B 4WFAV 1IBMO 2PPPA 4MPKA 1YITV 4GGQA 2A9HA 3ZMUA 4HNAB 3ZHSA 1HJWA 1VF6C 2GBOA 4LAVA 3UT5B 4IHJB 1N32O 1XHZA 5JQGA 1SA0A 3T1YO 5HBFA 4QE9A 5KHJA 4DWSC 2M08A 1N34B 1FFXA 4PHZA 2EJ7A 5KUMA 3QVNA 1TCOC 2QKCA 2PV3A 4YHHO 3W4RA 2Q4PA 1QLNA 1NMWA 4GIVA 5HFLA 2ZKOA 1QVFU 1FKAO 3W7TA 4BAYA 2QKSA 4TV9A 4AILC 1MNGA 3OGCC 2RSEA 4NNRA 4Q20A 4DZ3A 3AS2A 2A3EA 1A7XA 4DRHA 4DV5O 2EIJB 3G6BA 2F93B 1RM1C 2IUZA 4F4LA 3ZEDA 2IU3A 2WLIA 2XAHA 1NTKH 4IQ2A 4TYOA 1MMMA 5C93A 1VQ5V 4FVMA 2KFWA 3HKCA 3F5WC 3SJQC 3AG3C 5JVDA 1F7YA 5IJ0A 1YCIA 4PA7A 1H0GA 3QO7A 4UCVA 4Z2WA 2IF4A 2IM9A 3B77A 2ZXWB 3BMBA 2WLYA 1ROPA 2PTMA 2LGOA 1FAPA 2ETNA 3K08A 2LKNA 4QGPA 1VMGA 3UQ8A 1N33O 1BMFG 1VP7A 5CA1B 2XAQA 2A7WA 1I94B 4MTOA 3K5NA 1KYOF 2HHHO 2K8IA 4J80A 3K5MA 3IJ4A 1TUBB 4QIWF 1FKHA 2E75B 2CGNA 2ZD9A 1GN6A 3UF8A 3T4DA 2LP7A 1EIBA 4AQYB 2AOSA 4DRXB 1R3KC 2DWEC 1JNDA 1R3JC 3WB0A 1YEWA 2O92A 2E74B 1SKVA 2GUZA 1XL4A 5EZYA 1FKIA 2ZQMA 1MG1A 4ZBMA 1Q5OA 1XUQA 1OJHA 3H1KH 4TW6A 1CEZA 5HWCA 1N4CA 4GKJO 5L3GA 2E5LB 4DUYB 2MNTA 2Y78A 1NH2D 1VARA 4ZKIA 2YSUB 1VF8A 4IT5A 4U3JA 2P5OA 3ZRVA 4UUJC 1IXBA 2XP6A 3OGIB 4MAVA 1I0HA 1Y74A 4PD4F 4PJ0Z 4OX9O 2EBOA 1NWTA 4PDVA 5BZBA 1MOFA 5AG2A 4I55A 3AG4B 4DV6B 2IJJA 3TC5A 2BOBC 2XAGA 5GTIZ 3WD3A 5GONA 1ROTA 1CXZB 3WH0A 3PRDA 2B1GA 4TWKA 4JTCB 2AZ2A 1XMOO 1PINA 1VQ8V 1BS3A 2P7TC 5HUAA 4MSWC 3WL1A 1JPXA 2ZQUA 1RSOA 4PDMA 4ZHQB 2RNBA 3O5KA 3SPGA 1GUVA 4JI8B 1BL4A 1ZUQA 4LAXA 5A2QN 2PBCA 1B6QA 4H0LB 2XPBA 4P8VA 3J81N 1JFFA 1KFWA 3HPLC 4CZZA 1HNWO 4B3MB 3JSNA 1DLBA 4L8JA 4FJCC 5LXTA 1RPOA 2GDSA 1NBMG 1HKMA 4NR1A 2N05A 1F23A 2DWDC 4JZ2A 4K35A 1RFYA 3CCJV 2IH3C 1VQOV 1I5XA 4X1IA 5IYZB 4X89A 1MABG 1HNZB 2R72A 2UU9B 3KAFA 2XPAA 2XUMA 3ZRSA 4H13B 4DV1B 4K0KO 2Q0OC 2RQSA 4JI6B 3TCZA 2KG7A 1M4UA 3UI5A 2L2SA 3IKGA 5ITZB 2G41A 4LGXA 2CUGA 3Q4HA 1FKGA 2XAJA 3K3WA 1YIJV 2DSZA 2ZCEA 4JV5O 4UCSA 4FLUA 4HARA 1VQPV 3OTFA 3CHXA 1N0NA 2R9AA 4FLTA 1NI8A 2XP3A 1N0JA 3ZHQA 2L35A 4X64O 3VQXA 1WB8A 4GX1A 3L9DA 4QT2A 4DR2B 4UCOA 2HLDG 3UQIA 2RUQA 4XDKA 5GPGA 3K0GA 1SESA 2P22C 3CRAA 1MA1A 2QA4V 2BSKB 3CCQV 2N04A 4LAYA 1K73W 3STZC 3JD3A 3MDSA 1S5JA 4C02B 4LCUC 2MLZA 3OA5A 3PN1A 3FY1A 5BY1A 3O5PA 2ITDC 4G28B 1ZBCA 5HTGA 2E76B 3HKBA 2Q9LA 3T2MA 2YXYA 1KP2A 4JI3O 3S3XA 5HWBA 1H0IA 3QO8A 4NSBA 1IBKO 1O9HA 1VEWA 4FPPA 1I5YA 2Q5ZA 2UZ5A 1TUEB 4FZ1A 2MW2B 2DQ0A 4CS2A 2PPNA 3ZN0A 4IT4A 2MF9A 2ADQB 4HBEA 1FFQA 3SPJA 2RCVA 3OW2U 4QJFB 1M90W 4WJXA 4DIPA 5CMUA 1PPJH 2OCCB 4TV8A 1MSWD 4GX5A 5LP6A 4F6RA 1VF7A 4P30A 2XP9A 3SJBC 4B3SB 1AI7A 4DO2A 3O5EA 4JI1O 3AG1C 3CJHA 3WIJA 4FZ0A 1W9VA 3W7SA 3ARSA 2JEXA 3OE7G 4FIPC 5L3BA 5J9PC 2DT1A 1K4DC 2XAFA 1K9MW 4P2ZA 2EULA 3AG7A 3OFNG 3D8CA 4WFGA 2ODMA 3OMAB 4I4TA 4KQZA 1W59A 5KUKA 5LGTA 4LFCB 3JALA 2ZDIC 4KXRA 2EINB 5CA0B 1HJVA 1S72V 1Y0OA 3BAAA 2CGOA 3JARA 5LOVB 4DK0A 3KAIA 1I7FA 3NXSA 1R3IC 3ABLC 2EX3A 4J42A 5J2TA 4DRPA 1N1AA 4DR3B 5LP6C 4MVRA 2EIMB 1FXHA 5D5QA 5HW8A 1ZTEA 3UKMA 2EZPA 2ZIMA 4BWAA 2CTPA 3L71H 3TCUA 1F8AB 3G80A 5JH7A 3CPWU 1GRJA 4JYBA 1HKKA 2RURA 1WAWA 2N74A 3G6LA 1G1XB 4DWSB 2H94A 4PELA 5H9CA 3E2EA 1AR4A 3N2KA 4DUZB 1B06A 5KMGB 1IBLB 1D2KA 2FKXA 3FFQA 1DK1A 3KKYA 4LAWA 1H2MA 4IL6Z 2WLHA 2CH7A 2V7QG 1AJPA 1ZBWA 2PV2A 3SYQA 4UB6Z 4P8XA 4FN2A 1TA8A 1B04A 4J9YB 1H38A 2XT9A 4JAAA 2CK3G 4DR6B 3RWRD 1J4RA 4J7JA 4R0XA 1GKFA 3KAGA 4MTFA 3A2FA 1RM1B 3O5LA 2BOCC 3HKDA 3GU0A 2PYLA 3O5GA 1S5HC 2UUAB 1W1PA 4L87A 3L72H 3CZ8A 1S76D 2FYUH 3ZX6A 4ODKA 4BIOA 1IDSA 2H3OA 4IQCA 1J95A 4D6TH 4P8UA 1OCZC 2PGGA 1EM1A 5EYPA 3AS3A 3AG3B 4JTDB 1Q6UA 3DXRB 5JQGB 1SA0B 2PI4A 1I94O 4LF5B 2B1IA 3U10A 5IWAB 5LGNA 2LJ4A 3O5OA 1FFXB 1OV9A 3CP1A 1R9HA 1XMQB 2QE7G 2ZQSA 2DW4A 2ZQVA 1Q6HA 5KAIZ 4O4HB 5GPRA 4FLZA 2X7RB 2DT0A 1GN4A 4NXNO 1JVMA 3ZHRA 4LWSB 2LO1A 1YXBA 2ZR4A 4KUMA 4DXWA 1SQPH 1YDXA 4AQYO 4TV9B 3JD2A 3CXHF 2Y69C 4JFLA 4MW3A 4YY3B 3VOUA 3JXVA 3ZMVA 4OXSA 4KHPB 4NZCA 2ATKC 3BY6A 4XDLA 2JK5C 1SYTA 4MVMA 2GV9A 4BF8A 5IE9A 3K59A 3W7UA 3QG5A 4X66B 2WLIB 1AI6A 1Y76A 2EILC 4JI4B 2E5LO 2Q73A 4DUYO 4NVPA 4QZVB 2WSSG 3LUOA 3ETGA 2GHYA 1BZKA 1SZTA 3HKCB 1KQSU 1EDQA 1F4MA 5JCOA 5IJ0B 1HWYA 4BR6A 1AP6A 4LF7B 1CTNA 2LPVA 1E6NA 3CCMV 5DECA 4FK5C 2K9PA 4DV6O 1H2NA 1W1TA 3H1LH 3E83A 5B1AB 3DSQA 1U79A 4I9QA 3BXWA 4NXMB 1J6YA 1VQ6V 2LGQA 4X64B 1LL4A 1SQXH 4JI8O 4JYSA 1BL8A 4UDMA 3ZHTA 1QCEA 1Q43A 1V55C 1XREA 1K3EA 4WBNA 3ZJZA 4B3MO 1JR9A 5LYJB 2WLLA 2GSMB 1HNXB 2Y0PA 2F4VO 1BSMA 3K03A 3K5LA 4NYKA 5KAFZ 3BFRA 4HZ3A 2QWQB 4Q6GA 1YJ9V 4J7KA 2O57A 5JCOC 4W5UA 1XNRO 1EN5A 5EZYB 1E6PA 2UU9O 2KE0A 3MD0A 2IJHA 3SJAC 4DV1O 3OT7A 1JMKC 4FLWA 4JI6O 1SRYA 1LG1A 4DROA 3ARYA 1GN3A 1JNEA 3E22A 2P6JA 4W9OA 1S0VA 3O9OA 1E9LA 1AVMA 3ODKA 2OYQA 1NWRA 3B8MA 1J4IA 5L3FA 3D3IA 4H37A 1QVGU 3UQBA 3EHBB 1Y4MA 3FXYA 4DR2O 4EFEA 1U96A 4I5SA 1GM8A 4BIUA 1KD1W 4JI5B 2LFSA 4H44B 1Y67A 1Q82W 3F7VC 1J4HA 1P7BA 3QNEA 1YI2V 5KHGA 1T11A 3AK2A 4U84A 1SF9A 5JJEB 3JATA 2IJKA 3U11A 4CH4A 2M1IA 3CHCA 2HR3A 1PBKA 1JFFB 2IH1C 3SPIA 4JPRA 2M2AA 3KABA 2DG3A 4LF8B 3BCCH 4ASUG 4UB8Z 4JI2B 2R9IA 1XHXA 1RD6A 2MLXA 5LXTB 2UXNA 3WB2A 2AXTZ 2HVJC 2QDOA 3JD1A 2EIMC 1WNSA 2AHYA 4R8CA 3ALGA 4JFKA 1HJXA 3X2QB 4ZI7A 3O5DA 1EQ3A 3OD4A 3B40A 4OPAA 2ILMA 3IGAC 1YSCA 3M99B 3HB3B 1ENVA 1ZSPA 4LNUA 5TISZ 1PV0A 4PTMA 4Z1MG 2CTRA 1L0NH 2OT5A 3T1CA 1KT0A 4J41A 3O5MA 1FXKA 1O9GA 4B3SO 1TGOA 2EJRA 5LHGA 4TNSA 4J9ZB 1B6CA 3ZHUA 3GPKA 4U86A 2PF4E 4LH7A 5E79Z 3AS0A 2QM4A 3A0BZ 3RFRA 4JFMA 1VIBA 2FMLA 2ZINA 3E8FA 3SYOA 1ZBKA 2WA4A 3K9AA 4TQDA 3CCSV 4YJ2A 2YS8A 3APOA 3AG1B 3B2EE 1B3QA 4O4JA 5FNVA 1ZCNA 1AI4A 4ODOA 5KHKA 4LFCO 4L3NA 5CBGA 3QO5A 1PM9A 1ZX3A 4RUFA 2YBUA 1XEQA 2CE4A 5LA6A 1T5EA 4IIJA 4MTXA 1ZK6A 2FDMA 1NJIW 4W9PA 1NS1A 1JJ2U 1H2SB 2B5UA 3CGNA 4DR3O 3ASNC 1JJOA 2YICA 1SR0A 2R70A 3AK1A 2AHZA 1AB3A 3PRAA 1Q6IA 2WLKA 1SQBH 3A0RA 3OUFA 2OIEA 2DG4A 2P4KA 3CCEV 1BHBA 4TV8B 4F6EA 3ABLB 5LP6B 1IZ3A 4F6RB 4DUZO 1IBLO 4XAKA 1K4CC 1GH6A 3FKSG 2YI8A 2WLZA 4NXNB 1PD3A 4U7OA 4RWUA 1EYMA 2PY5A 2VWJA 1D7IA 3RYHB 4B3TB 4MVOA 4U7NA 5JJJB 3FAVA 3PJSK 4J11A 2OWOA 2OTJV 4OGQB 4TT3G 4DR6O 2VWKA 4GYCB 5LHIA 1THZA 1YJWV 4X8AA 3ICXA 1AI5A 4X1KA 2KGJA 2Z5UA 1EFRG 1AR5A 5BMVA 4GCZA 4O2BA 4KL1A 2UUAO 4LFAB 2PPOA 3J7AU 3E8HA 4I4TB 2JIZG 4QPKA 3WB1A 3NTPA 2LW1A 5B1AC 3R65A 1UPGA 1M57C 2WA3A 3JALB 1HP8A 1XNQB 1GM9A 3N2GA 1QPFA 3CS5A 4LF5O 2RN9A 2ZIOA 2YUAA 5KA6A 5IWAO 3THOA 2NNUA 1XMQO 1OCCC 5BXZA 3JAKA 3CC7V 3ML0A 1E6ZA 4FM2A 1OCZB 2JRIA 5KHIA 4DV2B 1Q81W 4UVBA 1NSGA 1K97A 2RUDA 2A0LA 3L70H 5EIBC 1BKFA 1XL6A 1LG2A 5GTHZ 1W26A 2JJ1G 2QGNA 1TFVA 3IC7A 1NWUA 2M7WA 1EZVH 3RYCA 4YY3O 2N87A 1Z5WA 2OLHA 4DWSD 3E35A 4KHPO 5EK0A 3N2KB 1YHQV 1JA8A 2KO7A 2IW5A 4NTWA 3K0DA 4WFHA 4X66O 3CCUV 2F4VB 3LSQA 3NRKA 4ZPWR 4WIWA 1XRVA 1VQNV 3K9SA 4JI4O 1IURA 1GPFA 1L8DA 3ZRWA 4W4KA 2Y69B 3CCLV 4S3KA 5CA3A 5K1PA 3OUSA 1XNRB 2YEVB 4X1YB 1X59A 3HKDB 4LF7O 5CB4A 1WLEA 2YIBD 1DTOA 4I50A 2EILB 4PA4A 5CN0A 1F4NA 1FKDA 3RGCA 4MTVA 4JASA 2X6AA 3ARQA 4W9QA 5EYPB 3CC2V 5KA5A 1SQFA 3WKZA 3UT5A 4IHJA 4YIOA 4NXMO 4ABMA 4JYAB 4X65B 4JFIA 3FX7A 3O5QA 3L73H 1H2GA 2QWRB 3D36A 1NKDA 4IT6A 1YATA 1KECA 2QWNB 4ZOLA 5B1OA 2Z3YA 1P4RA 3RM9A 3WD2A 3FB7C 3JD0A 1SETA 3VBBA 4R7CA 1HNXO 1ZBVA 4QNHB 1FKRA 1SQVH 4DR5B 2Y4TA 4B7KA 5C8YB 4JYYA 5B5EZ 1HXVA 1HW7A 2YIAA 4DR7B 4DRKA 3X2QC 2WM0A 1V55B 1YTFB 2A3QA 1FKLA 1US6A 3OM3B 2DSWA 1NH6A 2L6LA 3ZMZA 1M5YA 1Y76B 2IBZH 3OEEG 4IGGA 3MHSC 1KMIZ 2X0LA 4DZ2A 4DV0B 1W9UA 3GWOA 2UXBO 3RT3C 1ZL8B 3OR7C 3LNNA 3ARWA 4L72B 5DITA 2E3CA 1K5SA 2ZNIA 2PN0A 3WQWA 3B4SA 3D36C 3ABUA 2JGUA 3STLC 1D7JA 3CRCA 4RO2A 2JEUA 1ROUA 1A32A 2CDYA 3KAHA 2DG9A 4JI5O 3JCUZ 3ETQA 2YDEA 3RN4A 4MSPA 3UI6A 1AROP 4DV3B 2BCCH 4CH5A 1KUQA 5CA1A 3OTOB 5KLVH 1L1FA 2H8PC 2Q8VA 2YI9A 1ITXA 4K3AA 2GTSA 2PZSA 1LL7A 1TUBA 1GAXA 4WBNB 4E2LA 4MS2A 4LF8O 3LSSA 5EBLC 4C7UA 4TUYA 4JI2O 2WLLB 1KBHA 2F95B 3WD0A 4ML4A 3CC4V 1KB9F 4LC1A 1ZAUA 4DRXA 3SPHA 4LF6B 2XP5A 2NN4A 4GUNA 3ALFA 3G6EV 4Z2IA 1ZB5A 4TX0A 3IFXA 1D5NA 3JYCA 1GO3F 1NMVA 1FJDA 4NB5A 2FAPA 3ZMTA 1D6OA 2Q67A 2F23A 3DGEA 3LDEA 4N21A 4DRJA 2DN9A 5H6QA 5DF0A 1M56C 4X20A 3ZHVA 1DF5A 3CSXA 4DW0A 4LBEC 4X9QA 3E22B 5LL6Y 2O9OA 2W0XA 3E89A 4MTGA 3F5TA 4FFBA 4HAMA 3CH9A 3APQA 2ARHA 4RQFA 5LMNO 1S77D 4QIBA 1KT1A 3BRCA 2DE0X 2NR5A 1ORQC 5B3SC 5F2VO 3CX5F 2JVDA 2WLNA 4G50A 1UR9A 1SQGA 1E1RG 3SYCA 2PUSA 4J4NA 3B9AA 1D5AA 2BTQB 4CC5A 1OWQA 4LH6A 3BEHA 3RMEA 3JATB 3NR7A 4GX0A 3UO2A 1SC5B 3WL0A 2JZVA 1BQZA 1R6TA 1XILA 2UUBB 2PV1A 2Q7GA 1KC8W 3K06A 1M93A 2XTAA 5HKGA 2F43G 3C3TA 4PA9A 5IYZA 5HT1A 3ARXA 4CBCA 1HKJA 4R6ZA 5J6EA 1NZ6A 5BR8B 4JZGA 2A3CA 2CTWA 2FKEA 1GM7A 3ASNB 5ITZA 3WD1A 1FXVA 4FLYA 1IXMA 3K79A 3TJTA 3UI4A 2P90A 3KG2A 4B3RB 2ZM6O 4O4LA 4B3TO 1HR0B 1FAFA 5GW7A 3LDDA 1KU9A 4UV9A 3BA9A 3P30A 1SZXA 3ARPA 2F1MA 3LUTB 3GTYX 2JJ2G 2JGDA 1NU1H 2UXCB 3AS1A 3H1IH 2F66C 4HYOA 4LFAO 2KB1A 2BSKA 3NI6A 4IYIA 2AWGA 4YJ2B 4O4JB 5FNVB 4RUEA 4EKWA 1JNTA 2GTAA 3JYMA 5JVDB 3ZRXA 1J5EB 3EY6A 3HKEA 5IT9N 1W1YA 2IU0A 5LA6B 3OR6C 1XNQO 1S5LZ 3UQAA 2BE3A 5HFMA 4MGVA 1EZJA 1E15A 4LFBB 1NWSA 4RQEA 3OAAG 2PI6A 3CE2A 2OTLV 4DV4B 3CHEA 4LP8A 3P3NA 4DV2O 4JF3A 1M57B 2WWWA 3RGBA 2KQXA 1R6NA 4AY1A 4DW1A 3K58A 3CHFA 2DSUA 2ADPA 3ZMSA 1GK9A 2QTSA 1OCCB 3K04A 1ZU8A 1K92A 4PA6A 1EBOA 1I08A 3K57A 3UO3A 1G6UA 2QTOA 2ZNJA 3HR0A 5JJNB 4NTYA 5FPRA 3VAWA 4X88A 4ODQA 3IC9A 3AEIA 3IKDA 3H1JH 3JAMN 4Z2KA 5H5NA 2KR7A 4Q22A 1X6NA 3CGMA 3PRBA 3CRRA 5CBHA 3G6MA 4AI8A 2GUZB 3KCEA 4X1KB 3O5JA 4X62B 2JS3A 1K34A 5B66Z 4LR3A 4NKGB 4FLVA 5B1BC 4U3JB 1LR1A 3W7XA 4D7TA 2VQFB 2A3BA 1Y74B 3JASA 2UXBB 3ABMC 3KCYA 4DK1A 5L3CA 4JYAO 4X65O 4FLXA 2DQ3A 4UCTA 4I55B 1Q86W 1UFIA 3BHPA 5LOVA 5GONB 5D5PA 2YC0A 4FM0A 1K8AW 3TDBA 3JAKB 4P9PA 1PL0A 2JDIG 2VS0A 3DC6A 1VF6A 1QLEC 3CYOA 1OCOC 1RSOB 5DEDA 5FPOA 4DR5O 1XI1A 3L74H 5J2UA 2HP8A 3RW0A 4WKHA 4DR7O 1JOYA 1VQLV 3CHDA 3WFVA 2NLJC 4UCRA 2HJFC 3ABKC 3BPZA 3ZIAG 4R5EA 4MVQA 2DJVA 4MW8A 1Q90D 5KX5A 5I98A 2B9ZA 5JH8A 4P8WA 3TXQA 4DV0O 4I0XA 3J80N 3AG2C 4WF9V 4X1IB 5BXJA 3SYPA 4DR1B 2WK2A 3JAWA 1AILA 2YIBA 3E86A 4IYHA 4I50B 2KG7B 2QM8A 1FKJA 3CRMA 2RMKB 2OCHA 1FKKA 3Q4HB 1X6LA 1G8MA 3TXSA 3LSUA 1DF4A 5IY5C 3H9RB 2WLJA 3ABTA 3K5OA 3DXRA 1LUWA 4DV3O 4I7ZB 3AQUA 1QR9A 2EZOA 1WB7A 3I6CA 1P7GA 3OTOO 4D7SA 3MDYB 5LMNB 4DR4B 4JFJA 3GB7C 1YZBA 2ZR5A 1SQQH 1G4YB 4O4HA 4O4IA 4ZOLB 4JI0B 4LWSA 1K7DA 4DT4A 2W6JG 4TSFG 2DOSA 4PV1B 3RM8A 3ETEA 4A5UB 1XBLA 2X6CA 3LNMB 4LF6O 1WN7A 2ITKA 4QE7A 3R66A 1K33A 4YXWG 1LNQA 1D2DA 1YTFD 4P9OA 3HKBB 5DO2A 4Q7NA 1LJYA 4YJ3A 1R1BA 2P06A 3IK8A 4JTAB 1TVKA 3ZN1A 4LF4B 4HBOA 3ASOB 4URIA 4ZPTR 4CH3A 3I5DA 4BW9A 4O2AA 3UCSC 1FXKC 2QKAA 3B9DA 1AJQA 2Q7HA 3ARZA 2HJDA 1NTZH 1OHHG 2PI5A 1OGBA 1ZL1A 1FKTA 1M56B 3I55V 4MVZA 3T1HB 3DC5A 4DV7B 3C3SA 1NVPB 4WKFA 2YXHA 2AW9A 4S3JA 4EB6A 3B8SA 1N36B 2UUCB 4U85A 4MNMA 3W7WA 1FYJA 4WFBV 2Q68A 4DRQA 3O5FA 2Y0IA 2Y48A 3D3QA 2ZM6B 3OMIB 4KR0B 2ZE5A 2VQEB 2MPHA 1PP9H 3QTCA 3G67A 3CJHB 1SERA 2DYRC 3ARVA 1NR1A 2ZR2A 3M8AA 2Q0AA 5B3SB 1WP8A 4N23A 5EC2C 2B31A 3VQWA 4TUYB 5LYJA 5EC1C 1VQ4V 1PNMA 1JQ0A 3TGUH 2V1DA 2ZT9B 2UUBO 1OZ0A 2QF8A 4TOIA 1QHTA 2XNDG 2QJ1A 4FMTA 1URFA 4BIZA 2IJIA 1FS0G 2PYJA 4Z2HA 5JWPA 3SGIA 3CCVV 1HDJA 3FAPA 3JARB 1S3JA 3SR2C 5BR8O 4ZPVR 1MZEA 1PL4A 2Q69A 3FB6C 4X20B 1OCRC 5J2TB 1QPLA 2YXLA 3MAQA 4EEQA 2XOKG 1WA8A 2BTOA 1XQ8A 1F40A 4TQFA 2DYSC 5JH7B 4MT8A 2WLMA 1EN6A 4B3RO 4JYCA 1JCHA 3WG7B 2XASA 3KZ7A 4ODMA 1VQ9V 1HR0O 4ODNA 2WAMA 4FFKA 4JI7B 4FFBB 3WU2Z 2MK3A 1FKFA 5LHHA 3RYFA 5IJ9A 2X6BA 1QNMA 1MZFA 4Z2JA 2HEPA 2CH7B 1AP5A 5H2FZ 4WFEA 2UXCO 2A79B 1CPYA 2HG5C 1Y66A 1Q7YW 1AJNA 4TW7A 1WPXA 5IDJA 2RJZA 1E79G 2P67A 3FB5C 4CC6A 1N8RW 1FJGB 4DRNA 3CWBH 2YIDA 4UFZA 3RYIA 5L3EA 1FFTB 2K1EA 3RM4A 1C9HA 1J5EO 4CS4A 3C90A 3IHZA 4LFBO 4J10A 2LJ2A 2AZ0A 5DEZA 1KKCA 3ETDA 4HNAA 1WP7A 1NR7A 2UXDB 2VCDA 4GKKB 4DV4O 3B8NA 4CH6A 2JS5A 3OOBA 1R3LC 5FL7G 2MLYA 3A0HZ 4G2PA 4AHCA 1FKBA 3N27A 4UV8A 1V54C 4J4OA 4CS3A 1M5IA 3BABA 5LMUB 4XBFA 2R9RB 2ZE6A 1FKSA 1ZWIC 1LQ0A 4NTXA 4O4LB 1V9PA 1NQTA 4LF9B 2DT2A 4ICGA 5B1NA 4W4LA 1M9NA 3OMNB 2RUCA 2FB5A 2D2CB 4DH0A 3CD6V 3CB2A 3JD4A 4X62O 2JGDB 1GMGA 4KP4A 3EVKA 1COWG 1BT8A 1BHAA 3O5RA 2CAZC 4PDRA 3IAYA 1K9TA 4UXNA 2VQFO 3BVOA 4WKAA 4PI0A 4H33A 1WPBA 4TW8A 3HKEB 4R50A 3SDLA 1VQ7V 3SJCC 1IBMB 4BW5A 1X4TA 5IYBO 3WD4A 1P84F 5B1BB 4ZIBA 1SS3A 2Z0AA 1W0KG 2A3AA 2VN1A 4MNLA 3ABMB 1N32B 1NT2B 2ZDIA 3T1YB 1QBZA 1BQ0A 1TAEA 3KCXA 4K8ZA 2XHBA 4ZS6A 3M7MX 3SPCA 4EFBA 4YHHB 4G27B 3RVYA 2EIJC 1YW5A 2F4EA 4PDLA 1K5QA 1PNKA 1LL6A 4FAPA 2C2AA 1AR1B 4GT1A 1QLEB 1NTMH 1OCOB 2G8ZA 2QSAA 1WJZA 3P32A 5EIBD 3ZBHA 1UJWB 3RYHA 1F51A 2XP7A 4QT3A 3DTUB 4PI2A 3AK3A 1FD9A 1ZLZA 4RAIA 4J7ZA 5DIUA 5B8IC 3ASOC 2RDCA 4DV5B 1GOIA 5IYCO 3G4SV 4DR1O 1EN4A 1MSDA 4XDJA 2DT3A 3ABKB 1L1PA 4I9WA 1NH2B 2DPEA 3WQVA 1GN2A 2ZXWC 2OIGA 4ODPA 2UXXA 5EBWC 2QR4A 4Z2GA 3AG2B 3JASB 1H8HG 2AGAA 2M6YA 3O5IA 1Y6XA 1EHNA 2EIKB 5DIVA 2OFNA 1Q8IA 1BE3H 4B7EA 2Y4UA 1XHGA 4G2KA 1LUVA 4DR4O 3CXCU 1N34O 1O6IA 4KFMA 2LGWA 2G38A 3E8GA 2KKWA 1CP9A 5IY5B 2XP8A 1DGSA 4JI0O 1N33B 1YVWA 2ZE7A 4ZHQA 1OGGA 3GWKC 5D75A 3B9EA 4UVAA 3CCRV 5J2UB 5HW7A 3ARRA 2HHHB 3O65A 3JSLA 4WK9A 4JAUA 3T4ZA 2ITCC 1RP3B 3PR9A 2XP4A 3JCZA 5L3DA 3TETA 2A06H 4Z2LA 3AROA
chains in the Genus database with same CATH topology
3UQIA 2RUQA 2DG4A 5GPGA 3KADA 4XAKA 2WLZA 4LAYA 1HKIA 3ARTA 1EYMA 3TDBA 4ODRA 4C02B 4DRMA 1D7IA 2MLZA 3OA5A 2F2DA 3FY1A 3O5PA 1ZBCA 5HTGA 1UR8A 5HWBA 1H0IA 3JYJA 4NSBA 2KGJA 2F21A 4WKHA 1E6RA 2UZ5A 3CHDA 2PPOA 2PPNA 4IT4A 2MF9A 4HBEA 4R5EA 3NTPA 1FFQA 2DSVA 4WJXA 4DIPA 5I98A 5JH8A 1D7HA 3RFWA 4P8WA 3ARUA 1WB0A 1QPFA 5BXJA 1JVWA 2WK2A 2XP9A 5HW6A 2D9FA 1E6ZA 1NSGA 3O5EA 2RUDA 1FKJA 1FKKA 3WIJA 1BKFA 1LG2A 1W26A 1W9VA 1X6LA 2ZR6A 4O2TA 1TFVA 3ARSA 1NWUA 1W1VA 3H9RB 2N87A 2OLHA 4DWSD 2DT1A 1QZ2A 3AQUA 2YBTA 3I6CA 2KO7A 3MDYB 4ITZA 4JFJA 2ZR5A 4KQZA 3NRKA 4ZPWR 4WIWA 1XRVA 1GPFA 1HJVA 1Y0OA 4S3KA 4DT4A 4N19A 1IX5A 3RM8A 3KAIA 4MNJA 4DRPA 1N1AA 2ITKA 3QOKA 2ESCA 3KACA 5HW8A 1P5QA 2ZQTA 3B09A 1F8AB 1FKDA 3RGCA 4MNKA 1WNOA 4MTVA 5DO2A 1HKKA 4Q7NA 2RURA 3ARQA 1LJYA 1WAWA 4W9QA 2KI3A 4DWSB 3G6LA 3WKZA 3IK8A 3B7XA 1W9PA 4HBOA 1D2KA 4JFIA 1Q1CA 4URIA 4ZPTR 3O5QA 4LAWA 1FFRA 3B9DA 1ZBWA 2PV2A 4IT6A 3ARZA 4ODLA 1YATA 1ZL1A 1OGBA 4FN2A 4P8XA 1FKTA 2Q5AA 3RM9A 3WD2A 4WKFA 5GQBA 1ZBVA 4S3JA 3B8SA 1J4RA 4R0XA 4U85A 4DRIA 3KAGA 4MNMA 1FKRA 3O5LA 4DRQA 3O5FA 3O5GA 1HXVA 4KR0B 4DRKA 1W1PA 2MPHA 2WM0A 1FKLA 2DSWA 1NH6A 3CZ8A 3ARVA 4IPXA 4ODKA 1M5YA 4IQCA 4P8UA 4DWSA 3AS3A 1JNSA 2B31A 1Q6UA 4DZ2A 1W9UA 2QF8A 2LJ4A 3O5OA 1R9HA 2ZQVA 2ZQSA 1Q6HA 3ARWA 4L72B 5DITA 4Z2HA 5GPRA 2DT0A 3WQWA 3FAPA 1D7JA 2ZR4A 1ROUA 4ZPVR 3KAHA 2DG9A 3PA7A 4JFLA 1QPLA 3JXVA 4MSPA 3UI6A 2PPPA 4MPKA 4NZCA 1F40A 1SYTA 4GGQA 4BF8A 1ITXA 3KZ7A 4ODMA 1HJWA 4ODNA 1LL7A 4LAVA 1FKFA 4QZVB 3LUOA 5HBFA 1EDQA 3WD0A 4Z2JA 4ML4A 4DWSC 2M08A 1TCOC 2PV3A 3W4RA 2XP5A 1CTNA 2LPVA 1E6NA 3ALFA 4Z2IA 1NMWA 1ZB5A 4TX0A 4TW7A 4GIVA 1NMVA 1W1TA 1FJDA 4DRNA 2FAPA 1D6OA 4DRJA 3RM4A 5DF0A 1C9HA 2RSEA 4NNRA 1U79A 4DZ3A 3AS2A 3BXWA 2A3EA 1J6YA 3IHZA 1A7XA 4DRHA 1LL4A 2O9OA 4JYSA 5DEZA 2IUZA 2VCDA 4IQ2A 3CH9A 4TYOA 3OOBA 2MLYA 1KT1A 4QIBA 4G2PA 2KFWA 1FKBA 4G50A 4J4OA 1UR9A 1H0GA 4W5UA 4J4NA 3B9AA 2IF4A 1E6PA 1OWQA 1FKSA 3RMEA 2WLYA 2KE0A 1LQ0A 2LGOA 1FAPA 1LG1A 2DT2A 2JZVA 2LKNA 3WL0A 4DROA 3ARYA 1JNEA 2RUCA 4W9OA 4DH0A 1E9LA 2PV1A 3ODKA 1NWRA 1J4IA 2K8IA 5HKGA 1FKHA 3UQBA 3O5RA 5HT1A 3ARXA 3FXYA 1HKJA 3UF8A 1K9TA 1EIBA 4WKAA 5J6EA 2A3CA 2AOSA 4TW8A 1JNDA 2FKEA 1J4HA 2O92A 1T11A 3WD1A 4U84A 1FKIA 3WD4A 3UI4A 2M1IA 4TW6A 3CHCA 5HWCA 1PBKA 2A3AA 2VN1A 2MNTA 2M2AA 2Y78A 3KABA 4MNLA 2DG3A 1VF8A 1RD6A 2MLXA 3ARPA 2XP6A 4MAVA 4ZS6A 1YW5A 2F4EA 3ALGA 1NWTA 3AS1A 4JFKA 1LL6A 4FAPA 1HJXA 3NI6A 3WD3A 2AWGA 3TC5A 3O5DA 2G8ZA 1ROTA 1EQ3A 3WH0A 3PRDA 1JNTA 3JYMA 2XP7A 4QT3A 3EY6A 1PINA 1FD9A 1W1YA 5HUAA 5DIUA 5B8IC 3UQAA 3WL1A 1GOIA 2ZQUA 1E15A 4MGVA 4PTMA 3O5KA 1GUVA 1NWSA 1BL4A 2PI6A 4LAXA 1KT0A 3O5MA 2PBCA 2DT3A 2XPBA 1L1PA 3CHEA 4P8VA 1KFWA 2DPEA 4TNSA 3WQVA 1B6CA 4ODPA 3GPKA 4U86A 4AY1A 4Z2GA 3CHFA 2DSUA 3AS0A 3O5IA 1HKMA 1EHNA 5DIVA 2OFNA 4JFMA 1ZU8A 1ZBKA 1XHGA 1O6IA 3KAFA 1ZCNA 2XPAA 4ODOA 2RQSA 4L3NA 3VAWA 3TCZA 2YBUA 4ODQA 3UI5A 2L2SA 3IKDA 3IKGA 2XP8A 4Z2KA 2KR7A 4Q22A 1X6NA 2G41A 3CGMA 3PRBA 4LGXA 1OGGA 1FKGA 3G6MA 1ZK6A 3KCEA 2DSZA 5D75A 2FDMA 3B9EA 3O5JA 4W9PA 5HW7A 4HARA 3ARRA 3CGNA 4WK9A 2XP3A 1SR0A 3PR9A 2XP4A 3PRAA 1Q6IA 4QT2A 4Z2LA 3AROA 2A3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQI A;  2RUQ A;  1FKF A;  3KAC A;  2DG4 A;  3LUO A;  1FKI A;  4U84 A;  5GPG A;  3UI4 A;  5HW8 A;  1P5Q A;  3KAD A;  2ZQT A;  3B09 A;  2M1I A;  4TW6 A;  1F8A B;  1FKD A;  5HWC A;  2M08 A;  3RGC A;  1PBK A;  1TCO C;  2PV3 A;  2VN1 A;  2MNT A;  2M2A A;  2Y78 A;  3KAB A;  2XP5 A;  2DG3 A;  4LAY A;  4DRP A;  2LPV A;  2RUR A;  4W9Q A;  1EYM A;  1NMW A;  2KI3 A;  4TX0 A;  2MLX A;  3TDB A;  4ODR A;  4TW7 A;  4C02 B;  4GIV A;  4DRM A;  1D7I A;  2MLZ A;  2XP6 A;  3IK8 A;  3B7X A;  1NMV A;  1FJD A;  2F2D A;  4DRN A;  2FAP A;  1D6O A;  4JFI A;  1Q1C A;  3O5P A;  4DRJ A;  3O5Q A;  1YW5 A;  2F4E A;  4LAW A;  1C9H A;  5HTG A;  4JFK A;  4FAP A;  2RSE A;  4NNR A;  3NI6 A;  1U79 A;  2PV2 A;  4ODL A;  2AWG A;  3TC5 A;  4DZ3 A;  5HWB A;  1YAT A;  3O5D A;  3JYJ A;  1ROT A;  4FN2 A;  2KGJ A;  3IHZ A;  1J6Y A;  1EQ3 A;  1A7X A;  4DRH A;  3WH0 A;  3PRD A;  1FKT A;  1JNT A;  2F21 A;  2Q5A A;  3JYM A;  2XP7 A;  4JYS A;  4QT3 A;  2UZ5 A;  3EY6 A;  1PIN A;  1FD9 A;  2PPO A;  1J4R A;  4R0X A;  2VCD A;  4U85 A;  4DRI A;  3KAG A;  5HUA A;  2PPN A;  5DIU A;  5B8I C;  4IQ2 A;  3UQA A;  1FKR A;  3O5L A;  2MF9 A;  2ZQU A;  4MGV A;  4TYO A;  3NTP A;  4DRQ A;  3O5F A;  3O5G A;  3O5K A;  3OOB A;  1HXV A;  2MLY A;  1BL4 A;  1KT1 A;  4QIB A;  4DRK A;  4LAX A;  2MPH A;  4DIP A;  1KT0 A;  4G2P A;  5I98 A;  1FKL A;  2KFW A;  2PBC A;  3O5M A;  1D7H A;  3RFW A;  2XPB A;  1L1P A;  1FKB A;  4G50 A;  4J4O A;  4IPX A;  1QPF A;  4ODK A;  1M5Y A;  4IQC A;  4TNS A;  1B6C A;  5BXJ A;  4ODP A;  1JVW A;  2XP9 A;  5HW6 A;  3GPK A;  4U86 A;  4J4N A;  2D9F A;  1JNS A;  1Q6U A;  2IF4 A;  4DZ2 A;  3O5I A;  1FKS A;  1NSG A;  3O5E A;  5DIV A;  2KE0 A;  2RUD A;  1FKJ A;  2OFN A;  4JFM A;  2LGO A;  1FKK A;  1FAP A;  2LJ4 A;  3O5O A;  1BKF A;  1R9H A;  1W26 A;  2JZV A;  2LKN A;  2ZQS A;  2ZR6 A;  1Q6H A;  2ZQV A;  4O2T A;  4DRO A;  5DIT A;  2RUC A;  4W9O A;  3KAF A;  1ZCN A;  2XPA A;  2N87 A;  3H9R B;  4DH0 A;  1QZ2 A;  4ODO A;  2PV1 A;  2RQS A;  3ODK A;  3VAW A;  3FAP A;  1D7J A;  2ZR4 A;  1J4I A;  2K8I A;  3I6C A;  3TCZ A;  4ODQ A;  3UI5 A;  2KO7 A;  2L2S A;  3MDY B;  3IKD A;  3IKG A;  1ROU A;  4ITZ A;  2XP8 A;  4JFJ A;  5HKG A;  2KR7 A;  2DG9 A;  3KAH A;  3PA7 A;  2ZR5 A;  3CGM A;  3PRB A;  4JFL A;  3NRK A;  1FKH A;  1QPL A;  1FKG A;  3O5R A;  3JXV A;  1ZK6 A;  4MSP A;  3KCE A;  3UQB A;  3UI6 A;  5D75 A;  3O5J A;  4W9P A;  5HT1 A;  3UF8 A;  5HW7 A;  2PPP A;  3CGN A;  1F40 A;  2XP3 A;  5J6E A;  4GGQ A;  4BF8 A;  1Y0O A;  4TW8 A;  4DT4 A;  4N19 A;  2XP4 A;  3KZ7 A;  4ODM A;  1Q6I A;  2FKE A;  4ODN A;  1J4H A;  3KAI A;  4QT2 A;  1T11 A;  4LAV A;  1N1A A;  2ITK A; 
#chains in the Genus database with same CATH topology
 1QU7 A;  4MVS A;  3MHH C;  3A8T A;  5KX5 B;  3KAD A;  5LGU A;  5A9G A;  1R6K A;  4LF4 O;  4I0X B;  4FM1 A;  4WFF A;  5IYD O;  4ZI7 B;  1HKI A;  3ART A;  3WG7 C;  2YEV A;  3JAW B;  4X1Y A;  2D3O W;  4ODR A;  4DRM A;  4B08 A;  1XOU A;  2F2D A;  4GKJ B;  3AG4 C;  1L0L H;  3CME V;  3T1H O;  1YF2 A;  4DV7 O;  4LNU B;  1UR8 A;  1QQC A;  1N36 O;  2UUC O;  3JYJ A;  5CBF A;  5DN6 G;  1FXK B;  2F21 A;  4OX9 B;  4UVC A;  2VQE O;  3FYI B;  1E6R A;  2P4V A;  2QEX V;  1H2L A;  3EXA A;  3U0Z A;  1Q3E A;  3FB8 C;  2DSV A;  1XMO B;  4O4I B;  1D7H A;  3RFW A;  3ARU A;  1IVS A;  1WB0 A;  3RBZ A;  4UCU A;  3CRQ A;  3H01 A;  1JVW A;  5HW6 A;  5C8Y A;  2DYR B;  4YIP A;  2D9F A;  3F7Y C;  3VQY A;  3LDC A;  1PNL A;  4Z1V A;  2RQ6 A;  1JX9 A;  1HNW B;  4DYL A;  1VF5 B;  1WAZ A;  4IIJ B;  5KHH A;  1KP3 A;  3I56 V;  3EFF K;  1U97 A;  2ZR6 A;  2HFE C;  4O2T A;  2Q7E A;  4YJ3 B;  1W1V A;  2B5U B;  1QZ2 A;  2LW7 A;  1W0J G;  4JAV A;  1TVK B;  2YBT A;  2WPD G;  4MVU A;  4ITZ A;  4O2A B;  1PKX A;  1ZL8 A;  2VRZ A;  4K0K B;  4GZR B;  4JGS A;  1YJN V;  1E1Q G;  5K1X A;  4JI7 O;  1KKD A;  1VQM V;  5EBM C;  2W6I G;  1GTO A;  1OCR B;  1H2K A;  2FTK A;  4N19 A;  1IX5 A;  1NVP D;  2QWO B;  4EB6 B;  2Q6A A;  3VQV A;  4WCE V;  2HKO A;  4JV5 B;  2DYS B;  2KSD A;  4MNJ A;  3QOK A;  2ESC A;  1M1K W;  3KAC A;  3BA8 A;  1P5Q A;  3L75 H;  2ZQT A;  3B09 A;  3FAV B;  3FYE B;  2LQT A;  1FJG O;  1E44 A;  3UM7 A;  1RPR A;  1WNO A;  4MNK A;  1W2B U;  1Z5V A;  1VQK V;  1BCC H;  2KI3 A;  4HBN A;  2CTQ A;  5BMV B;  4O2B B;  3B7X A;  3KZI Z;  1W9P A;  2LFR A;  3CEI A;  2QM7 A;  1Q1C A;  1QR8 A;  2V4D A;  1FFR A;  4ODL A;  2UXD O;  4GKK O;  3RVZ A;  2HVK C;  3ZS8 C;  3GVM A;  3G71 V;  2Q5A A;  5CA0 A;  1HNZ O;  4K8X A;  5GQB A;  3N2G B;  5FLX N;  4PA3 A;  3TK1 A;  4DRI A;  4JI3 B;  2OCC C;  1P49 A;  3H9V A;  1IBK B;  1FPO A;  3E8B A;  1Z2G A;  5LMU O;  3OEH G;  5H6R A;  5LBQ A;  1WA8 B;  3EIP A;  3SYA A;  1IX9 A;  4IPX A;  1R73 A;  1JCH B;  3ZCC A;  1XDC A;  4DWS A;  3RYC B;  4GLX A;  4LF9 O;  1V54 B;  1JNS A;  3CMA V;  3QF7 A;  3RYF B;  5IJ9 B;  2W0F C;  5KMG A;  2ZR3 A;  3FD9 A;  2DMX A;  4OPH A;  4QPJ A;  4GX2 A;  4E4E A;  2QWP B;  2FL4 A;  4JI1 B;  5DM6 V;  5E1A C;  3ZRW B;  3H1H H;  2BTQ A;  4U3F H;  1H8E G;  3RYI B;  2ZE8 A;  2EIK C;  1BGY H;  3S3W A;  3PA7 A;  2EIN C;  3P3P A;  5CB4 B;  4WFA V;  1IBM O;  2PPP A;  4MPK A;  1YIT V;  4GGQ A;  2A9H A;  3ZMU A;  4HNA B;  3ZHS A;  1HJW A;  1VF6 C;  2GBO A;  4LAV A;  3UT5 B;  4IHJ B;  1N32 O;  1XHZ A;  5JQG A;  1SA0 A;  3T1Y O;  5HBF A;  4QE9 A;  5KHJ A;  4DWS C;  2M08 A;  1N34 B;  1FFX A;  4PHZ A;  2EJ7 A;  5KUM A;  3QVN A;  1TCO C;  2QKC A;  2PV3 A;  4YHH O;  3W4R A;  2Q4P A;  1QLN A;  1NMW A;  4GIV A;  5HFL A;  2ZKO A;  1QVF U;  1FKA O;  3W7T A;  4BAY A;  2QKS A;  4TV9 A;  4AIL C;  1MNG A;  3OGC C;  2RSE A;  4NNR A;  4Q20 A;  4DZ3 A;  3AS2 A;  2A3E A;  1A7X A;  4DRH A;  4DV5 O;  2EIJ B;  3G6B A;  2F93 B;  1RM1 C;  2IUZ A;  4F4L A;  3ZED A;  2IU3 A;  2WLI A;  2XAH A;  1NTK H;  4IQ2 A;  4TYO A;  1MMM A;  5C93 A;  1VQ5 V;  4FVM A;  2KFW A;  3HKC A;  3F5W C;  3SJQ C;  3AG3 C;  5JVD A;  1F7Y A;  5IJ0 A;  1YCI A;  4PA7 A;  1H0G A;  3QO7 A;  4UCV A;  4Z2W A;  2IF4 A;  2IM9 A;  3B77 A;  2ZXW B;  3BMB A;  2WLY A;  1ROP A;  2PTM A;  2LGO A;  1FAP A;  2ETN A;  3K08 A;  2LKN A;  4QGP A;  1VMG A;  3UQ8 A;  1N33 O;  1BMF G;  1VP7 A;  5CA1 B;  2XAQ A;  2A7W A;  1I94 B;  4MTO A;  3K5N A;  1KYO F;  2HHH O;  2K8I A;  4J80 A;  3K5M A;  3IJ4 A;  1TUB B;  4QIW F;  1FKH A;  2E75 B;  2CGN A;  2ZD9 A;  1GN6 A;  3UF8 A;  3T4D A;  2LP7 A;  1EIB A;  4AQY B;  2AOS A;  4DRX B;  1R3K C;  2DWE C;  1JND A;  1R3J C;  3WB0 A;  1YEW A;  2O92 A;  2E74 B;  1SKV A;  2GUZ A;  1XL4 A;  5EZY A;  1FKI A;  2ZQM A;  1MG1 A;  4ZBM A;  1Q5O A;  1XUQ A;  1OJH A;  3H1K H;  4TW6 A;  1CEZ A;  5HWC A;  1N4C A;  4GKJ O;  5L3G A;  2E5L B;  4DUY B;  2MNT A;  2Y78 A;  1NH2 D;  1VAR A;  4ZKI A;  2YSU B;  1VF8 A;  4IT5 A;  4U3J A;  2P5O A;  3ZRV A;  4UUJ C;  1IXB A;  2XP6 A;  3OGI B;  4MAV A;  1I0H A;  1Y74 A;  4PD4 F;  4PJ0 Z;  4OX9 O;  2EBO A;  1NWT A;  4PDV A;  5BZB A;  1MOF A;  5AG2 A;  4I55 A;  3AG4 B;  4DV6 B;  2IJJ A;  3TC5 A;  2BOB C;  2XAG A;  5GTI Z;  3WD3 A;  5GON A;  1ROT A;  1CXZ B;  3WH0 A;  3PRD A;  2B1G A;  4TWK A;  4JTC B;  2AZ2 A;  1XMO O;  1PIN A;  1VQ8 V;  1BS3 A;  2P7T C;  5HUA A;  4MSW C;  3WL1 A;  1JPX A;  2ZQU A;  1RSO A;  4PDM A;  4ZHQ B;  2RNB A;  3O5K A;  3SPG A;  1GUV A;  4JI8 B;  1BL4 A;  1ZUQ A;  4LAX A;  5A2Q N;  2PBC A;  1B6Q A;  4H0L B;  2XPB A;  4P8V A;  3J81 N;  1JFF A;  1KFW A;  3HPL C;  4CZZ A;  1HNW O;  4B3M B;  3JSN A;  1DLB A;  4L8J A;  4FJC C;  5LXT A;  1RPO A;  2GDS A;  1NBM G;  1HKM A;  4NR1 A;  2N05 A;  1F23 A;  2DWD C;  4JZ2 A;  4K35 A;  1RFY A;  3CCJ V;  2IH3 C;  1VQO V;  1I5X A;  4X1I A;  5IYZ B;  4X89 A;  1MAB G;  1HNZ B;  2R72 A;  2UU9 B;  3KAF A;  2XPA A;  2XUM A;  3ZRS A;  4H13 B;  4DV1 B;  4K0K O;  2Q0O C;  2RQS A;  4JI6 B;  3TCZ A;  2KG7 A;  1M4U A;  3UI5 A;  2L2S A;  3IKG A;  5ITZ B;  2G41 A;  4LGX A;  2CUG A;  3Q4H A;  1FKG A;  2XAJ A;  3K3W A;  1YIJ V;  2DSZ A;  2ZCE A;  4JV5 O;  4UCS A;  4FLU A;  4HAR A;  1VQP V;  3OTF A;  3CHX A;  1N0N A;  2R9A A;  4FLT A;  1NI8 A;  2XP3 A;  1N0J A;  3ZHQ A;  2L35 A;  4X64 O;  3VQX A;  1WB8 A;  4GX1 A;  3L9D A;  4QT2 A;  4DR2 B;  4UCO A;  2HLD G;  3UQI A;  2RUQ A;  4XDK A;  5GPG A;  3K0G A;  1SES A;  2P22 C;  3CRA A;  1MA1 A;  2QA4 V;  2BSK B;  3CCQ V;  2N04 A;  4LAY A;  1K73 W;  3STZ C;  3JD3 A;  3MDS A;  1S5J A;  4C02 B;  4LCU C;  2MLZ A;  3OA5 A;  3PN1 A;  3FY1 A;  5BY1 A;  3O5P A;  2ITD C;  4G28 B;  1ZBC A;  5HTG A;  2E76 B;  3HKB A;  2Q9L A;  3T2M A;  2YXY A;  1KP2 A;  4JI3 O;  3S3X A;  5HWB A;  1H0I A;  3QO8 A;  4NSB A;  1IBK O;  1O9H A;  1VEW A;  4FPP A;  1I5Y A;  2Q5Z A;  2UZ5 A;  1TUE B;  4FZ1 A;  2MW2 B;  2DQ0 A;  4CS2 A;  2PPN A;  3ZN0 A;  4IT4 A;  2MF9 A;  2ADQ B;  4HBE A;  1FFQ A;  3SPJ A;  2RCV A;  3OW2 U;  4QJF B;  1M90 W;  4WJX A;  4DIP A;  5CMU A;  1PPJ H;  2OCC B;  4TV8 A;  1MSW D;  4GX5 A;  5LP6 A;  4F6R A;  1VF7 A;  4P30 A;  2XP9 A;  3SJB C;  4B3S B;  1AI7 A;  4DO2 A;  3O5E A;  4JI1 O;  3AG1 C;  3CJH A;  3WIJ A;  4FZ0 A;  1W9V A;  3W7S A;  3ARS A;  2JEX A;  3OE7 G;  4FIP C;  5L3B A;  5J9P C;  2DT1 A;  1K4D C;  2XAF A;  1K9M W;  4P2Z A;  2EUL A;  3AG7 A;  3OFN G;  3D8C A;  4WFG A;  2ODM A;  3OMA B;  4I4T A;  4KQZ A;  1W59 A;  5KUK A;  5LGT A;  4LFC B;  3JAL A;  2ZDI C;  4KXR A;  2EIN B;  5CA0 B;  1HJV A;  1S72 V;  1Y0O A;  3BAA A;  2CGO A;  3JAR A;  5LOV B;  4DK0 A;  3KAI A;  1I7F A;  3NXS A;  1R3I C;  3ABL C;  2EX3 A;  4J42 A;  5J2T A;  4DRP A;  1N1A A;  4DR3 B;  5LP6 C;  4MVR A;  2EIM B;  1FXH A;  5D5Q A;  5HW8 A;  1ZTE A;  3UKM A;  2EZP A;  2ZIM A;  4BWA A;  2CTP A;  3L71 H;  3TCU A;  1F8A B;  3G80 A;  5JH7 A;  3CPW U;  1GRJ A;  4JYB A;  1HKK A;  2RUR A;  1WAW A;  2N74 A;  3G6L A;  1G1X B;  4DWS B;  2H94 A;  4PEL A;  5H9C A;  3E2E A;  1AR4 A;  3N2K A;  4DUZ B;  1B06 A;  5KMG B;  1IBL B;  1D2K A;  2FKX A;  3FFQ A;  1DK1 A;  3KKY A;  4LAW A;  1H2M A;  4IL6 Z;  2WLH A;  2CH7 A;  2V7Q G;  1AJP A;  1ZBW A;  2PV2 A;  3SYQ A;  4UB6 Z;  4P8X A;  4FN2 A;  1TA8 A;  1B04 A;  4J9Y B;  1H38 A;  2XT9 A;  4JAA A;  2CK3 G;  4DR6 B;  3RWR D;  1J4R A;  4J7J A;  4R0X A;  1GKF A;  3KAG A;  4MTF A;  3A2F A;  1RM1 B;  3O5L A;  2BOC C;  3HKD A;  3GU0 A;  2PYL A;  3O5G A;  1S5H C;  2UUA B;  1W1P A;  4L87 A;  3L72 H;  3CZ8 A;  1S76 D;  2FYU H;  3ZX6 A;  4ODK A;  4BIO A;  1IDS A;  2H3O A;  4IQC A;  1J95 A;  4D6T H;  4P8U A;  1OCZ C;  2PGG A;  1EM1 A;  5EYP A;  3AS3 A;  3AG3 B;  4JTD B;  1Q6U A;  3DXR B;  5JQG B;  1SA0 B;  2PI4 A;  1I94 O;  4LF5 B;  2B1I A;  3U10 A;  5IWA B;  5LGN A;  2LJ4 A;  3O5O A;  1FFX B;  1OV9 A;  3CP1 A;  1R9H A;  1XMQ B;  2QE7 G;  2ZQS A;  2DW4 A;  2ZQV A;  1Q6H A;  5KAI Z;  4O4H B;  5GPR A;  4FLZ A;  2X7R B;  2DT0 A;  1GN4 A;  4NXN O;  1JVM A;  3ZHR A;  4LWS B;  2LO1 A;  1YXB A;  2ZR4 A;  4KUM A;  4DXW A;  1SQP H;  1YDX A;  4AQY O;  4TV9 B;  3JD2 A;  3CXH F;  2Y69 C;  4JFL A;  4MW3 A;  4YY3 B;  3VOU A;  3JXV A;  3ZMV A;  4OXS A;  4KHP B;  4NZC A;  2ATK C;  3BY6 A;  4XDL A;  2JK5 C;  1SYT A;  4MVM A;  2GV9 A;  4BF8 A;  5IE9 A;  3K59 A;  3W7U A;  3QG5 A;  4X66 B;  2WLI B;  1AI6 A;  1Y76 A;  2EIL C;  4JI4 B;  2E5L O;  2Q73 A;  4DUY O;  4NVP A;  4QZV B;  2WSS G;  3LUO A;  3ETG A;  2GHY A;  1BZK A;  1SZT A;  3HKC B;  1KQS U;  1EDQ A;  1F4M A;  5JCO A;  5IJ0 B;  1HWY A;  4BR6 A;  1AP6 A;  4LF7 B;  1CTN A;  2LPV A;  1E6N A;  3CCM V;  5DEC A;  4FK5 C;  2K9P A;  4DV6 O;  1H2N A;  1W1T A;  3H1L H;  3E83 A;  5B1A B;  3DSQ A;  1U79 A;  4I9Q A;  3BXW A;  4NXM B;  1J6Y A;  1VQ6 V;  2LGQ A;  4X64 B;  1LL4 A;  1SQX H;  4JI8 O;  4JYS A;  1BL8 A;  4UDM A;  3ZHT A;  1QCE A;  1Q43 A;  1V55 C;  1XRE A;  1K3E A;  4WBN A;  3ZJZ A;  4B3M O;  1JR9 A;  5LYJ B;  2WLL A;  2GSM B;  1HNX B;  2Y0P A;  2F4V O;  1BSM A;  3K03 A;  3K5L A;  4NYK A;  5KAF Z;  3BFR A;  4HZ3 A;  2QWQ B;  4Q6G A;  1YJ9 V;  4J7K A;  2O57 A;  5JCO C;  4W5U A;  1XNR O;  1EN5 A;  5EZY B;  1E6P A;  2UU9 O;  2KE0 A;  3MD0 A;  2IJH A;  3SJA C;  4DV1 O;  3OT7 A;  1JMK C;  4FLW A;  4JI6 O;  1SRY A;  1LG1 A;  4DRO A;  3ARY A;  1GN3 A;  1JNE A;  3E22 A;  2P6J A;  4W9O A;  1S0V A;  3O9O A;  1E9L A;  1AVM A;  3ODK A;  2OYQ A;  1NWR A;  3B8M A;  1J4I A;  5L3F A;  3D3I A;  4H37 A;  1QVG U;  3UQB A;  3EHB B;  1Y4M A;  3FXY A;  4DR2 O;  4EFE A;  1U96 A;  4I5S A;  1GM8 A;  4BIU A;  1KD1 W;  4JI5 B;  2LFS A;  4H44 B;  1Y67 A;  1Q82 W;  3F7V C;  1J4H A;  1P7B A;  3QNE A;  1YI2 V;  5KHG A;  1T11 A;  3AK2 A;  4U84 A;  1SF9 A;  5JJE B;  3JAT A;  2IJK A;  3U11 A;  4CH4 A;  2M1I A;  3CHC A;  2HR3 A;  1PBK A;  1JFF B;  2IH1 C;  3SPI A;  4JPR A;  2M2A A;  3KAB A;  2DG3 A;  4LF8 B;  3BCC H;  4ASU G;  4UB8 Z;  4JI2 B;  2R9I A;  1XHX A;  1RD6 A;  2MLX A;  5LXT B;  2UXN A;  3WB2 A;  2AXT Z;  2HVJ C;  2QDO A;  3JD1 A;  2EIM C;  1WNS A;  2AHY A;  4R8C A;  3ALG A;  4JFK A;  1HJX A;  3X2Q B;  4ZI7 A;  3O5D A;  1EQ3 A;  3OD4 A;  3B40 A;  4OPA A;  2ILM A;  3IGA C;  1YSC A;  3M99 B;  3HB3 B;  1ENV A;  1ZSP A;  4LNU A;  5TIS Z;  1PV0 A;  4PTM A;  4Z1M G;  2CTR A;  1L0N H;  2OT5 A;  3T1C A;  1KT0 A;  4J41 A;  3O5M A;  1FXK A;  1O9G A;  4B3S O;  1TGO A;  2EJR A;  5LHG A;  4TNS A;  4J9Z B;  1B6C A;  3ZHU A;  3GPK A;  4U86 A;  2PF4 E;  4LH7 A;  5E79 Z;  3AS0 A;  2QM4 A;  3A0B Z;  3RFR A;  4JFM A;  1VIB A;  2FML A;  2ZIN A;  3E8F A;  3SYO A;  1ZBK A;  2WA4 A;  3K9A A;  4TQD A;  3CCS V;  4YJ2 A;  2YS8 A;  3APO A;  3AG1 B;  3B2E E;  1B3Q A;  4O4J A;  5FNV A;  1ZCN A;  1AI4 A;  4ODO A;  5KHK A;  4LFC O;  4L3N A;  5CBG A;  3QO5 A;  1PM9 A;  1ZX3 A;  4RUF A;  2YBU A;  1XEQ A;  2CE4 A;  5LA6 A;  1T5E A;  4IIJ A;  4MTX A;  1ZK6 A;  2FDM A;  1NJI W;  4W9P A;  1NS1 A;  1JJ2 U;  1H2S B;  2B5U A;  3CGN A;  4DR3 O;  3ASN C;  1JJO A;  2YIC A;  1SR0 A;  2R70 A;  3AK1 A;  2AHZ A;  1AB3 A;  3PRA A;  1Q6I A;  2WLK A;  1SQB H;  3A0R A;  3OUF A;  2OIE A;  2DG4 A;  2P4K A;  3CCE V;  1BHB A;  4TV8 B;  4F6E A;  3ABL B;  5LP6 B;  1IZ3 A;  4F6R B;  4DUZ O;  1IBL O;  4XAK A;  1K4C C;  1GH6 A;  3FKS G;  2YI8 A;  2WLZ A;  4NXN B;  1PD3 A;  4U7O A;  4RWU A;  1EYM A;  2PY5 A;  2VWJ A;  1D7I A;  3RYH B;  4B3T B;  4MVO A;  4U7N A;  5JJJ B;  3FAV A;  3PJS K;  4J11 A;  2OWO A;  2OTJ V;  4OGQ B;  4TT3 G;  4DR6 O;  2VWK A;  4GYC B;  5LHI A;  1THZ A;  1YJW V;  4X8A A;  3ICX A;  1AI5 A;  4X1K A;  2KGJ A;  2Z5U A;  1EFR G;  1AR5 A;  5BMV A;  4GCZ A;  4O2B A;  4KL1 A;  2UUA O;  4LFA B;  2PPO A;  3J7A U;  3E8H A;  4I4T B;  2JIZ G;  4QPK A;  3WB1 A;  3NTP A;  2LW1 A;  5B1A C;  3R65 A;  1UPG A;  1M57 C;  2WA3 A;  3JAL B;  1HP8 A;  1XNQ B;  1GM9 A;  3N2G A;  1QPF A;  3CS5 A;  4LF5 O;  2RN9 A;  2ZIO A;  2YUA A;  5KA6 A;  5IWA O;  3THO A;  2NNU A;  1XMQ O;  1OCC C;  5BXZ A;  3JAK A;  3CC7 V;  3ML0 A;  1E6Z A;  4FM2 A;  1OCZ B;  2JRI A;  5KHI A;  4DV2 B;  1Q81 W;  4UVB A;  1NSG A;  1K97 A;  2RUD A;  2A0L A;  3L70 H;  5EIB C;  1BKF A;  1XL6 A;  1LG2 A;  5GTH Z;  1W26 A;  2JJ1 G;  2QGN A;  1TFV A;  3IC7 A;  1NWU A;  2M7W A;  1EZV H;  3RYC A;  4YY3 O;  2N87 A;  1Z5W A;  2OLH A;  4DWS D;  3E35 A;  4KHP O;  5EK0 A;  3N2K B;  1YHQ V;  1JA8 A;  2KO7 A;  2IW5 A;  4NTW A;  3K0D A;  4WFH A;  4X66 O;  3CCU V;  2F4V B;  3LSQ A;  3NRK A;  4ZPW R;  4WIW A;  1XRV A;  1VQN V;  3K9S A;  4JI4 O;  1IUR A;  1GPF A;  1L8D A;  3ZRW A;  4W4K A;  2Y69 B;  3CCL V;  4S3K A;  5CA3 A;  5K1P A;  3OUS A;  1XNR B;  2YEV B;  4X1Y B;  1X59 A;  3HKD B;  4LF7 O;  5CB4 A;  1WLE A;  2YIB D;  1DTO A;  4I50 A;  2EIL B;  4PA4 A;  5CN0 A;  1F4N A;  1FKD A;  3RGC A;  4MTV A;  4JAS A;  2X6A A;  3ARQ A;  4W9Q A;  5EYP B;  3CC2 V;  5KA5 A;  1SQF A;  3WKZ A;  3UT5 A;  4IHJ A;  4YIO A;  4NXM O;  4ABM A;  4JYA B;  4X65 B;  4JFI A;  3FX7 A;  3O5Q A;  3L73 H;  1H2G A;  2QWR B;  3D36 A;  1NKD A;  4IT6 A;  1YAT A;  1KEC A;  2QWN B;  4ZOL A;  5B1O A;  2Z3Y A;  1P4R A;  3RM9 A;  3WD2 A;  3FB7 C;  3JD0 A;  1SET A;  3VBB A;  4R7C A;  1HNX O;  1ZBV A;  4QNH B;  1FKR A;  1SQV H;  4DR5 B;  2Y4T A;  4B7K A;  5C8Y B;  4JYY A;  5B5E Z;  1HXV A;  1HW7 A;  2YIA A;  4DR7 B;  4DRK A;  3X2Q C;  2WM0 A;  1V55 B;  1YTF B;  2A3Q A;  1FKL A;  1US6 A;  3OM3 B;  2DSW A;  1NH6 A;  2L6L A;  3ZMZ A;  1M5Y A;  1Y76 B;  2IBZ H;  3OEE G;  4IGG A;  3MHS C;  1KMI Z;  2X0L A;  4DZ2 A;  4DV0 B;  1W9U A;  3GWO A;  2UXB O;  3RT3 C;  1ZL8 B;  3OR7 C;  3LNN A;  3ARW A;  4L72 B;  5DIT A;  2E3C A;  1K5S A;  2ZNI A;  2PN0 A;  3WQW A;  3B4S A;  3D36 C;  3ABU A;  2JGU A;  3STL C;  1D7J A;  3CRC A;  4RO2 A;  2JEU A;  1ROU A;  1A32 A;  2CDY A;  3KAH A;  2DG9 A;  4JI5 O;  3JCU Z;  3ETQ A;  2YDE A;  3RN4 A;  4MSP A;  3UI6 A;  1ARO P;  4DV3 B;  2BCC H;  4CH5 A;  1KUQ A;  5CA1 A;  3OTO B;  5KLV H;  1L1F A;  2H8P C;  2Q8V A;  2YI9 A;  1ITX A;  4K3A A;  2GTS A;  2PZS A;  1LL7 A;  1TUB A;  1GAX A;  4WBN B;  4E2L A;  4MS2 A;  4LF8 O;  3LSS A;  5EBL C;  4C7U A;  4TUY A;  4JI2 O;  2WLL B;  1KBH A;  2F95 B;  3WD0 A;  4ML4 A;  3CC4 V;  1KB9 F;  4LC1 A;  1ZAU A;  4DRX A;  3SPH A;  4LF6 B;  2XP5 A;  2NN4 A;  4GUN A;  3ALF A;  3G6E V;  4Z2I A;  1ZB5 A;  4TX0 A;  3IFX A;  1D5N A;  3JYC A;  1GO3 F;  1NMV A;  1FJD A;  4NB5 A;  2FAP A;  3ZMT A;  1D6O A;  2Q67 A;  2F23 A;  3DGE A;  3LDE A;  4N21 A;  4DRJ A;  2DN9 A;  5H6Q A;  5DF0 A;  1M56 C;  4X20 A;  3ZHV A;  1DF5 A;  3CSX A;  4DW0 A;  4LBE C;  4X9Q A;  3E22 B;  5LL6 Y;  2O9O A;  2W0X A;  3E89 A;  4MTG A;  3F5T A;  4FFB A;  4HAM A;  3CH9 A;  3APQ A;  2ARH A;  4RQF A;  5LMN O;  1S77 D;  4QIB A;  1KT1 A;  3BRC A;  2DE0 X;  2NR5 A;  1ORQ C;  5B3S C;  5F2V O;  3CX5 F;  2JVD A;  2WLN A;  4G50 A;  1UR9 A;  1SQG A;  1E1R G;  3SYC A;  2PUS A;  4J4N A;  3B9A A;  1D5A A;  2BTQ B;  4CC5 A;  1OWQ A;  4LH6 A;  3BEH A;  3RME A;  3JAT B;  3NR7 A;  4GX0 A;  3UO2 A;  1SC5 B;  3WL0 A;  2JZV A;  1BQZ A;  1R6T A;  1XIL A;  2UUB B;  2PV1 A;  2Q7G A;  1KC8 W;  3K06 A;  1M93 A;  2XTA A;  5HKG A;  2F43 G;  3C3T A;  4PA9 A;  5IYZ A;  5HT1 A;  3ARX A;  4CBC A;  1HKJ A;  4R6Z A;  5J6E A;  1NZ6 A;  5BR8 B;  4JZG A;  2A3C A;  2CTW A;  2FKE A;  1GM7 A;  3ASN B;  5ITZ A;  3WD1 A;  1FXV A;  4FLY A;  1IXM A;  3K79 A;  3TJT A;  3UI4 A;  2P90 A;  3KG2 A;  4B3R B;  2ZM6 O;  4O4L A;  4B3T O;  1HR0 B;  1FAF A;  5GW7 A;  3LDD A;  1KU9 A;  4UV9 A;  3BA9 A;  3P30 A;  1SZX A;  3ARP A;  2F1M A;  3LUT B;  3GTY X;  2JJ2 G;  2JGD A;  1NU1 H;  2UXC B;  3AS1 A;  3H1I H;  2F66 C;  4HYO A;  4LFA O;  2KB1 A;  2BSK A;  3NI6 A;  4IYI A;  2AWG A;  4YJ2 B;  4O4J B;  5FNV B;  4RUE A;  4EKW A;  1JNT A;  2GTA A;  3JYM A;  5JVD B;  3ZRX A;  1J5E B;  3EY6 A;  3HKE A;  5IT9 N;  1W1Y A;  2IU0 A;  5LA6 B;  3OR6 C;  1XNQ O;  1S5L Z;  3UQA A;  2BE3 A;  5HFM A;  4MGV A;  1EZJ A;  1E15 A;  4LFB B;  1NWS A;  4RQE A;  3OAA G;  2PI6 A;  3CE2 A;  2OTL V;  4DV4 B;  3CHE A;  4LP8 A;  3P3N A;  4DV2 O;  4JF3 A;  1M57 B;  2WWW A;  3RGB A;  2KQX A;  1R6N A;  4AY1 A;  4DW1 A;  3K58 A;  3CHF A;  2DSU A;  2ADP A;  3ZMS A;  1GK9 A;  2QTS A;  1OCC B;  3K04 A;  1ZU8 A;  1K92 A;  4PA6 A;  1EBO A;  1I08 A;  3K57 A;  3UO3 A;  1G6U A;  2QTO A;  2ZNJ A;  3HR0 A;  5JJN B;  4NTY A;  5FPR A;  3VAW A;  4X88 A;  4ODQ A;  3IC9 A;  3AEI A;  3IKD A;  3H1J H;  3JAM N;  4Z2K A;  5H5N A;  2KR7 A;  4Q22 A;  1X6N A;  3CGM A;  3PRB A;  3CRR A;  5CBH A;  3G6M A;  4AI8 A;  2GUZ B;  3KCE A;  4X1K B;  3O5J A;  4X62 B;  2JS3 A;  1K34 A;  5B66 Z;  4LR3 A;  4NKG B;  4FLV A;  5B1B C;  4U3J B;  1LR1 A;  3W7X A;  4D7T A;  2VQF B;  2A3B A;  1Y74 B;  3JAS A;  2UXB B;  3ABM C;  3KCY A;  4DK1 A;  5L3C A;  4JYA O;  4X65 O;  4FLX A;  2DQ3 A;  4UCT A;  4I55 B;  1Q86 W;  1UFI A;  3BHP A;  5LOV A;  5GON B;  5D5P A;  2YC0 A;  4FM0 A;  1K8A W;  3TDB A;  3JAK B;  4P9P A;  1PL0 A;  2JDI G;  2VS0 A;  3DC6 A;  1VF6 A;  1QLE C;  3CYO A;  1OCO C;  1RSO B;  5DED A;  5FPO A;  4DR5 O;  1XI1 A;  3L74 H;  5J2U A;  2HP8 A;  3RW0 A;  4WKH A;  4DR7 O;  1JOY A;  1VQL V;  3CHD A;  3WFV A;  2NLJ C;  4UCR A;  2HJF C;  3ABK C;  3BPZ A;  3ZIA G;  4R5E A;  4MVQ A;  2DJV A;  4MW8 A;  1Q90 D;  5KX5 A;  5I98 A;  2B9Z A;  5JH8 A;  4P8W A;  3TXQ A;  4DV0 O;  4I0X A;  3J80 N;  3AG2 C;  4WF9 V;  4X1I B;  5BXJ A;  3SYP A;  4DR1 B;  2WK2 A;  3JAW A;  1AIL A;  2YIB A;  3E86 A;  4IYH A;  4I50 B;  2KG7 B;  2QM8 A;  1FKJ A;  3CRM A;  2RMK B;  2OCH A;  1FKK A;  3Q4H B;  1X6L A;  1G8M A;  3TXS A;  3LSU A;  1DF4 A;  5IY5 C;  3H9R B;  2WLJ A;  3ABT A;  3K5O A;  3DXR A;  1LUW A;  4DV3 O;  4I7Z B;  3AQU A;  1QR9 A;  2EZO A;  1WB7 A;  3I6C A;  1P7G A;  3OTO O;  4D7S A;  3MDY B;  5LMN B;  4DR4 B;  4JFJ A;  3GB7 C;  1YZB A;  2ZR5 A;  1SQQ H;  1G4Y B;  4O4H A;  4O4I A;  4ZOL B;  4JI0 B;  4LWS A;  1K7D A;  4DT4 A;  2W6J G;  4TSF G;  2DOS A;  4PV1 B;  3RM8 A;  3ETE A;  4A5U B;  1XBL A;  2X6C A;  3LNM B;  4LF6 O;  1WN7 A;  2ITK A;  4QE7 A;  3R66 A;  1K33 A;  4YXW G;  1LNQ A;  1D2D A;  1YTF D;  4P9O A;  3HKB B;  5DO2 A;  4Q7N A;  1LJY A;  4YJ3 A;  1R1B A;  2P06 A;  3IK8 A;  4JTA B;  1TVK A;  3ZN1 A;  4LF4 B;  4HBO A;  3ASO B;  4URI A;  4ZPT R;  4CH3 A;  3I5D A;  4BW9 A;  4O2A A;  3UCS C;  1FXK C;  2QKA A;  3B9D A;  1AJQ A;  2Q7H A;  3ARZ A;  2HJD A;  1NTZ H;  1OHH G;  2PI5 A;  1OGB A;  1ZL1 A;  1FKT A;  1M56 B;  3I55 V;  4MVZ A;  3T1H B;  3DC5 A;  4DV7 B;  3C3S A;  1NVP B;  4WKF A;  2YXH A;  2AW9 A;  4S3J A;  4EB6 A;  3B8S A;  1N36 B;  2UUC B;  4U85 A;  4MNM A;  3W7W A;  1FYJ A;  4WFB V;  2Q68 A;  4DRQ A;  3O5F A;  2Y0I A;  2Y48 A;  3D3Q A;  2ZM6 B;  3OMI B;  4KR0 B;  2ZE5 A;  2VQE B;  2MPH A;  1PP9 H;  3QTC A;  3G67 A;  3CJH B;  1SER A;  2DYR C;  3ARV A;  1NR1 A;  2ZR2 A;  3M8A A;  2Q0A A;  5B3S B;  1WP8 A;  4N23 A;  5EC2 C;  2B31 A;  3VQW A;  4TUY B;  5LYJ A;  5EC1 C;  1VQ4 V;  1PNM A;  1JQ0 A;  3TGU H;  2V1D A;  2ZT9 B;  2UUB O;  1OZ0 A;  2QF8 A;  4TOI A;  1QHT A;  2XND G;  2QJ1 A;  4FMT A;  1URF A;  4BIZ A;  2IJI A;  1FS0 G;  2PYJ A;  4Z2H A;  5JWP A;  3SGI A;  3CCV V;  1HDJ A;  3FAP A;  3JAR B;  1S3J A;  3SR2 C;  5BR8 O;  4ZPV R;  1MZE A;  1PL4 A;  2Q69 A;  3FB6 C;  4X20 B;  1OCR C;  5J2T B;  1QPL A;  2YXL A;  3MAQ A;  4EEQ A;  2XOK G;  1WA8 A;  2BTO A;  1XQ8 A;  1F40 A;  4TQF A;  2DYS C;  5JH7 B;  4MT8 A;  2WLM A;  1EN6 A;  4B3R O;  4JYC A;  1JCH A;  3WG7 B;  2XAS A;  3KZ7 A;  4ODM A;  1VQ9 V;  1HR0 O;  4ODN A;  2WAM A;  4FFK A;  4JI7 B;  4FFB B;  3WU2 Z;  2MK3 A;  1FKF A;  5LHH A;  3RYF A;  5IJ9 A;  2X6B A;  1QNM A;  1MZF A;  4Z2J A;  2HEP A;  2CH7 B;  1AP5 A;  5H2F Z;  4WFE A;  2UXC O;  2A79 B;  1CPY A;  2HG5 C;  1Y66 A;  1Q7Y W;  1AJN A;  4TW7 A;  1WPX A;  5IDJ A;  2RJZ A;  1E79 G;  2P67 A;  3FB5 C;  4CC6 A;  1N8R W;  1FJG B;  4DRN A;  3CWB H;  2YID A;  4UFZ A;  3RYI A;  5L3E A;  1FFT B;  2K1E A;  3RM4 A;  1C9H A;  1J5E O;  4CS4 A;  3C90 A;  3IHZ A;  4LFB O;  4J10 A;  2LJ2 A;  2AZ0 A;  5DEZ A;  1KKC A;  3ETD A;  4HNA A;  1WP7 A;  1NR7 A;  2UXD B;  2VCD A;  4GKK B;  4DV4 O;  3B8N A;  4CH6 A;  2JS5 A;  3OOB A;  1R3L C;  5FL7 G;  2MLY A;  3A0H Z;  4G2P A;  4AHC A;  1FKB A;  3N27 A;  4UV8 A;  1V54 C;  4J4O A;  4CS3 A;  1M5I A;  3BAB A;  5LMU B;  4XBF A;  2R9R B;  2ZE6 A;  1FKS A;  1ZWI C;  1LQ0 A;  4NTX A;  4O4L B;  1V9P A;  1NQT A;  4LF9 B;  2DT2 A;  4ICG A;  5B1N A;  4W4L A;  1M9N A;  3OMN B;  2RUC A;  2FB5 A;  2D2C B;  4DH0 A;  3CD6 V;  3CB2 A;  3JD4 A;  4X62 O;  2JGD B;  1GMG A;  4KP4 A;  3EVK A;  1COW G;  1BT8 A;  1BHA A;  3O5R A;  2CAZ C;  4PDR A;  3IAY A;  1K9T A;  4UXN A;  2VQF O;  3BVO A;  4WKA A;  4PI0 A;  4H33 A;  1WPB A;  4TW8 A;  3HKE B;  4R50 A;  3SDL A;  1VQ7 V;  3SJC C;  1IBM B;  4BW5 A;  1X4T A;  5IYB O;  3WD4 A;  1P84 F;  5B1B B;  4ZIB A;  1SS3 A;  2Z0A A;  1W0K G;  2A3A A;  2VN1 A;  4MNL A;  3ABM B;  1N32 B;  1NT2 B;  2ZDI A;  3T1Y B;  1QBZ A;  1BQ0 A;  1TAE A;  3KCX A;  4K8Z A;  2XHB A;  4ZS6 A;  3M7M X;  3SPC A;  4EFB A;  4YHH B;  4G27 B;  3RVY A;  2EIJ C;  1YW5 A;  2F4E A;  4PDL A;  1K5Q A;  1PNK A;  1LL6 A;  4FAP A;  2C2A A;  1AR1 B;  4GT1 A;  1QLE B;  1NTM H;  1OCO B;  2G8Z A;  2QSA A;  1WJZ A;  3P32 A;  5EIB D;  3ZBH A;  1UJW B;  3RYH A;  1F51 A;  2XP7 A;  4QT3 A;  3DTU B;  4PI2 A;  3AK3 A;  1FD9 A;  1ZLZ A;  4RAI A;  4J7Z A;  5DIU A;  5B8I C;  3ASO C;  2RDC A;  4DV5 B;  1GOI A;  5IYC O;  3G4S V;  4DR1 O;  1EN4 A;  1MSD A;  4XDJ A;  2DT3 A;  3ABK B;  1L1P A;  4I9W A;  1NH2 B;  2DPE A;  3WQV A;  1GN2 A;  2ZXW C;  2OIG A;  4ODP A;  2UXX A;  5EBW C;  2QR4 A;  4Z2G A;  3AG2 B;  3JAS B;  1H8H G;  2AGA A;  2M6Y A;  3O5I A;  1Y6X A;  1EHN A;  2EIK B;  5DIV A;  2OFN A;  1Q8I A;  1BE3 H;  4B7E A;  2Y4U A;  1XHG A;  4G2K A;  1LUV A;  4DR4 O;  3CXC U;  1N34 O;  1O6I A;  4KFM A;  2LGW A;  2G38 A;  3E8G A;  2KKW A;  1CP9 A;  5IY5 B;  2XP8 A;  1DGS A;  4JI0 O;  1N33 B;  1YVW A;  2ZE7 A;  4ZHQ A;  1OGG A;  3GWK C;  5D75 A;  3B9E A;  4UVA A;  3CCR V;  5J2U B;  5HW7 A;  3ARR A;  2HHH B;  3O65 A;  3JSL A;  4WK9 A;  4JAU A;  3T4Z A;  2ITC C;  1RP3 B;  3PR9 A;  2XP4 A;  3JCZ A;  5L3D A;  3TET A;  2A06 H;  4Z2L A;  3ARO A; 
#chains in the Genus database with same CATH homology
 3UQI A;  2RUQ A;  2DG4 A;  5GPG A;  3KAD A;  4XAK A;  2WLZ A;  4LAY A;  1HKI A;  3ART A;  1EYM A;  3TDB A;  4ODR A;  4C02 B;  4DRM A;  1D7I A;  2MLZ A;  3OA5 A;  2F2D A;  3FY1 A;  3O5P A;  1ZBC A;  5HTG A;  1UR8 A;  5HWB A;  1H0I A;  3JYJ A;  4NSB A;  2KGJ A;  2F21 A;  4WKH A;  1E6R A;  2UZ5 A;  3CHD A;  2PPO A;  2PPN A;  4IT4 A;  2MF9 A;  4HBE A;  4R5E A;  3NTP A;  1FFQ A;  2DSV A;  4WJX A;  4DIP A;  5I98 A;  5JH8 A;  1D7H A;  3RFW A;  4P8W A;  3ARU A;  1WB0 A;  1QPF A;  5BXJ A;  1JVW A;  2WK2 A;  2XP9 A;  5HW6 A;  2D9F A;  1E6Z A;  1NSG A;  3O5E A;  2RUD A;  1FKJ A;  1FKK A;  3WIJ A;  1BKF A;  1LG2 A;  1W26 A;  1W9V A;  1X6L A;  2ZR6 A;  4O2T A;  1TFV A;  3ARS A;  1NWU A;  1W1V A;  3H9R B;  2N87 A;  2OLH A;  4DWS D;  2DT1 A;  1QZ2 A;  3AQU A;  2YBT A;  3I6C A;  2KO7 A;  3MDY B;  4ITZ A;  4JFJ A;  2ZR5 A;  4KQZ A;  3NRK A;  4ZPW R;  4WIW A;  1XRV A;  1GPF A;  1HJV A;  1Y0O A;  4S3K A;  4DT4 A;  4N19 A;  1IX5 A;  3RM8 A;  3KAI A;  4MNJ A;  4DRP A;  1N1A A;  2ITK A;  3QOK A;  2ESC A;  3KAC A;  5HW8 A;  1P5Q A;  2ZQT A;  3B09 A;  1F8A B;  1FKD A;  3RGC A;  4MNK A;  1WNO A;  4MTV A;  5DO2 A;  1HKK A;  4Q7N A;  2RUR A;  3ARQ A;  1LJY A;  1WAW A;  4W9Q A;  2KI3 A;  4DWS B;  3G6L A;  3WKZ A;  3IK8 A;  3B7X A;  1W9P A;  4HBO A;  1D2K A;  4JFI A;  1Q1C A;  4URI A;  4ZPT R;  3O5Q A;  4LAW A;  1FFR A;  3B9D A;  1ZBW A;  2PV2 A;  4IT6 A;  3ARZ A;  4ODL A;  1YAT A;  1ZL1 A;  1OGB A;  4FN2 A;  4P8X A;  1FKT A;  2Q5A A;  3RM9 A;  3WD2 A;  4WKF A;  5GQB A;  1ZBV A;  4S3J A;  3B8S A;  1J4R A;  4R0X A;  4U85 A;  4DRI A;  3KAG A;  4MNM A;  1FKR A;  3O5L A;  4DRQ A;  3O5F A;  3O5G A;  1HXV A;  4KR0 B;  4DRK A;  1W1P A;  2MPH A;  2WM0 A;  1FKL A;  2DSW A;  1NH6 A;  3CZ8 A;  3ARV A;  4IPX A;  4ODK A;  1M5Y A;  4IQC A;  4P8U A;  4DWS A;  3AS3 A;  1JNS A;  2B31 A;  1Q6U A;  4DZ2 A;  1W9U A;  2QF8 A;  2LJ4 A;  3O5O A;  1R9H A;  2ZQV A;  2ZQS A;  1Q6H A;  3ARW A;  4L72 B;  5DIT A;  4Z2H A;  5GPR A;  2DT0 A;  3WQW A;  3FAP A;  1D7J A;  2ZR4 A;  1ROU A;  4ZPV R;  3KAH A;  2DG9 A;  3PA7 A;  4JFL A;  1QPL A;  3JXV A;  4MSP A;  3UI6 A;  2PPP A;  4MPK A;  4NZC A;  1F40 A;  1SYT A;  4GGQ A;  4BF8 A;  1ITX A;  3KZ7 A;  4ODM A;  1HJW A;  4ODN A;  1LL7 A;  4LAV A;  1FKF A;  4QZV B;  3LUO A;  5HBF A;  1EDQ A;  3WD0 A;  4Z2J A;  4ML4 A;  4DWS C;  2M08 A;  1TCO C;  2PV3 A;  3W4R A;  2XP5 A;  1CTN A;  2LPV A;  1E6N A;  3ALF A;  4Z2I A;  1NMW A;  1ZB5 A;  4TX0 A;  4TW7 A;  4GIV A;  1NMV A;  1W1T A;  1FJD A;  4DRN A;  2FAP A;  1D6O A;  4DRJ A;  3RM4 A;  5DF0 A;  1C9H A;  2RSE A;  4NNR A;  1U79 A;  4DZ3 A;  3AS2 A;  3BXW A;  2A3E A;  1J6Y A;  3IHZ A;  1A7X A;  4DRH A;  1LL4 A;  2O9O A;  4JYS A;  5DEZ A;  2IUZ A;  2VCD A;  4IQ2 A;  3CH9 A;  4TYO A;  3OOB A;  2MLY A;  1KT1 A;  4QIB A;  4G2P A;  2KFW A;  1FKB A;  4G50 A;  4J4O A;  1UR9 A;  1H0G A;  4W5U A;  4J4N A;  3B9A A;  2IF4 A;  1E6P A;  1OWQ A;  1FKS A;  3RME A;  2WLY A;  2KE0 A;  1LQ0 A;  2LGO A;  1FAP A;  1LG1 A;  2DT2 A;  2JZV A;  2LKN A;  3WL0 A;  4DRO A;  3ARY A;  1JNE A;  2RUC A;  4W9O A;  4DH0 A;  1E9L A;  2PV1 A;  3ODK A;  1NWR A;  1J4I A;  2K8I A;  5HKG A;  1FKH A;  3UQB A;  3O5R A;  5HT1 A;  3ARX A;  3FXY A;  1HKJ A;  3UF8 A;  1K9T A;  1EIB A;  4WKA A;  5J6E A;  2A3C A;  2AOS A;  4TW8 A;  1JND A;  2FKE A;  1J4H A;  2O92 A;  1T11 A;  3WD1 A;  4U84 A;  1FKI A;  3WD4 A;  3UI4 A;  2M1I A;  4TW6 A;  3CHC A;  5HWC A;  1PBK A;  2A3A A;  2VN1 A;  2MNT A;  2M2A A;  2Y78 A;  3KAB A;  4MNL A;  2DG3 A;  1VF8 A;  1RD6 A;  2MLX A;  3ARP A;  2XP6 A;  4MAV A;  4ZS6 A;  1YW5 A;  2F4E A;  3ALG A;  1NWT A;  3AS1 A;  4JFK A;  1LL6 A;  4FAP A;  1HJX A;  3NI6 A;  3WD3 A;  2AWG A;  3TC5 A;  3O5D A;  2G8Z A;  1ROT A;  1EQ3 A;  3WH0 A;  3PRD A;  1JNT A;  3JYM A;  2XP7 A;  4QT3 A;  3EY6 A;  1PIN A;  1FD9 A;  1W1Y A;  5HUA A;  5DIU A;  5B8I C;  3UQA A;  3WL1 A;  1GOI A;  2ZQU A;  1E15 A;  4MGV A;  4PTM A;  3O5K A;  1GUV A;  1NWS A;  1BL4 A;  2PI6 A;  4LAX A;  1KT0 A;  3O5M A;  2PBC A;  2DT3 A;  2XPB A;  1L1P A;  3CHE A;  4P8V A;  1KFW A;  2DPE A;  4TNS A;  3WQV A;  1B6C A;  4ODP A;  3GPK A;  4U86 A;  4AY1 A;  4Z2G A;  3CHF A;  2DSU A;  3AS0 A;  3O5I A;  1HKM A;  1EHN A;  5DIV A;  2OFN A;  4JFM A;  1ZU8 A;  1ZBK A;  1XHG A;  1O6I A;  3KAF A;  1ZCN A;  2XPA A;  4ODO A;  2RQS A;  4L3N A;  3VAW A;  3TCZ A;  2YBU A;  4ODQ A;  3UI5 A;  2L2S A;  3IKD A;  3IKG A;  2XP8 A;  4Z2K A;  2KR7 A;  4Q22 A;  1X6N A;  2G41 A;  3CGM A;  3PRB A;  4LGX A;  1OGG A;  1FKG A;  3G6M A;  1ZK6 A;  3KCE A;  2DSZ A;  5D75 A;  2FDM A;  3B9E A;  3O5J A;  4W9P A;  5HW7 A;  4HAR A;  3ARR A;  3CGN A;  4WK9 A;  2XP3 A;  1SR0 A;  3PR9 A;  2XP4 A;  3PRA A;  1Q6I A;  4QT2 A;  4Z2L A;  3ARO A;  2A3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...