4ODOA

Structure of slyd from thermus thermophilus in complex with fk506
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase, chaperone
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 35
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odoA00
3UQAA 2Q5AA 1QZ2A 2ZR6A 2D9FA 2RUQA 3CGNA 1FKDA 3KAFA 3UF8A 3UQBA 1BKFA 2ZQUA 2VN1A 2VCDA 1D6OA 2PV2A 1ZCNA 2L2SA 2XP7A 4TYOA 3OOBA 3MDYB 2KO7A 1B6CA 2KFWA 4ODQA 2DG4A 2PBCA 2DG9A 3IKDA 3ODKA 1F8AB 4GIVA 1FKIA 5DITA 1ROTA 1FKLA 5HW7A 4DRIA 4U86A 3LUOA 1FKHA 5DIVA 2MNTA 1NMWA 2OFNA 4DZ2A 4QT2A 5HT1A 4FN2A 3UI4A 1FKRA 2XP9A 1J6YA 4DT4A 1EYMA 1JVWA 3CGMA 4TNSA 2N87A 2PPPA 2KR7A 4DRPA 3O5EA 1JNSA 5HWCA 4TW7A 4GGQA 1QPLA 4JFIA 1W26A 2Y78A 3TCZA 1JNTA 1D7IA 4G50A 1FAPA 1HXVA 1PINA 2ZR4A 4N19A 1Q6HA 1ZK6A 3KCEA 5HW6A 1BL4A 3KZ7A 4IQ2A 4J4OA 1U79A 4DRNA 4IPXA 3O5JA 3O5DA 4O2TA 1FD9A 2IF4A 4DRHA 2RUDA 3O5KA 5BXJA 1ROUA 2MPHA 4ODRA 4DRKA 4ODKA 1KT1A 3NI6A 5HUAA 4U84A 1PBKA 3IHZA 2FKEA 4IQCA 1D7JA 1FKBA 3JXVA 3NTPA 4W9PA 4JFMA 2LJ4A 4TX0A 2JZVA 2AWGA 2RQSA 3VAWA 4ODMA 5HTGA 4QIBA 3WH0A 2UZ5A 1YW5A 4W9QA 2RURA 2XPBA 4TW8A 5D75A 1T11A 2MLXA 1J4HA 3RFWA 2XPAA 1M5YA 2K8IA 2PV3A 3B7XA 4QT3A 3UI6A 2ZQVA 3KADA 3NRKA 5HKGA 1FKKA 1QPFA 4C02B 1YATA 4JFLA 3O5QA 2M2AA 1FKGA 4DRMA 3FAPA 2RSEA 2MLZA 4J4NA 4LAVA 3RGCA 1FJDA 3I6CA 1NMVA 1Q6IA 4TW6A 5GPGA 3KABA 5HW8A 1Q6UA 3O5PA 3KACA 4JFJA 1D7HA 1A7XA 3PA7A 5J6EA 5B8IC 5I98A 2XP6A 2RUCA 3O5FA 5DIUA 3UI5A 3IK8A 2KI3A 3IKGA 2F4EA 4ITZA 2ZR5A 4LAYA 1EQ3A 1F40A 2KGJA 3O5IA 1Y0OA 2XP4A 4W9OA 4DROA 4DRQA 1FKFA 2KE0A 2M08A 4JFKA 3EY6A 4FAPA 4G2PA 3TC5A 2LPVA 3PRBA 1KT0A 4R0XA 2XP5A 2PV1A 3O5OA 1J4IA 1NSGA 3JYMA 3O5MA 3H9RB 3UQIA 1N1AA 2M1IA 2LKNA 1FKTA 4ODPA 1Q1CA 4NNRA 4DH0A 3O5RA 2XP8A 4LAXA 4MSPA 4BF8A 4ODLA 5HWBA 3O5LA 1TCOC 2F21A 3KAIA 2XP3A 4ODNA 4U85A 2F2DA 3JYJA 3O5GA 2ITKA 2LGOA 2ZQSA 2PPNA 1FKJA 4JYSA 1J4RA 1R9HA 2ZQTA 2DG3A 4DIPA 3PRDA 4MGVA 1L1PA 1C9HA 3KAGA 3TDBA 2MF9A 4DZ3A 3GPKA 4LAWA 2MLYA 1FKSA 1P5QA 2PPOA 4ODOA 4DRJA 3KAHA 2FAPA
chains in the Genus database with same CATH superfamily
3UQAA 2ZR6A 1FFRA 2ZQUA 2B31A 1W1TA 4Z2KA 1IX5A 1ZBVA 4GIVA 4DRIA 3CHDA 4AY1A 5DIVA 2MNTA 1NMWA 1JVWA 1OGGA 2N87A 1E15A 4S3JA 3O5EA 5GQBA 1JNSA 1W26A 1CTNA 1D7IA 3AROA 1ZK6A 3KCEA 1ZBCA 3KZ7A 4DRNA 2IF4A 2YBTA 1ROUA 4ODRA 1KT1A 4R5EA 4U84A 4NSBA 4Z2GA 4IQCA 1D7JA 3NTPA 4TX0A 2RQSA 3AS2A 3WL1A 3WH0A 4DWSC 3RFWA 2AOSA 2XPBA 4MNLA 1GUVA 3AS0A 1M5YA 2PV3A 4QT3A 3UI6A 1HKKA 4NZCA 1QPFA 2EULA 3WKZA 1EHNA 2DPEA 3I6CA 1Q6UA 3O5PA 1A7XA 3PA7A 5J6EA 4XAKA 3ARRA 3GTYX 3UI5A 4LAYA 1EQ3A 4P8VA 1HJVA 3ALGA 3PRBA 1KT0A 1O6IA 4R0XA 2PV1A 3ARVA 4DWSA 4DWSD 1E6PA 2WLYA 1XHGA 2A3EA 1Q1CA 4DH0A 2XP8A 1UR9A 4ODLA 4Z2LA 1LL7A 3AS1A 2O9OA 3OA5A 2PI6A 3ALFA 2ZQSA 4JYSA 4KR0B 3PRDA 2MF9A 4DZ3A 3GPKA 4HARA 4LAWA 2MLYA 1FKSA 1P5QA 1D2KA 2FAPA 2DT3A 2RUQA 1E9LA 2P4VA 2VN1A 2VCDA 3PRAA 4MPKA 1NWSA 2PV2A 1EIBA 2L2SA 4PTMA 2DT2A 3CHFA 2DT1A 3LUOA 1FKHA 4QT2A 5HT1A 4FN2A 2XP9A 3WD0A 1J6YA 3CGMA 2KR7A 5HBFA 1EDQA 4GGQA 3WQVA 4JFIA 2IUZA 1E44A 2Y78A 1OWQA 3B9AA 1HXVA 1FAPA 3CH9A 1PINA 4N19A 4IQ2A 4P8UA 4IPXA 3O5JA 3O5DA 1FD9A 2RUDA 5BXJA 1HJWA 4DRKA 3NI6A 1PBKA 3IHZA 3RM4A 4P8WA 1SYTA 1FKBA 3JXVA 4W9PA 3QOKA 3WL0A 4ODMA 4QIBA 3ARXA 2DSWA 1YW5A 4W9QA 1WAWA 2MLXA 2XPAA 1TFVA 3B7XA 1JNEA 3KADA 3NRKA 2G41A 2ETNA 2DSUA 1FKGA 3FAPA 4LAVA 4J4NA 1Q6IA 4W5UA 1GPFA 4JFJA 5DF0A 2A3AA 5B8IC 3PR9A 3RMEA 3O5IA 1Y0OA 1FKFA 2KE0A 2M08A 3AS3A 4JFKA 4LGXA 3ARPA 4Q22A 3CZ8A 3O5OA 4S3KA 1N1AA 2M1IA 2LKNA 4ODPA 4NNRA 4ML4A 4MTVA 3O5RA 4WJXA 4U85A 4HBOA 2ITKA 1FFQA 2PPNA 4MNJA 1FKJA 1WNOA 2ESCA 1GOIA 1R9HA 2DG3A 2OLHA 2ZQTA 3CHEA 4DIPA 3CHCA 1C9HA 1K9TA 2G8ZA 4WKAA 4MNKA 3FXYA 3KAFA 4Z2JA 1BKFA 1D6OA 4WKFA 1ZCNA 4TYOA 3OOBA 2DSZA 1JCHB 2KO7A 4ODQA 3ARUA 3FY1A 2DG4A 2DG9A 1F8AB 1FKIA 5HW7A 1ROTA 1FKLA 4U86A 2DT0A 1FKRA 4Q7NA 4TNSA 4IT6A 2PPPA 3RM9A 4Z2IA 1X6NA 5HWCA 3G6MA 4TW7A 1W9PA 3TCZA 1JNTA 1ZL1A 3AQUA 1W1PA 1ZBKA 5HW6A 2O92A 3W4RA 3O5KA 2MPHA 4ODKA 2FKEA 2LJ4A 2JZVA 3VAWA 2A3BA 4TW8A 5D75A 1J4HA 2K8IA 4MNMA 4DWSB 5HKGA 1FKKA 1YATA 4JFLA 1H0IA 2M2AA 4DRMA 2MLZA 1LL4A 3WD2A 3WD4A 5GPGA 1NMVA 3B9DA 3G6LA 4L72B 4Z2HA 3KABA 1H0GA 3KACA 4KQZA 5I98A 2F23A 2KI3A 4ITZA 2F4EA 1JNDA 1F40A 3B9EA 4WIWA 4WK9A 4ZPWR 3EY6A 4FAPA 3TC5A 1UR8A 3ARTA 2WLZA 3O5MA 3H9RB 3ARSA 1NWTA 3RM8A 1W1YA 4LAXA 3ARWA 3KAIA 4ODNA 2F2DA 2PN0A 3JYJA 3EIPA 3O5GA 1L1PA 3TDBA 1GRJA 4QZVB 4ZPTR 2PPOA 1LJYA 2QF8A 1W9UA 1WB0A 1ITXA 4DRJA 3KAHA 2Q5AA 1QZ2A 2D9FA 3CGNA 1FKDA 3UF8A 3UQBA 1E6ZA 1KFWA 2XP7A 3BMBA 3MDYB 1B6CA 2KFWA 3WD1A 2PBCA 3ODKA 2B5UB 3IKDA 5DITA 1VF8A 1HKIA 2OFNA 4DZ2A 3B8SA 3UI4A 4DT4A 1EYMA 5GPRA 4DRPA 1SR0A 1W1VA 1W9VA 1QPLA 1HKMA 3GU0A 5DEZA 3WD3A 4G50A 1RD6A 2A3CA 2ZR4A 1Q6HA 1BL4A 4J4OA 1U79A 4ZPVR 1NWUA 1NH6A 4P8XA 4O2TA 1HKJA 3BXWA 4DRHA 1LL6A 4WKHA 1HJXA 5HUAA 2YBUA 1ZB5A 4JFMA 3ARYA 2AWGA 2FDMA 5HTGA 2UZ5A 4URIA 2RURA 1T11A 2ZQVA 4C02B 4UDMA 3O5QA 1E6RA 2RSEA 3RGCA 1FJDA 4TW6A 1LG1A 5HW8A 2WK2A 5DO2A 1D7HA 2WM0A 3WQWA 4IT4A 2XP6A 4L3NA 2RUCA 1NWRA 3O5FA 5DIUA 2DSVA 3IK8A 3IKGA 2ZR5A 2KGJA 1LQ0A 2XP4A 4W9OA 4DROA 4DRQA 1OGBA 4G2PA 2LPVA 1ZU8A 2XP5A 1J4IA 3JYMA 1NSGA 1X6LA 4MAVA 3UQIA 3ARZA 1FKTA 1XRVA 1LG2A 4HBEA 4MSPA 4BF8A 5HWBA 4ZS6A 3O5LA 1TCOC 2F21A 3WIJA 5JH8A 1E6NA 2XP3A 1ZBWA 2LGOA 1J4RA 4MGVA 3KAGA 4ODOA 3ARQA
chains in the Genus database with same CATH topology
3UQAA 2ZR6A 1FFRA 2ZQUA 2B31A 1W1TA 4Z2KA 1IX5A 1ZBVA 4GIVA 4DRIA 3CHDA 4AY1A 5DIVA 2MNTA 1NMWA 1JVWA 1OGGA 2N87A 1E15A 4S3JA 3O5EA 5GQBA 1JNSA 1W26A 1CTNA 1D7IA 3AROA 1ZK6A 3KCEA 1ZBCA 3KZ7A 4DRNA 2IF4A 2YBTA 1ROUA 4ODRA 1KT1A 4R5EA 4U84A 4NSBA 4Z2GA 4IQCA 1D7JA 3NTPA 4TX0A 2RQSA 3AS2A 3WL1A 3WH0A 4DWSC 3RFWA 2AOSA 2XPBA 4MNLA 1GUVA 3AS0A 1M5YA 2PV3A 4QT3A 3UI6A 1HKKA 4NZCA 1QPFA 3WKZA 1EHNA 2DPEA 3I6CA 1Q6UA 3O5PA 1A7XA 3PA7A 5J6EA 4XAKA 3ARRA 3UI5A 4LAYA 1EQ3A 4P8VA 1HJVA 3ALGA 3PRBA 1KT0A 1O6IA 4R0XA 2PV1A 3ARVA 4DWSA 4DWSD 1E6PA 2WLYA 1XHGA 2A3EA 1Q1CA 4DH0A 2XP8A 1UR9A 4ODLA 4Z2LA 1LL7A 3AS1A 2O9OA 3OA5A 2PI6A 3ALFA 2ZQSA 4JYSA 4KR0B 3PRDA 2MF9A 4DZ3A 3GPKA 4HARA 4LAWA 2MLYA 1FKSA 1P5QA 1D2KA 2FAPA 2DT3A 2RUQA 1E9LA 2VN1A 2VCDA 3PRAA 4MPKA 1NWSA 2PV2A 1EIBA 2L2SA 4PTMA 2DT2A 3CHFA 2DT1A 3LUOA 1FKHA 4QT2A 5HT1A 4FN2A 2XP9A 3WD0A 1J6YA 3CGMA 2KR7A 5HBFA 1EDQA 4GGQA 3WQVA 4JFIA 2IUZA 2Y78A 1OWQA 3B9AA 1HXVA 1FAPA 3CH9A 1PINA 4N19A 4IQ2A 4P8UA 4IPXA 3O5JA 3O5DA 1FD9A 2RUDA 5BXJA 1HJWA 4DRKA 3NI6A 1PBKA 3IHZA 3RM4A 4P8WA 1SYTA 1FKBA 3JXVA 4W9PA 3QOKA 3WL0A 4ODMA 4QIBA 3ARXA 2DSWA 1YW5A 4W9QA 1WAWA 2MLXA 2XPAA 1TFVA 3B7XA 1JNEA 3KADA 3NRKA 2G41A 2DSUA 1FKGA 3FAPA 4LAVA 4J4NA 1Q6IA 4W5UA 1GPFA 4JFJA 5DF0A 2A3AA 5B8IC 3PR9A 3RMEA 3O5IA 1Y0OA 1FKFA 2KE0A 2M08A 3AS3A 4JFKA 4LGXA 3ARPA 4Q22A 3O5OA 3CZ8A 4S3KA 1N1AA 2M1IA 2LKNA 4ODPA 4NNRA 4ML4A 4MTVA 3O5RA 4WJXA 4U85A 4HBOA 2ITKA 1FFQA 2PPNA 4MNJA 1FKJA 1WNOA 2ESCA 1GOIA 1R9HA 2DG3A 2OLHA 2ZQTA 3CHEA 4DIPA 3CHCA 1C9HA 1K9TA 2G8ZA 4WKAA 4MNKA 3FXYA 3KAFA 4Z2JA 1BKFA 1D6OA 4WKFA 1ZCNA 4TYOA 3OOBA 2DSZA 2KO7A 4ODQA 3ARUA 3FY1A 2DG4A 2DG9A 1F8AB 1FKIA 5HW7A 1ROTA 1FKLA 4U86A 2DT0A 1FKRA 4Q7NA 4TNSA 4IT6A 2PPPA 3RM9A 4Z2IA 1X6NA 5HWCA 3G6MA 4TW7A 1W9PA 3TCZA 1JNTA 1ZL1A 3AQUA 1W1PA 1ZBKA 5HW6A 2O92A 3W4RA 3O5KA 2MPHA 4ODKA 2FKEA 2LJ4A 2JZVA 3VAWA 2A3BA 4TW8A 5D75A 1J4HA 2K8IA 4MNMA 4DWSB 5HKGA 1FKKA 1YATA 4JFLA 1H0IA 2M2AA 4DRMA 2MLZA 1LL4A 3WD2A 3WD4A 5GPGA 1NMVA 3B9DA 3G6LA 4L72B 4Z2HA 3KABA 1H0GA 3KACA 4KQZA 5I98A 2KI3A 4ITZA 2F4EA 1JNDA 1F40A 3B9EA 4WIWA 4WK9A 4ZPWR 3EY6A 4FAPA 3TC5A 1UR8A 3ARTA 2WLZA 3O5MA 3H9RB 3ARSA 1NWTA 3RM8A 1W1YA 4LAXA 3ARWA 3KAIA 4ODNA 2F2DA 3JYJA 3O5GA 1L1PA 3TDBA 4QZVB 4ZPTR 2PPOA 1LJYA 2QF8A 1W9UA 1WB0A 1ITXA 4DRJA 3KAHA 2Q5AA 1QZ2A 2D9FA 3CGNA 1FKDA 3UF8A 3UQBA 1E6ZA 1KFWA 2XP7A 3MDYB 1B6CA 2KFWA 3WD1A 2PBCA 3ODKA 3IKDA 5DITA 1VF8A 1HKIA 2OFNA 4DZ2A 3B8SA 3UI4A 4DT4A 1EYMA 5GPRA 4DRPA 1SR0A 1W1VA 1W9VA 1QPLA 1HKMA 5DEZA 3WD3A 4G50A 1RD6A 2A3CA 2ZR4A 1Q6HA 1BL4A 4J4OA 1U79A 4ZPVR 1NWUA 1NH6A 4P8XA 4O2TA 1HKJA 3BXWA 4DRHA 1LL6A 4WKHA 1HJXA 5HUAA 2YBUA 1ZB5A 4JFMA 3ARYA 2AWGA 2FDMA 5HTGA 2UZ5A 4URIA 2RURA 1T11A 2ZQVA 4C02B 3O5QA 1E6RA 2RSEA 3RGCA 1FJDA 4TW6A 1LG1A 5HW8A 2WK2A 5DO2A 1D7HA 2WM0A 3WQWA 4IT4A 2XP6A 4L3NA 2RUCA 1NWRA 3O5FA 5DIUA 2DSVA 3IK8A 3IKGA 2ZR5A 2KGJA 1LQ0A 2XP4A 4W9OA 4DROA 4DRQA 1OGBA 4G2PA 2LPVA 1ZU8A 2XP5A 1J4IA 3JYMA 1NSGA 1X6LA 4MAVA 3UQIA 3ARZA 1FKTA 1XRVA 1LG2A 4HBEA 4MSPA 4BF8A 5HWBA 4ZS6A 3O5LA 1TCOC 2F21A 3WIJA 5JH8A 1E6NA 2XP3A 1ZBWA 2LGOA 1J4RA 4MGVA 3KAGA 4ODOA 3ARQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQA A;  2Q5A A;  1QZ2 A;  2ZR6 A;  2D9F A;  2RUQ A;  3CGN A;  1FKD A;  3KAF A;  3UF8 A;  3UQB A;  1BKF A;  2ZQU A;  2VN1 A;  2VCD A;  1D6O A;  2PV2 A;  1ZCN A;  2L2S A;  2XP7 A;  4TYO A;  3OOB A;  3MDY B;  2KO7 A;  1B6C A;  2KFW A;  4ODQ A;  2DG4 A;  2PBC A;  2DG9 A;  3IKD A;  3ODK A;  1F8A B;  4GIV A;  1FKI A;  5DIT A;  1ROT A;  1FKL A;  5HW7 A;  4DRI A;  4U86 A;  3LUO A;  1FKH A;  5DIV A;  2MNT A;  1NMW A;  2OFN A;  4DZ2 A;  4QT2 A;  5HT1 A;  4FN2 A;  3UI4 A;  1FKR A;  2XP9 A;  1J6Y A;  4DT4 A;  1EYM A;  1JVW A;  3CGM A;  4TNS A;  2N87 A;  2PPP A;  2KR7 A;  4DRP A;  3O5E A;  1JNS A;  5HWC A;  4TW7 A;  4GGQ A;  1QPL A;  4JFI A;  1W26 A;  2Y78 A;  3TCZ A;  1JNT A;  1D7I A;  4G50 A;  1FAP A;  1HXV A;  1PIN A;  2ZR4 A;  4N19 A;  1Q6H A;  1ZK6 A;  3KCE A;  5HW6 A;  1BL4 A;  3KZ7 A;  4IQ2 A;  4J4O A;  1U79 A;  4DRN A;  4IPX A;  3O5J A;  3O5D A;  4O2T A;  1FD9 A;  2IF4 A;  4DRH A;  2RUD A;  3O5K A;  5BXJ A;  1ROU A;  2MPH A;  4ODR A;  4DRK A;  4ODK A;  1KT1 A;  3NI6 A;  5HUA A;  4U84 A;  1PBK A;  3IHZ A;  2FKE A;  4IQC A;  1D7J A;  1FKB A;  3JXV A;  3NTP A;  4W9P A;  4JFM A;  2LJ4 A;  4TX0 A;  2JZV A;  2AWG A;  2RQS A;  3VAW A;  4ODM A;  5HTG A;  4QIB A;  3WH0 A;  2UZ5 A;  1YW5 A;  4W9Q A;  2RUR A;  2XPB A;  4TW8 A;  5D75 A;  1T11 A;  2MLX A;  1J4H A;  3RFW A;  2XPA A;  1M5Y A;  2K8I A;  2PV3 A;  3B7X A;  4QT3 A;  3UI6 A;  2ZQV A;  3KAD A;  3NRK A;  5HKG A;  1FKK A;  1QPF A;  4C02 B;  1YAT A;  4JFL A;  3O5Q A;  2M2A A;  1FKG A;  4DRM A;  3FAP A;  2RSE A;  2MLZ A;  4J4N A;  4LAV A;  3RGC A;  1FJD A;  3I6C A;  1NMV A;  1Q6I A;  4TW6 A;  5GPG A;  3KAB A;  5HW8 A;  1Q6U A;  3O5P A;  3KAC A;  4JFJ A;  1D7H A;  1A7X A;  3PA7 A;  5J6E A;  5B8I C;  5I98 A;  2XP6 A;  2RUC A;  3O5F A;  5DIU A;  3UI5 A;  3IK8 A;  2KI3 A;  3IKG A;  2F4E A;  4ITZ A;  2ZR5 A;  4LAY A;  1EQ3 A;  1F40 A;  2KGJ A;  3O5I A;  1Y0O A;  2XP4 A;  4W9O A;  4DRO A;  4DRQ A;  1FKF A;  2KE0 A;  2M08 A;  4JFK A;  3EY6 A;  4FAP A;  4G2P A;  3TC5 A;  2LPV A;  3PRB A;  1KT0 A;  4R0X A;  2XP5 A;  2PV1 A;  3O5O A;  1J4I A;  1NSG A;  3JYM A;  3O5M A;  3H9R B;  3UQI A;  1N1A A;  2M1I A;  2LKN A;  1FKT A;  4ODP A;  1Q1C A;  4NNR A;  4DH0 A;  3O5R A;  2XP8 A;  4LAX A;  4MSP A;  4BF8 A;  4ODL A;  5HWB A;  3O5L A;  1TCO C;  2F21 A;  3KAI A;  2XP3 A;  4ODN A;  4U85 A;  2F2D A;  3JYJ A;  3O5G A;  2ITK A;  2LGO A;  2ZQS A;  2PPN A;  1FKJ A;  4JYS A;  1J4R A;  1R9H A;  2ZQT A;  2DG3 A;  4DIP A;  3PRD A;  4MGV A;  1L1P A;  1C9H A;  3KAG A;  3TDB A;  2MF9 A;  4DZ3 A;  3GPK A;  4LAW A;  2MLY A;  1FKS A;  1P5Q A;  2PPO A;  4ODO A;  4DRJ A;  3KAH A;  2FAP A; 
#chains in the Genus database with same CATH topology
 3UQA A;  2ZR6 A;  1FFR A;  2ZQU A;  2B31 A;  1W1T A;  4Z2K A;  1IX5 A;  1ZBV A;  4GIV A;  4DRI A;  3CHD A;  4AY1 A;  5DIV A;  2MNT A;  1NMW A;  1JVW A;  1OGG A;  2N87 A;  1E15 A;  4S3J A;  3O5E A;  5GQB A;  1JNS A;  1W26 A;  1CTN A;  1D7I A;  3ARO A;  1ZK6 A;  3KCE A;  1ZBC A;  3KZ7 A;  4DRN A;  2IF4 A;  2YBT A;  1ROU A;  4ODR A;  1KT1 A;  4R5E A;  4U84 A;  4NSB A;  4Z2G A;  4IQC A;  1D7J A;  3NTP A;  4TX0 A;  2RQS A;  3AS2 A;  3WL1 A;  3WH0 A;  4DWS C;  3RFW A;  2AOS A;  2XPB A;  4MNL A;  1GUV A;  3AS0 A;  1M5Y A;  2PV3 A;  4QT3 A;  3UI6 A;  1HKK A;  4NZC A;  1QPF A;  2EUL A;  3WKZ A;  1EHN A;  2DPE A;  3I6C A;  1Q6U A;  3O5P A;  1A7X A;  3PA7 A;  5J6E A;  4XAK A;  3ARR A;  3GTY X;  3UI5 A;  4LAY A;  1EQ3 A;  4P8V A;  1HJV A;  3ALG A;  3PRB A;  1KT0 A;  1O6I A;  4R0X A;  2PV1 A;  3ARV A;  4DWS A;  4DWS D;  1E6P A;  2WLY A;  1XHG A;  2A3E A;  1Q1C A;  4DH0 A;  2XP8 A;  1UR9 A;  4ODL A;  4Z2L A;  1LL7 A;  3AS1 A;  2O9O A;  3OA5 A;  2PI6 A;  3ALF A;  2ZQS A;  4JYS A;  4KR0 B;  3PRD A;  2MF9 A;  4DZ3 A;  3GPK A;  4HAR A;  4LAW A;  2MLY A;  1FKS A;  1P5Q A;  1D2K A;  2FAP A;  2DT3 A;  2RUQ A;  1E9L A;  2P4V A;  2VN1 A;  2VCD A;  3PRA A;  4MPK A;  1NWS A;  2PV2 A;  1EIB A;  2L2S A;  4PTM A;  2DT2 A;  3CHF A;  2DT1 A;  3LUO A;  1FKH A;  4QT2 A;  5HT1 A;  4FN2 A;  2XP9 A;  3WD0 A;  1J6Y A;  3CGM A;  2KR7 A;  5HBF A;  1EDQ A;  4GGQ A;  3WQV A;  4JFI A;  2IUZ A;  1E44 A;  2Y78 A;  1OWQ A;  3B9A A;  1HXV A;  1FAP A;  3CH9 A;  1PIN A;  4N19 A;  4IQ2 A;  4P8U A;  4IPX A;  3O5J A;  3O5D A;  1FD9 A;  2RUD A;  5BXJ A;  1HJW A;  4DRK A;  3NI6 A;  1PBK A;  3IHZ A;  3RM4 A;  4P8W A;  1SYT A;  1FKB A;  3JXV A;  4W9P A;  3QOK A;  3WL0 A;  4ODM A;  4QIB A;  3ARX A;  2DSW A;  1YW5 A;  4W9Q A;  1WAW A;  2MLX A;  2XPA A;  1TFV A;  3B7X A;  1JNE A;  3KAD A;  3NRK A;  2G41 A;  2ETN A;  2DSU A;  1FKG A;  3FAP A;  4LAV A;  4J4N A;  1Q6I A;  4W5U A;  1GPF A;  4JFJ A;  5DF0 A;  2A3A A;  5B8I C;  3PR9 A;  3RME A;  3O5I A;  1Y0O A;  1FKF A;  2KE0 A;  2M08 A;  3AS3 A;  4JFK A;  4LGX A;  3ARP A;  4Q22 A;  3CZ8 A;  3O5O A;  4S3K A;  1N1A A;  2M1I A;  2LKN A;  4ODP A;  4NNR A;  4ML4 A;  4MTV A;  3O5R A;  4WJX A;  4U85 A;  4HBO A;  2ITK A;  1FFQ A;  2PPN A;  4MNJ A;  1FKJ A;  1WNO A;  2ESC A;  1GOI A;  1R9H A;  2DG3 A;  2OLH A;  2ZQT A;  3CHE A;  4DIP A;  3CHC A;  1C9H A;  1K9T A;  2G8Z A;  4WKA A;  4MNK A;  3FXY A;  3KAF A;  4Z2J A;  1BKF A;  1D6O A;  4WKF A;  1ZCN A;  4TYO A;  3OOB A;  2DSZ A;  1JCH B;  2KO7 A;  4ODQ A;  3ARU A;  3FY1 A;  2DG4 A;  2DG9 A;  1F8A B;  1FKI A;  5HW7 A;  1ROT A;  1FKL A;  4U86 A;  2DT0 A;  1FKR A;  4Q7N A;  4TNS A;  4IT6 A;  2PPP A;  3RM9 A;  4Z2I A;  1X6N A;  5HWC A;  3G6M A;  4TW7 A;  1W9P A;  3TCZ A;  1JNT A;  1ZL1 A;  3AQU A;  1W1P A;  1ZBK A;  5HW6 A;  2O92 A;  3W4R A;  3O5K A;  2MPH A;  4ODK A;  2FKE A;  2LJ4 A;  2JZV A;  3VAW A;  2A3B A;  4TW8 A;  5D75 A;  1J4H A;  2K8I A;  4MNM A;  4DWS B;  5HKG A;  1FKK A;  1YAT A;  4JFL A;  1H0I A;  2M2A A;  4DRM A;  2MLZ A;  1LL4 A;  3WD2 A;  3WD4 A;  5GPG A;  1NMV A;  3B9D A;  3G6L A;  4L72 B;  4Z2H A;  3KAB A;  1H0G A;  3KAC A;  4KQZ A;  5I98 A;  2F23 A;  2KI3 A;  4ITZ A;  2F4E A;  1JND A;  1F40 A;  3B9E A;  4WIW A;  4WK9 A;  4ZPW R;  3EY6 A;  4FAP A;  3TC5 A;  1UR8 A;  3ART A;  2WLZ A;  3O5M A;  3H9R B;  3ARS A;  1NWT A;  3RM8 A;  1W1Y A;  4LAX A;  3ARW A;  3KAI A;  4ODN A;  2F2D A;  2PN0 A;  3JYJ A;  3EIP A;  3O5G A;  1L1P A;  3TDB A;  1GRJ A;  4QZV B;  4ZPT R;  2PPO A;  1LJY A;  2QF8 A;  1W9U A;  1WB0 A;  1ITX A;  4DRJ A;  3KAH A;  2Q5A A;  1QZ2 A;  2D9F A;  3CGN A;  1FKD A;  3UF8 A;  3UQB A;  1E6Z A;  1KFW A;  2XP7 A;  3BMB A;  3MDY B;  1B6C A;  2KFW A;  3WD1 A;  2PBC A;  3ODK A;  2B5U B;  3IKD A;  5DIT A;  1VF8 A;  1HKI A;  2OFN A;  4DZ2 A;  3B8S A;  3UI4 A;  4DT4 A;  1EYM A;  5GPR A;  4DRP A;  1SR0 A;  1W1V A;  1W9V A;  1QPL A;  1HKM A;  3GU0 A;  5DEZ A;  3WD3 A;  4G50 A;  1RD6 A;  2A3C A;  2ZR4 A;  1Q6H A;  1BL4 A;  4J4O A;  1U79 A;  4ZPV R;  1NWU A;  1NH6 A;  4P8X A;  4O2T A;  1HKJ A;  3BXW A;  4DRH A;  1LL6 A;  4WKH A;  1HJX A;  5HUA A;  2YBU A;  1ZB5 A;  4JFM A;  3ARY A;  2AWG A;  2FDM A;  5HTG A;  2UZ5 A;  4URI A;  2RUR A;  1T11 A;  2ZQV A;  4C02 B;  4UDM A;  3O5Q A;  1E6R A;  2RSE A;  3RGC A;  1FJD A;  4TW6 A;  1LG1 A;  5HW8 A;  2WK2 A;  5DO2 A;  1D7H A;  2WM0 A;  3WQW A;  4IT4 A;  2XP6 A;  4L3N A;  2RUC A;  1NWR A;  3O5F A;  5DIU A;  2DSV A;  3IK8 A;  3IKG A;  2ZR5 A;  2KGJ A;  1LQ0 A;  2XP4 A;  4W9O A;  4DRO A;  4DRQ A;  1OGB A;  4G2P A;  2LPV A;  1ZU8 A;  2XP5 A;  1J4I A;  3JYM A;  1NSG A;  1X6L A;  4MAV A;  3UQI A;  3ARZ A;  1FKT A;  1XRV A;  1LG2 A;  4HBE A;  4MSP A;  4BF8 A;  5HWB A;  4ZS6 A;  3O5L A;  1TCO C;  2F21 A;  3WIJ A;  5JH8 A;  1E6N A;  2XP3 A;  1ZBW A;  2LGO A;  1J4R A;  4MGV A;  3KAG A;  4ODO A;  3ARQ A; 
#chains in the Genus database with same CATH homology
 3UQA A;  2ZR6 A;  1FFR A;  2ZQU A;  2B31 A;  1W1T A;  4Z2K A;  1IX5 A;  1ZBV A;  4GIV A;  4DRI A;  3CHD A;  4AY1 A;  5DIV A;  2MNT A;  1NMW A;  1JVW A;  1OGG A;  2N87 A;  1E15 A;  4S3J A;  3O5E A;  5GQB A;  1JNS A;  1W26 A;  1CTN A;  1D7I A;  3ARO A;  1ZK6 A;  3KCE A;  1ZBC A;  3KZ7 A;  4DRN A;  2IF4 A;  2YBT A;  1ROU A;  4ODR A;  1KT1 A;  4R5E A;  4U84 A;  4NSB A;  4Z2G A;  4IQC A;  1D7J A;  3NTP A;  4TX0 A;  2RQS A;  3AS2 A;  3WL1 A;  3WH0 A;  4DWS C;  3RFW A;  2AOS A;  2XPB A;  4MNL A;  1GUV A;  3AS0 A;  1M5Y A;  2PV3 A;  4QT3 A;  3UI6 A;  1HKK A;  4NZC A;  1QPF A;  3WKZ A;  1EHN A;  2DPE A;  3I6C A;  1Q6U A;  3O5P A;  1A7X A;  3PA7 A;  5J6E A;  4XAK A;  3ARR A;  3UI5 A;  4LAY A;  1EQ3 A;  4P8V A;  1HJV A;  3ALG A;  3PRB A;  1KT0 A;  1O6I A;  4R0X A;  2PV1 A;  3ARV A;  4DWS A;  4DWS D;  1E6P A;  2WLY A;  1XHG A;  2A3E A;  1Q1C A;  4DH0 A;  2XP8 A;  1UR9 A;  4ODL A;  4Z2L A;  1LL7 A;  3AS1 A;  2O9O A;  3OA5 A;  2PI6 A;  3ALF A;  2ZQS A;  4JYS A;  4KR0 B;  3PRD A;  2MF9 A;  4DZ3 A;  3GPK A;  4HAR A;  4LAW A;  2MLY A;  1FKS A;  1P5Q A;  1D2K A;  2FAP A;  2DT3 A;  2RUQ A;  1E9L A;  2VN1 A;  2VCD A;  3PRA A;  4MPK A;  1NWS A;  2PV2 A;  1EIB A;  2L2S A;  4PTM A;  2DT2 A;  3CHF A;  2DT1 A;  3LUO A;  1FKH A;  4QT2 A;  5HT1 A;  4FN2 A;  2XP9 A;  3WD0 A;  1J6Y A;  3CGM A;  2KR7 A;  5HBF A;  1EDQ A;  4GGQ A;  3WQV A;  4JFI A;  2IUZ A;  2Y78 A;  1OWQ A;  3B9A A;  1HXV A;  1FAP A;  3CH9 A;  1PIN A;  4N19 A;  4IQ2 A;  4P8U A;  4IPX A;  3O5J A;  3O5D A;  1FD9 A;  2RUD A;  5BXJ A;  1HJW A;  4DRK A;  3NI6 A;  1PBK A;  3IHZ A;  3RM4 A;  4P8W A;  1SYT A;  1FKB A;  3JXV A;  4W9P A;  3QOK A;  3WL0 A;  4ODM A;  4QIB A;  3ARX A;  2DSW A;  1YW5 A;  4W9Q A;  1WAW A;  2MLX A;  2XPA A;  1TFV A;  3B7X A;  1JNE A;  3KAD A;  3NRK A;  2G41 A;  2DSU A;  1FKG A;  3FAP A;  4LAV A;  4J4N A;  1Q6I A;  4W5U A;  1GPF A;  4JFJ A;  5DF0 A;  2A3A A;  5B8I C;  3PR9 A;  3RME A;  3O5I A;  1Y0O A;  1FKF A;  2KE0 A;  2M08 A;  3AS3 A;  4JFK A;  4LGX A;  3ARP A;  4Q22 A;  3O5O A;  3CZ8 A;  4S3K A;  1N1A A;  2M1I A;  2LKN A;  4ODP A;  4NNR A;  4ML4 A;  4MTV A;  3O5R A;  4WJX A;  4U85 A;  4HBO A;  2ITK A;  1FFQ A;  2PPN A;  4MNJ A;  1FKJ A;  1WNO A;  2ESC A;  1GOI A;  1R9H A;  2DG3 A;  2OLH A;  2ZQT A;  3CHE A;  4DIP A;  3CHC A;  1C9H A;  1K9T A;  2G8Z A;  4WKA A;  4MNK A;  3FXY A;  3KAF A;  4Z2J A;  1BKF A;  1D6O A;  4WKF A;  1ZCN A;  4TYO A;  3OOB A;  2DSZ A;  2KO7 A;  4ODQ A;  3ARU A;  3FY1 A;  2DG4 A;  2DG9 A;  1F8A B;  1FKI A;  5HW7 A;  1ROT A;  1FKL A;  4U86 A;  2DT0 A;  1FKR A;  4Q7N A;  4TNS A;  4IT6 A;  2PPP A;  3RM9 A;  4Z2I A;  1X6N A;  5HWC A;  3G6M A;  4TW7 A;  1W9P A;  3TCZ A;  1JNT A;  1ZL1 A;  3AQU A;  1W1P A;  1ZBK A;  5HW6 A;  2O92 A;  3W4R A;  3O5K A;  2MPH A;  4ODK A;  2FKE A;  2LJ4 A;  2JZV A;  3VAW A;  2A3B A;  4TW8 A;  5D75 A;  1J4H A;  2K8I A;  4MNM A;  4DWS B;  5HKG A;  1FKK A;  1YAT A;  4JFL A;  1H0I A;  2M2A A;  4DRM A;  2MLZ A;  1LL4 A;  3WD2 A;  3WD4 A;  5GPG A;  1NMV A;  3B9D A;  3G6L A;  4L72 B;  4Z2H A;  3KAB A;  1H0G A;  3KAC A;  4KQZ A;  5I98 A;  2KI3 A;  4ITZ A;  2F4E A;  1JND A;  1F40 A;  3B9E A;  4WIW A;  4WK9 A;  4ZPW R;  3EY6 A;  4FAP A;  3TC5 A;  1UR8 A;  3ART A;  2WLZ A;  3O5M A;  3H9R B;  3ARS A;  1NWT A;  3RM8 A;  1W1Y A;  4LAX A;  3ARW A;  3KAI A;  4ODN A;  2F2D A;  3JYJ A;  3O5G A;  1L1P A;  3TDB A;  4QZV B;  4ZPT R;  2PPO A;  1LJY A;  2QF8 A;  1W9U A;  1WB0 A;  1ITX A;  4DRJ A;  3KAH A;  2Q5A A;  1QZ2 A;  2D9F A;  3CGN A;  1FKD A;  3UF8 A;  3UQB A;  1E6Z A;  1KFW A;  2XP7 A;  3MDY B;  1B6C A;  2KFW A;  3WD1 A;  2PBC A;  3ODK A;  3IKD A;  5DIT A;  1VF8 A;  1HKI A;  2OFN A;  4DZ2 A;  3B8S A;  3UI4 A;  4DT4 A;  1EYM A;  5GPR A;  4DRP A;  1SR0 A;  1W1V A;  1W9V A;  1QPL A;  1HKM A;  5DEZ A;  3WD3 A;  4G50 A;  1RD6 A;  2A3C A;  2ZR4 A;  1Q6H A;  1BL4 A;  4J4O A;  1U79 A;  4ZPV R;  1NWU A;  1NH6 A;  4P8X A;  4O2T A;  1HKJ A;  3BXW A;  4DRH A;  1LL6 A;  4WKH A;  1HJX A;  5HUA A;  2YBU A;  1ZB5 A;  4JFM A;  3ARY A;  2AWG A;  2FDM A;  5HTG A;  2UZ5 A;  4URI A;  2RUR A;  1T11 A;  2ZQV A;  4C02 B;  3O5Q A;  1E6R A;  2RSE A;  3RGC A;  1FJD A;  4TW6 A;  1LG1 A;  5HW8 A;  2WK2 A;  5DO2 A;  1D7H A;  2WM0 A;  3WQW A;  4IT4 A;  2XP6 A;  4L3N A;  2RUC A;  1NWR A;  3O5F A;  5DIU A;  2DSV A;  3IK8 A;  3IKG A;  2ZR5 A;  2KGJ A;  1LQ0 A;  2XP4 A;  4W9O A;  4DRO A;  4DRQ A;  1OGB A;  4G2P A;  2LPV A;  1ZU8 A;  2XP5 A;  1J4I A;  3JYM A;  1NSG A;  1X6L A;  4MAV A;  3UQI A;  3ARZ A;  1FKT A;  1XRV A;  1LG2 A;  4HBE A;  4MSP A;  4BF8 A;  5HWB A;  4ZS6 A;  3O5L A;  1TCO C;  2F21 A;  3WIJ A;  5JH8 A;  1E6N A;  2XP3 A;  1ZBW A;  2LGO A;  1J4R A;  4MGV A;  3KAG A;  4ODO A;  3ARQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...