1FD9A

Crystal structure of the macrophage infectivity potentiator protein (mip) a major virulence factor from legionella pneumophila
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
204
structure length
204
Chain Sequence
b'TDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MACROPHAGE INFECTIVITY POTENTIATOR PROTEIN)
publication title Crystal structure of Mip, a prolylisomerase from Legionella pneumophila
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Isomerase
total genus 64
structure length 204
sequence length 204
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1fd9A02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fd9A01
3KABA 3B09A 4DIPA 1FKRA 1YW5A 4W9OA 1FAPA 4ITZA 2PV1A 3KZ7A 4JFJA 1PINA 3H9RB 2KFWA 1P5QA 1Y0OA 1YATA 4GGQA 4DRNA 1FKLA 1FKHA 1D6OA 3IHZA 5BXJA 2Q5AA 3UI4A 5J6EA 5HW8A 3O5KA 2MNTA 1FKJA 1J4RA 5HWBA 4DRMA 2XP5A 2XP3A 4W9PA 3O5MA 5HT1A 2XP8A 2RURA 3FAPA 4LAYA 1FKSA 4N19A 1FKBA 3TCZA 4DZ2A 2KO7A 2PPPA 3LUOA 2LKNA 1QPLA 1JVWA 4LAVA 2MLYA 3EY6A 2MF9A 5D75A 1JNSA 2PV2A 2ZR6A 4J4NA 4DRKA 2K8IA 2DG3A 3IKGA 4ODLA 5DIVA 3O5EA 4DRHA 1EQ3A 3KADA 5B8IC 1FKFA 3KAIA 4JFKA 5HKGA 5DITA 1QPFA 2MLXA 4IQCA 5HW6A 5I98A 5HUAA 1F8AB 2F2DA 3NTPA 1QZ2A 1EYMA 3UI6A 3O5JA 3VAWA 4DROA 1FKGA 1ZCNA 4JFLA 4O2TA 4MSPA 2KGJA 3MDYB 2PPOA 1M5YA 4ODNA 1NSGA 3IKDA 4G2PA 4IQ2A 1NMWA 2XP4A 3O5QA 2L2SA 2MLZA 1JNTA 4FN2A 4QT3A 2XPAA 2ZQVA 1B6CA 1J6YA 1U79A 2PV3A 2M2AA 4JFMA 4LAWA 4QIBA 4TX0A 5HTGA 3PRBA 1HXVA 1R9HA 3O5DA 3O5RA 4ODQA 4BF8A 1ROTA 4TNSA 1ZK6A 3RFWA 1KT0A 2ZR5A 2N87A 4DH0A 3NRKA 2JZVA 4TYOA 2IF4A 1A7XA 1W26A 2Y78A 3O5LA 3PA7A 4DRJA 3CGNA 5DIUA 1FKIA 2RUQA 1FKTA 3O5PA 3UQIA 3O5OA 2F4EA 2ZQUA 5GPGA 4W9QA 2XP6A 4U86A 4C02B 4LAXA 2OFNA 4MGVA 1L1PA 2M1IA 2FAPA 2XP7A 3TDBA 1BKFA 1FKDA 3O5GA 3ODKA 4DRPA 2ZR4A 1FJDA 3WH0A 2ZQTA 2RQSA 4ODKA 1Q6IA 1ROUA 4QT2A 2KI3A 3RGCA 3UF8A 4U84A 2XPBA 4TW7A 4JYSA 3KAGA 4JFIA 3GPKA 3KAHA 3KAFA 4ODRA 3KACA 2AWGA 1NMVA 3I6CA 4DZ3A 5HW7A 4DRIA 1D7HA 3OOBA 4ODPA 4TW8A 3JXVA 2ITKA 1N1AA 1TCOC 3UQAA 1D7JA 1KT1A 3CGMA 3IK8A 4J4OA 4NNRA 1Q6HA 4G50A 2M08A 2FKEA 1FKKA 1Q6UA 1D7IA 2D9FA 2ZQSA 2RUCA 4R0XA 4DT4A 2UZ5A 4GIVA 3UQBA 2LJ4A 4U85A 4DRQA 2VCDA 3NI6A 3JYJA 1BL4A 2DG9A 3JYMA 2KR7A 1T11A 2DG4A 2RSEA 3PRDA 4ODMA 4FAPA 2LPVA 1PBKA 1C9HA 3B7XA 3KCEA 4IPXA 2PBCA 1Q1CA 4ODOA 1FD9A 1F40A 2KE0A 2LGOA 3TC5A 2MPHA 3UI5A 3O5IA 1J4HA 2VN1A 2XP9A 2RUDA 4TW6A 5HWCA 2PPNA 1J4IA 2F21A 3O5FA
chains in the Genus database with same CATH superfamily
3QOKA 3SPHA 2PV1A 5H9CA 1GN6A 3CCUV 1HNZO 3OMAB 1M4UA 5KMGA 5EYPB 5FLXN 4MVQA 4DR7O 3OR6C 5CBFA 2HJDA 3A0HZ 4YIOA 2Q5AA 5J6EA 4ICGA 4EEQA 4HYOA 1J5EO 1NTKH 2QKCA 3FB7C 1FXVA 2YSUB 4LAYA 3E2EA 2WLMA 1MZFA 1Q90D 3LUOA 5KHHA 1GN4A 3ZX6A 4J4NA 3L72H 4LCUC 1MG1A 1NU1H 4IT4A 1X4TA 2ADQB 1LNQA 2YIDA 1VF5B 2P6JA 4O2TA 1M93A 5BY1A 4MSWC 1W1VA 2GSMB 4XDKA 1ZBKA 4BIUA 1BE3H 4QT3A 3ZN1A 1YI2V 3RYFA 4D7TA 5F2VO 3A2FA 5A9GA 3CC2V 2HJFC 1BT8A 5LBQA 2VQEB 1JVMA 3D8CA 3T1CA 4TYOA 3WB0A 1S5HC 4FLWA 1CTNA 1AP5A 5JCOC 1K5QA 1KBHA 1NH6A 3HKEB 4XDLA 1BQZA 3ASNB 1AI6A 4I7ZB 1OZ0A 3P32A 2ZT9B 5CA0B 1I94B 3N27A 3NXSA 3KZIZ 3ZHUA 3EVKA 4BR6A 1QVFU 1GK9A 2KQXA 5B3SC 3JYCA 4N21A 1GMGA 3OOBA 1NS1A 3G4SV 4O4LB 1OGGA 4NNRA 1HDJA 2QWQB 3FB8C 3K03A 3APOA 3PRAA 2UZ5A 4P8WA 4P8XA 3ABUA 4DRQA 4PDLA 2DG9A 1LL6A 5EC2C 1W9PA 1X6NA 2AGAA 1F7YA 3VQVA 1FD9A 4KP4A 4B3MO 1YITV 2UXXA 4MTFA 5JJEB 2NNUA 4X89A 4OGQB 3F5WC 2WLZA 1WN7A 4TV9A 4LWSB 4OX9O 2JGUA 5EZYB 1IBMB 1NTZH 2WSSG 3K9SA 5B1BC 4QE9A 2YBUA 2FMLA 2CTPA 5BXJA 1PKXA 5HW8A 3SYCA 4ZOLA 5HBFA 2B31A 3O5MA 1Y4MA 5LOVB 1KC8W 4GKJB 1VQ8V 1AROP 1RFYA 4FM2A 2QR4A 1JVWA 4LAVA 2A7WA 2DSVA 3BABA 2LFSA 3QG5A 5HKGA 1RM1B 5DITA 2DW4A 2JDIG 5HUAA 4WFAV 1D2DA 4JAVA 4PDVA 3RMEA 2ZDIA 4JFLA 4MW8A 3TCUA 4G2PA 5L3EA 2XP4A 3JD3A 4JV5O 2ZQVA 1J6YA 2DT3A 4LGXA 2EILB 2K9PA 3H1LH 3L71H 3JAKB 3ARWA 2CAZC 2ZKOA 1F4NA 5HTGA 2YICA 3ABTA 1R9HA 4DR5B 4X65B 3HKDB 4I9WA 2DQ3A 1KT0A 2ZE5A 2IF4A 4X66B 1QCEA 2DWEC 5CBHA 4B7KA 3B8MA 1PD3A 1XOUA 1NVPB 5CA1A 1A7XA 4K0KB 3O5LA 1FFTB 1NTMH 1IX5A 3M8AA 4AI8A 5L3GA 5B1AB 2M1IA 1J95A 4JI7O 4S3JA 1SQFA 1QQCA 2P4VA 4MNLA 3ODKA 1Q43A 3WKZA 1ROUA 2MK3A 1VP7A 4O2BA 3WFVA 1X59A 2A79B 4UCOA 4LBEC 1FFXB 1KMIZ 1RPRA 3C3TA 3JXVA 1W59A 4PA9A 3H01A 1QR8A 4L87A 1Y76B 5KA6A 3CC7V 2A9HA 4O4JA 4KHPO 2VCDA 1ZLZA 3OGIB 2GDSA 4QJFB 5JH7B 3B7XA 3AS0A 4NXMO 4DWSD 3R66A 4JI6B 1KP3A 1XNRO 4JYAB 5KA5A 4Z2WA 2Y69C 4W9OA 2DPEA 1I0HA 2WPDG 1Y6XA 2KFWA 4GGQA 4MVSA 3DSQA 3K0GA 5B1BB 1HJWA 4Q7NA 3JD2A 3FB5C 5LGNA 2LO1A 1KD1W 4JPRA 4I4TA 5EBLC 3ARTA 3SYAA 1B3QA 4G27B 2QWPB 4UXNA 5KAFZ 3PN1A 1FKFA 1YF2A 3ABMC 2ZM6B 1N0JA 2B1GA 4LP8A 1ZCNA 4NXNO 1IX9A 3CJHB 4ABMA 4Q22A 4LWSA 4TQDA 4ZKIA 4JZGA 2UUAO 1XREA 3L75H 3CS5A 1ROTA 1IZ3A 1PPJH 1KECA 1FJGB 2C2AA 4I0XA 1E6NA 3OD4A 4Z2JA 5LYJB 3A0BZ 4O2AB 3PA7A 3FD9A 5LOVA 3JCUZ 5H5NA 3SDLA 4C02B 3JSLA 3AS2A 1LG2A 4K35A 1QHTA 1CXZB 4IHJA 4IGGA 1FXKB 4KQZA 4GYCB 3B40A 4JI2B 3GWKC 2HFEC 4LH7A 3W7SA 1EFRG 2F66C 4PV1B 5J2TA 4DR4B 1JFFA 3H1HH 4U84A 4TW7A 1WP7A 1DF5A 3ALFA 3B9DA 2RCVA 4ODRA 2QKAA 1G6UA 2P06A 2YXYA 2CE4A 4R5EA 1B06A 4AHCA 2KKWA 2R9RB 3HR0A 3JAKA 2B5UB 4P9OA 4DV0O 1XNQO 3FB6C 4JI3B 2M08A 2IJHA 3RYHB 1S5LZ 2CTWA 1I5XA 4CC5A 5K1PA 4MNMA 1NKDA 1FYJA 1THZA 1K97A 3FAVB 3E8GA 4ZIBA 5LA6B 5TISZ 4J41A 1HNWO 2MPHA 1SESA 1ZWIC 3T1YO 1JJ2U 4IIJA 1L0NH 1MABG 2E75B 1MSDA 2ITCC 3JASB 3F5TA 4QZVB 1PINA 3THOA 3AQUA 4WFEA 1CEZA 3CWBH 2WLNA 1FKLA 4UCSA 3SJBC 3IHZA 4AQYO 3K5MA 2A06H 3E83A 1PNLA 2Q5ZA 3APQA 2UU9B 3WQVA 5LHGA 1WNSA 3FAPA 1JNEA 1I5YA 4DUYO 2RJZA 4LF5B 1JPXA 2WLLA 2A0LA 2EIJC 1HWYA 2K8IA 3BAAA 2DG3A 5CN0A 3ABMB 1EQ3A 3WB1A 4JI0B 3ARYA 3BXWA 1W0KG 3CHDA 4DROA 4DT4A 2HG5C 2ZXWC 1AP6A 4P2ZA 4E2LA 4DR3O 2R9AA 4DV6B 5JQGB 1NZ6A 4TUYA 2MLZA 1WA8B 2DWDC 5EC1C 5BR8B 1N36O 4JFMA 5ITZA 1NJIW 2O92A 2BTQB 4TSFG 2Y4TA 1XEQA 1GN3A 2Q7HA 4TNSA 4W5UA 2Q7GA 2Q0AA 3ZHSA 3TETA 4X62B 2G8ZA 5CMUA 1FKIA 3ZRXA 3K5LA 2DT1A 4LAXA 4DK0A 1H2KA 5CB4B 1LUVA 4J7JA 3G80A 4PA7A 3VOUA 3GPKA 3KAFA 3B8NA 4TW8A 2JIZG 4MAVA 3ZMTA 4FFBA 1D2KA 5HFLA 4HBOA 4EB6B 3UCSC 2D3OW 5LYJA 1N0NA 1TUEB 2DG4A 2LFRA 1E79G 2QTSA 1WLEA 4LFCB 2LPVA 2WLKA 3OGCC 3KCEA 1NVPD 3ABKB 3L74H 4DV1B 2JGDA 2X7RB 1K4DC 4GUNA 1UJWB 1PNKA 5KMGB 2F21A 3UO2A 5LP6C 2UUBO 2JEUA 1YJWV 3S3XA 1Z2GA 1BSMA 3P3NA 1H2NA 1ITXA 2X0LA 2R70A 2DSUA 3LSSA 3RM9A 1M5IA 3RYHA 1HR0O 1HJXA 4HAMA 2IJJA 3ZMVA 2XP3A 3CEIA 5HT1A 3ZHVA 4JAUA 5KHGA 1DTOA 1MZEA 1OJHA 5L3DA 3CXHF 3K5OA 3ZRWA 4YY3B 4WFGA 4TT3G 4P30A 1L0LH 2MLYA 2DYSC 2YI9A 2EX3A 1EIBA 4LFAB 3KADA 4JFKA 3W7XA 1WB0A 2MLXA 5I98A 2OCCB 3N2KA 2GTSA 3WD4A 2Q9LA 3ZMSA 3TJTA 3RYFB 3KKYA 3VAWA 4J42A 1VF6A 3MDYB 2Y48A 4Z2LA 3LSQA 4MW3A 4X9QA 1FFQA 1K8AW 3GB7C 3CRQA 4WKAA 3IAYA 4LFBB 4IT5A 4WF9V 4B3RB 1COWG 4TX0A 1XHZA 1G4YB 2PTMA 3AG2B 4LF7O 3ZBHA 2JZVA 3BY6A 1Q81W 1LG1A 1Z5VA 2QWRB 1W26A 3JD0A 3ARRA 3O5PA 4W9QA 2QTOA 3E86A 4DR1B 4MGVA 3LNNA 4K8XA 3TDBA 2IW5A 1N34B 3CC4V 4WFBV 1Y66A 1VMGA 4RAIA 4DV7B 4LC1A 4PDMA 2B1IA 1F23A 4OPHA 2KI3A 2F43G 4ZPVR 5FL7G 1E9LA 3RGBA 2ZQMA 2K1EA 3OW2U 4B3SB 4IT6A 2D9FA 2RUCA 5IJ0A 1M9NA 2N05A 3C90A 4C7UA 2VQFB 4TV8A 1JCHA 3KCXA 1D5AA 3RYCA 2YUAA 1FPOA 3CHCA 1T5EA 2PN0A 3CH9A 4MTGA 4WCEV 1ZBWA 1IBLO 2UXBB 5CB4A 1KKCA 2ZR2A 4TV9B 1XMQO 2Q67A 1TUBA 1GH6A 5KAIZ 5KUMA 1L8DA 3SYPA 4KR0B 4JFJA 1WJZA 3SJCC 4ZOLB 1FFRA 2Q4PA 2R9IA 4K3AA 3WG7B 5LMUB 4DRNA 2JEXA 3K5NA 1YDXA 1XDCA 2UXCB 1NWRA 5HWBA 2IU0A 5B1OA 2WLHA 1BGYH 4N19A 3E35A 4FMTA 4CBCA 4NYKA 2LKNA 2DYSB 4ZBMA 3IC9A 2ZR6A 1BCCH 3BA9A 2UXNA 1EHNA 1O6IA 4YJ3A 4BWAA 4J9ZB 3UI6A 1OV9A 1WB8A 2WM0A 1AI7A 1Q82W 1NSGA 2F95B 1EZVH 4B3TO 5IDJA 1VQ4V 3CCEV 1I7FA 3TXSA 3CCMV 2ZIMA 4FLZA 2ZE8A 5CA1B 2ZNJA 5JVDA 1SS3A 1CP9A 4GKKB 2PUSA 3E8HA 3Q4HA 1P4RA 1RM1C 2B9ZA 2ZNIA 4CS2A 3CPWU 1GAXA 4O2BB 5IJ9A 4MVZA 4LF8B 4ODKA 4QT2A 3WL1A 4LF6B 4MVMA 1HKKA 5KX5A 4ZHQA 2EILC 1FS0G 5EBMC 1Q3EA 1HP8A 4O4JB 3J81N 2L35A 3I56V 1R6TA 4DXWA 4P8VA 5JJNB 4IL6Z 2QGNA 4PJ0Z 3HB3B 2CK3G 4MVOA 4LF9O 5B1AC 3NI6A 3LNMB 2DT0A 3ML0A 1DLBA 4JTAB 5GTIZ 3IGAC 2DSZA 2P5OA 2KE0A 2LGOA 4JAAA 4JI3O 3T4DA 1KUQA 2QKSA 2VN1A 1H8HG 1J4IA 4I9QA 3O5FA 1ZBCA 1ENVA 4X8AA 3K57A 2YEVA 4X20A 4I50B 1FKHA 3JD4A 5JJJB 4I4TB 2F1MA 3OAAG 3RVZA 2AW9A 3SJQC 3H1IH 4RO2A 1OCZC 1H2SB 2HEPA 4DV5B 2A3EA 2BCCH 1KYOF 3ETGA 2IM9A 3R65A 5LMNB 4ZI7A 2KO7A 2D2CB 1Y67A 4R7CA 1ROPA 2WLIA 5B8IC 3KAIA 4MNKA 5GPRA 2G41A 1EDQA 5FPOA 5J2UA 2OCHA 2E5LB 3FFQA 4I0XB 3CCVV 2QSAA 2Z3YA 2HR3A 1IBKB 2KB1A 3WQWA 5HFMA 1RP3B 2N87A 3ZRVA 4X1IA 1N32B 4IHJB 2PYJA 1AB3A 4WIWA 5DIUA 3LDDA 3MHHC 2Q7EA 2XP6A 3AROA 2ODMA 5DN6G 1L1PA 5J2TB 3LSUA 1NWUA 1JFFB 1SZXA 1Q7YW 4JI4O 4A5UB 1FJDA 1JA8A 1ZL8A 1GN2A 3ABLB 3VQYA 4X62O 4O4HA 2F4VB 4EFBA 4Q20A 3OTOO 1YJNV 4LF4O 1GPFA 3CX5F 2OTLV 1NMVA 4DZ3A 4DRIA 5A2QN 2OT5A 1IDSA 1H8EG 1VQLV 3QO5A 4R0XA 2YIBA 5FPRA 2ZIOA 2XT9A 2QWNB 2IJIA 5GW7A 3OMNB 3JYMA 1T11A 4IIJB 1FXKC 3PJSK 3CHFA 4YHHB 2ILMA 3CCQV 3B8SA 1YSCA 4TOIA 1LUWA 4JI1B 4AILC 3DXRA 1EBOA 4NTWA 3VQXA 3OUFA 4ITZA 3UM7A 3AG1B 1OHHG 4H0LB 4LFCO 3H9RB 3SPCA 1Y0OA 2Q0OC 4P9PA 3AEIA 3AG4B 4DUZB 1SF9A 4I55B 1S3JA 1OCZB 4X1YB 3BCCH 3UQ8A 3T1HO 4JI5B 2WLLB 1U96A 1WP8A 2PF4E 4TQFA 2IUZA 1QNMA 4O4IA 2HHHO 5L3FA 1E15A 2UXDO 2PV2A 4DRKA 3G6LA 1B6QA 1HKMA 4TUYB 1XI1A 3NTPA 1QZ2A 4X64O 5ITZB 4U7NA 2DN9A 2CDYA 4IQ2A 1XQ8A 4DYLA 5AG2A 3RT3C 4KL1A 3O5QA 2L2SA 1V54C 4KFMA 4BIZA 4I50A 2PV3A 3CRMA 5IWAB 3JCZA 1FAFA 3IFXA 2AXTZ 2CH7A 3CXCU 1OGBA 2LW1A 2ESCA 4ODQA 4J7ZA 3DC6A 4WBNA 1D5NA 1WB7A 1ZX3A 4IYIA 1GOIA 1AJNA 3T2MA 1K5SA 5LXTA 1LL7A 3ARVA 3ARUA 1HNZB 1PP9H 3WH0A 1ZAUA 4DR7B 4HARA 2Z5UA 1PL0A 4FFBB 1N33O 1J5EB 2XAJA 2ITKA 2GTAA 2LGWA 4JI8O 4G50A 4UFZA 4GIVA 3RVYA 2LJ4A 2X6AA 2IH1C 1E6PA 1SQGA 2JGDB 1M57C 1YTFB 2KR7A 3WL0A 4OPAA 5CA3A 2FYUH 1F40A 2YXLA 3TC5A 3UO3A 4FVMA 1K33A 5KHJA 2WA3A 5IYZA 2RUDA 2YIAA 2VQFO 4F4LA 2CUGA 1YW5A 2O57A 2P90A 4DV4O 4TWKA 1W9VA 3DC5A 3EIPA 2JS3A 3DGEA 3ZRWB 1FKJA 1TA8A 1SA0A 1KQSU 1YJ9V 1VARA 2IH3C 3X2QB 1JOYA 4DZ2A 1AVMA 3AG3C 2PPPA 3ABKC 5CBGA 1PL4A 1DF4A 3N2KB 1JNSA 1YZBA 1UR8A 4R50A 3MHSC 2YDEA 1N4CA 4DR6O 4DR2B 4LH6A 3STZC 1QPFA 3STLC 4UVBA 1FKGA 1EZJA 1SKVA 1K34A 1V55C 3ARPA 2BTOA 4JF3A 3MDSA 1V54B 4DV3O 2ZE6A 4FN2A 3CD6V 3QF7A 1QLNA 5KLVH 4H13B 3BHPA 4QE7A 4I55A 4X1YA 4RUFA 5BZBA 1E6RA 2CGOA 3RFWA 2V4DA 4PHZA 1IVSA 4B3MB 3OA5A 2N04A 3CGNA 1FKTA 1GKFA 4DO2A 2OCCC 1PV0A 3HKBA 4L3NA 1H0IA 4DRPA 1XMOB 1E1RG 1LR1A 4OX9B 1DK1A 5BMVA 2JRIA 3T4ZA 5H2FZ 4DV2B 3HPLC 5IJ0B 2EULA 2Q73A 5IY5C 4ODPA 3AG2C 4TV8B 1VQNV 1JCHB 2HVJC 4XDJA 3RYCB 1Q6HA 5IYCO 1P7BA 1F51A 4MVUA 2ZQSA 4CS3A 1JX9A 3CRCA 3P30A 1K9MW 5EIBC 4W4LA 2EZOA 1IXBA 1M57B 2RSEA 4FM1A 1TUBB 1O9GA 2VQEO 2PBCA 4GCZA 4WKHA 3OFNG 3RWRD 2XAFA 1RSOB 4KXRA 3EFFK 2IBZH 3D3QA 3CCSV 3WD0A 2ITDC 1J4HA 4JV5B 3AS3A 3B09A 4GX0A 4YXWG 3ZJZA 4URIA 3CSXA 1I94O 4MTVA 3OE7G 1JMKC 3CRAA 5L3CA 4B08A 5JH8A 3GU0A 5DEDA 1PM9A 1QLEB 2EIMB 1M56B 1TFVA 4JI7B 3QO8A 3AG3B 3ARQA 5H6QA 1LL4A 4YJ3B 3ZIAG 3SPGA 5DM6V 4E4EA 4LNUA 3JAMN 2V7QG 3TGUH 2HLDG 3LDCA 4Z2GA 2YBTA 1BS3A 5L3BA 2A3CA 2F2DA 3BMBA 1V55B 2JVDA 1S0VA 1TAEA 2PPOA 3P3PA 3WG7C 2DT2A 3A0RA 4QNHB 5JVDB 1DGSA 2DMXA 3B77A 1N8RW 4KHPB 1AJPA 2Z0AA 3Q4HB 1MA1A 1HKJA 1XRVA 3O5DA 4XAKA 3CHEA 3OM3B 5FNVA 1IBMO 1W1TA 3RN4A 4WK9A 4XBFA 2ZDIC 3BPZA 4NXMB 5IJ9B 3JARA 1XNRB 2YC0A 1BKFA 5DEZA 4GKJO 4EFEA 5KX5B 4ZHQB 5K1XA 1R6KA 3RGCA 1VQOV 3NR7A 3H1JH 3B9AA 3K04A 3KAGA 1W1YA 3KAHA 2PI6A 4F6EA 1NWTA 5IY5B 3QTCA 2MW2B 1H0GA 1D7HA 2LGQA 2RNBA 2XAGA 2FL4A 1D7JA 4CH4A 1FKKA 5DF0A 1EN5A 2EJ7A 3WD2A 1BL4A 1GM8A 4DR5O 1V9PA 4X65O 1E6ZA 1VQ5V 2QDOA 1P49A 4ODOA 5C8YA 1MSWD 4NXNB 4X66O 4K0KO 3W7WA 2HP8A 5J9PC 1W2BU 2PPNA 4UVAA 2YEVB 3KABA 4FK5C 4X20B 4WKFA 3CCLV 2UUAB 4UUJC 3H1KH 2PI4A 5GQBA 2NN4A 1KKDA 3C3SA 4B7EA 3D36A 2Y4UA 4JI1O 4L8JA 4ZI7B 1K4CC 2DQ0A 3HKCA 4GX2A 2WLIB 1NR1A 3RM4A 4W4KA 5J2UB 2MF9A 1YTFD 4MT8A 4Z2HA 2Y0IA 4NTYA 1RSOA 2BSKA 5HW6A 4QIWF 4CH5A 2A3QA 4DWSB 1IXMA 1NWSA 1GRJA 2QE7G 3E22A 4H37A 4DV0B 2UUCB 1XNQB 4JI6O 4JYAO 4Z1MG 3SYQA 4F6RA 1R73A 2CTQA 4X1IB 4Z2IA 2KG7A 2RMKB 1HXVA 4MTXA 3O5RA 3ASOB 3UT5B 3NRKA 2E76B 1O9HA 1HNWB 4CS4A 4NVPA 4DRJA 2RUQA 3T1YB 2ZQUA 1ZL8B 1JNDA 2ADPA 4O4HB 3O5GA 3ETEA 4UV8A 2X6BA 4QPJA 5IYBO 1MMMA 4CH3A 2GHYA 2FKXA 1VQPV 3UF8A 4JYSA 4AQYB 2ZM6O 3E89A 4S3KA 4CZZA 4G2KA 4NB5A 1A32A 1TCOC 1QU7A 2XNDG 3O9OA 4PELA 2OIEA 2FKEA 1Q6UA 4DUYB 3GVMA 4KUMA 3WU2Z 2A3BA 3FKSG 3ARSA 4ZPWR 3RM8A 4DRXA 2XHBA 1LJYA 1FJGO 3DXRB 3RYIA 1SQXH 3JALA 3ABLC 3QNEA 4DR3B 5IE9A 4X88A 1FKRA 3CZ8A 1N36B 2IJKA 4HNAA 3KZ7A 1OCRB 4JI2O 4UDMA 4U3JA 1VF8A 4UCVA 1BHAA 3JAWA 4DR4O 4FLXA 3FXYA 3EXAA 4O4IB 1XL6A 3O5KA 3TXQA 2G38A 4PD4F 1FKBA 1AR5A 4CC6A 3JATB 1URFA 4UCRA 1TVKA 1QPLA 1OCCC 1XUQA 3ZHQA 4ODLA 4DW0A 5DIVA 5E1AC 4BW5A 1YCIA 4X1KA 4NTXA 4UV9A 2WA4A 2BOCC 3AG1C 3CP1A 3CHXA 4JASA 4MSPA 2KGJA 3K0DA 1M1KW 1E1QG 3AG4C 2CH7B 2OTJV 5LGTA 2WAMA 2OLHA 2RQ6A 3L70H 4WBNB 4DR2O 4ASUG 2YI8A 3IJ4A 3PRBA 1AI5A 3G6MA 2FTKA 1LQ0A 3KCYA 3N2GA 1Q5OA 2PI5A 1AJQA 3DTUB 2GUZA 2CGNA 5LXTB 4RQEA 3K9AA 2QF8A 4U3FH 3O5OA 2OIGA 4PI2A 5GPGA 4U86A 2UU9O 2DE0X 2H94A 2QJ1A 2DYRB 2UUBB 3OEHG 3GWOA 4PA4A 1Z5WA 4LF5O 2Q6AA 3FYIB 3M99B 4BW9A 1VQ7V 4DWSA 2JJ1G 1SQQH 4JI0O 4UB8Z 1JR9A 1HR0B 4UCUA 1MNGA 1BL8A 4D7SA 5KUKA 2ZE7A 2R72A 3AK3A 4DV6O 2JK5C 1XMOO 3CGMA 3PR9A 1YXBA 1VQ6V 4FFKA 1NH2B 5LP6A 5BR8O 3UT5A 3ZEDA 4J10A 1YHQV 4DV2O 3F7VC 5E79Z 5IYZB 5B1NA 3J7AU 1VQ9V 4AY1A 1Y74A 2QM8A 3K08A 2X6CA 5HWCA 2EIKC 2IU3A 4FLTA 2AHYA 3LDEA 5DECA 1HNXB 1RPOA 3ICXA 2PYLA 1ZTEA 1S5JA 1GUVA 1HJVA 4LF7B 1SA0B 3BEHA 2Q69A 1ZU8A 4WJXA 1FKAO 4RWUA 3VBBA 5EYPA 4DRMA 2PZSA 3SPJA 2XP8A 4NSBA 1EN4A 2RURA 5EIBD 1AR4A 5BXZA 1OCCB 1X6LA 3CCRV 3H9VA 3IKGA 1R3IC 4DRHA 3U0ZA 2ZCEA 1F4MA 1F8AB 3W7UA 3O5JA 3B4SA 3ZMUA 4DV1O 4ODNA 3IKDA 3F7YC 1NMWA 1KU9A 1R3LC 2FDMA 1HW7A 4PDRA 4DV3B 4UB6Z 2OWOA 3OTFA 1B6CA 1U79A 1WAZA 5B3SB 2Y0PA 4BF8A 3X2QC 4DW1A 1IBLB 2ZR5A 2VRZA 1GTOA 1QR9A 1H2MA 3HKBB 1SC5B 4BIOA 1K9TA 1H2LA 1VF6C 3JATA 1XMQB 1ORQC 2F4EA 2XASA 2HKOA 1WPXA 5BMVB 2FAPA 3ZN0A 1ZBVA 2BOBC 1VQKV 1KFWA 4YY3O 2ATKC 3ETQA 2ZQTA 2RQSA 3HKEA 4LR3A 4LFAO 4JFIA 2N74A 2XTAA 3K79A 3W7TA 2DJVA 1BZKA 2WLYA 3U10A 3ARZA 5CA0A 2YS8A 2VWKA 4JYBA 4MTOA 1N1AA 2QM4A 3K3WA 3W4RA 2QM7A 3OUSA 3G6BA 1JQ0A 1UR9A 4LFBO 4B3RO 1VIBA 3J80N 2LJ2A 4O4LA 1NI8A 4R6ZA 1AR1B 4IPXA 3RW0A 1Q1CA 2WLJA 3O5IA 4Q6GA 2XP9A 2EIKB 1AI4A 4DR1O 4B3TB 2W0FC 1JJOA 3D36C 1N34O 1FAPA 1L1FA 1SETA 3CB2A 1AILA 2CTRA 4DV7O 1NR7A 1VQMV 2YIBD 1P84F 3G71V 1TGOA 1M90W 4N23A 2AZ0A 5EZYA 2MNTA 3K58A 4J11A 4LNUB 4JZ2A 4BAYA 4W9PA 2EJRA 4JYCA 4B3SO 4G28B 1FKSA 3TCZA 1R1BA 3SJAC 4H44B 4JTDB 4GX1A 2QWOB 3CMAV 3ALGA 5D75A 5IYDO 1XBLA 3WD3A 3UKMA 1G1XB 2UXBO 3ARXA 2VS0A 3OT7A 4FJCC 1M5YA 4FM0A 1ZUQA 1QLEC 2EIMC 3MAQA 2P67A 5FNVB 1M56C 1KB9F 3QO7A 3ZRSA 4LF9B 3I55V 2EZPA 4L72B 1FXHA 2DSWA 3JARB 2QEXV 5LMUO 1YIJV 4DH0A 3ETDA 1SQVH 2UUCO 2L6LA 2UXCO 1S72V 4D6TH 3UQIA 3M7MX 1VEWA 2YXHA 3HKDA 2H8PC 3L73H 4ZS6A 4QPKA 3CCJV 1PNMA 2WK2A 2OFNA 2XP7A 3TK1A 2PY5A 2QA4V 4YIPA 5JCOA 5JWPA 1SQBH 3SR2C 1BQ0A 5LHIA 4MPKA 1BHBA 4J9YB 1SRYA 3SPIA 2DOSA 1S76D 1YVWA 2KSDA 3BRCA 2JJ2G 3B9EA 2Q68A 2Y69B 3I6CA 1Q8IA 2ETNA 2W0XA 3K59A 5GONB 5LGUA 1KT1A 3IK8A 2OYQA 1D7IA 1FFXA 5LHHA 2H3OA 4YJ2B 1WPBA 3UQBA 5C8YB 4K8ZA 1SERA 1NT2B 4J80A 2V1DA 1Y76A 2EINC 4ODMA 2O9OA 1P7GA 5D5QA 2GBOA 3SGIA 2P7TC 4I5SA 4GKKO 2NLJC 3UI5A 4HZ3A 4IYHA 4GT1A 5JH7A 1B04A 4DIPA 4UCTA 4ML4A 3ZCCA 3CMEV 2F93B 3K06A 4LF8O 4WFFA 4JYYA 1E44A 4LF6O 3HKCB 2NR5A 4PA6A 3JD1A 2ZINA 3OMIB 4WFHA 2LW7A 2ZD9A 1KP2A 1OCOC 3MD0A 1NH2D 2VWJA 2BSKB 4JI4B 1IURA 3EY6A 4FLVA 3OTOB 3ZMZA 4LF4B 3E22B 2A3AA 4P8UA 3E8FA 3I5DA 4IQCA 3O65A 1ZL1A 4OXSA 3RBZA 4NR1A 1XILA 4F6RB 1GM7A 4JGSA 2KG7B 3U11A 5EBWC 1R3JC 4HBNA 1JNTA 1HKIA 2XPAA 1I08A 4FZ0A 4LAWA 3CJHA 4PTMA 1SZTA 1RD6A 1GM9A 1WNOA 3WD1A 4MNJA 1ZK6A 2GV9A 2M6YA 2M7WA 3ZHTA 2E3CA 5KHKA 2XOKG 3ZS8C 4DV5O 3AK1A 4GZRB 4DWSC 4O2AA 5LMNO 4GX5A 4U7OA 3RFRA 3KG2A 2ZR4A 1UFIA 1Q6IA 1YEWA 5DO2A 4DK1A 5GTHZ 1H38A 2P22C 1FXKA 3T1HB 1R6NA 3KACA 3FYEB 2AWGA 3QVNA 5HW7A 3BFRA 3UQAA 3EHBB 1NBMG 2EBOA 4DRXB 3ASOC 4GLXA 4FLYA 2E5LO 2XUMA 2HHHB 1ZB5A 3SYOA 5B5EZ 3RYIB 1NQTA 1R3KC 2UXDB 3CE2A 4ZPTR 4MVRA 4U85A 3JALB 2B5UA 3JYJA 2EINB 3PRDA 1H2GA 1W1PA 4FAPA 1IBKO 1PBKA 1K3EA 4X64B 3LUTB 3AS1A 1N32O 4HNAB 4H33A 1VF7A 3FAVA 2AZ2A 2EIJB 4U3JB 3L9DA 3JAWB 5LA6A 3BVOA 3AG7A 4NKGB 1EM1A 1P5QA 2ZXWB 4RQFA 1K73W 1YATA 2JS5A 3JASA 2F4VO 2ZR3A 1D6OA 1K7DA 1UPGA 5GONA 3ZHRA 4FPPA 4Z1VA 3UI4A 1TVKB 4QGPA 1J4RA 2XP5A 1OCOB 4YJ2A 1HNXO 3OEEG 1XL4A 4X1KB 3S3WA 4EKWA 4J7KA 4JTCB 4RUEA 2ARHA 3FY1A 5H6RA 3FX7A 1EN6A 2FB5A 3O5EA 1K92A 1GO3F 1US6A 1OCRC 1OWQA 4MS2A 1N33B 4YHHO 1EYMA 2PGGA 2AOSA 1U97A 4JI8B 2XAHA 3D3IA 4PA3A 1SR0A 3N2GB 2W6IG 3A8TA 3JSNA 5IT9N 2P4KA 5LL6Y 1G8MA 4QIBA 4FLUA 2M2AA 2GUZB 5JQGA 3BA8A 3GTYX 1WA8A 2Q8VA 2AHZA 4DUZO 2Y78A 2BTQA 4JI5O 1WAWA 1CPYA 3CYOA 4FIPC 1XHGA 1S77D 1FKDA 1SQPH 4CH6A 1SYTA 4HBEA 4DV4B 3ASNC 1XHXA 2HVKC 4PI0A 2BE3A 1BMFG 2RDCA 3WIJA 1Q86W 2XPBA 3E8BA 2E74B 5KHIA 3G67A 4Z2KA 1W0JG 5LP6B 1MOFA 4UVCA 4NZCA 2LQTA 3OR7C 2F23A 4J4OA 2WWWA 3CRRA 1QVGU 5C93A 4FZ1A 3AK2A 5IWAO 3VQWA 1Y74B 4DR6B 5D5PA 2RN9A 3B2EE 2DYRC 3WB2A 5B66Z 1C9HA 4EB6A 1W9UA 5EK0A 2XAQA 2W6JG 1QBZA 1ZSPA 3IC7A 4TW6A 4R8CA 3G6EV 2LP7A
chains in the Genus database with same CATH topology
3QOKA 1YW5A 2PV1A 1W9VA 1GUVA 1HJVA 1ITXA 1ZU8A 4WJXA 2DSUA 2Q5AA 5J6EA 3RM9A 1FKJA 1HJXA 4DRMA 2XP3A 5HT1A 2XP8A 4NSBA 2RURA 4LAYA 4DZ2A 3LUOA 2PPPA 2MLYA 1X6LA 1JNSA 4J4NA 1UR8A 3IKGA 4IT4A 1EIBA 4DRHA 3KADA 4JFKA 1QPFA 1WB0A 2MLXA 5I98A 1F8AB 3WD4A 3O5JA 3VAWA 1FKGA 4O2TA 3MDYB 3ARPA 1W1VA 4ODNA 1FFQA 3IKDA 4Z2LA 1NMWA 1ZBKA 2FDMA 4FN2A 4QT3A 4WKAA 1B6CA 1U79A 4TX0A 4BF8A 1E6RA 3RFWA 2ZR5A 2JZVA 4TYOA 1LG1A 1W26A 3OA5A 3CGNA 1K9TA 1CTNA 1FKTA 3ARRA 3O5PA 2F4EA 4W9QA 4MGVA 2FAPA 1NH6A 1ZBVA 3TDBA 1KFWA 4L3NA 1H0IA 4DRPA 2ZQTA 2RQSA 2KI3A 4JFIA 4ZPVR 2WLYA 1E9LA 3ARZA 3OOBA 4ODPA 1N1AA 1OGGA 4IT6A 1Q6HA 4NNRA 3W4RA 2D9FA 2ZQSA 2RUCA 3PRAA 2UZ5A 1UR9A 4P8WA 4P8XA 4DRQA 3CHCA 2DG9A 3CH9A 1LL6A 1W9PA 2RSEA 1X6NA 1ZBWA 4IPXA 2PBCA 1Q1CA 4WKHA 1FD9A 3WD0A 3O5IA 1J4HA 2XP9A 3AS3A 3B09A 1FAPA 4KR0B 4JFJA 2WLZA 4URIA 1FFRA 4MTVA 4DRNA 2YBUA 5BXJA 5JH8A 5HW8A 1NWRA 2MNTA 5HWBA 5HBFA 1TFVA 4W9PA 2B31A 3O5MA 1FKSA 4N19A 3TCZA 3ARQA 1LL4A 2LKNA 1JVWA 4LAVA 3ALGA 5D75A 2DSVA 2ZR6A 3WD3A 4Z2GA 1EHNA 2YBTA 5HKGA 1O6IA 5DITA 5HUAA 2F2DA 2A3CA 3ARXA 3UI6A 3RMEA 4JFLA 2PPOA 2WM0A 1M5YA 2DT2A 1NSGA 4G2PA 2XP4A 2ZQVA 1J6YA 2DT3A 4LGXA 3ARWA 4L72B 5HTGA 1R9HA 1HKJA 1XRVA 3O5DA 4XAKA 2DSWA 1KT0A 3CHEA 1W1TA 4DH0A 2IF4A 4WK9A 1A7XA 3O5LA 3UQIA 4ZS6A 1IX5A 2WK2A 2OFNA 2M1IA 2XP7A 4S3JA 1BKFA 5DEZA 4MNLA 3ODKA 4ODKA 1ROUA 4QT2A 3RGCA 3WL1A 4MPKA 3WKZA 3B9AA 3KAGA 1HKKA 1W1YA 3KAHA 3B9EA 2PI6A 1NWTA 3I6CA 1H0GA 1D7HA 3JXVA 1D7JA 1KT1A 3IK8A 1FKKA 4P8VA 1D7IA 3UQBA 5DF0A 2VCDA 3NI6A 2DT0A 3WD2A 1BL4A 4ODMA 2O9OA 1E6ZA 3B7XA 2DSZA 4ODOA 2KE0A 2LGOA 3AS0A 3UI5A 2VN1A 4DWSD 2PPNA 1J4IA 3O5FA 1ZBCA 3KABA 4DIPA 4WKFA 4W9OA 2DPEA 4ML4A 5GQBA 2KFWA 4GGQA 1HJWA 1FKHA 4Q7NA 2A3EA 2KO7A 3RM4A 3ARTA 3EY6A 2MF9A 4Z2HA 2A3AA 1FKFA 3KAIA 4P8UA 5B8IC 5HW6A 4MNKA 4IQCA 5GPRA 2G41A 1EDQA 1ZL1A 4DWSB 1ZCNA 1NWSA 4Q22A 1JNTA 1HKIA 2XPAA 4LAWA 4Z2IA 1HXVA 4PTMA 3O5RA 1RD6A 1ROTA 1WNOA 1E6NA 3WD1A 4MNJA 1ZK6A 3WQWA 4Z2JA 2N87A 3NRKA 3PA7A 4DRJA 5DIUA 2RUQA 4WIWA 2ZQUA 1JNDA 2XP6A 3AROA 4C02B 3AS2A 1L1PA 1NWUA 1LG2A 3O5GA 4DWSC 4KQZA 2ZR4A 1FJDA 1Q6IA 5DO2A 3UF8A 4U84A 4TW7A 1GPFA 4JYSA 3ALFA 3B9DA 4ODRA 3KACA 2AWGA 1NMVA 4S3KA 4DZ3A 5HW7A 4DRIA 4R5EA 3UQAA 1TCOC 2M08A 2FKEA 4R0XA 1Q6UA 1ZB5A 2A3BA 3ARSA 4ZPWR 4ZPTR 3RM8A 4MNMA 4U85A 3JYJA 3JYMA 1W1PA 1T11A 3PRDA 1LJYA 4FAPA 1PBKA 3CHFA 3B8SA 3AS1A 2MPHA 1FKRA 3CZ8A 4ITZA 3KZ7A 4QZVB 1PINA 3H9RB 3AQUA 1P5QA 1Y0OA 1YATA 1VF8A 3FXYA 1FKLA 1D6OA 3IHZA 3UI4A 3O5KA 1J4RA 2XP5A 3WQVA 3FAPA 2IUZA 1FKBA 1JNEA 1QPLA 1E15A 3FY1A 2PV2A 4DRKA 2K8IA 2DG3A 4ODLA 5DIVA 3O5EA 3G6LA 1EQ3A 1HKMA 3ARYA 3BXWA 1OWQA 3NTPA 1QZ2A 3CHDA 1EYMA 4DROA 4DT4A 2AOSA 4MSPA 2KGJA 4IQ2A 3O5QA 2L2SA 2MLZA 1SR0A 2OLHA 2PV3A 4QIBA 2M2AA 4JFMA 2O92A 3PRBA 1OGBA 2ESCA 4ODQA 4TNSA 3G6MA 4W5UA 1LQ0A 2G8ZA 2Y78A 1FKIA 2QF8A 1WAWA 3O5OA 5GPGA 1GOIA 4U86A 2DT1A 4LAXA 1XHGA 1FKDA 1LL7A 1SYTA 4HBEA 3ARVA 3ARUA 3WH0A 4DWSA 3WIJA 2XPBA 4HARA 3GPKA 3KAFA 4Z2KA 4TW8A 2ITKA 4NZCA 4MAVA 3PR9A 3CGMA 4J4OA 4G50A 1D2KA 4HBOA 4GIVA 2LJ4A 1E6PA 2KR7A 2DG4A 3WL0A 2LPVA 1C9HA 1W9UA 3KCEA 4AY1A 1F40A 3TC5A 4TW6A 2RUDA 5HWCA 2F21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAB A;  3B09 A;  4DIP A;  1FKR A;  1YW5 A;  4W9O A;  1FAP A;  4ITZ A;  2PV1 A;  3KZ7 A;  4JFJ A;  1PIN A;  3H9R B;  2KFW A;  1P5Q A;  1Y0O A;  1YAT A;  4GGQ A;  4DRN A;  1FKL A;  1FKH A;  1D6O A;  3IHZ A;  5BXJ A;  2Q5A A;  3UI4 A;  5J6E A;  5HW8 A;  3O5K A;  2MNT A;  1FKJ A;  1J4R A;  5HWB A;  4DRM A;  2XP5 A;  2XP3 A;  4W9P A;  3O5M A;  5HT1 A;  2XP8 A;  2RUR A;  3FAP A;  4LAY A;  1FKS A;  4N19 A;  1FKB A;  3TCZ A;  4DZ2 A;  2KO7 A;  2PPP A;  3LUO A;  2LKN A;  1QPL A;  1JVW A;  4LAV A;  2MLY A;  3EY6 A;  2MF9 A;  5D75 A;  1JNS A;  2PV2 A;  2ZR6 A;  4J4N A;  4DRK A;  2K8I A;  2DG3 A;  3IKG A;  4ODL A;  5DIV A;  3O5E A;  4DRH A;  1EQ3 A;  3KAD A;  5B8I C;  1FKF A;  3KAI A;  4JFK A;  5HKG A;  5DIT A;  1QPF A;  2MLX A;  4IQC A;  5HW6 A;  5I98 A;  5HUA A;  1F8A B;  2F2D A;  3NTP A;  1QZ2 A;  1EYM A;  3UI6 A;  3O5J A;  3VAW A;  4DRO A;  1FKG A;  1ZCN A;  4JFL A;  4O2T A;  4MSP A;  2KGJ A;  3MDY B;  2PPO A;  1M5Y A;  4ODN A;  1NSG A;  3IKD A;  4G2P A;  4IQ2 A;  1NMW A;  2XP4 A;  3O5Q A;  2L2S A;  2MLZ A;  1JNT A;  4FN2 A;  4QT3 A;  2XPA A;  2ZQV A;  1B6C A;  1J6Y A;  1U79 A;  2PV3 A;  2M2A A;  4JFM A;  4LAW A;  4QIB A;  4TX0 A;  5HTG A;  3PRB A;  1HXV A;  1R9H A;  3O5D A;  3O5R A;  4ODQ A;  4BF8 A;  1ROT A;  4TNS A;  1ZK6 A;  3RFW A;  1KT0 A;  2ZR5 A;  2N87 A;  4DH0 A;  3NRK A;  2JZV A;  4TYO A;  2IF4 A;  1A7X A;  1W26 A;  2Y78 A;  3O5L A;  3PA7 A;  4DRJ A;  3CGN A;  5DIU A;  1FKI A;  2RUQ A;  1FKT A;  3O5P A;  3UQI A;  3O5O A;  2F4E A;  2ZQU A;  5GPG A;  4W9Q A;  2XP6 A;  4U86 A;  4C02 B;  4LAX A;  2OFN A;  4MGV A;  1L1P A;  2M1I A;  2FAP A;  2XP7 A;  3TDB A;  1BKF A;  1FKD A;  3O5G A;  3ODK A;  4DRP A;  2ZR4 A;  1FJD A;  3WH0 A;  2ZQT A;  2RQS A;  4ODK A;  1Q6I A;  1ROU A;  4QT2 A;  2KI3 A;  3RGC A;  3UF8 A;  4U84 A;  2XPB A;  4TW7 A;  4JYS A;  3KAG A;  4JFI A;  3GPK A;  3KAH A;  3KAF A;  4ODR A;  3KAC A;  2AWG A;  1NMV A;  3I6C A;  4DZ3 A;  5HW7 A;  4DRI A;  1D7H A;  3OOB A;  4ODP A;  4TW8 A;  3JXV A;  2ITK A;  1N1A A;  1TCO C;  3UQA A;  1D7J A;  1KT1 A;  3CGM A;  3IK8 A;  4J4O A;  4NNR A;  1Q6H A;  4G50 A;  2M08 A;  2FKE A;  1FKK A;  1Q6U A;  1D7I A;  2D9F A;  2ZQS A;  2RUC A;  4R0X A;  4DT4 A;  2UZ5 A;  4GIV A;  3UQB A;  2LJ4 A;  4U85 A;  4DRQ A;  2VCD A;  3NI6 A;  3JYJ A;  1BL4 A;  2DG9 A;  3JYM A;  2KR7 A;  1T11 A;  2DG4 A;  2RSE A;  3PRD A;  4ODM A;  4FAP A;  2LPV A;  1PBK A;  1C9H A;  3B7X A;  3KCE A;  4IPX A;  2PBC A;  1Q1C A;  4ODO A;  1FD9 A;  1F40 A;  2KE0 A;  2LGO A;  3TC5 A;  2MPH A;  3UI5 A;  3O5I A;  1J4H A;  2VN1 A;  2XP9 A;  2RUD A;  4TW6 A;  5HWC A;  2PPN A;  1J4I A;  2F21 A;  3O5F A; 
#chains in the Genus database with same CATH topology
 3QOK A;  3SPH A;  2PV1 A;  5H9C A;  1GN6 A;  3CCU V;  1HNZ O;  3OMA B;  1M4U A;  5KMG A;  5EYP B;  5FLX N;  4MVQ A;  4DR7 O;  3OR6 C;  5CBF A;  2HJD A;  3A0H Z;  4YIO A;  2Q5A A;  5J6E A;  4ICG A;  4EEQ A;  4HYO A;  1J5E O;  1NTK H;  2QKC A;  3FB7 C;  1FXV A;  2YSU B;  4LAY A;  3E2E A;  2WLM A;  1MZF A;  1Q90 D;  3LUO A;  5KHH A;  1GN4 A;  3ZX6 A;  4J4N A;  3L72 H;  4LCU C;  1MG1 A;  1NU1 H;  4IT4 A;  1X4T A;  2ADQ B;  1LNQ A;  2YID A;  1VF5 B;  2P6J A;  4O2T A;  1M93 A;  5BY1 A;  4MSW C;  1W1V A;  2GSM B;  4XDK A;  1ZBK A;  4BIU A;  1BE3 H;  4QT3 A;  3ZN1 A;  1YI2 V;  3RYF A;  4D7T A;  5F2V O;  3A2F A;  5A9G A;  3CC2 V;  2HJF C;  1BT8 A;  5LBQ A;  2VQE B;  1JVM A;  3D8C A;  3T1C A;  4TYO A;  3WB0 A;  1S5H C;  4FLW A;  1CTN A;  1AP5 A;  5JCO C;  1K5Q A;  1KBH A;  1NH6 A;  3HKE B;  4XDL A;  1BQZ A;  3ASN B;  1AI6 A;  4I7Z B;  1OZ0 A;  3P32 A;  2ZT9 B;  5CA0 B;  1I94 B;  3N27 A;  3NXS A;  3KZI Z;  3ZHU A;  3EVK A;  4BR6 A;  1QVF U;  1GK9 A;  2KQX A;  5B3S C;  3JYC A;  4N21 A;  1GMG A;  3OOB A;  1NS1 A;  3G4S V;  4O4L B;  1OGG A;  4NNR A;  1HDJ A;  2QWQ B;  3FB8 C;  3K03 A;  3APO A;  3PRA A;  2UZ5 A;  4P8W A;  4P8X A;  3ABU A;  4DRQ A;  4PDL A;  2DG9 A;  1LL6 A;  5EC2 C;  1W9P A;  1X6N A;  2AGA A;  1F7Y A;  3VQV A;  1FD9 A;  4KP4 A;  4B3M O;  1YIT V;  2UXX A;  4MTF A;  5JJE B;  2NNU A;  4X89 A;  4OGQ B;  3F5W C;  2WLZ A;  1WN7 A;  4TV9 A;  4LWS B;  4OX9 O;  2JGU A;  5EZY B;  1IBM B;  1NTZ H;  2WSS G;  3K9S A;  5B1B C;  4QE9 A;  2YBU A;  2FML A;  2CTP A;  5BXJ A;  1PKX A;  5HW8 A;  3SYC A;  4ZOL A;  5HBF A;  2B31 A;  3O5M A;  1Y4M A;  5LOV B;  1KC8 W;  4GKJ B;  1VQ8 V;  1ARO P;  1RFY A;  4FM2 A;  2QR4 A;  1JVW A;  4LAV A;  2A7W A;  2DSV A;  3BAB A;  2LFS A;  3QG5 A;  5HKG A;  1RM1 B;  5DIT A;  2DW4 A;  2JDI G;  5HUA A;  4WFA V;  1D2D A;  4JAV A;  4PDV A;  3RME A;  2ZDI A;  4JFL A;  4MW8 A;  3TCU A;  4G2P A;  5L3E A;  2XP4 A;  3JD3 A;  4JV5 O;  2ZQV A;  1J6Y A;  2DT3 A;  4LGX A;  2EIL B;  2K9P A;  3H1L H;  3L71 H;  3JAK B;  3ARW A;  2CAZ C;  2ZKO A;  1F4N A;  5HTG A;  2YIC A;  3ABT A;  1R9H A;  4DR5 B;  4X65 B;  3HKD B;  4I9W A;  2DQ3 A;  1KT0 A;  2ZE5 A;  2IF4 A;  4X66 B;  1QCE A;  2DWE C;  5CBH A;  4B7K A;  3B8M A;  1PD3 A;  1XOU A;  1NVP B;  5CA1 A;  1A7X A;  4K0K B;  3O5L A;  1FFT B;  1NTM H;  1IX5 A;  3M8A A;  4AI8 A;  5L3G A;  5B1A B;  2M1I A;  1J95 A;  4JI7 O;  4S3J A;  1SQF A;  1QQC A;  2P4V A;  4MNL A;  3ODK A;  1Q43 A;  3WKZ A;  1ROU A;  2MK3 A;  1VP7 A;  4O2B A;  3WFV A;  1X59 A;  2A79 B;  4UCO A;  4LBE C;  1FFX B;  1KMI Z;  1RPR A;  3C3T A;  3JXV A;  1W59 A;  4PA9 A;  3H01 A;  1QR8 A;  4L87 A;  1Y76 B;  5KA6 A;  3CC7 V;  2A9H A;  4O4J A;  4KHP O;  2VCD A;  1ZLZ A;  3OGI B;  2GDS A;  4QJF B;  5JH7 B;  3B7X A;  3AS0 A;  4NXM O;  4DWS D;  3R66 A;  4JI6 B;  1KP3 A;  1XNR O;  4JYA B;  5KA5 A;  4Z2W A;  2Y69 C;  4W9O A;  2DPE A;  1I0H A;  2WPD G;  1Y6X A;  2KFW A;  4GGQ A;  4MVS A;  3DSQ A;  3K0G A;  5B1B B;  1HJW A;  4Q7N A;  3JD2 A;  3FB5 C;  5LGN A;  2LO1 A;  1KD1 W;  4JPR A;  4I4T A;  5EBL C;  3ART A;  3SYA A;  1B3Q A;  4G27 B;  2QWP B;  4UXN A;  5KAF Z;  3PN1 A;  1FKF A;  1YF2 A;  3ABM C;  2ZM6 B;  1N0J A;  2B1G A;  4LP8 A;  1ZCN A;  4NXN O;  1IX9 A;  3CJH B;  4ABM A;  4Q22 A;  4LWS A;  4TQD A;  4ZKI A;  4JZG A;  2UUA O;  1XRE A;  3L75 H;  3CS5 A;  1ROT A;  1IZ3 A;  1PPJ H;  1KEC A;  1FJG B;  2C2A A;  4I0X A;  1E6N A;  3OD4 A;  4Z2J A;  5LYJ B;  3A0B Z;  4O2A B;  3PA7 A;  3FD9 A;  5LOV A;  3JCU Z;  5H5N A;  3SDL A;  4C02 B;  3JSL A;  3AS2 A;  1LG2 A;  4K35 A;  1QHT A;  1CXZ B;  4IHJ A;  4IGG A;  1FXK B;  4KQZ A;  4GYC B;  3B40 A;  4JI2 B;  3GWK C;  2HFE C;  4LH7 A;  3W7S A;  1EFR G;  2F66 C;  4PV1 B;  5J2T A;  4DR4 B;  1JFF A;  3H1H H;  4U84 A;  4TW7 A;  1WP7 A;  1DF5 A;  3ALF A;  3B9D A;  2RCV A;  4ODR A;  2QKA A;  1G6U A;  2P06 A;  2YXY A;  2CE4 A;  4R5E A;  1B06 A;  4AHC A;  2KKW A;  2R9R B;  3HR0 A;  3JAK A;  2B5U B;  4P9O A;  4DV0 O;  1XNQ O;  3FB6 C;  4JI3 B;  2M08 A;  2IJH A;  3RYH B;  1S5L Z;  2CTW A;  1I5X A;  4CC5 A;  5K1P A;  4MNM A;  1NKD A;  1FYJ A;  1THZ A;  1K97 A;  3FAV B;  3E8G A;  4ZIB A;  5LA6 B;  5TIS Z;  4J41 A;  1HNW O;  2MPH A;  1SES A;  1ZWI C;  3T1Y O;  1JJ2 U;  4IIJ A;  1L0N H;  1MAB G;  2E75 B;  1MSD A;  2ITC C;  3JAS B;  3F5T A;  4QZV B;  1PIN A;  3THO A;  3AQU A;  4WFE A;  1CEZ A;  3CWB H;  2WLN A;  1FKL A;  4UCS A;  3SJB C;  3IHZ A;  4AQY O;  3K5M A;  2A06 H;  3E83 A;  1PNL A;  2Q5Z A;  3APQ A;  2UU9 B;  3WQV A;  5LHG A;  1WNS A;  3FAP A;  1JNE A;  1I5Y A;  4DUY O;  2RJZ A;  4LF5 B;  1JPX A;  2WLL A;  2A0L A;  2EIJ C;  1HWY A;  2K8I A;  3BAA A;  2DG3 A;  5CN0 A;  3ABM B;  1EQ3 A;  3WB1 A;  4JI0 B;  3ARY A;  3BXW A;  1W0K G;  3CHD A;  4DRO A;  4DT4 A;  2HG5 C;  2ZXW C;  1AP6 A;  4P2Z A;  4E2L A;  4DR3 O;  2R9A A;  4DV6 B;  5JQG B;  1NZ6 A;  4TUY A;  2MLZ A;  1WA8 B;  2DWD C;  5EC1 C;  5BR8 B;  1N36 O;  4JFM A;  5ITZ A;  1NJI W;  2O92 A;  2BTQ B;  4TSF G;  2Y4T A;  1XEQ A;  1GN3 A;  2Q7H A;  4TNS A;  4W5U A;  2Q7G A;  2Q0A A;  3ZHS A;  3TET A;  4X62 B;  2G8Z A;  5CMU A;  1FKI A;  3ZRX A;  3K5L A;  2DT1 A;  4LAX A;  4DK0 A;  1H2K A;  5CB4 B;  1LUV A;  4J7J A;  3G80 A;  4PA7 A;  3VOU A;  3GPK A;  3KAF A;  3B8N A;  4TW8 A;  2JIZ G;  4MAV A;  3ZMT A;  4FFB A;  1D2K A;  5HFL A;  4HBO A;  4EB6 B;  3UCS C;  2D3O W;  5LYJ A;  1N0N A;  1TUE B;  2DG4 A;  2LFR A;  1E79 G;  2QTS A;  1WLE A;  4LFC B;  2LPV A;  2WLK A;  3OGC C;  3KCE A;  1NVP D;  3ABK B;  3L74 H;  4DV1 B;  2JGD A;  2X7R B;  1K4D C;  4GUN A;  1UJW B;  1PNK A;  5KMG B;  2F21 A;  3UO2 A;  5LP6 C;  2UUB O;  2JEU A;  1YJW V;  3S3X A;  1Z2G A;  1BSM A;  3P3N A;  1H2N A;  1ITX A;  2X0L A;  2R70 A;  2DSU A;  3LSS A;  3RM9 A;  1M5I A;  3RYH A;  1HR0 O;  1HJX A;  4HAM A;  2IJJ A;  3ZMV A;  2XP3 A;  3CEI A;  5HT1 A;  3ZHV A;  4JAU A;  5KHG A;  1DTO A;  1MZE A;  1OJH A;  5L3D A;  3CXH F;  3K5O A;  3ZRW A;  4YY3 B;  4WFG A;  4TT3 G;  4P30 A;  1L0L H;  2MLY A;  2DYS C;  2YI9 A;  2EX3 A;  1EIB A;  4LFA B;  3KAD A;  4JFK A;  3W7X A;  1WB0 A;  2MLX A;  5I98 A;  2OCC B;  3N2K A;  2GTS A;  3WD4 A;  2Q9L A;  3ZMS A;  3TJT A;  3RYF B;  3KKY A;  3VAW A;  4J42 A;  1VF6 A;  3MDY B;  2Y48 A;  4Z2L A;  3LSQ A;  4MW3 A;  4X9Q A;  1FFQ A;  1K8A W;  3GB7 C;  3CRQ A;  4WKA A;  3IAY A;  4LFB B;  4IT5 A;  4WF9 V;  4B3R B;  1COW G;  4TX0 A;  1XHZ A;  1G4Y B;  2PTM A;  3AG2 B;  4LF7 O;  3ZBH A;  2JZV A;  3BY6 A;  1Q81 W;  1LG1 A;  1Z5V A;  2QWR B;  1W26 A;  3JD0 A;  3ARR A;  3O5P A;  4W9Q A;  2QTO A;  3E86 A;  4DR1 B;  4MGV A;  3LNN A;  4K8X A;  3TDB A;  2IW5 A;  1N34 B;  3CC4 V;  4WFB V;  1Y66 A;  1VMG A;  4RAI A;  4DV7 B;  4LC1 A;  4PDM A;  2B1I A;  1F23 A;  4OPH A;  2KI3 A;  2F43 G;  4ZPV R;  5FL7 G;  1E9L A;  3RGB A;  2ZQM A;  2K1E A;  3OW2 U;  4B3S B;  4IT6 A;  2D9F A;  2RUC A;  5IJ0 A;  1M9N A;  2N05 A;  3C90 A;  4C7U A;  2VQF B;  4TV8 A;  1JCH A;  3KCX A;  1D5A A;  3RYC A;  2YUA A;  1FPO A;  3CHC A;  1T5E A;  2PN0 A;  3CH9 A;  4MTG A;  4WCE V;  1ZBW A;  1IBL O;  2UXB B;  5CB4 A;  1KKC A;  2ZR2 A;  4TV9 B;  1XMQ O;  2Q67 A;  1TUB A;  1GH6 A;  5KAI Z;  5KUM A;  1L8D A;  3SYP A;  4KR0 B;  4JFJ A;  1WJZ A;  3SJC C;  4ZOL B;  1FFR A;  2Q4P A;  2R9I A;  4K3A A;  3WG7 B;  5LMU B;  4DRN A;  2JEX A;  3K5N A;  1YDX A;  1XDC A;  2UXC B;  1NWR A;  5HWB A;  2IU0 A;  5B1O A;  2WLH A;  1BGY H;  4N19 A;  3E35 A;  4FMT A;  4CBC A;  4NYK A;  2LKN A;  2DYS B;  4ZBM A;  3IC9 A;  2ZR6 A;  1BCC H;  3BA9 A;  2UXN A;  1EHN A;  1O6I A;  4YJ3 A;  4BWA A;  4J9Z B;  3UI6 A;  1OV9 A;  1WB8 A;  2WM0 A;  1AI7 A;  1Q82 W;  1NSG A;  2F95 B;  1EZV H;  4B3T O;  5IDJ A;  1VQ4 V;  3CCE V;  1I7F A;  3TXS A;  3CCM V;  2ZIM A;  4FLZ A;  2ZE8 A;  5CA1 B;  2ZNJ A;  5JVD A;  1SS3 A;  1CP9 A;  4GKK B;  2PUS A;  3E8H A;  3Q4H A;  1P4R A;  1RM1 C;  2B9Z A;  2ZNI A;  4CS2 A;  3CPW U;  1GAX A;  4O2B B;  5IJ9 A;  4MVZ A;  4LF8 B;  4ODK A;  4QT2 A;  3WL1 A;  4LF6 B;  4MVM A;  1HKK A;  5KX5 A;  4ZHQ A;  2EIL C;  1FS0 G;  5EBM C;  1Q3E A;  1HP8 A;  4O4J B;  3J81 N;  2L35 A;  3I56 V;  1R6T A;  4DXW A;  4P8V A;  5JJN B;  4IL6 Z;  2QGN A;  4PJ0 Z;  3HB3 B;  2CK3 G;  4MVO A;  4LF9 O;  5B1A C;  3NI6 A;  3LNM B;  2DT0 A;  3ML0 A;  1DLB A;  4JTA B;  5GTI Z;  3IGA C;  2DSZ A;  2P5O A;  2KE0 A;  2LGO A;  4JAA A;  4JI3 O;  3T4D A;  1KUQ A;  2QKS A;  2VN1 A;  1H8H G;  1J4I A;  4I9Q A;  3O5F A;  1ZBC A;  1ENV A;  4X8A A;  3K57 A;  2YEV A;  4X20 A;  4I50 B;  1FKH A;  3JD4 A;  5JJJ B;  4I4T B;  2F1M A;  3OAA G;  3RVZ A;  2AW9 A;  3SJQ C;  3H1I H;  4RO2 A;  1OCZ C;  1H2S B;  2HEP A;  4DV5 B;  2A3E A;  2BCC H;  1KYO F;  3ETG A;  2IM9 A;  3R65 A;  5LMN B;  4ZI7 A;  2KO7 A;  2D2C B;  1Y67 A;  4R7C A;  1ROP A;  2WLI A;  5B8I C;  3KAI A;  4MNK A;  5GPR A;  2G41 A;  1EDQ A;  5FPO A;  5J2U A;  2OCH A;  2E5L B;  3FFQ A;  4I0X B;  3CCV V;  2QSA A;  2Z3Y A;  2HR3 A;  1IBK B;  2KB1 A;  3WQW A;  5HFM A;  1RP3 B;  2N87 A;  3ZRV A;  4X1I A;  1N32 B;  4IHJ B;  2PYJ A;  1AB3 A;  4WIW A;  5DIU A;  3LDD A;  3MHH C;  2Q7E A;  2XP6 A;  3ARO A;  2ODM A;  5DN6 G;  1L1P A;  5J2T B;  3LSU A;  1NWU A;  1JFF B;  1SZX A;  1Q7Y W;  4JI4 O;  4A5U B;  1FJD A;  1JA8 A;  1ZL8 A;  1GN2 A;  3ABL B;  3VQY A;  4X62 O;  4O4H A;  2F4V B;  4EFB A;  4Q20 A;  3OTO O;  1YJN V;  4LF4 O;  1GPF A;  3CX5 F;  2OTL V;  1NMV A;  4DZ3 A;  4DRI A;  5A2Q N;  2OT5 A;  1IDS A;  1H8E G;  1VQL V;  3QO5 A;  4R0X A;  2YIB A;  5FPR A;  2ZIO A;  2XT9 A;  2QWN B;  2IJI A;  5GW7 A;  3OMN B;  3JYM A;  1T11 A;  4IIJ B;  1FXK C;  3PJS K;  3CHF A;  4YHH B;  2ILM A;  3CCQ V;  3B8S A;  1YSC A;  4TOI A;  1LUW A;  4JI1 B;  4AIL C;  3DXR A;  1EBO A;  4NTW A;  3VQX A;  3OUF A;  4ITZ A;  3UM7 A;  3AG1 B;  1OHH G;  4H0L B;  4LFC O;  3H9R B;  3SPC A;  1Y0O A;  2Q0O C;  4P9P A;  3AEI A;  3AG4 B;  4DUZ B;  1SF9 A;  4I55 B;  1S3J A;  1OCZ B;  4X1Y B;  3BCC H;  3UQ8 A;  3T1H O;  4JI5 B;  2WLL B;  1U96 A;  1WP8 A;  2PF4 E;  4TQF A;  2IUZ A;  1QNM A;  4O4I A;  2HHH O;  5L3F A;  1E15 A;  2UXD O;  2PV2 A;  4DRK A;  3G6L A;  1B6Q A;  1HKM A;  4TUY B;  1XI1 A;  3NTP A;  1QZ2 A;  4X64 O;  5ITZ B;  4U7N A;  2DN9 A;  2CDY A;  4IQ2 A;  1XQ8 A;  4DYL A;  5AG2 A;  3RT3 C;  4KL1 A;  3O5Q A;  2L2S A;  1V54 C;  4KFM A;  4BIZ A;  4I50 A;  2PV3 A;  3CRM A;  5IWA B;  3JCZ A;  1FAF A;  3IFX A;  2AXT Z;  2CH7 A;  3CXC U;  1OGB A;  2LW1 A;  2ESC A;  4ODQ A;  4J7Z A;  3DC6 A;  4WBN A;  1D5N A;  1WB7 A;  1ZX3 A;  4IYI A;  1GOI A;  1AJN A;  3T2M A;  1K5S A;  5LXT A;  1LL7 A;  3ARV A;  3ARU A;  1HNZ B;  1PP9 H;  3WH0 A;  1ZAU A;  4DR7 B;  4HAR A;  2Z5U A;  1PL0 A;  4FFB B;  1N33 O;  1J5E B;  2XAJ A;  2ITK A;  2GTA A;  2LGW A;  4JI8 O;  4G50 A;  4UFZ A;  4GIV A;  3RVY A;  2LJ4 A;  2X6A A;  2IH1 C;  1E6P A;  1SQG A;  2JGD B;  1M57 C;  1YTF B;  2KR7 A;  3WL0 A;  4OPA A;  5CA3 A;  2FYU H;  1F40 A;  2YXL A;  3TC5 A;  3UO3 A;  4FVM A;  1K33 A;  5KHJ A;  2WA3 A;  5IYZ A;  2RUD A;  2YIA A;  2VQF O;  4F4L A;  2CUG A;  1YW5 A;  2O57 A;  2P90 A;  4DV4 O;  4TWK A;  1W9V A;  3DC5 A;  3EIP A;  2JS3 A;  3DGE A;  3ZRW B;  1FKJ A;  1TA8 A;  1SA0 A;  1KQS U;  1YJ9 V;  1VAR A;  2IH3 C;  3X2Q B;  1JOY A;  4DZ2 A;  1AVM A;  3AG3 C;  2PPP A;  3ABK C;  5CBG A;  1PL4 A;  1DF4 A;  3N2K B;  1JNS A;  1YZB A;  1UR8 A;  4R50 A;  3MHS C;  2YDE A;  1N4C A;  4DR6 O;  4DR2 B;  4LH6 A;  3STZ C;  1QPF A;  3STL C;  4UVB A;  1FKG A;  1EZJ A;  1SKV A;  1K34 A;  1V55 C;  3ARP A;  2BTO A;  4JF3 A;  3MDS A;  1V54 B;  4DV3 O;  2ZE6 A;  4FN2 A;  3CD6 V;  3QF7 A;  1QLN A;  5KLV H;  4H13 B;  3BHP A;  4QE7 A;  4I55 A;  4X1Y A;  4RUF A;  5BZB A;  1E6R A;  2CGO A;  3RFW A;  2V4D A;  4PHZ A;  1IVS A;  4B3M B;  3OA5 A;  2N04 A;  3CGN A;  1FKT A;  1GKF A;  4DO2 A;  2OCC C;  1PV0 A;  3HKB A;  4L3N A;  1H0I A;  4DRP A;  1XMO B;  1E1R G;  1LR1 A;  4OX9 B;  1DK1 A;  5BMV A;  2JRI A;  3T4Z A;  5H2F Z;  4DV2 B;  3HPL C;  5IJ0 B;  2EUL A;  2Q73 A;  5IY5 C;  4ODP A;  3AG2 C;  4TV8 B;  1VQN V;  1JCH B;  2HVJ C;  4XDJ A;  3RYC B;  1Q6H A;  5IYC O;  1P7B A;  1F51 A;  4MVU A;  2ZQS A;  4CS3 A;  1JX9 A;  3CRC A;  3P30 A;  1K9M W;  5EIB C;  4W4L A;  2EZO A;  1IXB A;  1M57 B;  2RSE A;  4FM1 A;  1TUB B;  1O9G A;  2VQE O;  2PBC A;  4GCZ A;  4WKH A;  3OFN G;  3RWR D;  2XAF A;  1RSO B;  4KXR A;  3EFF K;  2IBZ H;  3D3Q A;  3CCS V;  3WD0 A;  2ITD C;  1J4H A;  4JV5 B;  3AS3 A;  3B09 A;  4GX0 A;  4YXW G;  3ZJZ A;  4URI A;  3CSX A;  1I94 O;  4MTV A;  3OE7 G;  1JMK C;  3CRA A;  5L3C A;  4B08 A;  5JH8 A;  3GU0 A;  5DED A;  1PM9 A;  1QLE B;  2EIM B;  1M56 B;  1TFV A;  4JI7 B;  3QO8 A;  3AG3 B;  3ARQ A;  5H6Q A;  1LL4 A;  4YJ3 B;  3ZIA G;  3SPG A;  5DM6 V;  4E4E A;  4LNU A;  3JAM N;  2V7Q G;  3TGU H;  2HLD G;  3LDC A;  4Z2G A;  2YBT A;  1BS3 A;  5L3B A;  2A3C A;  2F2D A;  3BMB A;  1V55 B;  2JVD A;  1S0V A;  1TAE A;  2PPO A;  3P3P A;  3WG7 C;  2DT2 A;  3A0R A;  4QNH B;  5JVD B;  1DGS A;  2DMX A;  3B77 A;  1N8R W;  4KHP B;  1AJP A;  2Z0A A;  3Q4H B;  1MA1 A;  1HKJ A;  1XRV A;  3O5D A;  4XAK A;  3CHE A;  3OM3 B;  5FNV A;  1IBM O;  1W1T A;  3RN4 A;  4WK9 A;  4XBF A;  2ZDI C;  3BPZ A;  4NXM B;  5IJ9 B;  3JAR A;  1XNR B;  2YC0 A;  1BKF A;  5DEZ A;  4GKJ O;  4EFE A;  5KX5 B;  4ZHQ B;  5K1X A;  1R6K A;  3RGC A;  1VQO V;  3NR7 A;  3H1J H;  3B9A A;  3K04 A;  3KAG A;  1W1Y A;  3KAH A;  2PI6 A;  4F6E A;  1NWT A;  5IY5 B;  3QTC A;  2MW2 B;  1H0G A;  1D7H A;  2LGQ A;  2RNB A;  2XAG A;  2FL4 A;  1D7J A;  4CH4 A;  1FKK A;  5DF0 A;  1EN5 A;  2EJ7 A;  3WD2 A;  1BL4 A;  1GM8 A;  4DR5 O;  1V9P A;  4X65 O;  1E6Z A;  1VQ5 V;  2QDO A;  1P49 A;  4ODO A;  5C8Y A;  1MSW D;  4NXN B;  4X66 O;  4K0K O;  3W7W A;  2HP8 A;  5J9P C;  1W2B U;  2PPN A;  4UVA A;  2YEV B;  3KAB A;  4FK5 C;  4X20 B;  4WKF A;  3CCL V;  2UUA B;  4UUJ C;  3H1K H;  2PI4 A;  5GQB A;  2NN4 A;  1KKD A;  3C3S A;  4B7E A;  3D36 A;  2Y4U A;  4JI1 O;  4L8J A;  4ZI7 B;  1K4C C;  2DQ0 A;  3HKC A;  4GX2 A;  2WLI B;  1NR1 A;  3RM4 A;  4W4K A;  5J2U B;  2MF9 A;  1YTF D;  4MT8 A;  4Z2H A;  2Y0I A;  4NTY A;  1RSO A;  2BSK A;  5HW6 A;  4QIW F;  4CH5 A;  2A3Q A;  4DWS B;  1IXM A;  1NWS A;  1GRJ A;  2QE7 G;  3E22 A;  4H37 A;  4DV0 B;  2UUC B;  1XNQ B;  4JI6 O;  4JYA O;  4Z1M G;  3SYQ A;  4F6R A;  1R73 A;  2CTQ A;  4X1I B;  4Z2I A;  2KG7 A;  2RMK B;  1HXV A;  4MTX A;  3O5R A;  3ASO B;  3UT5 B;  3NRK A;  2E76 B;  1O9H A;  1HNW B;  4CS4 A;  4NVP A;  4DRJ A;  2RUQ A;  3T1Y B;  2ZQU A;  1ZL8 B;  1JND A;  2ADP A;  4O4H B;  3O5G A;  3ETE A;  4UV8 A;  2X6B A;  4QPJ A;  5IYB O;  1MMM A;  4CH3 A;  2GHY A;  2FKX A;  1VQP V;  3UF8 A;  4JYS A;  4AQY B;  2ZM6 O;  3E89 A;  4S3K A;  4CZZ A;  4G2K A;  4NB5 A;  1A32 A;  1TCO C;  1QU7 A;  2XND G;  3O9O A;  4PEL A;  2OIE A;  2FKE A;  1Q6U A;  4DUY B;  3GVM A;  4KUM A;  3WU2 Z;  2A3B A;  3FKS G;  3ARS A;  4ZPW R;  3RM8 A;  4DRX A;  2XHB A;  1LJY A;  1FJG O;  3DXR B;  3RYI A;  1SQX H;  3JAL A;  3ABL C;  3QNE A;  4DR3 B;  5IE9 A;  4X88 A;  1FKR A;  3CZ8 A;  1N36 B;  2IJK A;  4HNA A;  3KZ7 A;  1OCR B;  4JI2 O;  4UDM A;  4U3J A;  1VF8 A;  4UCV A;  1BHA A;  3JAW A;  4DR4 O;  4FLX A;  3FXY A;  3EXA A;  4O4I B;  1XL6 A;  3O5K A;  3TXQ A;  2G38 A;  4PD4 F;  1FKB A;  1AR5 A;  4CC6 A;  3JAT B;  1URF A;  4UCR A;  1TVK A;  1QPL A;  1OCC C;  1XUQ A;  3ZHQ A;  4ODL A;  4DW0 A;  5DIV A;  5E1A C;  4BW5 A;  1YCI A;  4X1K A;  4NTX A;  4UV9 A;  2WA4 A;  2BOC C;  3AG1 C;  3CP1 A;  3CHX A;  4JAS A;  4MSP A;  2KGJ A;  3K0D A;  1M1K W;  1E1Q G;  3AG4 C;  2CH7 B;  2OTJ V;  5LGT A;  2WAM A;  2OLH A;  2RQ6 A;  3L70 H;  4WBN B;  4DR2 O;  4ASU G;  2YI8 A;  3IJ4 A;  3PRB A;  1AI5 A;  3G6M A;  2FTK A;  1LQ0 A;  3KCY A;  3N2G A;  1Q5O A;  2PI5 A;  1AJQ A;  3DTU B;  2GUZ A;  2CGN A;  5LXT B;  4RQE A;  3K9A A;  2QF8 A;  4U3F H;  3O5O A;  2OIG A;  4PI2 A;  5GPG A;  4U86 A;  2UU9 O;  2DE0 X;  2H94 A;  2QJ1 A;  2DYR B;  2UUB B;  3OEH G;  3GWO A;  4PA4 A;  1Z5W A;  4LF5 O;  2Q6A A;  3FYI B;  3M99 B;  4BW9 A;  1VQ7 V;  4DWS A;  2JJ1 G;  1SQQ H;  4JI0 O;  4UB8 Z;  1JR9 A;  1HR0 B;  4UCU A;  1MNG A;  1BL8 A;  4D7S A;  5KUK A;  2ZE7 A;  2R72 A;  3AK3 A;  4DV6 O;  2JK5 C;  1XMO O;  3CGM A;  3PR9 A;  1YXB A;  1VQ6 V;  4FFK A;  1NH2 B;  5LP6 A;  5BR8 O;  3UT5 A;  3ZED A;  4J10 A;  1YHQ V;  4DV2 O;  3F7V C;  5E79 Z;  5IYZ B;  5B1N A;  3J7A U;  1VQ9 V;  4AY1 A;  1Y74 A;  2QM8 A;  3K08 A;  2X6C A;  5HWC A;  2EIK C;  2IU3 A;  4FLT A;  2AHY A;  3LDE A;  5DEC A;  1HNX B;  1RPO A;  3ICX A;  2PYL A;  1ZTE A;  1S5J A;  1GUV A;  1HJV A;  4LF7 B;  1SA0 B;  3BEH A;  2Q69 A;  1ZU8 A;  4WJX A;  1FKA O;  4RWU A;  3VBB A;  5EYP A;  4DRM A;  2PZS A;  3SPJ A;  2XP8 A;  4NSB A;  1EN4 A;  2RUR A;  5EIB D;  1AR4 A;  5BXZ A;  1OCC B;  1X6L A;  3CCR V;  3H9V A;  3IKG A;  1R3I C;  4DRH A;  3U0Z A;  2ZCE A;  1F4M A;  1F8A B;  3W7U A;  3O5J A;  3B4S A;  3ZMU A;  4DV1 O;  4ODN A;  3IKD A;  3F7Y C;  1NMW A;  1KU9 A;  1R3L C;  2FDM A;  1HW7 A;  4PDR A;  4DV3 B;  4UB6 Z;  2OWO A;  3OTF A;  1B6C A;  1U79 A;  1WAZ A;  5B3S B;  2Y0P A;  4BF8 A;  3X2Q C;  4DW1 A;  1IBL B;  2ZR5 A;  2VRZ A;  1GTO A;  1QR9 A;  1H2M A;  3HKB B;  1SC5 B;  4BIO A;  1K9T A;  1H2L A;  1VF6 C;  3JAT A;  1XMQ B;  1ORQ C;  2F4E A;  2XAS A;  2HKO A;  1WPX A;  5BMV B;  2FAP A;  3ZN0 A;  1ZBV A;  2BOB C;  1VQK V;  1KFW A;  4YY3 O;  2ATK C;  3ETQ A;  2ZQT A;  2RQS A;  3HKE A;  4LR3 A;  4LFA O;  4JFI A;  2N74 A;  2XTA A;  3K79 A;  3W7T A;  2DJV A;  1BZK A;  2WLY A;  3U10 A;  3ARZ A;  5CA0 A;  2YS8 A;  2VWK A;  4JYB A;  4MTO A;  1N1A A;  2QM4 A;  3K3W A;  3W4R A;  2QM7 A;  3OUS A;  3G6B A;  1JQ0 A;  1UR9 A;  4LFB O;  4B3R O;  1VIB A;  3J80 N;  2LJ2 A;  4O4L A;  1NI8 A;  4R6Z A;  1AR1 B;  4IPX A;  3RW0 A;  1Q1C A;  2WLJ A;  3O5I A;  4Q6G A;  2XP9 A;  2EIK B;  1AI4 A;  4DR1 O;  4B3T B;  2W0F C;  1JJO A;  3D36 C;  1N34 O;  1FAP A;  1L1F A;  1SET A;  3CB2 A;  1AIL A;  2CTR A;  4DV7 O;  1NR7 A;  1VQM V;  2YIB D;  1P84 F;  3G71 V;  1TGO A;  1M90 W;  4N23 A;  2AZ0 A;  5EZY A;  2MNT A;  3K58 A;  4J11 A;  4LNU B;  4JZ2 A;  4BAY A;  4W9P A;  2EJR A;  4JYC A;  4B3S O;  4G28 B;  1FKS A;  3TCZ A;  1R1B A;  3SJA C;  4H44 B;  4JTD B;  4GX1 A;  2QWO B;  3CMA V;  3ALG A;  5D75 A;  5IYD O;  1XBL A;  3WD3 A;  3UKM A;  1G1X B;  2UXB O;  3ARX A;  2VS0 A;  3OT7 A;  4FJC C;  1M5Y A;  4FM0 A;  1ZUQ A;  1QLE C;  2EIM C;  3MAQ A;  2P67 A;  5FNV B;  1M56 C;  1KB9 F;  3QO7 A;  3ZRS A;  4LF9 B;  3I55 V;  2EZP A;  4L72 B;  1FXH A;  2DSW A;  3JAR B;  2QEX V;  5LMU O;  1YIJ V;  4DH0 A;  3ETD A;  1SQV H;  2UUC O;  2L6L A;  2UXC O;  1S72 V;  4D6T H;  3UQI A;  3M7M X;  1VEW A;  2YXH A;  3HKD A;  2H8P C;  3L73 H;  4ZS6 A;  4QPK A;  3CCJ V;  1PNM A;  2WK2 A;  2OFN A;  2XP7 A;  3TK1 A;  2PY5 A;  2QA4 V;  4YIP A;  5JCO A;  5JWP A;  1SQB H;  3SR2 C;  1BQ0 A;  5LHI A;  4MPK A;  1BHB A;  4J9Y B;  1SRY A;  3SPI A;  2DOS A;  1S76 D;  1YVW A;  2KSD A;  3BRC A;  2JJ2 G;  3B9E A;  2Q68 A;  2Y69 B;  3I6C A;  1Q8I A;  2ETN A;  2W0X A;  3K59 A;  5GON B;  5LGU A;  1KT1 A;  3IK8 A;  2OYQ A;  1D7I A;  1FFX A;  5LHH A;  2H3O A;  4YJ2 B;  1WPB A;  3UQB A;  5C8Y B;  4K8Z A;  1SER A;  1NT2 B;  4J80 A;  2V1D A;  1Y76 A;  2EIN C;  4ODM A;  2O9O A;  1P7G A;  5D5Q A;  2GBO A;  3SGI A;  2P7T C;  4I5S A;  4GKK O;  2NLJ C;  3UI5 A;  4HZ3 A;  4IYH A;  4GT1 A;  5JH7 A;  1B04 A;  4DIP A;  4UCT A;  4ML4 A;  3ZCC A;  3CME V;  2F93 B;  3K06 A;  4LF8 O;  4WFF A;  4JYY A;  1E44 A;  4LF6 O;  3HKC B;  2NR5 A;  4PA6 A;  3JD1 A;  2ZIN A;  3OMI B;  4WFH A;  2LW7 A;  2ZD9 A;  1KP2 A;  1OCO C;  3MD0 A;  1NH2 D;  2VWJ A;  2BSK B;  4JI4 B;  1IUR A;  3EY6 A;  4FLV A;  3OTO B;  3ZMZ A;  4LF4 B;  3E22 B;  2A3A A;  4P8U A;  3E8F A;  3I5D A;  4IQC A;  3O65 A;  1ZL1 A;  4OXS A;  3RBZ A;  4NR1 A;  1XIL A;  4F6R B;  1GM7 A;  4JGS A;  2KG7 B;  3U11 A;  5EBW C;  1R3J C;  4HBN A;  1JNT A;  1HKI A;  2XPA A;  1I08 A;  4FZ0 A;  4LAW A;  3CJH A;  4PTM A;  1SZT A;  1RD6 A;  1GM9 A;  1WNO A;  3WD1 A;  4MNJ A;  1ZK6 A;  2GV9 A;  2M6Y A;  2M7W A;  3ZHT A;  2E3C A;  5KHK A;  2XOK G;  3ZS8 C;  4DV5 O;  3AK1 A;  4GZR B;  4DWS C;  4O2A A;  5LMN O;  4GX5 A;  4U7O A;  3RFR A;  3KG2 A;  2ZR4 A;  1UFI A;  1Q6I A;  1YEW A;  5DO2 A;  4DK1 A;  5GTH Z;  1H38 A;  2P22 C;  1FXK A;  3T1H B;  1R6N A;  3KAC A;  3FYE B;  2AWG A;  3QVN A;  5HW7 A;  3BFR A;  3UQA A;  3EHB B;  1NBM G;  2EBO A;  4DRX B;  3ASO C;  4GLX A;  4FLY A;  2E5L O;  2XUM A;  2HHH B;  1ZB5 A;  3SYO A;  5B5E Z;  3RYI B;  1NQT A;  1R3K C;  2UXD B;  3CE2 A;  4ZPT R;  4MVR A;  4U85 A;  3JAL B;  2B5U A;  3JYJ A;  2EIN B;  3PRD A;  1H2G A;  1W1P A;  4FAP A;  1IBK O;  1PBK A;  1K3E A;  4X64 B;  3LUT B;  3AS1 A;  1N32 O;  4HNA B;  4H33 A;  1VF7 A;  3FAV A;  2AZ2 A;  2EIJ B;  4U3J B;  3L9D A;  3JAW B;  5LA6 A;  3BVO A;  3AG7 A;  4NKG B;  1EM1 A;  1P5Q A;  2ZXW B;  4RQF A;  1K73 W;  1YAT A;  2JS5 A;  3JAS A;  2F4V O;  2ZR3 A;  1D6O A;  1K7D A;  1UPG A;  5GON A;  3ZHR A;  4FPP A;  4Z1V A;  3UI4 A;  1TVK B;  4QGP A;  1J4R A;  2XP5 A;  1OCO B;  4YJ2 A;  1HNX O;  3OEE G;  1XL4 A;  4X1K B;  3S3W A;  4EKW A;  4J7K A;  4JTC B;  4RUE A;  2ARH A;  3FY1 A;  5H6R A;  3FX7 A;  1EN6 A;  2FB5 A;  3O5E A;  1K92 A;  1GO3 F;  1US6 A;  1OCR C;  1OWQ A;  4MS2 A;  1N33 B;  4YHH O;  1EYM A;  2PGG A;  2AOS A;  1U97 A;  4JI8 B;  2XAH A;  3D3I A;  4PA3 A;  1SR0 A;  3N2G B;  2W6I G;  3A8T A;  3JSN A;  5IT9 N;  2P4K A;  5LL6 Y;  1G8M A;  4QIB A;  4FLU A;  2M2A A;  2GUZ B;  5JQG A;  3BA8 A;  3GTY X;  1WA8 A;  2Q8V A;  2AHZ A;  4DUZ O;  2Y78 A;  2BTQ A;  4JI5 O;  1WAW A;  1CPY A;  3CYO A;  4FIP C;  1XHG A;  1S77 D;  1FKD A;  1SQP H;  4CH6 A;  1SYT A;  4HBE A;  4DV4 B;  3ASN C;  1XHX A;  2HVK C;  4PI0 A;  2BE3 A;  1BMF G;  2RDC A;  3WIJ A;  1Q86 W;  2XPB A;  3E8B A;  2E74 B;  5KHI A;  3G67 A;  4Z2K A;  1W0J G;  5LP6 B;  1MOF A;  4UVC A;  4NZC A;  2LQT A;  3OR7 C;  2F23 A;  4J4O A;  2WWW A;  3CRR A;  1QVG U;  5C93 A;  4FZ1 A;  3AK2 A;  5IWA O;  3VQW A;  1Y74 B;  4DR6 B;  5D5P A;  2RN9 A;  3B2E E;  2DYR C;  3WB2 A;  5B66 Z;  1C9H A;  4EB6 A;  1W9U A;  5EK0 A;  2XAQ A;  2W6J G;  1QBZ A;  1ZSP A;  3IC7 A;  4TW6 A;  4R8C A;  3G6E V;  2LP7 A; 
#chains in the Genus database with same CATH homology
 3QOK A;  1YW5 A;  2PV1 A;  1W9V A;  1GUV A;  1HJV A;  1ITX A;  1ZU8 A;  4WJX A;  2DSU A;  2Q5A A;  5J6E A;  3RM9 A;  1FKJ A;  1HJX A;  4DRM A;  2XP3 A;  5HT1 A;  2XP8 A;  4NSB A;  2RUR A;  4LAY A;  4DZ2 A;  3LUO A;  2PPP A;  2MLY A;  1X6L A;  1JNS A;  4J4N A;  1UR8 A;  3IKG A;  4IT4 A;  1EIB A;  4DRH A;  3KAD A;  4JFK A;  1QPF A;  1WB0 A;  2MLX A;  5I98 A;  1F8A B;  3WD4 A;  3O5J A;  3VAW A;  1FKG A;  4O2T A;  3MDY B;  3ARP A;  1W1V A;  4ODN A;  1FFQ A;  3IKD A;  4Z2L A;  1NMW A;  1ZBK A;  2FDM A;  4FN2 A;  4QT3 A;  4WKA A;  1B6C A;  1U79 A;  4TX0 A;  4BF8 A;  1E6R A;  3RFW A;  2ZR5 A;  2JZV A;  4TYO A;  1LG1 A;  1W26 A;  3OA5 A;  3CGN A;  1K9T A;  1CTN A;  1FKT A;  3ARR A;  3O5P A;  2F4E A;  4W9Q A;  4MGV A;  2FAP A;  1NH6 A;  1ZBV A;  3TDB A;  1KFW A;  4L3N A;  1H0I A;  4DRP A;  2ZQT A;  2RQS A;  2KI3 A;  4JFI A;  4ZPV R;  2WLY A;  1E9L A;  3ARZ A;  3OOB A;  4ODP A;  1N1A A;  1OGG A;  4IT6 A;  1Q6H A;  4NNR A;  3W4R A;  2D9F A;  2ZQS A;  2RUC A;  3PRA A;  2UZ5 A;  1UR9 A;  4P8W A;  4P8X A;  4DRQ A;  3CHC A;  2DG9 A;  3CH9 A;  1LL6 A;  1W9P A;  2RSE A;  1X6N A;  1ZBW A;  4IPX A;  2PBC A;  1Q1C A;  4WKH A;  1FD9 A;  3WD0 A;  3O5I A;  1J4H A;  2XP9 A;  3AS3 A;  3B09 A;  1FAP A;  4KR0 B;  4JFJ A;  2WLZ A;  4URI A;  1FFR A;  4MTV A;  4DRN A;  2YBU A;  5BXJ A;  5JH8 A;  5HW8 A;  1NWR A;  2MNT A;  5HWB A;  5HBF A;  1TFV A;  4W9P A;  2B31 A;  3O5M A;  1FKS A;  4N19 A;  3TCZ A;  3ARQ A;  1LL4 A;  2LKN A;  1JVW A;  4LAV A;  3ALG A;  5D75 A;  2DSV A;  2ZR6 A;  3WD3 A;  4Z2G A;  1EHN A;  2YBT A;  5HKG A;  1O6I A;  5DIT A;  5HUA A;  2F2D A;  2A3C A;  3ARX A;  3UI6 A;  3RME A;  4JFL A;  2PPO A;  2WM0 A;  1M5Y A;  2DT2 A;  1NSG A;  4G2P A;  2XP4 A;  2ZQV A;  1J6Y A;  2DT3 A;  4LGX A;  3ARW A;  4L72 B;  5HTG A;  1R9H A;  1HKJ A;  1XRV A;  3O5D A;  4XAK A;  2DSW A;  1KT0 A;  3CHE A;  1W1T A;  4DH0 A;  2IF4 A;  4WK9 A;  1A7X A;  3O5L A;  3UQI A;  4ZS6 A;  1IX5 A;  2WK2 A;  2OFN A;  2M1I A;  2XP7 A;  4S3J A;  1BKF A;  5DEZ A;  4MNL A;  3ODK A;  4ODK A;  1ROU A;  4QT2 A;  3RGC A;  3WL1 A;  4MPK A;  3WKZ A;  3B9A A;  3KAG A;  1HKK A;  1W1Y A;  3KAH A;  3B9E A;  2PI6 A;  1NWT A;  3I6C A;  1H0G A;  1D7H A;  3JXV A;  1D7J A;  1KT1 A;  3IK8 A;  1FKK A;  4P8V A;  1D7I A;  3UQB A;  5DF0 A;  2VCD A;  3NI6 A;  2DT0 A;  3WD2 A;  1BL4 A;  4ODM A;  2O9O A;  1E6Z A;  3B7X A;  2DSZ A;  4ODO A;  2KE0 A;  2LGO A;  3AS0 A;  3UI5 A;  2VN1 A;  4DWS D;  2PPN A;  1J4I A;  3O5F A;  1ZBC A;  3KAB A;  4DIP A;  4WKF A;  4W9O A;  2DPE A;  4ML4 A;  5GQB A;  2KFW A;  4GGQ A;  1HJW A;  1FKH A;  4Q7N A;  2A3E A;  2KO7 A;  3RM4 A;  3ART A;  3EY6 A;  2MF9 A;  4Z2H A;  2A3A A;  1FKF A;  3KAI A;  4P8U A;  5B8I C;  5HW6 A;  4MNK A;  4IQC A;  5GPR A;  2G41 A;  1EDQ A;  1ZL1 A;  4DWS B;  1ZCN A;  1NWS A;  4Q22 A;  1JNT A;  1HKI A;  2XPA A;  4LAW A;  4Z2I A;  1HXV A;  4PTM A;  3O5R A;  1RD6 A;  1ROT A;  1WNO A;  1E6N A;  3WD1 A;  4MNJ A;  1ZK6 A;  3WQW A;  4Z2J A;  2N87 A;  3NRK A;  3PA7 A;  4DRJ A;  5DIU A;  2RUQ A;  4WIW A;  2ZQU A;  1JND A;  2XP6 A;  3ARO A;  4C02 B;  3AS2 A;  1L1P A;  1NWU A;  1LG2 A;  3O5G A;  4DWS C;  4KQZ A;  2ZR4 A;  1FJD A;  1Q6I A;  5DO2 A;  3UF8 A;  4U84 A;  4TW7 A;  1GPF A;  4JYS A;  3ALF A;  3B9D A;  4ODR A;  3KAC A;  2AWG A;  1NMV A;  4S3K A;  4DZ3 A;  5HW7 A;  4DRI A;  4R5E A;  3UQA A;  1TCO C;  2M08 A;  2FKE A;  4R0X A;  1Q6U A;  1ZB5 A;  2A3B A;  3ARS A;  4ZPW R;  4ZPT R;  3RM8 A;  4MNM A;  4U85 A;  3JYJ A;  3JYM A;  1W1P A;  1T11 A;  3PRD A;  1LJY A;  4FAP A;  1PBK A;  3CHF A;  3B8S A;  3AS1 A;  2MPH A;  1FKR A;  3CZ8 A;  4ITZ A;  3KZ7 A;  4QZV B;  1PIN A;  3H9R B;  3AQU A;  1P5Q A;  1Y0O A;  1YAT A;  1VF8 A;  3FXY A;  1FKL A;  1D6O A;  3IHZ A;  3UI4 A;  3O5K A;  1J4R A;  2XP5 A;  3WQV A;  3FAP A;  2IUZ A;  1FKB A;  1JNE A;  1QPL A;  1E15 A;  3FY1 A;  2PV2 A;  4DRK A;  2K8I A;  2DG3 A;  4ODL A;  5DIV A;  3O5E A;  3G6L A;  1EQ3 A;  1HKM A;  3ARY A;  3BXW A;  1OWQ A;  3NTP A;  1QZ2 A;  3CHD A;  1EYM A;  4DRO A;  4DT4 A;  2AOS A;  4MSP A;  2KGJ A;  4IQ2 A;  3O5Q A;  2L2S A;  2MLZ A;  1SR0 A;  2OLH A;  2PV3 A;  4QIB A;  2M2A A;  4JFM A;  2O92 A;  3PRB A;  1OGB A;  2ESC A;  4ODQ A;  4TNS A;  3G6M A;  4W5U A;  1LQ0 A;  2G8Z A;  2Y78 A;  1FKI A;  2QF8 A;  1WAW A;  3O5O A;  5GPG A;  1GOI A;  4U86 A;  2DT1 A;  4LAX A;  1XHG A;  1FKD A;  1LL7 A;  1SYT A;  4HBE A;  3ARV A;  3ARU A;  3WH0 A;  4DWS A;  3WIJ A;  2XPB A;  4HAR A;  3GPK A;  3KAF A;  4Z2K A;  4TW8 A;  2ITK A;  4NZC A;  4MAV A;  3PR9 A;  3CGM A;  4J4O A;  4G50 A;  1D2K A;  4HBO A;  4GIV A;  2LJ4 A;  1E6P A;  2KR7 A;  2DG4 A;  3WL0 A;  2LPV A;  1C9H A;  1W9U A;  3KCE A;  4AY1 A;  1F40 A;  3TC5 A;  4TW6 A;  2RUD A;  5HWC A;  2F21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...