4ODOA

Structure of slyd from thermus thermophilus in complex with fk506
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
b'MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
total genus 35
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odoA00
2M1IA 2MLYA 4DT4A 5HWCA 2Y78A 1J4RA 2RQSA 1D7IA 4R0XA 1J4HA 2DG9A 1Q6HA 2ITKA 1FD9A 4MGVA 4J4NA 2ZQTA 1BL4A 1FKFA 3CGNA 1PBKA 2ZQSA 1R9HA 2ZQUA 4DZ2A 1N1AA 2IF4A 1FKRA 1FKSA 1FKBA 1BKFA 2LKNA 3O5KA 4LAXA 2KFWA 1P5QA 2F21A 3KADA 4ODKA 3IKDA 3NI6A 4QT2A 4U84A 1KT0A 5DIVA 4BF8A 3EY6A 1J6YA 5DITA 3UI5A 1F40A 1PINA 4IQCA 5HW7A 5HWBA 2KE0A 2PV2A 3OOBA 3PRDA 4DRIA 1T11A 4G2PA 2RUDA 4DH0A 5HW6A 2Q5AA 2RUCA 2ZR4A 2M08A 3ODKA 2VN1A 4DROA 2PBCA 3O5PA 3VAWA 1FKGA 4DIPA 1A7XA 4IPXA 1EQ3A 4N19A 2F2DA 1EYMA 1QPFA 1U79A 3UF8A 4JFIA 3KAIA 3UI4A 2ZQVA 3GPKA 4TW6A 3KABA 2LPVA 1Q6IA 2PV3A 1NSGA 3IK8A 3PRBA 5HW8A 2LJ4A 4C02B 1C9HA 3IHZA 3O5MA 4G50A 1TCOC 2UZ5A 4W9PA 2RSEA 5HUAA 3RFWA 2RUQA 5HT1A 4TYOA 1FKIA 4TW7A 5BXJA 2F4EA 3O5QA 4FN2A 4TW8A 4ITZA 4ODRA 1ROUA 3TDBA 1FKLA 3RGCA 2MF9A 4JYSA 5DIUA 4JFJA 1Y0OA 3KZ7A 4ODNA 1NMWA 4QIBA 5D75A 4DRKA 1FKHA 2MLZA 2N87A 2FKEA 3O5EA 1M5YA 2DG4A 2K8IA 2PPPA 3O5JA 1ZK6A 2XP9A 1Q6UA 2XP3A 4DRJA 4JFMA 3I6CA 4ODLA 4J4OA 4GGQA 3O5DA 4ODMA 3UQBA 1D6OA 1W26A 1FJDA 4JFKA 3KAHA 5GPGA 2PV1A 5B8IC 3O5RA 1NMVA 4O2TA 2ZR5A 3UI6A 3O5OA 1B6CA 4U86A 4DRMA 3H9RB 2XPBA 3O5IA 3TCZA 3O5GA 3NRKA 1D7HA 1JVWA 2D9FA 1ZCNA 2KR7A 2L2SA 3IKGA 1D7JA 1F8AB 3JYJA 4JFLA 4LAWA 4W9OA 4DRPA 1QZ2A 2JZVA 2LGOA 2XP4A 2AWGA 2XP8A 5J6EA 4LAVA 3FAPA 1FAPA 3O5FA 5HTGA 4DZ3A 4TX0A 2MNTA 2DG3A 3TC5A 2MPHA 4DRQA 2PPNA 2VCDA 4QT3A 1J4IA 4TNSA 3NTPA 3O5LA 1FKKA 1Q1CA 2PPOA 2KI3A 4GIVA 1FKJA 4LAYA 2XP5A 4FAPA 1ROTA 3LUOA 4ODOA 2ZR6A 4ODPA 1YW5A 3KCEA 3PA7A 2MLXA 4W9QA 1QPLA 4DRNA 1KT1A 2M2AA 1L1PA 2XP6A 4DRHA 1FKTA 3JYMA 4MSPA 3JXVA 4NNRA 3UQIA 5I98A 2OFNA 1JNTA 1JNSA 2RURA 3MDYB 3UQAA 3B7XA 1FKDA 1HXVA 4U85A 4IQ2A 2XP7A 3KACA 3KAFA 3WH0A 2KGJA 2XPAA 1YATA 4ODQA 3CGMA 2FAPA 5HKGA 3KAGA 2KO7A
chains in the Genus database with same CATH superfamily
2AOSA 5HWCA 3RMEA 2RQSA 1D7IA 2DSUA 3WD2A 1FD9A 4J4NA 1FKFA 2ZQUA 2DT0A 1FKRA 2LKNA 4IT4A 3O5KA 1SR0A 1CTNA 3KADA 4ZS6A 4BF8A 3NI6A 4IT6A 1KT0A 2DSWA 3UI5A 1IX5A 1F40A 4IQCA 3OOBA 2PV2A 1T11A 2WM0A 3ARZA 5HW6A 1H0GA 2ZR4A 3CHFA 3ODKA 4DROA 2PBCA 3VAWA 1EQ3A 1A7XA 4N19A 2F2DA 1QPFA 3BXWA 4QZVB 4ZPWR 4R5EA 2LPVA 4WKFA 1NSGA 3ARYA 4C02B 3O5MA 4W9PA 2UZ5A 1RD6A 2RSEA 5HUAA 3RFWA 1E44A 1GRJA 5BXJA 2F4EA 3AS3A 4HBOA 1LQ0A 3RM9A 2MF9A 4JFJA 1Y0OA 3KZ7A 4WKAA 4ZPVR 4DRKA 2WK2A 4P8UA 1W9VA 2N87A 2FKEA 3O5JA 2FDMA 3G6MA 2XP3A 3I6CA 4J4OA 2OLHA 4GGQA 4ODMA 3B9DA 1HKIA 1W1YA 1E6NA 3WIJA 3KAHA 5GPGA 1ZB5A 2PV1A 1NMVA 1XHGA 1FFQA 4Z2JA 3TCZA 1UR9A 4JFLA 1KFWA 3ARVA 4LAVA 1E6ZA 1GOIA 2DG3A 2G8ZA 4DRQA 2PPNA 4TNSA 3NTPA 1Q1CA 1O6IA 2PPOA 1ZBCA 4MTVA 2ZR6A 1YW5A 1E6RA 1QPLA 1KT1A 4URIA 1FFRA 2XP6A 1E15A 3WD1A 1FKTA 4NNRA 1HKKA 2OFNA 1LJYA 2RURA 4W5UA 5HBFA 1TFVA 3OA5A 1OGBA 5JH8A 1X6NA 4ODQA 4MNKA 4MPKA 3KAGA 3ARWA 2M1IA 2O92A 3WL1A 1J4HA 2ITKA 4MGVA 4DZ2A 4LAXA 1JNDA 2F21A 3IKDA 5DITA 3AS1A 5HWBA 2KE0A 4DRIA 1HJVA 2Q5AA 2RUCA 1HJXA 3ARUA 4DIPA 4IPXA 1EYMA 3FXYA 2A3BA 3UF8A 3ARXA 2ZQVA 3CZ8A 3GPKA 5GPRA 4TW6A 2PV3A 5HW8A 3IHZA 3B9AA 1EHNA 5DIUA 4MNMA 1FKHA 3O5EA 2DG4A 1NH6A 2XP9A 1Q6UA 5DEZA 2DSZA 3RM4A 3CHEA 2ESCA 1NWSA 3WD3A 1W26A 1FJDA 4Q22A 1LL6A 1LG1A 4O2TA 3UI6A 3AS0A 2XPBA 2A3CA 3WD0A 1OWQA 1JVWA 2D9FA 1ZCNA 2B31A 2KR7A 1D7JA 3JYJA 4LAWA 4W9OA 2O9OA 1WB0A 1FAPA 3BMBA 4WK9A 4L72B 1ZBVA 1SYTA 2MNTA 4DWSD 2MPHA 1WAWA 1ZBWA 4ZPTR 2KI3A 4GIVA 1FKJA 4ODOA 4MNJA 3KCEA 4W9QA 2MLXA 1W1PA 4DRNA 3FY1A 5I98A 4P8WA 4LGXA 3UQAA 4U85A 4IQ2A 3KAFA 4DWSA 2XPAA 2FAPA 5HKGA 2F23A 4R0XA 2DSVA 2WLZA 2IUZA 1UR8A 1JNEA 2ZQTA 1BL4A 3CGNA 2DT3A 1PBKA 1R9HA 1N1AA 1FKSA 4Z2HA 1H0IA 1K9TA 1ZBKA 2KFWA 1P5QA 3QOKA 4QT2A 5DIVA 4WKHA 3TDBA 1J6YA 1LL7A 1PINA 4G2PA 2RUDA 4DH0A 2M08A 2VN1A 4MNLA 3O5PA 2PN0A 4KQZA 1XRVA 3KAIA 1Q6IA 5J6EA 3PRBA 2LJ4A 1C9HA 3ALFA 4G50A 1ITXA 1TCOC 1VF8A 1W1TA 4TYOA 4TW7A 2YBUA 4FN2A 4TW8A 1ROUA 1FKLA 4JYSA 4ODNA 3W4RA 1M5YA 2K8IA 2PPPA 1ZK6A 4DRJA 4JFMA 3EIPA 4ODLA 5GQBA 3O5DA 3CHDA 4Q7NA 4WIWA 3PRAA 5B8IC 3O5RA 4AY1A 2B5UB 2EULA 1ZL1A 4DRMA 4U86A 3H9RB 4L3NA 3O5IA 3O5GA 3NRKA 4Z2LA 4NZCA 3ARSA 2L2SA 3IKGA 3AQUA 4DRPA 1QZ2A 2LGOA 2AWGA 3ARPA 2ETNA 4S3KA 1LG2A 3FAPA 3O5FA 1JCHB 4TX0A 3TC5A 4NSBA 2VCDA 4LAYA 2XP5A 1D2KA 2WLYA 4Z2KA 5DF0A 3PA7A 4WJXA 2M2AA 1L1PA 4HARA 4DRHA 3JYMA 4MSPA 1JNSA 3GTYX 2YBTA 3B9EA 3KACA 4PTMA 3WH0A 2KGJA 3CH9A 1YATA 3CGMA 2KO7A 2A3AA 2MLYA 4DT4A 1E9LA 2Y78A 1J4RA 1E6PA 2DG9A 1Q6HA 1W1VA 2PI6A 2ZQSA 2IF4A 1FKBA 1BKFA 1EIBA 2P4VA 1HKMA 3CHCA 4ODKA 4U84A 3EY6A 3GU0A 1NWRA 1GPFA 4UDMA 1NWUA 5HW7A 3PRDA 1FKGA 1LL4A 4MAVA 3RM8A 1U79A 2DT1A 4JFIA 1OGGA 1HJWA 2A3EA 3UI4A 3KABA 3IK8A 4DWSC 2RUQA 4XAKA 4ML4A 5HT1A 1FKIA 3O5QA 4ITZA 4ODRA 4HBEA 3RGCA 5D75A 1X6LA 4QIBA 1NMWA 4Z2GA 4Z2IA 2MLZA 3WQWA 3WD4A 1GUVA 1NWTA 3AROA 3UQBA 1D6OA 4JFKA 3WKZA 2DPEA 3AS2A 2ZR5A 3O5OA 1B6CA 4P8VA 3PR9A 2QF8A 1W9UA 1D7HA 3WL0A 1F8AB 3B8SA 2JZVA 2XP4A 1EDQA 2XP8A 4P8XA 5HTGA 2G41A 4DZ3A 4QT3A 1J4IA 4S3JA 3O5LA 3ARTA 1FKKA 4KR0B 4FAPA 1ROTA 3LUOA 4ODPA 1WNOA 2DT2A 4DWSB 3ARQA 1ZU8A 3G6LA 3UQIA 1JNTA 3MDYB 3ALGA 5DO2A 3B7XA 1FKDA 1HXVA 1W9PA 2XP7A 3WQVA 1HKJA 3JXVA 3ARRA
chains in the Genus database with same CATH topology
2AOSA 5HWCA 3RMEA 2RQSA 1D7IA 2DSUA 3WD2A 1FD9A 4J4NA 1FKFA 2ZQUA 2DT0A 1FKRA 2LKNA 4IT4A 3O5KA 1SR0A 1CTNA 3KADA 4ZS6A 4BF8A 3NI6A 4IT6A 1KT0A 2DSWA 3UI5A 1IX5A 1F40A 4IQCA 3OOBA 2PV2A 1T11A 2WM0A 3ARZA 5HW6A 1H0GA 2ZR4A 3CHFA 3ODKA 4DROA 2PBCA 3VAWA 1EQ3A 1A7XA 4N19A 2F2DA 1QPFA 3BXWA 4QZVB 4ZPWR 4R5EA 2LPVA 4WKFA 1NSGA 3ARYA 4C02B 3O5MA 4W9PA 2UZ5A 1RD6A 2RSEA 5HUAA 3RFWA 5BXJA 2F4EA 3AS3A 4HBOA 1LQ0A 3RM9A 2MF9A 4JFJA 1Y0OA 3KZ7A 4WKAA 4ZPVR 4DRKA 2WK2A 4P8UA 1W9VA 2N87A 2FKEA 3O5JA 2FDMA 3G6MA 2XP3A 3I6CA 4J4OA 2OLHA 4GGQA 4ODMA 3B9DA 1HKIA 1W1YA 1E6NA 3WIJA 3KAHA 5GPGA 1ZB5A 2PV1A 1NMVA 1XHGA 1FFQA 4Z2JA 3TCZA 1UR9A 4JFLA 1KFWA 3ARVA 4LAVA 1E6ZA 1GOIA 2DG3A 2G8ZA 4DRQA 2PPNA 4TNSA 3NTPA 1Q1CA 1O6IA 2PPOA 1ZBCA 4MTVA 2ZR6A 1YW5A 1E6RA 1QPLA 1KT1A 4URIA 1FFRA 2XP6A 1E15A 3WD1A 1FKTA 4NNRA 1HKKA 2OFNA 1LJYA 2RURA 4W5UA 5HBFA 1TFVA 3OA5A 1OGBA 5JH8A 1X6NA 4ODQA 4MNKA 4MPKA 3KAGA 3ARWA 2M1IA 2O92A 3WL1A 1J4HA 2ITKA 4MGVA 4DZ2A 4LAXA 1JNDA 2F21A 3IKDA 5DITA 3AS1A 5HWBA 2KE0A 4DRIA 1HJVA 2Q5AA 2RUCA 1HJXA 3ARUA 4DIPA 4IPXA 1EYMA 3FXYA 2A3BA 3UF8A 3ARXA 2ZQVA 3CZ8A 3GPKA 5GPRA 4TW6A 2PV3A 5HW8A 3IHZA 3B9AA 1EHNA 5DIUA 4MNMA 1FKHA 3O5EA 2DG4A 1NH6A 2XP9A 1Q6UA 5DEZA 2DSZA 3RM4A 3CHEA 2ESCA 1NWSA 3WD3A 1W26A 1FJDA 4Q22A 1LL6A 1LG1A 4O2TA 3UI6A 3AS0A 2XPBA 2A3CA 3WD0A 1OWQA 1JVWA 2D9FA 1ZCNA 2B31A 2KR7A 1D7JA 3JYJA 4LAWA 4W9OA 2O9OA 1WB0A 1FAPA 4WK9A 4L72B 1ZBVA 1SYTA 2MNTA 4DWSD 2MPHA 1WAWA 1ZBWA 4ZPTR 2KI3A 4GIVA 1FKJA 4ODOA 4MNJA 3KCEA 4W9QA 2MLXA 1W1PA 4DRNA 3FY1A 5I98A 4P8WA 4LGXA 3UQAA 4U85A 4IQ2A 3KAFA 4DWSA 2XPAA 2FAPA 5HKGA 4R0XA 2DSVA 2WLZA 2IUZA 1UR8A 1JNEA 2ZQTA 1BL4A 3CGNA 2DT3A 1PBKA 1R9HA 1N1AA 1FKSA 4Z2HA 1H0IA 1K9TA 1ZBKA 2KFWA 1P5QA 3QOKA 4QT2A 5DIVA 4WKHA 3TDBA 1J6YA 1LL7A 1PINA 4G2PA 2RUDA 4DH0A 2M08A 2VN1A 4MNLA 3O5PA 4KQZA 1XRVA 3KAIA 1Q6IA 5J6EA 3PRBA 2LJ4A 1C9HA 3ALFA 4G50A 1ITXA 1TCOC 1VF8A 1W1TA 4TYOA 4TW7A 2YBUA 4FN2A 4TW8A 1ROUA 1FKLA 4JYSA 4ODNA 3W4RA 1M5YA 2K8IA 2PPPA 1ZK6A 4DRJA 4JFMA 4ODLA 5GQBA 3O5DA 3CHDA 4Q7NA 4WIWA 3PRAA 5B8IC 3O5RA 4AY1A 1ZL1A 4DRMA 4U86A 3H9RB 4L3NA 3O5IA 3O5GA 3NRKA 4Z2LA 4NZCA 3ARSA 2L2SA 3IKGA 3AQUA 4DRPA 1QZ2A 2LGOA 2AWGA 3ARPA 4S3KA 1LG2A 3FAPA 3O5FA 4TX0A 3TC5A 4NSBA 2VCDA 4LAYA 2XP5A 1D2KA 2WLYA 4Z2KA 5DF0A 3PA7A 4WJXA 2M2AA 1L1PA 4HARA 4DRHA 3JYMA 4MSPA 1JNSA 2YBTA 3B9EA 3KACA 4PTMA 3WH0A 2KGJA 3CH9A 1YATA 3CGMA 2KO7A 2A3AA 2MLYA 4DT4A 1E9LA 2Y78A 1J4RA 1E6PA 2DG9A 1Q6HA 1W1VA 2PI6A 2ZQSA 2IF4A 1FKBA 1BKFA 1EIBA 1HKMA 3CHCA 4ODKA 4U84A 3EY6A 1NWRA 1GPFA 1NWUA 5HW7A 3PRDA 1FKGA 1LL4A 4MAVA 3RM8A 1U79A 2DT1A 4JFIA 1OGGA 1HJWA 2A3EA 3UI4A 3KABA 3IK8A 4DWSC 2RUQA 4XAKA 4ML4A 5HT1A 1FKIA 3O5QA 4ITZA 4ODRA 4HBEA 3RGCA 5D75A 1X6LA 4QIBA 1NMWA 4Z2GA 4Z2IA 2MLZA 3WQWA 3WD4A 1GUVA 1NWTA 3AROA 3UQBA 1D6OA 4JFKA 3WKZA 2DPEA 3AS2A 2ZR5A 3O5OA 1B6CA 4P8VA 3PR9A 2QF8A 1W9UA 1D7HA 3WL0A 1F8AB 3B8SA 2JZVA 2XP4A 1EDQA 2XP8A 4P8XA 5HTGA 2G41A 4DZ3A 4QT3A 1J4IA 4S3JA 3O5LA 3ARTA 1FKKA 4KR0B 4FAPA 1ROTA 3LUOA 4ODPA 1WNOA 2DT2A 4DWSB 3ARQA 1ZU8A 3G6LA 3UQIA 1JNTA 3MDYB 3ALGA 5DO2A 3B7XA 1FKDA 1HXVA 1W9PA 2XP7A 3WQVA 1HKJA 3JXVA 3ARRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M1I A;  2MLY A;  4DT4 A;  5HWC A;  2Y78 A;  1J4R A;  2RQS A;  1D7I A;  4R0X A;  1J4H A;  2DG9 A;  1Q6H A;  2ITK A;  1FD9 A;  4MGV A;  4J4N A;  2ZQT A;  1BL4 A;  1FKF A;  3CGN A;  1PBK A;  2ZQS A;  1R9H A;  2ZQU A;  4DZ2 A;  1N1A A;  2IF4 A;  1FKR A;  1FKS A;  1FKB A;  1BKF A;  2LKN A;  3O5K A;  4LAX A;  2KFW A;  1P5Q A;  2F21 A;  3KAD A;  4ODK A;  3IKD A;  3NI6 A;  4QT2 A;  4U84 A;  1KT0 A;  5DIV A;  4BF8 A;  3EY6 A;  1J6Y A;  5DIT A;  3UI5 A;  1F40 A;  1PIN A;  4IQC A;  5HW7 A;  5HWB A;  2KE0 A;  2PV2 A;  3OOB A;  3PRD A;  4DRI A;  1T11 A;  4G2P A;  2RUD A;  4DH0 A;  5HW6 A;  2Q5A A;  2RUC A;  2ZR4 A;  2M08 A;  3ODK A;  2VN1 A;  4DRO A;  2PBC A;  3O5P A;  3VAW A;  1FKG A;  4DIP A;  1A7X A;  4IPX A;  1EQ3 A;  4N19 A;  2F2D A;  1EYM A;  1QPF A;  1U79 A;  3UF8 A;  4JFI A;  3KAI A;  3UI4 A;  2ZQV A;  3GPK A;  4TW6 A;  3KAB A;  2LPV A;  1Q6I A;  2PV3 A;  1NSG A;  3IK8 A;  3PRB A;  5HW8 A;  2LJ4 A;  4C02 B;  1C9H A;  3IHZ A;  3O5M A;  4G50 A;  1TCO C;  2UZ5 A;  4W9P A;  2RSE A;  5HUA A;  3RFW A;  2RUQ A;  5HT1 A;  4TYO A;  1FKI A;  4TW7 A;  5BXJ A;  2F4E A;  3O5Q A;  4FN2 A;  4TW8 A;  4ITZ A;  4ODR A;  1ROU A;  3TDB A;  1FKL A;  3RGC A;  2MF9 A;  4JYS A;  5DIU A;  4JFJ A;  1Y0O A;  3KZ7 A;  4ODN A;  1NMW A;  4QIB A;  5D75 A;  4DRK A;  1FKH A;  2MLZ A;  2N87 A;  2FKE A;  3O5E A;  1M5Y A;  2DG4 A;  2K8I A;  2PPP A;  3O5J A;  1ZK6 A;  2XP9 A;  1Q6U A;  2XP3 A;  4DRJ A;  4JFM A;  3I6C A;  4ODL A;  4J4O A;  4GGQ A;  3O5D A;  4ODM A;  3UQB A;  1D6O A;  1W26 A;  1FJD A;  4JFK A;  3KAH A;  5GPG A;  2PV1 A;  5B8I C;  3O5R A;  1NMV A;  4O2T A;  2ZR5 A;  3UI6 A;  3O5O A;  1B6C A;  4U86 A;  4DRM A;  3H9R B;  2XPB A;  3O5I A;  3TCZ A;  3O5G A;  3NRK A;  1D7H A;  1JVW A;  2D9F A;  1ZCN A;  2KR7 A;  2L2S A;  3IKG A;  1D7J A;  1F8A B;  3JYJ A;  4JFL A;  4LAW A;  4W9O A;  4DRP A;  1QZ2 A;  2JZV A;  2LGO A;  2XP4 A;  2AWG A;  2XP8 A;  5J6E A;  4LAV A;  3FAP A;  1FAP A;  3O5F A;  5HTG A;  4DZ3 A;  4TX0 A;  2MNT A;  2DG3 A;  3TC5 A;  2MPH A;  4DRQ A;  2PPN A;  2VCD A;  4QT3 A;  1J4I A;  4TNS A;  3NTP A;  3O5L A;  1FKK A;  1Q1C A;  2PPO A;  2KI3 A;  4GIV A;  1FKJ A;  4LAY A;  2XP5 A;  4FAP A;  1ROT A;  3LUO A;  4ODO A;  2ZR6 A;  4ODP A;  1YW5 A;  3KCE A;  3PA7 A;  2MLX A;  4W9Q A;  1QPL A;  4DRN A;  1KT1 A;  2M2A A;  1L1P A;  2XP6 A;  4DRH A;  1FKT A;  3JYM A;  4MSP A;  3JXV A;  4NNR A;  3UQI A;  5I98 A;  2OFN A;  1JNT A;  1JNS A;  2RUR A;  3MDY B;  3UQA A;  3B7X A;  1FKD A;  1HXV A;  4U85 A;  4IQ2 A;  2XP7 A;  3KAC A;  3KAF A;  3WH0 A;  2KGJ A;  2XPA A;  1YAT A;  4ODQ A;  3CGM A;  2FAP A;  5HKG A;  3KAG A;  2KO7 A; 
#chains in the Genus database with same CATH topology
 2AOS A;  5HWC A;  3RME A;  2RQS A;  1D7I A;  2DSU A;  3WD2 A;  1FD9 A;  4J4N A;  1FKF A;  2ZQU A;  2DT0 A;  1FKR A;  2LKN A;  4IT4 A;  3O5K A;  1SR0 A;  1CTN A;  3KAD A;  4ZS6 A;  4BF8 A;  3NI6 A;  4IT6 A;  1KT0 A;  2DSW A;  3UI5 A;  1IX5 A;  1F40 A;  4IQC A;  3OOB A;  2PV2 A;  1T11 A;  2WM0 A;  3ARZ A;  5HW6 A;  1H0G A;  2ZR4 A;  3CHF A;  3ODK A;  4DRO A;  2PBC A;  3VAW A;  1EQ3 A;  1A7X A;  4N19 A;  2F2D A;  1QPF A;  3BXW A;  4QZV B;  4ZPW R;  4R5E A;  2LPV A;  4WKF A;  1NSG A;  3ARY A;  4C02 B;  3O5M A;  4W9P A;  2UZ5 A;  1RD6 A;  2RSE A;  5HUA A;  3RFW A;  1E44 A;  1GRJ A;  5BXJ A;  2F4E A;  3AS3 A;  4HBO A;  1LQ0 A;  3RM9 A;  2MF9 A;  4JFJ A;  1Y0O A;  3KZ7 A;  4WKA A;  4ZPV R;  4DRK A;  2WK2 A;  4P8U A;  1W9V A;  2N87 A;  2FKE A;  3O5J A;  2FDM A;  3G6M A;  2XP3 A;  3I6C A;  4J4O A;  2OLH A;  4GGQ A;  4ODM A;  3B9D A;  1HKI A;  1W1Y A;  1E6N A;  3WIJ A;  3KAH A;  5GPG A;  1ZB5 A;  2PV1 A;  1NMV A;  1XHG A;  1FFQ A;  4Z2J A;  3TCZ A;  1UR9 A;  4JFL A;  1KFW A;  3ARV A;  4LAV A;  1E6Z A;  1GOI A;  2DG3 A;  2G8Z A;  4DRQ A;  2PPN A;  4TNS A;  3NTP A;  1Q1C A;  1O6I A;  2PPO A;  1ZBC A;  4MTV A;  2ZR6 A;  1YW5 A;  1E6R A;  1QPL A;  1KT1 A;  4URI A;  1FFR A;  2XP6 A;  1E15 A;  3WD1 A;  1FKT A;  4NNR A;  1HKK A;  2OFN A;  1LJY A;  2RUR A;  4W5U A;  5HBF A;  1TFV A;  3OA5 A;  1OGB A;  5JH8 A;  1X6N A;  4ODQ A;  4MNK A;  4MPK A;  3KAG A;  3ARW A;  2M1I A;  2O92 A;  3WL1 A;  1J4H A;  2ITK A;  4MGV A;  4DZ2 A;  4LAX A;  1JND A;  2F21 A;  3IKD A;  5DIT A;  3AS1 A;  5HWB A;  2KE0 A;  4DRI A;  1HJV A;  2Q5A A;  2RUC A;  1HJX A;  3ARU A;  4DIP A;  4IPX A;  1EYM A;  3FXY A;  2A3B A;  3UF8 A;  3ARX A;  2ZQV A;  3CZ8 A;  3GPK A;  5GPR A;  4TW6 A;  2PV3 A;  5HW8 A;  3IHZ A;  3B9A A;  1EHN A;  5DIU A;  4MNM A;  1FKH A;  3O5E A;  2DG4 A;  1NH6 A;  2XP9 A;  1Q6U A;  5DEZ A;  2DSZ A;  3RM4 A;  3CHE A;  2ESC A;  1NWS A;  3WD3 A;  1W26 A;  1FJD A;  4Q22 A;  1LL6 A;  1LG1 A;  4O2T A;  3UI6 A;  3AS0 A;  2XPB A;  2A3C A;  3WD0 A;  1OWQ A;  1JVW A;  2D9F A;  1ZCN A;  2B31 A;  2KR7 A;  1D7J A;  3JYJ A;  4LAW A;  4W9O A;  2O9O A;  1WB0 A;  1FAP A;  3BMB A;  4WK9 A;  4L72 B;  1ZBV A;  1SYT A;  2MNT A;  4DWS D;  2MPH A;  1WAW A;  1ZBW A;  4ZPT R;  2KI3 A;  4GIV A;  1FKJ A;  4ODO A;  4MNJ A;  3KCE A;  4W9Q A;  2MLX A;  1W1P A;  4DRN A;  3FY1 A;  5I98 A;  4P8W A;  4LGX A;  3UQA A;  4U85 A;  4IQ2 A;  3KAF A;  4DWS A;  2XPA A;  2FAP A;  5HKG A;  2F23 A;  4R0X A;  2DSV A;  2WLZ A;  2IUZ A;  1UR8 A;  1JNE A;  2ZQT A;  1BL4 A;  3CGN A;  2DT3 A;  1PBK A;  1R9H A;  1N1A A;  1FKS A;  4Z2H A;  1H0I A;  1K9T A;  1ZBK A;  2KFW A;  1P5Q A;  3QOK A;  4QT2 A;  5DIV A;  4WKH A;  3TDB A;  1J6Y A;  1LL7 A;  1PIN A;  4G2P A;  2RUD A;  4DH0 A;  2M08 A;  2VN1 A;  4MNL A;  3O5P A;  2PN0 A;  4KQZ A;  1XRV A;  3KAI A;  1Q6I A;  5J6E A;  3PRB A;  2LJ4 A;  1C9H A;  3ALF A;  4G50 A;  1ITX A;  1TCO C;  1VF8 A;  1W1T A;  4TYO A;  4TW7 A;  2YBU A;  4FN2 A;  4TW8 A;  1ROU A;  1FKL A;  4JYS A;  4ODN A;  3W4R A;  1M5Y A;  2K8I A;  2PPP A;  1ZK6 A;  4DRJ A;  4JFM A;  3EIP A;  4ODL A;  5GQB A;  3O5D A;  3CHD A;  4Q7N A;  4WIW A;  3PRA A;  5B8I C;  3O5R A;  4AY1 A;  2B5U B;  2EUL A;  1ZL1 A;  4DRM A;  4U86 A;  3H9R B;  4L3N A;  3O5I A;  3O5G A;  3NRK A;  4Z2L A;  4NZC A;  3ARS A;  2L2S A;  3IKG A;  3AQU A;  4DRP A;  1QZ2 A;  2LGO A;  2AWG A;  3ARP A;  2ETN A;  4S3K A;  1LG2 A;  3FAP A;  3O5F A;  1JCH B;  4TX0 A;  3TC5 A;  4NSB A;  2VCD A;  4LAY A;  2XP5 A;  1D2K A;  2WLY A;  4Z2K A;  5DF0 A;  3PA7 A;  4WJX A;  2M2A A;  1L1P A;  4HAR A;  4DRH A;  3JYM A;  4MSP A;  1JNS A;  3GTY X;  2YBT A;  3B9E A;  3KAC A;  4PTM A;  3WH0 A;  2KGJ A;  3CH9 A;  1YAT A;  3CGM A;  2KO7 A;  2A3A A;  2MLY A;  4DT4 A;  1E9L A;  2Y78 A;  1J4R A;  1E6P A;  2DG9 A;  1Q6H A;  1W1V A;  2PI6 A;  2ZQS A;  2IF4 A;  1FKB A;  1BKF A;  1EIB A;  2P4V A;  1HKM A;  3CHC A;  4ODK A;  4U84 A;  3EY6 A;  3GU0 A;  1NWR A;  1GPF A;  4UDM A;  1NWU A;  5HW7 A;  3PRD A;  1FKG A;  1LL4 A;  4MAV A;  3RM8 A;  1U79 A;  2DT1 A;  4JFI A;  1OGG A;  1HJW A;  2A3E A;  3UI4 A;  3KAB A;  3IK8 A;  4DWS C;  2RUQ A;  4XAK A;  4ML4 A;  5HT1 A;  1FKI A;  3O5Q A;  4ITZ A;  4ODR A;  4HBE A;  3RGC A;  5D75 A;  1X6L A;  4QIB A;  1NMW A;  4Z2G A;  4Z2I A;  2MLZ A;  3WQW A;  3WD4 A;  1GUV A;  1NWT A;  3ARO A;  3UQB A;  1D6O A;  4JFK A;  3WKZ A;  2DPE A;  3AS2 A;  2ZR5 A;  3O5O A;  1B6C A;  4P8V A;  3PR9 A;  2QF8 A;  1W9U A;  1D7H A;  3WL0 A;  1F8A B;  3B8S A;  2JZV A;  2XP4 A;  1EDQ A;  2XP8 A;  4P8X A;  5HTG A;  2G41 A;  4DZ3 A;  4QT3 A;  1J4I A;  4S3J A;  3O5L A;  3ART A;  1FKK A;  4KR0 B;  4FAP A;  1ROT A;  3LUO A;  4ODP A;  1WNO A;  2DT2 A;  4DWS B;  3ARQ A;  1ZU8 A;  3G6L A;  3UQI A;  1JNT A;  3MDY B;  3ALG A;  5DO2 A;  3B7X A;  1FKD A;  1HXV A;  1W9P A;  2XP7 A;  3WQV A;  1HKJ A;  3JXV A;  3ARR A; 
#chains in the Genus database with same CATH homology
 2AOS A;  5HWC A;  3RME A;  2RQS A;  1D7I A;  2DSU A;  3WD2 A;  1FD9 A;  4J4N A;  1FKF A;  2ZQU A;  2DT0 A;  1FKR A;  2LKN A;  4IT4 A;  3O5K A;  1SR0 A;  1CTN A;  3KAD A;  4ZS6 A;  4BF8 A;  3NI6 A;  4IT6 A;  1KT0 A;  2DSW A;  3UI5 A;  1IX5 A;  1F40 A;  4IQC A;  3OOB A;  2PV2 A;  1T11 A;  2WM0 A;  3ARZ A;  5HW6 A;  1H0G A;  2ZR4 A;  3CHF A;  3ODK A;  4DRO A;  2PBC A;  3VAW A;  1EQ3 A;  1A7X A;  4N19 A;  2F2D A;  1QPF A;  3BXW A;  4QZV B;  4ZPW R;  4R5E A;  2LPV A;  4WKF A;  1NSG A;  3ARY A;  4C02 B;  3O5M A;  4W9P A;  2UZ5 A;  1RD6 A;  2RSE A;  5HUA A;  3RFW A;  5BXJ A;  2F4E A;  3AS3 A;  4HBO A;  1LQ0 A;  3RM9 A;  2MF9 A;  4JFJ A;  1Y0O A;  3KZ7 A;  4WKA A;  4ZPV R;  4DRK A;  2WK2 A;  4P8U A;  1W9V A;  2N87 A;  2FKE A;  3O5J A;  2FDM A;  3G6M A;  2XP3 A;  3I6C A;  4J4O A;  2OLH A;  4GGQ A;  4ODM A;  3B9D A;  1HKI A;  1W1Y A;  1E6N A;  3WIJ A;  3KAH A;  5GPG A;  1ZB5 A;  2PV1 A;  1NMV A;  1XHG A;  1FFQ A;  4Z2J A;  3TCZ A;  1UR9 A;  4JFL A;  1KFW A;  3ARV A;  4LAV A;  1E6Z A;  1GOI A;  2DG3 A;  2G8Z A;  4DRQ A;  2PPN A;  4TNS A;  3NTP A;  1Q1C A;  1O6I A;  2PPO A;  1ZBC A;  4MTV A;  2ZR6 A;  1YW5 A;  1E6R A;  1QPL A;  1KT1 A;  4URI A;  1FFR A;  2XP6 A;  1E15 A;  3WD1 A;  1FKT A;  4NNR A;  1HKK A;  2OFN A;  1LJY A;  2RUR A;  4W5U A;  5HBF A;  1TFV A;  3OA5 A;  1OGB A;  5JH8 A;  1X6N A;  4ODQ A;  4MNK A;  4MPK A;  3KAG A;  3ARW A;  2M1I A;  2O92 A;  3WL1 A;  1J4H A;  2ITK A;  4MGV A;  4DZ2 A;  4LAX A;  1JND A;  2F21 A;  3IKD A;  5DIT A;  3AS1 A;  5HWB A;  2KE0 A;  4DRI A;  1HJV A;  2Q5A A;  2RUC A;  1HJX A;  3ARU A;  4DIP A;  4IPX A;  1EYM A;  3FXY A;  2A3B A;  3UF8 A;  3ARX A;  2ZQV A;  3CZ8 A;  3GPK A;  5GPR A;  4TW6 A;  2PV3 A;  5HW8 A;  3IHZ A;  3B9A A;  1EHN A;  5DIU A;  4MNM A;  1FKH A;  3O5E A;  2DG4 A;  1NH6 A;  2XP9 A;  1Q6U A;  5DEZ A;  2DSZ A;  3RM4 A;  3CHE A;  2ESC A;  1NWS A;  3WD3 A;  1W26 A;  1FJD A;  4Q22 A;  1LL6 A;  1LG1 A;  4O2T A;  3UI6 A;  3AS0 A;  2XPB A;  2A3C A;  3WD0 A;  1OWQ A;  1JVW A;  2D9F A;  1ZCN A;  2B31 A;  2KR7 A;  1D7J A;  3JYJ A;  4LAW A;  4W9O A;  2O9O A;  1WB0 A;  1FAP A;  4WK9 A;  4L72 B;  1ZBV A;  1SYT A;  2MNT A;  4DWS D;  2MPH A;  1WAW A;  1ZBW A;  4ZPT R;  2KI3 A;  4GIV A;  1FKJ A;  4ODO A;  4MNJ A;  3KCE A;  4W9Q A;  2MLX A;  1W1P A;  4DRN A;  3FY1 A;  5I98 A;  4P8W A;  4LGX A;  3UQA A;  4U85 A;  4IQ2 A;  3KAF A;  4DWS A;  2XPA A;  2FAP A;  5HKG A;  4R0X A;  2DSV A;  2WLZ A;  2IUZ A;  1UR8 A;  1JNE A;  2ZQT A;  1BL4 A;  3CGN A;  2DT3 A;  1PBK A;  1R9H A;  1N1A A;  1FKS A;  4Z2H A;  1H0I A;  1K9T A;  1ZBK A;  2KFW A;  1P5Q A;  3QOK A;  4QT2 A;  5DIV A;  4WKH A;  3TDB A;  1J6Y A;  1LL7 A;  1PIN A;  4G2P A;  2RUD A;  4DH0 A;  2M08 A;  2VN1 A;  4MNL A;  3O5P A;  4KQZ A;  1XRV A;  3KAI A;  1Q6I A;  5J6E A;  3PRB A;  2LJ4 A;  1C9H A;  3ALF A;  4G50 A;  1ITX A;  1TCO C;  1VF8 A;  1W1T A;  4TYO A;  4TW7 A;  2YBU A;  4FN2 A;  4TW8 A;  1ROU A;  1FKL A;  4JYS A;  4ODN A;  3W4R A;  1M5Y A;  2K8I A;  2PPP A;  1ZK6 A;  4DRJ A;  4JFM A;  4ODL A;  5GQB A;  3O5D A;  3CHD A;  4Q7N A;  4WIW A;  3PRA A;  5B8I C;  3O5R A;  4AY1 A;  1ZL1 A;  4DRM A;  4U86 A;  3H9R B;  4L3N A;  3O5I A;  3O5G A;  3NRK A;  4Z2L A;  4NZC A;  3ARS A;  2L2S A;  3IKG A;  3AQU A;  4DRP A;  1QZ2 A;  2LGO A;  2AWG A;  3ARP A;  4S3K A;  1LG2 A;  3FAP A;  3O5F A;  4TX0 A;  3TC5 A;  4NSB A;  2VCD A;  4LAY A;  2XP5 A;  1D2K A;  2WLY A;  4Z2K A;  5DF0 A;  3PA7 A;  4WJX A;  2M2A A;  1L1P A;  4HAR A;  4DRH A;  3JYM A;  4MSP A;  1JNS A;  2YBT A;  3B9E A;  3KAC A;  4PTM A;  3WH0 A;  2KGJ A;  3CH9 A;  1YAT A;  3CGM A;  2KO7 A;  2A3A A;  2MLY A;  4DT4 A;  1E9L A;  2Y78 A;  1J4R A;  1E6P A;  2DG9 A;  1Q6H A;  1W1V A;  2PI6 A;  2ZQS A;  2IF4 A;  1FKB A;  1BKF A;  1EIB A;  1HKM A;  3CHC A;  4ODK A;  4U84 A;  3EY6 A;  1NWR A;  1GPF A;  1NWU A;  5HW7 A;  3PRD A;  1FKG A;  1LL4 A;  4MAV A;  3RM8 A;  1U79 A;  2DT1 A;  4JFI A;  1OGG A;  1HJW A;  2A3E A;  3UI4 A;  3KAB A;  3IK8 A;  4DWS C;  2RUQ A;  4XAK A;  4ML4 A;  5HT1 A;  1FKI A;  3O5Q A;  4ITZ A;  4ODR A;  4HBE A;  3RGC A;  5D75 A;  1X6L A;  4QIB A;  1NMW A;  4Z2G A;  4Z2I A;  2MLZ A;  3WQW A;  3WD4 A;  1GUV A;  1NWT A;  3ARO A;  3UQB A;  1D6O A;  4JFK A;  3WKZ A;  2DPE A;  3AS2 A;  2ZR5 A;  3O5O A;  1B6C A;  4P8V A;  3PR9 A;  2QF8 A;  1W9U A;  1D7H A;  3WL0 A;  1F8A B;  3B8S A;  2JZV A;  2XP4 A;  1EDQ A;  2XP8 A;  4P8X A;  5HTG A;  2G41 A;  4DZ3 A;  4QT3 A;  1J4I A;  4S3J A;  3O5L A;  3ART A;  1FKK A;  4KR0 B;  4FAP A;  1ROT A;  3LUO A;  4ODP A;  1WNO A;  2DT2 A;  4DWS B;  3ARQ A;  1ZU8 A;  3G6L A;  3UQI A;  1JNT A;  3MDY B;  3ALG A;  5DO2 A;  3B7X A;  1FKD A;  1HXV A;  1W9P A;  2XP7 A;  3WQV A;  1HKJ A;  3JXV A;  3ARR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...