4ODOA

Structure of slyd from thermus thermophilus in complex with fk506
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD
total genus 35
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odoA00
4ODLA 4DT4A 3KADA 3O5LA 1J6YA 1ZCNA 4QIBA 4FN2A 4ODQA 4JFMA 1QZ2A 4J4OA 4DRMA 1FKRA 2XPBA 2MF9A 4R0XA 3UF8A 3O5GA 1JNTA 1FKLA 1J4HA 2KI3A 5DIUA 1A7XA 2PPNA 2Q5AA 3TCZA 4TW8A 4MSPA 2OFNA 4JFLA 4TNSA 5HUAA 3KABA 1FD9A 1QPFA 3UI4A 5BXJA 4U86A 3KAGA 1JNSA 2PBCA 4U85A 2VN1A 3CGMA 2AWGA 5B8IC 3TC5A 1FKTA 2MPHA 3EY6A 3CGNA 4BF8A 4QT2A 2XP3A 4LAWA 4LAVA 4MGVA 4TW6A 4FAPA 4ODRA 1PINA 3IHZA 1D7IA 4DROA 3PRDA 1FKBA 1Q1CA 4ODPA 2KE0A 3O5EA 2KO7A 5GPGA 4ODOA 2RURA 3O5IA 4W9OA 5D75A 3UQBA 1YW5A 2KFWA 1FKKA 2M1IA 3O5PA 4IQCA 3IK8A 3NTPA 4LAXA 4DRQA 4DRHA 2M2AA 2XP8A 1HXVA 5HWCA 3LUOA 2XP5A 2XP4A 1M5YA 2ZR6A 2ZR5A 3KAFA 1JVWA 4DRPA 4J4NA 2RQSA 3H9RB 1W26A 2ZR4A 3OOBA 1BKFA 1FKDA 2DG4A 3MDYB 4DH0A 3UI5A 1FJDA 2F2DA 4ITZA 5DIVA 5HT1A 2VCDA 4LAYA 3NRKA 2LPVA 1D6OA 2N87A 2KR7A 4G2PA 3VAWA 2DG9A 1L1PA 4G50A 1J4IA 3UI6A 2ITKA 2PV3A 1T11A 2XPAA 2D9FA 3KZ7A 3O5KA 3B7XA 2F21A 4IPXA 5HWBA 2UZ5A 2LKNA 2ZQSA 4ODKA 2RUDA 2RUQA 3RGCA 1KT0A 4W9QA 1EYMA 2K8IA 3FAPA 4DRIA 4DRNA 3GPKA 3O5OA 3UQIA 3O5JA 5HW6A 2PPOA 2MLXA 1N1AA 3IKDA 3UQAA 1C9HA 2PV1A 2XP9A 4U84A 2IF4A 4DZ3A 4DIPA 2KGJA 4QT3A 1KT1A 1D7JA 2MLYA 3TDBA 1BL4A 4JFJA 5DITA 4DRJA 2ZQTA 4NNRA 2JZVA 1P5QA 1D7HA 1Q6IA 2DG3A 3IKGA 5HW7A 3ODKA 1F40A 5HTGA 2MLZA 2RSEA 4JFKA 3JYMA 2LJ4A 2FKEA 4W9PA 1QPLA 2XP7A 2RUCA 2PPPA 5HW8A 1NMWA 1Q6HA 5J6EA 3NI6A 4TYOA 3O5FA 4GIVA 1TCOC 3RFWA 3I6CA 2ZQVA 4JYSA 1EQ3A 4DRKA 1R9HA 1FAPA 3O5DA 4O2TA 2ZQUA 1J4RA 1PBKA 1F8AB 3O5MA 4DZ2A 5HKGA 3KACA 3JXVA 3JYJA 1FKSA 3KAHA 4C02B 1FKHA 4N19A 2FAPA 4ODNA 2L2SA 1B6CA 2XP6A 1Y0OA 2MNTA 1NSGA 1FKIA 3O5RA 2Y78A 3PRBA 4TW7A 2LGOA 1ZK6A 1FKFA 1ROUA 1FKJA 1FKGA 1YATA 3O5QA 4GGQA 4TX0A 3WH0A 5I98A 1U79A 1ROTA 4JFIA 1Q6UA 1NMVA 2M08A 2F4EA 2PV2A 3PA7A 4IQ2A 3KAIA 3KCEA 4ODMA
chains in the Genus database with same CATH superfamily
2G41A 3ARSA 1XHGA 5DIUA 3WD3A 2WM0A 4MSPA 2OFNA 4ML4A 1FD9A 2PBCA 4U85A 2VN1A 3CGMA 3WD0A 4R5EA 2MPHA 3EY6A 2B5UB 3CGNA 2WK2A 3CHFA 2XP3A 1WNOA 2A3CA 4LAWA 1TFVA 1PINA 4ODPA 4NZCA 2KO7A 4Z2GA 4W9OA 1HKIA 1FKKA 1ZBKA 2M1IA 1E6RA 4IQCA 3WL1A 1HXVA 1E6NA 2XP4A 3KAFA 1K9TA 1W9UA 2RQSA 3H9RB 3OOBA 1BKFA 4MNLA 1EHNA 2DSZA 4ZPTR 1FJDA 4ITZA 4DWSC 4P8XA 1E6PA 3VAWA 4S3JA 1WB0A 3UI6A 4IT6A 1HJWA 2XPAA 4IT4A 1ZU8A 3BXWA 3PRAA 5HBFA 3ARUA 3BMBA 3RMEA 2PN0A 2O9OA 3ARYA 4DRIA 2DSWA 3O5JA 2PV1A 2KGJA 1KT1A 4P8WA 3GTYX 4JFJA 2JZVA 1W1TA 3ODKA 5HTGA 2A3EA 1KFWA 3JYMA 4W9PA 3WD1A 2XP7A 4KQZA 1NWUA 2DSUA 3NI6A 3O5FA 4L3NA 3RFWA 1LL7A 4JYSA 4DWSD 3O5MA 3JXVA 3JYJA 3KAHA 4XAKA 4MNKA 1B6CA 2XP6A 1HKMA 1Y0OA 1FKIA 4MAVA 1ROUA 1GUVA 1NH6A 3AS1A 1U79A 1NWTA 1ROTA 4JFIA 1Q6UA 1LQ0A 2F4EA 2PV2A 3ALFA 5HW7A 3WL0A 4DT4A 1J6YA 1LG2A 3KADA 4P8UA 4QIBA 4W5UA 1O6IA 4ZPVR 4JFMA 1ZBWA 3ARRA 4J4OA 1JNDA 4DWSB 3UF8A 2KI3A 4TW8A 1W9PA 4TNSA 5GQBA 3KABA 2A3BA 1X6LA 5B8IC 3TC5A 4P8VA 1ZL1A 1IX5A 1X6NA 5JH8A 4QT2A 3ARWA 3ARQA 1ZB5A 2O92A 1Q1CA 2KE0A 3O5EA 4ODOA 5D75A 5GPRA 1YW5A 2KFWA 1EIBA 4WK9A 1VF8A 4MPKA 1JCHB 4DRQA 3OA5A 2M2AA 5HWCA 4QZVB 1E15A 2ZR5A 4J4NA 1NWSA 1W26A 3B9EA 4DH0A 3ARXA 4PTMA 2F2DA 5HT1A 1E6ZA 1NWRA 2LPVA 2DT2A 4HBEA 2KR7A 4MTVA 1J4IA 2ITKA 1FFRA 3W4RA 3ARVA 3CHCA 3WQWA 2PI6A 4Z2JA 2LKNA 3ARTA 4ODKA 2B31A 2RUQA 3O5OA 3UQIA 2AOSA 1ZBCA 2PPOA 1OWQA 1N1AA 2F23A 4DZ3A 2IF4A 4QT3A 2MLYA 5DITA 2ZQTA 1F40A 2DPEA 4JFKA 2LJ4A 1SR0A 2ETNA 1EDQA 2RUCA 2PPPA 1NMWA 3QOKA 1TCOC 2ZQVA 4DWSA 1EQ3A 4DRKA 4ZPWR 3B9AA 3O5DA 4O2TA 1PBKA 4DZ2A 1F8AB 4WIWA 1HKJA 4N19A 4NSBA 2DSVA 2MNTA 1NSGA 3O5RA 1UR8A 2Y78A 4TW7A 2LGOA 1FKFA 3O5QA 1FKJA 4Z2KA 1ZBVA 3PA7A 3KAIA 3KCEA 3AQUA 4ODMA 3WD2A 1ZCNA 4ODQA 1LJYA 4DRMA 2XPBA 2MF9A 4R0XA 3AS3A 1JNTA 1FKLA 1J4HA 4WKAA 1A7XA 2PPNA 2Q5AA 3ARZA 4JFLA 4WKFA 1QPFA 3UI4A 1JNSA 4U86A 4WJXA 1FFQA 3RM8A 2AWGA 1FKTA 4BF8A 1HJXA 4WKHA 4MGVA 4TW6A 4FAPA 4ODRA 1D7IA 3PRDA 2DT1A 1FKBA 5GPGA 3UQBA 3O5IA 3IK8A 3NTPA 4LAXA 4DRHA 3LUOA 2XP5A 1M5YA 4DRPA 3RM9A 2ZR4A 1FKDA 2EULA 2DG4A 4L72B 3UI5A 4Z2IA 4MNMA 5DIVA 2VCDA 2G8ZA 4LAYA 4KR0B 1D6OA 4G2PA 4G50A 1T11A 4MNJA 3O5KA 3RM4A 4IPXA 2F21A 2UZ5A 4HARA 2ZQSA 3FY1A 1H0GA 2IUZA 1KT0A 2YBTA 3FAPA 3GPKA 1E9LA 3UQAA 1C9HA 4U84A 2XP9A 1W1VA 1D7JA 1W1PA 4Q7NA 4URIA 4S3KA 4DRJA 2WLZA 1D7HA 1GOIA 3IKGA 1XRVA 3PR9A 2RSEA 1QPLA 4TYOA 4GIVA 1OGBA 4LGXA 1R9HA 5DO2A 1FAPA 2ZQUA 3CHDA 3ARPA 3KACA 1UR9A 2FAPA 2L2SA 1H0IA 3FXYA 1ZK6A 4Z2HA 3WH0A 1FKGA 4GGQA 1SYTA 2M08A 1OGGA 2YBUA 4ODLA 3O5LA 2OLHA 3WD4A 4FN2A 1HJVA 1QZ2A 5DEZA 2DT3A 1FKRA 3EIPA 3O5GA 3TCZA 5HUAA 4AY1A 4Q22A 4ZS6A 2FDMA 3CH9A 4UDMA 5BXJA 3KAGA 3AS0A 1GRJA 2ESCA 4LAVA 3IHZA 4DROA 3AROA 1JNEA 3B9DA 3GU0A 2RURA 3G6MA 5DF0A 3O5PA 3WQVA 1LG1A 2XP8A 2ZR6A 1JVWA 3CZ8A 1LL4A 3MDYB 2P4VA 3NRKA 1HKKA 2N87A 2DG9A 1L1PA 3AS2A 1W9VA 2PV3A 2D9FA 3KZ7A 3B7XA 5HWBA 1RD6A 2RUDA 3RGCA 4W9QA 1EYMA 2K8IA 3WKZA 3B8SA 4DRNA 1D2KA 5HW6A 3ALGA 2MLXA 1LL6A 2WLYA 3IKDA 4DIPA 3WIJA 3TDBA 1BL4A 4NNRA 1P5QA 1Q6IA 2DG3A 2MLZA 3G6LA 2FKEA 1GPFA 5HW8A 1Q6HA 5J6EA 3CHEA 1W1YA 2QF8A 1ITXA 2A3AA 3I6CA 4Z2LA 1J4RA 5HKGA 4C02B 1E44A 1FKSA 1FKHA 4ODNA 1WAWA 3PRBA 2DT0A 1YATA 4TX0A 5I98A 1CTNA 1NMVA 4HBOA 4IQ2A
chains in the Genus database with same CATH topology
2G41A 3ARSA 1XHGA 5DIUA 3WD3A 2WM0A 4MSPA 2OFNA 4ML4A 1FD9A 2PBCA 4U85A 2VN1A 3CGMA 3WD0A 4R5EA 2MPHA 3EY6A 3CGNA 2WK2A 3CHFA 2XP3A 1WNOA 2A3CA 4LAWA 1TFVA 1PINA 4ODPA 4NZCA 2KO7A 4Z2GA 4W9OA 1HKIA 1FKKA 1ZBKA 2M1IA 1E6RA 4IQCA 3WL1A 1HXVA 1E6NA 2XP4A 3KAFA 1K9TA 1W9UA 2RQSA 3H9RB 3OOBA 1BKFA 4MNLA 1EHNA 2DSZA 4ZPTR 1FJDA 4ITZA 4DWSC 4P8XA 1E6PA 3VAWA 4S3JA 1WB0A 3UI6A 4IT6A 1HJWA 2XPAA 4IT4A 1ZU8A 3BXWA 3PRAA 5HBFA 3ARUA 3RMEA 2O9OA 3ARYA 4DRIA 2DSWA 3O5JA 2PV1A 2KGJA 1KT1A 4P8WA 4JFJA 2JZVA 1W1TA 3ODKA 5HTGA 2A3EA 1KFWA 3JYMA 4W9PA 3WD1A 2XP7A 4KQZA 1NWUA 2DSUA 3NI6A 3O5FA 4L3NA 3RFWA 1LL7A 4JYSA 4DWSD 3O5MA 3JXVA 3JYJA 3KAHA 4XAKA 4MNKA 1B6CA 2XP6A 1HKMA 1Y0OA 1FKIA 4MAVA 1ROUA 1GUVA 1NH6A 3AS1A 1U79A 1NWTA 1ROTA 4JFIA 1Q6UA 1LQ0A 2F4EA 2PV2A 3ALFA 5HW7A 3WL0A 4DT4A 1J6YA 1LG2A 3KADA 4P8UA 4QIBA 4W5UA 1O6IA 4ZPVR 4JFMA 1ZBWA 3ARRA 4J4OA 1JNDA 4DWSB 3UF8A 2KI3A 4TW8A 1W9PA 4TNSA 5GQBA 3KABA 2A3BA 1X6LA 5B8IC 3TC5A 4P8VA 1ZL1A 1IX5A 1X6NA 5JH8A 4QT2A 3ARWA 3ARQA 1ZB5A 2O92A 1Q1CA 2KE0A 3O5EA 4ODOA 5D75A 5GPRA 1YW5A 2KFWA 1EIBA 4WK9A 1VF8A 4MPKA 4DRQA 3OA5A 2M2AA 5HWCA 4QZVB 1E15A 2ZR5A 4J4NA 1NWSA 1W26A 3B9EA 4DH0A 3ARXA 4PTMA 2F2DA 5HT1A 1E6ZA 1NWRA 2LPVA 2DT2A 4HBEA 2KR7A 4MTVA 1J4IA 2ITKA 1FFRA 3W4RA 3ARVA 3CHCA 3WQWA 2PI6A 4Z2JA 2LKNA 3ARTA 4ODKA 2B31A 2RUQA 3O5OA 3UQIA 2AOSA 1ZBCA 2PPOA 1OWQA 1N1AA 4DZ3A 2IF4A 4QT3A 2MLYA 5DITA 2ZQTA 1F40A 2DPEA 4JFKA 2LJ4A 1SR0A 1EDQA 2RUCA 2PPPA 1NMWA 3QOKA 1TCOC 2ZQVA 4DWSA 1EQ3A 4DRKA 4ZPWR 3B9AA 3O5DA 4O2TA 1PBKA 4DZ2A 1F8AB 4WIWA 1HKJA 4N19A 4NSBA 2DSVA 2MNTA 1NSGA 3O5RA 1UR8A 2Y78A 4TW7A 2LGOA 1FKFA 3O5QA 1FKJA 4Z2KA 1ZBVA 3PA7A 3KAIA 3KCEA 3AQUA 4ODMA 3WD2A 1ZCNA 4ODQA 1LJYA 4DRMA 2XPBA 2MF9A 4R0XA 3AS3A 1JNTA 1FKLA 1J4HA 4WKAA 1A7XA 2PPNA 2Q5AA 3ARZA 4JFLA 4WKFA 1QPFA 3UI4A 1JNSA 4U86A 4WJXA 1FFQA 3RM8A 2AWGA 1FKTA 4BF8A 1HJXA 4WKHA 4MGVA 4TW6A 4FAPA 4ODRA 1D7IA 3PRDA 2DT1A 1FKBA 5GPGA 3UQBA 3O5IA 3IK8A 3NTPA 4LAXA 4DRHA 3LUOA 2XP5A 1M5YA 4DRPA 3RM9A 2ZR4A 1FKDA 2DG4A 4L72B 3UI5A 4Z2IA 4MNMA 5DIVA 2VCDA 2G8ZA 4LAYA 4KR0B 1D6OA 4G2PA 4G50A 1T11A 4MNJA 3O5KA 3RM4A 4IPXA 2F21A 2UZ5A 4HARA 2ZQSA 3FY1A 1H0GA 2IUZA 1KT0A 2YBTA 3FAPA 3GPKA 1E9LA 3UQAA 1C9HA 4U84A 2XP9A 1W1VA 1D7JA 1W1PA 4Q7NA 4URIA 4S3KA 4DRJA 2WLZA 1D7HA 1GOIA 3IKGA 1XRVA 3PR9A 2RSEA 1QPLA 4TYOA 4GIVA 1OGBA 4LGXA 1R9HA 5DO2A 1FAPA 2ZQUA 3CHDA 3ARPA 3KACA 1UR9A 2FAPA 2L2SA 1H0IA 3FXYA 1ZK6A 4Z2HA 3WH0A 1FKGA 4GGQA 1SYTA 2M08A 1OGGA 2YBUA 4ODLA 3O5LA 2OLHA 3WD4A 4FN2A 1HJVA 1QZ2A 5DEZA 2DT3A 1FKRA 3O5GA 3TCZA 5HUAA 4AY1A 4Q22A 4ZS6A 2FDMA 3CH9A 5BXJA 3KAGA 3AS0A 2ESCA 4LAVA 3IHZA 4DROA 3AROA 1JNEA 3B9DA 2RURA 3G6MA 5DF0A 3O5PA 3WQVA 1LG1A 2XP8A 2ZR6A 1JVWA 3CZ8A 1LL4A 3MDYB 3NRKA 1HKKA 2N87A 2DG9A 1L1PA 3AS2A 1W9VA 2PV3A 2D9FA 3KZ7A 3B7XA 5HWBA 1RD6A 2RUDA 3RGCA 4W9QA 1EYMA 2K8IA 3WKZA 3B8SA 4DRNA 1D2KA 5HW6A 3ALGA 2MLXA 1LL6A 2WLYA 3IKDA 4DIPA 3WIJA 3TDBA 1BL4A 4NNRA 1P5QA 1Q6IA 2DG3A 2MLZA 3G6LA 2FKEA 1GPFA 5HW8A 1Q6HA 5J6EA 3CHEA 1W1YA 2QF8A 1ITXA 2A3AA 3I6CA 4Z2LA 1J4RA 5HKGA 4C02B 1FKSA 1FKHA 4ODNA 1WAWA 3PRBA 2DT0A 1YATA 4TX0A 5I98A 1CTNA 1NMVA 4HBOA 4IQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODL A;  4DT4 A;  3KAD A;  3O5L A;  1J6Y A;  1ZCN A;  4QIB A;  4FN2 A;  4ODQ A;  4JFM A;  1QZ2 A;  4J4O A;  4DRM A;  1FKR A;  2XPB A;  2MF9 A;  4R0X A;  3UF8 A;  3O5G A;  1JNT A;  1FKL A;  1J4H A;  2KI3 A;  5DIU A;  1A7X A;  2PPN A;  2Q5A A;  3TCZ A;  4TW8 A;  4MSP A;  2OFN A;  4JFL A;  4TNS A;  5HUA A;  3KAB A;  1FD9 A;  1QPF A;  3UI4 A;  5BXJ A;  4U86 A;  3KAG A;  1JNS A;  2PBC A;  4U85 A;  2VN1 A;  3CGM A;  2AWG A;  5B8I C;  3TC5 A;  1FKT A;  2MPH A;  3EY6 A;  3CGN A;  4BF8 A;  4QT2 A;  2XP3 A;  4LAW A;  4LAV A;  4MGV A;  4TW6 A;  4FAP A;  4ODR A;  1PIN A;  3IHZ A;  1D7I A;  4DRO A;  3PRD A;  1FKB A;  1Q1C A;  4ODP A;  2KE0 A;  3O5E A;  2KO7 A;  5GPG A;  4ODO A;  2RUR A;  3O5I A;  4W9O A;  5D75 A;  3UQB A;  1YW5 A;  2KFW A;  1FKK A;  2M1I A;  3O5P A;  4IQC A;  3IK8 A;  3NTP A;  4LAX A;  4DRQ A;  4DRH A;  2M2A A;  2XP8 A;  1HXV A;  5HWC A;  3LUO A;  2XP5 A;  2XP4 A;  1M5Y A;  2ZR6 A;  2ZR5 A;  3KAF A;  1JVW A;  4DRP A;  4J4N A;  2RQS A;  3H9R B;  1W26 A;  2ZR4 A;  3OOB A;  1BKF A;  1FKD A;  2DG4 A;  3MDY B;  4DH0 A;  3UI5 A;  1FJD A;  2F2D A;  4ITZ A;  5DIV A;  5HT1 A;  2VCD A;  4LAY A;  3NRK A;  2LPV A;  1D6O A;  2N87 A;  2KR7 A;  4G2P A;  3VAW A;  2DG9 A;  1L1P A;  4G50 A;  1J4I A;  3UI6 A;  2ITK A;  2PV3 A;  1T11 A;  2XPA A;  2D9F A;  3KZ7 A;  3O5K A;  3B7X A;  2F21 A;  4IPX A;  5HWB A;  2UZ5 A;  2LKN A;  2ZQS A;  4ODK A;  2RUD A;  2RUQ A;  3RGC A;  1KT0 A;  4W9Q A;  1EYM A;  2K8I A;  3FAP A;  4DRI A;  4DRN A;  3GPK A;  3O5O A;  3UQI A;  3O5J A;  5HW6 A;  2PPO A;  2MLX A;  1N1A A;  3IKD A;  3UQA A;  1C9H A;  2PV1 A;  2XP9 A;  4U84 A;  2IF4 A;  4DZ3 A;  4DIP A;  2KGJ A;  4QT3 A;  1KT1 A;  1D7J A;  2MLY A;  3TDB A;  1BL4 A;  4JFJ A;  5DIT A;  4DRJ A;  2ZQT A;  4NNR A;  2JZV A;  1P5Q A;  1D7H A;  1Q6I A;  2DG3 A;  3IKG A;  5HW7 A;  3ODK A;  1F40 A;  5HTG A;  2MLZ A;  2RSE A;  4JFK A;  3JYM A;  2LJ4 A;  2FKE A;  4W9P A;  1QPL A;  2XP7 A;  2RUC A;  2PPP A;  5HW8 A;  1NMW A;  1Q6H A;  5J6E A;  3NI6 A;  4TYO A;  3O5F A;  4GIV A;  1TCO C;  3RFW A;  3I6C A;  2ZQV A;  4JYS A;  1EQ3 A;  4DRK A;  1R9H A;  1FAP A;  3O5D A;  4O2T A;  2ZQU A;  1J4R A;  1PBK A;  1F8A B;  3O5M A;  4DZ2 A;  5HKG A;  3KAC A;  3JXV A;  3JYJ A;  1FKS A;  3KAH A;  4C02 B;  1FKH A;  4N19 A;  2FAP A;  4ODN A;  2L2S A;  1B6C A;  2XP6 A;  1Y0O A;  2MNT A;  1NSG A;  1FKI A;  3O5R A;  2Y78 A;  3PRB A;  4TW7 A;  2LGO A;  1ZK6 A;  1FKF A;  1ROU A;  1FKJ A;  1FKG A;  1YAT A;  3O5Q A;  4GGQ A;  4TX0 A;  3WH0 A;  5I98 A;  1U79 A;  1ROT A;  4JFI A;  1Q6U A;  1NMV A;  2M08 A;  2F4E A;  2PV2 A;  3PA7 A;  4IQ2 A;  3KAI A;  3KCE A;  4ODM A; 
#chains in the Genus database with same CATH topology
 2G41 A;  3ARS A;  1XHG A;  5DIU A;  3WD3 A;  2WM0 A;  4MSP A;  2OFN A;  4ML4 A;  1FD9 A;  2PBC A;  4U85 A;  2VN1 A;  3CGM A;  3WD0 A;  4R5E A;  2MPH A;  3EY6 A;  2B5U B;  3CGN A;  2WK2 A;  3CHF A;  2XP3 A;  1WNO A;  2A3C A;  4LAW A;  1TFV A;  1PIN A;  4ODP A;  4NZC A;  2KO7 A;  4Z2G A;  4W9O A;  1HKI A;  1FKK A;  1ZBK A;  2M1I A;  1E6R A;  4IQC A;  3WL1 A;  1HXV A;  1E6N A;  2XP4 A;  3KAF A;  1K9T A;  1W9U A;  2RQS A;  3H9R B;  3OOB A;  1BKF A;  4MNL A;  1EHN A;  2DSZ A;  4ZPT R;  1FJD A;  4ITZ A;  4DWS C;  4P8X A;  1E6P A;  3VAW A;  4S3J A;  1WB0 A;  3UI6 A;  4IT6 A;  1HJW A;  2XPA A;  4IT4 A;  1ZU8 A;  3BXW A;  3PRA A;  5HBF A;  3ARU A;  3BMB A;  3RME A;  2PN0 A;  2O9O A;  3ARY A;  4DRI A;  2DSW A;  3O5J A;  2PV1 A;  2KGJ A;  1KT1 A;  4P8W A;  3GTY X;  4JFJ A;  2JZV A;  1W1T A;  3ODK A;  5HTG A;  2A3E A;  1KFW A;  3JYM A;  4W9P A;  3WD1 A;  2XP7 A;  4KQZ A;  1NWU A;  2DSU A;  3NI6 A;  3O5F A;  4L3N A;  3RFW A;  1LL7 A;  4JYS A;  4DWS D;  3O5M A;  3JXV A;  3JYJ A;  3KAH A;  4XAK A;  4MNK A;  1B6C A;  2XP6 A;  1HKM A;  1Y0O A;  1FKI A;  4MAV A;  1ROU A;  1GUV A;  1NH6 A;  3AS1 A;  1U79 A;  1NWT A;  1ROT A;  4JFI A;  1Q6U A;  1LQ0 A;  2F4E A;  2PV2 A;  3ALF A;  5HW7 A;  3WL0 A;  4DT4 A;  1J6Y A;  1LG2 A;  3KAD A;  4P8U A;  4QIB A;  4W5U A;  1O6I A;  4ZPV R;  4JFM A;  1ZBW A;  3ARR A;  4J4O A;  1JND A;  4DWS B;  3UF8 A;  2KI3 A;  4TW8 A;  1W9P A;  4TNS A;  5GQB A;  3KAB A;  2A3B A;  1X6L A;  5B8I C;  3TC5 A;  4P8V A;  1ZL1 A;  1IX5 A;  1X6N A;  5JH8 A;  4QT2 A;  3ARW A;  3ARQ A;  1ZB5 A;  2O92 A;  1Q1C A;  2KE0 A;  3O5E A;  4ODO A;  5D75 A;  5GPR A;  1YW5 A;  2KFW A;  1EIB A;  4WK9 A;  1VF8 A;  4MPK A;  1JCH B;  4DRQ A;  3OA5 A;  2M2A A;  5HWC A;  4QZV B;  1E15 A;  2ZR5 A;  4J4N A;  1NWS A;  1W26 A;  3B9E A;  4DH0 A;  3ARX A;  4PTM A;  2F2D A;  5HT1 A;  1E6Z A;  1NWR A;  2LPV A;  2DT2 A;  4HBE A;  2KR7 A;  4MTV A;  1J4I A;  2ITK A;  1FFR A;  3W4R A;  3ARV A;  3CHC A;  3WQW A;  2PI6 A;  4Z2J A;  2LKN A;  3ART A;  4ODK A;  2B31 A;  2RUQ A;  3O5O A;  3UQI A;  2AOS A;  1ZBC A;  2PPO A;  1OWQ A;  1N1A A;  2F23 A;  4DZ3 A;  2IF4 A;  4QT3 A;  2MLY A;  5DIT A;  2ZQT A;  1F40 A;  2DPE A;  4JFK A;  2LJ4 A;  1SR0 A;  2ETN A;  1EDQ A;  2RUC A;  2PPP A;  1NMW A;  3QOK A;  1TCO C;  2ZQV A;  4DWS A;  1EQ3 A;  4DRK A;  4ZPW R;  3B9A A;  3O5D A;  4O2T A;  1PBK A;  4DZ2 A;  1F8A B;  4WIW A;  1HKJ A;  4N19 A;  4NSB A;  2DSV A;  2MNT A;  1NSG A;  3O5R A;  1UR8 A;  2Y78 A;  4TW7 A;  2LGO A;  1FKF A;  3O5Q A;  1FKJ A;  4Z2K A;  1ZBV A;  3PA7 A;  3KAI A;  3KCE A;  3AQU A;  4ODM A;  3WD2 A;  1ZCN A;  4ODQ A;  1LJY A;  4DRM A;  2XPB A;  2MF9 A;  4R0X A;  3AS3 A;  1JNT A;  1FKL A;  1J4H A;  4WKA A;  1A7X A;  2PPN A;  2Q5A A;  3ARZ A;  4JFL A;  4WKF A;  1QPF A;  3UI4 A;  1JNS A;  4U86 A;  4WJX A;  1FFQ A;  3RM8 A;  2AWG A;  1FKT A;  4BF8 A;  1HJX A;  4WKH A;  4MGV A;  4TW6 A;  4FAP A;  4ODR A;  1D7I A;  3PRD A;  2DT1 A;  1FKB A;  5GPG A;  3UQB A;  3O5I A;  3IK8 A;  3NTP A;  4LAX A;  4DRH A;  3LUO A;  2XP5 A;  1M5Y A;  4DRP A;  3RM9 A;  2ZR4 A;  1FKD A;  2EUL A;  2DG4 A;  4L72 B;  3UI5 A;  4Z2I A;  4MNM A;  5DIV A;  2VCD A;  2G8Z A;  4LAY A;  4KR0 B;  1D6O A;  4G2P A;  4G50 A;  1T11 A;  4MNJ A;  3O5K A;  3RM4 A;  4IPX A;  2F21 A;  2UZ5 A;  4HAR A;  2ZQS A;  3FY1 A;  1H0G A;  2IUZ A;  1KT0 A;  2YBT A;  3FAP A;  3GPK A;  1E9L A;  3UQA A;  1C9H A;  4U84 A;  2XP9 A;  1W1V A;  1D7J A;  1W1P A;  4Q7N A;  4URI A;  4S3K A;  4DRJ A;  2WLZ A;  1D7H A;  1GOI A;  3IKG A;  1XRV A;  3PR9 A;  2RSE A;  1QPL A;  4TYO A;  4GIV A;  1OGB A;  4LGX A;  1R9H A;  5DO2 A;  1FAP A;  2ZQU A;  3CHD A;  3ARP A;  3KAC A;  1UR9 A;  2FAP A;  2L2S A;  1H0I A;  3FXY A;  1ZK6 A;  4Z2H A;  3WH0 A;  1FKG A;  4GGQ A;  1SYT A;  2M08 A;  1OGG A;  2YBU A;  4ODL A;  3O5L A;  2OLH A;  3WD4 A;  4FN2 A;  1HJV A;  1QZ2 A;  5DEZ A;  2DT3 A;  1FKR A;  3EIP A;  3O5G A;  3TCZ A;  5HUA A;  4AY1 A;  4Q22 A;  4ZS6 A;  2FDM A;  3CH9 A;  4UDM A;  5BXJ A;  3KAG A;  3AS0 A;  1GRJ A;  2ESC A;  4LAV A;  3IHZ A;  4DRO A;  3ARO A;  1JNE A;  3B9D A;  3GU0 A;  2RUR A;  3G6M A;  5DF0 A;  3O5P A;  3WQV A;  1LG1 A;  2XP8 A;  2ZR6 A;  1JVW A;  3CZ8 A;  1LL4 A;  3MDY B;  2P4V A;  3NRK A;  1HKK A;  2N87 A;  2DG9 A;  1L1P A;  3AS2 A;  1W9V A;  2PV3 A;  2D9F A;  3KZ7 A;  3B7X A;  5HWB A;  1RD6 A;  2RUD A;  3RGC A;  4W9Q A;  1EYM A;  2K8I A;  3WKZ A;  3B8S A;  4DRN A;  1D2K A;  5HW6 A;  3ALG A;  2MLX A;  1LL6 A;  2WLY A;  3IKD A;  4DIP A;  3WIJ A;  3TDB A;  1BL4 A;  4NNR A;  1P5Q A;  1Q6I A;  2DG3 A;  2MLZ A;  3G6L A;  2FKE A;  1GPF A;  5HW8 A;  1Q6H A;  5J6E A;  3CHE A;  1W1Y A;  2QF8 A;  1ITX A;  2A3A A;  3I6C A;  4Z2L A;  1J4R A;  5HKG A;  4C02 B;  1E44 A;  1FKS A;  1FKH A;  4ODN A;  1WAW A;  3PRB A;  2DT0 A;  1YAT A;  4TX0 A;  5I98 A;  1CTN A;  1NMV A;  4HBO A;  4IQ2 A; 
#chains in the Genus database with same CATH homology
 2G41 A;  3ARS A;  1XHG A;  5DIU A;  3WD3 A;  2WM0 A;  4MSP A;  2OFN A;  4ML4 A;  1FD9 A;  2PBC A;  4U85 A;  2VN1 A;  3CGM A;  3WD0 A;  4R5E A;  2MPH A;  3EY6 A;  3CGN A;  2WK2 A;  3CHF A;  2XP3 A;  1WNO A;  2A3C A;  4LAW A;  1TFV A;  1PIN A;  4ODP A;  4NZC A;  2KO7 A;  4Z2G A;  4W9O A;  1HKI A;  1FKK A;  1ZBK A;  2M1I A;  1E6R A;  4IQC A;  3WL1 A;  1HXV A;  1E6N A;  2XP4 A;  3KAF A;  1K9T A;  1W9U A;  2RQS A;  3H9R B;  3OOB A;  1BKF A;  4MNL A;  1EHN A;  2DSZ A;  4ZPT R;  1FJD A;  4ITZ A;  4DWS C;  4P8X A;  1E6P A;  3VAW A;  4S3J A;  1WB0 A;  3UI6 A;  4IT6 A;  1HJW A;  2XPA A;  4IT4 A;  1ZU8 A;  3BXW A;  3PRA A;  5HBF A;  3ARU A;  3RME A;  2O9O A;  3ARY A;  4DRI A;  2DSW A;  3O5J A;  2PV1 A;  2KGJ A;  1KT1 A;  4P8W A;  4JFJ A;  2JZV A;  1W1T A;  3ODK A;  5HTG A;  2A3E A;  1KFW A;  3JYM A;  4W9P A;  3WD1 A;  2XP7 A;  4KQZ A;  1NWU A;  2DSU A;  3NI6 A;  3O5F A;  4L3N A;  3RFW A;  1LL7 A;  4JYS A;  4DWS D;  3O5M A;  3JXV A;  3JYJ A;  3KAH A;  4XAK A;  4MNK A;  1B6C A;  2XP6 A;  1HKM A;  1Y0O A;  1FKI A;  4MAV A;  1ROU A;  1GUV A;  1NH6 A;  3AS1 A;  1U79 A;  1NWT A;  1ROT A;  4JFI A;  1Q6U A;  1LQ0 A;  2F4E A;  2PV2 A;  3ALF A;  5HW7 A;  3WL0 A;  4DT4 A;  1J6Y A;  1LG2 A;  3KAD A;  4P8U A;  4QIB A;  4W5U A;  1O6I A;  4ZPV R;  4JFM A;  1ZBW A;  3ARR A;  4J4O A;  1JND A;  4DWS B;  3UF8 A;  2KI3 A;  4TW8 A;  1W9P A;  4TNS A;  5GQB A;  3KAB A;  2A3B A;  1X6L A;  5B8I C;  3TC5 A;  4P8V A;  1ZL1 A;  1IX5 A;  1X6N A;  5JH8 A;  4QT2 A;  3ARW A;  3ARQ A;  1ZB5 A;  2O92 A;  1Q1C A;  2KE0 A;  3O5E A;  4ODO A;  5D75 A;  5GPR A;  1YW5 A;  2KFW A;  1EIB A;  4WK9 A;  1VF8 A;  4MPK A;  4DRQ A;  3OA5 A;  2M2A A;  5HWC A;  4QZV B;  1E15 A;  2ZR5 A;  4J4N A;  1NWS A;  1W26 A;  3B9E A;  4DH0 A;  3ARX A;  4PTM A;  2F2D A;  5HT1 A;  1E6Z A;  1NWR A;  2LPV A;  2DT2 A;  4HBE A;  2KR7 A;  4MTV A;  1J4I A;  2ITK A;  1FFR A;  3W4R A;  3ARV A;  3CHC A;  3WQW A;  2PI6 A;  4Z2J A;  2LKN A;  3ART A;  4ODK A;  2B31 A;  2RUQ A;  3O5O A;  3UQI A;  2AOS A;  1ZBC A;  2PPO A;  1OWQ A;  1N1A A;  4DZ3 A;  2IF4 A;  4QT3 A;  2MLY A;  5DIT A;  2ZQT A;  1F40 A;  2DPE A;  4JFK A;  2LJ4 A;  1SR0 A;  1EDQ A;  2RUC A;  2PPP A;  1NMW A;  3QOK A;  1TCO C;  2ZQV A;  4DWS A;  1EQ3 A;  4DRK A;  4ZPW R;  3B9A A;  3O5D A;  4O2T A;  1PBK A;  4DZ2 A;  1F8A B;  4WIW A;  1HKJ A;  4N19 A;  4NSB A;  2DSV A;  2MNT A;  1NSG A;  3O5R A;  1UR8 A;  2Y78 A;  4TW7 A;  2LGO A;  1FKF A;  3O5Q A;  1FKJ A;  4Z2K A;  1ZBV A;  3PA7 A;  3KAI A;  3KCE A;  3AQU A;  4ODM A;  3WD2 A;  1ZCN A;  4ODQ A;  1LJY A;  4DRM A;  2XPB A;  2MF9 A;  4R0X A;  3AS3 A;  1JNT A;  1FKL A;  1J4H A;  4WKA A;  1A7X A;  2PPN A;  2Q5A A;  3ARZ A;  4JFL A;  4WKF A;  1QPF A;  3UI4 A;  1JNS A;  4U86 A;  4WJX A;  1FFQ A;  3RM8 A;  2AWG A;  1FKT A;  4BF8 A;  1HJX A;  4WKH A;  4MGV A;  4TW6 A;  4FAP A;  4ODR A;  1D7I A;  3PRD A;  2DT1 A;  1FKB A;  5GPG A;  3UQB A;  3O5I A;  3IK8 A;  3NTP A;  4LAX A;  4DRH A;  3LUO A;  2XP5 A;  1M5Y A;  4DRP A;  3RM9 A;  2ZR4 A;  1FKD A;  2DG4 A;  4L72 B;  3UI5 A;  4Z2I A;  4MNM A;  5DIV A;  2VCD A;  2G8Z A;  4LAY A;  4KR0 B;  1D6O A;  4G2P A;  4G50 A;  1T11 A;  4MNJ A;  3O5K A;  3RM4 A;  4IPX A;  2F21 A;  2UZ5 A;  4HAR A;  2ZQS A;  3FY1 A;  1H0G A;  2IUZ A;  1KT0 A;  2YBT A;  3FAP A;  3GPK A;  1E9L A;  3UQA A;  1C9H A;  4U84 A;  2XP9 A;  1W1V A;  1D7J A;  1W1P A;  4Q7N A;  4URI A;  4S3K A;  4DRJ A;  2WLZ A;  1D7H A;  1GOI A;  3IKG A;  1XRV A;  3PR9 A;  2RSE A;  1QPL A;  4TYO A;  4GIV A;  1OGB A;  4LGX A;  1R9H A;  5DO2 A;  1FAP A;  2ZQU A;  3CHD A;  3ARP A;  3KAC A;  1UR9 A;  2FAP A;  2L2S A;  1H0I A;  3FXY A;  1ZK6 A;  4Z2H A;  3WH0 A;  1FKG A;  4GGQ A;  1SYT A;  2M08 A;  1OGG A;  2YBU A;  4ODL A;  3O5L A;  2OLH A;  3WD4 A;  4FN2 A;  1HJV A;  1QZ2 A;  5DEZ A;  2DT3 A;  1FKR A;  3O5G A;  3TCZ A;  5HUA A;  4AY1 A;  4Q22 A;  4ZS6 A;  2FDM A;  3CH9 A;  5BXJ A;  3KAG A;  3AS0 A;  2ESC A;  4LAV A;  3IHZ A;  4DRO A;  3ARO A;  1JNE A;  3B9D A;  2RUR A;  3G6M A;  5DF0 A;  3O5P A;  3WQV A;  1LG1 A;  2XP8 A;  2ZR6 A;  1JVW A;  3CZ8 A;  1LL4 A;  3MDY B;  3NRK A;  1HKK A;  2N87 A;  2DG9 A;  1L1P A;  3AS2 A;  1W9V A;  2PV3 A;  2D9F A;  3KZ7 A;  3B7X A;  5HWB A;  1RD6 A;  2RUD A;  3RGC A;  4W9Q A;  1EYM A;  2K8I A;  3WKZ A;  3B8S A;  4DRN A;  1D2K A;  5HW6 A;  3ALG A;  2MLX A;  1LL6 A;  2WLY A;  3IKD A;  4DIP A;  3WIJ A;  3TDB A;  1BL4 A;  4NNR A;  1P5Q A;  1Q6I A;  2DG3 A;  2MLZ A;  3G6L A;  2FKE A;  1GPF A;  5HW8 A;  1Q6H A;  5J6E A;  3CHE A;  1W1Y A;  2QF8 A;  1ITX A;  2A3A A;  3I6C A;  4Z2L A;  1J4R A;  5HKG A;  4C02 B;  1FKS A;  1FKH A;  4ODN A;  1WAW A;  3PRB A;  2DT0 A;  1YAT A;  4TX0 A;  5I98 A;  1CTN A;  1NMV A;  4HBO A;  4IQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...