4ODOA

Structure of slyd from thermus thermophilus in complex with fk506
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
total genus 35
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odoA00
2F4EA 3O5IA 1N1AA 5DIVA 3GPKA 1F8AB 1NMWA 4DRMA 3NTPA 4IPXA 4FAPA 5HW7A 5I98A 2K8IA 4ODQA 4C02B 4TYOA 3NRKA 4LAYA 4DRKA 3KAIA 1EYMA 1NMVA 2MNTA 2DG9A 2KR7A 2PPNA 2Y78A 4G50A 2JZVA 1JNSA 4IQ2A 4MGVA 1FKKA 3B7XA 4DRJA 3UQIA 2LJ4A 2F2DA 5HWBA 1BL4A 3ODKA 3KABA 3CGMA 4DRQA 3KAFA 2Q5AA 3IKDA 3O5DA 3O5EA 4TNSA 3TDBA 2IF4A 2PBCA 3WH0A 1FKBA 1YATA 4DH0A 1JVWA 5HW8A 4DRPA 1Q6UA 2KI3A 4DRNA 1PINA 2PV1A 2VCDA 4LAWA 3LUOA 2PV3A 4GGQA 2MLZA 4ITZA 2AWGA 3O5OA 5HW6A 4DZ3A 1R9HA 4JYSA 3UF8A 1D7JA 1M5YA 2ZQUA 3O5FA 2L2SA 4GIVA 4W9QA 3NI6A 3UI6A 3PRBA 2M1IA 1ROTA 2PV2A 4U86A 1L1PA 2MLXA 5B8IC 2FAPA 4U84A 1D7IA 4JFLA 2XP6A 4BF8A 1FKTA 4ODOA 5J6EA 2KO7A 2UZ5A 2ZQSA 2ZR6A 2LKNA 1P5QA 1ZK6A 2PPPA 3O5JA 1FKSA 3O5PA 3O5LA 4DZ2A 1JNTA 1QPLA 2MLYA 4DRIA 5BXJA 3IK8A 4LAXA 1FD9A 1BKFA 3FAPA 3UQAA 4O2TA 4TW8A 5D75A 1J4RA 1U79A 1ROUA 1KT0A 2F21A 1FKJA 2KE0A 2XP7A 3O5RA 4W9OA 4DRHA 4R0XA 2RUQA 3JXVA 3PRDA 1FKFA 2RSEA 3IKGA 2XP5A 4ODRA 3O5QA 3VAWA 5HTGA 1F40A 4ODNA 1Q6IA 4MSPA 2DG3A 5DIUA 1QZ2A 2RUCA 4JFKA 1J4HA 3H9RB 1KT1A 3KAHA 1NSGA 2RUDA 3KACA 4DROA 2XPAA 1FJDA 2LGOA 2ZR5A 2OFNA 3MDYB 2XP4A 1A7XA 1B6CA 4J4NA 2LPVA 4LAVA 2N87A 4JFJA 3KAGA 3UQBA 1W26A 4QIBA 5HT1A 1J6YA 4J4OA 3CGNA 2RQSA 3PA7A 5DITA 5HWCA 4IQCA 1FAPA 2XP8A 2M08A 2ITKA 1TCOC 2ZQTA 2PPOA 3IHZA 4ODMA 4TW6A 1FKIA 3JYJA 3O5KA 1HXVA 2MPHA 1Q1CA 2XP9A 4ODLA 3RFWA 3KZ7A 1C9HA 3KCEA 2KFWA 2ZQVA 3JYMA 4JFMA 1ZCNA 4FN2A 1D6OA 4JFIA 1QPFA 5GPGA 3UI5A 1FKGA 5HKGA 3KADA 2XPBA 4QT3A 3RGCA 4U85A 1EQ3A 1FKDA 3TCZA 1T11A 3EY6A 1D7HA 1YW5A 2ZR4A 1FKRA 2FKEA 1Q6HA 2XP3A 2D9FA 4DIPA 4G2PA 4W9PA 1J4IA 4NNRA 4ODPA 4ODKA 5HUAA 2RURA 1FKLA 2KGJA 2MF9A 4N19A 4QT2A 4DT4A 3I6CA 1FKHA 2M2AA 1Y0OA 3O5GA 3O5MA 3TC5A 2DG4A 4TW7A 3UI4A 1PBKA 2VN1A 4TX0A 3OOBA
chains in the Genus database with same CATH superfamily
1N1AA 3GPKA 4MPKA 3WQWA 4TYOA 4DRKA 3KAIA 4HBOA 1JCHB 4DRJA 2LJ4A 2F2DA 5HWBA 3KABA 1KFWA 4P8WA 1FKBA 1JVWA 5HW8A 4NSBA 4MTVA 3CHCA 4DZ3A 1ZU8A 3UF8A 1D7JA 1WNOA 2PN0A 3PRBA 1L1PA 2MLXA 4Q7NA 2XP6A 2DT0A 2DT2A 2KO7A 2UZ5A 3WD3A 3O5LA 1QPLA 1LQ0A 2MLYA 4LAXA 4O2TA 1J4RA 1ROUA 1KT0A 3O5RA 1FKJA 2AOSA 4WJXA 3IKGA 2XP5A 4ODNA 4MSPA 2DG3A 4Z2IA 2RUCA 3PRAA 1J4HA 1K9TA 3GTYX 3AS2A 3WL0A 2OFNA 4Z2HA 2XP4A 1E6PA 3KAGA 4QIBA 4J4OA 3WKZA 2RQSA 1GRJA 2ITKA 2PPOA 4ODMA 1ZB5A 2MPHA 2XP9A 3B9AA 1UR8A 1W1PA 1EHNA 2QF8A 2KFWA 1ZCNA 1W9PA 4JFIA 3UI5A 2ETNA 4Z2JA 4QT3A 3EIPA 3EY6A 1YW5A 4WKAA 4DWSC 4DIPA 1J4IA 2DSVA 4ZPWR 5HUAA 4S3JA 3WD2A 1FKHA 1ITXA 4PTMA 1LJYA 3TC5A 2DSWA 1PBKA 2VN1A 4Q22A 3ARQA 5DIVA 1F8AB 1XRVA 4DRMA 3NTPA 4IPXA 4FAPA 5I98A 4ODQA 4C02B 4IT4A 1VF8A 4LAYA 4MNJA 3WD0A 2JZVA 1JNSA 1LL4A 4MNKA 1BL4A 1EDQA 4DRQA 2F23A 3O5EA 2PBCA 2G41A 1NH6A 1ZBCA 1E44A 1HJVA 4ML4A 2KI3A 4DRNA 2VCDA 1X6LA 2MLZA 2AWGA 3O5OA 2DSZA 4JYSA 3RMEA 3WL1A 3CHEA 2ZQUA 4GIVA 2M1IA 2DSUA 2DPEA 4U84A 4JFLA 3ALGA 4BF8A 2B5UB 1FKTA 4ODOA 3O5JA 1HKMA 4KQZA 1JNTA 4DRIA 1BKFA 1SYTA 5D75A 1D2KA 1W9VA 2KE0A 4P8XA 5JH8A 4W9OA 3G6MA 2WLYA 3ALFA 1FKFA 3WD4A 1F40A 5HTGA 2DT3A 1W1VA 1Q6IA 5DIUA 1QZ2A 4JFKA 3KAHA 2RUDA 3AS3A 3ARTA 1ZBVA 3RM9A 1B6CA 2LPVA 3UQBA 1W26A 5HT1A 3W4RA 3PA7A 5HWCA 4IQCA 4QZVB 4Z2GA 1FFQA 3FY1A 3IHZA 1X6NA 4TW6A 3JYJA 3O5KA 2FDMA 1HXVA 1CTNA 1Q1CA 4WKHA 3KZ7A 3KCEA 3JYMA 4JFMA 3CH9A 2A3EA 4FN2A 1D6OA 3KADA 3WD1A 1H0IA 4KR0B 4U85A 5DO2A 4Z2KA 2ZR4A 2FKEA 1Q6HA 3B8SA 2OLHA 3ARRA 2RURA 1FKLA 2MF9A 2YBUA 4XAKA 4DT4A 3G6LA 5GQBA 4TX0A 2F4EA 3O5IA 1WAWA 1NWUA 5HW7A 3NRKA 1EYMA 4S3KA 2MNTA 2KR7A 2Y78A 3WQVA 4G50A 2B31A 4IQ2A 3ARSA 3ODKA 1E6RA 3O5DA 2Q5AA 1NWTA 3ARWA 3IKDA 4TNSA 3WIJA 2IF4A 3WH0A 4DWSB 5GPRA 4DWSD 1Q6UA 1PINA 1LL6A 4LAWA 4GGQA 2PV3A 4P8VA 4WIWA 5HW6A 3O5FA 4MNMA 4W9QA 1SR0A 3NI6A 3UI6A 4U86A 1ROTA 4MAVA 2P4VA 4URIA 5B8IC 2FAPA 3QOKA 1D7IA 1UR9A 2ZR6A 1ZK6A 2PPPA 1FKSA 3ARPA 4MNLA 1GOIA 1FD9A 3UQAA 2A3AA 4L72B 2O9OA 1XHGA 2F21A 2XP7A 4R0XA 2RUQA 3PRDA 2RSEA 3AQUA 2WLZA 3PR9A 4ODRA 3ARUA 3AROA 1ZL1A 3H9RB 4HARA 1KT1A 1NSGA 1WB0A 4W5UA 4DROA 2XPAA 1FJDA 4L3NA 1EIBA 4J4NA 4LAVA 2N87A 4JFJA 1J6YA 3CHFA 1RD6A 1FAPA 3B9EA 2DT1A 2XP8A 2M08A 2ZQTA 3BMBA 2WM0A 2PI6A 4IT6A 3RFWA 1LL7A 1JNDA 2G8ZA 3ARYA 5HKGA 1QPFA 5GPGA 1HJXA 2XPBA 1IX5A 1FKDA 1T11A 1D7HA 1FKRA 3FXYA 1HJWA 2XP3A 2D9FA 4WK9A 1FFRA 1ZBWA 4W9PA 4ODPA 1GUVA 2KGJA 3RM8A 4HBEA 1HKIA 4DWSA 4ZPVR 4QT2A 4ZPTR 3GU0A 2M2AA 1Y0OA 2YBTA 3CZ8A 3O5GA 3O5MA 2DG4A 4TW7A 5DF0A 4Z2LA 3OOBA 1NMWA 4LGXA 2K8IA 1HKJA 1NMVA 2DG9A 2PPNA 1NWRA 4P8UA 4MGVA 1FKKA 3B7XA 3UQIA 3ARZA 3CGMA 3KAFA 1LG1A 3TDBA 1E9LA 1YATA 4DH0A 4DRPA 2PV1A 3LUOA 4ITZA 1R9HA 1M5YA 2L2SA 5DEZA 4ZS6A 2PV2A 5HBFA 1TFVA 1W1YA 1OGBA 5J6EA 2A3CA 4AY1A 2ZQSA 2LKNA 1P5QA 3O5PA 4DZ2A 2EULA 3CHDA 4NZCA 2A3BA 2O92A 3IK8A 5BXJA 3FAPA 4TW8A 3AS1A 1LG2A 1U79A 4DRHA 1W1TA 1NWSA 1E15A 1O6IA 3JXVA 3O5QA 3VAWA 1W9UA 3BXWA 3RM4A 3KACA 1GPFA 2LGOA 2ZR5A 3MDYB 1A7XA 1ZBKA 3CGNA 5DITA 2WK2A 1TCOC 1FKIA 3B9DA 1OWQA 4ODLA 1C9HA 2ZQVA 3ARXA 1FKGA 3RGCA 1EQ3A 3TCZA 2IUZA 4UDMA 4G2PA 1OGGA 2ESCA 3ARVA 4NNRA 4ODKA 4WKFA 4R5EA 1JNEA 4N19A 3I6CA 1E6ZA 3AS0A 3OA5A 1HKKA 1H0GA 1E6NA 3UI4A
chains in the Genus database with same CATH topology
1N1AA 3GPKA 4MPKA 3WQWA 4TYOA 4DRKA 3KAIA 4HBOA 4DRJA 2LJ4A 2F2DA 5HWBA 3KABA 1KFWA 4P8WA 1FKBA 1JVWA 5HW8A 4NSBA 4MTVA 3CHCA 4DZ3A 1ZU8A 3UF8A 1D7JA 1WNOA 3PRBA 1L1PA 2MLXA 4Q7NA 2XP6A 2DT0A 2DT2A 2KO7A 2UZ5A 3WD3A 3O5LA 1QPLA 1LQ0A 2MLYA 4LAXA 4O2TA 1J4RA 1ROUA 1KT0A 3O5RA 1FKJA 2AOSA 4WJXA 3IKGA 2XP5A 4ODNA 4MSPA 2DG3A 4Z2IA 2RUCA 3PRAA 1J4HA 1K9TA 3AS2A 3WL0A 2OFNA 4Z2HA 2XP4A 1E6PA 3KAGA 4QIBA 4J4OA 3WKZA 2RQSA 2ITKA 2PPOA 4ODMA 1ZB5A 2MPHA 2XP9A 3B9AA 1UR8A 1W1PA 1EHNA 2QF8A 2KFWA 1ZCNA 1W9PA 4JFIA 3UI5A 4Z2JA 4QT3A 3EY6A 1YW5A 4WKAA 4DWSC 4DIPA 1J4IA 2DSVA 4ZPWR 5HUAA 4S3JA 3WD2A 1FKHA 1ITXA 4PTMA 1LJYA 3TC5A 2DSWA 1PBKA 2VN1A 4Q22A 3ARQA 5DIVA 1F8AB 1XRVA 4DRMA 3NTPA 4IPXA 4FAPA 5I98A 4ODQA 4C02B 4IT4A 1VF8A 4LAYA 4MNJA 3WD0A 2JZVA 1JNSA 1LL4A 4MNKA 1BL4A 1EDQA 4DRQA 3O5EA 2PBCA 2G41A 1NH6A 1ZBCA 1HJVA 4ML4A 2KI3A 4DRNA 2VCDA 1X6LA 2MLZA 2AWGA 3O5OA 2DSZA 4JYSA 3RMEA 3WL1A 3CHEA 2ZQUA 4GIVA 2M1IA 2DSUA 2DPEA 4U84A 4JFLA 3ALGA 4BF8A 1FKTA 4ODOA 3O5JA 1HKMA 4KQZA 1JNTA 4DRIA 1BKFA 1SYTA 5D75A 1D2KA 1W9VA 2KE0A 4P8XA 5JH8A 4W9OA 3G6MA 2WLYA 3ALFA 1FKFA 3WD4A 1F40A 5HTGA 2DT3A 1W1VA 1Q6IA 5DIUA 1QZ2A 4JFKA 3KAHA 2RUDA 3AS3A 3ARTA 1ZBVA 3RM9A 1B6CA 2LPVA 3UQBA 1W26A 5HT1A 3W4RA 3PA7A 5HWCA 4IQCA 4QZVB 4Z2GA 1FFQA 3FY1A 3IHZA 1X6NA 4TW6A 3JYJA 3O5KA 2FDMA 1HXVA 1CTNA 1Q1CA 4WKHA 3KZ7A 3KCEA 3JYMA 4JFMA 3CH9A 2A3EA 4FN2A 1D6OA 3KADA 3WD1A 1H0IA 4KR0B 4U85A 5DO2A 4Z2KA 2ZR4A 2FKEA 1Q6HA 3B8SA 2OLHA 3ARRA 2RURA 1FKLA 2MF9A 2YBUA 4XAKA 4DT4A 3G6LA 5GQBA 4TX0A 2F4EA 3O5IA 1WAWA 1NWUA 5HW7A 3NRKA 1EYMA 4S3KA 2MNTA 2KR7A 2Y78A 3WQVA 4G50A 2B31A 4IQ2A 3ARSA 3ODKA 1E6RA 3O5DA 2Q5AA 1NWTA 3ARWA 3IKDA 4TNSA 3WIJA 2IF4A 3WH0A 4DWSB 5GPRA 4DWSD 1Q6UA 1PINA 1LL6A 4LAWA 4GGQA 2PV3A 4P8VA 4WIWA 5HW6A 3O5FA 4MNMA 4W9QA 1SR0A 3NI6A 3UI6A 4U86A 1ROTA 4MAVA 4URIA 5B8IC 2FAPA 3QOKA 1D7IA 1UR9A 2ZR6A 1ZK6A 2PPPA 1FKSA 3ARPA 4MNLA 1GOIA 1FD9A 3UQAA 2A3AA 4L72B 2O9OA 1XHGA 2F21A 2XP7A 4R0XA 2RUQA 3PRDA 2RSEA 3AQUA 2WLZA 3PR9A 4ODRA 3ARUA 3AROA 1ZL1A 3H9RB 4HARA 1KT1A 1NSGA 1WB0A 4W5UA 4DROA 2XPAA 1FJDA 4L3NA 1EIBA 4J4NA 4LAVA 2N87A 4JFJA 1J6YA 3CHFA 1RD6A 1FAPA 3B9EA 2DT1A 2XP8A 2M08A 2ZQTA 2WM0A 2PI6A 4IT6A 3RFWA 1LL7A 1JNDA 2G8ZA 3ARYA 5HKGA 1QPFA 5GPGA 1HJXA 2XPBA 1IX5A 1FKDA 1T11A 1D7HA 1FKRA 3FXYA 1HJWA 2XP3A 2D9FA 4WK9A 1FFRA 1ZBWA 4W9PA 4ODPA 1GUVA 2KGJA 3RM8A 4HBEA 1HKIA 4DWSA 4ZPVR 4QT2A 4ZPTR 2M2AA 1Y0OA 2YBTA 3CZ8A 3O5GA 3O5MA 2DG4A 4TW7A 5DF0A 4Z2LA 3OOBA 1NMWA 4LGXA 2K8IA 1HKJA 1NMVA 2DG9A 2PPNA 1NWRA 4P8UA 4MGVA 1FKKA 3B7XA 3UQIA 3ARZA 3CGMA 3KAFA 1LG1A 3TDBA 1E9LA 1YATA 4DH0A 4DRPA 2PV1A 3LUOA 4ITZA 1R9HA 1M5YA 2L2SA 5DEZA 4ZS6A 2PV2A 5HBFA 1TFVA 1W1YA 1OGBA 5J6EA 2A3CA 4AY1A 2ZQSA 2LKNA 1P5QA 3O5PA 4DZ2A 3CHDA 4NZCA 2A3BA 2O92A 3IK8A 5BXJA 3FAPA 4TW8A 3AS1A 1LG2A 1U79A 4DRHA 1W1TA 1NWSA 1E15A 1O6IA 3JXVA 3O5QA 3VAWA 1W9UA 3BXWA 3RM4A 3KACA 1GPFA 2LGOA 2ZR5A 3MDYB 1A7XA 1ZBKA 3CGNA 5DITA 2WK2A 1TCOC 1FKIA 3B9DA 1OWQA 4ODLA 1C9HA 2ZQVA 3ARXA 1FKGA 3RGCA 1EQ3A 3TCZA 2IUZA 4G2PA 1OGGA 2ESCA 3ARVA 4NNRA 4ODKA 4WKFA 4R5EA 1JNEA 4N19A 3I6CA 1E6ZA 3AS0A 3OA5A 1HKKA 1H0GA 1E6NA 3UI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4E A;  3O5I A;  1N1A A;  5DIV A;  3GPK A;  1F8A B;  1NMW A;  4DRM A;  3NTP A;  4IPX A;  4FAP A;  5HW7 A;  5I98 A;  2K8I A;  4ODQ A;  4C02 B;  4TYO A;  3NRK A;  4LAY A;  4DRK A;  3KAI A;  1EYM A;  1NMV A;  2MNT A;  2DG9 A;  2KR7 A;  2PPN A;  2Y78 A;  4G50 A;  2JZV A;  1JNS A;  4IQ2 A;  4MGV A;  1FKK A;  3B7X A;  4DRJ A;  3UQI A;  2LJ4 A;  2F2D A;  5HWB A;  1BL4 A;  3ODK A;  3KAB A;  3CGM A;  4DRQ A;  3KAF A;  2Q5A A;  3IKD A;  3O5D A;  3O5E A;  4TNS A;  3TDB A;  2IF4 A;  2PBC A;  3WH0 A;  1FKB A;  1YAT A;  4DH0 A;  1JVW A;  5HW8 A;  4DRP A;  1Q6U A;  2KI3 A;  4DRN A;  1PIN A;  2PV1 A;  2VCD A;  4LAW A;  3LUO A;  2PV3 A;  4GGQ A;  2MLZ A;  4ITZ A;  2AWG A;  3O5O A;  5HW6 A;  4DZ3 A;  1R9H A;  4JYS A;  3UF8 A;  1D7J A;  1M5Y A;  2ZQU A;  3O5F A;  2L2S A;  4GIV A;  4W9Q A;  3NI6 A;  3UI6 A;  3PRB A;  2M1I A;  1ROT A;  2PV2 A;  4U86 A;  1L1P A;  2MLX A;  5B8I C;  2FAP A;  4U84 A;  1D7I A;  4JFL A;  2XP6 A;  4BF8 A;  1FKT A;  4ODO A;  5J6E A;  2KO7 A;  2UZ5 A;  2ZQS A;  2ZR6 A;  2LKN A;  1P5Q A;  1ZK6 A;  2PPP A;  3O5J A;  1FKS A;  3O5P A;  3O5L A;  4DZ2 A;  1JNT A;  1QPL A;  2MLY A;  4DRI A;  5BXJ A;  3IK8 A;  4LAX A;  1FD9 A;  1BKF A;  3FAP A;  3UQA A;  4O2T A;  4TW8 A;  5D75 A;  1J4R A;  1U79 A;  1ROU A;  1KT0 A;  2F21 A;  1FKJ A;  2KE0 A;  2XP7 A;  3O5R A;  4W9O A;  4DRH A;  4R0X A;  2RUQ A;  3JXV A;  3PRD A;  1FKF A;  2RSE A;  3IKG A;  2XP5 A;  4ODR A;  3O5Q A;  3VAW A;  5HTG A;  1F40 A;  4ODN A;  1Q6I A;  4MSP A;  2DG3 A;  5DIU A;  1QZ2 A;  2RUC A;  4JFK A;  1J4H A;  3H9R B;  1KT1 A;  3KAH A;  1NSG A;  2RUD A;  3KAC A;  4DRO A;  2XPA A;  1FJD A;  2LGO A;  2ZR5 A;  2OFN A;  3MDY B;  2XP4 A;  1A7X A;  1B6C A;  4J4N A;  2LPV A;  4LAV A;  2N87 A;  4JFJ A;  3KAG A;  3UQB A;  1W26 A;  4QIB A;  5HT1 A;  1J6Y A;  4J4O A;  3CGN A;  2RQS A;  3PA7 A;  5DIT A;  5HWC A;  4IQC A;  1FAP A;  2XP8 A;  2M08 A;  2ITK A;  1TCO C;  2ZQT A;  2PPO A;  3IHZ A;  4ODM A;  4TW6 A;  1FKI A;  3JYJ A;  3O5K A;  1HXV A;  2MPH A;  1Q1C A;  2XP9 A;  4ODL A;  3RFW A;  3KZ7 A;  1C9H A;  3KCE A;  2KFW A;  2ZQV A;  3JYM A;  4JFM A;  1ZCN A;  4FN2 A;  1D6O A;  4JFI A;  1QPF A;  5GPG A;  3UI5 A;  1FKG A;  5HKG A;  3KAD A;  2XPB A;  4QT3 A;  3RGC A;  4U85 A;  1EQ3 A;  1FKD A;  3TCZ A;  1T11 A;  3EY6 A;  1D7H A;  1YW5 A;  2ZR4 A;  1FKR A;  2FKE A;  1Q6H A;  2XP3 A;  2D9F A;  4DIP A;  4G2P A;  4W9P A;  1J4I A;  4NNR A;  4ODP A;  4ODK A;  5HUA A;  2RUR A;  1FKL A;  2KGJ A;  2MF9 A;  4N19 A;  4QT2 A;  4DT4 A;  3I6C A;  1FKH A;  2M2A A;  1Y0O A;  3O5G A;  3O5M A;  3TC5 A;  2DG4 A;  4TW7 A;  3UI4 A;  1PBK A;  2VN1 A;  4TX0 A;  3OOB A; 
#chains in the Genus database with same CATH topology
 1N1A A;  3GPK A;  4MPK A;  3WQW A;  4TYO A;  4DRK A;  3KAI A;  4HBO A;  1JCH B;  4DRJ A;  2LJ4 A;  2F2D A;  5HWB A;  3KAB A;  1KFW A;  4P8W A;  1FKB A;  1JVW A;  5HW8 A;  4NSB A;  4MTV A;  3CHC A;  4DZ3 A;  1ZU8 A;  3UF8 A;  1D7J A;  1WNO A;  2PN0 A;  3PRB A;  1L1P A;  2MLX A;  4Q7N A;  2XP6 A;  2DT0 A;  2DT2 A;  2KO7 A;  2UZ5 A;  3WD3 A;  3O5L A;  1QPL A;  1LQ0 A;  2MLY A;  4LAX A;  4O2T A;  1J4R A;  1ROU A;  1KT0 A;  3O5R A;  1FKJ A;  2AOS A;  4WJX A;  3IKG A;  2XP5 A;  4ODN A;  4MSP A;  2DG3 A;  4Z2I A;  2RUC A;  3PRA A;  1J4H A;  1K9T A;  3GTY X;  3AS2 A;  3WL0 A;  2OFN A;  4Z2H A;  2XP4 A;  1E6P A;  3KAG A;  4QIB A;  4J4O A;  3WKZ A;  2RQS A;  1GRJ A;  2ITK A;  2PPO A;  4ODM A;  1ZB5 A;  2MPH A;  2XP9 A;  3B9A A;  1UR8 A;  1W1P A;  1EHN A;  2QF8 A;  2KFW A;  1ZCN A;  1W9P A;  4JFI A;  3UI5 A;  2ETN A;  4Z2J A;  4QT3 A;  3EIP A;  3EY6 A;  1YW5 A;  4WKA A;  4DWS C;  4DIP A;  1J4I A;  2DSV A;  4ZPW R;  5HUA A;  4S3J A;  3WD2 A;  1FKH A;  1ITX A;  4PTM A;  1LJY A;  3TC5 A;  2DSW A;  1PBK A;  2VN1 A;  4Q22 A;  3ARQ A;  5DIV A;  1F8A B;  1XRV A;  4DRM A;  3NTP A;  4IPX A;  4FAP A;  5I98 A;  4ODQ A;  4C02 B;  4IT4 A;  1VF8 A;  4LAY A;  4MNJ A;  3WD0 A;  2JZV A;  1JNS A;  1LL4 A;  4MNK A;  1BL4 A;  1EDQ A;  4DRQ A;  2F23 A;  3O5E A;  2PBC A;  2G41 A;  1NH6 A;  1ZBC A;  1E44 A;  1HJV A;  4ML4 A;  2KI3 A;  4DRN A;  2VCD A;  1X6L A;  2MLZ A;  2AWG A;  3O5O A;  2DSZ A;  4JYS A;  3RME A;  3WL1 A;  3CHE A;  2ZQU A;  4GIV A;  2M1I A;  2DSU A;  2DPE A;  4U84 A;  4JFL A;  3ALG A;  4BF8 A;  2B5U B;  1FKT A;  4ODO A;  3O5J A;  1HKM A;  4KQZ A;  1JNT A;  4DRI A;  1BKF A;  1SYT A;  5D75 A;  1D2K A;  1W9V A;  2KE0 A;  4P8X A;  5JH8 A;  4W9O A;  3G6M A;  2WLY A;  3ALF A;  1FKF A;  3WD4 A;  1F40 A;  5HTG A;  2DT3 A;  1W1V A;  1Q6I A;  5DIU A;  1QZ2 A;  4JFK A;  3KAH A;  2RUD A;  3AS3 A;  3ART A;  1ZBV A;  3RM9 A;  1B6C A;  2LPV A;  3UQB A;  1W26 A;  5HT1 A;  3W4R A;  3PA7 A;  5HWC A;  4IQC A;  4QZV B;  4Z2G A;  1FFQ A;  3FY1 A;  3IHZ A;  1X6N A;  4TW6 A;  3JYJ A;  3O5K A;  2FDM A;  1HXV A;  1CTN A;  1Q1C A;  4WKH A;  3KZ7 A;  3KCE A;  3JYM A;  4JFM A;  3CH9 A;  2A3E A;  4FN2 A;  1D6O A;  3KAD A;  3WD1 A;  1H0I A;  4KR0 B;  4U85 A;  5DO2 A;  4Z2K A;  2ZR4 A;  2FKE A;  1Q6H A;  3B8S A;  2OLH A;  3ARR A;  2RUR A;  1FKL A;  2MF9 A;  2YBU A;  4XAK A;  4DT4 A;  3G6L A;  5GQB A;  4TX0 A;  2F4E A;  3O5I A;  1WAW A;  1NWU A;  5HW7 A;  3NRK A;  1EYM A;  4S3K A;  2MNT A;  2KR7 A;  2Y78 A;  3WQV A;  4G50 A;  2B31 A;  4IQ2 A;  3ARS A;  3ODK A;  1E6R A;  3O5D A;  2Q5A A;  1NWT A;  3ARW A;  3IKD A;  4TNS A;  3WIJ A;  2IF4 A;  3WH0 A;  4DWS B;  5GPR A;  4DWS D;  1Q6U A;  1PIN A;  1LL6 A;  4LAW A;  4GGQ A;  2PV3 A;  4P8V A;  4WIW A;  5HW6 A;  3O5F A;  4MNM A;  4W9Q A;  1SR0 A;  3NI6 A;  3UI6 A;  4U86 A;  1ROT A;  4MAV A;  2P4V A;  4URI A;  5B8I C;  2FAP A;  3QOK A;  1D7I A;  1UR9 A;  2ZR6 A;  1ZK6 A;  2PPP A;  1FKS A;  3ARP A;  4MNL A;  1GOI A;  1FD9 A;  3UQA A;  2A3A A;  4L72 B;  2O9O A;  1XHG A;  2F21 A;  2XP7 A;  4R0X A;  2RUQ A;  3PRD A;  2RSE A;  3AQU A;  2WLZ A;  3PR9 A;  4ODR A;  3ARU A;  3ARO A;  1ZL1 A;  3H9R B;  4HAR A;  1KT1 A;  1NSG A;  1WB0 A;  4W5U A;  4DRO A;  2XPA A;  1FJD A;  4L3N A;  1EIB A;  4J4N A;  4LAV A;  2N87 A;  4JFJ A;  1J6Y A;  3CHF A;  1RD6 A;  1FAP A;  3B9E A;  2DT1 A;  2XP8 A;  2M08 A;  2ZQT A;  3BMB A;  2WM0 A;  2PI6 A;  4IT6 A;  3RFW A;  1LL7 A;  1JND A;  2G8Z A;  3ARY A;  5HKG A;  1QPF A;  5GPG A;  1HJX A;  2XPB A;  1IX5 A;  1FKD A;  1T11 A;  1D7H A;  1FKR A;  3FXY A;  1HJW A;  2XP3 A;  2D9F A;  4WK9 A;  1FFR A;  1ZBW A;  4W9P A;  4ODP A;  1GUV A;  2KGJ A;  3RM8 A;  4HBE A;  1HKI A;  4DWS A;  4ZPV R;  4QT2 A;  4ZPT R;  3GU0 A;  2M2A A;  1Y0O A;  2YBT A;  3CZ8 A;  3O5G A;  3O5M A;  2DG4 A;  4TW7 A;  5DF0 A;  4Z2L A;  3OOB A;  1NMW A;  4LGX A;  2K8I A;  1HKJ A;  1NMV A;  2DG9 A;  2PPN A;  1NWR A;  4P8U A;  4MGV A;  1FKK A;  3B7X A;  3UQI A;  3ARZ A;  3CGM A;  3KAF A;  1LG1 A;  3TDB A;  1E9L A;  1YAT A;  4DH0 A;  4DRP A;  2PV1 A;  3LUO A;  4ITZ A;  1R9H A;  1M5Y A;  2L2S A;  5DEZ A;  4ZS6 A;  2PV2 A;  5HBF A;  1TFV A;  1W1Y A;  1OGB A;  5J6E A;  2A3C A;  4AY1 A;  2ZQS A;  2LKN A;  1P5Q A;  3O5P A;  4DZ2 A;  2EUL A;  3CHD A;  4NZC A;  2A3B A;  2O92 A;  3IK8 A;  5BXJ A;  3FAP A;  4TW8 A;  3AS1 A;  1LG2 A;  1U79 A;  4DRH A;  1W1T A;  1NWS A;  1E15 A;  1O6I A;  3JXV A;  3O5Q A;  3VAW A;  1W9U A;  3BXW A;  3RM4 A;  3KAC A;  1GPF A;  2LGO A;  2ZR5 A;  3MDY B;  1A7X A;  1ZBK A;  3CGN A;  5DIT A;  2WK2 A;  1TCO C;  1FKI A;  3B9D A;  1OWQ A;  4ODL A;  1C9H A;  2ZQV A;  3ARX A;  1FKG A;  3RGC A;  1EQ3 A;  3TCZ A;  2IUZ A;  4UDM A;  4G2P A;  1OGG A;  2ESC A;  3ARV A;  4NNR A;  4ODK A;  4WKF A;  4R5E A;  1JNE A;  4N19 A;  3I6C A;  1E6Z A;  3AS0 A;  3OA5 A;  1HKK A;  1H0G A;  1E6N A;  3UI4 A; 
#chains in the Genus database with same CATH homology
 1N1A A;  3GPK A;  4MPK A;  3WQW A;  4TYO A;  4DRK A;  3KAI A;  4HBO A;  4DRJ A;  2LJ4 A;  2F2D A;  5HWB A;  3KAB A;  1KFW A;  4P8W A;  1FKB A;  1JVW A;  5HW8 A;  4NSB A;  4MTV A;  3CHC A;  4DZ3 A;  1ZU8 A;  3UF8 A;  1D7J A;  1WNO A;  3PRB A;  1L1P A;  2MLX A;  4Q7N A;  2XP6 A;  2DT0 A;  2DT2 A;  2KO7 A;  2UZ5 A;  3WD3 A;  3O5L A;  1QPL A;  1LQ0 A;  2MLY A;  4LAX A;  4O2T A;  1J4R A;  1ROU A;  1KT0 A;  3O5R A;  1FKJ A;  2AOS A;  4WJX A;  3IKG A;  2XP5 A;  4ODN A;  4MSP A;  2DG3 A;  4Z2I A;  2RUC A;  3PRA A;  1J4H A;  1K9T A;  3AS2 A;  3WL0 A;  2OFN A;  4Z2H A;  2XP4 A;  1E6P A;  3KAG A;  4QIB A;  4J4O A;  3WKZ A;  2RQS A;  2ITK A;  2PPO A;  4ODM A;  1ZB5 A;  2MPH A;  2XP9 A;  3B9A A;  1UR8 A;  1W1P A;  1EHN A;  2QF8 A;  2KFW A;  1ZCN A;  1W9P A;  4JFI A;  3UI5 A;  4Z2J A;  4QT3 A;  3EY6 A;  1YW5 A;  4WKA A;  4DWS C;  4DIP A;  1J4I A;  2DSV A;  4ZPW R;  5HUA A;  4S3J A;  3WD2 A;  1FKH A;  1ITX A;  4PTM A;  1LJY A;  3TC5 A;  2DSW A;  1PBK A;  2VN1 A;  4Q22 A;  3ARQ A;  5DIV A;  1F8A B;  1XRV A;  4DRM A;  3NTP A;  4IPX A;  4FAP A;  5I98 A;  4ODQ A;  4C02 B;  4IT4 A;  1VF8 A;  4LAY A;  4MNJ A;  3WD0 A;  2JZV A;  1JNS A;  1LL4 A;  4MNK A;  1BL4 A;  1EDQ A;  4DRQ A;  3O5E A;  2PBC A;  2G41 A;  1NH6 A;  1ZBC A;  1HJV A;  4ML4 A;  2KI3 A;  4DRN A;  2VCD A;  1X6L A;  2MLZ A;  2AWG A;  3O5O A;  2DSZ A;  4JYS A;  3RME A;  3WL1 A;  3CHE A;  2ZQU A;  4GIV A;  2M1I A;  2DSU A;  2DPE A;  4U84 A;  4JFL A;  3ALG A;  4BF8 A;  1FKT A;  4ODO A;  3O5J A;  1HKM A;  4KQZ A;  1JNT A;  4DRI A;  1BKF A;  1SYT A;  5D75 A;  1D2K A;  1W9V A;  2KE0 A;  4P8X A;  5JH8 A;  4W9O A;  3G6M A;  2WLY A;  3ALF A;  1FKF A;  3WD4 A;  1F40 A;  5HTG A;  2DT3 A;  1W1V A;  1Q6I A;  5DIU A;  1QZ2 A;  4JFK A;  3KAH A;  2RUD A;  3AS3 A;  3ART A;  1ZBV A;  3RM9 A;  1B6C A;  2LPV A;  3UQB A;  1W26 A;  5HT1 A;  3W4R A;  3PA7 A;  5HWC A;  4IQC A;  4QZV B;  4Z2G A;  1FFQ A;  3FY1 A;  3IHZ A;  1X6N A;  4TW6 A;  3JYJ A;  3O5K A;  2FDM A;  1HXV A;  1CTN A;  1Q1C A;  4WKH A;  3KZ7 A;  3KCE A;  3JYM A;  4JFM A;  3CH9 A;  2A3E A;  4FN2 A;  1D6O A;  3KAD A;  3WD1 A;  1H0I A;  4KR0 B;  4U85 A;  5DO2 A;  4Z2K A;  2ZR4 A;  2FKE A;  1Q6H A;  3B8S A;  2OLH A;  3ARR A;  2RUR A;  1FKL A;  2MF9 A;  2YBU A;  4XAK A;  4DT4 A;  3G6L A;  5GQB A;  4TX0 A;  2F4E A;  3O5I A;  1WAW A;  1NWU A;  5HW7 A;  3NRK A;  1EYM A;  4S3K A;  2MNT A;  2KR7 A;  2Y78 A;  3WQV A;  4G50 A;  2B31 A;  4IQ2 A;  3ARS A;  3ODK A;  1E6R A;  3O5D A;  2Q5A A;  1NWT A;  3ARW A;  3IKD A;  4TNS A;  3WIJ A;  2IF4 A;  3WH0 A;  4DWS B;  5GPR A;  4DWS D;  1Q6U A;  1PIN A;  1LL6 A;  4LAW A;  4GGQ A;  2PV3 A;  4P8V A;  4WIW A;  5HW6 A;  3O5F A;  4MNM A;  4W9Q A;  1SR0 A;  3NI6 A;  3UI6 A;  4U86 A;  1ROT A;  4MAV A;  4URI A;  5B8I C;  2FAP A;  3QOK A;  1D7I A;  1UR9 A;  2ZR6 A;  1ZK6 A;  2PPP A;  1FKS A;  3ARP A;  4MNL A;  1GOI A;  1FD9 A;  3UQA A;  2A3A A;  4L72 B;  2O9O A;  1XHG A;  2F21 A;  2XP7 A;  4R0X A;  2RUQ A;  3PRD A;  2RSE A;  3AQU A;  2WLZ A;  3PR9 A;  4ODR A;  3ARU A;  3ARO A;  1ZL1 A;  3H9R B;  4HAR A;  1KT1 A;  1NSG A;  1WB0 A;  4W5U A;  4DRO A;  2XPA A;  1FJD A;  4L3N A;  1EIB A;  4J4N A;  4LAV A;  2N87 A;  4JFJ A;  1J6Y A;  3CHF A;  1RD6 A;  1FAP A;  3B9E A;  2DT1 A;  2XP8 A;  2M08 A;  2ZQT A;  2WM0 A;  2PI6 A;  4IT6 A;  3RFW A;  1LL7 A;  1JND A;  2G8Z A;  3ARY A;  5HKG A;  1QPF A;  5GPG A;  1HJX A;  2XPB A;  1IX5 A;  1FKD A;  1T11 A;  1D7H A;  1FKR A;  3FXY A;  1HJW A;  2XP3 A;  2D9F A;  4WK9 A;  1FFR A;  1ZBW A;  4W9P A;  4ODP A;  1GUV A;  2KGJ A;  3RM8 A;  4HBE A;  1HKI A;  4DWS A;  4ZPV R;  4QT2 A;  4ZPT R;  2M2A A;  1Y0O A;  2YBT A;  3CZ8 A;  3O5G A;  3O5M A;  2DG4 A;  4TW7 A;  5DF0 A;  4Z2L A;  3OOB A;  1NMW A;  4LGX A;  2K8I A;  1HKJ A;  1NMV A;  2DG9 A;  2PPN A;  1NWR A;  4P8U A;  4MGV A;  1FKK A;  3B7X A;  3UQI A;  3ARZ A;  3CGM A;  3KAF A;  1LG1 A;  3TDB A;  1E9L A;  1YAT A;  4DH0 A;  4DRP A;  2PV1 A;  3LUO A;  4ITZ A;  1R9H A;  1M5Y A;  2L2S A;  5DEZ A;  4ZS6 A;  2PV2 A;  5HBF A;  1TFV A;  1W1Y A;  1OGB A;  5J6E A;  2A3C A;  4AY1 A;  2ZQS A;  2LKN A;  1P5Q A;  3O5P A;  4DZ2 A;  3CHD A;  4NZC A;  2A3B A;  2O92 A;  3IK8 A;  5BXJ A;  3FAP A;  4TW8 A;  3AS1 A;  1LG2 A;  1U79 A;  4DRH A;  1W1T A;  1NWS A;  1E15 A;  1O6I A;  3JXV A;  3O5Q A;  3VAW A;  1W9U A;  3BXW A;  3RM4 A;  3KAC A;  1GPF A;  2LGO A;  2ZR5 A;  3MDY B;  1A7X A;  1ZBK A;  3CGN A;  5DIT A;  2WK2 A;  1TCO C;  1FKI A;  3B9D A;  1OWQ A;  4ODL A;  1C9H A;  2ZQV A;  3ARX A;  1FKG A;  3RGC A;  1EQ3 A;  3TCZ A;  2IUZ A;  4G2P A;  1OGG A;  2ESC A;  3ARV A;  4NNR A;  4ODK A;  4WKF A;  4R5E A;  1JNE A;  4N19 A;  3I6C A;  1E6Z A;  3AS0 A;  3OA5 A;  1HKK A;  1H0G A;  1E6N A;  3UI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...