4ODOA

Structure of slyd from thermus thermophilus in complex with fk506
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD
total genus 35
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odoA00
1P5QA 4ODMA 3PRBA 1F8AB 2XP5A 1TCOC 3TC5A 5HWCA 1R9HA 4DT4A 4ODNA 3TDBA 1D7HA 4JFMA 4LAYA 1FKSA 3O5QA 2K8IA 1YATA 2KE0A 1J4HA 2RUQA 3JXVA 1FD9A 1N1AA 2FAPA 4LAXA 2M2AA 4QIBA 1B6CA 2ZR6A 3ODKA 4BF8A 1KT0A 3IK8A 4MSPA 4DRKA 1FKFA 2RUDA 4J4OA 1FAPA 1PBKA 4ODRA 4W9QA 1FKJA 1FKGA 3IKDA 2LGOA 3VAWA 4U86A 1EYMA 1QZ2A 3O5LA 2ZQTA 4DZ2A 2KO7A 3KABA 4DRJA 3O5GA 4DIPA 5DIVA 3RGCA 3RFWA 1QPFA 2MF9A 4U84A 2XP6A 5HW7A 4JYSA 3NRKA 1W26A 2OFNA 4GGQA 4DRIA 2KGJA 4R0XA 1U79A 2PV2A 3H9RB 4DRHA 3O5IA 4ODLA 3O5JA 2RUCA 5HW6A 3O5RA 4DZ3A 2XP4A 4NNRA 1D7IA 2LPVA 2ZQSA 3IHZA 4ITZA 3JYMA 2XPBA 5DITA 1NSGA 1F40A 2LKNA 2VCDA 4DRQA 2RURA 3UI6A 1HXVA 2PV3A 3UQIA 4QT2A 1ROUA 4TW8A 4LAVA 5J6EA 4DH0A 4G2PA 4TW6A 2PPPA 2ZQVA 3B7XA 3UF8A 2XPAA 3PA7A 4TNSA 3UI4A 4DRMA 1C9HA 2AWGA 3O5DA 3NI6A 3KZ7A 1KT1A 5HT1A 4DRNA 2ZR4A 4O2TA 2MLZA 2RQSA 4W9OA 1FKBA 3PRDA 5BXJA 2MLYA 5I98A 4GIVA 5HW8A 4N19A 2M08A 1FKDA 4ODPA 5HTGA 4ODKA 2PPOA 1EQ3A 4DROA 1J4RA 3KAGA 1J6YA 5GPGA 2LJ4A 1Q6HA 3KCEA 3OOBA 2F4EA 3FAPA 3JYJA 2MLXA 3UI5A 1JNSA 2XP3A 2Y78A 2DG4A 3EY6A 2L2SA 4C02B 1Q6IA 5HKGA 3O5PA 1BL4A 4DRPA 5HWBA 3I6CA 3IKGA 1T11A 4QT3A 1L1PA 2VN1A 2IF4A 3O5OA 3LUOA 2XP9A 2F2DA 4IQ2A 1J4IA 4J4NA 4JFLA 2PBCA 1BKFA 1ZK6A 4G50A 3O5EA 1FJDA 5HUAA 2PPNA 2PV1A 4U85A 1Q6UA 1FKTA 1Y0OA 1FKHA 2KR7A 1JVWA 3KACA 3O5KA 4JFIA 5DIUA 3TCZA 3O5MA 3WH0A 2ZQUA 2MPHA 1FKIA 4IQCA 4FAPA 4MGVA 2ITKA 3O5FA 3MDYB 4JFJA 1NMWA 1QPLA 3KAIA 1ROTA 5B8IC 1FKKA 2KI3A 1FKRA 2XP8A 2UZ5A 4ODOA 3CGMA 1ZCNA 4JFKA 5D75A 2JZVA 3KAFA 1JNTA 4TX0A 4LAWA 2KFWA 1A7XA 3UQBA 1Q1CA 2N87A 3KAHA 2Q5AA 4ODQA 3NTPA 1D7JA 2D9FA 2FKEA 4TYOA 2M1IA 1D6OA 1M5YA 1YW5A 3UQAA 2DG9A 4TW7A 1NMVA 1PINA 1FKLA 2F21A 4W9PA 2ZR5A 4FN2A 3KADA 2MNTA 2RSEA 3CGNA 4IPXA 3GPKA 2DG3A 2XP7A
chains in the Genus database with same CATH superfamily
3WL1A 1TCOC 4URIA 5GQBA 3G6LA 1K9TA 1W1YA 4JFMA 3TDBA 1LG2A 1CTNA 1ZBVA 2ZR6A 3ODKA 4BF8A 1KT0A 3AS1A 1FKFA 2RUDA 4ODRA 1PBKA 4W9QA 1FKJA 1FKGA 4U86A 1EYMA 1QZ2A 3PR9A 1HJVA 2O92A 2P4VA 3RFWA 4U84A 4KR0B 1W26A 4DRIA 2OLHA 2IUZA 4HBOA 4R0XA 1ZBWA 1W9VA 1UR9A 4ODLA 3ARYA 2ZQSA 2LKNA 2G41A 4DRQA 4MAVA 3UQIA 1ROUA 1LL6A 4L72B 3B7XA 3BXWA 4NZCA 2AWGA 1GPFA 3KZ7A 4DRNA 2MLZA 4WKHA 3PRDA 2MLYA 1WAWA 2G8ZA 5I98A 4N19A 4ODPA 2PPOA 4DWSA 4DROA 1E6RA 1JNDA 3KCEA 1E15A 3FAPA 3UI5A 1OGBA 2DG4A 2L2SA 1NWRA 5HKGA 3O5PA 3I6CA 1T11A 1X6LA 2A3BA 1XHGA 1W9UA 2ESCA 3LUOA 3ARRA 1E6PA 5HBFA 4JFLA 2PBCA 3CHDA 4MNKA 1FJDA 2PPNA 2PV1A 4DIPA 1Q6UA 2WLYA 4Z2HA 4JFIA 3TCZA 3WH0A 2ZQUA 1TFVA 4IQCA 1FKIA 4FAPA 4Z2KA 3AS2A 3KAIA 3RM8A 1H0GA 5B8IC 1EDQA 2KI3A 3WQWA 2WLZA 4IT4A 2UZ5A 4UDMA 3CZ8A 3KAFA 1W1VA 2KFWA 5DF0A 1A7XA 3KAHA 2Q5AA 1D7JA 4PTMA 4TYOA 1D6OA 1NMVA 3B8SA 2F21A 4W9PA 4ZS6A 4FN2A 3ARZA 3CGNA 1P5QA 3PRBA 1EIBA 3ARSA 5HWCA 4ODNA 3G6MA 2K8IA 1J4HA 4HBEA 2M2AA 4MPKA 4DWSB 4WJXA 3AQUA 4ZPWR 4J4OA 4P8WA 1FAPA 2KO7A 1HKJA 3FY1A 5DIVA 3RGCA 2XP6A 3QOKA 3NRKA 4GGQA 2OFNA 2A3AA 4WKFA 1OGGA 1U79A 3FXYA 2PV2A 3H9RB 1FFRA 3GTYX 3O5JA 3WD3A 5HW6A 3O5RA 4HARA 2DSZA 2XP4A 3AS3A 4NNRA 1D7IA 3IHZA 3JYMA 1UR8A 2VCDA 3UI6A 1RD6A 2ETNA 4DH0A 1HJWA 4G2PA 4MNLA 4TW6A 3WD2A 1HKMA 3UF8A 2XPAA 4WK9A 4TNSA 3UI4A 1C9HA 4S3KA 3NI6A 4Z2LA 5HT1A 2ZR4A 2RQSA 1FKBA 1VF8A 1HJXA 4ODKA 1EQ3A 5GPGA 1SR0A 4ZPTR 1JNSA 2MLXA 2Y78A 4C02B 4DRPA 1L1PA 3WQVA 2VN1A 2IF4A 2XP9A 2DT3A 4IQ2A 1J4IA 5JH8A 3B9EA 4J4NA 4XAKA 3ARTA 1BKFA 4ML4A 2DT1A 5HUAA 4U85A 3O5KA 1FKTA 3OA5A 1JVWA 3KACA 1NWSA 4ZPVR 2MPHA 4Z2IA 3MDYB 4JFJA 2QF8A 1ROTA 3RMEA 1FKKA 1FKRA 1WB0A 1X6NA 4JFKA 5D75A 3AS0A 2JZVA 1LL4A 3NTPA 3B9DA 4MNJA 2RSEA 2KGJA 3ARVA 3WD4A 3TC5A 1FKSA 4JYSA 2KE0A 1YATA 2RUQA 3JXVA 4LAXA 4QIBA 1B6CA 3IK8A 4Z2GA 4MSPA 5GPRA 3WD1A 3CH9A 2LGOA 3PRAA 3O5LA 4DZ2A 4P8VA 4DRJA 1QPFA 2MF9A 5HW7A 1W9PA 3ARUA 3BMBA 1GRJA 4DZ3A 1EHNA 1LJYA 3ARPA 2LPVA 4ITZA 1NSGA 1JNEA 1HXVA 3WKZA 2PV3A 4QT2A 4TW8A 5J6EA 2PPPA 3AROA 2DPEA 4W9OA 4DWSD 1E9LA 2A3EA 1FKDA 4W5UA 5HTGA 1W1TA 1J6YA 1Q6HA 3OOBA 2F4EA 3JYJA 2XP3A 1Q6IA 2WM0A 4AY1A 1WNOA 1LG1A 1BL4A 3IKGA 4QT3A 3ALFA 3O5OA 2F2DA 4P8UA 1JCHB 4KQZA 2PI6A 3CHEA 1FKHA 1Y0OA 2KR7A 5DIUA 2YBUA 1HKKA 3O5MA 2WK2A 4MGVA 4IT6A 1SYTA 2EULA 2XP8A 4ODOA 3CGMA 1ZCNA 2PN0A 1JNTA 4LAWA 1FFQA 3UQBA 1Q1CA 1NH6A 2B5UB 2FKEA 3ALGA 1IX5A 1M5YA 2DG9A 2A3CA 1KFWA 2ZR5A 1ZL1A 2MNTA 2DSWA 4IPXA 3GPKA 2XP7A 4ODMA 1F8AB 2XP5A 1GUVA 1ZU8A 1R9HA 4DT4A 1D7HA 4LAYA 3O5QA 4R5EA 1FD9A 1N1AA 2FAPA 1ZBKA 3RM9A 4DRKA 3W4RA 3IKDA 3VAWA 2ZQTA 3KABA 3O5GA 3B9AA 2F23A 3CHFA 2O9OA 4DRHA 3O5IA 1HKIA 4Q22A 2YBTA 2RUCA 2DSUA 4Z2JA 1NWUA 5DO2A 4MNMA 5DITA 1F40A 1H0IA 2XPBA 1NWTA 4S3JA 4LGXA 2RURA 4QZVB 2B31A 4LAVA 3CHCA 2ZQVA 1W1PA 2FDMA 3PA7A 1E44A 4DRMA 3O5DA 1KT1A 1OWQA 5DEZA 3WL0A 4O2TA 1ZB5A 1D2KA 4WIWA 5BXJA 4GIVA 5HW8A 2M08A 1J4RA 3KAGA 2LJ4A 1LL7A 4DWSC 3EY6A 4MTVA 1E6NA 1ITXA 5HWBA 4NSBA 2DT2A 1LQ0A 3ARXA 4Q7NA 3WIJA 1E6ZA 3ARQA 1ZK6A 4G50A 3WD0A 3O5EA 2DSVA 4WKAA 1ZBCA 3GU0A 2AOSA 4L3NA 1O6IA 2ITKA 3O5FA 1NMWA 1QPLA 3EIPA 4TX0A 2N87A 4ODQA 2D9FA 3ARWA 2M1IA 1YW5A 3RM4A 3UQAA 4TW7A 1PINA 1FKLA 2DT0A 3KADA 1XRVA 4P8XA 2DG3A 1GOIA
chains in the Genus database with same CATH topology
3WL1A 1TCOC 4URIA 5GQBA 3G6LA 1K9TA 1W1YA 4JFMA 3TDBA 1LG2A 1CTNA 1ZBVA 2ZR6A 3ODKA 4BF8A 1KT0A 3AS1A 1FKFA 2RUDA 4ODRA 1PBKA 4W9QA 1FKJA 1FKGA 4U86A 1EYMA 1QZ2A 3PR9A 1HJVA 2O92A 3RFWA 4U84A 4KR0B 1W26A 4DRIA 2OLHA 2IUZA 4HBOA 4R0XA 1ZBWA 1W9VA 1UR9A 4ODLA 3ARYA 2ZQSA 2LKNA 2G41A 4DRQA 4MAVA 3UQIA 1ROUA 1LL6A 4L72B 3B7XA 3BXWA 4NZCA 2AWGA 1GPFA 3KZ7A 4DRNA 2MLZA 4WKHA 3PRDA 2MLYA 1WAWA 2G8ZA 5I98A 4N19A 4ODPA 2PPOA 4DWSA 4DROA 1E6RA 1JNDA 3KCEA 1E15A 3FAPA 3UI5A 1OGBA 2DG4A 2L2SA 1NWRA 5HKGA 3O5PA 3I6CA 1T11A 1X6LA 2A3BA 1XHGA 1W9UA 2ESCA 3LUOA 3ARRA 1E6PA 5HBFA 4JFLA 2PBCA 3CHDA 4MNKA 1FJDA 2PPNA 2PV1A 4DIPA 1Q6UA 2WLYA 4Z2HA 4JFIA 3TCZA 3WH0A 2ZQUA 1TFVA 4IQCA 1FKIA 4FAPA 4Z2KA 3AS2A 3KAIA 3RM8A 1H0GA 5B8IC 1EDQA 2KI3A 3WQWA 2WLZA 4IT4A 2UZ5A 3CZ8A 3KAFA 1W1VA 2KFWA 5DF0A 1A7XA 3KAHA 2Q5AA 1D7JA 4PTMA 4TYOA 1D6OA 1NMVA 3B8SA 2F21A 4W9PA 4ZS6A 4FN2A 3ARZA 3CGNA 1P5QA 3PRBA 1EIBA 3ARSA 5HWCA 4ODNA 3G6MA 2K8IA 1J4HA 4HBEA 2M2AA 4MPKA 4DWSB 4WJXA 3AQUA 4ZPWR 4J4OA 4P8WA 1FAPA 2KO7A 1HKJA 3FY1A 5DIVA 3RGCA 2XP6A 3QOKA 3NRKA 4GGQA 2OFNA 2A3AA 4WKFA 1OGGA 1U79A 3FXYA 2PV2A 3H9RB 1FFRA 3O5JA 3WD3A 5HW6A 3O5RA 4HARA 2DSZA 2XP4A 3AS3A 4NNRA 1D7IA 3IHZA 3JYMA 1UR8A 2VCDA 3UI6A 1RD6A 4DH0A 1HJWA 4G2PA 4MNLA 4TW6A 3WD2A 1HKMA 3UF8A 2XPAA 4WK9A 4TNSA 3UI4A 1C9HA 4S3KA 3NI6A 4Z2LA 5HT1A 2ZR4A 2RQSA 1FKBA 1VF8A 1HJXA 4ODKA 1EQ3A 5GPGA 1SR0A 4ZPTR 1JNSA 2MLXA 2Y78A 4C02B 4DRPA 1L1PA 3WQVA 2VN1A 2IF4A 2XP9A 2DT3A 4IQ2A 1J4IA 5JH8A 3B9EA 4J4NA 4XAKA 3ARTA 1BKFA 4ML4A 2DT1A 5HUAA 4U85A 3O5KA 1FKTA 3OA5A 1JVWA 3KACA 1NWSA 4ZPVR 2MPHA 4Z2IA 3MDYB 4JFJA 2QF8A 1ROTA 3RMEA 1FKKA 1FKRA 1WB0A 1X6NA 4JFKA 5D75A 3AS0A 2JZVA 1LL4A 3NTPA 3B9DA 4MNJA 2RSEA 2KGJA 3ARVA 3WD4A 3TC5A 1FKSA 4JYSA 2KE0A 1YATA 2RUQA 3JXVA 4LAXA 4QIBA 1B6CA 3IK8A 4Z2GA 4MSPA 5GPRA 3WD1A 3CH9A 2LGOA 3PRAA 3O5LA 4DZ2A 4P8VA 4DRJA 1QPFA 2MF9A 5HW7A 1W9PA 3ARUA 4DZ3A 1EHNA 1LJYA 3ARPA 2LPVA 4ITZA 1NSGA 1JNEA 1HXVA 3WKZA 2PV3A 4QT2A 4TW8A 5J6EA 2PPPA 3AROA 2DPEA 4W9OA 4DWSD 1E9LA 2A3EA 1FKDA 4W5UA 5HTGA 1W1TA 1J6YA 1Q6HA 3OOBA 2F4EA 3JYJA 2XP3A 1Q6IA 2WM0A 4AY1A 1WNOA 1LG1A 1BL4A 3IKGA 4QT3A 3ALFA 3O5OA 2F2DA 4P8UA 4KQZA 2PI6A 3CHEA 1FKHA 1Y0OA 2KR7A 5DIUA 2YBUA 1HKKA 3O5MA 2WK2A 4MGVA 4IT6A 1SYTA 2XP8A 4ODOA 3CGMA 1ZCNA 1JNTA 4LAWA 1FFQA 3UQBA 1Q1CA 1NH6A 2FKEA 3ALGA 1IX5A 1M5YA 2DG9A 2A3CA 1KFWA 2ZR5A 1ZL1A 2MNTA 2DSWA 4IPXA 3GPKA 2XP7A 4ODMA 1F8AB 2XP5A 1GUVA 1ZU8A 1R9HA 4DT4A 1D7HA 4LAYA 3O5QA 4R5EA 1FD9A 1N1AA 2FAPA 1ZBKA 3RM9A 4DRKA 3W4RA 3IKDA 3VAWA 2ZQTA 3KABA 3O5GA 3B9AA 3CHFA 2O9OA 4DRHA 3O5IA 1HKIA 4Q22A 2YBTA 2RUCA 2DSUA 4Z2JA 1NWUA 5DO2A 4MNMA 5DITA 1F40A 1H0IA 2XPBA 1NWTA 4S3JA 4LGXA 2RURA 4QZVB 2B31A 4LAVA 3CHCA 2ZQVA 1W1PA 2FDMA 3PA7A 4DRMA 3O5DA 1KT1A 1OWQA 5DEZA 3WL0A 4O2TA 1ZB5A 1D2KA 4WIWA 5BXJA 4GIVA 5HW8A 2M08A 1J4RA 3KAGA 2LJ4A 1LL7A 4DWSC 3EY6A 4MTVA 1E6NA 1ITXA 5HWBA 4NSBA 2DT2A 1LQ0A 3ARXA 4Q7NA 3WIJA 1E6ZA 3ARQA 1ZK6A 4G50A 3WD0A 3O5EA 2DSVA 4WKAA 1ZBCA 2AOSA 4L3NA 1O6IA 2ITKA 3O5FA 1NMWA 1QPLA 4TX0A 2N87A 4ODQA 2D9FA 3ARWA 2M1IA 1YW5A 3RM4A 3UQAA 4TW7A 1PINA 1FKLA 2DT0A 3KADA 1XRVA 4P8XA 2DG3A 1GOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P5Q A;  4ODM A;  3PRB A;  1F8A B;  2XP5 A;  1TCO C;  3TC5 A;  5HWC A;  1R9H A;  4DT4 A;  4ODN A;  3TDB A;  1D7H A;  4JFM A;  4LAY A;  1FKS A;  3O5Q A;  2K8I A;  1YAT A;  2KE0 A;  1J4H A;  2RUQ A;  3JXV A;  1FD9 A;  1N1A A;  2FAP A;  4LAX A;  2M2A A;  4QIB A;  1B6C A;  2ZR6 A;  3ODK A;  4BF8 A;  1KT0 A;  3IK8 A;  4MSP A;  4DRK A;  1FKF A;  2RUD A;  4J4O A;  1FAP A;  1PBK A;  4ODR A;  4W9Q A;  1FKJ A;  1FKG A;  3IKD A;  2LGO A;  3VAW A;  4U86 A;  1EYM A;  1QZ2 A;  3O5L A;  2ZQT A;  4DZ2 A;  2KO7 A;  3KAB A;  4DRJ A;  3O5G A;  4DIP A;  5DIV A;  3RGC A;  3RFW A;  1QPF A;  2MF9 A;  4U84 A;  2XP6 A;  5HW7 A;  4JYS A;  3NRK A;  1W26 A;  2OFN A;  4GGQ A;  4DRI A;  2KGJ A;  4R0X A;  1U79 A;  2PV2 A;  3H9R B;  4DRH A;  3O5I A;  4ODL A;  3O5J A;  2RUC A;  5HW6 A;  3O5R A;  4DZ3 A;  2XP4 A;  4NNR A;  1D7I A;  2LPV A;  2ZQS A;  3IHZ A;  4ITZ A;  3JYM A;  2XPB A;  5DIT A;  1NSG A;  1F40 A;  2LKN A;  2VCD A;  4DRQ A;  2RUR A;  3UI6 A;  1HXV A;  2PV3 A;  3UQI A;  4QT2 A;  1ROU A;  4TW8 A;  4LAV A;  5J6E A;  4DH0 A;  4G2P A;  4TW6 A;  2PPP A;  2ZQV A;  3B7X A;  3UF8 A;  2XPA A;  3PA7 A;  4TNS A;  3UI4 A;  4DRM A;  1C9H A;  2AWG A;  3O5D A;  3NI6 A;  3KZ7 A;  1KT1 A;  5HT1 A;  4DRN A;  2ZR4 A;  4O2T A;  2MLZ A;  2RQS A;  4W9O A;  1FKB A;  3PRD A;  5BXJ A;  2MLY A;  5I98 A;  4GIV A;  5HW8 A;  4N19 A;  2M08 A;  1FKD A;  4ODP A;  5HTG A;  4ODK A;  2PPO A;  1EQ3 A;  4DRO A;  1J4R A;  3KAG A;  1J6Y A;  5GPG A;  2LJ4 A;  1Q6H A;  3KCE A;  3OOB A;  2F4E A;  3FAP A;  3JYJ A;  2MLX A;  3UI5 A;  1JNS A;  2XP3 A;  2Y78 A;  2DG4 A;  3EY6 A;  2L2S A;  4C02 B;  1Q6I A;  5HKG A;  3O5P A;  1BL4 A;  4DRP A;  5HWB A;  3I6C A;  3IKG A;  1T11 A;  4QT3 A;  1L1P A;  2VN1 A;  2IF4 A;  3O5O A;  3LUO A;  2XP9 A;  2F2D A;  4IQ2 A;  1J4I A;  4J4N A;  4JFL A;  2PBC A;  1BKF A;  1ZK6 A;  4G50 A;  3O5E A;  1FJD A;  5HUA A;  2PPN A;  2PV1 A;  4U85 A;  1Q6U A;  1FKT A;  1Y0O A;  1FKH A;  2KR7 A;  1JVW A;  3KAC A;  3O5K A;  4JFI A;  5DIU A;  3TCZ A;  3O5M A;  3WH0 A;  2ZQU A;  2MPH A;  1FKI A;  4IQC A;  4FAP A;  4MGV A;  2ITK A;  3O5F A;  3MDY B;  4JFJ A;  1NMW A;  1QPL A;  3KAI A;  1ROT A;  5B8I C;  1FKK A;  2KI3 A;  1FKR A;  2XP8 A;  2UZ5 A;  4ODO A;  3CGM A;  1ZCN A;  4JFK A;  5D75 A;  2JZV A;  3KAF A;  1JNT A;  4TX0 A;  4LAW A;  2KFW A;  1A7X A;  3UQB A;  1Q1C A;  2N87 A;  3KAH A;  2Q5A A;  4ODQ A;  3NTP A;  1D7J A;  2D9F A;  2FKE A;  4TYO A;  2M1I A;  1D6O A;  1M5Y A;  1YW5 A;  3UQA A;  2DG9 A;  4TW7 A;  1NMV A;  1PIN A;  1FKL A;  2F21 A;  4W9P A;  2ZR5 A;  4FN2 A;  3KAD A;  2MNT A;  2RSE A;  3CGN A;  4IPX A;  3GPK A;  2DG3 A;  2XP7 A; 
#chains in the Genus database with same CATH topology
 3WL1 A;  1TCO C;  4URI A;  5GQB A;  3G6L A;  1K9T A;  1W1Y A;  4JFM A;  3TDB A;  1LG2 A;  1CTN A;  1ZBV A;  2ZR6 A;  3ODK A;  4BF8 A;  1KT0 A;  3AS1 A;  1FKF A;  2RUD A;  4ODR A;  1PBK A;  4W9Q A;  1FKJ A;  1FKG A;  4U86 A;  1EYM A;  1QZ2 A;  3PR9 A;  1HJV A;  2O92 A;  2P4V A;  3RFW A;  4U84 A;  4KR0 B;  1W26 A;  4DRI A;  2OLH A;  2IUZ A;  4HBO A;  4R0X A;  1ZBW A;  1W9V A;  1UR9 A;  4ODL A;  3ARY A;  2ZQS A;  2LKN A;  2G41 A;  4DRQ A;  4MAV A;  3UQI A;  1ROU A;  1LL6 A;  4L72 B;  3B7X A;  3BXW A;  4NZC A;  2AWG A;  1GPF A;  3KZ7 A;  4DRN A;  2MLZ A;  4WKH A;  3PRD A;  2MLY A;  1WAW A;  2G8Z A;  5I98 A;  4N19 A;  4ODP A;  2PPO A;  4DWS A;  4DRO A;  1E6R A;  1JND A;  3KCE A;  1E15 A;  3FAP A;  3UI5 A;  1OGB A;  2DG4 A;  2L2S A;  1NWR A;  5HKG A;  3O5P A;  3I6C A;  1T11 A;  1X6L A;  2A3B A;  1XHG A;  1W9U A;  2ESC A;  3LUO A;  3ARR A;  1E6P A;  5HBF A;  4JFL A;  2PBC A;  3CHD A;  4MNK A;  1FJD A;  2PPN A;  2PV1 A;  4DIP A;  1Q6U A;  2WLY A;  4Z2H A;  4JFI A;  3TCZ A;  3WH0 A;  2ZQU A;  1TFV A;  4IQC A;  1FKI A;  4FAP A;  4Z2K A;  3AS2 A;  3KAI A;  3RM8 A;  1H0G A;  5B8I C;  1EDQ A;  2KI3 A;  3WQW A;  2WLZ A;  4IT4 A;  2UZ5 A;  4UDM A;  3CZ8 A;  3KAF A;  1W1V A;  2KFW A;  5DF0 A;  1A7X A;  3KAH A;  2Q5A A;  1D7J A;  4PTM A;  4TYO A;  1D6O A;  1NMV A;  3B8S A;  2F21 A;  4W9P A;  4ZS6 A;  4FN2 A;  3ARZ A;  3CGN A;  1P5Q A;  3PRB A;  1EIB A;  3ARS A;  5HWC A;  4ODN A;  3G6M A;  2K8I A;  1J4H A;  4HBE A;  2M2A A;  4MPK A;  4DWS B;  4WJX A;  3AQU A;  4ZPW R;  4J4O A;  4P8W A;  1FAP A;  2KO7 A;  1HKJ A;  3FY1 A;  5DIV A;  3RGC A;  2XP6 A;  3QOK A;  3NRK A;  4GGQ A;  2OFN A;  2A3A A;  4WKF A;  1OGG A;  1U79 A;  3FXY A;  2PV2 A;  3H9R B;  1FFR A;  3GTY X;  3O5J A;  3WD3 A;  5HW6 A;  3O5R A;  4HAR A;  2DSZ A;  2XP4 A;  3AS3 A;  4NNR A;  1D7I A;  3IHZ A;  3JYM A;  1UR8 A;  2VCD A;  3UI6 A;  1RD6 A;  2ETN A;  4DH0 A;  1HJW A;  4G2P A;  4MNL A;  4TW6 A;  3WD2 A;  1HKM A;  3UF8 A;  2XPA A;  4WK9 A;  4TNS A;  3UI4 A;  1C9H A;  4S3K A;  3NI6 A;  4Z2L A;  5HT1 A;  2ZR4 A;  2RQS A;  1FKB A;  1VF8 A;  1HJX A;  4ODK A;  1EQ3 A;  5GPG A;  1SR0 A;  4ZPT R;  1JNS A;  2MLX A;  2Y78 A;  4C02 B;  4DRP A;  1L1P A;  3WQV A;  2VN1 A;  2IF4 A;  2XP9 A;  2DT3 A;  4IQ2 A;  1J4I A;  5JH8 A;  3B9E A;  4J4N A;  4XAK A;  3ART A;  1BKF A;  4ML4 A;  2DT1 A;  5HUA A;  4U85 A;  3O5K A;  1FKT A;  3OA5 A;  1JVW A;  3KAC A;  1NWS A;  4ZPV R;  2MPH A;  4Z2I A;  3MDY B;  4JFJ A;  2QF8 A;  1ROT A;  3RME A;  1FKK A;  1FKR A;  1WB0 A;  1X6N A;  4JFK A;  5D75 A;  3AS0 A;  2JZV A;  1LL4 A;  3NTP A;  3B9D A;  4MNJ A;  2RSE A;  2KGJ A;  3ARV A;  3WD4 A;  3TC5 A;  1FKS A;  4JYS A;  2KE0 A;  1YAT A;  2RUQ A;  3JXV A;  4LAX A;  4QIB A;  1B6C A;  3IK8 A;  4Z2G A;  4MSP A;  5GPR A;  3WD1 A;  3CH9 A;  2LGO A;  3PRA A;  3O5L A;  4DZ2 A;  4P8V A;  4DRJ A;  1QPF A;  2MF9 A;  5HW7 A;  1W9P A;  3ARU A;  3BMB A;  1GRJ A;  4DZ3 A;  1EHN A;  1LJY A;  3ARP A;  2LPV A;  4ITZ A;  1NSG A;  1JNE A;  1HXV A;  3WKZ A;  2PV3 A;  4QT2 A;  4TW8 A;  5J6E A;  2PPP A;  3ARO A;  2DPE A;  4W9O A;  4DWS D;  1E9L A;  2A3E A;  1FKD A;  4W5U A;  5HTG A;  1W1T A;  1J6Y A;  1Q6H A;  3OOB A;  2F4E A;  3JYJ A;  2XP3 A;  1Q6I A;  2WM0 A;  4AY1 A;  1WNO A;  1LG1 A;  1BL4 A;  3IKG A;  4QT3 A;  3ALF A;  3O5O A;  2F2D A;  4P8U A;  1JCH B;  4KQZ A;  2PI6 A;  3CHE A;  1FKH A;  1Y0O A;  2KR7 A;  5DIU A;  2YBU A;  1HKK A;  3O5M A;  2WK2 A;  4MGV A;  4IT6 A;  1SYT A;  2EUL A;  2XP8 A;  4ODO A;  3CGM A;  1ZCN A;  2PN0 A;  1JNT A;  4LAW A;  1FFQ A;  3UQB A;  1Q1C A;  1NH6 A;  2B5U B;  2FKE A;  3ALG A;  1IX5 A;  1M5Y A;  2DG9 A;  2A3C A;  1KFW A;  2ZR5 A;  1ZL1 A;  2MNT A;  2DSW A;  4IPX A;  3GPK A;  2XP7 A;  4ODM A;  1F8A B;  2XP5 A;  1GUV A;  1ZU8 A;  1R9H A;  4DT4 A;  1D7H A;  4LAY A;  3O5Q A;  4R5E A;  1FD9 A;  1N1A A;  2FAP A;  1ZBK A;  3RM9 A;  4DRK A;  3W4R A;  3IKD A;  3VAW A;  2ZQT A;  3KAB A;  3O5G A;  3B9A A;  2F23 A;  3CHF A;  2O9O A;  4DRH A;  3O5I A;  1HKI A;  4Q22 A;  2YBT A;  2RUC A;  2DSU A;  4Z2J A;  1NWU A;  5DO2 A;  4MNM A;  5DIT A;  1F40 A;  1H0I A;  2XPB A;  1NWT A;  4S3J A;  4LGX A;  2RUR A;  4QZV B;  2B31 A;  4LAV A;  3CHC A;  2ZQV A;  1W1P A;  2FDM A;  3PA7 A;  1E44 A;  4DRM A;  3O5D A;  1KT1 A;  1OWQ A;  5DEZ A;  3WL0 A;  4O2T A;  1ZB5 A;  1D2K A;  4WIW A;  5BXJ A;  4GIV A;  5HW8 A;  2M08 A;  1J4R A;  3KAG A;  2LJ4 A;  1LL7 A;  4DWS C;  3EY6 A;  4MTV A;  1E6N A;  1ITX A;  5HWB A;  4NSB A;  2DT2 A;  1LQ0 A;  3ARX A;  4Q7N A;  3WIJ A;  1E6Z A;  3ARQ A;  1ZK6 A;  4G50 A;  3WD0 A;  3O5E A;  2DSV A;  4WKA A;  1ZBC A;  3GU0 A;  2AOS A;  4L3N A;  1O6I A;  2ITK A;  3O5F A;  1NMW A;  1QPL A;  3EIP A;  4TX0 A;  2N87 A;  4ODQ A;  2D9F A;  3ARW A;  2M1I A;  1YW5 A;  3RM4 A;  3UQA A;  4TW7 A;  1PIN A;  1FKL A;  2DT0 A;  3KAD A;  1XRV A;  4P8X A;  2DG3 A;  1GOI A; 
#chains in the Genus database with same CATH homology
 3WL1 A;  1TCO C;  4URI A;  5GQB A;  3G6L A;  1K9T A;  1W1Y A;  4JFM A;  3TDB A;  1LG2 A;  1CTN A;  1ZBV A;  2ZR6 A;  3ODK A;  4BF8 A;  1KT0 A;  3AS1 A;  1FKF A;  2RUD A;  4ODR A;  1PBK A;  4W9Q A;  1FKJ A;  1FKG A;  4U86 A;  1EYM A;  1QZ2 A;  3PR9 A;  1HJV A;  2O92 A;  3RFW A;  4U84 A;  4KR0 B;  1W26 A;  4DRI A;  2OLH A;  2IUZ A;  4HBO A;  4R0X A;  1ZBW A;  1W9V A;  1UR9 A;  4ODL A;  3ARY A;  2ZQS A;  2LKN A;  2G41 A;  4DRQ A;  4MAV A;  3UQI A;  1ROU A;  1LL6 A;  4L72 B;  3B7X A;  3BXW A;  4NZC A;  2AWG A;  1GPF A;  3KZ7 A;  4DRN A;  2MLZ A;  4WKH A;  3PRD A;  2MLY A;  1WAW A;  2G8Z A;  5I98 A;  4N19 A;  4ODP A;  2PPO A;  4DWS A;  4DRO A;  1E6R A;  1JND A;  3KCE A;  1E15 A;  3FAP A;  3UI5 A;  1OGB A;  2DG4 A;  2L2S A;  1NWR A;  5HKG A;  3O5P A;  3I6C A;  1T11 A;  1X6L A;  2A3B A;  1XHG A;  1W9U A;  2ESC A;  3LUO A;  3ARR A;  1E6P A;  5HBF A;  4JFL A;  2PBC A;  3CHD A;  4MNK A;  1FJD A;  2PPN A;  2PV1 A;  4DIP A;  1Q6U A;  2WLY A;  4Z2H A;  4JFI A;  3TCZ A;  3WH0 A;  2ZQU A;  1TFV A;  4IQC A;  1FKI A;  4FAP A;  4Z2K A;  3AS2 A;  3KAI A;  3RM8 A;  1H0G A;  5B8I C;  1EDQ A;  2KI3 A;  3WQW A;  2WLZ A;  4IT4 A;  2UZ5 A;  3CZ8 A;  3KAF A;  1W1V A;  2KFW A;  5DF0 A;  1A7X A;  3KAH A;  2Q5A A;  1D7J A;  4PTM A;  4TYO A;  1D6O A;  1NMV A;  3B8S A;  2F21 A;  4W9P A;  4ZS6 A;  4FN2 A;  3ARZ A;  3CGN A;  1P5Q A;  3PRB A;  1EIB A;  3ARS A;  5HWC A;  4ODN A;  3G6M A;  2K8I A;  1J4H A;  4HBE A;  2M2A A;  4MPK A;  4DWS B;  4WJX A;  3AQU A;  4ZPW R;  4J4O A;  4P8W A;  1FAP A;  2KO7 A;  1HKJ A;  3FY1 A;  5DIV A;  3RGC A;  2XP6 A;  3QOK A;  3NRK A;  4GGQ A;  2OFN A;  2A3A A;  4WKF A;  1OGG A;  1U79 A;  3FXY A;  2PV2 A;  3H9R B;  1FFR A;  3O5J A;  3WD3 A;  5HW6 A;  3O5R A;  4HAR A;  2DSZ A;  2XP4 A;  3AS3 A;  4NNR A;  1D7I A;  3IHZ A;  3JYM A;  1UR8 A;  2VCD A;  3UI6 A;  1RD6 A;  4DH0 A;  1HJW A;  4G2P A;  4MNL A;  4TW6 A;  3WD2 A;  1HKM A;  3UF8 A;  2XPA A;  4WK9 A;  4TNS A;  3UI4 A;  1C9H A;  4S3K A;  3NI6 A;  4Z2L A;  5HT1 A;  2ZR4 A;  2RQS A;  1FKB A;  1VF8 A;  1HJX A;  4ODK A;  1EQ3 A;  5GPG A;  1SR0 A;  4ZPT R;  1JNS A;  2MLX A;  2Y78 A;  4C02 B;  4DRP A;  1L1P A;  3WQV A;  2VN1 A;  2IF4 A;  2XP9 A;  2DT3 A;  4IQ2 A;  1J4I A;  5JH8 A;  3B9E A;  4J4N A;  4XAK A;  3ART A;  1BKF A;  4ML4 A;  2DT1 A;  5HUA A;  4U85 A;  3O5K A;  1FKT A;  3OA5 A;  1JVW A;  3KAC A;  1NWS A;  4ZPV R;  2MPH A;  4Z2I A;  3MDY B;  4JFJ A;  2QF8 A;  1ROT A;  3RME A;  1FKK A;  1FKR A;  1WB0 A;  1X6N A;  4JFK A;  5D75 A;  3AS0 A;  2JZV A;  1LL4 A;  3NTP A;  3B9D A;  4MNJ A;  2RSE A;  2KGJ A;  3ARV A;  3WD4 A;  3TC5 A;  1FKS A;  4JYS A;  2KE0 A;  1YAT A;  2RUQ A;  3JXV A;  4LAX A;  4QIB A;  1B6C A;  3IK8 A;  4Z2G A;  4MSP A;  5GPR A;  3WD1 A;  3CH9 A;  2LGO A;  3PRA A;  3O5L A;  4DZ2 A;  4P8V A;  4DRJ A;  1QPF A;  2MF9 A;  5HW7 A;  1W9P A;  3ARU A;  4DZ3 A;  1EHN A;  1LJY A;  3ARP A;  2LPV A;  4ITZ A;  1NSG A;  1JNE A;  1HXV A;  3WKZ A;  2PV3 A;  4QT2 A;  4TW8 A;  5J6E A;  2PPP A;  3ARO A;  2DPE A;  4W9O A;  4DWS D;  1E9L A;  2A3E A;  1FKD A;  4W5U A;  5HTG A;  1W1T A;  1J6Y A;  1Q6H A;  3OOB A;  2F4E A;  3JYJ A;  2XP3 A;  1Q6I A;  2WM0 A;  4AY1 A;  1WNO A;  1LG1 A;  1BL4 A;  3IKG A;  4QT3 A;  3ALF A;  3O5O A;  2F2D A;  4P8U A;  4KQZ A;  2PI6 A;  3CHE A;  1FKH A;  1Y0O A;  2KR7 A;  5DIU A;  2YBU A;  1HKK A;  3O5M A;  2WK2 A;  4MGV A;  4IT6 A;  1SYT A;  2XP8 A;  4ODO A;  3CGM A;  1ZCN A;  1JNT A;  4LAW A;  1FFQ A;  3UQB A;  1Q1C A;  1NH6 A;  2FKE A;  3ALG A;  1IX5 A;  1M5Y A;  2DG9 A;  2A3C A;  1KFW A;  2ZR5 A;  1ZL1 A;  2MNT A;  2DSW A;  4IPX A;  3GPK A;  2XP7 A;  4ODM A;  1F8A B;  2XP5 A;  1GUV A;  1ZU8 A;  1R9H A;  4DT4 A;  1D7H A;  4LAY A;  3O5Q A;  4R5E A;  1FD9 A;  1N1A A;  2FAP A;  1ZBK A;  3RM9 A;  4DRK A;  3W4R A;  3IKD A;  3VAW A;  2ZQT A;  3KAB A;  3O5G A;  3B9A A;  3CHF A;  2O9O A;  4DRH A;  3O5I A;  1HKI A;  4Q22 A;  2YBT A;  2RUC A;  2DSU A;  4Z2J A;  1NWU A;  5DO2 A;  4MNM A;  5DIT A;  1F40 A;  1H0I A;  2XPB A;  1NWT A;  4S3J A;  4LGX A;  2RUR A;  4QZV B;  2B31 A;  4LAV A;  3CHC A;  2ZQV A;  1W1P A;  2FDM A;  3PA7 A;  4DRM A;  3O5D A;  1KT1 A;  1OWQ A;  5DEZ A;  3WL0 A;  4O2T A;  1ZB5 A;  1D2K A;  4WIW A;  5BXJ A;  4GIV A;  5HW8 A;  2M08 A;  1J4R A;  3KAG A;  2LJ4 A;  1LL7 A;  4DWS C;  3EY6 A;  4MTV A;  1E6N A;  1ITX A;  5HWB A;  4NSB A;  2DT2 A;  1LQ0 A;  3ARX A;  4Q7N A;  3WIJ A;  1E6Z A;  3ARQ A;  1ZK6 A;  4G50 A;  3WD0 A;  3O5E A;  2DSV A;  4WKA A;  1ZBC A;  2AOS A;  4L3N A;  1O6I A;  2ITK A;  3O5F A;  1NMW A;  1QPL A;  4TX0 A;  2N87 A;  4ODQ A;  2D9F A;  3ARW A;  2M1I A;  1YW5 A;  3RM4 A;  3UQA A;  4TW7 A;  1PIN A;  1FKL A;  2DT0 A;  3KAD A;  1XRV A;  4P8X A;  2DG3 A;  1GOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...